data_2HA3
# 
_entry.id   2HA3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HA3         
RCSB  RCSB038119   
WWPDB D_1000038119 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1J06 'apo mACHE' unspecified 
PDB 2H9Y .           unspecified 
PDB 2HA0 .           unspecified 
PDB 2HA2 .           unspecified 
PDB 2HA4 .           unspecified 
PDB 2HA5 .           unspecified 
PDB 2HA6 .           unspecified 
PDB 2HA7 .           unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HA3 
_pdbx_database_status.recvd_initial_deposition_date   2006-06-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bourne, Y.'       1 
'Radic, Z.'        2 
'Sulzenbacher, G.' 3 
'Kim, E.'          4 
'Taylor, P.'       5 
'Marchot, P.'      6 
# 
_citation.id                        primary 
_citation.title                     
;Substrate and product trafficking through the active center gorge of acetylcholinesterase analyzed by crystallography and equilibrium binding
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                29256 
_citation.page_last                 29267 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16837465 
_citation.pdbx_database_id_DOI      10.1074/jbc.M603018200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bourne, Y.'       1 ? 
primary 'Radic, Z.'        2 ? 
primary 'Sulzenbacher, G.' 3 ? 
primary 'Kim, E.'          4 ? 
primary 'Taylor, P.'       5 ? 
primary 'Marchot, P.'      6 ? 
# 
_cell.entry_id           2HA3 
_cell.length_a           79.387 
_cell.length_b           111.874 
_cell.length_c           227.147 
_cell.angle_alpha        89.97 
_cell.angle_beta         90.02 
_cell.angle_gamma        90.04 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HA3 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase                                                  59764.488 2   3.1.1.7 ? 'catalytic domain' 
? 
2 branched    man 'alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose' 367.349   1   ?       ? ?                  
? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                              221.208   2   ?       ? ?                  
? 
4 non-polymer syn 'HEXAETHYLENE GLYCOL'                                                 282.331   1   ?       ? ?                  
? 
5 non-polymer syn 'CHOLINE ION'                                                         104.171   4   ?       ? ?                  
? 
6 water       nat water                                                                 18.015    742 ?       ? ?                  
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     Homo 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              'LAMBDA ZAP' 
_entity_src_gen.pdbx_host_org_cell_line            'HEK 293' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 'HUMAN EMBRYONIC KIDNEY CELLS (HEK)' 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           32 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2HA3 A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 2HA3 B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ?                            'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ?                            'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ?                            'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ?                            'C4 H7 N O4'     133.103 
CHT non-polymer                   . 'CHOLINE ION'                            ?                            'C5 H14 N O 1'   104.171 
CYS 'L-peptide linking'           y CYSTEINE                                 ?                            'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                     ?                            'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                ?                            'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ?                            'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ?                            'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ?                            'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ?                            'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ?                            'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ?                            'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ?                            'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                               ?                            'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ?                            'C8 H15 N O6'    221.208 
P6G non-polymer                   . 'HEXAETHYLENE GLYCOL'                    'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7'     282.331 
PHE 'L-peptide linking'           y PHENYLALANINE                            ?                            'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ?                            'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ?                            'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ?                            'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ?                            'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ?                            'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ?                            'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2HA3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.22 
_exptl_crystal.density_percent_sol   70.83 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    
'25-32% PEG550 MME or PEG600, 60-100mM HEPES or Na acetate, pH 6.5-8.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2004-03-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.975 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.975 
# 
_reflns.entry_id                     2HA3 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.25 
_reflns.d_resolution_low             30 
_reflns.number_all                   ? 
_reflns.number_obs                   92590 
_reflns.percent_possible_obs         96.2 
_reflns.pdbx_Rmerge_I_obs            0.073 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.9 
_reflns.B_iso_Wilson_estimate        41.7 
_reflns.pdbx_redundancy              3.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.25 
_reflns_shell.d_res_low              2.35 
_reflns_shell.percent_possible_all   96.2 
_reflns_shell.Rmerge_I_obs           0.338 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.0 
_reflns_shell.pdbx_redundancy        3.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2HA3 
_refine.ls_number_reflns_obs                     90675 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.25 
_refine.ls_percent_reflns_obs                    96.03 
_refine.ls_R_factor_obs                          0.17588 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17539 
_refine.ls_R_factor_R_free                       0.1993 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1845 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               .962 
_refine.correlation_coeff_Fo_to_Fc_free          .952 
_refine.B_iso_mean                               42.036 
_refine.aniso_B[1][1]                            2.06 
_refine.aniso_B[2][2]                            2.77 
_refine.aniso_B[3][3]                            -4.83 
_refine.aniso_B[1][2]                            .00 
_refine.aniso_B[1][3]                            .00 
_refine.aniso_B[2][3]                            .00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             .80 
_refine.pdbx_solvent_shrinkage_radii             .80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1J06 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       .167 
_refine.pdbx_overall_ESU_R_Free                  .146 
_refine.overall_SU_ML                            .111 
_refine.overall_SU_B                             8.372 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8362 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         99 
_refine_hist.number_atoms_solvent             742 
_refine_hist.number_atoms_total               9203 
_refine_hist.d_res_high                       2.25 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             .010   .022   ? 8725  'X-RAY DIFFRACTION' ? 
r_bond_other_d               .002   .020   ? 5917  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.250  1.968  ? 11926 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            .920   3.002  ? 14264 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.263  5.000  ? 1068  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.529 22.897 ? 397   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.980 15.000 ? 1259  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.163 15.000 ? 72    'X-RAY DIFFRACTION' ? 
r_chiral_restr               .075   .200   ? 1291  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         .004   .020   ? 9751  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           .001   .020   ? 1859  'X-RAY DIFFRACTION' ? 
r_nbd_refined                .197   .200   ? 1798  'X-RAY DIFFRACTION' ? 
r_nbd_other                  .196   .200   ? 6227  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              .178   .200   ? 4239  'X-RAY DIFFRACTION' ? 
r_nbtor_other                .086   .200   ? 4362  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        .163   .200   ? 512   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       .118   .200   ? 10    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         .302   .200   ? 48    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     .135   .200   ? 27    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  .667   1.500  ? 5684  'X-RAY DIFFRACTION' ? 
r_mcbond_other               .114   1.500  ? 2148  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.004  2.000  ? 8634  'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.477  3.000  ? 3743  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.361  4.500  ? 3292  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.250 
_refine_ls_shell.d_res_low                        2.308 
_refine_ls_shell.number_reflns_R_work             4787 
_refine_ls_shell.R_factor_R_work                  0.224 
_refine_ls_shell.percent_reflns_obs               72.99 
_refine_ls_shell.R_factor_R_free                  0.223 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             102 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2HA3 
_struct.title                     'Crystal structure of mouse acetylcholinesterase complexed with choline' 
_struct.pdbx_descriptor           'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HA3 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'HYDROLASE FOLD, SERINE ESTERASE, ACETYLCHOLINESTERASE, HOMODIMER, GLYCOSYLATED PROTEIN, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 3 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SER A 203 ? SER A 215 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 12 ASN A 265 ? THR A 275 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P13 13 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 TRP A 286 ? LEU A 289 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 15 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 GLY A 335 ? VAL A 340 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASN A 464 ? GLY A 456 ASN A 464 5 ? 9  
HELX_P HELX_P24 24 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 25 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 26 ARG A 534 ? THR A 543 ? ARG A 534 THR A 543 1 ? 10 
HELX_P HELX_P27 27 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P28 28 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 29 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 30 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 31 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P32 32 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 33 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P34 34 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 35 SER B 203 ? SER B 215 ? SER B 203 SER B 215 1 ? 13 
HELX_P HELX_P36 36 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P37 37 ALA B 241 ? VAL B 255 ? ALA B 241 VAL B 255 1 ? 15 
HELX_P HELX_P38 38 ASN B 265 ? ARG B 276 ? ASN B 265 ARG B 276 1 ? 12 
HELX_P HELX_P39 39 PRO B 277 ? ASP B 283 ? PRO B 277 ASP B 283 1 ? 7  
HELX_P HELX_P40 40 HIS B 284 ? VAL B 288 ? HIS B 284 VAL B 288 5 ? 5  
HELX_P HELX_P41 41 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 42 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 43 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 44 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 45 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 46 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 47 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 48 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 49 GLY B 456 ? ASN B 464 ? GLY B 456 ASN B 464 5 ? 9  
HELX_P HELX_P50 50 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 51 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 52 ARG B 534 ? SER B 541 ? ARG B 534 SER B 541 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf2 disulf ?    ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.111 ? ?               
disulf3 disulf ?    ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.057 ? ?               
disulf4 disulf ?    ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.050 ? ?               
disulf5 disulf ?    ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.115 ? ?               
disulf6 disulf ?    ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.062 ? ?               
covale1 covale one  ? A ASN 350 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 C NAG 1   1_555 ? ? ? ? ? ? ? 1.456 ? N-Glycosylation 
covale2 covale one  ? A ASN 464 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 464 A NAG 701 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
covale3 covale one  ? B ASN 350 ND2 ? ? ? 1_555 H NAG .   C1 ? ? B ASN 350 B NAG 601 1_555 ? ? ? ? ? ? ? 1.458 ? N-Glycosylation 
covale4 covale both ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 2   1_555 ? ? ? ? ? ? ? 1.455 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -5.35 
2 LYS 496 A . ? LYS 496 A SER 497 A ? SER 497 A 1 8.20  
3 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 0.36  
4 SER 497 B . ? SER 497 B PRO 498 B ? PRO 498 B 1 -0.27 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 2  ? 
D ? 3  ? 
E ? 11 ? 
F ? 2  ? 
G ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
C 1  2  ? parallel      
D 1  2  ? anti-parallel 
D 2  3  ? parallel      
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
E 4  5  ? parallel      
E 5  6  ? parallel      
E 6  7  ? parallel      
E 7  8  ? parallel      
E 8  9  ? parallel      
E 9  10 ? parallel      
E 10 11 ? anti-parallel 
F 1  2  ? parallel      
G 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
A 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
A 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
B 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
B 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
B 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
B 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
B 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
B 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
B 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
B 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
B 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
B 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
B 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
C 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
C 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
D 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
D 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
D 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
E 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
E 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
E 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
E 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
E 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
E 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
E 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
E 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
E 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
E 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
E 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
F 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
F 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
G 1  VAL B 239 ? SER B 240 ? VAL B 239 SER B 240 
G 2  VAL B 302 ? VAL B 303 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 10  ? N VAL A 10  O LEU A 17  ? O LEU A 17  
A 2  3  N GLN A 16  ? N GLN A 16  O LEU A 60  ? O LEU A 60  
B 1  2  N ILE A 20  ? N ILE A 20  O ALA A 31  ? O ALA A 31  
B 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
B 3  4  N ASN A 100 ? N ASN A 100 O SER A 148 ? O SER A 148 
B 4  5  O VAL A 145 ? O VAL A 145 N LEU A 115 ? N LEU A 115 
B 5  6  N VAL A 114 ? N VAL A 114 O SER A 196 ? O SER A 196 
B 6  7  N LEU A 199 ? N LEU A 199 O VAL A 226 ? O VAL A 226 
B 7  8  N LEU A 227 ? N LEU A 227 O LEU A 327 ? O LEU A 327 
B 8  9  N VAL A 328 ? N VAL A 328 O TYR A 426 ? O TYR A 426 
B 9  10 N ILE A 429 ? N ILE A 429 O LEU A 513 ? O LEU A 513 
B 10 11 N TYR A 510 ? N TYR A 510 O ARG A 521 ? O ARG A 521 
C 1  2  N VAL A 68  ? N VAL A 68  O SER A 93  ? O SER A 93  
D 1  2  N VAL B 10  ? N VAL B 10  O LEU B 17  ? O LEU B 17  
D 2  3  N GLN B 16  ? N GLN B 16  O LEU B 60  ? O LEU B 60  
E 1  2  N ILE B 20  ? N ILE B 20  O ALA B 31  ? O ALA B 31  
E 2  3  N PHE B 32  ? N PHE B 32  O VAL B 101 ? O VAL B 101 
E 3  4  N ASN B 100 ? N ASN B 100 O SER B 148 ? O SER B 148 
E 4  5  O VAL B 147 ? O VAL B 147 N LEU B 115 ? N LEU B 115 
E 5  6  N THR B 112 ? N THR B 112 O ASP B 193 ? O ASP B 193 
E 6  7  N GLY B 201 ? N GLY B 201 O GLN B 228 ? O GLN B 228 
E 7  8  N LEU B 227 ? N LEU B 227 O LEU B 327 ? O LEU B 327 
E 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
E 9  10 N ILE B 429 ? N ILE B 429 O LEU B 513 ? O LEU B 513 
E 10 11 N TYR B 510 ? N TYR B 510 O ARG B 521 ? O ARG B 521 
F 1  2  N VAL B 68  ? N VAL B 68  O SER B 93  ? O SER B 93  
G 1  2  N VAL B 239 ? N VAL B 239 O VAL B 303 ? O VAL B 303 
# 
_database_PDB_matrix.entry_id          2HA3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HA3 
_atom_sites.fract_transf_matrix[1][1]   .012597 
_atom_sites.fract_transf_matrix[1][2]   .000008 
_atom_sites.fract_transf_matrix[1][3]   .000003 
_atom_sites.fract_transf_matrix[2][1]   .000000 
_atom_sites.fract_transf_matrix[2][2]   .008939 
_atom_sites.fract_transf_matrix[2][3]   -.000005 
_atom_sites.fract_transf_matrix[3][1]   .000000 
_atom_sites.fract_transf_matrix[3][2]   .000000 
_atom_sites.fract_transf_matrix[3][3]   .004402 
_atom_sites.fract_transf_vector[1]      .00000 
_atom_sites.fract_transf_vector[2]      .00000 
_atom_sites.fract_transf_vector[3]      .00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 32.335  14.900  56.078  1.00 69.88 ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 30.870  14.943  55.836  1.00 69.74 ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 30.149  15.060  57.165  1.00 70.78 ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 30.779  14.956  58.232  1.00 71.83 ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 30.395  13.697  55.052  1.00 69.16 ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 30.433  12.375  55.801  1.00 69.18 ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 30.064  11.176  54.925  1.00 68.22 ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 28.959  10.616  55.114  1.00 66.77 ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 30.888  10.774  54.074  1.00 66.32 ? 1    GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 28.834  15.274  57.094  1.00 70.43 ? 2    GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 27.997  15.404  58.291  1.00 71.10 ? 2    GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 26.899  16.428  58.120  1.00 71.06 ? 2    GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 25.782  16.221  58.595  1.00 70.90 ? 2    GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 27.235  17.517  57.419  1.00 70.92 ? 3    ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 26.366  18.694  57.234  1.00 71.14 ? 3    ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 25.702  18.754  55.843  1.00 70.00 ? 3    ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 24.784  19.538  55.639  1.00 70.11 ? 3    ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 27.191  19.980  57.467  1.00 72.32 ? 3    ARG A CB  1 
ATOM   19   C CG  . ARG A 1 3   ? 27.041  20.679  58.836  1.00 74.57 ? 3    ARG A CG  1 
ATOM   20   C CD  . ARG A 1 3   ? 27.429  19.798  60.020  1.00 76.96 ? 3    ARG A CD  1 
ATOM   21   N NE  . ARG A 1 3   ? 26.805  20.191  61.300  1.00 79.01 ? 3    ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 3   ? 25.489  20.162  61.556  1.00 80.04 ? 3    ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 3   ? 24.611  19.805  60.617  1.00 80.09 ? 3    ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 3   ? 25.038  20.500  62.759  1.00 80.11 ? 3    ARG A NH2 1 
ATOM   25   N N   . GLU A 1 4   ? 26.163  17.928  54.902  1.00 68.59 ? 4    GLU A N   1 
ATOM   26   C CA  . GLU A 1 4   ? 25.687  17.945  53.507  1.00 67.60 ? 4    GLU A CA  1 
ATOM   27   C C   . GLU A 1 4   ? 24.536  16.981  53.228  1.00 65.76 ? 4    GLU A C   1 
ATOM   28   O O   . GLU A 1 4   ? 24.171  16.173  54.071  1.00 65.92 ? 4    GLU A O   1 
ATOM   29   C CB  . GLU A 1 4   ? 26.823  17.564  52.547  1.00 67.23 ? 4    GLU A CB  1 
ATOM   30   C CG  . GLU A 1 4   ? 28.094  18.378  52.688  1.00 70.57 ? 4    GLU A CG  1 
ATOM   31   C CD  . GLU A 1 4   ? 29.343  17.541  52.423  1.00 74.56 ? 4    GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 4   ? 30.171  17.977  51.587  1.00 76.95 ? 4    GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 4   ? 29.488  16.453  53.053  1.00 76.61 ? 4    GLU A OE2 1 
ATOM   34   N N   . ASP A 1 5   ? 24.003  17.080  52.008  1.00 63.46 ? 5    ASP A N   1 
ATOM   35   C CA  . ASP A 1 5   ? 22.916  16.242  51.507  1.00 62.10 ? 5    ASP A CA  1 
ATOM   36   C C   . ASP A 1 5   ? 23.396  14.794  51.405  1.00 61.21 ? 5    ASP A C   1 
ATOM   37   O O   . ASP A 1 5   ? 24.246  14.481  50.569  1.00 60.31 ? 5    ASP A O   1 
ATOM   38   C CB  . ASP A 1 5   ? 22.464  16.753  50.120  1.00 60.96 ? 5    ASP A CB  1 
ATOM   39   C CG  . ASP A 1 5   ? 21.159  16.120  49.640  1.00 60.44 ? 5    ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 5   ? 20.732  15.102  50.210  1.00 58.87 ? 5    ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 5   ? 20.542  16.650  48.685  1.00 58.20 ? 5    ASP A OD2 1 
ATOM   42   N N   . PRO A 1 6   ? 22.845  13.894  52.244  1.00 61.04 ? 6    PRO A N   1 
ATOM   43   C CA  . PRO A 1 6   ? 23.313  12.499  52.226  1.00 60.47 ? 6    PRO A CA  1 
ATOM   44   C C   . PRO A 1 6   ? 22.976  11.771  50.915  1.00 59.41 ? 6    PRO A C   1 
ATOM   45   O O   . PRO A 1 6   ? 23.551  10.733  50.597  1.00 58.50 ? 6    PRO A O   1 
ATOM   46   C CB  . PRO A 1 6   ? 22.564  11.871  53.407  1.00 61.44 ? 6    PRO A CB  1 
ATOM   47   C CG  . PRO A 1 6   ? 21.327  12.714  53.558  1.00 61.78 ? 6    PRO A CG  1 
ATOM   48   C CD  . PRO A 1 6   ? 21.756  14.097  53.222  1.00 61.88 ? 6    PRO A CD  1 
ATOM   49   N N   . GLN A 1 7   ? 22.071  12.352  50.143  1.00 58.79 ? 7    GLN A N   1 
ATOM   50   C CA  . GLN A 1 7   ? 21.598  11.733  48.930  1.00 58.49 ? 7    GLN A CA  1 
ATOM   51   C C   . GLN A 1 7   ? 22.478  12.075  47.731  1.00 56.43 ? 7    GLN A C   1 
ATOM   52   O O   . GLN A 1 7   ? 22.188  11.649  46.628  1.00 56.38 ? 7    GLN A O   1 
ATOM   53   C CB  . GLN A 1 7   ? 20.120  12.091  48.737  1.00 58.92 ? 7    GLN A CB  1 
ATOM   54   C CG  . GLN A 1 7   ? 19.337  11.690  50.013  1.00 61.87 ? 7    GLN A CG  1 
ATOM   55   C CD  . GLN A 1 7   ? 17.825  11.691  49.892  1.00 63.02 ? 7    GLN A CD  1 
ATOM   56   O OE1 . GLN A 1 7   ? 17.205  12.708  49.525  1.00 64.93 ? 7    GLN A OE1 1 
ATOM   57   N NE2 . GLN A 1 7   ? 17.208  10.550  50.254  1.00 65.38 ? 7    GLN A NE2 1 
ATOM   58   N N   . LEU A 1 8   ? 23.588  12.782  47.968  1.00 54.99 ? 8    LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? 24.519  13.173  46.905  1.00 53.34 ? 8    LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? 25.945  12.615  47.050  1.00 52.82 ? 8    LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? 26.843  13.013  46.311  1.00 51.92 ? 8    LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? 24.578  14.706  46.831  1.00 52.82 ? 8    LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? 23.299  15.392  46.337  1.00 51.31 ? 8    LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? 23.416  16.922  46.465  1.00 48.54 ? 8    LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? 22.974  14.981  44.909  1.00 47.49 ? 8    LEU A CD2 1 
ATOM   66   N N   . LEU A 1 9   ? 26.148  11.697  47.991  1.00 53.20 ? 9    LEU A N   1 
ATOM   67   C CA  . LEU A 1 9   ? 27.473  11.124  48.252  1.00 53.26 ? 9    LEU A CA  1 
ATOM   68   C C   . LEU A 1 9   ? 27.495  9.692   47.731  1.00 52.55 ? 9    LEU A C   1 
ATOM   69   O O   . LEU A 1 9   ? 26.646  8.883   48.102  1.00 53.28 ? 9    LEU A O   1 
ATOM   70   C CB  . LEU A 1 9   ? 27.796  11.153  49.748  1.00 54.09 ? 9    LEU A CB  1 
ATOM   71   C CG  . LEU A 1 9   ? 27.599  12.511  50.458  1.00 56.46 ? 9    LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 9   ? 27.743  12.395  52.012  1.00 56.29 ? 9    LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 9   ? 28.531  13.599  49.891  1.00 56.30 ? 9    LEU A CD2 1 
ATOM   74   N N   . VAL A 1 10  ? 28.463  9.396   46.870  1.00 51.37 ? 10   VAL A N   1 
ATOM   75   C CA  . VAL A 1 10  ? 28.547  8.119   46.178  1.00 50.92 ? 10   VAL A CA  1 
ATOM   76   C C   . VAL A 1 10  ? 30.016  7.702   46.067  1.00 50.46 ? 10   VAL A C   1 
ATOM   77   O O   . VAL A 1 10  ? 30.895  8.548   45.878  1.00 51.29 ? 10   VAL A O   1 
ATOM   78   C CB  . VAL A 1 10  ? 27.900  8.234   44.761  1.00 50.42 ? 10   VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 10  ? 28.177  7.029   43.922  1.00 50.95 ? 10   VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 10  ? 26.392  8.430   44.882  1.00 50.68 ? 10   VAL A CG2 1 
ATOM   81   N N   . ARG A 1 11  ? 30.287  6.407   46.211  1.00 49.68 ? 11   ARG A N   1 
ATOM   82   C CA  . ARG A 1 11  ? 31.624  5.879   45.990  1.00 48.99 ? 11   ARG A CA  1 
ATOM   83   C C   . ARG A 1 11  ? 31.689  5.141   44.652  1.00 48.26 ? 11   ARG A C   1 
ATOM   84   O O   . ARG A 1 11  ? 30.773  4.388   44.311  1.00 47.79 ? 11   ARG A O   1 
ATOM   85   C CB  . ARG A 1 11  ? 32.041  4.947   47.121  1.00 49.50 ? 11   ARG A CB  1 
ATOM   86   C CG  . ARG A 1 11  ? 33.335  4.221   46.854  1.00 49.61 ? 11   ARG A CG  1 
ATOM   87   C CD  . ARG A 1 11  ? 33.802  3.453   48.051  1.00 50.22 ? 11   ARG A CD  1 
ATOM   88   N NE  . ARG A 1 11  ? 34.273  4.308   49.141  1.00 50.84 ? 11   ARG A NE  1 
ATOM   89   C CZ  . ARG A 1 11  ? 35.506  4.794   49.268  1.00 51.11 ? 11   ARG A CZ  1 
ATOM   90   N NH1 . ARG A 1 11  ? 35.809  5.540   50.326  1.00 51.93 ? 11   ARG A NH1 1 
ATOM   91   N NH2 . ARG A 1 11  ? 36.439  4.540   48.364  1.00 51.40 ? 11   ARG A NH2 1 
ATOM   92   N N   . VAL A 1 12  ? 32.772  5.385   43.909  1.00 47.53 ? 12   VAL A N   1 
ATOM   93   C CA  . VAL A 1 12  ? 33.123  4.613   42.716  1.00 47.13 ? 12   VAL A CA  1 
ATOM   94   C C   . VAL A 1 12  ? 34.493  3.951   42.938  1.00 47.92 ? 12   VAL A C   1 
ATOM   95   O O   . VAL A 1 12  ? 35.123  4.168   43.974  1.00 48.13 ? 12   VAL A O   1 
ATOM   96   C CB  . VAL A 1 12  ? 33.126  5.486   41.438  1.00 46.44 ? 12   VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 12  ? 31.716  6.020   41.158  1.00 46.04 ? 12   VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 12  ? 34.149  6.635   41.535  1.00 45.08 ? 12   VAL A CG2 1 
ATOM   99   N N   . ARG A 1 13  ? 34.941  3.149   41.970  1.00 48.03 ? 13   ARG A N   1 
ATOM   100  C CA  . ARG A 1 13  ? 36.210  2.418   42.063  1.00 48.73 ? 13   ARG A CA  1 
ATOM   101  C C   . ARG A 1 13  ? 37.404  3.309   42.435  1.00 48.46 ? 13   ARG A C   1 
ATOM   102  O O   . ARG A 1 13  ? 38.260  2.909   43.214  1.00 48.79 ? 13   ARG A O   1 
ATOM   103  C CB  . ARG A 1 13  ? 36.451  1.670   40.740  1.00 48.93 ? 13   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 13  ? 37.782  0.949   40.579  1.00 50.76 ? 13   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 13  ? 37.943  -0.316  41.439  1.00 55.65 ? 13   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 13  ? 38.957  -0.058  42.456  1.00 58.88 ? 13   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 13  ? 40.177  -0.574  42.502  1.00 59.42 ? 13   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 13  ? 40.593  -1.467  41.634  1.00 62.67 ? 13   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 13  ? 40.986  -0.207  43.467  1.00 60.92 ? 13   ARG A NH2 1 
ATOM   110  N N   . GLY A 1 14  ? 37.431  4.528   41.910  1.00 47.66 ? 14   GLY A N   1 
ATOM   111  C CA  . GLY A 1 14  ? 38.518  5.467   42.178  1.00 47.48 ? 14   GLY A CA  1 
ATOM   112  C C   . GLY A 1 14  ? 38.407  6.224   43.492  1.00 47.62 ? 14   GLY A C   1 
ATOM   113  O O   . GLY A 1 14  ? 39.392  6.829   43.956  1.00 47.03 ? 14   GLY A O   1 
ATOM   114  N N   . GLY A 1 15  ? 37.223  6.190   44.103  1.00 47.43 ? 15   GLY A N   1 
ATOM   115  C CA  . GLY A 1 15  ? 37.003  6.913   45.354  1.00 48.09 ? 15   GLY A CA  1 
ATOM   116  C C   . GLY A 1 15  ? 35.633  7.539   45.519  1.00 47.86 ? 15   GLY A C   1 
ATOM   117  O O   . GLY A 1 15  ? 34.691  7.206   44.794  1.00 46.56 ? 15   GLY A O   1 
ATOM   118  N N   . GLN A 1 16  ? 35.545  8.459   46.481  1.00 48.91 ? 16   GLN A N   1 
ATOM   119  C CA  . GLN A 1 16  ? 34.282  9.090   46.879  1.00 49.65 ? 16   GLN A CA  1 
ATOM   120  C C   . GLN A 1 16  ? 33.979  10.315  46.038  1.00 49.11 ? 16   GLN A C   1 
ATOM   121  O O   . GLN A 1 16  ? 34.894  11.061  45.689  1.00 49.30 ? 16   GLN A O   1 
ATOM   122  C CB  . GLN A 1 16  ? 34.323  9.474   48.358  1.00 50.47 ? 16   GLN A CB  1 
ATOM   123  C CG  . GLN A 1 16  ? 33.862  8.359   49.277  1.00 51.97 ? 16   GLN A CG  1 
ATOM   124  C CD  . GLN A 1 16  ? 33.864  8.759   50.742  1.00 53.91 ? 16   GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 16  ? 34.843  9.327   51.240  1.00 59.39 ? 16   GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 16  ? 32.771  8.467   51.441  1.00 55.58 ? 16   GLN A NE2 1 
ATOM   127  N N   . LEU A 1 17  ? 32.697  10.517  45.709  1.00 48.89 ? 17   LEU A N   1 
ATOM   128  C CA  . LEU A 1 17  ? 32.260  11.671  44.897  1.00 48.47 ? 17   LEU A CA  1 
ATOM   129  C C   . LEU A 1 17  ? 31.140  12.426  45.604  1.00 48.65 ? 17   LEU A C   1 
ATOM   130  O O   . LEU A 1 17  ? 30.329  11.818  46.299  1.00 48.76 ? 17   LEU A O   1 
ATOM   131  C CB  . LEU A 1 17  ? 31.708  11.219  43.536  1.00 47.90 ? 17   LEU A CB  1 
ATOM   132  C CG  . LEU A 1 17  ? 32.522  10.331  42.594  1.00 48.02 ? 17   LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 17  ? 31.600  9.769   41.552  1.00 48.15 ? 17   LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 17  ? 33.656  11.080  41.937  1.00 48.59 ? 17   LEU A CD2 1 
ATOM   135  N N   . ARG A 1 18  ? 31.077  13.738  45.396  1.00 49.00 ? 18   ARG A N   1 
ATOM   136  C CA  . ARG A 1 18  ? 29.919  14.534  45.804  1.00 49.57 ? 18   ARG A CA  1 
ATOM   137  C C   . ARG A 1 18  ? 29.308  15.199  44.578  1.00 48.19 ? 18   ARG A C   1 
ATOM   138  O O   . ARG A 1 18  ? 29.980  15.931  43.863  1.00 47.79 ? 18   ARG A O   1 
ATOM   139  C CB  . ARG A 1 18  ? 30.305  15.584  46.830  1.00 49.72 ? 18   ARG A CB  1 
ATOM   140  C CG  . ARG A 1 18  ? 29.125  16.412  47.374  1.00 51.97 ? 18   ARG A CG  1 
ATOM   141  C CD  . ARG A 1 18  ? 29.588  17.409  48.470  1.00 55.09 ? 18   ARG A CD  1 
ATOM   142  N NE  . ARG A 1 18  ? 30.862  18.015  48.077  1.00 58.82 ? 18   ARG A NE  1 
ATOM   143  C CZ  . ARG A 1 18  ? 32.055  17.797  48.642  1.00 60.55 ? 18   ARG A CZ  1 
ATOM   144  N NH1 . ARG A 1 18  ? 32.211  17.014  49.722  1.00 62.63 ? 18   ARG A NH1 1 
ATOM   145  N NH2 . ARG A 1 18  ? 33.120  18.400  48.117  1.00 61.03 ? 18   ARG A NH2 1 
ATOM   146  N N   . GLY A 1 19  ? 28.027  14.923  44.346  1.00 48.04 ? 19   GLY A N   1 
ATOM   147  C CA  . GLY A 1 19  ? 27.277  15.520  43.252  1.00 47.34 ? 19   GLY A CA  1 
ATOM   148  C C   . GLY A 1 19  ? 26.494  16.745  43.679  1.00 47.58 ? 19   GLY A C   1 
ATOM   149  O O   . GLY A 1 19  ? 26.705  17.287  44.762  1.00 47.63 ? 19   GLY A O   1 
ATOM   150  N N   . ILE A 1 20  ? 25.579  17.158  42.811  1.00 47.39 ? 20   ILE A N   1 
ATOM   151  C CA  . ILE A 1 20  ? 24.761  18.343  43.017  1.00 48.24 ? 20   ILE A CA  1 
ATOM   152  C C   . ILE A 1 20  ? 23.296  18.042  42.671  1.00 48.49 ? 20   ILE A C   1 
ATOM   153  O O   . ILE A 1 20  ? 23.003  17.327  41.705  1.00 47.41 ? 20   ILE A O   1 
ATOM   154  C CB  . ILE A 1 20  ? 25.295  19.526  42.168  1.00 47.89 ? 20   ILE A CB  1 
ATOM   155  C CG1 . ILE A 1 20  ? 24.537  20.821  42.474  1.00 49.35 ? 20   ILE A CG1 1 
ATOM   156  C CG2 . ILE A 1 20  ? 25.227  19.209  40.674  1.00 46.57 ? 20   ILE A CG2 1 
ATOM   157  C CD1 . ILE A 1 20  ? 25.231  22.087  41.911  1.00 49.12 ? 20   ILE A CD1 1 
ATOM   158  N N   . ARG A 1 21  ? 22.389  18.559  43.493  1.00 49.73 ? 21   ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? 20.953  18.464  43.236  1.00 51.28 ? 21   ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? 20.574  19.573  42.264  1.00 51.25 ? 21   ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? 20.713  20.739  42.593  1.00 51.51 ? 21   ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? 20.161  18.639  44.535  1.00 52.09 ? 21   ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? 18.666  18.447  44.372  1.00 53.95 ? 21   ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? 17.888  18.707  45.676  1.00 56.72 ? 21   ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? 16.747  19.579  45.397  1.00 61.33 ? 21   ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? 15.544  19.525  45.976  1.00 64.44 ? 21   ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? 15.248  18.624  46.916  1.00 66.97 ? 21   ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? 14.606  20.395  45.588  1.00 64.23 ? 21   ARG A NH2 1 
ATOM   169  N N   . LEU A 1 22  ? 20.118  19.196  41.073  1.00 51.28 ? 22   LEU A N   1 
ATOM   170  C CA  . LEU A 1 22  ? 19.705  20.144  40.045  1.00 51.95 ? 22   LEU A CA  1 
ATOM   171  C C   . LEU A 1 22  ? 18.184  20.171  39.915  1.00 52.89 ? 22   LEU A C   1 
ATOM   172  O O   . LEU A 1 22  ? 17.519  19.182  40.206  1.00 52.91 ? 22   LEU A O   1 
ATOM   173  C CB  . LEU A 1 22  ? 20.324  19.767  38.702  1.00 50.79 ? 22   LEU A CB  1 
ATOM   174  C CG  . LEU A 1 22  ? 21.844  19.856  38.581  1.00 50.17 ? 22   LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 22  ? 22.247  19.393  37.186  1.00 50.27 ? 22   LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 22  ? 22.370  21.261  38.859  1.00 48.67 ? 22   LEU A CD2 1 
ATOM   177  N N   . LYS A 1 23  ? 17.652  21.312  39.485  1.00 53.98 ? 23   LYS A N   1 
ATOM   178  C CA  . LYS A 1 23  ? 16.214  21.483  39.267  1.00 55.59 ? 23   LYS A CA  1 
ATOM   179  C C   . LYS A 1 23  ? 15.873  21.190  37.817  1.00 53.87 ? 23   LYS A C   1 
ATOM   180  O O   . LYS A 1 23  ? 16.443  21.797  36.926  1.00 52.86 ? 23   LYS A O   1 
ATOM   181  C CB  . LYS A 1 23  ? 15.762  22.922  39.565  1.00 56.66 ? 23   LYS A CB  1 
ATOM   182  C CG  . LYS A 1 23  ? 16.111  23.456  40.948  1.00 59.91 ? 23   LYS A CG  1 
ATOM   183  C CD  . LYS A 1 23  ? 15.923  24.991  40.995  1.00 60.95 ? 23   LYS A CD  1 
ATOM   184  C CE  . LYS A 1 23  ? 15.948  25.527  42.433  1.00 63.99 ? 23   LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 23  ? 15.560  26.991  42.481  1.00 66.11 ? 23   LYS A NZ  1 
ATOM   186  N N   . ALA A 1 24  ? 14.960  20.250  37.598  1.00 53.51 ? 24   ALA A N   1 
ATOM   187  C CA  . ALA A 1 24  ? 14.282  20.092  36.315  1.00 52.81 ? 24   ALA A CA  1 
ATOM   188  C C   . ALA A 1 24  ? 12.853  20.579  36.530  1.00 53.75 ? 24   ALA A C   1 
ATOM   189  O O   . ALA A 1 24  ? 12.399  20.675  37.668  1.00 54.05 ? 24   ALA A O   1 
ATOM   190  C CB  . ALA A 1 24  ? 14.289  18.663  35.868  1.00 51.89 ? 24   ALA A CB  1 
ATOM   191  N N   . PRO A 1 25  ? 12.144  20.906  35.439  1.00 53.86 ? 25   PRO A N   1 
ATOM   192  C CA  . PRO A 1 25  ? 10.789  21.444  35.558  1.00 54.71 ? 25   PRO A CA  1 
ATOM   193  C C   . PRO A 1 25  ? 9.870   20.626  36.457  1.00 55.07 ? 25   PRO A C   1 
ATOM   194  O O   . PRO A 1 25  ? 9.131   21.197  37.249  1.00 56.61 ? 25   PRO A O   1 
ATOM   195  C CB  . PRO A 1 25  ? 10.283  21.444  34.113  1.00 54.57 ? 25   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 25  ? 11.526  21.558  33.274  1.00 53.49 ? 25   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 25  ? 12.587  20.814  34.032  1.00 53.52 ? 25   PRO A CD  1 
ATOM   198  N N   . GLY A 1 26  ? 9.923   19.306  36.359  1.00 54.17 ? 26   GLY A N   1 
ATOM   199  C CA  . GLY A 1 26  ? 9.025   18.466  37.148  1.00 54.69 ? 26   GLY A CA  1 
ATOM   200  C C   . GLY A 1 26  ? 9.531   18.069  38.522  1.00 54.52 ? 26   GLY A C   1 
ATOM   201  O O   . GLY A 1 26  ? 8.793   17.457  39.285  1.00 55.20 ? 26   GLY A O   1 
ATOM   202  N N   . GLY A 1 27  ? 10.789  18.391  38.835  1.00 53.57 ? 27   GLY A N   1 
ATOM   203  C CA  . GLY A 1 27  ? 11.397  18.004  40.113  1.00 53.17 ? 27   GLY A CA  1 
ATOM   204  C C   . GLY A 1 27  ? 12.918  17.985  40.084  1.00 51.88 ? 27   GLY A C   1 
ATOM   205  O O   . GLY A 1 27  ? 13.527  18.307  39.060  1.00 50.50 ? 27   GLY A O   1 
ATOM   206  N N   . PRO A 1 28  ? 13.547  17.621  41.223  1.00 51.54 ? 28   PRO A N   1 
ATOM   207  C CA  . PRO A 1 28  ? 15.008  17.517  41.319  1.00 50.77 ? 28   PRO A CA  1 
ATOM   208  C C   . PRO A 1 28  ? 15.607  16.299  40.610  1.00 49.62 ? 28   PRO A C   1 
ATOM   209  O O   . PRO A 1 28  ? 14.947  15.271  40.480  1.00 50.10 ? 28   PRO A O   1 
ATOM   210  C CB  . PRO A 1 28  ? 15.260  17.416  42.825  1.00 51.13 ? 28   PRO A CB  1 
ATOM   211  C CG  . PRO A 1 28  ? 14.016  16.807  43.372  1.00 52.55 ? 28   PRO A CG  1 
ATOM   212  C CD  . PRO A 1 28  ? 12.889  17.307  42.504  1.00 52.78 ? 28   PRO A CD  1 
ATOM   213  N N   . VAL A 1 29  ? 16.852  16.440  40.155  1.00 48.55 ? 29   VAL A N   1 
ATOM   214  C CA  . VAL A 1 29  ? 17.648  15.322  39.666  1.00 47.79 ? 29   VAL A CA  1 
ATOM   215  C C   . VAL A 1 29  ? 19.019  15.355  40.342  1.00 47.32 ? 29   VAL A C   1 
ATOM   216  O O   . VAL A 1 29  ? 19.424  16.396  40.855  1.00 47.43 ? 29   VAL A O   1 
ATOM   217  C CB  . VAL A 1 29  ? 17.800  15.350  38.118  1.00 47.40 ? 29   VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 29  ? 16.422  15.262  37.443  1.00 47.64 ? 29   VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 29  ? 18.540  16.587  37.660  1.00 46.59 ? 29   VAL A CG2 1 
ATOM   220  N N   . SER A 1 30  ? 19.712  14.215  40.356  1.00 46.52 ? 30   SER A N   1 
ATOM   221  C CA  . SER A 1 30  ? 21.079  14.143  40.857  1.00 46.36 ? 30   SER A CA  1 
ATOM   222  C C   . SER A 1 30  ? 22.039  14.259  39.678  1.00 45.56 ? 30   SER A C   1 
ATOM   223  O O   . SER A 1 30  ? 21.850  13.608  38.649  1.00 45.01 ? 30   SER A O   1 
ATOM   224  C CB  . SER A 1 30  ? 21.351  12.826  41.589  1.00 46.87 ? 30   SER A CB  1 
ATOM   225  O OG  . SER A 1 30  ? 20.250  12.383  42.385  1.00 48.64 ? 30   SER A OG  1 
ATOM   226  N N   . ALA A 1 31  ? 23.064  15.094  39.817  1.00 44.87 ? 31   ALA A N   1 
ATOM   227  C CA  . ALA A 1 31  ? 24.071  15.216  38.784  1.00 44.06 ? 31   ALA A CA  1 
ATOM   228  C C   . ALA A 1 31  ? 25.450  15.014  39.392  1.00 44.05 ? 31   ALA A C   1 
ATOM   229  O O   . ALA A 1 31  ? 25.766  15.574  40.449  1.00 44.80 ? 31   ALA A O   1 
ATOM   230  C CB  . ALA A 1 31  ? 23.981  16.560  38.118  1.00 43.89 ? 31   ALA A CB  1 
ATOM   231  N N   . PHE A 1 32  ? 26.254  14.198  38.717  1.00 43.08 ? 32   PHE A N   1 
ATOM   232  C CA  . PHE A 1 32  ? 27.649  13.994  39.055  1.00 42.68 ? 32   PHE A CA  1 
ATOM   233  C C   . PHE A 1 32  ? 28.479  14.359  37.839  1.00 42.16 ? 32   PHE A C   1 
ATOM   234  O O   . PHE A 1 32  ? 28.608  13.587  36.906  1.00 41.87 ? 32   PHE A O   1 
ATOM   235  C CB  . PHE A 1 32  ? 27.879  12.556  39.475  1.00 42.24 ? 32   PHE A CB  1 
ATOM   236  C CG  . PHE A 1 32  ? 27.056  12.152  40.646  1.00 42.90 ? 32   PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 32  ? 25.791  11.621  40.467  1.00 43.20 ? 32   PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 32  ? 27.539  12.305  41.939  1.00 43.61 ? 32   PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 32  ? 25.013  11.258  41.564  1.00 42.44 ? 32   PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 32  ? 26.776  11.939  43.033  1.00 43.21 ? 32   PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 32  ? 25.507  11.422  42.846  1.00 43.06 ? 32   PHE A CZ  1 
ATOM   242  N N   . LEU A 1 33  ? 29.021  15.565  37.859  1.00 42.40 ? 33   LEU A N   1 
ATOM   243  C CA  . LEU A 1 33  ? 29.640  16.150  36.690  1.00 42.43 ? 33   LEU A CA  1 
ATOM   244  C C   . LEU A 1 33  ? 31.151  16.227  36.856  1.00 42.64 ? 33   LEU A C   1 
ATOM   245  O O   . LEU A 1 33  ? 31.659  16.571  37.926  1.00 43.43 ? 33   LEU A O   1 
ATOM   246  C CB  . LEU A 1 33  ? 29.043  17.539  36.430  1.00 42.50 ? 33   LEU A CB  1 
ATOM   247  C CG  . LEU A 1 33  ? 27.508  17.579  36.404  1.00 43.31 ? 33   LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 33  ? 26.987  19.027  36.364  1.00 42.16 ? 33   LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 33  ? 26.912  16.744  35.236  1.00 41.58 ? 33   LEU A CD2 1 
ATOM   250  N N   . GLY A 1 34  ? 31.871  15.888  35.793  1.00 42.45 ? 34   GLY A N   1 
ATOM   251  C CA  . GLY A 1 34  ? 33.325  16.004  35.795  1.00 42.40 ? 34   GLY A CA  1 
ATOM   252  C C   . GLY A 1 34  ? 34.028  14.908  36.560  1.00 42.44 ? 34   GLY A C   1 
ATOM   253  O O   . GLY A 1 34  ? 35.056  15.154  37.205  1.00 42.81 ? 34   GLY A O   1 
ATOM   254  N N   . ILE A 1 35  ? 33.496  13.687  36.473  1.00 42.09 ? 35   ILE A N   1 
ATOM   255  C CA  . ILE A 1 35  ? 34.162  12.518  37.056  1.00 42.30 ? 35   ILE A CA  1 
ATOM   256  C C   . ILE A 1 35  ? 35.308  12.094  36.129  1.00 42.59 ? 35   ILE A C   1 
ATOM   257  O O   . ILE A 1 35  ? 35.073  11.766  34.960  1.00 42.14 ? 35   ILE A O   1 
ATOM   258  C CB  . ILE A 1 35  ? 33.198  11.305  37.223  1.00 42.58 ? 35   ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 35  ? 31.954  11.691  38.055  1.00 41.92 ? 35   ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 35  ? 33.962  10.104  37.804  1.00 42.08 ? 35   ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 35  ? 30.785  10.713  37.907  1.00 42.04 ? 35   ILE A CD1 1 
ATOM   262  N N   . PRO A 1 36  ? 36.553  12.096  36.637  1.00 43.24 ? 36   PRO A N   1 
ATOM   263  C CA  . PRO A 1 36  ? 37.679  11.671  35.788  1.00 43.36 ? 36   PRO A CA  1 
ATOM   264  C C   . PRO A 1 36  ? 37.655  10.173  35.524  1.00 43.44 ? 36   PRO A C   1 
ATOM   265  O O   . PRO A 1 36  ? 37.522  9.415   36.461  1.00 43.94 ? 36   PRO A O   1 
ATOM   266  C CB  . PRO A 1 36  ? 38.911  12.015  36.639  1.00 43.85 ? 36   PRO A CB  1 
ATOM   267  C CG  . PRO A 1 36  ? 38.409  11.982  38.068  1.00 44.06 ? 36   PRO A CG  1 
ATOM   268  C CD  . PRO A 1 36  ? 36.991  12.475  37.998  1.00 43.88 ? 36   PRO A CD  1 
ATOM   269  N N   . PHE A 1 37  ? 37.804  9.748   34.274  1.00 43.27 ? 37   PHE A N   1 
ATOM   270  C CA  . PHE A 1 37  ? 37.842  8.311   33.966  1.00 43.29 ? 37   PHE A CA  1 
ATOM   271  C C   . PHE A 1 37  ? 39.180  7.847   33.381  1.00 43.63 ? 37   PHE A C   1 
ATOM   272  O O   . PHE A 1 37  ? 39.371  6.669   33.145  1.00 43.42 ? 37   PHE A O   1 
ATOM   273  C CB  . PHE A 1 37  ? 36.663  7.897   33.060  1.00 42.73 ? 37   PHE A CB  1 
ATOM   274  C CG  . PHE A 1 37  ? 36.690  8.490   31.671  1.00 42.19 ? 37   PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 37  ? 37.339  7.834   30.627  1.00 43.30 ? 37   PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 37  ? 36.015  9.673   31.391  1.00 42.70 ? 37   PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 37  ? 37.357  8.376   29.331  1.00 42.13 ? 37   PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 37  ? 36.017  10.217  30.097  1.00 41.77 ? 37   PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 37  ? 36.688  9.566   29.072  1.00 41.32 ? 37   PHE A CZ  1 
ATOM   280  N N   . ALA A 1 38  ? 40.094  8.786   33.160  1.00 44.43 ? 38   ALA A N   1 
ATOM   281  C CA  . ALA A 1 38  ? 41.429  8.491   32.641  1.00 45.20 ? 38   ALA A CA  1 
ATOM   282  C C   . ALA A 1 38  ? 42.463  9.384   33.308  1.00 45.83 ? 38   ALA A C   1 
ATOM   283  O O   . ALA A 1 38  ? 42.134  10.453  33.800  1.00 45.60 ? 38   ALA A O   1 
ATOM   284  C CB  . ALA A 1 38  ? 41.467  8.698   31.135  1.00 44.69 ? 38   ALA A CB  1 
ATOM   285  N N   . GLU A 1 39  ? 43.712  8.942   33.328  1.00 47.16 ? 39   GLU A N   1 
ATOM   286  C CA  . GLU A 1 39  ? 44.812  9.846   33.632  1.00 48.31 ? 39   GLU A CA  1 
ATOM   287  C C   . GLU A 1 39  ? 44.856  10.911  32.545  1.00 48.26 ? 39   GLU A C   1 
ATOM   288  O O   . GLU A 1 39  ? 44.638  10.605  31.367  1.00 48.27 ? 39   GLU A O   1 
ATOM   289  C CB  . GLU A 1 39  ? 46.151  9.094   33.711  1.00 49.50 ? 39   GLU A CB  1 
ATOM   290  C CG  . GLU A 1 39  ? 46.270  8.190   34.937  1.00 51.27 ? 39   GLU A CG  1 
ATOM   291  C CD  . GLU A 1 39  ? 46.204  8.977   36.237  1.00 53.52 ? 39   GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 39  ? 46.936  9.976   36.350  1.00 55.77 ? 39   GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 39  ? 45.432  8.606   37.143  1.00 53.81 ? 39   GLU A OE2 1 
ATOM   294  N N   . PRO A 1 40  ? 45.101  12.175  32.928  1.00 48.80 ? 40   PRO A N   1 
ATOM   295  C CA  . PRO A 1 40  ? 45.165  13.236  31.925  1.00 48.61 ? 40   PRO A CA  1 
ATOM   296  C C   . PRO A 1 40  ? 46.127  12.901  30.782  1.00 48.71 ? 40   PRO A C   1 
ATOM   297  O O   . PRO A 1 40  ? 47.304  12.621  31.032  1.00 49.77 ? 40   PRO A O   1 
ATOM   298  C CB  . PRO A 1 40  ? 45.649  14.443  32.730  1.00 49.43 ? 40   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 40  ? 45.133  14.182  34.112  1.00 49.59 ? 40   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 40  ? 45.304  12.702  34.290  1.00 49.33 ? 40   PRO A CD  1 
ATOM   301  N N   . PRO A 1 41  ? 45.624  12.884  29.538  1.00 47.89 ? 41   PRO A N   1 
ATOM   302  C CA  . PRO A 1 41  ? 46.427  12.486  28.391  1.00 47.82 ? 41   PRO A CA  1 
ATOM   303  C C   . PRO A 1 41  ? 47.347  13.594  27.893  1.00 48.15 ? 41   PRO A C   1 
ATOM   304  O O   . PRO A 1 41  ? 47.332  13.930  26.714  1.00 47.90 ? 41   PRO A O   1 
ATOM   305  C CB  . PRO A 1 41  ? 45.369  12.137  27.345  1.00 47.42 ? 41   PRO A CB  1 
ATOM   306  C CG  . PRO A 1 41  ? 44.253  13.046  27.646  1.00 46.83 ? 41   PRO A CG  1 
ATOM   307  C CD  . PRO A 1 41  ? 44.241  13.210  29.141  1.00 47.24 ? 41   PRO A CD  1 
ATOM   308  N N   . VAL A 1 42  ? 48.172  14.111  28.795  1.00 48.71 ? 42   VAL A N   1 
ATOM   309  C CA  . VAL A 1 42  ? 48.996  15.273  28.543  1.00 49.20 ? 42   VAL A CA  1 
ATOM   310  C C   . VAL A 1 42  ? 50.481  14.871  28.450  1.00 50.48 ? 42   VAL A C   1 
ATOM   311  O O   . VAL A 1 42  ? 50.884  13.788  28.903  1.00 51.17 ? 42   VAL A O   1 
ATOM   312  C CB  . VAL A 1 42  ? 48.803  16.325  29.677  1.00 49.63 ? 42   VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 42  ? 47.322  16.722  29.799  1.00 47.28 ? 42   VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 42  ? 49.339  15.781  31.032  1.00 48.06 ? 42   VAL A CG2 1 
ATOM   315  N N   . GLY A 1 43  ? 51.291  15.747  27.866  1.00 50.78 ? 43   GLY A N   1 
ATOM   316  C CA  . GLY A 1 43  ? 52.742  15.555  27.841  1.00 51.70 ? 43   GLY A CA  1 
ATOM   317  C C   . GLY A 1 43  ? 53.108  14.350  27.010  1.00 51.70 ? 43   GLY A C   1 
ATOM   318  O O   . GLY A 1 43  ? 52.757  14.269  25.839  1.00 51.42 ? 43   GLY A O   1 
ATOM   319  N N   . SER A 1 44  ? 53.784  13.389  27.625  1.00 52.60 ? 44   SER A N   1 
ATOM   320  C CA  . SER A 1 44  ? 54.218  12.177  26.925  1.00 53.02 ? 44   SER A CA  1 
ATOM   321  C C   . SER A 1 44  ? 53.041  11.290  26.535  1.00 52.37 ? 44   SER A C   1 
ATOM   322  O O   . SER A 1 44  ? 53.189  10.401  25.713  1.00 52.02 ? 44   SER A O   1 
ATOM   323  C CB  . SER A 1 44  ? 55.170  11.386  27.807  1.00 54.08 ? 44   SER A CB  1 
ATOM   324  O OG  . SER A 1 44  ? 54.560  11.118  29.065  1.00 54.02 ? 44   SER A OG  1 
ATOM   325  N N   . ARG A 1 45  ? 51.873  11.533  27.137  1.00 52.32 ? 45   ARG A N   1 
ATOM   326  C CA  . ARG A 1 45  ? 50.672  10.745  26.858  1.00 51.78 ? 45   ARG A CA  1 
ATOM   327  C C   . ARG A 1 45  ? 49.881  11.237  25.651  1.00 50.21 ? 45   ARG A C   1 
ATOM   328  O O   . ARG A 1 45  ? 48.936  10.575  25.219  1.00 49.24 ? 45   ARG A O   1 
ATOM   329  C CB  . ARG A 1 45  ? 49.775  10.727  28.085  1.00 52.29 ? 45   ARG A CB  1 
ATOM   330  C CG  . ARG A 1 45  ? 50.452  10.188  29.358  1.00 56.31 ? 45   ARG A CG  1 
ATOM   331  C CD  . ARG A 1 45  ? 49.486  9.290   30.144  1.00 63.19 ? 45   ARG A CD  1 
ATOM   332  N NE  . ARG A 1 45  ? 49.383  9.561   31.589  1.00 65.33 ? 45   ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 45  ? 50.233  9.135   32.530  1.00 69.47 ? 45   ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 45  ? 51.310  8.406   32.220  1.00 71.48 ? 45   ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 45  ? 50.005  9.447   33.810  1.00 70.41 ? 45   ARG A NH2 1 
ATOM   336  N N   . ARG A 1 46  ? 50.253  12.392  25.099  1.00 49.72 ? 46   ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? 49.560  12.911  23.910  1.00 48.77 ? 46   ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? 49.694  11.901  22.758  1.00 48.63 ? 46   ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? 50.770  11.353  22.526  1.00 48.66 ? 46   ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? 50.105  14.283  23.501  1.00 49.01 ? 46   ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? 49.377  14.921  22.313  1.00 48.71 ? 46   ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? 50.146  16.108  21.745  1.00 48.60 ? 46   ARG A CD  1 
ATOM   343  N NE  . ARG A 1 46  ? 49.954  17.344  22.499  1.00 47.61 ? 46   ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 46  ? 50.599  18.484  22.222  1.00 49.77 ? 46   ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 46  ? 51.485  18.538  21.230  1.00 50.09 ? 46   ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 46  ? 50.365  19.576  22.937  1.00 49.54 ? 46   ARG A NH2 1 
ATOM   347  N N   . PHE A 1 47  ? 48.575  11.652  22.073  1.00 47.89 ? 47   PHE A N   1 
ATOM   348  C CA  . PHE A 1 47  ? 48.471  10.665  20.984  1.00 48.10 ? 47   PHE A CA  1 
ATOM   349  C C   . PHE A 1 47  ? 48.408  9.214   21.428  1.00 48.52 ? 47   PHE A C   1 
ATOM   350  O O   . PHE A 1 47  ? 48.216  8.347   20.581  1.00 48.86 ? 47   PHE A O   1 
ATOM   351  C CB  . PHE A 1 47  ? 49.598  10.798  19.951  1.00 48.54 ? 47   PHE A CB  1 
ATOM   352  C CG  . PHE A 1 47  ? 49.831  12.197  19.478  1.00 48.79 ? 47   PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 47  ? 48.795  12.938  18.925  1.00 48.53 ? 47   PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 47  ? 51.087  12.773  19.569  1.00 48.62 ? 47   PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 47  ? 49.018  14.229  18.471  1.00 47.79 ? 47   PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 47  ? 51.306  14.050  19.125  1.00 48.94 ? 47   PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 47  ? 50.274  14.780  18.571  1.00 48.65 ? 47   PHE A CZ  1 
ATOM   358  N N   . MET A 1 48  ? 48.555  8.948   22.727  1.00 49.00 ? 48   MET A N   1 
ATOM   359  C CA  . MET A 1 48  ? 48.587  7.581   23.236  1.00 50.17 ? 48   MET A CA  1 
ATOM   360  C C   . MET A 1 48  ? 47.234  7.119   23.777  1.00 48.98 ? 48   MET A C   1 
ATOM   361  O O   . MET A 1 48  ? 46.423  7.929   24.222  1.00 48.21 ? 48   MET A O   1 
ATOM   362  C CB  . MET A 1 48  ? 49.614  7.451   24.368  1.00 50.83 ? 48   MET A CB  1 
ATOM   363  C CG  . MET A 1 48  ? 51.006  7.941   24.025  1.00 52.61 ? 48   MET A CG  1 
ATOM   364  S SD  . MET A 1 48  ? 52.274  7.062   24.962  1.00 56.08 ? 48   MET A SD  1 
ATOM   365  C CE  . MET A 1 48  ? 52.119  5.493   24.090  1.00 57.93 ? 48   MET A CE  1 
ATOM   366  N N   . PRO A 1 49  ? 46.998  5.802   23.768  1.00 49.30 ? 49   PRO A N   1 
ATOM   367  C CA  . PRO A 1 49  ? 45.793  5.244   24.383  1.00 49.20 ? 49   PRO A CA  1 
ATOM   368  C C   . PRO A 1 49  ? 45.578  5.758   25.804  1.00 49.25 ? 49   PRO A C   1 
ATOM   369  O O   . PRO A 1 49  ? 46.542  6.017   26.519  1.00 49.50 ? 49   PRO A O   1 
ATOM   370  C CB  . PRO A 1 49  ? 46.079  3.745   24.407  1.00 49.48 ? 49   PRO A CB  1 
ATOM   371  C CG  . PRO A 1 49  ? 47.004  3.539   23.245  1.00 49.90 ? 49   PRO A CG  1 
ATOM   372  C CD  . PRO A 1 49  ? 47.845  4.755   23.168  1.00 49.86 ? 49   PRO A CD  1 
ATOM   373  N N   . PRO A 1 50  ? 44.319  5.897   26.216  1.00 49.00 ? 50   PRO A N   1 
ATOM   374  C CA  . PRO A 1 50  ? 44.072  6.383   27.562  1.00 49.63 ? 50   PRO A CA  1 
ATOM   375  C C   . PRO A 1 50  ? 44.443  5.329   28.599  1.00 50.94 ? 50   PRO A C   1 
ATOM   376  O O   . PRO A 1 50  ? 44.314  4.133   28.332  1.00 51.27 ? 50   PRO A O   1 
ATOM   377  C CB  . PRO A 1 50  ? 42.564  6.613   27.572  1.00 48.61 ? 50   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 50  ? 42.052  5.599   26.617  1.00 48.22 ? 50   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 50  ? 43.072  5.571   25.512  1.00 48.24 ? 50   PRO A CD  1 
ATOM   380  N N   . GLU A 1 51  ? 44.912  5.784   29.757  1.00 52.15 ? 51   GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 45.125  4.921   30.912  1.00 54.11 ? 51   GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 44.048  5.231   31.937  1.00 52.60 ? 51   GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 43.723  6.408   32.157  1.00 52.12 ? 51   GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 46.465  5.207   31.558  1.00 54.99 ? 51   GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 47.664  5.073   30.641  1.00 58.60 ? 51   GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 48.945  5.472   31.363  1.00 60.56 ? 51   GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 49.282  6.680   31.337  1.00 66.69 ? 51   GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 49.596  4.584   31.972  1.00 67.01 ? 51   GLU A OE2 1 
ATOM   389  N N   . PRO A 1 52  ? 43.501  4.191   32.584  1.00 52.10 ? 52   PRO A N   1 
ATOM   390  C CA  . PRO A 1 52  ? 42.475  4.407   33.607  1.00 51.47 ? 52   PRO A CA  1 
ATOM   391  C C   . PRO A 1 52  ? 42.917  5.337   34.735  1.00 51.04 ? 52   PRO A C   1 
ATOM   392  O O   . PRO A 1 52  ? 44.070  5.323   35.150  1.00 50.77 ? 52   PRO A O   1 
ATOM   393  C CB  . PRO A 1 52  ? 42.229  3.002   34.160  1.00 51.86 ? 52   PRO A CB  1 
ATOM   394  C CG  . PRO A 1 52  ? 42.646  2.097   33.082  1.00 52.52 ? 52   PRO A CG  1 
ATOM   395  C CD  . PRO A 1 52  ? 43.791  2.757   32.402  1.00 52.64 ? 52   PRO A CD  1 
ATOM   396  N N   . LYS A 1 53  ? 41.975  6.125   35.221  1.00 50.60 ? 53   LYS A N   1 
ATOM   397  C CA  . LYS A 1 53  ? 42.226  7.037   36.306  1.00 51.29 ? 53   LYS A CA  1 
ATOM   398  C C   . LYS A 1 53  ? 42.660  6.272   37.551  1.00 52.12 ? 53   LYS A C   1 
ATOM   399  O O   . LYS A 1 53  ? 41.970  5.363   37.997  1.00 52.09 ? 53   LYS A O   1 
ATOM   400  C CB  . LYS A 1 53  ? 40.960  7.845   36.595  1.00 50.78 ? 53   LYS A CB  1 
ATOM   401  C CG  . LYS A 1 53  ? 41.075  8.829   37.751  1.00 52.11 ? 53   LYS A CG  1 
ATOM   402  C CD  . LYS A 1 53  ? 42.091  9.924   37.456  1.00 52.57 ? 53   LYS A CD  1 
ATOM   403  C CE  . LYS A 1 53  ? 42.264  10.870  38.622  1.00 52.92 ? 53   LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 53  ? 43.149  12.013  38.238  1.00 55.24 ? 53   LYS A NZ  1 
ATOM   405  N N   . ARG A 1 54  ? 43.802  6.649   38.110  1.00 53.10 ? 54   ARG A N   1 
ATOM   406  C CA  . ARG A 1 54  ? 44.218  6.140   39.408  1.00 54.53 ? 54   ARG A CA  1 
ATOM   407  C C   . ARG A 1 54  ? 43.332  6.695   40.543  1.00 53.61 ? 54   ARG A C   1 
ATOM   408  O O   . ARG A 1 54  ? 42.876  7.846   40.473  1.00 52.47 ? 54   ARG A O   1 
ATOM   409  C CB  . ARG A 1 54  ? 45.690  6.471   39.645  1.00 56.05 ? 54   ARG A CB  1 
ATOM   410  C CG  . ARG A 1 54  ? 46.640  5.500   38.930  1.00 60.39 ? 54   ARG A CG  1 
ATOM   411  C CD  . ARG A 1 54  ? 47.829  6.183   38.296  1.00 66.89 ? 54   ARG A CD  1 
ATOM   412  N NE  . ARG A 1 54  ? 48.306  7.329   39.070  1.00 70.37 ? 54   ARG A NE  1 
ATOM   413  C CZ  . ARG A 1 54  ? 49.252  8.180   38.653  1.00 73.95 ? 54   ARG A CZ  1 
ATOM   414  N NH1 . ARG A 1 54  ? 49.855  8.013   37.470  1.00 74.73 ? 54   ARG A NH1 1 
ATOM   415  N NH2 . ARG A 1 54  ? 49.609  9.205   39.433  1.00 74.52 ? 54   ARG A NH2 1 
ATOM   416  N N   . PRO A 1 55  ? 43.069  5.873   41.581  1.00 53.33 ? 55   PRO A N   1 
ATOM   417  C CA  . PRO A 1 55  ? 42.204  6.326   42.665  1.00 53.13 ? 55   PRO A CA  1 
ATOM   418  C C   . PRO A 1 55  ? 42.730  7.577   43.356  1.00 53.46 ? 55   PRO A C   1 
ATOM   419  O O   . PRO A 1 55  ? 43.939  7.799   43.411  1.00 53.64 ? 55   PRO A O   1 
ATOM   420  C CB  . PRO A 1 55  ? 42.197  5.133   43.640  1.00 53.80 ? 55   PRO A CB  1 
ATOM   421  C CG  . PRO A 1 55  ? 42.579  3.982   42.839  1.00 53.78 ? 55   PRO A CG  1 
ATOM   422  C CD  . PRO A 1 55  ? 43.526  4.490   41.802  1.00 53.63 ? 55   PRO A CD  1 
ATOM   423  N N   . TRP A 1 56  ? 41.808  8.386   43.861  1.00 53.64 ? 56   TRP A N   1 
ATOM   424  C CA  . TRP A 1 56  ? 42.126  9.632   44.564  1.00 54.49 ? 56   TRP A CA  1 
ATOM   425  C C   . TRP A 1 56  ? 41.757  9.494   46.037  1.00 55.45 ? 56   TRP A C   1 
ATOM   426  O O   . TRP A 1 56  ? 40.964  8.628   46.411  1.00 55.65 ? 56   TRP A O   1 
ATOM   427  C CB  . TRP A 1 56  ? 41.354  10.811  43.941  1.00 53.77 ? 56   TRP A CB  1 
ATOM   428  C CG  . TRP A 1 56  ? 39.872  10.595  43.922  1.00 53.09 ? 56   TRP A CG  1 
ATOM   429  C CD1 . TRP A 1 56  ? 38.985  10.881  44.922  1.00 53.40 ? 56   TRP A CD1 1 
ATOM   430  C CD2 . TRP A 1 56  ? 39.106  10.013  42.864  1.00 52.22 ? 56   TRP A CD2 1 
ATOM   431  N NE1 . TRP A 1 56  ? 37.721  10.518  44.549  1.00 52.43 ? 56   TRP A NE1 1 
ATOM   432  C CE2 . TRP A 1 56  ? 37.763  9.987   43.287  1.00 52.10 ? 56   TRP A CE2 1 
ATOM   433  C CE3 . TRP A 1 56  ? 39.426  9.508   41.598  1.00 52.08 ? 56   TRP A CE3 1 
ATOM   434  C CZ2 . TRP A 1 56  ? 36.736  9.478   42.487  1.00 51.63 ? 56   TRP A CZ2 1 
ATOM   435  C CZ3 . TRP A 1 56  ? 38.406  9.011   40.801  1.00 51.75 ? 56   TRP A CZ3 1 
ATOM   436  C CH2 . TRP A 1 56  ? 37.076  8.998   41.251  1.00 51.58 ? 56   TRP A CH2 1 
ATOM   437  N N   . SER A 1 57  ? 42.316  10.352  46.880  1.00 57.00 ? 57   SER A N   1 
ATOM   438  C CA  . SER A 1 57  ? 41.931  10.364  48.292  1.00 58.07 ? 57   SER A CA  1 
ATOM   439  C C   . SER A 1 57  ? 40.894  11.457  48.533  1.00 57.17 ? 57   SER A C   1 
ATOM   440  O O   . SER A 1 57  ? 40.859  12.455  47.818  1.00 56.91 ? 57   SER A O   1 
ATOM   441  C CB  . SER A 1 57  ? 43.154  10.567  49.195  1.00 59.61 ? 57   SER A CB  1 
ATOM   442  O OG  . SER A 1 57  ? 43.728  11.848  48.995  1.00 61.73 ? 57   SER A OG  1 
ATOM   443  N N   . GLY A 1 58  ? 40.037  11.243  49.527  1.00 57.32 ? 58   GLY A N   1 
ATOM   444  C CA  . GLY A 1 58  ? 39.008  12.213  49.895  1.00 57.01 ? 58   GLY A CA  1 
ATOM   445  C C   . GLY A 1 58  ? 37.833  12.237  48.932  1.00 56.06 ? 58   GLY A C   1 
ATOM   446  O O   . GLY A 1 58  ? 37.694  11.368  48.067  1.00 55.85 ? 58   GLY A O   1 
ATOM   447  N N   . VAL A 1 59  ? 36.990  13.247  49.081  1.00 55.95 ? 59   VAL A N   1 
ATOM   448  C CA  . VAL A 1 59  ? 35.766  13.351  48.299  1.00 55.03 ? 59   VAL A CA  1 
ATOM   449  C C   . VAL A 1 59  ? 36.062  14.228  47.094  1.00 54.39 ? 59   VAL A C   1 
ATOM   450  O O   . VAL A 1 59  ? 36.460  15.373  47.247  1.00 55.24 ? 59   VAL A O   1 
ATOM   451  C CB  . VAL A 1 59  ? 34.629  13.949  49.146  1.00 55.38 ? 59   VAL A CB  1 
ATOM   452  C CG1 . VAL A 1 59  ? 33.317  13.985  48.362  1.00 53.98 ? 59   VAL A CG1 1 
ATOM   453  C CG2 . VAL A 1 59  ? 34.488  13.170  50.439  1.00 54.51 ? 59   VAL A CG2 1 
ATOM   454  N N   . LEU A 1 60  ? 35.916  13.675  45.895  1.00 53.36 ? 60   LEU A N   1 
ATOM   455  C CA  . LEU A 1 60  ? 36.127  14.448  44.681  1.00 52.55 ? 60   LEU A CA  1 
ATOM   456  C C   . LEU A 1 60  ? 34.872  15.268  44.434  1.00 52.14 ? 60   LEU A C   1 
ATOM   457  O O   . LEU A 1 60  ? 33.765  14.738  44.492  1.00 51.36 ? 60   LEU A O   1 
ATOM   458  C CB  . LEU A 1 60  ? 36.449  13.523  43.500  1.00 51.90 ? 60   LEU A CB  1 
ATOM   459  C CG  . LEU A 1 60  ? 36.690  14.168  42.121  1.00 51.75 ? 60   LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 60  ? 37.751  13.409  41.351  1.00 50.63 ? 60   LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 60  ? 35.396  14.230  41.318  1.00 50.51 ? 60   LEU A CD2 1 
ATOM   462  N N   . ASP A 1 61  ? 35.026  16.569  44.195  1.00 52.34 ? 61   ASP A N   1 
ATOM   463  C CA  . ASP A 1 61  ? 33.860  17.379  43.874  1.00 52.35 ? 61   ASP A CA  1 
ATOM   464  C C   . ASP A 1 61  ? 33.377  17.107  42.452  1.00 50.59 ? 61   ASP A C   1 
ATOM   465  O O   . ASP A 1 61  ? 34.092  17.381  41.503  1.00 50.34 ? 61   ASP A O   1 
ATOM   466  C CB  . ASP A 1 61  ? 34.139  18.865  44.023  1.00 53.63 ? 61   ASP A CB  1 
ATOM   467  C CG  . ASP A 1 61  ? 32.881  19.686  43.854  1.00 55.96 ? 61   ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 61  ? 32.570  20.055  42.707  1.00 57.55 ? 61   ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 61  ? 32.168  19.890  44.869  1.00 63.41 ? 61   ASP A OD2 1 
ATOM   470  N N   . ALA A 1 62  ? 32.159  16.577  42.318  1.00 49.59 ? 62   ALA A N   1 
ATOM   471  C CA  . ALA A 1 62  ? 31.565  16.292  41.010  1.00 48.08 ? 62   ALA A CA  1 
ATOM   472  C C   . ALA A 1 62  ? 30.314  17.161  40.794  1.00 47.69 ? 62   ALA A C   1 
ATOM   473  O O   . ALA A 1 62  ? 29.243  16.658  40.409  1.00 46.40 ? 62   ALA A O   1 
ATOM   474  C CB  . ALA A 1 62  ? 31.234  14.830  40.890  1.00 47.06 ? 62   ALA A CB  1 
ATOM   475  N N   . THR A 1 63  ? 30.468  18.472  41.025  1.00 47.32 ? 63   THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? 29.341  19.410  40.972  1.00 47.18 ? 63   THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? 29.362  20.361  39.765  1.00 47.15 ? 63   THR A C   1 
ATOM   478  O O   . THR A 1 63  ? 28.398  21.094  39.559  1.00 46.80 ? 63   THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? 29.270  20.291  42.248  1.00 48.23 ? 63   THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? 30.415  21.150  42.291  1.00 47.64 ? 63   THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? 29.193  19.438  43.550  1.00 47.43 ? 63   THR A CG2 1 
ATOM   482  N N   . THR A 1 64  ? 30.449  20.369  38.988  1.00 46.69 ? 64   THR A N   1 
ATOM   483  C CA  . THR A 1 64  ? 30.545  21.229  37.821  1.00 46.89 ? 64   THR A CA  1 
ATOM   484  C C   . THR A 1 64  ? 31.168  20.483  36.655  1.00 46.35 ? 64   THR A C   1 
ATOM   485  O O   . THR A 1 64  ? 31.963  19.567  36.859  1.00 46.22 ? 64   THR A O   1 
ATOM   486  C CB  . THR A 1 64  ? 31.403  22.497  38.096  1.00 47.77 ? 64   THR A CB  1 
ATOM   487  O OG1 . THR A 1 64  ? 32.776  22.130  38.275  1.00 48.71 ? 64   THR A OG1 1 
ATOM   488  C CG2 . THR A 1 64  ? 30.939  23.227  39.353  1.00 48.99 ? 64   THR A CG2 1 
ATOM   489  N N   . PHE A 1 65  ? 30.816  20.882  35.431  1.00 46.00 ? 65   PHE A N   1 
ATOM   490  C CA  . PHE A 1 65  ? 31.451  20.310  34.234  1.00 45.81 ? 65   PHE A CA  1 
ATOM   491  C C   . PHE A 1 65  ? 32.945  20.596  34.215  1.00 45.98 ? 65   PHE A C   1 
ATOM   492  O O   . PHE A 1 65  ? 33.399  21.644  34.658  1.00 46.59 ? 65   PHE A O   1 
ATOM   493  C CB  . PHE A 1 65  ? 30.839  20.832  32.939  1.00 45.29 ? 65   PHE A CB  1 
ATOM   494  C CG  . PHE A 1 65  ? 29.421  20.382  32.701  1.00 45.27 ? 65   PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 65  ? 29.140  19.060  32.410  1.00 45.26 ? 65   PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 65  ? 28.375  21.298  32.713  1.00 45.54 ? 65   PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 65  ? 27.833  18.640  32.169  1.00 45.34 ? 65   PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 65  ? 27.060  20.889  32.466  1.00 45.61 ? 65   PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 65  ? 26.793  19.561  32.202  1.00 45.37 ? 65   PHE A CZ  1 
ATOM   500  N N   . GLN A 1 66  ? 33.704  19.658  33.669  1.00 45.77 ? 66   GLN A N   1 
ATOM   501  C CA  . GLN A 1 66  ? 35.136  19.831  33.543  1.00 46.21 ? 66   GLN A CA  1 
ATOM   502  C C   . GLN A 1 66  ? 35.543  20.429  32.185  1.00 45.57 ? 66   GLN A C   1 
ATOM   503  O O   . GLN A 1 66  ? 34.691  20.919  31.426  1.00 45.05 ? 66   GLN A O   1 
ATOM   504  C CB  . GLN A 1 66  ? 35.822  18.505  33.850  1.00 46.73 ? 66   GLN A CB  1 
ATOM   505  C CG  . GLN A 1 66  ? 36.245  18.404  35.301  1.00 48.20 ? 66   GLN A CG  1 
ATOM   506  C CD  . GLN A 1 66  ? 37.564  19.107  35.534  1.00 51.41 ? 66   GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 66  ? 38.130  19.712  34.607  1.00 52.53 ? 66   GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 66  ? 38.084  19.009  36.760  1.00 51.55 ? 66   GLN A NE2 1 
ATOM   509  N N   . ASN A 1 67  ? 36.851  20.436  31.920  1.00 45.41 ? 67   ASN A N   1 
ATOM   510  C CA  . ASN A 1 67  ? 37.413  21.003  30.703  1.00 44.79 ? 67   ASN A CA  1 
ATOM   511  C C   . ASN A 1 67  ? 36.896  20.288  29.452  1.00 44.28 ? 67   ASN A C   1 
ATOM   512  O O   . ASN A 1 67  ? 36.633  19.070  29.454  1.00 43.82 ? 67   ASN A O   1 
ATOM   513  C CB  . ASN A 1 67  ? 38.945  20.920  30.702  1.00 45.10 ? 67   ASN A CB  1 
ATOM   514  C CG  . ASN A 1 67  ? 39.598  21.693  31.848  1.00 46.55 ? 67   ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 67  ? 39.077  22.688  32.314  1.00 45.77 ? 67   ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 67  ? 40.761  21.210  32.305  1.00 47.44 ? 67   ASN A ND2 1 
ATOM   517  N N   . VAL A 1 68  ? 36.749  21.078  28.396  1.00 44.09 ? 68   VAL A N   1 
ATOM   518  C CA  . VAL A 1 68  ? 36.483  20.592  27.056  1.00 43.77 ? 68   VAL A CA  1 
ATOM   519  C C   . VAL A 1 68  ? 37.822  20.199  26.401  1.00 44.15 ? 68   VAL A C   1 
ATOM   520  O O   . VAL A 1 68  ? 38.865  20.831  26.634  1.00 44.97 ? 68   VAL A O   1 
ATOM   521  C CB  . VAL A 1 68  ? 35.774  21.696  26.261  1.00 43.80 ? 68   VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? 35.686  21.349  24.791  1.00 45.06 ? 68   VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? 34.389  21.959  26.857  1.00 42.22 ? 68   VAL A CG2 1 
ATOM   524  N N   . CYS A 1 69  ? 37.805  19.132  25.621  1.00 43.96 ? 69   CYS A N   1 
ATOM   525  C CA  . CYS A 1 69  ? 39.004  18.669  24.944  1.00 44.90 ? 69   CYS A CA  1 
ATOM   526  C C   . CYS A 1 69  ? 39.413  19.700  23.915  1.00 45.43 ? 69   CYS A C   1 
ATOM   527  O O   . CYS A 1 69  ? 38.566  20.306  23.261  1.00 45.19 ? 69   CYS A O   1 
ATOM   528  C CB  . CYS A 1 69  ? 38.779  17.301  24.287  1.00 44.35 ? 69   CYS A CB  1 
ATOM   529  S SG  . CYS A 1 69  ? 38.531  15.960  25.474  1.00 45.24 ? 69   CYS A SG  1 
ATOM   530  N N   . TYR A 1 70  ? 40.723  19.895  23.792  1.00 46.51 ? 70   TYR A N   1 
ATOM   531  C CA  . TYR A 1 70  ? 41.274  20.946  22.952  1.00 46.91 ? 70   TYR A CA  1 
ATOM   532  C C   . TYR A 1 70  ? 40.813  20.789  21.507  1.00 46.48 ? 70   TYR A C   1 
ATOM   533  O O   . TYR A 1 70  ? 40.851  19.693  20.932  1.00 45.40 ? 70   TYR A O   1 
ATOM   534  C CB  . TYR A 1 70  ? 42.809  20.993  23.041  1.00 47.91 ? 70   TYR A CB  1 
ATOM   535  C CG  . TYR A 1 70  ? 43.312  22.400  22.958  1.00 48.42 ? 70   TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 70  ? 43.676  23.112  24.098  1.00 50.83 ? 70   TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 70  ? 43.378  23.047  21.739  1.00 49.17 ? 70   TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 70  ? 44.126  24.447  24.001  1.00 49.11 ? 70   TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 70  ? 43.800  24.350  21.639  1.00 49.24 ? 70   TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 70  ? 44.170  25.052  22.767  1.00 50.35 ? 70   TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 70  ? 44.597  26.375  22.617  1.00 51.79 ? 70   TYR A OH  1 
ATOM   542  N N   . GLN A 1 71  ? 40.353  21.892  20.935  1.00 46.94 ? 71   GLN A N   1 
ATOM   543  C CA  . GLN A 1 71  ? 39.664  21.825  19.661  1.00 46.95 ? 71   GLN A CA  1 
ATOM   544  C C   . GLN A 1 71  ? 39.545  23.161  18.970  1.00 48.83 ? 71   GLN A C   1 
ATOM   545  O O   . GLN A 1 71  ? 39.685  24.214  19.577  1.00 48.74 ? 71   GLN A O   1 
ATOM   546  C CB  . GLN A 1 71  ? 38.259  21.233  19.830  1.00 46.17 ? 71   GLN A CB  1 
ATOM   547  C CG  . GLN A 1 71  ? 37.287  22.098  20.606  1.00 44.51 ? 71   GLN A CG  1 
ATOM   548  C CD  . GLN A 1 71  ? 35.991  21.373  20.937  1.00 43.23 ? 71   GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 71  ? 34.934  21.696  20.406  1.00 38.91 ? 71   GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 71  ? 36.068  20.409  21.823  1.00 37.99 ? 71   GLN A NE2 1 
ATOM   551  N N   . TYR A 1 72  ? 39.273  23.067  17.676  1.00 51.07 ? 72   TYR A N   1 
ATOM   552  C CA  . TYR A 1 72  ? 38.942  24.200  16.834  1.00 52.98 ? 72   TYR A CA  1 
ATOM   553  C C   . TYR A 1 72  ? 37.633  24.828  17.304  1.00 53.71 ? 72   TYR A C   1 
ATOM   554  O O   . TYR A 1 72  ? 36.668  24.114  17.597  1.00 53.52 ? 72   TYR A O   1 
ATOM   555  C CB  . TYR A 1 72  ? 38.831  23.704  15.385  1.00 53.62 ? 72   TYR A CB  1 
ATOM   556  C CG  . TYR A 1 72  ? 38.390  24.740  14.393  1.00 54.65 ? 72   TYR A CG  1 
ATOM   557  C CD1 . TYR A 1 72  ? 37.048  24.880  14.070  1.00 55.19 ? 72   TYR A CD1 1 
ATOM   558  C CD2 . TYR A 1 72  ? 39.311  25.577  13.774  1.00 55.81 ? 72   TYR A CD2 1 
ATOM   559  C CE1 . TYR A 1 72  ? 36.626  25.828  13.167  1.00 55.77 ? 72   TYR A CE1 1 
ATOM   560  C CE2 . TYR A 1 72  ? 38.896  26.532  12.864  1.00 56.67 ? 72   TYR A CE2 1 
ATOM   561  C CZ  . TYR A 1 72  ? 37.547  26.644  12.564  1.00 56.15 ? 72   TYR A CZ  1 
ATOM   562  O OH  . TYR A 1 72  ? 37.108  27.576  11.662  1.00 57.44 ? 72   TYR A OH  1 
ATOM   563  N N   . VAL A 1 73  ? 37.615  26.156  17.384  1.00 55.13 ? 73   VAL A N   1 
ATOM   564  C CA  . VAL A 1 73  ? 36.440  26.920  17.788  1.00 56.45 ? 73   VAL A CA  1 
ATOM   565  C C   . VAL A 1 73  ? 35.893  27.718  16.582  1.00 58.41 ? 73   VAL A C   1 
ATOM   566  O O   . VAL A 1 73  ? 36.588  28.527  15.981  1.00 58.79 ? 73   VAL A O   1 
ATOM   567  C CB  . VAL A 1 73  ? 36.792  27.868  18.963  1.00 57.08 ? 73   VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 73  ? 35.684  28.867  19.233  1.00 55.98 ? 73   VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 73  ? 37.099  27.047  20.221  1.00 56.70 ? 73   VAL A CG2 1 
ATOM   570  N N   . ASP A 1 74  ? 34.636  27.476  16.242  1.00 60.27 ? 74   ASP A N   1 
ATOM   571  C CA  . ASP A 1 74  ? 34.008  28.091  15.074  1.00 61.99 ? 74   ASP A CA  1 
ATOM   572  C C   . ASP A 1 74  ? 33.803  29.590  15.234  1.00 63.56 ? 74   ASP A C   1 
ATOM   573  O O   . ASP A 1 74  ? 33.225  30.042  16.219  1.00 63.56 ? 74   ASP A O   1 
ATOM   574  C CB  . ASP A 1 74  ? 32.658  27.440  14.820  1.00 61.69 ? 74   ASP A CB  1 
ATOM   575  C CG  . ASP A 1 74  ? 32.150  27.690  13.424  1.00 63.61 ? 74   ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 74  ? 32.252  26.742  12.599  1.00 66.79 ? 74   ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 74  ? 31.663  28.813  13.160  1.00 62.89 ? 74   ASP A OD2 1 
ATOM   578  N N   . THR A 1 75  ? 34.255  30.352  14.242  1.00 65.77 ? 75   THR A N   1 
ATOM   579  C CA  . THR A 1 75  ? 34.043  31.814  14.222  1.00 68.03 ? 75   THR A CA  1 
ATOM   580  C C   . THR A 1 75  ? 33.457  32.339  12.884  1.00 68.55 ? 75   THR A C   1 
ATOM   581  O O   . THR A 1 75  ? 33.583  33.524  12.569  1.00 69.23 ? 75   THR A O   1 
ATOM   582  C CB  . THR A 1 75  ? 35.353  32.564  14.602  1.00 68.88 ? 75   THR A CB  1 
ATOM   583  O OG1 . THR A 1 75  ? 36.483  31.897  14.010  1.00 68.85 ? 75   THR A OG1 1 
ATOM   584  C CG2 . THR A 1 75  ? 35.524  32.594  16.130  1.00 69.32 ? 75   THR A CG2 1 
ATOM   585  N N   . LEU A 1 76  ? 32.778  31.466  12.135  1.00 68.75 ? 76   LEU A N   1 
ATOM   586  C CA  . LEU A 1 76  ? 32.130  31.861  10.873  1.00 69.13 ? 76   LEU A CA  1 
ATOM   587  C C   . LEU A 1 76  ? 31.080  32.965  11.084  1.00 70.28 ? 76   LEU A C   1 
ATOM   588  O O   . LEU A 1 76  ? 31.009  33.924  10.298  1.00 71.41 ? 76   LEU A O   1 
ATOM   589  C CB  . LEU A 1 76  ? 31.476  30.652  10.185  1.00 68.67 ? 76   LEU A CB  1 
ATOM   590  C CG  . LEU A 1 76  ? 30.774  30.928  8.833   1.00 68.92 ? 76   LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 76  ? 31.774  31.407  7.770   1.00 69.01 ? 76   LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 76  ? 29.997  29.705  8.332   1.00 68.17 ? 76   LEU A CD2 1 
ATOM   593  N N   . TYR A 1 77  ? 30.279  32.830  12.145  1.00 70.22 ? 77   TYR A N   1 
ATOM   594  C CA  . TYR A 1 77  ? 29.192  33.765  12.440  1.00 70.41 ? 77   TYR A CA  1 
ATOM   595  C C   . TYR A 1 77  ? 29.201  34.221  13.912  1.00 70.65 ? 77   TYR A C   1 
ATOM   596  O O   . TYR A 1 77  ? 28.460  33.700  14.736  1.00 69.78 ? 77   TYR A O   1 
ATOM   597  C CB  . TYR A 1 77  ? 27.849  33.125  12.097  1.00 70.01 ? 77   TYR A CB  1 
ATOM   598  C CG  . TYR A 1 77  ? 27.621  32.825  10.625  1.00 70.11 ? 77   TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 77  ? 27.604  33.845  9.675   1.00 70.72 ? 77   TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 77  ? 27.364  31.522  10.190  1.00 70.56 ? 77   TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 77  ? 27.369  33.576  8.322   1.00 70.71 ? 77   TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 77  ? 27.118  31.238  8.833   1.00 70.05 ? 77   TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 77  ? 27.120  32.266  7.906   1.00 70.53 ? 77   TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 77  ? 26.879  31.988  6.570   1.00 70.03 ? 77   TYR A OH  1 
ATOM   605  N N   . PRO A 1 78  ? 30.049  35.209  14.244  1.00 71.67 ? 78   PRO A N   1 
ATOM   606  C CA  . PRO A 1 78  ? 30.127  35.837  15.574  1.00 71.90 ? 78   PRO A CA  1 
ATOM   607  C C   . PRO A 1 78  ? 28.794  36.275  16.179  1.00 71.54 ? 78   PRO A C   1 
ATOM   608  O O   . PRO A 1 78  ? 28.035  37.009  15.545  1.00 72.62 ? 78   PRO A O   1 
ATOM   609  C CB  . PRO A 1 78  ? 30.987  37.076  15.318  1.00 73.18 ? 78   PRO A CB  1 
ATOM   610  C CG  . PRO A 1 78  ? 31.883  36.663  14.194  1.00 73.59 ? 78   PRO A CG  1 
ATOM   611  C CD  . PRO A 1 78  ? 31.059  35.760  13.318  1.00 72.28 ? 78   PRO A CD  1 
ATOM   612  N N   . GLY A 1 79  ? 28.525  35.833  17.407  1.00 70.26 ? 79   GLY A N   1 
ATOM   613  C CA  . GLY A 1 79  ? 27.320  36.231  18.141  1.00 69.43 ? 79   GLY A CA  1 
ATOM   614  C C   . GLY A 1 79  ? 26.093  35.414  17.782  1.00 67.78 ? 79   GLY A C   1 
ATOM   615  O O   . GLY A 1 79  ? 25.038  35.577  18.399  1.00 67.54 ? 79   GLY A O   1 
ATOM   616  N N   . PHE A 1 80  ? 26.242  34.527  16.794  1.00 65.80 ? 80   PHE A N   1 
ATOM   617  C CA  . PHE A 1 80  ? 25.126  33.792  16.221  1.00 64.32 ? 80   PHE A CA  1 
ATOM   618  C C   . PHE A 1 80  ? 24.940  32.506  16.986  1.00 63.29 ? 80   PHE A C   1 
ATOM   619  O O   . PHE A 1 80  ? 25.848  31.683  17.036  1.00 62.44 ? 80   PHE A O   1 
ATOM   620  C CB  . PHE A 1 80  ? 25.395  33.491  14.743  1.00 63.52 ? 80   PHE A CB  1 
ATOM   621  C CG  . PHE A 1 80  ? 24.289  32.734  14.056  1.00 62.24 ? 80   PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 80  ? 22.975  33.187  14.112  1.00 61.74 ? 80   PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 80  ? 24.569  31.587  13.327  1.00 60.55 ? 80   PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 80  ? 21.962  32.496  13.473  1.00 61.68 ? 80   PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 80  ? 23.556  30.887  12.682  1.00 60.24 ? 80   PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 80  ? 22.253  31.341  12.756  1.00 61.21 ? 80   PHE A CZ  1 
ATOM   627  N N   . GLU A 1 81  ? 23.761  32.333  17.574  1.00 63.28 ? 81   GLU A N   1 
ATOM   628  C CA  . GLU A 1 81  ? 23.507  31.183  18.430  1.00 63.25 ? 81   GLU A CA  1 
ATOM   629  C C   . GLU A 1 81  ? 23.525  29.869  17.640  1.00 61.50 ? 81   GLU A C   1 
ATOM   630  O O   . GLU A 1 81  ? 23.949  28.831  18.154  1.00 60.47 ? 81   GLU A O   1 
ATOM   631  C CB  . GLU A 1 81  ? 22.191  31.351  19.202  1.00 64.29 ? 81   GLU A CB  1 
ATOM   632  C CG  . GLU A 1 81  ? 21.725  30.055  19.896  1.00 67.17 ? 81   GLU A CG  1 
ATOM   633  C CD  . GLU A 1 81  ? 21.325  30.233  21.357  1.00 72.08 ? 81   GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 81  ? 20.793  31.317  21.718  1.00 75.18 ? 81   GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 81  ? 21.540  29.259  22.135  1.00 73.99 ? 81   GLU A OE2 1 
ATOM   636  N N   . GLY A 1 82  ? 23.079  29.931  16.388  1.00 60.42 ? 82   GLY A N   1 
ATOM   637  C CA  . GLY A 1 82  ? 23.074  28.771  15.508  1.00 59.10 ? 82   GLY A CA  1 
ATOM   638  C C   . GLY A 1 82  ? 24.411  28.063  15.450  1.00 57.98 ? 82   GLY A C   1 
ATOM   639  O O   . GLY A 1 82  ? 24.460  26.836  15.400  1.00 57.64 ? 82   GLY A O   1 
ATOM   640  N N   . THR A 1 83  ? 25.495  28.832  15.447  1.00 57.14 ? 83   THR A N   1 
ATOM   641  C CA  . THR A 1 83  ? 26.828  28.257  15.486  1.00 56.43 ? 83   THR A CA  1 
ATOM   642  C C   . THR A 1 83  ? 27.356  28.106  16.926  1.00 55.92 ? 83   THR A C   1 
ATOM   643  O O   . THR A 1 83  ? 27.994  27.109  17.258  1.00 55.28 ? 83   THR A O   1 
ATOM   644  C CB  . THR A 1 83  ? 27.829  29.065  14.607  1.00 56.74 ? 83   THR A CB  1 
ATOM   645  O OG1 . THR A 1 83  ? 27.773  30.459  14.935  1.00 57.11 ? 83   THR A OG1 1 
ATOM   646  C CG2 . THR A 1 83  ? 27.518  28.860  13.115  1.00 55.93 ? 83   THR A CG2 1 
ATOM   647  N N   . GLU A 1 84  ? 27.052  29.074  17.784  1.00 55.85 ? 84   GLU A N   1 
ATOM   648  C CA  . GLU A 1 84  ? 27.697  29.156  19.088  1.00 56.07 ? 84   GLU A CA  1 
ATOM   649  C C   . GLU A 1 84  ? 27.165  28.169  20.110  1.00 53.88 ? 84   GLU A C   1 
ATOM   650  O O   . GLU A 1 84  ? 27.873  27.820  21.052  1.00 53.42 ? 84   GLU A O   1 
ATOM   651  C CB  . GLU A 1 84  ? 27.653  30.592  19.617  1.00 56.95 ? 84   GLU A CB  1 
ATOM   652  C CG  . GLU A 1 84  ? 28.751  31.439  18.976  1.00 59.70 ? 84   GLU A CG  1 
ATOM   653  C CD  . GLU A 1 84  ? 28.705  32.891  19.374  1.00 61.72 ? 84   GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 84  ? 28.002  33.219  20.360  1.00 68.54 ? 84   GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 84  ? 29.378  33.709  18.698  1.00 67.02 ? 84   GLU A OE2 1 
ATOM   656  N N   . MET A 1 85  ? 25.949  27.674  19.908  1.00 52.08 ? 85   MET A N   1 
ATOM   657  C CA  . MET A 1 85  ? 25.448  26.593  20.752  1.00 50.77 ? 85   MET A CA  1 
ATOM   658  C C   . MET A 1 85  ? 26.318  25.325  20.681  1.00 48.67 ? 85   MET A C   1 
ATOM   659  O O   . MET A 1 85  ? 26.261  24.509  21.582  1.00 47.91 ? 85   MET A O   1 
ATOM   660  C CB  . MET A 1 85  ? 23.994  26.267  20.431  1.00 50.54 ? 85   MET A CB  1 
ATOM   661  C CG  . MET A 1 85  ? 23.728  25.683  19.055  1.00 50.94 ? 85   MET A CG  1 
ATOM   662  S SD  . MET A 1 85  ? 21.965  25.247  18.841  1.00 51.92 ? 85   MET A SD  1 
ATOM   663  C CE  . MET A 1 85  ? 21.939  23.709  19.720  1.00 50.51 ? 85   MET A CE  1 
ATOM   664  N N   . TRP A 1 86  ? 27.124  25.178  19.629  1.00 47.08 ? 86   TRP A N   1 
ATOM   665  C CA  . TRP A 1 86  ? 27.987  24.018  19.476  1.00 46.10 ? 86   TRP A CA  1 
ATOM   666  C C   . TRP A 1 86  ? 29.428  24.235  19.962  1.00 46.07 ? 86   TRP A C   1 
ATOM   667  O O   . TRP A 1 86  ? 30.200  23.281  20.072  1.00 45.55 ? 86   TRP A O   1 
ATOM   668  C CB  . TRP A 1 86  ? 27.996  23.550  18.019  1.00 45.55 ? 86   TRP A CB  1 
ATOM   669  C CG  . TRP A 1 86  ? 26.631  23.370  17.440  1.00 45.13 ? 86   TRP A CG  1 
ATOM   670  C CD1 . TRP A 1 86  ? 26.067  24.123  16.475  1.00 45.41 ? 86   TRP A CD1 1 
ATOM   671  C CD2 . TRP A 1 86  ? 25.666  22.380  17.793  1.00 43.83 ? 86   TRP A CD2 1 
ATOM   672  N NE1 . TRP A 1 86  ? 24.802  23.676  16.198  1.00 45.66 ? 86   TRP A NE1 1 
ATOM   673  C CE2 . TRP A 1 86  ? 24.533  22.598  16.990  1.00 44.05 ? 86   TRP A CE2 1 
ATOM   674  C CE3 . TRP A 1 86  ? 25.647  21.331  18.712  1.00 45.05 ? 86   TRP A CE3 1 
ATOM   675  C CZ2 . TRP A 1 86  ? 23.388  21.811  17.076  1.00 44.70 ? 86   TRP A CZ2 1 
ATOM   676  C CZ3 . TRP A 1 86  ? 24.510  20.546  18.800  1.00 44.77 ? 86   TRP A CZ3 1 
ATOM   677  C CH2 . TRP A 1 86  ? 23.398  20.784  17.979  1.00 44.88 ? 86   TRP A CH2 1 
ATOM   678  N N   . ASN A 1 87  ? 29.784  25.477  20.249  1.00 46.68 ? 87   ASN A N   1 
ATOM   679  C CA  . ASN A 1 87  ? 31.142  25.822  20.682  1.00 47.35 ? 87   ASN A CA  1 
ATOM   680  C C   . ASN A 1 87  ? 31.429  25.447  22.143  1.00 47.20 ? 87   ASN A C   1 
ATOM   681  O O   . ASN A 1 87  ? 30.505  25.391  22.970  1.00 46.26 ? 87   ASN A O   1 
ATOM   682  C CB  . ASN A 1 87  ? 31.395  27.323  20.509  1.00 48.12 ? 87   ASN A CB  1 
ATOM   683  C CG  . ASN A 1 87  ? 31.721  27.715  19.067  1.00 49.85 ? 87   ASN A CG  1 
ATOM   684  O OD1 . ASN A 1 87  ? 32.165  26.896  18.255  1.00 53.98 ? 87   ASN A OD1 1 
ATOM   685  N ND2 . ASN A 1 87  ? 31.527  28.984  18.759  1.00 50.42 ? 87   ASN A ND2 1 
ATOM   686  N N   . PRO A 1 88  ? 32.723  25.247  22.478  1.00 47.42 ? 88   PRO A N   1 
ATOM   687  C CA  . PRO A 1 88  ? 33.096  24.886  23.856  1.00 47.28 ? 88   PRO A CA  1 
ATOM   688  C C   . PRO A 1 88  ? 32.499  25.857  24.856  1.00 47.22 ? 88   PRO A C   1 
ATOM   689  O O   . PRO A 1 88  ? 32.453  27.053  24.592  1.00 46.96 ? 88   PRO A O   1 
ATOM   690  C CB  . PRO A 1 88  ? 34.619  25.004  23.854  1.00 47.66 ? 88   PRO A CB  1 
ATOM   691  C CG  . PRO A 1 88  ? 35.013  24.775  22.445  1.00 47.82 ? 88   PRO A CG  1 
ATOM   692  C CD  . PRO A 1 88  ? 33.913  25.378  21.611  1.00 47.60 ? 88   PRO A CD  1 
ATOM   693  N N   . ASN A 1 89  ? 32.006  25.338  25.973  1.00 46.97 ? 89   ASN A N   1 
ATOM   694  C CA  . ASN A 1 89  ? 31.418  26.183  27.007  1.00 47.08 ? 89   ASN A CA  1 
ATOM   695  C C   . ASN A 1 89  ? 32.183  26.085  28.319  1.00 47.46 ? 89   ASN A C   1 
ATOM   696  O O   . ASN A 1 89  ? 31.708  26.561  29.338  1.00 47.66 ? 89   ASN A O   1 
ATOM   697  C CB  . ASN A 1 89  ? 29.928  25.841  27.203  1.00 46.98 ? 89   ASN A CB  1 
ATOM   698  C CG  . ASN A 1 89  ? 29.692  24.417  27.699  1.00 46.24 ? 89   ASN A CG  1 
ATOM   699  O OD1 . ASN A 1 89  ? 30.533  23.536  27.558  1.00 44.82 ? 89   ASN A OD1 1 
ATOM   700  N ND2 . ASN A 1 89  ? 28.529  24.195  28.281  1.00 48.98 ? 89   ASN A ND2 1 
ATOM   701  N N   . ARG A 1 90  ? 33.364  25.461  28.279  1.00 47.13 ? 90   ARG A N   1 
ATOM   702  C CA  . ARG A 1 90  ? 34.300  25.395  29.414  1.00 47.57 ? 90   ARG A CA  1 
ATOM   703  C C   . ARG A 1 90  ? 35.706  25.448  28.841  1.00 47.34 ? 90   ARG A C   1 
ATOM   704  O O   . ARG A 1 90  ? 35.892  25.277  27.637  1.00 46.96 ? 90   ARG A O   1 
ATOM   705  C CB  . ARG A 1 90  ? 34.142  24.089  30.210  1.00 47.60 ? 90   ARG A CB  1 
ATOM   706  C CG  . ARG A 1 90  ? 32.828  23.941  30.979  1.00 49.63 ? 90   ARG A CG  1 
ATOM   707  C CD  . ARG A 1 90  ? 32.806  24.813  32.229  1.00 54.00 ? 90   ARG A CD  1 
ATOM   708  N NE  . ARG A 1 90  ? 31.531  24.731  32.941  1.00 56.31 ? 90   ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 90  ? 30.420  25.379  32.586  1.00 57.37 ? 90   ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 90  ? 30.398  26.156  31.517  1.00 57.91 ? 90   ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 90  ? 29.307  25.231  33.295  1.00 58.26 ? 90   ARG A NH2 1 
ATOM   712  N N   . GLU A 1 91  ? 36.698  25.637  29.706  1.00 47.68 ? 91   GLU A N   1 
ATOM   713  C CA  . GLU A 1 91  ? 38.083  25.780  29.277  1.00 47.80 ? 91   GLU A CA  1 
ATOM   714  C C   . GLU A 1 91  ? 38.564  24.657  28.364  1.00 47.05 ? 91   GLU A C   1 
ATOM   715  O O   . GLU A 1 91  ? 38.285  23.479  28.607  1.00 46.42 ? 91   GLU A O   1 
ATOM   716  C CB  . GLU A 1 91  ? 38.986  25.837  30.502  1.00 48.44 ? 91   GLU A CB  1 
ATOM   717  C CG  . GLU A 1 91  ? 40.455  26.042  30.167  1.00 49.31 ? 91   GLU A CG  1 
ATOM   718  C CD  . GLU A 1 91  ? 41.335  26.148  31.402  1.00 51.09 ? 91   GLU A CD  1 
ATOM   719  O OE1 . GLU A 1 91  ? 40.806  26.490  32.480  1.00 52.32 ? 91   GLU A OE1 1 
ATOM   720  O OE2 . GLU A 1 91  ? 42.556  25.888  31.293  1.00 53.63 ? 91   GLU A OE2 1 
ATOM   721  N N   . LEU A 1 92  ? 39.276  25.027  27.304  1.00 47.20 ? 92   LEU A N   1 
ATOM   722  C CA  . LEU A 1 92  ? 39.937  24.048  26.433  1.00 46.82 ? 92   LEU A CA  1 
ATOM   723  C C   . LEU A 1 92  ? 41.233  23.605  27.066  1.00 47.07 ? 92   LEU A C   1 
ATOM   724  O O   . LEU A 1 92  ? 42.068  24.428  27.451  1.00 47.86 ? 92   LEU A O   1 
ATOM   725  C CB  . LEU A 1 92  ? 40.226  24.632  25.051  1.00 47.23 ? 92   LEU A CB  1 
ATOM   726  C CG  . LEU A 1 92  ? 39.017  25.102  24.242  1.00 47.21 ? 92   LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 92  ? 39.468  25.706  22.918  1.00 47.64 ? 92   LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 92  ? 38.099  23.941  23.994  1.00 48.29 ? 92   LEU A CD2 1 
ATOM   729  N N   . SER A 1 93  ? 41.387  22.294  27.189  1.00 46.75 ? 93   SER A N   1 
ATOM   730  C CA  . SER A 1 93  ? 42.586  21.698  27.756  1.00 46.71 ? 93   SER A CA  1 
ATOM   731  C C   . SER A 1 93  ? 42.732  20.280  27.220  1.00 46.39 ? 93   SER A C   1 
ATOM   732  O O   . SER A 1 93  ? 41.737  19.631  26.893  1.00 45.80 ? 93   SER A O   1 
ATOM   733  C CB  . SER A 1 93  ? 42.488  21.666  29.284  1.00 46.88 ? 93   SER A CB  1 
ATOM   734  O OG  . SER A 1 93  ? 43.599  20.993  29.859  1.00 46.97 ? 93   SER A OG  1 
ATOM   735  N N   . GLU A 1 94  ? 43.971  19.802  27.151  1.00 46.84 ? 94   GLU A N   1 
ATOM   736  C CA  . GLU A 1 94  ? 44.240  18.381  26.874  1.00 46.63 ? 94   GLU A CA  1 
ATOM   737  C C   . GLU A 1 94  ? 43.857  17.497  28.056  1.00 46.38 ? 94   GLU A C   1 
ATOM   738  O O   . GLU A 1 94  ? 43.637  16.299  27.890  1.00 46.42 ? 94   GLU A O   1 
ATOM   739  C CB  . GLU A 1 94  ? 45.717  18.164  26.541  1.00 47.35 ? 94   GLU A CB  1 
ATOM   740  C CG  . GLU A 1 94  ? 46.109  18.722  25.187  1.00 47.02 ? 94   GLU A CG  1 
ATOM   741  C CD  . GLU A 1 94  ? 47.536  18.384  24.820  1.00 48.11 ? 94   GLU A CD  1 
ATOM   742  O OE1 . GLU A 1 94  ? 47.788  17.233  24.382  1.00 46.68 ? 94   GLU A OE1 1 
ATOM   743  O OE2 . GLU A 1 94  ? 48.400  19.279  24.960  1.00 47.66 ? 94   GLU A OE2 1 
ATOM   744  N N   . ASP A 1 95  ? 43.800  18.089  29.246  1.00 46.40 ? 95   ASP A N   1 
ATOM   745  C CA  . ASP A 1 95  ? 43.294  17.408  30.434  1.00 46.23 ? 95   ASP A CA  1 
ATOM   746  C C   . ASP A 1 95  ? 41.779  17.547  30.417  1.00 44.92 ? 95   ASP A C   1 
ATOM   747  O O   . ASP A 1 95  ? 41.221  18.528  30.951  1.00 44.39 ? 95   ASP A O   1 
ATOM   748  C CB  . ASP A 1 95  ? 43.869  18.045  31.701  1.00 47.15 ? 95   ASP A CB  1 
ATOM   749  C CG  . ASP A 1 95  ? 43.291  17.447  32.977  1.00 48.77 ? 95   ASP A CG  1 
ATOM   750  O OD1 . ASP A 1 95  ? 42.559  16.431  32.929  1.00 49.42 ? 95   ASP A OD1 1 
ATOM   751  O OD2 . ASP A 1 95  ? 43.596  18.004  34.043  1.00 53.95 ? 95   ASP A OD2 1 
ATOM   752  N N   . CYS A 1 96  ? 41.128  16.574  29.784  1.00 43.60 ? 96   CYS A N   1 
ATOM   753  C CA  . CYS A 1 96  ? 39.714  16.698  29.441  1.00 43.04 ? 96   CYS A CA  1 
ATOM   754  C C   . CYS A 1 96  ? 38.900  15.404  29.540  1.00 42.08 ? 96   CYS A C   1 
ATOM   755  O O   . CYS A 1 96  ? 37.706  15.410  29.214  1.00 41.35 ? 96   CYS A O   1 
ATOM   756  C CB  . CYS A 1 96  ? 39.605  17.261  28.012  1.00 42.97 ? 96   CYS A CB  1 
ATOM   757  S SG  . CYS A 1 96  ? 40.143  16.073  26.727  1.00 43.31 ? 96   CYS A SG  1 
ATOM   758  N N   . LEU A 1 97  ? 39.516  14.328  30.035  1.00 42.07 ? 97   LEU A N   1 
ATOM   759  C CA  . LEU A 1 97  ? 38.899  13.007  30.021  1.00 41.56 ? 97   LEU A CA  1 
ATOM   760  C C   . LEU A 1 97  ? 38.063  12.792  31.281  1.00 41.29 ? 97   LEU A C   1 
ATOM   761  O O   . LEU A 1 97  ? 38.474  12.129  32.234  1.00 41.68 ? 97   LEU A O   1 
ATOM   762  C CB  . LEU A 1 97  ? 39.969  11.918  29.820  1.00 42.12 ? 97   LEU A CB  1 
ATOM   763  C CG  . LEU A 1 97  ? 40.649  11.949  28.438  1.00 41.54 ? 97   LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 97  ? 41.556  10.746  28.233  1.00 39.73 ? 97   LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 97  ? 39.583  12.019  27.336  1.00 41.00 ? 97   LEU A CD2 1 
ATOM   766  N N   . TYR A 1 98  ? 36.875  13.384  31.248  1.00 40.61 ? 98   TYR A N   1 
ATOM   767  C CA  . TYR A 1 98  ? 35.943  13.401  32.357  1.00 40.64 ? 98   TYR A CA  1 
ATOM   768  C C   . TYR A 1 98  ? 34.575  13.016  31.820  1.00 40.02 ? 98   TYR A C   1 
ATOM   769  O O   . TYR A 1 98  ? 34.278  13.294  30.659  1.00 39.31 ? 98   TYR A O   1 
ATOM   770  C CB  . TYR A 1 98  ? 35.894  14.810  32.978  1.00 41.20 ? 98   TYR A CB  1 
ATOM   771  C CG  . TYR A 1 98  ? 37.229  15.293  33.533  1.00 41.23 ? 98   TYR A CG  1 
ATOM   772  C CD1 . TYR A 1 98  ? 37.615  14.980  34.822  1.00 41.63 ? 98   TYR A CD1 1 
ATOM   773  C CD2 . TYR A 1 98  ? 38.097  16.058  32.758  1.00 42.14 ? 98   TYR A CD2 1 
ATOM   774  C CE1 . TYR A 1 98  ? 38.820  15.404  35.331  1.00 42.31 ? 98   TYR A CE1 1 
ATOM   775  C CE2 . TYR A 1 98  ? 39.309  16.494  33.253  1.00 41.39 ? 98   TYR A CE2 1 
ATOM   776  C CZ  . TYR A 1 98  ? 39.663  16.160  34.546  1.00 43.03 ? 98   TYR A CZ  1 
ATOM   777  O OH  . TYR A 1 98  ? 40.865  16.574  35.061  1.00 44.63 ? 98   TYR A OH  1 
ATOM   778  N N   . LEU A 1 99  ? 33.761  12.358  32.643  1.00 39.80 ? 99   LEU A N   1 
ATOM   779  C CA  . LEU A 1 99  ? 32.390  12.014  32.254  1.00 39.51 ? 99   LEU A CA  1 
ATOM   780  C C   . LEU A 1 99  ? 31.356  12.541  33.256  1.00 39.39 ? 99   LEU A C   1 
ATOM   781  O O   . LEU A 1 99  ? 31.711  12.988  34.342  1.00 40.21 ? 99   LEU A O   1 
ATOM   782  C CB  . LEU A 1 99  ? 32.232  10.498  32.047  1.00 39.41 ? 99   LEU A CB  1 
ATOM   783  C CG  . LEU A 1 99  ? 32.553  9.508   33.169  1.00 40.31 ? 99   LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 99  ? 31.439  9.443   34.218  1.00 39.51 ? 99   LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 99  ? 32.809  8.126   32.568  1.00 39.39 ? 99   LEU A CD2 1 
ATOM   786  N N   . ASN A 1 100 ? 30.090  12.477  32.849  1.00 38.63 ? 100  ASN A N   1 
ATOM   787  C CA  . ASN A 1 100 ? 28.947  13.043  33.568  1.00 39.02 ? 100  ASN A CA  1 
ATOM   788  C C   . ASN A 1 100 ? 27.834  12.003  33.735  1.00 38.56 ? 100  ASN A C   1 
ATOM   789  O O   . ASN A 1 100 ? 27.592  11.230  32.834  1.00 36.96 ? 100  ASN A O   1 
ATOM   790  C CB  . ASN A 1 100 ? 28.386  14.210  32.758  1.00 39.05 ? 100  ASN A CB  1 
ATOM   791  C CG  . ASN A 1 100 ? 29.447  15.231  32.397  1.00 40.50 ? 100  ASN A CG  1 
ATOM   792  O OD1 . ASN A 1 100 ? 30.100  15.800  33.289  1.00 41.01 ? 100  ASN A OD1 1 
ATOM   793  N ND2 . ASN A 1 100 ? 29.637  15.461  31.088  1.00 37.83 ? 100  ASN A ND2 1 
ATOM   794  N N   . VAL A 1 101 ? 27.169  12.008  34.886  1.00 39.52 ? 101  VAL A N   1 
ATOM   795  C CA  . VAL A 1 101 ? 26.054  11.101  35.167  1.00 40.46 ? 101  VAL A CA  1 
ATOM   796  C C   . VAL A 1 101 ? 24.865  11.893  35.709  1.00 41.47 ? 101  VAL A C   1 
ATOM   797  O O   . VAL A 1 101 ? 25.005  12.635  36.656  1.00 42.27 ? 101  VAL A O   1 
ATOM   798  C CB  . VAL A 1 101 ? 26.437  10.044  36.224  1.00 40.94 ? 101  VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 101 ? 25.247  9.130   36.530  1.00 39.66 ? 101  VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 101 ? 27.667  9.248   35.778  1.00 40.51 ? 101  VAL A CG2 1 
ATOM   801  N N   . TRP A 1 102 ? 23.699  11.729  35.103  1.00 42.40 ? 102  TRP A N   1 
ATOM   802  C CA  . TRP A 1 102 ? 22.452  12.244  35.669  1.00 43.49 ? 102  TRP A CA  1 
ATOM   803  C C   . TRP A 1 102 ? 21.586  11.061  36.055  1.00 44.30 ? 102  TRP A C   1 
ATOM   804  O O   . TRP A 1 102 ? 21.524  10.056  35.333  1.00 43.77 ? 102  TRP A O   1 
ATOM   805  C CB  . TRP A 1 102 ? 21.665  13.065  34.655  1.00 43.74 ? 102  TRP A CB  1 
ATOM   806  C CG  . TRP A 1 102 ? 22.215  14.405  34.328  1.00 43.74 ? 102  TRP A CG  1 
ATOM   807  C CD1 . TRP A 1 102 ? 21.847  15.607  34.884  1.00 44.54 ? 102  TRP A CD1 1 
ATOM   808  C CD2 . TRP A 1 102 ? 23.186  14.705  33.330  1.00 42.47 ? 102  TRP A CD2 1 
ATOM   809  N NE1 . TRP A 1 102 ? 22.547  16.633  34.291  1.00 44.78 ? 102  TRP A NE1 1 
ATOM   810  C CE2 . TRP A 1 102 ? 23.378  16.106  33.337  1.00 43.86 ? 102  TRP A CE2 1 
ATOM   811  C CE3 . TRP A 1 102 ? 23.906  13.929  32.420  1.00 43.23 ? 102  TRP A CE3 1 
ATOM   812  C CZ2 . TRP A 1 102 ? 24.269  16.746  32.470  1.00 43.57 ? 102  TRP A CZ2 1 
ATOM   813  C CZ3 . TRP A 1 102 ? 24.793  14.560  31.564  1.00 43.06 ? 102  TRP A CZ3 1 
ATOM   814  C CH2 . TRP A 1 102 ? 24.974  15.956  31.600  1.00 43.54 ? 102  TRP A CH2 1 
ATOM   815  N N   . THR A 1 103 ? 20.904  11.199  37.185  1.00 45.13 ? 103  THR A N   1 
ATOM   816  C CA  . THR A 1 103 ? 20.008  10.179  37.669  1.00 45.99 ? 103  THR A CA  1 
ATOM   817  C C   . THR A 1 103 ? 18.859  10.871  38.374  1.00 46.64 ? 103  THR A C   1 
ATOM   818  O O   . THR A 1 103 ? 18.961  12.053  38.717  1.00 46.76 ? 103  THR A O   1 
ATOM   819  C CB  . THR A 1 103 ? 20.713  9.234   38.663  1.00 46.43 ? 103  THR A CB  1 
ATOM   820  O OG1 . THR A 1 103 ? 20.844  9.881   39.932  1.00 48.56 ? 103  THR A OG1 1 
ATOM   821  C CG2 . THR A 1 103 ? 22.080  8.841   38.167  1.00 45.95 ? 103  THR A CG2 1 
ATOM   822  N N   . PRO A 1 104 ? 17.748  10.152  38.576  1.00 47.34 ? 104  PRO A N   1 
ATOM   823  C CA  . PRO A 1 104 ? 16.693  10.646  39.455  1.00 48.26 ? 104  PRO A CA  1 
ATOM   824  C C   . PRO A 1 104 ? 17.191  11.039  40.844  1.00 48.90 ? 104  PRO A C   1 
ATOM   825  O O   . PRO A 1 104 ? 18.269  10.621  41.264  1.00 48.89 ? 104  PRO A O   1 
ATOM   826  C CB  . PRO A 1 104 ? 15.733  9.445   39.554  1.00 48.66 ? 104  PRO A CB  1 
ATOM   827  C CG  . PRO A 1 104 ? 15.915  8.735   38.266  1.00 48.09 ? 104  PRO A CG  1 
ATOM   828  C CD  . PRO A 1 104 ? 17.380  8.873   37.940  1.00 47.26 ? 104  PRO A CD  1 
ATOM   829  N N   . TYR A 1 105 ? 16.385  11.834  41.536  1.00 50.10 ? 105  TYR A N   1 
ATOM   830  C CA  . TYR A 1 105 ? 16.649  12.252  42.909  1.00 51.26 ? 105  TYR A CA  1 
ATOM   831  C C   . TYR A 1 105 ? 15.379  12.014  43.712  1.00 52.97 ? 105  TYR A C   1 
ATOM   832  O O   . TYR A 1 105 ? 14.335  12.579  43.377  1.00 53.32 ? 105  TYR A O   1 
ATOM   833  C CB  . TYR A 1 105 ? 17.023  13.729  42.962  1.00 51.13 ? 105  TYR A CB  1 
ATOM   834  C CG  . TYR A 1 105 ? 17.358  14.251  44.346  1.00 51.62 ? 105  TYR A CG  1 
ATOM   835  C CD1 . TYR A 1 105 ? 18.673  14.462  44.722  1.00 51.76 ? 105  TYR A CD1 1 
ATOM   836  C CD2 . TYR A 1 105 ? 16.353  14.557  45.274  1.00 52.84 ? 105  TYR A CD2 1 
ATOM   837  C CE1 . TYR A 1 105 ? 18.993  14.947  45.991  1.00 52.39 ? 105  TYR A CE1 1 
ATOM   838  C CE2 . TYR A 1 105 ? 16.665  15.039  46.549  1.00 52.53 ? 105  TYR A CE2 1 
ATOM   839  C CZ  . TYR A 1 105 ? 17.988  15.229  46.893  1.00 52.73 ? 105  TYR A CZ  1 
ATOM   840  O OH  . TYR A 1 105 ? 18.326  15.712  48.130  1.00 53.62 ? 105  TYR A OH  1 
ATOM   841  N N   . PRO A 1 106 ? 15.449  11.165  44.758  1.00 54.54 ? 106  PRO A N   1 
ATOM   842  C CA  . PRO A 1 106 ? 16.613  10.357  45.136  1.00 54.84 ? 106  PRO A CA  1 
ATOM   843  C C   . PRO A 1 106 ? 16.950  9.301   44.089  1.00 54.96 ? 106  PRO A C   1 
ATOM   844  O O   . PRO A 1 106 ? 16.110  8.970   43.252  1.00 54.62 ? 106  PRO A O   1 
ATOM   845  C CB  . PRO A 1 106 ? 16.187  9.709   46.462  1.00 55.74 ? 106  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 106 ? 14.734  9.779   46.489  1.00 56.40 ? 106  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 106 ? 14.327  10.973  45.690  1.00 55.66 ? 106  PRO A CD  1 
ATOM   848  N N   . ARG A 1 107 ? 18.176  8.787   44.141  1.00 55.80 ? 107  ARG A N   1 
ATOM   849  C CA  . ARG A 1 107 ? 18.634  7.779   43.181  1.00 56.18 ? 107  ARG A CA  1 
ATOM   850  C C   . ARG A 1 107 ? 17.707  6.580   43.177  1.00 57.62 ? 107  ARG A C   1 
ATOM   851  O O   . ARG A 1 107 ? 17.144  6.239   44.214  1.00 58.80 ? 107  ARG A O   1 
ATOM   852  C CB  . ARG A 1 107 ? 20.062  7.335   43.489  1.00 55.73 ? 107  ARG A CB  1 
ATOM   853  C CG  . ARG A 1 107 ? 21.076  8.461   43.316  1.00 55.93 ? 107  ARG A CG  1 
ATOM   854  C CD  . ARG A 1 107 ? 22.492  7.961   43.221  1.00 55.40 ? 107  ARG A CD  1 
ATOM   855  N NE  . ARG A 1 107 ? 22.915  7.228   44.413  1.00 55.94 ? 107  ARG A NE  1 
ATOM   856  C CZ  . ARG A 1 107 ? 23.302  7.786   45.555  1.00 56.84 ? 107  ARG A CZ  1 
ATOM   857  N NH1 . ARG A 1 107 ? 23.324  9.108   45.698  1.00 58.50 ? 107  ARG A NH1 1 
ATOM   858  N NH2 . ARG A 1 107 ? 23.668  7.012   46.567  1.00 57.58 ? 107  ARG A NH2 1 
ATOM   859  N N   . PRO A 1 108 ? 17.538  5.936   42.010  1.00 58.35 ? 108  PRO A N   1 
ATOM   860  C CA  . PRO A 1 108 ? 16.648  4.773   41.912  1.00 59.66 ? 108  PRO A CA  1 
ATOM   861  C C   . PRO A 1 108 ? 17.052  3.637   42.856  1.00 60.71 ? 108  PRO A C   1 
ATOM   862  O O   . PRO A 1 108 ? 18.236  3.388   43.048  1.00 60.66 ? 108  PRO A O   1 
ATOM   863  C CB  . PRO A 1 108 ? 16.805  4.319   40.457  1.00 58.85 ? 108  PRO A CB  1 
ATOM   864  C CG  . PRO A 1 108 ? 17.373  5.478   39.739  1.00 58.52 ? 108  PRO A CG  1 
ATOM   865  C CD  . PRO A 1 108 ? 18.174  6.259   40.723  1.00 57.52 ? 108  PRO A CD  1 
ATOM   866  N N   . ALA A 1 109 ? 16.071  2.957   43.431  1.00 62.46 ? 109  ALA A N   1 
ATOM   867  C CA  . ALA A 1 109 ? 16.339  1.851   44.363  1.00 63.85 ? 109  ALA A CA  1 
ATOM   868  C C   . ALA A 1 109 ? 16.521  0.508   43.633  1.00 64.12 ? 109  ALA A C   1 
ATOM   869  O O   . ALA A 1 109 ? 17.103  -0.418  44.188  1.00 65.19 ? 109  ALA A O   1 
ATOM   870  C CB  . ALA A 1 109 ? 15.220  1.751   45.398  1.00 64.92 ? 109  ALA A CB  1 
ATOM   871  N N   . SER A 1 110 ? 16.019  0.411   42.401  1.00 63.73 ? 110  SER A N   1 
ATOM   872  C CA  . SER A 1 110 ? 16.183  -0.785  41.578  1.00 63.34 ? 110  SER A CA  1 
ATOM   873  C C   . SER A 1 110 ? 16.946  -0.441  40.287  1.00 61.68 ? 110  SER A C   1 
ATOM   874  O O   . SER A 1 110 ? 16.835  0.681   39.798  1.00 61.37 ? 110  SER A O   1 
ATOM   875  C CB  . SER A 1 110 ? 14.814  -1.397  41.256  1.00 64.55 ? 110  SER A CB  1 
ATOM   876  O OG  . SER A 1 110 ? 14.088  -0.560  40.380  1.00 65.35 ? 110  SER A OG  1 
ATOM   877  N N   . PRO A 1 111 ? 17.734  -1.402  39.748  1.00 60.71 ? 111  PRO A N   1 
ATOM   878  C CA  . PRO A 1 111 ? 18.589  -1.195  38.560  1.00 59.25 ? 111  PRO A CA  1 
ATOM   879  C C   . PRO A 1 111 ? 17.856  -0.583  37.360  1.00 57.74 ? 111  PRO A C   1 
ATOM   880  O O   . PRO A 1 111 ? 16.928  -1.190  36.826  1.00 58.57 ? 111  PRO A O   1 
ATOM   881  C CB  . PRO A 1 111 ? 19.080  -2.607  38.216  1.00 59.56 ? 111  PRO A CB  1 
ATOM   882  C CG  . PRO A 1 111 ? 18.928  -3.402  39.450  1.00 60.76 ? 111  PRO A CG  1 
ATOM   883  C CD  . PRO A 1 111 ? 17.862  -2.771  40.290  1.00 61.38 ? 111  PRO A CD  1 
ATOM   884  N N   . THR A 1 112 ? 18.290  0.607   36.947  1.00 55.46 ? 112  THR A N   1 
ATOM   885  C CA  . THR A 1 112 ? 17.646  1.364   35.895  1.00 53.75 ? 112  THR A CA  1 
ATOM   886  C C   . THR A 1 112 ? 18.483  1.308   34.610  1.00 52.66 ? 112  THR A C   1 
ATOM   887  O O   . THR A 1 112 ? 19.698  1.530   34.661  1.00 52.03 ? 112  THR A O   1 
ATOM   888  C CB  . THR A 1 112 ? 17.516  2.843   36.328  1.00 53.55 ? 112  THR A CB  1 
ATOM   889  O OG1 . THR A 1 112 ? 16.833  2.916   37.579  1.00 54.25 ? 112  THR A OG1 1 
ATOM   890  C CG2 . THR A 1 112 ? 16.778  3.672   35.292  1.00 53.20 ? 112  THR A CG2 1 
ATOM   891  N N   . PRO A 1 113 ? 17.836  1.042   33.456  1.00 51.72 ? 113  PRO A N   1 
ATOM   892  C CA  . PRO A 1 113 ? 18.491  1.110   32.155  1.00 50.87 ? 113  PRO A CA  1 
ATOM   893  C C   . PRO A 1 113 ? 19.323  2.391   31.955  1.00 48.95 ? 113  PRO A C   1 
ATOM   894  O O   . PRO A 1 113 ? 18.899  3.486   32.327  1.00 48.18 ? 113  PRO A O   1 
ATOM   895  C CB  . PRO A 1 113 ? 17.313  1.076   31.173  1.00 51.06 ? 113  PRO A CB  1 
ATOM   896  C CG  . PRO A 1 113 ? 16.302  0.237   31.875  1.00 52.46 ? 113  PRO A CG  1 
ATOM   897  C CD  . PRO A 1 113 ? 16.419  0.657   33.318  1.00 52.59 ? 113  PRO A CD  1 
ATOM   898  N N   . VAL A 1 114 ? 20.502  2.225   31.365  1.00 47.46 ? 114  VAL A N   1 
ATOM   899  C CA  . VAL A 1 114 ? 21.449  3.315   31.189  1.00 46.02 ? 114  VAL A CA  1 
ATOM   900  C C   . VAL A 1 114 ? 21.498  3.771   29.733  1.00 45.43 ? 114  VAL A C   1 
ATOM   901  O O   . VAL A 1 114 ? 21.561  2.941   28.840  1.00 45.35 ? 114  VAL A O   1 
ATOM   902  C CB  . VAL A 1 114 ? 22.851  2.881   31.621  1.00 45.49 ? 114  VAL A CB  1 
ATOM   903  C CG1 . VAL A 1 114 ? 23.857  4.027   31.413  1.00 43.73 ? 114  VAL A CG1 1 
ATOM   904  C CG2 . VAL A 1 114 ? 22.818  2.397   33.080  1.00 44.73 ? 114  VAL A CG2 1 
ATOM   905  N N   . LEU A 1 115 ? 21.463  5.087   29.518  1.00 44.73 ? 115  LEU A N   1 
ATOM   906  C CA  . LEU A 1 115 ? 21.704  5.680   28.205  1.00 44.38 ? 115  LEU A CA  1 
ATOM   907  C C   . LEU A 1 115 ? 23.064  6.387   28.196  1.00 43.49 ? 115  LEU A C   1 
ATOM   908  O O   . LEU A 1 115 ? 23.343  7.175   29.076  1.00 44.07 ? 115  LEU A O   1 
ATOM   909  C CB  . LEU A 1 115 ? 20.613  6.682   27.861  1.00 44.52 ? 115  LEU A CB  1 
ATOM   910  C CG  . LEU A 1 115 ? 19.317  6.208   27.197  1.00 47.76 ? 115  LEU A CG  1 
ATOM   911  C CD1 . LEU A 1 115 ? 18.230  7.260   27.313  1.00 49.70 ? 115  LEU A CD1 1 
ATOM   912  C CD2 . LEU A 1 115 ? 19.558  5.913   25.710  1.00 51.14 ? 115  LEU A CD2 1 
ATOM   913  N N   . ILE A 1 116 ? 23.909  6.092   27.213  1.00 42.68 ? 116  ILE A N   1 
ATOM   914  C CA  . ILE A 1 116 ? 25.200  6.731   27.107  1.00 42.19 ? 116  ILE A CA  1 
ATOM   915  C C   . ILE A 1 116 ? 25.280  7.540   25.813  1.00 41.59 ? 116  ILE A C   1 
ATOM   916  O O   . ILE A 1 116 ? 25.212  6.971   24.713  1.00 40.85 ? 116  ILE A O   1 
ATOM   917  C CB  . ILE A 1 116 ? 26.363  5.734   27.134  1.00 42.79 ? 116  ILE A CB  1 
ATOM   918  C CG1 . ILE A 1 116 ? 26.329  4.871   28.403  1.00 43.11 ? 116  ILE A CG1 1 
ATOM   919  C CG2 . ILE A 1 116 ? 27.683  6.485   27.032  1.00 41.67 ? 116  ILE A CG2 1 
ATOM   920  C CD1 . ILE A 1 116 ? 27.467  3.836   28.480  1.00 42.56 ? 116  ILE A CD1 1 
ATOM   921  N N   . TRP A 1 117 ? 25.421  8.860   25.978  1.00 40.76 ? 117  TRP A N   1 
ATOM   922  C CA  . TRP A 1 117 ? 25.543  9.808   24.882  1.00 40.61 ? 117  TRP A CA  1 
ATOM   923  C C   . TRP A 1 117 ? 26.968  10.015  24.431  1.00 40.53 ? 117  TRP A C   1 
ATOM   924  O O   . TRP A 1 117 ? 27.848  10.311  25.257  1.00 41.06 ? 117  TRP A O   1 
ATOM   925  C CB  . TRP A 1 117 ? 25.018  11.175  25.309  1.00 40.61 ? 117  TRP A CB  1 
ATOM   926  C CG  . TRP A 1 117 ? 25.131  12.237  24.250  1.00 40.06 ? 117  TRP A CG  1 
ATOM   927  C CD1 . TRP A 1 117 ? 25.926  13.342  24.285  1.00 40.76 ? 117  TRP A CD1 1 
ATOM   928  C CD2 . TRP A 1 117 ? 24.418  12.296  23.013  1.00 39.01 ? 117  TRP A CD2 1 
ATOM   929  N NE1 . TRP A 1 117 ? 25.745  14.086  23.150  1.00 40.90 ? 117  TRP A NE1 1 
ATOM   930  C CE2 . TRP A 1 117 ? 24.815  13.468  22.359  1.00 39.64 ? 117  TRP A CE2 1 
ATOM   931  C CE3 . TRP A 1 117 ? 23.452  11.485  22.415  1.00 40.12 ? 117  TRP A CE3 1 
ATOM   932  C CZ2 . TRP A 1 117 ? 24.293  13.848  21.122  1.00 40.66 ? 117  TRP A CZ2 1 
ATOM   933  C CZ3 . TRP A 1 117 ? 22.940  11.852  21.196  1.00 40.22 ? 117  TRP A CZ3 1 
ATOM   934  C CH2 . TRP A 1 117 ? 23.366  13.021  20.555  1.00 40.31 ? 117  TRP A CH2 1 
ATOM   935  N N   . ILE A 1 118 ? 27.171  9.922   23.116  1.00 40.12 ? 118  ILE A N   1 
ATOM   936  C CA  . ILE A 1 118 ? 28.435  10.257  22.469  1.00 39.68 ? 118  ILE A CA  1 
ATOM   937  C C   . ILE A 1 118 ? 28.216  11.406  21.487  1.00 39.83 ? 118  ILE A C   1 
ATOM   938  O O   . ILE A 1 118 ? 27.524  11.239  20.473  1.00 39.31 ? 118  ILE A O   1 
ATOM   939  C CB  . ILE A 1 118 ? 29.039  9.045   21.708  1.00 39.98 ? 118  ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 118 ? 29.039  7.796   22.609  1.00 40.02 ? 118  ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 118 ? 30.457  9.392   21.206  1.00 39.92 ? 118  ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 118 ? 29.795  6.569   22.033  1.00 40.47 ? 118  ILE A CD1 1 
ATOM   943  N N   . TYR A 1 119 ? 28.807  12.567  21.792  1.00 39.21 ? 119  TYR A N   1 
ATOM   944  C CA  . TYR A 1 119 ? 28.621  13.756  20.973  1.00 39.47 ? 119  TYR A CA  1 
ATOM   945  C C   . TYR A 1 119 ? 29.285  13.655  19.607  1.00 39.34 ? 119  TYR A C   1 
ATOM   946  O O   . TYR A 1 119 ? 30.221  12.865  19.410  1.00 39.34 ? 119  TYR A O   1 
ATOM   947  C CB  . TYR A 1 119 ? 29.118  15.023  21.679  1.00 39.72 ? 119  TYR A CB  1 
ATOM   948  C CG  . TYR A 1 119 ? 30.573  15.043  22.090  1.00 39.50 ? 119  TYR A CG  1 
ATOM   949  C CD1 . TYR A 1 119 ? 31.589  15.301  21.163  1.00 40.83 ? 119  TYR A CD1 1 
ATOM   950  C CD2 . TYR A 1 119 ? 30.939  14.883  23.425  1.00 40.17 ? 119  TYR A CD2 1 
ATOM   951  C CE1 . TYR A 1 119 ? 32.939  15.359  21.559  1.00 39.74 ? 119  TYR A CE1 1 
ATOM   952  C CE2 . TYR A 1 119 ? 32.276  14.929  23.826  1.00 39.54 ? 119  TYR A CE2 1 
ATOM   953  C CZ  . TYR A 1 119 ? 33.271  15.166  22.898  1.00 40.64 ? 119  TYR A CZ  1 
ATOM   954  O OH  . TYR A 1 119 ? 34.601  15.208  23.303  1.00 40.77 ? 119  TYR A OH  1 
ATOM   955  N N   . GLY A 1 120 ? 28.764  14.459  18.682  1.00 38.63 ? 120  GLY A N   1 
ATOM   956  C CA  . GLY A 1 120 ? 29.317  14.632  17.352  1.00 39.10 ? 120  GLY A CA  1 
ATOM   957  C C   . GLY A 1 120 ? 30.077  15.958  17.250  1.00 39.58 ? 120  GLY A C   1 
ATOM   958  O O   . GLY A 1 120 ? 30.326  16.633  18.263  1.00 40.80 ? 120  GLY A O   1 
ATOM   959  N N   . GLY A 1 121 ? 30.417  16.347  16.029  1.00 39.54 ? 121  GLY A N   1 
ATOM   960  C CA  . GLY A 1 121 ? 31.351  17.472  15.789  1.00 40.07 ? 121  GLY A CA  1 
ATOM   961  C C   . GLY A 1 121 ? 32.524  17.097  14.889  1.00 39.85 ? 121  GLY A C   1 
ATOM   962  O O   . GLY A 1 121 ? 33.619  17.667  15.002  1.00 40.32 ? 121  GLY A O   1 
ATOM   963  N N   . GLY A 1 122 ? 32.280  16.136  14.001  1.00 39.37 ? 122  GLY A N   1 
ATOM   964  C CA  . GLY A 1 122 ? 33.200  15.750  12.944  1.00 39.46 ? 122  GLY A CA  1 
ATOM   965  C C   . GLY A 1 122 ? 34.497  15.125  13.394  1.00 39.55 ? 122  GLY A C   1 
ATOM   966  O O   . GLY A 1 122 ? 35.455  15.091  12.614  1.00 41.17 ? 122  GLY A O   1 
ATOM   967  N N   . PHE A 1 123 ? 34.540  14.665  14.646  1.00 39.03 ? 123  PHE A N   1 
ATOM   968  C CA  . PHE A 1 123 ? 35.746  14.141  15.283  1.00 38.75 ? 123  PHE A CA  1 
ATOM   969  C C   . PHE A 1 123 ? 36.798  15.235  15.533  1.00 39.08 ? 123  PHE A C   1 
ATOM   970  O O   . PHE A 1 123 ? 37.923  14.917  15.919  1.00 38.71 ? 123  PHE A O   1 
ATOM   971  C CB  . PHE A 1 123 ? 36.345  12.988  14.469  1.00 39.18 ? 123  PHE A CB  1 
ATOM   972  C CG  . PHE A 1 123 ? 35.490  11.753  14.427  1.00 37.82 ? 123  PHE A CG  1 
ATOM   973  C CD1 . PHE A 1 123 ? 35.332  10.976  15.559  1.00 39.19 ? 123  PHE A CD1 1 
ATOM   974  C CD2 . PHE A 1 123 ? 34.870  11.348  13.245  1.00 38.89 ? 123  PHE A CD2 1 
ATOM   975  C CE1 . PHE A 1 123 ? 34.546  9.813   15.537  1.00 38.09 ? 123  PHE A CE1 1 
ATOM   976  C CE2 . PHE A 1 123 ? 34.075  10.180  13.200  1.00 37.46 ? 123  PHE A CE2 1 
ATOM   977  C CZ  . PHE A 1 123 ? 33.918  9.419   14.349  1.00 38.89 ? 123  PHE A CZ  1 
ATOM   978  N N   . TYR A 1 124 ? 36.429  16.512  15.326  1.00 38.61 ? 124  TYR A N   1 
ATOM   979  C CA  . TYR A 1 124 ? 37.329  17.656  15.587  1.00 39.27 ? 124  TYR A CA  1 
ATOM   980  C C   . TYR A 1 124 ? 36.782  18.605  16.671  1.00 38.90 ? 124  TYR A C   1 
ATOM   981  O O   . TYR A 1 124 ? 37.446  19.560  17.060  1.00 38.17 ? 124  TYR A O   1 
ATOM   982  C CB  . TYR A 1 124 ? 37.606  18.453  14.286  1.00 40.39 ? 124  TYR A CB  1 
ATOM   983  C CG  . TYR A 1 124 ? 36.441  19.316  13.826  1.00 40.18 ? 124  TYR A CG  1 
ATOM   984  C CD1 . TYR A 1 124 ? 36.266  20.612  14.311  1.00 42.24 ? 124  TYR A CD1 1 
ATOM   985  C CD2 . TYR A 1 124 ? 35.507  18.825  12.930  1.00 42.55 ? 124  TYR A CD2 1 
ATOM   986  C CE1 . TYR A 1 124 ? 35.184  21.392  13.919  1.00 41.74 ? 124  TYR A CE1 1 
ATOM   987  C CE2 . TYR A 1 124 ? 34.430  19.595  12.521  1.00 42.49 ? 124  TYR A CE2 1 
ATOM   988  C CZ  . TYR A 1 124 ? 34.267  20.871  13.032  1.00 41.75 ? 124  TYR A CZ  1 
ATOM   989  O OH  . TYR A 1 124 ? 33.193  21.622  12.617  1.00 42.22 ? 124  TYR A OH  1 
ATOM   990  N N   . SER A 1 125 ? 35.573  18.334  17.162  1.00 38.25 ? 125  SER A N   1 
ATOM   991  C CA  . SER A 1 125 ? 34.924  19.220  18.095  1.00 37.72 ? 125  SER A CA  1 
ATOM   992  C C   . SER A 1 125 ? 33.871  18.513  18.918  1.00 37.88 ? 125  SER A C   1 
ATOM   993  O O   . SER A 1 125 ? 33.517  17.335  18.657  1.00 36.81 ? 125  SER A O   1 
ATOM   994  C CB  . SER A 1 125 ? 34.270  20.375  17.332  1.00 38.33 ? 125  SER A CB  1 
ATOM   995  O OG  . SER A 1 125 ? 33.305  19.910  16.401  1.00 37.56 ? 125  SER A OG  1 
ATOM   996  N N   . GLY A 1 126 ? 33.364  19.255  19.898  1.00 37.91 ? 126  GLY A N   1 
ATOM   997  C CA  . GLY A 1 126 ? 32.273  18.798  20.745  1.00 38.94 ? 126  GLY A CA  1 
ATOM   998  C C   . GLY A 1 126 ? 32.621  18.771  22.218  1.00 39.30 ? 126  GLY A C   1 
ATOM   999  O O   . GLY A 1 126 ? 33.783  18.870  22.603  1.00 40.03 ? 126  GLY A O   1 
ATOM   1000 N N   . ALA A 1 127 ? 31.588  18.621  23.031  1.00 40.11 ? 127  ALA A N   1 
ATOM   1001 C CA  . ALA A 1 127 ? 31.719  18.503  24.482  1.00 40.51 ? 127  ALA A CA  1 
ATOM   1002 C C   . ALA A 1 127 ? 30.431  17.928  25.060  1.00 40.78 ? 127  ALA A C   1 
ATOM   1003 O O   . ALA A 1 127 ? 29.335  18.243  24.585  1.00 39.72 ? 127  ALA A O   1 
ATOM   1004 C CB  . ALA A 1 127 ? 31.991  19.835  25.092  1.00 40.22 ? 127  ALA A CB  1 
ATOM   1005 N N   . ALA A 1 128 ? 30.575  17.119  26.108  1.00 41.18 ? 128  ALA A N   1 
ATOM   1006 C CA  . ALA A 1 128 ? 29.434  16.578  26.833  1.00 41.74 ? 128  ALA A CA  1 
ATOM   1007 C C   . ALA A 1 128 ? 28.744  17.631  27.707  1.00 42.39 ? 128  ALA A C   1 
ATOM   1008 O O   . ALA A 1 128 ? 27.626  17.412  28.213  1.00 43.02 ? 128  ALA A O   1 
ATOM   1009 C CB  . ALA A 1 128 ? 29.868  15.365  27.663  1.00 41.79 ? 128  ALA A CB  1 
ATOM   1010 N N   . SER A 1 129 ? 29.380  18.791  27.856  1.00 42.82 ? 129  SER A N   1 
ATOM   1011 C CA  . SER A 1 129 ? 28.859  19.843  28.725  1.00 42.92 ? 129  SER A CA  1 
ATOM   1012 C C   . SER A 1 129 ? 27.907  20.822  28.025  1.00 43.06 ? 129  SER A C   1 
ATOM   1013 O O   . SER A 1 129 ? 27.392  21.743  28.649  1.00 44.19 ? 129  SER A O   1 
ATOM   1014 C CB  . SER A 1 129 ? 30.030  20.584  29.350  1.00 43.29 ? 129  SER A CB  1 
ATOM   1015 O OG  . SER A 1 129 ? 30.868  21.177  28.359  1.00 43.40 ? 129  SER A OG  1 
ATOM   1016 N N   . LEU A 1 130 ? 27.673  20.655  26.729  1.00 43.08 ? 130  LEU A N   1 
ATOM   1017 C CA  . LEU A 1 130 ? 26.797  21.589  25.995  1.00 42.90 ? 130  LEU A CA  1 
ATOM   1018 C C   . LEU A 1 130 ? 25.356  21.493  26.488  1.00 43.43 ? 130  LEU A C   1 
ATOM   1019 O O   . LEU A 1 130 ? 24.888  20.416  26.882  1.00 43.09 ? 130  LEU A O   1 
ATOM   1020 C CB  . LEU A 1 130 ? 26.846  21.311  24.488  1.00 42.43 ? 130  LEU A CB  1 
ATOM   1021 C CG  . LEU A 1 130 ? 28.205  21.394  23.788  1.00 42.69 ? 130  LEU A CG  1 
ATOM   1022 C CD1 . LEU A 1 130 ? 28.007  21.222  22.298  1.00 42.43 ? 130  LEU A CD1 1 
ATOM   1023 C CD2 . LEU A 1 130 ? 28.908  22.729  24.099  1.00 42.33 ? 130  LEU A CD2 1 
ATOM   1024 N N   . ASP A 1 131 ? 24.646  22.619  26.449  1.00 44.66 ? 131  ASP A N   1 
ATOM   1025 C CA  . ASP A 1 131 ? 23.294  22.699  27.006  1.00 45.49 ? 131  ASP A CA  1 
ATOM   1026 C C   . ASP A 1 131 ? 22.312  21.729  26.330  1.00 44.93 ? 131  ASP A C   1 
ATOM   1027 O O   . ASP A 1 131 ? 21.386  21.257  26.977  1.00 44.48 ? 131  ASP A O   1 
ATOM   1028 C CB  . ASP A 1 131 ? 22.732  24.123  26.910  1.00 46.33 ? 131  ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 131 ? 23.361  25.092  27.909  1.00 48.58 ? 131  ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 131 ? 24.065  24.672  28.856  1.00 50.48 ? 131  ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 131 ? 23.103  26.305  27.764  1.00 51.69 ? 131  ASP A OD2 1 
ATOM   1032 N N   . VAL A 1 132 ? 22.507  21.443  25.047  1.00 44.33 ? 132  VAL A N   1 
ATOM   1033 C CA  . VAL A 1 132 ? 21.571  20.575  24.327  1.00 44.20 ? 132  VAL A CA  1 
ATOM   1034 C C   . VAL A 1 132 ? 21.740  19.104  24.674  1.00 43.19 ? 132  VAL A C   1 
ATOM   1035 O O   . VAL A 1 132 ? 20.882  18.295  24.318  1.00 43.00 ? 132  VAL A O   1 
ATOM   1036 C CB  . VAL A 1 132 ? 21.648  20.739  22.789  1.00 44.39 ? 132  VAL A CB  1 
ATOM   1037 C CG1 . VAL A 1 132 ? 20.906  22.005  22.364  1.00 47.19 ? 132  VAL A CG1 1 
ATOM   1038 C CG2 . VAL A 1 132 ? 23.093  20.742  22.300  1.00 44.35 ? 132  VAL A CG2 1 
ATOM   1039 N N   . TYR A 1 133 ? 22.829  18.768  25.369  1.00 42.29 ? 133  TYR A N   1 
ATOM   1040 C CA  . TYR A 1 133 ? 23.066  17.414  25.850  1.00 41.88 ? 133  TYR A CA  1 
ATOM   1041 C C   . TYR A 1 133 ? 22.758  17.306  27.354  1.00 42.30 ? 133  TYR A C   1 
ATOM   1042 O O   . TYR A 1 133 ? 23.229  16.387  28.022  1.00 42.19 ? 133  TYR A O   1 
ATOM   1043 C CB  . TYR A 1 133 ? 24.523  16.978  25.593  1.00 41.43 ? 133  TYR A CB  1 
ATOM   1044 C CG  . TYR A 1 133 ? 25.060  17.198  24.187  1.00 40.65 ? 133  TYR A CG  1 
ATOM   1045 C CD1 . TYR A 1 133 ? 24.257  16.993  23.085  1.00 40.77 ? 133  TYR A CD1 1 
ATOM   1046 C CD2 . TYR A 1 133 ? 26.386  17.553  23.969  1.00 39.87 ? 133  TYR A CD2 1 
ATOM   1047 C CE1 . TYR A 1 133 ? 24.729  17.168  21.804  1.00 40.85 ? 133  TYR A CE1 1 
ATOM   1048 C CE2 . TYR A 1 133 ? 26.876  17.735  22.675  1.00 41.38 ? 133  TYR A CE2 1 
ATOM   1049 C CZ  . TYR A 1 133 ? 26.024  17.539  21.588  1.00 40.78 ? 133  TYR A CZ  1 
ATOM   1050 O OH  . TYR A 1 133 ? 26.435  17.697  20.282  1.00 39.45 ? 133  TYR A OH  1 
ATOM   1051 N N   . ASP A 1 134 ? 21.964  18.235  27.883  1.00 42.95 ? 134  ASP A N   1 
ATOM   1052 C CA  . ASP A 1 134 ? 21.613  18.251  29.307  1.00 43.61 ? 134  ASP A CA  1 
ATOM   1053 C C   . ASP A 1 134 ? 20.721  17.055  29.672  1.00 43.87 ? 134  ASP A C   1 
ATOM   1054 O O   . ASP A 1 134 ? 19.589  16.952  29.193  1.00 43.94 ? 134  ASP A O   1 
ATOM   1055 C CB  . ASP A 1 134 ? 20.915  19.572  29.634  1.00 44.41 ? 134  ASP A CB  1 
ATOM   1056 C CG  . ASP A 1 134 ? 20.592  19.739  31.125  1.00 46.43 ? 134  ASP A CG  1 
ATOM   1057 O OD1 . ASP A 1 134 ? 20.737  18.791  31.923  1.00 47.87 ? 134  ASP A OD1 1 
ATOM   1058 O OD2 . ASP A 1 134 ? 20.173  20.851  31.492  1.00 48.80 ? 134  ASP A OD2 1 
ATOM   1059 N N   . GLY A 1 135 ? 21.231  16.167  30.533  1.00 44.09 ? 135  GLY A N   1 
ATOM   1060 C CA  . GLY A 1 135 ? 20.523  14.922  30.895  1.00 44.10 ? 135  GLY A CA  1 
ATOM   1061 C C   . GLY A 1 135 ? 19.383  15.024  31.900  1.00 44.86 ? 135  GLY A C   1 
ATOM   1062 O O   . GLY A 1 135 ? 18.711  14.032  32.184  1.00 45.55 ? 135  GLY A O   1 
ATOM   1063 N N   . ARG A 1 136 ? 19.130  16.211  32.429  1.00 45.36 ? 136  ARG A N   1 
ATOM   1064 C CA  . ARG A 1 136 ? 18.200  16.347  33.550  1.00 46.37 ? 136  ARG A CA  1 
ATOM   1065 C C   . ARG A 1 136 ? 16.756  15.964  33.212  1.00 46.55 ? 136  ARG A C   1 
ATOM   1066 O O   . ARG A 1 136 ? 16.048  15.444  34.070  1.00 46.44 ? 136  ARG A O   1 
ATOM   1067 C CB  . ARG A 1 136 ? 18.276  17.755  34.173  1.00 46.66 ? 136  ARG A CB  1 
ATOM   1068 C CG  . ARG A 1 136 ? 17.570  18.892  33.409  1.00 48.43 ? 136  ARG A CG  1 
ATOM   1069 C CD  . ARG A 1 136 ? 17.726  20.251  34.132  1.00 49.02 ? 136  ARG A CD  1 
ATOM   1070 N NE  . ARG A 1 136 ? 19.110  20.742  34.098  1.00 51.67 ? 136  ARG A NE  1 
ATOM   1071 C CZ  . ARG A 1 136 ? 19.622  21.688  34.898  1.00 53.15 ? 136  ARG A CZ  1 
ATOM   1072 N NH1 . ARG A 1 136 ? 20.890  22.051  34.758  1.00 52.89 ? 136  ARG A NH1 1 
ATOM   1073 N NH2 . ARG A 1 136 ? 18.901  22.264  35.850  1.00 54.69 ? 136  ARG A NH2 1 
ATOM   1074 N N   . PHE A 1 137 ? 16.334  16.187  31.964  1.00 45.98 ? 137  PHE A N   1 
ATOM   1075 C CA  . PHE A 1 137 ? 14.937  15.977  31.589  1.00 46.03 ? 137  PHE A CA  1 
ATOM   1076 C C   . PHE A 1 137 ? 14.640  14.501  31.408  1.00 45.99 ? 137  PHE A C   1 
ATOM   1077 O O   . PHE A 1 137 ? 13.597  14.015  31.859  1.00 47.28 ? 137  PHE A O   1 
ATOM   1078 C CB  . PHE A 1 137 ? 14.583  16.743  30.319  1.00 46.04 ? 137  PHE A CB  1 
ATOM   1079 C CG  . PHE A 1 137 ? 14.982  18.185  30.356  1.00 45.41 ? 137  PHE A CG  1 
ATOM   1080 C CD1 . PHE A 1 137 ? 14.214  19.105  31.038  1.00 48.13 ? 137  PHE A CD1 1 
ATOM   1081 C CD2 . PHE A 1 137 ? 16.135  18.620  29.709  1.00 45.33 ? 137  PHE A CD2 1 
ATOM   1082 C CE1 . PHE A 1 137 ? 14.581  20.446  31.078  1.00 48.23 ? 137  PHE A CE1 1 
ATOM   1083 C CE2 . PHE A 1 137 ? 16.513  19.948  29.743  1.00 45.22 ? 137  PHE A CE2 1 
ATOM   1084 C CZ  . PHE A 1 137 ? 15.743  20.865  30.431  1.00 46.87 ? 137  PHE A CZ  1 
ATOM   1085 N N   . LEU A 1 138 ? 15.546  13.791  30.740  1.00 44.93 ? 138  LEU A N   1 
ATOM   1086 C CA  . LEU A 1 138 ? 15.443  12.337  30.609  1.00 44.66 ? 138  LEU A CA  1 
ATOM   1087 C C   . LEU A 1 138 ? 15.494  11.674  31.984  1.00 44.48 ? 138  LEU A C   1 
ATOM   1088 O O   . LEU A 1 138 ? 14.678  10.808  32.288  1.00 44.65 ? 138  LEU A O   1 
ATOM   1089 C CB  . LEU A 1 138 ? 16.555  11.793  29.701  1.00 44.25 ? 138  LEU A CB  1 
ATOM   1090 C CG  . LEU A 1 138 ? 16.343  12.058  28.205  1.00 43.65 ? 138  LEU A CG  1 
ATOM   1091 C CD1 . LEU A 1 138 ? 17.670  12.021  27.407  1.00 41.51 ? 138  LEU A CD1 1 
ATOM   1092 C CD2 . LEU A 1 138 ? 15.314  11.056  27.659  1.00 44.01 ? 138  LEU A CD2 1 
ATOM   1093 N N   . ALA A 1 139 ? 16.438  12.115  32.810  1.00 44.05 ? 139  ALA A N   1 
ATOM   1094 C CA  . ALA A 1 139 ? 16.545  11.675  34.203  1.00 44.73 ? 139  ALA A CA  1 
ATOM   1095 C C   . ALA A 1 139 ? 15.248  11.915  34.985  1.00 45.79 ? 139  ALA A C   1 
ATOM   1096 O O   . ALA A 1 139 ? 14.716  11.001  35.597  1.00 46.06 ? 139  ALA A O   1 
ATOM   1097 C CB  . ALA A 1 139 ? 17.717  12.373  34.906  1.00 43.73 ? 139  ALA A CB  1 
ATOM   1098 N N   . GLN A 1 140 ? 14.744  13.144  34.959  1.00 46.47 ? 140  GLN A N   1 
ATOM   1099 C CA  . GLN A 1 140 ? 13.572  13.484  35.760  1.00 47.58 ? 140  GLN A CA  1 
ATOM   1100 C C   . GLN A 1 140 ? 12.301  12.816  35.207  1.00 48.40 ? 140  GLN A C   1 
ATOM   1101 O O   . GLN A 1 140 ? 11.570  12.140  35.951  1.00 48.60 ? 140  GLN A O   1 
ATOM   1102 C CB  . GLN A 1 140 ? 13.396  15.003  35.859  1.00 47.52 ? 140  GLN A CB  1 
ATOM   1103 C CG  . GLN A 1 140 ? 12.610  15.473  37.078  1.00 49.52 ? 140  GLN A CG  1 
ATOM   1104 C CD  . GLN A 1 140 ? 11.115  15.222  36.973  1.00 51.87 ? 140  GLN A CD  1 
ATOM   1105 O OE1 . GLN A 1 140 ? 10.530  15.373  35.901  1.00 53.29 ? 140  GLN A OE1 1 
ATOM   1106 N NE2 . GLN A 1 140 ? 10.485  14.852  38.095  1.00 52.86 ? 140  GLN A NE2 1 
ATOM   1107 N N   . VAL A 1 141 ? 12.038  13.006  33.915  1.00 48.25 ? 141  VAL A N   1 
ATOM   1108 C CA  . VAL A 1 141 ? 10.741  12.626  33.357  1.00 48.99 ? 141  VAL A CA  1 
ATOM   1109 C C   . VAL A 1 141 ? 10.644  11.126  33.105  1.00 49.42 ? 141  VAL A C   1 
ATOM   1110 O O   . VAL A 1 141 ? 9.619   10.510  33.407  1.00 50.34 ? 141  VAL A O   1 
ATOM   1111 C CB  . VAL A 1 141 ? 10.426  13.397  32.057  1.00 49.04 ? 141  VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 141 ? 9.107   12.890  31.424  1.00 48.47 ? 141  VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 141 ? 10.362  14.903  32.337  1.00 49.05 ? 141  VAL A CG2 1 
ATOM   1114 N N   . GLU A 1 142 ? 11.704  10.541  32.558  1.00 48.90 ? 142  GLU A N   1 
ATOM   1115 C CA  . GLU A 1 142 ? 11.705  9.118   32.216  1.00 49.36 ? 142  GLU A CA  1 
ATOM   1116 C C   . GLU A 1 142 ? 12.411  8.250   33.245  1.00 49.34 ? 142  GLU A C   1 
ATOM   1117 O O   . GLU A 1 142 ? 12.372  7.023   33.139  1.00 49.72 ? 142  GLU A O   1 
ATOM   1118 C CB  . GLU A 1 142 ? 12.330  8.904   30.830  1.00 48.92 ? 142  GLU A CB  1 
ATOM   1119 C CG  . GLU A 1 142 ? 11.443  9.385   29.694  1.00 49.93 ? 142  GLU A CG  1 
ATOM   1120 C CD  . GLU A 1 142 ? 10.104  8.654   29.626  1.00 53.39 ? 142  GLU A CD  1 
ATOM   1121 O OE1 . GLU A 1 142 ? 9.977   7.500   30.100  1.00 55.01 ? 142  GLU A OE1 1 
ATOM   1122 O OE2 . GLU A 1 142 ? 9.165   9.243   29.079  1.00 57.13 ? 142  GLU A OE2 1 
ATOM   1123 N N   . GLY A 1 143 ? 13.034  8.867   34.249  1.00 49.10 ? 143  GLY A N   1 
ATOM   1124 C CA  . GLY A 1 143 ? 13.755  8.108   35.276  1.00 49.31 ? 143  GLY A CA  1 
ATOM   1125 C C   . GLY A 1 143 ? 15.019  7.439   34.760  1.00 48.47 ? 143  GLY A C   1 
ATOM   1126 O O   . GLY A 1 143 ? 15.475  6.442   35.315  1.00 49.11 ? 143  GLY A O   1 
ATOM   1127 N N   . ALA A 1 144 ? 15.590  7.999   33.698  1.00 47.84 ? 144  ALA A N   1 
ATOM   1128 C CA  . ALA A 1 144 ? 16.767  7.433   33.046  1.00 46.69 ? 144  ALA A CA  1 
ATOM   1129 C C   . ALA A 1 144 ? 18.010  7.668   33.873  1.00 46.01 ? 144  ALA A C   1 
ATOM   1130 O O   . ALA A 1 144 ? 18.111  8.664   34.554  1.00 45.61 ? 144  ALA A O   1 
ATOM   1131 C CB  . ALA A 1 144 ? 16.946  8.072   31.674  1.00 46.09 ? 144  ALA A CB  1 
ATOM   1132 N N   . VAL A 1 145 ? 18.964  6.748   33.811  1.00 46.04 ? 145  VAL A N   1 
ATOM   1133 C CA  . VAL A 1 145 ? 20.329  7.080   34.190  1.00 45.35 ? 145  VAL A CA  1 
ATOM   1134 C C   . VAL A 1 145 ? 21.067  7.467   32.905  1.00 45.04 ? 145  VAL A C   1 
ATOM   1135 O O   . VAL A 1 145 ? 21.146  6.681   31.967  1.00 45.74 ? 145  VAL A O   1 
ATOM   1136 C CB  . VAL A 1 145 ? 21.010  5.914   34.940  1.00 46.03 ? 145  VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 145 ? 22.518  6.199   35.160  1.00 44.11 ? 145  VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 145 ? 20.274  5.637   36.289  1.00 44.59 ? 145  VAL A CG2 1 
ATOM   1139 N N   . LEU A 1 146 ? 21.579  8.691   32.838  1.00 45.13 ? 146  LEU A N   1 
ATOM   1140 C CA  . LEU A 1 146 ? 22.253  9.154   31.627  1.00 44.10 ? 146  LEU A CA  1 
ATOM   1141 C C   . LEU A 1 146 ? 23.720  9.492   31.880  1.00 43.14 ? 146  LEU A C   1 
ATOM   1142 O O   . LEU A 1 146 ? 24.058  10.186  32.838  1.00 43.25 ? 146  LEU A O   1 
ATOM   1143 C CB  . LEU A 1 146 ? 21.500  10.346  31.020  1.00 43.93 ? 146  LEU A CB  1 
ATOM   1144 C CG  . LEU A 1 146 ? 21.867  10.697  29.556  1.00 44.42 ? 146  LEU A CG  1 
ATOM   1145 C CD1 . LEU A 1 146 ? 20.635  11.079  28.756  1.00 44.13 ? 146  LEU A CD1 1 
ATOM   1146 C CD2 . LEU A 1 146 ? 22.926  11.804  29.466  1.00 44.03 ? 146  LEU A CD2 1 
ATOM   1147 N N   . VAL A 1 147 ? 24.585  8.989   31.006  1.00 42.47 ? 147  VAL A N   1 
ATOM   1148 C CA  . VAL A 1 147 ? 26.014  9.211   31.106  1.00 41.66 ? 147  VAL A CA  1 
ATOM   1149 C C   . VAL A 1 147 ? 26.523  9.801   29.800  1.00 41.60 ? 147  VAL A C   1 
ATOM   1150 O O   . VAL A 1 147 ? 26.105  9.388   28.727  1.00 40.85 ? 147  VAL A O   1 
ATOM   1151 C CB  . VAL A 1 147 ? 26.760  7.896   31.375  1.00 42.29 ? 147  VAL A CB  1 
ATOM   1152 C CG1 . VAL A 1 147 ? 28.276  8.138   31.540  1.00 39.72 ? 147  VAL A CG1 1 
ATOM   1153 C CG2 . VAL A 1 147 ? 26.136  7.161   32.580  1.00 41.59 ? 147  VAL A CG2 1 
ATOM   1154 N N   . SER A 1 148 ? 27.410  10.784  29.907  1.00 41.52 ? 148  SER A N   1 
ATOM   1155 C CA  . SER A 1 148 ? 28.101  11.346  28.741  1.00 41.39 ? 148  SER A CA  1 
ATOM   1156 C C   . SER A 1 148 ? 29.568  11.563  29.080  1.00 41.19 ? 148  SER A C   1 
ATOM   1157 O O   . SER A 1 148 ? 29.906  11.895  30.217  1.00 41.68 ? 148  SER A O   1 
ATOM   1158 C CB  . SER A 1 148 ? 27.455  12.665  28.305  1.00 41.07 ? 148  SER A CB  1 
ATOM   1159 O OG  . SER A 1 148 ? 27.408  13.569  29.388  1.00 42.32 ? 148  SER A OG  1 
ATOM   1160 N N   . MET A 1 149 ? 30.435  11.361  28.092  1.00 40.60 ? 149  MET A N   1 
ATOM   1161 C CA  . MET A 1 149 ? 31.861  11.485  28.292  1.00 40.65 ? 149  MET A CA  1 
ATOM   1162 C C   . MET A 1 149 ? 32.457  12.429  27.274  1.00 40.52 ? 149  MET A C   1 
ATOM   1163 O O   . MET A 1 149 ? 31.975  12.527  26.137  1.00 40.15 ? 149  MET A O   1 
ATOM   1164 C CB  . MET A 1 149 ? 32.548  10.100  28.193  1.00 40.98 ? 149  MET A CB  1 
ATOM   1165 C CG  . MET A 1 149 ? 32.966  9.656   26.776  1.00 41.10 ? 149  MET A CG  1 
ATOM   1166 S SD  . MET A 1 149 ? 31.596  9.317   25.627  1.00 40.87 ? 149  MET A SD  1 
ATOM   1167 C CE  . MET A 1 149 ? 31.208  7.632   26.097  1.00 38.52 ? 149  MET A CE  1 
ATOM   1168 N N   . ASN A 1 150 ? 33.506  13.126  27.699  1.00 40.73 ? 150  ASN A N   1 
ATOM   1169 C CA  . ASN A 1 150 ? 34.386  13.842  26.789  1.00 41.07 ? 150  ASN A CA  1 
ATOM   1170 C C   . ASN A 1 150 ? 35.340  12.795  26.200  1.00 40.62 ? 150  ASN A C   1 
ATOM   1171 O O   . ASN A 1 150 ? 35.703  11.838  26.882  1.00 41.45 ? 150  ASN A O   1 
ATOM   1172 C CB  . ASN A 1 150 ? 35.174  14.937  27.519  1.00 41.34 ? 150  ASN A CB  1 
ATOM   1173 C CG  . ASN A 1 150 ? 34.353  16.197  27.796  1.00 43.55 ? 150  ASN A CG  1 
ATOM   1174 O OD1 . ASN A 1 150 ? 33.189  16.329  27.397  1.00 43.17 ? 150  ASN A OD1 1 
ATOM   1175 N ND2 . ASN A 1 150 ? 34.991  17.159  28.473  1.00 46.03 ? 150  ASN A ND2 1 
ATOM   1176 N N   . TYR A 1 151 ? 35.685  12.944  24.926  1.00 39.65 ? 151  TYR A N   1 
ATOM   1177 C CA  . TYR A 1 151 ? 36.705  12.114  24.287  1.00 39.45 ? 151  TYR A CA  1 
ATOM   1178 C C   . TYR A 1 151 ? 37.559  13.022  23.398  1.00 39.66 ? 151  TYR A C   1 
ATOM   1179 O O   . TYR A 1 151 ? 37.065  13.994  22.850  1.00 39.29 ? 151  TYR A O   1 
ATOM   1180 C CB  . TYR A 1 151 ? 36.071  10.977  23.462  1.00 39.16 ? 151  TYR A CB  1 
ATOM   1181 C CG  . TYR A 1 151 ? 35.192  11.424  22.308  1.00 38.29 ? 151  TYR A CG  1 
ATOM   1182 C CD1 . TYR A 1 151 ? 33.826  11.644  22.485  1.00 38.31 ? 151  TYR A CD1 1 
ATOM   1183 C CD2 . TYR A 1 151 ? 35.721  11.615  21.035  1.00 38.18 ? 151  TYR A CD2 1 
ATOM   1184 C CE1 . TYR A 1 151 ? 33.014  12.047  21.418  1.00 37.96 ? 151  TYR A CE1 1 
ATOM   1185 C CE2 . TYR A 1 151 ? 34.925  12.035  19.967  1.00 36.79 ? 151  TYR A CE2 1 
ATOM   1186 C CZ  . TYR A 1 151 ? 33.576  12.254  20.162  1.00 37.82 ? 151  TYR A CZ  1 
ATOM   1187 O OH  . TYR A 1 151 ? 32.786  12.671  19.103  1.00 37.00 ? 151  TYR A OH  1 
ATOM   1188 N N   . ARG A 1 152 ? 38.839  12.702  23.256  1.00 40.46 ? 152  ARG A N   1 
ATOM   1189 C CA  . ARG A 1 152 ? 39.743  13.542  22.484  1.00 40.41 ? 152  ARG A CA  1 
ATOM   1190 C C   . ARG A 1 152 ? 39.317  13.634  21.028  1.00 40.18 ? 152  ARG A C   1 
ATOM   1191 O O   . ARG A 1 152 ? 38.811  12.674  20.446  1.00 39.99 ? 152  ARG A O   1 
ATOM   1192 C CB  . ARG A 1 152 ? 41.174  13.016  22.580  1.00 41.21 ? 152  ARG A CB  1 
ATOM   1193 C CG  . ARG A 1 152 ? 41.809  13.262  23.950  1.00 41.83 ? 152  ARG A CG  1 
ATOM   1194 C CD  . ARG A 1 152 ? 43.161  12.599  24.062  1.00 42.17 ? 152  ARG A CD  1 
ATOM   1195 N NE  . ARG A 1 152 ? 43.010  11.187  24.350  1.00 42.14 ? 152  ARG A NE  1 
ATOM   1196 C CZ  . ARG A 1 152 ? 43.997  10.301  24.377  1.00 44.46 ? 152  ARG A CZ  1 
ATOM   1197 N NH1 . ARG A 1 152 ? 45.246  10.662  24.119  1.00 45.13 ? 152  ARG A NH1 1 
ATOM   1198 N NH2 . ARG A 1 152 ? 43.718  9.028   24.677  1.00 45.30 ? 152  ARG A NH2 1 
ATOM   1199 N N   . VAL A 1 153 ? 39.527  14.810  20.448  1.00 40.64 ? 153  VAL A N   1 
ATOM   1200 C CA  . VAL A 1 153 ? 39.113  15.093  19.082  1.00 40.18 ? 153  VAL A CA  1 
ATOM   1201 C C   . VAL A 1 153 ? 40.299  15.695  18.340  1.00 41.12 ? 153  VAL A C   1 
ATOM   1202 O O   . VAL A 1 153 ? 41.325  16.045  18.955  1.00 41.36 ? 153  VAL A O   1 
ATOM   1203 C CB  . VAL A 1 153 ? 37.878  16.044  19.067  1.00 40.32 ? 153  VAL A CB  1 
ATOM   1204 C CG1 . VAL A 1 153 ? 36.659  15.341  19.671  1.00 38.87 ? 153  VAL A CG1 1 
ATOM   1205 C CG2 . VAL A 1 153 ? 38.160  17.382  19.799  1.00 39.22 ? 153  VAL A CG2 1 
ATOM   1206 N N   . GLY A 1 154 ? 40.167  15.794  17.021  1.00 41.19 ? 154  GLY A N   1 
ATOM   1207 C CA  . GLY A 1 154 ? 41.203  16.403  16.181  1.00 41.93 ? 154  GLY A CA  1 
ATOM   1208 C C   . GLY A 1 154 ? 42.465  15.565  16.193  1.00 42.61 ? 154  GLY A C   1 
ATOM   1209 O O   . GLY A 1 154 ? 42.397  14.350  16.301  1.00 42.78 ? 154  GLY A O   1 
ATOM   1210 N N   . THR A 1 155 ? 43.616  16.228  16.120  1.00 43.70 ? 155  THR A N   1 
ATOM   1211 C CA  . THR A 1 155 ? 44.913  15.558  16.178  1.00 44.32 ? 155  THR A CA  1 
ATOM   1212 C C   . THR A 1 155 ? 45.063  14.745  17.483  1.00 44.38 ? 155  THR A C   1 
ATOM   1213 O O   . THR A 1 155 ? 45.502  13.600  17.475  1.00 44.79 ? 155  THR A O   1 
ATOM   1214 C CB  . THR A 1 155 ? 46.075  16.582  16.060  1.00 45.51 ? 155  THR A CB  1 
ATOM   1215 O OG1 . THR A 1 155 ? 45.961  17.570  17.097  1.00 44.45 ? 155  THR A OG1 1 
ATOM   1216 C CG2 . THR A 1 155 ? 46.083  17.278  14.680  1.00 44.09 ? 155  THR A CG2 1 
ATOM   1217 N N   . PHE A 1 156 ? 44.652  15.335  18.593  1.00 43.90 ? 156  PHE A N   1 
ATOM   1218 C CA  . PHE A 1 156 ? 44.837  14.734  19.925  1.00 44.02 ? 156  PHE A CA  1 
ATOM   1219 C C   . PHE A 1 156 ? 44.152  13.383  20.054  1.00 43.76 ? 156  PHE A C   1 
ATOM   1220 O O   . PHE A 1 156 ? 44.648  12.478  20.728  1.00 44.44 ? 156  PHE A O   1 
ATOM   1221 C CB  . PHE A 1 156 ? 44.302  15.687  20.996  1.00 43.73 ? 156  PHE A CB  1 
ATOM   1222 C CG  . PHE A 1 156 ? 44.816  17.073  20.846  1.00 43.94 ? 156  PHE A CG  1 
ATOM   1223 C CD1 . PHE A 1 156 ? 46.063  17.408  21.324  1.00 44.32 ? 156  PHE A CD1 1 
ATOM   1224 C CD2 . PHE A 1 156 ? 44.086  18.029  20.150  1.00 43.27 ? 156  PHE A CD2 1 
ATOM   1225 C CE1 . PHE A 1 156 ? 46.561  18.688  21.154  1.00 44.73 ? 156  PHE A CE1 1 
ATOM   1226 C CE2 . PHE A 1 156 ? 44.584  19.298  19.973  1.00 43.69 ? 156  PHE A CE2 1 
ATOM   1227 C CZ  . PHE A 1 156 ? 45.826  19.623  20.478  1.00 45.01 ? 156  PHE A CZ  1 
ATOM   1228 N N   . GLY A 1 157 ? 43.007  13.258  19.401  1.00 43.01 ? 157  GLY A N   1 
ATOM   1229 C CA  . GLY A 1 157 ? 42.239  12.022  19.435  1.00 42.91 ? 157  GLY A CA  1 
ATOM   1230 C C   . GLY A 1 157 ? 42.474  11.091  18.271  1.00 42.15 ? 157  GLY A C   1 
ATOM   1231 O O   . GLY A 1 157 ? 42.274  9.891   18.414  1.00 42.93 ? 157  GLY A O   1 
ATOM   1232 N N   . PHE A 1 158 ? 42.886  11.623  17.118  1.00 41.59 ? 158  PHE A N   1 
ATOM   1233 C CA  . PHE A 1 158 ? 42.882  10.828  15.892  1.00 41.12 ? 158  PHE A CA  1 
ATOM   1234 C C   . PHE A 1 158 ? 44.092  10.896  14.976  1.00 41.78 ? 158  PHE A C   1 
ATOM   1235 O O   . PHE A 1 158 ? 44.145  10.168  13.990  1.00 41.06 ? 158  PHE A O   1 
ATOM   1236 C CB  . PHE A 1 158 ? 41.580  11.108  15.130  1.00 40.72 ? 158  PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 158 ? 40.360  10.673  15.895  1.00 39.70 ? 158  PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 158 ? 40.012  9.343   15.947  1.00 40.47 ? 158  PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 158 ? 39.596  11.601  16.613  1.00 39.81 ? 158  PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 158 ? 38.909  8.927   16.693  1.00 40.15 ? 158  PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 158 ? 38.500  11.200  17.359  1.00 38.85 ? 158  PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 158 ? 38.155  9.861   17.395  1.00 39.08 ? 158  PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 159 ? 45.064  11.755  15.277  1.00 43.09 ? 159  LEU A N   1 
ATOM   1244 C CA  . LEU A 1 159 ? 46.313  11.751  14.514  1.00 44.11 ? 159  LEU A CA  1 
ATOM   1245 C C   . LEU A 1 159 ? 46.980  10.392  14.712  1.00 45.46 ? 159  LEU A C   1 
ATOM   1246 O O   . LEU A 1 159 ? 47.117  9.932   15.837  1.00 46.08 ? 159  LEU A O   1 
ATOM   1247 C CB  . LEU A 1 159 ? 47.244  12.876  14.949  1.00 44.43 ? 159  LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 159 ? 48.549  12.991  14.145  1.00 45.43 ? 159  LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 159 ? 48.923  14.459  13.917  1.00 44.40 ? 159  LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 159 ? 49.707  12.196  14.825  1.00 44.56 ? 159  LEU A CD2 1 
ATOM   1251 N N   . ALA A 1 160 ? 47.370  9.755   13.610  1.00 46.45 ? 160  ALA A N   1 
ATOM   1252 C CA  . ALA A 1 160 ? 47.867  8.386   13.631  1.00 47.63 ? 160  ALA A CA  1 
ATOM   1253 C C   . ALA A 1 160 ? 49.062  8.227   12.715  1.00 49.04 ? 160  ALA A C   1 
ATOM   1254 O O   . ALA A 1 160 ? 49.056  8.735   11.585  1.00 48.77 ? 160  ALA A O   1 
ATOM   1255 C CB  . ALA A 1 160 ? 46.772  7.434   13.187  1.00 47.51 ? 160  ALA A CB  1 
ATOM   1256 N N   . LEU A 1 161 ? 50.095  7.555   13.221  1.00 50.49 ? 161  LEU A N   1 
ATOM   1257 C CA  . LEU A 1 161 ? 51.120  6.946   12.368  1.00 52.10 ? 161  LEU A CA  1 
ATOM   1258 C C   . LEU A 1 161 ? 50.916  5.453   12.451  1.00 52.54 ? 161  LEU A C   1 
ATOM   1259 O O   . LEU A 1 161 ? 51.441  4.799   13.343  1.00 53.13 ? 161  LEU A O   1 
ATOM   1260 C CB  . LEU A 1 161 ? 52.517  7.375   12.793  1.00 52.96 ? 161  LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 161 ? 52.702  8.842   12.397  1.00 53.71 ? 161  LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 161 ? 53.855  9.424   13.102  1.00 57.31 ? 161  LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 161 ? 52.885  8.968   10.883  1.00 55.17 ? 161  LEU A CD2 1 
ATOM   1264 N N   . PRO A 1 162 ? 50.078  4.917   11.557  1.00 53.22 ? 162  PRO A N   1 
ATOM   1265 C CA  . PRO A 1 162 ? 49.625  3.542   11.737  1.00 54.24 ? 162  PRO A CA  1 
ATOM   1266 C C   . PRO A 1 162 ? 50.769  2.538   11.783  1.00 55.95 ? 162  PRO A C   1 
ATOM   1267 O O   . PRO A 1 162 ? 51.660  2.575   10.942  1.00 56.57 ? 162  PRO A O   1 
ATOM   1268 C CB  . PRO A 1 162 ? 48.717  3.314   10.523  1.00 53.67 ? 162  PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 162 ? 48.251  4.647   10.172  1.00 52.63 ? 162  PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 162 ? 49.450  5.520   10.372  1.00 52.83 ? 162  PRO A CD  1 
ATOM   1271 N N   . GLY A 1 163 ? 50.742  1.670   12.791  1.00 57.16 ? 163  GLY A N   1 
ATOM   1272 C CA  . GLY A 1 163 ? 51.792  0.688   12.993  1.00 58.91 ? 163  GLY A CA  1 
ATOM   1273 C C   . GLY A 1 163 ? 52.810  1.108   14.033  1.00 59.97 ? 163  GLY A C   1 
ATOM   1274 O O   . GLY A 1 163 ? 53.561  0.266   14.535  1.00 62.14 ? 163  GLY A O   1 
ATOM   1275 N N   . SER A 1 164 ? 52.854  2.398   14.354  1.00 59.56 ? 164  SER A N   1 
ATOM   1276 C CA  . SER A 1 164 ? 53.758  2.910   15.377  1.00 60.06 ? 164  SER A CA  1 
ATOM   1277 C C   . SER A 1 164 ? 53.260  2.546   16.763  1.00 60.24 ? 164  SER A C   1 
ATOM   1278 O O   . SER A 1 164 ? 52.091  2.206   16.954  1.00 59.50 ? 164  SER A O   1 
ATOM   1279 C CB  . SER A 1 164 ? 53.872  4.433   15.281  1.00 59.63 ? 164  SER A CB  1 
ATOM   1280 O OG  . SER A 1 164 ? 52.676  5.071   15.705  1.00 58.01 ? 164  SER A OG  1 
ATOM   1281 N N   . ARG A 1 165 ? 54.153  2.643   17.737  1.00 61.59 ? 165  ARG A N   1 
ATOM   1282 C CA  . ARG A 1 165 ? 53.782  2.420   19.129  1.00 62.02 ? 165  ARG A CA  1 
ATOM   1283 C C   . ARG A 1 165 ? 53.179  3.698   19.718  1.00 59.60 ? 165  ARG A C   1 
ATOM   1284 O O   . ARG A 1 165 ? 52.222  3.637   20.488  1.00 59.16 ? 165  ARG A O   1 
ATOM   1285 C CB  . ARG A 1 165 ? 55.012  2.008   19.946  1.00 64.21 ? 165  ARG A CB  1 
ATOM   1286 C CG  . ARG A 1 165 ? 54.686  1.193   21.203  1.00 69.51 ? 165  ARG A CG  1 
ATOM   1287 C CD  . ARG A 1 165 ? 55.610  1.547   22.389  1.00 77.05 ? 165  ARG A CD  1 
ATOM   1288 N NE  . ARG A 1 165 ? 55.241  2.845   22.991  1.00 80.25 ? 165  ARG A NE  1 
ATOM   1289 C CZ  . ARG A 1 165 ? 56.037  3.587   23.772  1.00 82.20 ? 165  ARG A CZ  1 
ATOM   1290 N NH1 . ARG A 1 165 ? 57.276  3.181   24.072  1.00 84.51 ? 165  ARG A NH1 1 
ATOM   1291 N NH2 . ARG A 1 165 ? 55.592  4.747   24.254  1.00 80.80 ? 165  ARG A NH2 1 
ATOM   1292 N N   . GLU A 1 166 ? 53.729  4.849   19.324  1.00 58.02 ? 166  GLU A N   1 
ATOM   1293 C CA  . GLU A 1 166 ? 53.465  6.127   20.004  1.00 56.39 ? 166  GLU A CA  1 
ATOM   1294 C C   . GLU A 1 166 ? 52.222  6.921   19.522  1.00 54.27 ? 166  GLU A C   1 
ATOM   1295 O O   . GLU A 1 166 ? 51.694  7.768   20.253  1.00 53.11 ? 166  GLU A O   1 
ATOM   1296 C CB  . GLU A 1 166 ? 54.721  7.010   19.912  1.00 57.54 ? 166  GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 166 ? 56.013  6.333   20.427  1.00 59.88 ? 166  GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 166 ? 56.826  5.616   19.332  1.00 62.95 ? 166  GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 166 ? 56.312  5.370   18.217  1.00 64.08 ? 166  GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 166 ? 57.999  5.279   19.599  1.00 66.91 ? 166  GLU A OE2 1 
ATOM   1301 N N   . ALA A 1 167 ? 51.791  6.674   18.292  1.00 53.08 ? 167  ALA A N   1 
ATOM   1302 C CA  . ALA A 1 167 ? 50.586  7.301   17.738  1.00 52.10 ? 167  ALA A CA  1 
ATOM   1303 C C   . ALA A 1 167 ? 49.838  6.246   16.920  1.00 51.05 ? 167  ALA A C   1 
ATOM   1304 O O   . ALA A 1 167 ? 49.837  6.276   15.689  1.00 50.94 ? 167  ALA A O   1 
ATOM   1305 C CB  . ALA A 1 167 ? 50.954  8.524   16.875  1.00 51.63 ? 167  ALA A CB  1 
ATOM   1306 N N   . PRO A 1 168 ? 49.226  5.277   17.608  1.00 50.67 ? 168  PRO A N   1 
ATOM   1307 C CA  . PRO A 1 168 ? 48.628  4.130   16.927  1.00 50.38 ? 168  PRO A CA  1 
ATOM   1308 C C   . PRO A 1 168 ? 47.335  4.418   16.185  1.00 49.56 ? 168  PRO A C   1 
ATOM   1309 O O   . PRO A 1 168 ? 46.902  3.587   15.378  1.00 50.10 ? 168  PRO A O   1 
ATOM   1310 C CB  . PRO A 1 168 ? 48.369  3.154   18.072  1.00 50.62 ? 168  PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 168 ? 48.145  4.023   19.268  1.00 50.19 ? 168  PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 168 ? 49.101  5.173   19.074  1.00 50.74 ? 168  PRO A CD  1 
ATOM   1313 N N   . GLY A 1 169 ? 46.715  5.570   16.444  1.00 48.35 ? 169  GLY A N   1 
ATOM   1314 C CA  . GLY A 1 169 ? 45.409  5.886   15.870  1.00 47.01 ? 169  GLY A CA  1 
ATOM   1315 C C   . GLY A 1 169 ? 44.234  5.472   16.753  1.00 45.93 ? 169  GLY A C   1 
ATOM   1316 O O   . GLY A 1 169 ? 44.369  4.618   17.625  1.00 45.57 ? 169  GLY A O   1 
ATOM   1317 N N   . ASN A 1 170 ? 43.085  6.111   16.523  1.00 44.58 ? 170  ASN A N   1 
ATOM   1318 C CA  . ASN A 1 170 ? 41.808  5.756   17.154  1.00 43.69 ? 170  ASN A CA  1 
ATOM   1319 C C   . ASN A 1 170 ? 41.726  5.948   18.677  1.00 42.97 ? 170  ASN A C   1 
ATOM   1320 O O   . ASN A 1 170 ? 40.830  5.408   19.322  1.00 42.20 ? 170  ASN A O   1 
ATOM   1321 C CB  . ASN A 1 170 ? 41.408  4.306   16.794  1.00 44.14 ? 170  ASN A CB  1 
ATOM   1322 C CG  . ASN A 1 170 ? 41.181  4.109   15.316  1.00 44.93 ? 170  ASN A CG  1 
ATOM   1323 O OD1 . ASN A 1 170 ? 40.702  5.012   14.644  1.00 44.24 ? 170  ASN A OD1 1 
ATOM   1324 N ND2 . ASN A 1 170 ? 41.514  2.914   14.798  1.00 44.79 ? 170  ASN A ND2 1 
ATOM   1325 N N   . VAL A 1 171 ? 42.622  6.741   19.253  1.00 42.50 ? 171  VAL A N   1 
ATOM   1326 C CA  . VAL A 1 171 ? 42.684  6.861   20.703  1.00 41.52 ? 171  VAL A CA  1 
ATOM   1327 C C   . VAL A 1 171 ? 41.439  7.577   21.265  1.00 41.10 ? 171  VAL A C   1 
ATOM   1328 O O   . VAL A 1 171 ? 41.019  7.272   22.375  1.00 40.73 ? 171  VAL A O   1 
ATOM   1329 C CB  . VAL A 1 171 ? 44.022  7.476   21.201  1.00 42.12 ? 171  VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 171 ? 45.219  6.676   20.642  1.00 40.75 ? 171  VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 171 ? 44.129  8.948   20.852  1.00 40.38 ? 171  VAL A CG2 1 
ATOM   1332 N N   . GLY A 1 172 ? 40.833  8.484   20.494  1.00 40.16 ? 172  GLY A N   1 
ATOM   1333 C CA  . GLY A 1 172 ? 39.541  9.075   20.881  1.00 39.52 ? 172  GLY A CA  1 
ATOM   1334 C C   . GLY A 1 172 ? 38.404  8.061   21.038  1.00 39.41 ? 172  GLY A C   1 
ATOM   1335 O O   . GLY A 1 172 ? 37.514  8.230   21.880  1.00 38.62 ? 172  GLY A O   1 
ATOM   1336 N N   . LEU A 1 173 ? 38.444  7.005   20.230  1.00 39.55 ? 173  LEU A N   1 
ATOM   1337 C CA  . LEU A 1 173 ? 37.506  5.889   20.341  1.00 39.84 ? 173  LEU A CA  1 
ATOM   1338 C C   . LEU A 1 173 ? 37.826  5.035   21.562  1.00 40.61 ? 173  LEU A C   1 
ATOM   1339 O O   . LEU A 1 173 ? 36.931  4.442   22.178  1.00 39.83 ? 173  LEU A O   1 
ATOM   1340 C CB  . LEU A 1 173 ? 37.540  5.029   19.071  1.00 39.77 ? 173  LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 173 ? 36.949  5.660   17.802  1.00 39.96 ? 173  LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 173 ? 37.252  4.817   16.557  1.00 37.10 ? 173  LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 173 ? 35.434  5.881   17.963  1.00 40.12 ? 173  LEU A CD2 1 
ATOM   1344 N N   . LEU A 1 174 ? 39.111  4.981   21.905  1.00 42.05 ? 174  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 174 ? 39.571  4.253   23.082  1.00 42.88 ? 174  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 174 ? 39.168  4.992   24.353  1.00 42.49 ? 174  LEU A C   1 
ATOM   1347 O O   . LEU A 1 174 ? 38.872  4.355   25.354  1.00 43.06 ? 174  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 174 ? 41.086  4.013   23.047  1.00 43.68 ? 174  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 174 ? 41.607  2.970   22.048  1.00 44.63 ? 174  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 174 ? 43.133  2.897   22.113  1.00 44.97 ? 174  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 174 ? 40.993  1.585   22.290  1.00 43.66 ? 174  LEU A CD2 1 
ATOM   1352 N N   . ASP A 1 175 ? 39.121  6.323   24.299  1.00 41.76 ? 175  ASP A N   1 
ATOM   1353 C CA  . ASP A 1 175 ? 38.598  7.133   25.407  1.00 41.44 ? 175  ASP A CA  1 
ATOM   1354 C C   . ASP A 1 175 ? 37.137  6.787   25.643  1.00 41.33 ? 175  ASP A C   1 
ATOM   1355 O O   . ASP A 1 175 ? 36.710  6.512   26.778  1.00 41.91 ? 175  ASP A O   1 
ATOM   1356 C CB  . ASP A 1 175 ? 38.701  8.634   25.121  1.00 40.88 ? 175  ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 175 ? 40.136  9.105   24.927  1.00 41.77 ? 175  ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 175 ? 41.093  8.401   25.351  1.00 41.43 ? 175  ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 175 ? 40.312  10.189  24.340  1.00 40.46 ? 175  ASP A OD2 1 
ATOM   1360 N N   . GLN A 1 176 ? 36.370  6.787   24.562  1.00 40.68 ? 176  GLN A N   1 
ATOM   1361 C CA  . GLN A 1 176 ? 34.969  6.408   24.643  1.00 40.44 ? 176  GLN A CA  1 
ATOM   1362 C C   . GLN A 1 176 ? 34.818  5.045   25.285  1.00 40.86 ? 176  GLN A C   1 
ATOM   1363 O O   . GLN A 1 176 ? 34.010  4.867   26.196  1.00 40.83 ? 176  GLN A O   1 
ATOM   1364 C CB  . GLN A 1 176 ? 34.333  6.402   23.258  1.00 40.10 ? 176  GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 176 ? 34.227  7.771   22.607  1.00 39.59 ? 176  GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 176 ? 33.749  7.671   21.186  1.00 39.76 ? 176  GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 176 ? 33.164  6.660   20.793  1.00 41.02 ? 176  GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 176 ? 33.993  8.710   20.402  1.00 39.08 ? 176  GLN A NE2 1 
ATOM   1369 N N   . ARG A 1 177 ? 35.618  4.086   24.818  1.00 41.77 ? 177  ARG A N   1 
ATOM   1370 C CA  . ARG A 1 177 ? 35.548  2.707   25.326  1.00 42.17 ? 177  ARG A CA  1 
ATOM   1371 C C   . ARG A 1 177 ? 35.898  2.612   26.813  1.00 41.44 ? 177  ARG A C   1 
ATOM   1372 O O   . ARG A 1 177 ? 35.284  1.834   27.534  1.00 41.32 ? 177  ARG A O   1 
ATOM   1373 C CB  . ARG A 1 177 ? 36.453  1.767   24.511  1.00 42.62 ? 177  ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 177 ? 36.442  0.299   25.006  1.00 44.35 ? 177  ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 177 ? 37.451  -0.532  24.281  1.00 45.16 ? 177  ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 177 ? 36.960  -0.886  22.961  1.00 47.78 ? 177  ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 177 ? 37.723  -1.368  21.977  1.00 48.72 ? 177  ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 177 ? 39.028  -1.565  22.151  1.00 48.92 ? 177  ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 177 ? 37.165  -1.677  20.823  1.00 48.86 ? 177  ARG A NH2 1 
ATOM   1380 N N   . LEU A 1 178 ? 36.888  3.381   27.254  1.00 41.04 ? 178  LEU A N   1 
ATOM   1381 C CA  . LEU A 1 178 ? 37.247  3.433   28.669  1.00 41.36 ? 178  LEU A CA  1 
ATOM   1382 C C   . LEU A 1 178 ? 36.075  3.932   29.513  1.00 41.49 ? 178  LEU A C   1 
ATOM   1383 O O   . LEU A 1 178 ? 35.820  3.408   30.584  1.00 42.04 ? 178  LEU A O   1 
ATOM   1384 C CB  . LEU A 1 178 ? 38.492  4.302   28.884  1.00 41.41 ? 178  LEU A CB  1 
ATOM   1385 C CG  . LEU A 1 178 ? 39.182  4.249   30.253  1.00 42.09 ? 178  LEU A CG  1 
ATOM   1386 C CD1 . LEU A 1 178 ? 39.531  2.798   30.669  1.00 43.82 ? 178  LEU A CD1 1 
ATOM   1387 C CD2 . LEU A 1 178 ? 40.433  5.116   30.207  1.00 41.74 ? 178  LEU A CD2 1 
ATOM   1388 N N   . ALA A 1 179 ? 35.355  4.939   29.020  1.00 41.64 ? 179  ALA A N   1 
ATOM   1389 C CA  . ALA A 1 179 ? 34.136  5.418   29.671  1.00 41.54 ? 179  ALA A CA  1 
ATOM   1390 C C   . ALA A 1 179 ? 33.065  4.320   29.711  1.00 42.30 ? 179  ALA A C   1 
ATOM   1391 O O   . ALA A 1 179 ? 32.328  4.204   30.698  1.00 42.77 ? 179  ALA A O   1 
ATOM   1392 C CB  . ALA A 1 179 ? 33.598  6.674   28.960  1.00 40.23 ? 179  ALA A CB  1 
ATOM   1393 N N   . LEU A 1 180 ? 32.963  3.522   28.646  1.00 43.04 ? 180  LEU A N   1 
ATOM   1394 C CA  . LEU A 1 180 ? 31.998  2.413   28.641  1.00 43.52 ? 180  LEU A CA  1 
ATOM   1395 C C   . LEU A 1 180 ? 32.375  1.373   29.703  1.00 44.63 ? 180  LEU A C   1 
ATOM   1396 O O   . LEU A 1 180 ? 31.481  0.797   30.360  1.00 44.06 ? 180  LEU A O   1 
ATOM   1397 C CB  . LEU A 1 180 ? 31.857  1.731   27.270  1.00 43.14 ? 180  LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 180 ? 31.471  2.545   26.020  1.00 43.39 ? 180  LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 180 ? 30.956  1.608   24.900  1.00 39.73 ? 180  LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 180 ? 30.458  3.674   26.304  1.00 40.97 ? 180  LEU A CD2 1 
ATOM   1401 N N   . GLN A 1 181 ? 33.682  1.134   29.856  1.00 45.15 ? 181  GLN A N   1 
ATOM   1402 C CA  . GLN A 1 181 ? 34.173  0.197   30.861  1.00 46.86 ? 181  GLN A CA  1 
ATOM   1403 C C   . GLN A 1 181 ? 33.887  0.755   32.251  1.00 45.60 ? 181  GLN A C   1 
ATOM   1404 O O   . GLN A 1 181 ? 33.451  0.033   33.147  1.00 45.80 ? 181  GLN A O   1 
ATOM   1405 C CB  . GLN A 1 181 ? 35.664  -0.101  30.670  1.00 47.43 ? 181  GLN A CB  1 
ATOM   1406 C CG  . GLN A 1 181 ? 35.938  -0.953  29.408  1.00 51.26 ? 181  GLN A CG  1 
ATOM   1407 C CD  . GLN A 1 181 ? 37.423  -1.058  28.996  1.00 52.13 ? 181  GLN A CD  1 
ATOM   1408 O OE1 . GLN A 1 181 ? 38.265  -0.241  29.401  1.00 57.96 ? 181  GLN A OE1 1 
ATOM   1409 N NE2 . GLN A 1 181 ? 37.735  -2.063  28.162  1.00 54.71 ? 181  GLN A NE2 1 
ATOM   1410 N N   . TRP A 1 182 ? 34.083  2.059   32.401  1.00 44.13 ? 182  TRP A N   1 
ATOM   1411 C CA  . TRP A 1 182 ? 33.775  2.722   33.646  1.00 43.42 ? 182  TRP A CA  1 
ATOM   1412 C C   . TRP A 1 182 ? 32.310  2.537   34.029  1.00 43.18 ? 182  TRP A C   1 
ATOM   1413 O O   . TRP A 1 182 ? 32.003  2.329   35.195  1.00 43.31 ? 182  TRP A O   1 
ATOM   1414 C CB  . TRP A 1 182 ? 34.107  4.200   33.547  1.00 42.19 ? 182  TRP A CB  1 
ATOM   1415 C CG  . TRP A 1 182 ? 33.948  4.946   34.835  1.00 42.23 ? 182  TRP A CG  1 
ATOM   1416 C CD1 . TRP A 1 182 ? 34.942  5.275   35.714  1.00 41.59 ? 182  TRP A CD1 1 
ATOM   1417 C CD2 . TRP A 1 182 ? 32.734  5.485   35.379  1.00 40.93 ? 182  TRP A CD2 1 
ATOM   1418 N NE1 . TRP A 1 182 ? 34.418  5.980   36.773  1.00 42.10 ? 182  TRP A NE1 1 
ATOM   1419 C CE2 . TRP A 1 182 ? 33.070  6.131   36.587  1.00 41.99 ? 182  TRP A CE2 1 
ATOM   1420 C CE3 . TRP A 1 182 ? 31.402  5.499   34.955  1.00 40.82 ? 182  TRP A CE3 1 
ATOM   1421 C CZ2 . TRP A 1 182 ? 32.119  6.760   37.388  1.00 41.33 ? 182  TRP A CZ2 1 
ATOM   1422 C CZ3 . TRP A 1 182 ? 30.455  6.124   35.749  1.00 40.75 ? 182  TRP A CZ3 1 
ATOM   1423 C CH2 . TRP A 1 182 ? 30.817  6.731   36.962  1.00 41.71 ? 182  TRP A CH2 1 
ATOM   1424 N N   . VAL A 1 183 ? 31.411  2.634   33.051  1.00 42.88 ? 183  VAL A N   1 
ATOM   1425 C CA  . VAL A 1 183 ? 29.996  2.471   33.332  1.00 42.90 ? 183  VAL A CA  1 
ATOM   1426 C C   . VAL A 1 183 ? 29.746  1.045   33.815  1.00 43.63 ? 183  VAL A C   1 
ATOM   1427 O O   . VAL A 1 183 ? 29.048  0.842   34.804  1.00 43.80 ? 183  VAL A O   1 
ATOM   1428 C CB  . VAL A 1 183 ? 29.101  2.837   32.115  1.00 42.46 ? 183  VAL A CB  1 
ATOM   1429 C CG1 . VAL A 1 183 ? 27.654  2.376   32.345  1.00 42.89 ? 183  VAL A CG1 1 
ATOM   1430 C CG2 . VAL A 1 183 ? 29.147  4.345   31.852  1.00 40.88 ? 183  VAL A CG2 1 
ATOM   1431 N N   . GLN A 1 184 ? 30.359  0.058   33.161  1.00 44.77 ? 184  GLN A N   1 
ATOM   1432 C CA  . GLN A 1 184 ? 30.180  -1.349  33.571  1.00 45.75 ? 184  GLN A CA  1 
ATOM   1433 C C   . GLN A 1 184 ? 30.595  -1.563  35.015  1.00 46.30 ? 184  GLN A C   1 
ATOM   1434 O O   . GLN A 1 184 ? 29.892  -2.249  35.768  1.00 47.39 ? 184  GLN A O   1 
ATOM   1435 C CB  . GLN A 1 184 ? 30.955  -2.314  32.671  1.00 46.23 ? 184  GLN A CB  1 
ATOM   1436 C CG  . GLN A 1 184 ? 30.344  -2.515  31.304  1.00 46.67 ? 184  GLN A CG  1 
ATOM   1437 C CD  . GLN A 1 184 ? 28.965  -3.118  31.380  1.00 47.45 ? 184  GLN A CD  1 
ATOM   1438 O OE1 . GLN A 1 184 ? 28.796  -4.209  31.908  1.00 50.53 ? 184  GLN A OE1 1 
ATOM   1439 N NE2 . GLN A 1 184 ? 27.964  -2.396  30.884  1.00 46.77 ? 184  GLN A NE2 1 
ATOM   1440 N N   . GLU A 1 185 ? 31.720  -0.977  35.410  1.00 46.30 ? 185  GLU A N   1 
ATOM   1441 C CA  . GLU A 1 185 ? 32.205  -1.177  36.763  1.00 46.79 ? 185  GLU A CA  1 
ATOM   1442 C C   . GLU A 1 185 ? 31.415  -0.377  37.804  1.00 46.11 ? 185  GLU A C   1 
ATOM   1443 O O   . GLU A 1 185 ? 31.152  -0.891  38.892  1.00 46.40 ? 185  GLU A O   1 
ATOM   1444 C CB  . GLU A 1 185 ? 33.709  -0.892  36.901  1.00 47.24 ? 185  GLU A CB  1 
ATOM   1445 C CG  . GLU A 1 185 ? 34.161  -0.934  38.384  1.00 49.04 ? 185  GLU A CG  1 
ATOM   1446 C CD  . GLU A 1 185 ? 35.543  -1.493  38.616  1.00 54.05 ? 185  GLU A CD  1 
ATOM   1447 O OE1 . GLU A 1 185 ? 35.782  -2.067  39.715  1.00 53.93 ? 185  GLU A OE1 1 
ATOM   1448 O OE2 . GLU A 1 185 ? 36.394  -1.342  37.706  1.00 59.54 ? 185  GLU A OE2 1 
ATOM   1449 N N   . ASN A 1 186 ? 31.022  0.852   37.475  1.00 45.09 ? 186  ASN A N   1 
ATOM   1450 C CA  . ASN A 1 186 ? 30.593  1.811   38.507  1.00 44.63 ? 186  ASN A CA  1 
ATOM   1451 C C   . ASN A 1 186 ? 29.136  2.238   38.522  1.00 44.14 ? 186  ASN A C   1 
ATOM   1452 O O   . ASN A 1 186 ? 28.666  2.716   39.546  1.00 44.76 ? 186  ASN A O   1 
ATOM   1453 C CB  . ASN A 1 186 ? 31.466  3.059   38.439  1.00 44.31 ? 186  ASN A CB  1 
ATOM   1454 C CG  . ASN A 1 186 ? 32.927  2.763   38.688  1.00 45.61 ? 186  ASN A CG  1 
ATOM   1455 O OD1 . ASN A 1 186 ? 33.323  2.425   39.811  1.00 46.12 ? 186  ASN A OD1 1 
ATOM   1456 N ND2 . ASN A 1 186 ? 33.746  2.888   37.640  1.00 45.18 ? 186  ASN A ND2 1 
ATOM   1457 N N   . ILE A 1 187 ? 28.414  2.072   37.417  1.00 43.67 ? 187  ILE A N   1 
ATOM   1458 C CA  . ILE A 1 187 ? 27.101  2.704   37.283  1.00 43.50 ? 187  ILE A CA  1 
ATOM   1459 C C   . ILE A 1 187 ? 26.050  2.142   38.265  1.00 44.24 ? 187  ILE A C   1 
ATOM   1460 O O   . ILE A 1 187 ? 25.076  2.824   38.592  1.00 44.30 ? 187  ILE A O   1 
ATOM   1461 C CB  . ILE A 1 187 ? 26.567  2.660   35.816  1.00 43.01 ? 187  ILE A CB  1 
ATOM   1462 C CG1 . ILE A 1 187 ? 25.622  3.848   35.550  1.00 43.60 ? 187  ILE A CG1 1 
ATOM   1463 C CG2 . ILE A 1 187 ? 25.864  1.355   35.522  1.00 42.87 ? 187  ILE A CG2 1 
ATOM   1464 C CD1 . ILE A 1 187 ? 26.299  5.202   35.512  1.00 41.56 ? 187  ILE A CD1 1 
ATOM   1465 N N   . ALA A 1 188 ? 26.243  0.910   38.737  1.00 44.78 ? 188  ALA A N   1 
ATOM   1466 C CA  . ALA A 1 188 ? 25.364  0.346   39.762  1.00 45.28 ? 188  ALA A CA  1 
ATOM   1467 C C   . ALA A 1 188 ? 25.426  1.155   41.059  1.00 45.88 ? 188  ALA A C   1 
ATOM   1468 O O   . ALA A 1 188 ? 24.469  1.165   41.823  1.00 46.69 ? 188  ALA A O   1 
ATOM   1469 C CB  . ALA A 1 188 ? 25.702  -1.101  40.026  1.00 45.44 ? 188  ALA A CB  1 
ATOM   1470 N N   . ALA A 1 189 ? 26.543  1.838   41.304  1.00 45.93 ? 189  ALA A N   1 
ATOM   1471 C CA  . ALA A 1 189 ? 26.662  2.726   42.460  1.00 46.40 ? 189  ALA A CA  1 
ATOM   1472 C C   . ALA A 1 189 ? 25.638  3.873   42.424  1.00 46.50 ? 189  ALA A C   1 
ATOM   1473 O O   . ALA A 1 189 ? 25.337  4.457   43.465  1.00 47.60 ? 189  ALA A O   1 
ATOM   1474 C CB  . ALA A 1 189 ? 28.088  3.297   42.556  1.00 45.77 ? 189  ALA A CB  1 
ATOM   1475 N N   . PHE A 1 190 ? 25.139  4.212   41.232  1.00 46.10 ? 190  PHE A N   1 
ATOM   1476 C CA  . PHE A 1 190 ? 24.189  5.321   41.036  1.00 45.49 ? 190  PHE A CA  1 
ATOM   1477 C C   . PHE A 1 190 ? 22.768  4.824   40.813  1.00 46.20 ? 190  PHE A C   1 
ATOM   1478 O O   . PHE A 1 190 ? 21.865  5.625   40.575  1.00 45.75 ? 190  PHE A O   1 
ATOM   1479 C CB  . PHE A 1 190 ? 24.587  6.145   39.814  1.00 44.56 ? 190  PHE A CB  1 
ATOM   1480 C CG  . PHE A 1 190 ? 25.934  6.762   39.921  1.00 43.65 ? 190  PHE A CG  1 
ATOM   1481 C CD1 . PHE A 1 190 ? 27.060  6.040   39.583  1.00 43.74 ? 190  PHE A CD1 1 
ATOM   1482 C CD2 . PHE A 1 190 ? 26.081  8.054   40.372  1.00 42.75 ? 190  PHE A CD2 1 
ATOM   1483 C CE1 . PHE A 1 190 ? 28.320  6.597   39.689  1.00 43.29 ? 190  PHE A CE1 1 
ATOM   1484 C CE2 . PHE A 1 190 ? 27.337  8.616   40.481  1.00 42.93 ? 190  PHE A CE2 1 
ATOM   1485 C CZ  . PHE A 1 190 ? 28.459  7.883   40.143  1.00 42.89 ? 190  PHE A CZ  1 
ATOM   1486 N N   . GLY A 1 191 ? 22.572  3.507   40.905  1.00 46.76 ? 191  GLY A N   1 
ATOM   1487 C CA  . GLY A 1 191 ? 21.278  2.886   40.611  1.00 47.30 ? 191  GLY A CA  1 
ATOM   1488 C C   . GLY A 1 191 ? 21.112  2.445   39.162  1.00 46.92 ? 191  GLY A C   1 
ATOM   1489 O O   . GLY A 1 191 ? 20.032  2.041   38.765  1.00 47.52 ? 191  GLY A O   1 
ATOM   1490 N N   . GLY A 1 192 ? 22.184  2.496   38.374  1.00 46.56 ? 192  GLY A N   1 
ATOM   1491 C CA  . GLY A 1 192 ? 22.131  2.091   36.972  1.00 45.96 ? 192  GLY A CA  1 
ATOM   1492 C C   . GLY A 1 192 ? 22.372  0.611   36.796  1.00 46.52 ? 192  GLY A C   1 
ATOM   1493 O O   . GLY A 1 192 ? 23.056  -0.002  37.608  1.00 46.41 ? 192  GLY A O   1 
ATOM   1494 N N   . ASP A 1 193 ? 21.824  0.054   35.714  1.00 46.76 ? 193  ASP A N   1 
ATOM   1495 C CA  . ASP A 1 193 ? 21.887  -1.386  35.417  1.00 47.37 ? 193  ASP A CA  1 
ATOM   1496 C C   . ASP A 1 193 ? 22.929  -1.623  34.335  1.00 46.80 ? 193  ASP A C   1 
ATOM   1497 O O   . ASP A 1 193 ? 22.687  -1.295  33.175  1.00 46.42 ? 193  ASP A O   1 
ATOM   1498 C CB  . ASP A 1 193 ? 20.522  -1.856  34.908  1.00 47.98 ? 193  ASP A CB  1 
ATOM   1499 C CG  . ASP A 1 193 ? 20.445  -3.371  34.685  1.00 49.94 ? 193  ASP A CG  1 
ATOM   1500 O OD1 . ASP A 1 193 ? 21.463  -4.070  34.859  1.00 51.08 ? 193  ASP A OD1 1 
ATOM   1501 O OD2 . ASP A 1 193 ? 19.339  -3.867  34.344  1.00 51.29 ? 193  ASP A OD2 1 
ATOM   1502 N N   . PRO A 1 194 ? 24.097  -2.186  34.693  1.00 47.00 ? 194  PRO A N   1 
ATOM   1503 C CA  . PRO A 1 194 ? 25.113  -2.428  33.649  1.00 46.61 ? 194  PRO A CA  1 
ATOM   1504 C C   . PRO A 1 194 ? 24.725  -3.497  32.610  1.00 47.58 ? 194  PRO A C   1 
ATOM   1505 O O   . PRO A 1 194 ? 25.352  -3.582  31.552  1.00 47.07 ? 194  PRO A O   1 
ATOM   1506 C CB  . PRO A 1 194 ? 26.354  -2.841  34.447  1.00 46.78 ? 194  PRO A CB  1 
ATOM   1507 C CG  . PRO A 1 194 ? 25.846  -3.295  35.773  1.00 47.70 ? 194  PRO A CG  1 
ATOM   1508 C CD  . PRO A 1 194 ? 24.558  -2.586  36.035  1.00 47.44 ? 194  PRO A CD  1 
ATOM   1509 N N   . MET A 1 195 ? 23.713  -4.307  32.918  1.00 48.78 ? 195  MET A N   1 
ATOM   1510 C CA  . MET A 1 195 ? 23.163  -5.261  31.965  1.00 50.28 ? 195  MET A CA  1 
ATOM   1511 C C   . MET A 1 195 ? 22.132  -4.638  31.003  1.00 49.25 ? 195  MET A C   1 
ATOM   1512 O O   . MET A 1 195 ? 21.569  -5.345  30.163  1.00 49.75 ? 195  MET A O   1 
ATOM   1513 C CB  . MET A 1 195 ? 22.556  -6.460  32.718  1.00 51.48 ? 195  MET A CB  1 
ATOM   1514 C CG  . MET A 1 195 ? 23.597  -7.303  33.440  1.00 51.93 ? 195  MET A CG  1 
ATOM   1515 S SD  . MET A 1 195 ? 22.918  -8.762  34.213  1.00 58.75 ? 195  MET A SD  1 
ATOM   1516 C CE  . MET A 1 195 ? 24.431  -9.736  34.389  1.00 56.80 ? 195  MET A CE  1 
ATOM   1517 N N   . SER A 1 196 ? 21.903  -3.326  31.103  1.00 48.37 ? 196  SER A N   1 
ATOM   1518 C CA  . SER A 1 196 ? 21.046  -2.617  30.153  1.00 47.63 ? 196  SER A CA  1 
ATOM   1519 C C   . SER A 1 196 ? 21.607  -1.237  29.830  1.00 46.22 ? 196  SER A C   1 
ATOM   1520 O O   . SER A 1 196 ? 21.238  -0.233  30.441  1.00 45.63 ? 196  SER A O   1 
ATOM   1521 C CB  . SER A 1 196 ? 19.619  -2.495  30.688  1.00 48.34 ? 196  SER A CB  1 
ATOM   1522 O OG  . SER A 1 196 ? 18.789  -1.767  29.784  1.00 47.61 ? 196  SER A OG  1 
ATOM   1523 N N   . VAL A 1 197 ? 22.466  -1.215  28.819  1.00 45.59 ? 197  VAL A N   1 
ATOM   1524 C CA  . VAL A 1 197 ? 23.238  -0.054  28.407  1.00 44.24 ? 197  VAL A CA  1 
ATOM   1525 C C   . VAL A 1 197 ? 22.995  0.157   26.921  1.00 43.74 ? 197  VAL A C   1 
ATOM   1526 O O   . VAL A 1 197 ? 23.283  -0.723  26.103  1.00 43.62 ? 197  VAL A O   1 
ATOM   1527 C CB  . VAL A 1 197 ? 24.765  -0.241  28.640  1.00 44.50 ? 197  VAL A CB  1 
ATOM   1528 C CG1 . VAL A 1 197 ? 25.555  1.019   28.159  1.00 42.50 ? 197  VAL A CG1 1 
ATOM   1529 C CG2 . VAL A 1 197 ? 25.055  -0.547  30.111  1.00 43.79 ? 197  VAL A CG2 1 
ATOM   1530 N N   . THR A 1 198 ? 22.435  1.318   26.599  1.00 42.51 ? 198  THR A N   1 
ATOM   1531 C CA  . THR A 1 198 ? 22.162  1.731   25.228  1.00 42.14 ? 198  THR A CA  1 
ATOM   1532 C C   . THR A 1 198 ? 23.054  2.928   24.903  1.00 41.52 ? 198  THR A C   1 
ATOM   1533 O O   . THR A 1 198 ? 23.082  3.902   25.663  1.00 40.92 ? 198  THR A O   1 
ATOM   1534 C CB  . THR A 1 198 ? 20.677  2.157   25.075  1.00 42.47 ? 198  THR A CB  1 
ATOM   1535 O OG1 . THR A 1 198 ? 19.850  1.065   25.461  1.00 42.66 ? 198  THR A OG1 1 
ATOM   1536 C CG2 . THR A 1 198 ? 20.337  2.567   23.658  1.00 39.63 ? 198  THR A CG2 1 
ATOM   1537 N N   . LEU A 1 199 ? 23.801  2.836   23.806  1.00 41.33 ? 199  LEU A N   1 
ATOM   1538 C CA  . LEU A 1 199 ? 24.582  3.968   23.327  1.00 41.21 ? 199  LEU A CA  1 
ATOM   1539 C C   . LEU A 1 199 ? 23.733  4.805   22.396  1.00 41.08 ? 199  LEU A C   1 
ATOM   1540 O O   . LEU A 1 199 ? 22.997  4.264   21.577  1.00 41.39 ? 199  LEU A O   1 
ATOM   1541 C CB  . LEU A 1 199 ? 25.817  3.519   22.549  1.00 40.99 ? 199  LEU A CB  1 
ATOM   1542 C CG  . LEU A 1 199 ? 26.739  2.467   23.183  1.00 41.50 ? 199  LEU A CG  1 
ATOM   1543 C CD1 . LEU A 1 199 ? 27.902  2.217   22.247  1.00 38.94 ? 199  LEU A CD1 1 
ATOM   1544 C CD2 . LEU A 1 199 ? 27.217  2.926   24.562  1.00 41.17 ? 199  LEU A CD2 1 
ATOM   1545 N N   . PHE A 1 200 ? 23.866  6.128   22.494  1.00 40.87 ? 200  PHE A N   1 
ATOM   1546 C CA  . PHE A 1 200 ? 23.318  6.992   21.473  1.00 40.26 ? 200  PHE A CA  1 
ATOM   1547 C C   . PHE A 1 200 ? 24.211  8.181   21.154  1.00 40.34 ? 200  PHE A C   1 
ATOM   1548 O O   . PHE A 1 200 ? 24.975  8.680   21.990  1.00 39.90 ? 200  PHE A O   1 
ATOM   1549 C CB  . PHE A 1 200 ? 21.844  7.347   21.746  1.00 40.37 ? 200  PHE A CB  1 
ATOM   1550 C CG  . PHE A 1 200 ? 21.606  8.316   22.866  1.00 39.94 ? 200  PHE A CG  1 
ATOM   1551 C CD1 . PHE A 1 200 ? 22.103  8.104   24.135  1.00 39.57 ? 200  PHE A CD1 1 
ATOM   1552 C CD2 . PHE A 1 200 ? 20.788  9.423   22.661  1.00 40.40 ? 200  PHE A CD2 1 
ATOM   1553 C CE1 . PHE A 1 200 ? 21.831  9.006   25.162  1.00 38.99 ? 200  PHE A CE1 1 
ATOM   1554 C CE2 . PHE A 1 200 ? 20.516  10.311  23.695  1.00 38.96 ? 200  PHE A CE2 1 
ATOM   1555 C CZ  . PHE A 1 200 ? 21.045  10.103  24.934  1.00 38.21 ? 200  PHE A CZ  1 
ATOM   1556 N N   . GLY A 1 201 ? 24.141  8.605   19.900  1.00 39.98 ? 201  GLY A N   1 
ATOM   1557 C CA  . GLY A 1 201 ? 24.992  9.667   19.440  1.00 39.81 ? 201  GLY A CA  1 
ATOM   1558 C C   . GLY A 1 201 ? 24.464  10.239  18.154  1.00 39.85 ? 201  GLY A C   1 
ATOM   1559 O O   . GLY A 1 201 ? 23.604  9.636   17.499  1.00 39.81 ? 201  GLY A O   1 
ATOM   1560 N N   . GLU A 1 202 ? 24.991  11.399  17.794  1.00 39.12 ? 202  GLU A N   1 
ATOM   1561 C CA  . GLU A 1 202 ? 24.600  12.060  16.575  1.00 39.33 ? 202  GLU A CA  1 
ATOM   1562 C C   . GLU A 1 202 ? 25.842  12.445  15.783  1.00 39.09 ? 202  GLU A C   1 
ATOM   1563 O O   . GLU A 1 202 ? 26.878  12.757  16.359  1.00 39.04 ? 202  GLU A O   1 
ATOM   1564 C CB  . GLU A 1 202 ? 23.730  13.274  16.883  1.00 39.24 ? 202  GLU A CB  1 
ATOM   1565 C CG  . GLU A 1 202 ? 23.179  13.978  15.644  1.00 40.79 ? 202  GLU A CG  1 
ATOM   1566 C CD  . GLU A 1 202 ? 24.037  15.121  15.156  1.00 41.74 ? 202  GLU A CD  1 
ATOM   1567 O OE1 . GLU A 1 202 ? 25.010  15.488  15.857  1.00 40.57 ? 202  GLU A OE1 1 
ATOM   1568 O OE2 . GLU A 1 202 ? 23.723  15.660  14.067  1.00 43.34 ? 202  GLU A OE2 1 
ATOM   1569 N N   . SER A 1 203 ? 25.717  12.384  14.460  1.00 39.32 ? 203  SER A N   1 
ATOM   1570 C CA  . SER A 1 203 ? 26.784  12.724  13.533  1.00 39.50 ? 203  SER A CA  1 
ATOM   1571 C C   . SER A 1 203 ? 28.039  11.883  13.808  1.00 39.13 ? 203  SER A C   1 
ATOM   1572 O O   . SER A 1 203 ? 27.956  10.659  13.735  1.00 39.78 ? 203  SER A O   1 
ATOM   1573 C CB  . SER A 1 203 ? 27.046  14.230  13.559  1.00 39.52 ? 203  SER A CB  1 
ATOM   1574 O OG  . SER A 1 203 ? 27.780  14.591  12.392  1.00 42.61 ? 203  SER A OG  1 
ATOM   1575 N N   . ALA A 1 204 ? 29.178  12.505  14.126  1.00 38.45 ? 204  ALA A N   1 
ATOM   1576 C CA  . ALA A 1 204 ? 30.412  11.759  14.486  1.00 38.28 ? 204  ALA A CA  1 
ATOM   1577 C C   . ALA A 1 204 ? 30.200  10.860  15.704  1.00 38.35 ? 204  ALA A C   1 
ATOM   1578 O O   . ALA A 1 204 ? 30.888  9.821   15.871  1.00 39.09 ? 204  ALA A O   1 
ATOM   1579 C CB  . ALA A 1 204 ? 31.595  12.740  14.743  1.00 37.88 ? 204  ALA A CB  1 
ATOM   1580 N N   . GLY A 1 205 ? 29.254  11.249  16.557  1.00 37.34 ? 205  GLY A N   1 
ATOM   1581 C CA  . GLY A 1 205 ? 28.897  10.457  17.711  1.00 37.77 ? 205  GLY A CA  1 
ATOM   1582 C C   . GLY A 1 205 ? 28.174  9.188   17.290  1.00 37.95 ? 205  GLY A C   1 
ATOM   1583 O O   . GLY A 1 205 ? 28.353  8.146   17.892  1.00 38.60 ? 205  GLY A O   1 
ATOM   1584 N N   . ALA A 1 206 ? 27.357  9.300   16.250  1.00 37.71 ? 206  ALA A N   1 
ATOM   1585 C CA  . ALA A 1 206 ? 26.637  8.187   15.668  1.00 38.15 ? 206  ALA A CA  1 
ATOM   1586 C C   . ALA A 1 206 ? 27.627  7.240   14.970  1.00 38.85 ? 206  ALA A C   1 
ATOM   1587 O O   . ALA A 1 206 ? 27.590  6.030   15.164  1.00 39.68 ? 206  ALA A O   1 
ATOM   1588 C CB  . ALA A 1 206 ? 25.584  8.717   14.685  1.00 37.73 ? 206  ALA A CB  1 
ATOM   1589 N N   . ALA A 1 207 ? 28.530  7.801   14.176  1.00 39.19 ? 207  ALA A N   1 
ATOM   1590 C CA  . ALA A 1 207 ? 29.613  7.033   13.569  1.00 39.97 ? 207  ALA A CA  1 
ATOM   1591 C C   . ALA A 1 207 ? 30.378  6.247   14.632  1.00 40.40 ? 207  ALA A C   1 
ATOM   1592 O O   . ALA A 1 207 ? 30.707  5.071   14.446  1.00 41.76 ? 207  ALA A O   1 
ATOM   1593 C CB  . ALA A 1 207 ? 30.581  7.989   12.807  1.00 39.33 ? 207  ALA A CB  1 
ATOM   1594 N N   . SER A 1 208 ? 30.663  6.909   15.748  1.00 40.51 ? 208  SER A N   1 
ATOM   1595 C CA  . SER A 1 208 ? 31.391  6.287   16.869  1.00 40.53 ? 208  SER A CA  1 
ATOM   1596 C C   . SER A 1 208 ? 30.637  5.100   17.436  1.00 40.74 ? 208  SER A C   1 
ATOM   1597 O O   . SER A 1 208 ? 31.226  4.042   17.647  1.00 41.31 ? 208  SER A O   1 
ATOM   1598 C CB  . SER A 1 208 ? 31.659  7.310   17.986  1.00 40.11 ? 208  SER A CB  1 
ATOM   1599 O OG  . SER A 1 208 ? 32.462  8.392   17.523  1.00 40.08 ? 208  SER A OG  1 
ATOM   1600 N N   . VAL A 1 209 ? 29.343  5.289   17.695  1.00 40.33 ? 209  VAL A N   1 
ATOM   1601 C CA  . VAL A 1 209 ? 28.462  4.206   18.151  1.00 40.32 ? 209  VAL A CA  1 
ATOM   1602 C C   . VAL A 1 209 ? 28.586  3.024   17.189  1.00 41.68 ? 209  VAL A C   1 
ATOM   1603 O O   . VAL A 1 209 ? 28.753  1.884   17.625  1.00 41.53 ? 209  VAL A O   1 
ATOM   1604 C CB  . VAL A 1 209 ? 26.965  4.671   18.264  1.00 39.79 ? 209  VAL A CB  1 
ATOM   1605 C CG1 . VAL A 1 209 ? 25.994  3.476   18.361  1.00 39.37 ? 209  VAL A CG1 1 
ATOM   1606 C CG2 . VAL A 1 209 ? 26.790  5.610   19.443  1.00 37.75 ? 209  VAL A CG2 1 
ATOM   1607 N N   . GLY A 1 210 ? 28.535  3.299   15.882  1.00 42.01 ? 210  GLY A N   1 
ATOM   1608 C CA  . GLY A 1 210 ? 28.652  2.222   14.873  1.00 43.12 ? 210  GLY A CA  1 
ATOM   1609 C C   . GLY A 1 210 ? 29.992  1.508   14.913  1.00 43.69 ? 210  GLY A C   1 
ATOM   1610 O O   . GLY A 1 210 ? 30.085  0.316   14.689  1.00 44.60 ? 210  GLY A O   1 
ATOM   1611 N N   . MET A 1 211 ? 31.040  2.246   15.221  1.00 43.82 ? 211  MET A N   1 
ATOM   1612 C CA  . MET A 1 211 ? 32.334  1.644   15.382  1.00 45.35 ? 211  MET A CA  1 
ATOM   1613 C C   . MET A 1 211 ? 32.486  0.785   16.631  1.00 44.31 ? 211  MET A C   1 
ATOM   1614 O O   . MET A 1 211 ? 33.215  -0.189  16.597  1.00 44.23 ? 211  MET A O   1 
ATOM   1615 C CB  . MET A 1 211 ? 33.404  2.716   15.280  1.00 45.56 ? 211  MET A CB  1 
ATOM   1616 C CG  . MET A 1 211 ? 33.578  3.101   13.802  1.00 46.65 ? 211  MET A CG  1 
ATOM   1617 S SD  . MET A 1 211 ? 34.577  4.527   13.731  1.00 49.71 ? 211  MET A SD  1 
ATOM   1618 C CE  . MET A 1 211 ? 34.022  5.285   12.185  1.00 48.04 ? 211  MET A CE  1 
ATOM   1619 N N   . HIS A 1 212 ? 31.773  1.114   17.705  1.00 43.59 ? 212  HIS A N   1 
ATOM   1620 C CA  . HIS A 1 212 ? 31.697  0.217   18.853  1.00 43.74 ? 212  HIS A CA  1 
ATOM   1621 C C   . HIS A 1 212 ? 30.935  -1.073  18.504  1.00 44.45 ? 212  HIS A C   1 
ATOM   1622 O O   . HIS A 1 212 ? 31.291  -2.147  18.973  1.00 44.47 ? 212  HIS A O   1 
ATOM   1623 C CB  . HIS A 1 212 ? 31.108  0.928   20.070  1.00 43.02 ? 212  HIS A CB  1 
ATOM   1624 C CG  . HIS A 1 212 ? 31.990  2.013   20.600  1.00 42.57 ? 212  HIS A CG  1 
ATOM   1625 N ND1 . HIS A 1 212 ? 33.245  1.763   21.107  1.00 42.86 ? 212  HIS A ND1 1 
ATOM   1626 C CD2 . HIS A 1 212 ? 31.813  3.351   20.674  1.00 42.03 ? 212  HIS A CD2 1 
ATOM   1627 C CE1 . HIS A 1 212 ? 33.806  2.906   21.463  1.00 44.27 ? 212  HIS A CE1 1 
ATOM   1628 N NE2 . HIS A 1 212 ? 32.956  3.887   21.214  1.00 41.02 ? 212  HIS A NE2 1 
ATOM   1629 N N   . ILE A 1 213 ? 29.920  -0.965  17.649  1.00 44.59 ? 213  ILE A N   1 
ATOM   1630 C CA  . ILE A 1 213 ? 29.231  -2.143  17.123  1.00 45.64 ? 213  ILE A CA  1 
ATOM   1631 C C   . ILE A 1 213 ? 30.177  -3.044  16.312  1.00 47.19 ? 213  ILE A C   1 
ATOM   1632 O O   . ILE A 1 213 ? 30.045  -4.252  16.343  1.00 48.46 ? 213  ILE A O   1 
ATOM   1633 C CB  . ILE A 1 213 ? 28.017  -1.768  16.237  1.00 45.36 ? 213  ILE A CB  1 
ATOM   1634 C CG1 . ILE A 1 213 ? 26.943  -1.036  17.057  1.00 44.73 ? 213  ILE A CG1 1 
ATOM   1635 C CG2 . ILE A 1 213 ? 27.411  -3.030  15.568  1.00 45.52 ? 213  ILE A CG2 1 
ATOM   1636 C CD1 . ILE A 1 213 ? 25.714  -0.604  16.242  1.00 44.30 ? 213  ILE A CD1 1 
ATOM   1637 N N   . LEU A 1 214 ? 31.123  -2.459  15.582  1.00 47.79 ? 214  LEU A N   1 
ATOM   1638 C CA  . LEU A 1 214 ? 31.985  -3.229  14.681  1.00 48.70 ? 214  LEU A CA  1 
ATOM   1639 C C   . LEU A 1 214 ? 33.311  -3.656  15.304  1.00 49.59 ? 214  LEU A C   1 
ATOM   1640 O O   . LEU A 1 214 ? 34.084  -4.399  14.671  1.00 50.63 ? 214  LEU A O   1 
ATOM   1641 C CB  . LEU A 1 214 ? 32.247  -2.419  13.405  1.00 48.39 ? 214  LEU A CB  1 
ATOM   1642 C CG  . LEU A 1 214 ? 30.978  -2.031  12.629  1.00 48.28 ? 214  LEU A CG  1 
ATOM   1643 C CD1 . LEU A 1 214 ? 31.297  -1.043  11.493  1.00 44.78 ? 214  LEU A CD1 1 
ATOM   1644 C CD2 . LEU A 1 214 ? 30.277  -3.302  12.114  1.00 47.39 ? 214  LEU A CD2 1 
ATOM   1645 N N   . SER A 1 215 ? 33.569  -3.220  16.536  1.00 49.76 ? 215  SER A N   1 
ATOM   1646 C CA  . SER A 1 215 ? 34.792  -3.582  17.259  1.00 50.40 ? 215  SER A CA  1 
ATOM   1647 C C   . SER A 1 215 ? 34.448  -4.485  18.440  1.00 51.83 ? 215  SER A C   1 
ATOM   1648 O O   . SER A 1 215 ? 33.762  -4.068  19.366  1.00 51.27 ? 215  SER A O   1 
ATOM   1649 C CB  . SER A 1 215 ? 35.509  -2.323  17.743  1.00 49.83 ? 215  SER A CB  1 
ATOM   1650 O OG  . SER A 1 215 ? 36.824  -2.609  18.171  1.00 48.57 ? 215  SER A OG  1 
ATOM   1651 N N   . LEU A 1 216 ? 34.951  -5.719  18.406  1.00 53.87 ? 216  LEU A N   1 
ATOM   1652 C CA  . LEU A 1 216 ? 34.561  -6.769  19.357  1.00 55.30 ? 216  LEU A CA  1 
ATOM   1653 C C   . LEU A 1 216 ? 34.725  -6.434  20.844  1.00 54.49 ? 216  LEU A C   1 
ATOM   1654 O O   . LEU A 1 216 ? 33.819  -6.711  21.624  1.00 55.16 ? 216  LEU A O   1 
ATOM   1655 C CB  . LEU A 1 216 ? 35.296  -8.080  19.038  1.00 57.15 ? 216  LEU A CB  1 
ATOM   1656 C CG  . LEU A 1 216 ? 34.556  -8.980  18.035  1.00 60.32 ? 216  LEU A CG  1 
ATOM   1657 C CD1 . LEU A 1 216 ? 35.528  -9.846  17.186  1.00 63.40 ? 216  LEU A CD1 1 
ATOM   1658 C CD2 . LEU A 1 216 ? 33.535  -9.852  18.804  1.00 62.90 ? 216  LEU A CD2 1 
ATOM   1659 N N   . PRO A 1 217 ? 35.871  -5.856  21.244  1.00 53.46 ? 217  PRO A N   1 
ATOM   1660 C CA  . PRO A 1 217 ? 36.048  -5.484  22.650  1.00 53.08 ? 217  PRO A CA  1 
ATOM   1661 C C   . PRO A 1 217 ? 35.008  -4.497  23.198  1.00 52.50 ? 217  PRO A C   1 
ATOM   1662 O O   . PRO A 1 217 ? 34.754  -4.492  24.401  1.00 53.17 ? 217  PRO A O   1 
ATOM   1663 C CB  . PRO A 1 217 ? 37.449  -4.861  22.681  1.00 53.01 ? 217  PRO A CB  1 
ATOM   1664 C CG  . PRO A 1 217 ? 38.136  -5.363  21.471  1.00 53.44 ? 217  PRO A CG  1 
ATOM   1665 C CD  . PRO A 1 217 ? 37.066  -5.552  20.442  1.00 53.40 ? 217  PRO A CD  1 
ATOM   1666 N N   . SER A 1 218 ? 34.426  -3.662  22.345  1.00 51.65 ? 218  SER A N   1 
ATOM   1667 C CA  . SER A 1 218 ? 33.325  -2.784  22.764  1.00 51.14 ? 218  SER A CA  1 
ATOM   1668 C C   . SER A 1 218 ? 31.992  -3.518  22.941  1.00 51.64 ? 218  SER A C   1 
ATOM   1669 O O   . SER A 1 218 ? 31.145  -3.089  23.720  1.00 50.75 ? 218  SER A O   1 
ATOM   1670 C CB  . SER A 1 218 ? 33.132  -1.650  21.766  1.00 50.13 ? 218  SER A CB  1 
ATOM   1671 O OG  . SER A 1 218 ? 34.205  -0.729  21.820  1.00 49.88 ? 218  SER A OG  1 
ATOM   1672 N N   . ARG A 1 219 ? 31.806  -4.618  22.215  1.00 53.04 ? 219  ARG A N   1 
ATOM   1673 C CA  . ARG A 1 219 ? 30.492  -5.269  22.134  1.00 54.01 ? 219  ARG A CA  1 
ATOM   1674 C C   . ARG A 1 219 ? 29.971  -5.773  23.458  1.00 54.02 ? 219  ARG A C   1 
ATOM   1675 O O   . ARG A 1 219 ? 28.756  -5.789  23.683  1.00 54.16 ? 219  ARG A O   1 
ATOM   1676 C CB  . ARG A 1 219 ? 30.510  -6.414  21.115  1.00 55.45 ? 219  ARG A CB  1 
ATOM   1677 C CG  . ARG A 1 219 ? 30.525  -5.933  19.681  1.00 57.55 ? 219  ARG A CG  1 
ATOM   1678 C CD  . ARG A 1 219 ? 29.245  -5.166  19.338  1.00 61.59 ? 219  ARG A CD  1 
ATOM   1679 N NE  . ARG A 1 219 ? 28.058  -6.022  19.266  1.00 63.85 ? 219  ARG A NE  1 
ATOM   1680 C CZ  . ARG A 1 219 ? 27.743  -6.798  18.226  1.00 66.73 ? 219  ARG A CZ  1 
ATOM   1681 N NH1 . ARG A 1 219 ? 28.534  -6.872  17.154  1.00 67.73 ? 219  ARG A NH1 1 
ATOM   1682 N NH2 . ARG A 1 219 ? 26.629  -7.532  18.270  1.00 67.01 ? 219  ARG A NH2 1 
ATOM   1683 N N   . SER A 1 220 ? 30.888  -6.166  24.337  1.00 53.91 ? 220  SER A N   1 
ATOM   1684 C CA  . SER A 1 220 ? 30.524  -6.612  25.667  1.00 54.30 ? 220  SER A CA  1 
ATOM   1685 C C   . SER A 1 220 ? 30.176  -5.466  26.609  1.00 52.29 ? 220  SER A C   1 
ATOM   1686 O O   . SER A 1 220 ? 29.768  -5.713  27.744  1.00 53.35 ? 220  SER A O   1 
ATOM   1687 C CB  . SER A 1 220 ? 31.658  -7.467  26.279  1.00 55.74 ? 220  SER A CB  1 
ATOM   1688 O OG  . SER A 1 220 ? 32.883  -6.746  26.361  1.00 57.20 ? 220  SER A OG  1 
ATOM   1689 N N   . LEU A 1 221 ? 30.303  -4.215  26.159  1.00 49.89 ? 221  LEU A N   1 
ATOM   1690 C CA  . LEU A 1 221 ? 30.131  -3.080  27.061  1.00 47.45 ? 221  LEU A CA  1 
ATOM   1691 C C   . LEU A 1 221 ? 28.785  -2.391  26.865  1.00 46.50 ? 221  LEU A C   1 
ATOM   1692 O O   . LEU A 1 221 ? 28.468  -1.422  27.559  1.00 45.57 ? 221  LEU A O   1 
ATOM   1693 C CB  . LEU A 1 221 ? 31.299  -2.104  26.913  1.00 46.59 ? 221  LEU A CB  1 
ATOM   1694 C CG  . LEU A 1 221 ? 32.694  -2.731  27.059  1.00 47.01 ? 221  LEU A CG  1 
ATOM   1695 C CD1 . LEU A 1 221 ? 33.772  -1.775  26.575  1.00 44.84 ? 221  LEU A CD1 1 
ATOM   1696 C CD2 . LEU A 1 221 ? 32.972  -3.216  28.495  1.00 44.58 ? 221  LEU A CD2 1 
ATOM   1697 N N   . PHE A 1 222 ? 27.979  -2.907  25.944  1.00 46.12 ? 222  PHE A N   1 
ATOM   1698 C CA  . PHE A 1 222 ? 26.635  -2.361  25.714  1.00 45.67 ? 222  PHE A CA  1 
ATOM   1699 C C   . PHE A 1 222 ? 25.752  -3.372  25.007  1.00 46.26 ? 222  PHE A C   1 
ATOM   1700 O O   . PHE A 1 222 ? 26.239  -4.375  24.498  1.00 46.75 ? 222  PHE A O   1 
ATOM   1701 C CB  . PHE A 1 222 ? 26.691  -1.064  24.896  1.00 44.59 ? 222  PHE A CB  1 
ATOM   1702 C CG  . PHE A 1 222 ? 27.079  -1.266  23.461  1.00 43.68 ? 222  PHE A CG  1 
ATOM   1703 C CD1 . PHE A 1 222 ? 28.409  -1.464  23.109  1.00 44.17 ? 222  PHE A CD1 1 
ATOM   1704 C CD2 . PHE A 1 222 ? 26.116  -1.258  22.461  1.00 44.43 ? 222  PHE A CD2 1 
ATOM   1705 C CE1 . PHE A 1 222 ? 28.778  -1.666  21.784  1.00 44.37 ? 222  PHE A CE1 1 
ATOM   1706 C CE2 . PHE A 1 222 ? 26.471  -1.454  21.133  1.00 45.64 ? 222  PHE A CE2 1 
ATOM   1707 C CZ  . PHE A 1 222 ? 27.815  -1.664  20.795  1.00 45.29 ? 222  PHE A CZ  1 
ATOM   1708 N N   . HIS A 1 223 ? 24.462  -3.064  24.946  1.00 46.52 ? 223  HIS A N   1 
ATOM   1709 C CA  . HIS A 1 223 ? 23.448  -4.005  24.491  1.00 47.88 ? 223  HIS A CA  1 
ATOM   1710 C C   . HIS A 1 223 ? 22.609  -3.541  23.300  1.00 48.35 ? 223  HIS A C   1 
ATOM   1711 O O   . HIS A 1 223 ? 22.079  -4.378  22.550  1.00 49.75 ? 223  HIS A O   1 
ATOM   1712 C CB  . HIS A 1 223 ? 22.546  -4.306  25.681  1.00 48.25 ? 223  HIS A CB  1 
ATOM   1713 C CG  . HIS A 1 223 ? 23.320  -4.610  26.925  1.00 48.72 ? 223  HIS A CG  1 
ATOM   1714 N ND1 . HIS A 1 223 ? 23.699  -5.888  27.268  1.00 47.69 ? 223  HIS A ND1 1 
ATOM   1715 C CD2 . HIS A 1 223 ? 23.859  -3.793  27.858  1.00 46.59 ? 223  HIS A CD2 1 
ATOM   1716 C CE1 . HIS A 1 223 ? 24.404  -5.846  28.382  1.00 48.07 ? 223  HIS A CE1 1 
ATOM   1717 N NE2 . HIS A 1 223 ? 24.524  -4.584  28.756  1.00 48.00 ? 223  HIS A NE2 1 
ATOM   1718 N N   . ARG A 1 224 ? 22.456  -2.230  23.152  1.00 47.23 ? 224  ARG A N   1 
ATOM   1719 C CA  . ARG A 1 224 ? 21.608  -1.645  22.112  1.00 47.70 ? 224  ARG A CA  1 
ATOM   1720 C C   . ARG A 1 224 ? 22.245  -0.316  21.655  1.00 45.66 ? 224  ARG A C   1 
ATOM   1721 O O   . ARG A 1 224 ? 23.095  0.211   22.349  1.00 44.52 ? 224  ARG A O   1 
ATOM   1722 C CB  . ARG A 1 224 ? 20.208  -1.381  22.669  1.00 48.00 ? 224  ARG A CB  1 
ATOM   1723 C CG  . ARG A 1 224 ? 19.354  -2.595  22.728  1.00 51.44 ? 224  ARG A CG  1 
ATOM   1724 C CD  . ARG A 1 224 ? 18.069  -2.335  23.486  1.00 52.47 ? 224  ARG A CD  1 
ATOM   1725 N NE  . ARG A 1 224 ? 18.322  -2.168  24.911  1.00 55.46 ? 224  ARG A NE  1 
ATOM   1726 C CZ  . ARG A 1 224 ? 18.574  -3.163  25.759  1.00 56.53 ? 224  ARG A CZ  1 
ATOM   1727 N NH1 . ARG A 1 224 ? 18.631  -4.418  25.344  1.00 59.33 ? 224  ARG A NH1 1 
ATOM   1728 N NH2 . ARG A 1 224 ? 18.778  -2.893  27.037  1.00 57.20 ? 224  ARG A NH2 1 
ATOM   1729 N N   . ALA A 1 225 ? 21.838  0.205   20.500  1.00 45.24 ? 225  ALA A N   1 
ATOM   1730 C CA  . ALA A 1 225 ? 22.497  1.381   19.908  1.00 44.26 ? 225  ALA A CA  1 
ATOM   1731 C C   . ALA A 1 225 ? 21.542  2.261   19.115  1.00 43.65 ? 225  ALA A C   1 
ATOM   1732 O O   . ALA A 1 225 ? 20.655  1.755   18.435  1.00 43.99 ? 225  ALA A O   1 
ATOM   1733 C CB  . ALA A 1 225 ? 23.639  0.939   19.022  1.00 44.11 ? 225  ALA A CB  1 
ATOM   1734 N N   . VAL A 1 226 ? 21.726  3.583   19.235  1.00 43.09 ? 226  VAL A N   1 
ATOM   1735 C CA  . VAL A 1 226 ? 21.033  4.582   18.423  1.00 42.23 ? 226  VAL A CA  1 
ATOM   1736 C C   . VAL A 1 226 ? 22.041  5.434   17.631  1.00 41.77 ? 226  VAL A C   1 
ATOM   1737 O O   . VAL A 1 226 ? 22.955  6.050   18.207  1.00 40.73 ? 226  VAL A O   1 
ATOM   1738 C CB  . VAL A 1 226 ? 20.162  5.516   19.290  1.00 42.38 ? 226  VAL A CB  1 
ATOM   1739 C CG1 . VAL A 1 226 ? 19.399  6.525   18.404  1.00 40.29 ? 226  VAL A CG1 1 
ATOM   1740 C CG2 . VAL A 1 226 ? 19.207  4.693   20.170  1.00 42.19 ? 226  VAL A CG2 1 
ATOM   1741 N N   . LEU A 1 227 ? 21.862  5.459   16.310  1.00 41.67 ? 227  LEU A N   1 
ATOM   1742 C CA  . LEU A 1 227 ? 22.708  6.229   15.402  1.00 40.69 ? 227  LEU A CA  1 
ATOM   1743 C C   . LEU A 1 227 ? 21.875  7.305   14.736  1.00 40.47 ? 227  LEU A C   1 
ATOM   1744 O O   . LEU A 1 227 ? 21.079  7.014   13.840  1.00 40.46 ? 227  LEU A O   1 
ATOM   1745 C CB  . LEU A 1 227 ? 23.329  5.315   14.334  1.00 40.99 ? 227  LEU A CB  1 
ATOM   1746 C CG  . LEU A 1 227 ? 24.404  4.301   14.783  1.00 41.67 ? 227  LEU A CG  1 
ATOM   1747 C CD1 . LEU A 1 227 ? 23.747  3.109   15.447  1.00 39.49 ? 227  LEU A CD1 1 
ATOM   1748 C CD2 . LEU A 1 227 ? 25.308  3.831   13.606  1.00 40.43 ? 227  LEU A CD2 1 
ATOM   1749 N N   . GLN A 1 228 ? 22.076  8.549   15.170  1.00 40.26 ? 228  GLN A N   1 
ATOM   1750 C CA  . GLN A 1 228 ? 21.380  9.722   14.639  1.00 39.90 ? 228  GLN A CA  1 
ATOM   1751 C C   . GLN A 1 228 ? 22.246  10.483  13.625  1.00 39.57 ? 228  GLN A C   1 
ATOM   1752 O O   . GLN A 1 228 ? 23.284  11.029  13.971  1.00 39.15 ? 228  GLN A O   1 
ATOM   1753 C CB  . GLN A 1 228 ? 20.969  10.649  15.788  1.00 40.28 ? 228  GLN A CB  1 
ATOM   1754 C CG  . GLN A 1 228 ? 20.171  9.941   16.903  1.00 40.66 ? 228  GLN A CG  1 
ATOM   1755 C CD  . GLN A 1 228 ? 19.899  10.815  18.096  1.00 40.97 ? 228  GLN A CD  1 
ATOM   1756 O OE1 . GLN A 1 228 ? 19.767  10.315  19.218  1.00 41.21 ? 228  GLN A OE1 1 
ATOM   1757 N NE2 . GLN A 1 228 ? 19.831  12.134  17.876  1.00 43.46 ? 228  GLN A NE2 1 
ATOM   1758 N N   . SER A 1 229 ? 21.818  10.483  12.365  1.00 40.13 ? 229  SER A N   1 
ATOM   1759 C CA  . SER A 1 229 ? 22.474  11.220  11.281  1.00 39.80 ? 229  SER A CA  1 
ATOM   1760 C C   . SER A 1 229 ? 23.968  10.914  11.195  1.00 39.67 ? 229  SER A C   1 
ATOM   1761 O O   . SER A 1 229 ? 24.783  11.799  11.018  1.00 40.08 ? 229  SER A O   1 
ATOM   1762 C CB  . SER A 1 229 ? 22.240  12.736  11.433  1.00 39.85 ? 229  SER A CB  1 
ATOM   1763 O OG  . SER A 1 229 ? 20.865  13.058  11.574  1.00 40.04 ? 229  SER A OG  1 
ATOM   1764 N N   . GLY A 1 230 ? 24.334  9.650   11.309  1.00 40.68 ? 230  GLY A N   1 
ATOM   1765 C CA  . GLY A 1 230 ? 25.740  9.264   11.235  1.00 40.75 ? 230  GLY A CA  1 
ATOM   1766 C C   . GLY A 1 230 ? 25.924  7.768   11.190  1.00 41.41 ? 230  GLY A C   1 
ATOM   1767 O O   . GLY A 1 230 ? 25.100  7.024   11.721  1.00 41.27 ? 230  GLY A O   1 
ATOM   1768 N N   . THR A 1 231 ? 27.016  7.336   10.563  1.00 41.98 ? 231  THR A N   1 
ATOM   1769 C CA  . THR A 1 231 ? 27.277  5.922   10.320  1.00 42.84 ? 231  THR A CA  1 
ATOM   1770 C C   . THR A 1 231 ? 28.793  5.678   10.287  1.00 43.05 ? 231  THR A C   1 
ATOM   1771 O O   . THR A 1 231 ? 29.548  6.587   9.974   1.00 43.23 ? 231  THR A O   1 
ATOM   1772 C CB  . THR A 1 231 ? 26.650  5.458   8.953   1.00 43.54 ? 231  THR A CB  1 
ATOM   1773 O OG1 . THR A 1 231 ? 27.199  6.231   7.880   1.00 43.59 ? 231  THR A OG1 1 
ATOM   1774 C CG2 . THR A 1 231 ? 25.142  5.629   8.932   1.00 42.60 ? 231  THR A CG2 1 
ATOM   1775 N N   . PRO A 1 232 ? 29.248  4.461   10.627  1.00 43.52 ? 232  PRO A N   1 
ATOM   1776 C CA  . PRO A 1 232 ? 30.692  4.176   10.514  1.00 43.92 ? 232  PRO A CA  1 
ATOM   1777 C C   . PRO A 1 232 ? 31.151  3.964   9.055   1.00 44.65 ? 232  PRO A C   1 
ATOM   1778 O O   . PRO A 1 232 ? 32.277  4.312   8.704   1.00 44.08 ? 232  PRO A O   1 
ATOM   1779 C CB  . PRO A 1 232 ? 30.849  2.897   11.334  1.00 44.01 ? 232  PRO A CB  1 
ATOM   1780 C CG  . PRO A 1 232 ? 29.524  2.207   11.212  1.00 44.43 ? 232  PRO A CG  1 
ATOM   1781 C CD  . PRO A 1 232 ? 28.494  3.303   11.150  1.00 43.69 ? 232  PRO A CD  1 
ATOM   1782 N N   . ASN A 1 233 ? 30.284  3.372   8.230   1.00 45.32 ? 233  ASN A N   1 
ATOM   1783 C CA  . ASN A 1 233 ? 30.479  3.370   6.789   1.00 45.92 ? 233  ASN A CA  1 
ATOM   1784 C C   . ASN A 1 233 ? 30.271  4.773   6.243   1.00 45.93 ? 233  ASN A C   1 
ATOM   1785 O O   . ASN A 1 233 ? 29.768  5.662   6.948   1.00 45.95 ? 233  ASN A O   1 
ATOM   1786 C CB  . ASN A 1 233 ? 29.525  2.391   6.087   1.00 46.39 ? 233  ASN A CB  1 
ATOM   1787 C CG  . ASN A 1 233 ? 28.059  2.624   6.441   1.00 46.68 ? 233  ASN A CG  1 
ATOM   1788 O OD1 . ASN A 1 233 ? 27.677  2.524   7.601   1.00 46.51 ? 233  ASN A OD1 1 
ATOM   1789 N ND2 . ASN A 1 233 ? 27.231  2.898   5.439   1.00 46.95 ? 233  ASN A ND2 1 
ATOM   1790 N N   . GLY A 1 234 ? 30.630  4.981   4.981   1.00 46.27 ? 234  GLY A N   1 
ATOM   1791 C CA  . GLY A 1 234 ? 30.401  6.277   4.348   1.00 46.25 ? 234  GLY A CA  1 
ATOM   1792 C C   . GLY A 1 234 ? 31.705  7.024   4.112   1.00 46.14 ? 234  GLY A C   1 
ATOM   1793 O O   . GLY A 1 234 ? 32.776  6.584   4.549   1.00 47.36 ? 234  GLY A O   1 
ATOM   1794 N N   . PRO A 1 235 ? 31.627  8.149   3.405   1.00 45.28 ? 235  PRO A N   1 
ATOM   1795 C CA  . PRO A 1 235 ? 32.808  8.794   2.852   1.00 45.05 ? 235  PRO A CA  1 
ATOM   1796 C C   . PRO A 1 235 ? 33.666  9.645   3.807   1.00 44.54 ? 235  PRO A C   1 
ATOM   1797 O O   . PRO A 1 235 ? 34.787  10.032  3.426   1.00 44.94 ? 235  PRO A O   1 
ATOM   1798 C CB  . PRO A 1 235 ? 32.212  9.668   1.748   1.00 45.20 ? 235  PRO A CB  1 
ATOM   1799 C CG  . PRO A 1 235 ? 30.894  10.036  2.253   1.00 45.05 ? 235  PRO A CG  1 
ATOM   1800 C CD  . PRO A 1 235 ? 30.392  8.855   3.028   1.00 44.92 ? 235  PRO A CD  1 
ATOM   1801 N N   . TRP A 1 236 ? 33.175  9.939   5.011   1.00 43.53 ? 236  TRP A N   1 
ATOM   1802 C CA  . TRP A 1 236 ? 33.883  10.870  5.927   1.00 42.95 ? 236  TRP A CA  1 
ATOM   1803 C C   . TRP A 1 236 ? 34.343  10.305  7.276   1.00 42.41 ? 236  TRP A C   1 
ATOM   1804 O O   . TRP A 1 236 ? 35.225  10.891  7.905   1.00 41.95 ? 236  TRP A O   1 
ATOM   1805 C CB  . TRP A 1 236 ? 33.025  12.108  6.206   1.00 42.26 ? 236  TRP A CB  1 
ATOM   1806 C CG  . TRP A 1 236 ? 31.669  11.791  6.769   1.00 41.93 ? 236  TRP A CG  1 
ATOM   1807 C CD1 . TRP A 1 236 ? 30.530  11.622  6.066   1.00 41.51 ? 236  TRP A CD1 1 
ATOM   1808 C CD2 . TRP A 1 236 ? 31.324  11.604  8.153   1.00 40.86 ? 236  TRP A CD2 1 
ATOM   1809 N NE1 . TRP A 1 236 ? 29.491  11.334  6.912   1.00 42.39 ? 236  TRP A NE1 1 
ATOM   1810 C CE2 . TRP A 1 236 ? 29.954  11.309  8.200   1.00 42.14 ? 236  TRP A CE2 1 
ATOM   1811 C CE3 . TRP A 1 236 ? 32.047  11.643  9.353   1.00 41.53 ? 236  TRP A CE3 1 
ATOM   1812 C CZ2 . TRP A 1 236 ? 29.278  11.060  9.400   1.00 41.42 ? 236  TRP A CZ2 1 
ATOM   1813 C CZ3 . TRP A 1 236 ? 31.383  11.392  10.544  1.00 41.19 ? 236  TRP A CZ3 1 
ATOM   1814 C CH2 . TRP A 1 236 ? 30.008  11.101  10.556  1.00 41.41 ? 236  TRP A CH2 1 
ATOM   1815 N N   . ALA A 1 237 ? 33.736  9.205   7.720   1.00 41.89 ? 237  ALA A N   1 
ATOM   1816 C CA  . ALA A 1 237 ? 33.890  8.716   9.099   1.00 41.96 ? 237  ALA A CA  1 
ATOM   1817 C C   . ALA A 1 237 ? 35.194  7.960   9.342   1.00 42.16 ? 237  ALA A C   1 
ATOM   1818 O O   . ALA A 1 237 ? 35.606  7.818   10.491  1.00 41.98 ? 237  ALA A O   1 
ATOM   1819 C CB  . ALA A 1 237 ? 32.676  7.827   9.514   1.00 41.20 ? 237  ALA A CB  1 
ATOM   1820 N N   . THR A 1 238 ? 35.822  7.452   8.280   1.00 42.49 ? 238  THR A N   1 
ATOM   1821 C CA  . THR A 1 238 ? 37.138  6.790   8.408   1.00 42.92 ? 238  THR A CA  1 
ATOM   1822 C C   . THR A 1 238 ? 38.092  7.190   7.283   1.00 43.10 ? 238  THR A C   1 
ATOM   1823 O O   . THR A 1 238 ? 37.671  7.732   6.243   1.00 42.81 ? 238  THR A O   1 
ATOM   1824 C CB  . THR A 1 238 ? 37.037  5.248   8.383   1.00 43.72 ? 238  THR A CB  1 
ATOM   1825 O OG1 . THR A 1 238 ? 36.535  4.813   7.105   1.00 43.85 ? 238  THR A OG1 1 
ATOM   1826 C CG2 . THR A 1 238 ? 36.141  4.723   9.519   1.00 43.34 ? 238  THR A CG2 1 
ATOM   1827 N N   . VAL A 1 239 ? 39.377  6.936   7.510   1.00 43.25 ? 239  VAL A N   1 
ATOM   1828 C CA  . VAL A 1 239 ? 40.392  7.031   6.456   1.00 43.47 ? 239  VAL A CA  1 
ATOM   1829 C C   . VAL A 1 239 ? 41.208  5.745   6.433   1.00 44.46 ? 239  VAL A C   1 
ATOM   1830 O O   . VAL A 1 239 ? 41.264  5.029   7.424   1.00 44.38 ? 239  VAL A O   1 
ATOM   1831 C CB  . VAL A 1 239 ? 41.347  8.235   6.653   1.00 43.60 ? 239  VAL A CB  1 
ATOM   1832 C CG1 . VAL A 1 239 ? 40.626  9.567   6.354   1.00 41.43 ? 239  VAL A CG1 1 
ATOM   1833 C CG2 . VAL A 1 239 ? 41.987  8.227   8.060   1.00 41.70 ? 239  VAL A CG2 1 
ATOM   1834 N N   . SER A 1 240 ? 41.838  5.449   5.300   1.00 45.57 ? 240  SER A N   1 
ATOM   1835 C CA  . SER A 1 240 ? 42.781  4.330   5.228   1.00 47.10 ? 240  SER A CA  1 
ATOM   1836 C C   . SER A 1 240 ? 44.000  4.641   6.077   1.00 47.18 ? 240  SER A C   1 
ATOM   1837 O O   . SER A 1 240 ? 44.228  5.788   6.433   1.00 46.69 ? 240  SER A O   1 
ATOM   1838 C CB  . SER A 1 240 ? 43.225  4.075   3.788   1.00 47.70 ? 240  SER A CB  1 
ATOM   1839 O OG  . SER A 1 240 ? 43.953  5.188   3.310   1.00 49.18 ? 240  SER A OG  1 
ATOM   1840 N N   . ALA A 1 241 ? 44.776  3.609   6.404   1.00 48.26 ? 241  ALA A N   1 
ATOM   1841 C CA  . ALA A 1 241 ? 46.033  3.795   7.107   1.00 48.79 ? 241  ALA A CA  1 
ATOM   1842 C C   . ALA A 1 241 ? 46.961  4.692   6.294   1.00 49.28 ? 241  ALA A C   1 
ATOM   1843 O O   . ALA A 1 241 ? 47.654  5.528   6.855   1.00 49.99 ? 241  ALA A O   1 
ATOM   1844 C CB  . ALA A 1 241 ? 46.718  2.430   7.391   1.00 49.70 ? 241  ALA A CB  1 
ATOM   1845 N N   . GLY A 1 242 ? 46.994  4.506   4.980   1.00 49.73 ? 242  GLY A N   1 
ATOM   1846 C CA  . GLY A 1 242 ? 47.864  5.320   4.124   1.00 50.32 ? 242  GLY A CA  1 
ATOM   1847 C C   . GLY A 1 242 ? 47.527  6.805   4.162   1.00 49.53 ? 242  GLY A C   1 
ATOM   1848 O O   . GLY A 1 242 ? 48.423  7.657   4.233   1.00 49.80 ? 242  GLY A O   1 
ATOM   1849 N N   . GLU A 1 243 ? 46.236  7.117   4.115   1.00 48.42 ? 243  GLU A N   1 
ATOM   1850 C CA  . GLU A 1 243 ? 45.783  8.508   4.129   1.00 47.72 ? 243  GLU A CA  1 
ATOM   1851 C C   . GLU A 1 243 ? 46.036  9.146   5.500   1.00 47.24 ? 243  GLU A C   1 
ATOM   1852 O O   . GLU A 1 243 ? 46.528  10.259  5.579   1.00 47.20 ? 243  GLU A O   1 
ATOM   1853 C CB  . GLU A 1 243 ? 44.308  8.583   3.720   1.00 47.25 ? 243  GLU A CB  1 
ATOM   1854 C CG  . GLU A 1 243 ? 43.662  9.979   3.720   1.00 46.84 ? 243  GLU A CG  1 
ATOM   1855 C CD  . GLU A 1 243 ? 44.263  10.939  2.717   1.00 47.00 ? 243  GLU A CD  1 
ATOM   1856 O OE1 . GLU A 1 243 ? 43.842  12.104  2.711   1.00 47.55 ? 243  GLU A OE1 1 
ATOM   1857 O OE2 . GLU A 1 243 ? 45.141  10.547  1.927   1.00 50.55 ? 243  GLU A OE2 1 
ATOM   1858 N N   . ALA A 1 244 ? 45.753  8.413   6.575   1.00 47.30 ? 244  ALA A N   1 
ATOM   1859 C CA  . ALA A 1 244 ? 46.096  8.852   7.935   1.00 46.63 ? 244  ALA A CA  1 
ATOM   1860 C C   . ALA A 1 244 ? 47.579  9.235   8.053   1.00 47.46 ? 244  ALA A C   1 
ATOM   1861 O O   . ALA A 1 244 ? 47.916  10.311  8.554   1.00 47.39 ? 244  ALA A O   1 
ATOM   1862 C CB  . ALA A 1 244 ? 45.754  7.769   8.933   1.00 45.96 ? 244  ALA A CB  1 
ATOM   1863 N N   . ARG A 1 245 ? 48.457  8.357   7.575   1.00 48.11 ? 245  ARG A N   1 
ATOM   1864 C CA  . ARG A 1 245 ? 49.899  8.605   7.613   1.00 49.13 ? 245  ARG A CA  1 
ATOM   1865 C C   . ARG A 1 245 ? 50.278  9.873   6.830   1.00 49.42 ? 245  ARG A C   1 
ATOM   1866 O O   . ARG A 1 245 ? 51.120  10.674  7.271   1.00 49.30 ? 245  ARG A O   1 
ATOM   1867 C CB  . ARG A 1 245 ? 50.651  7.378   7.050   1.00 50.21 ? 245  ARG A CB  1 
ATOM   1868 C CG  . ARG A 1 245 ? 52.171  7.530   6.935   1.00 51.03 ? 245  ARG A CG  1 
ATOM   1869 C CD  . ARG A 1 245 ? 52.857  6.172   6.743   1.00 52.24 ? 245  ARG A CD  1 
ATOM   1870 N NE  . ARG A 1 245 ? 52.797  5.349   7.951   1.00 51.95 ? 245  ARG A NE  1 
ATOM   1871 C CZ  . ARG A 1 245 ? 53.627  5.470   8.984   1.00 52.92 ? 245  ARG A CZ  1 
ATOM   1872 N NH1 . ARG A 1 245 ? 54.607  6.375   8.982   1.00 53.59 ? 245  ARG A NH1 1 
ATOM   1873 N NH2 . ARG A 1 245 ? 53.474  4.682   10.033  1.00 52.68 ? 245  ARG A NH2 1 
ATOM   1874 N N   . ARG A 1 246 ? 49.661  10.038  5.664   1.00 49.28 ? 246  ARG A N   1 
ATOM   1875 C CA  . ARG A 1 246 ? 49.917  11.200  4.827   1.00 50.22 ? 246  ARG A CA  1 
ATOM   1876 C C   . ARG A 1 246 ? 49.522  12.509  5.536   1.00 49.37 ? 246  ARG A C   1 
ATOM   1877 O O   . ARG A 1 246 ? 50.282  13.479  5.533   1.00 49.04 ? 246  ARG A O   1 
ATOM   1878 C CB  . ARG A 1 246 ? 49.154  11.083  3.512   1.00 50.23 ? 246  ARG A CB  1 
ATOM   1879 C CG  . ARG A 1 246 ? 49.556  12.145  2.497   1.00 51.84 ? 246  ARG A CG  1 
ATOM   1880 C CD  . ARG A 1 246 ? 48.586  12.217  1.347   1.00 51.95 ? 246  ARG A CD  1 
ATOM   1881 N NE  . ARG A 1 246 ? 47.257  12.712  1.733   1.00 52.90 ? 246  ARG A NE  1 
ATOM   1882 C CZ  . ARG A 1 246 ? 46.963  13.988  1.986   1.00 52.52 ? 246  ARG A CZ  1 
ATOM   1883 N NH1 . ARG A 1 246 ? 45.721  14.322  2.293   1.00 50.90 ? 246  ARG A NH1 1 
ATOM   1884 N NH2 . ARG A 1 246 ? 47.891  14.938  1.916   1.00 54.05 ? 246  ARG A NH2 1 
ATOM   1885 N N   . ARG A 1 247 ? 48.332  12.524  6.136   1.00 48.18 ? 247  ARG A N   1 
ATOM   1886 C CA  . ARG A 1 247 ? 47.848  13.717  6.836   1.00 47.44 ? 247  ARG A CA  1 
ATOM   1887 C C   . ARG A 1 247 ? 48.692  14.047  8.070   1.00 47.42 ? 247  ARG A C   1 
ATOM   1888 O O   . ARG A 1 247 ? 48.988  15.216  8.329   1.00 47.76 ? 247  ARG A O   1 
ATOM   1889 C CB  . ARG A 1 247 ? 46.389  13.541  7.233   1.00 46.37 ? 247  ARG A CB  1 
ATOM   1890 C CG  . ARG A 1 247 ? 45.456  13.500  6.041   1.00 45.84 ? 247  ARG A CG  1 
ATOM   1891 C CD  . ARG A 1 247 ? 44.016  13.345  6.476   1.00 45.45 ? 247  ARG A CD  1 
ATOM   1892 N NE  . ARG A 1 247 ? 43.161  13.088  5.328   1.00 44.66 ? 247  ARG A NE  1 
ATOM   1893 C CZ  . ARG A 1 247 ? 41.847  12.970  5.379   1.00 44.93 ? 247  ARG A CZ  1 
ATOM   1894 N NH1 . ARG A 1 247 ? 41.188  13.120  6.516   1.00 45.62 ? 247  ARG A NH1 1 
ATOM   1895 N NH2 . ARG A 1 247 ? 41.181  12.718  4.270   1.00 46.18 ? 247  ARG A NH2 1 
ATOM   1896 N N   . ALA A 1 248 ? 49.080  13.014  8.813   1.00 47.32 ? 248  ALA A N   1 
ATOM   1897 C CA  . ALA A 1 248 ? 49.890  13.172  10.020  1.00 47.23 ? 248  ALA A CA  1 
ATOM   1898 C C   . ALA A 1 248 ? 51.254  13.727  9.669   1.00 48.13 ? 248  ALA A C   1 
ATOM   1899 O O   . ALA A 1 248 ? 51.759  14.611  10.358  1.00 48.59 ? 248  ALA A O   1 
ATOM   1900 C CB  . ALA A 1 248 ? 50.033  11.844  10.748  1.00 46.87 ? 248  ALA A CB  1 
ATOM   1901 N N   . THR A 1 249 ? 51.844  13.206  8.594   1.00 48.84 ? 249  THR A N   1 
ATOM   1902 C CA  . THR A 1 249 ? 53.183  13.617  8.167   1.00 49.83 ? 249  THR A CA  1 
ATOM   1903 C C   . THR A 1 249 ? 53.179  15.029  7.621   1.00 49.71 ? 249  THR A C   1 
ATOM   1904 O O   . THR A 1 249 ? 54.111  15.786  7.880   1.00 50.48 ? 249  THR A O   1 
ATOM   1905 C CB  . THR A 1 249 ? 53.760  12.656  7.094   1.00 50.76 ? 249  THR A CB  1 
ATOM   1906 O OG1 . THR A 1 249 ? 53.867  11.343  7.651   1.00 52.09 ? 249  THR A OG1 1 
ATOM   1907 C CG2 . THR A 1 249 ? 55.134  13.111  6.622   1.00 50.51 ? 249  THR A CG2 1 
ATOM   1908 N N   . LEU A 1 250 ? 52.152  15.377  6.845   1.00 48.88 ? 250  LEU A N   1 
ATOM   1909 C CA  . LEU A 1 250 ? 52.003  16.751  6.372   1.00 48.94 ? 250  LEU A CA  1 
ATOM   1910 C C   . LEU A 1 250 ? 51.851  17.700  7.567   1.00 48.85 ? 250  LEU A C   1 
ATOM   1911 O O   . LEU A 1 250 ? 52.568  18.686  7.680   1.00 49.06 ? 250  LEU A O   1 
ATOM   1912 C CB  . LEU A 1 250 ? 50.805  16.888  5.422   1.00 48.26 ? 250  LEU A CB  1 
ATOM   1913 C CG  . LEU A 1 250 ? 50.571  18.274  4.795   1.00 48.17 ? 250  LEU A CG  1 
ATOM   1914 C CD1 . LEU A 1 250 ? 51.849  18.797  4.113   1.00 48.19 ? 250  LEU A CD1 1 
ATOM   1915 C CD2 . LEU A 1 250 ? 49.417  18.245  3.804   1.00 47.33 ? 250  LEU A CD2 1 
ATOM   1916 N N   . LEU A 1 251 ? 50.916  17.389  8.459   1.00 48.70 ? 251  LEU A N   1 
ATOM   1917 C CA  . LEU A 1 251 ? 50.704  18.210  9.640   1.00 48.99 ? 251  LEU A CA  1 
ATOM   1918 C C   . LEU A 1 251 ? 52.019  18.440  10.370  1.00 49.75 ? 251  LEU A C   1 
ATOM   1919 O O   . LEU A 1 251 ? 52.345  19.571  10.694  1.00 49.68 ? 251  LEU A O   1 
ATOM   1920 C CB  . LEU A 1 251 ? 49.699  17.572  10.599  1.00 48.47 ? 251  LEU A CB  1 
ATOM   1921 C CG  . LEU A 1 251 ? 49.421  18.498  11.797  1.00 49.97 ? 251  LEU A CG  1 
ATOM   1922 C CD1 . LEU A 1 251 ? 48.075  19.178  11.666  1.00 49.90 ? 251  LEU A CD1 1 
ATOM   1923 C CD2 . LEU A 1 251 ? 49.543  17.755  13.119  1.00 51.15 ? 251  LEU A CD2 1 
ATOM   1924 N N   . ALA A 1 252 ? 52.768  17.368  10.614  1.00 50.61 ? 252  ALA A N   1 
ATOM   1925 C CA  . ALA A 1 252 ? 54.073  17.468  11.262  1.00 52.01 ? 252  ALA A CA  1 
ATOM   1926 C C   . ALA A 1 252 ? 54.987  18.467  10.545  1.00 53.47 ? 252  ALA A C   1 
ATOM   1927 O O   . ALA A 1 252 ? 55.653  19.277  11.192  1.00 53.43 ? 252  ALA A O   1 
ATOM   1928 C CB  . ALA A 1 252 ? 54.749  16.092  11.353  1.00 52.43 ? 252  ALA A CB  1 
ATOM   1929 N N   . ARG A 1 253 ? 55.012  18.413  9.217   1.00 54.59 ? 253  ARG A N   1 
ATOM   1930 C CA  . ARG A 1 253 ? 55.841  19.344  8.434   1.00 57.25 ? 253  ARG A CA  1 
ATOM   1931 C C   . ARG A 1 253 ? 55.394  20.783  8.671   1.00 56.32 ? 253  ARG A C   1 
ATOM   1932 O O   . ARG A 1 253 ? 56.193  21.640  9.016   1.00 56.89 ? 253  ARG A O   1 
ATOM   1933 C CB  . ARG A 1 253 ? 55.778  19.029  6.941   1.00 57.06 ? 253  ARG A CB  1 
ATOM   1934 C CG  . ARG A 1 253 ? 56.576  17.820  6.532   1.00 59.79 ? 253  ARG A CG  1 
ATOM   1935 C CD  . ARG A 1 253 ? 56.737  17.780  5.020   1.00 63.05 ? 253  ARG A CD  1 
ATOM   1936 N NE  . ARG A 1 253 ? 57.550  16.645  4.565   1.00 69.15 ? 253  ARG A NE  1 
ATOM   1937 C CZ  . ARG A 1 253 ? 58.882  16.565  4.648   1.00 73.00 ? 253  ARG A CZ  1 
ATOM   1938 N NH1 . ARG A 1 253 ? 59.506  15.483  4.176   1.00 73.93 ? 253  ARG A NH1 1 
ATOM   1939 N NH2 . ARG A 1 253 ? 59.607  17.543  5.205   1.00 75.94 ? 253  ARG A NH2 1 
ATOM   1940 N N   . LEU A 1 254 ? 54.096  21.014  8.515   1.00 55.35 ? 254  LEU A N   1 
ATOM   1941 C CA  . LEU A 1 254 ? 53.506  22.330  8.712   1.00 55.34 ? 254  LEU A CA  1 
ATOM   1942 C C   . LEU A 1 254 ? 53.801  22.966  10.069  1.00 56.14 ? 254  LEU A C   1 
ATOM   1943 O O   . LEU A 1 254 ? 53.804  24.188  10.170  1.00 57.02 ? 254  LEU A O   1 
ATOM   1944 C CB  . LEU A 1 254 ? 51.995  22.279  8.472   1.00 53.67 ? 254  LEU A CB  1 
ATOM   1945 C CG  . LEU A 1 254 ? 51.632  22.071  7.002   1.00 53.62 ? 254  LEU A CG  1 
ATOM   1946 C CD1 . LEU A 1 254 ? 50.115  21.890  6.798   1.00 51.13 ? 254  LEU A CD1 1 
ATOM   1947 C CD2 . LEU A 1 254 ? 52.184  23.205  6.160   1.00 52.20 ? 254  LEU A CD2 1 
ATOM   1948 N N   . VAL A 1 255 ? 54.065  22.161  11.096  1.00 56.62 ? 255  VAL A N   1 
ATOM   1949 C CA  . VAL A 1 255 ? 54.332  22.696  12.429  1.00 57.56 ? 255  VAL A CA  1 
ATOM   1950 C C   . VAL A 1 255 ? 55.804  22.603  12.812  1.00 60.49 ? 255  VAL A C   1 
ATOM   1951 O O   . VAL A 1 255 ? 56.147  22.766  13.972  1.00 61.35 ? 255  VAL A O   1 
ATOM   1952 C CB  . VAL A 1 255 ? 53.453  22.021  13.523  1.00 56.34 ? 255  VAL A CB  1 
ATOM   1953 C CG1 . VAL A 1 255 ? 51.992  22.274  13.234  1.00 54.07 ? 255  VAL A CG1 1 
ATOM   1954 C CG2 . VAL A 1 255 ? 53.753  20.530  13.639  1.00 54.14 ? 255  VAL A CG2 1 
ATOM   1955 N N   . GLY A 1 256 ? 56.674  22.365  11.837  1.00 62.96 ? 256  GLY A N   1 
ATOM   1956 C CA  . GLY A 1 256 ? 58.110  22.391  12.074  1.00 65.66 ? 256  GLY A CA  1 
ATOM   1957 C C   . GLY A 1 256 ? 58.714  21.101  12.604  1.00 67.20 ? 256  GLY A C   1 
ATOM   1958 O O   . GLY A 1 256 ? 59.809  21.116  13.173  1.00 68.65 ? 256  GLY A O   1 
ATOM   1959 N N   . CYS A 1 257 ? 58.016  19.987  12.401  1.00 67.68 ? 257  CYS A N   1 
ATOM   1960 C CA  . CYS A 1 257 ? 58.522  18.664  12.738  1.00 68.88 ? 257  CYS A CA  1 
ATOM   1961 C C   . CYS A 1 257 ? 58.701  17.834  11.475  1.00 71.15 ? 257  CYS A C   1 
ATOM   1962 O O   . CYS A 1 257 ? 58.013  16.844  11.278  1.00 70.71 ? 257  CYS A O   1 
ATOM   1963 C CB  . CYS A 1 257 ? 57.550  17.958  13.685  1.00 67.25 ? 257  CYS A CB  1 
ATOM   1964 S SG  . CYS A 1 257 ? 57.394  18.762  15.285  1.00 65.73 ? 257  CYS A SG  1 
ATOM   1965 N N   . PRO A 1 258 ? 59.632  18.228  10.599  1.00 75.10 ? 258  PRO A N   1 
ATOM   1966 C CA  . PRO A 1 258 ? 59.834  17.367  9.428   1.00 77.10 ? 258  PRO A CA  1 
ATOM   1967 C C   . PRO A 1 258 ? 60.337  15.967  9.842   1.00 78.31 ? 258  PRO A C   1 
ATOM   1968 O O   . PRO A 1 258 ? 61.043  15.851  10.860  1.00 79.09 ? 258  PRO A O   1 
ATOM   1969 C CB  . PRO A 1 258 ? 60.887  18.124  8.604   1.00 78.23 ? 258  PRO A CB  1 
ATOM   1970 C CG  . PRO A 1 258 ? 61.610  18.987  9.610   1.00 78.59 ? 258  PRO A CG  1 
ATOM   1971 C CD  . PRO A 1 258 ? 60.541  19.388  10.597  1.00 76.52 ? 258  PRO A CD  1 
ATOM   1972 N N   . PRO A 1 259 ? 59.923  14.912  9.099   1.00 79.11 ? 259  PRO A N   1 
ATOM   1973 C CA  . PRO A 1 259 ? 60.377  13.517  9.303   1.00 79.70 ? 259  PRO A CA  1 
ATOM   1974 C C   . PRO A 1 259 ? 61.901  13.342  9.350   1.00 81.75 ? 259  PRO A C   1 
ATOM   1975 O O   . PRO A 1 259 ? 62.609  13.878  8.498   1.00 83.21 ? 259  PRO A O   1 
ATOM   1976 C CB  . PRO A 1 259 ? 59.797  12.773  8.087   1.00 79.78 ? 259  PRO A CB  1 
ATOM   1977 C CG  . PRO A 1 259 ? 58.592  13.571  7.678   1.00 78.63 ? 259  PRO A CG  1 
ATOM   1978 C CD  . PRO A 1 259 ? 58.908  15.009  8.022   1.00 78.49 ? 259  PRO A CD  1 
ATOM   1979 N N   . ASN A 1 265 ? 61.804  7.853   10.522  1.00 76.41 ? 265  ASN A N   1 
ATOM   1980 C CA  . ASN A 1 265 ? 61.440  7.179   11.776  1.00 75.89 ? 265  ASN A CA  1 
ATOM   1981 C C   . ASN A 1 265 ? 60.287  7.884   12.517  1.00 73.48 ? 265  ASN A C   1 
ATOM   1982 O O   . ASN A 1 265 ? 60.304  9.114   12.704  1.00 73.55 ? 265  ASN A O   1 
ATOM   1983 C CB  . ASN A 1 265 ? 62.684  7.032   12.665  1.00 77.72 ? 265  ASN A CB  1 
ATOM   1984 C CG  . ASN A 1 265 ? 62.351  6.757   14.129  1.00 79.32 ? 265  ASN A CG  1 
ATOM   1985 O OD1 . ASN A 1 265 ? 62.606  7.601   14.997  1.00 80.81 ? 265  ASN A OD1 1 
ATOM   1986 N ND2 . ASN A 1 265 ? 61.793  5.569   14.414  1.00 81.38 ? 265  ASN A ND2 1 
ATOM   1987 N N   . ASP A 1 266 ? 59.290  7.095   12.927  1.00 70.93 ? 266  ASP A N   1 
ATOM   1988 C CA  . ASP A 1 266 ? 58.063  7.625   13.525  1.00 68.01 ? 266  ASP A CA  1 
ATOM   1989 C C   . ASP A 1 266 ? 58.272  8.158   14.933  1.00 66.79 ? 266  ASP A C   1 
ATOM   1990 O O   . ASP A 1 266 ? 57.675  9.167   15.301  1.00 65.41 ? 266  ASP A O   1 
ATOM   1991 C CB  . ASP A 1 266 ? 56.958  6.557   13.553  1.00 67.16 ? 266  ASP A CB  1 
ATOM   1992 C CG  . ASP A 1 266 ? 56.324  6.321   12.187  1.00 66.51 ? 266  ASP A CG  1 
ATOM   1993 O OD1 . ASP A 1 266 ? 56.522  7.144   11.267  1.00 66.96 ? 266  ASP A OD1 1 
ATOM   1994 O OD2 . ASP A 1 266 ? 55.613  5.309   12.034  1.00 64.98 ? 266  ASP A OD2 1 
ATOM   1995 N N   . THR A 1 267 ? 59.105  7.477   15.718  1.00 66.38 ? 267  THR A N   1 
ATOM   1996 C CA  . THR A 1 267 ? 59.360  7.881   17.097  1.00 65.58 ? 267  THR A CA  1 
ATOM   1997 C C   . THR A 1 267 ? 59.772  9.345   17.152  1.00 65.42 ? 267  THR A C   1 
ATOM   1998 O O   . THR A 1 267 ? 59.170  10.131  17.872  1.00 64.38 ? 267  THR A O   1 
ATOM   1999 C CB  . THR A 1 267 ? 60.449  6.993   17.767  1.00 66.85 ? 267  THR A CB  1 
ATOM   2000 O OG1 . THR A 1 267 ? 59.974  5.644   17.858  1.00 65.46 ? 267  THR A OG1 1 
ATOM   2001 C CG2 . THR A 1 267 ? 60.786  7.496   19.167  1.00 66.05 ? 267  THR A CG2 1 
ATOM   2002 N N   . GLU A 1 268 ? 60.796  9.697   16.375  1.00 66.38 ? 268  GLU A N   1 
ATOM   2003 C CA  . GLU A 1 268 ? 61.275  11.086  16.259  1.00 66.78 ? 268  GLU A CA  1 
ATOM   2004 C C   . GLU A 1 268 ? 60.148  12.050  15.892  1.00 64.03 ? 268  GLU A C   1 
ATOM   2005 O O   . GLU A 1 268 ? 59.953  13.064  16.554  1.00 63.93 ? 268  GLU A O   1 
ATOM   2006 C CB  . GLU A 1 268 ? 62.369  11.202  15.183  1.00 68.06 ? 268  GLU A CB  1 
ATOM   2007 C CG  . GLU A 1 268 ? 63.723  10.643  15.560  1.00 71.09 ? 268  GLU A CG  1 
ATOM   2008 C CD  . GLU A 1 268 ? 64.835  11.067  14.581  1.00 73.33 ? 268  GLU A CD  1 
ATOM   2009 O OE1 . GLU A 1 268 ? 64.557  11.835  13.620  1.00 76.44 ? 268  GLU A OE1 1 
ATOM   2010 O OE2 . GLU A 1 268 ? 65.997  10.636  14.783  1.00 77.53 ? 268  GLU A OE2 1 
ATOM   2011 N N   . LEU A 1 269 ? 59.425  11.731  14.822  1.00 61.92 ? 269  LEU A N   1 
ATOM   2012 C CA  . LEU A 1 269 ? 58.351  12.590  14.334  1.00 59.83 ? 269  LEU A CA  1 
ATOM   2013 C C   . LEU A 1 269 ? 57.323  12.834  15.434  1.00 57.91 ? 269  LEU A C   1 
ATOM   2014 O O   . LEU A 1 269 ? 56.940  13.978  15.694  1.00 57.55 ? 269  LEU A O   1 
ATOM   2015 C CB  . LEU A 1 269 ? 57.692  11.976  13.087  1.00 59.22 ? 269  LEU A CB  1 
ATOM   2016 C CG  . LEU A 1 269 ? 56.635  12.812  12.342  1.00 58.79 ? 269  LEU A CG  1 
ATOM   2017 C CD1 . LEU A 1 269 ? 56.559  12.434  10.886  1.00 57.75 ? 269  LEU A CD1 1 
ATOM   2018 C CD2 . LEU A 1 269 ? 55.251  12.686  12.970  1.00 56.24 ? 269  LEU A CD2 1 
ATOM   2019 N N   . ILE A 1 270 ? 56.900  11.756  16.092  1.00 56.57 ? 270  ILE A N   1 
ATOM   2020 C CA  . ILE A 1 270 ? 55.873  11.844  17.126  1.00 54.93 ? 270  ILE A CA  1 
ATOM   2021 C C   . ILE A 1 270 ? 56.397  12.604  18.344  1.00 54.94 ? 270  ILE A C   1 
ATOM   2022 O O   . ILE A 1 270 ? 55.690  13.439  18.901  1.00 53.24 ? 270  ILE A O   1 
ATOM   2023 C CB  . ILE A 1 270 ? 55.336  10.455  17.522  1.00 54.29 ? 270  ILE A CB  1 
ATOM   2024 C CG1 . ILE A 1 270 ? 54.718  9.764   16.299  1.00 53.51 ? 270  ILE A CG1 1 
ATOM   2025 C CG2 . ILE A 1 270 ? 54.292  10.590  18.599  1.00 52.28 ? 270  ILE A CG2 1 
ATOM   2026 C CD1 . ILE A 1 270 ? 54.603  8.240   16.436  1.00 54.57 ? 270  ILE A CD1 1 
ATOM   2027 N N   . ALA A 1 271 ? 57.653  12.360  18.711  1.00 56.10 ? 271  ALA A N   1 
ATOM   2028 C CA  . ALA A 1 271 ? 58.258  13.061  19.836  1.00 57.11 ? 271  ALA A CA  1 
ATOM   2029 C C   . ALA A 1 271 ? 58.282  14.575  19.609  1.00 57.63 ? 271  ALA A C   1 
ATOM   2030 O O   . ALA A 1 271 ? 57.962  15.342  20.520  1.00 57.72 ? 271  ALA A O   1 
ATOM   2031 C CB  . ALA A 1 271 ? 59.662  12.518  20.124  1.00 58.40 ? 271  ALA A CB  1 
ATOM   2032 N N   . CYS A 1 272 ? 58.624  15.002  18.394  1.00 58.60 ? 272  CYS A N   1 
ATOM   2033 C CA  . CYS A 1 272 ? 58.587  16.417  18.044  1.00 58.51 ? 272  CYS A CA  1 
ATOM   2034 C C   . CYS A 1 272 ? 57.157  16.980  18.089  1.00 56.34 ? 272  CYS A C   1 
ATOM   2035 O O   . CYS A 1 272 ? 56.933  18.062  18.622  1.00 56.23 ? 272  CYS A O   1 
ATOM   2036 C CB  . CYS A 1 272 ? 59.203  16.654  16.663  1.00 59.52 ? 272  CYS A CB  1 
ATOM   2037 S SG  . CYS A 1 272 ? 59.257  18.402  16.210  1.00 62.39 ? 272  CYS A SG  1 
ATOM   2038 N N   . LEU A 1 273 ? 56.193  16.257  17.536  1.00 54.69 ? 273  LEU A N   1 
ATOM   2039 C CA  . LEU A 1 273 ? 54.785  16.672  17.658  1.00 53.22 ? 273  LEU A CA  1 
ATOM   2040 C C   . LEU A 1 273 ? 54.364  16.893  19.123  1.00 52.43 ? 273  LEU A C   1 
ATOM   2041 O O   . LEU A 1 273 ? 53.618  17.819  19.420  1.00 51.62 ? 273  LEU A O   1 
ATOM   2042 C CB  . LEU A 1 273 ? 53.836  15.668  16.993  1.00 51.92 ? 273  LEU A CB  1 
ATOM   2043 C CG  . LEU A 1 273 ? 53.757  15.670  15.458  1.00 52.23 ? 273  LEU A CG  1 
ATOM   2044 C CD1 . LEU A 1 273 ? 52.862  14.526  14.982  1.00 48.85 ? 273  LEU A CD1 1 
ATOM   2045 C CD2 . LEU A 1 273 ? 53.281  17.011  14.884  1.00 49.58 ? 273  LEU A CD2 1 
ATOM   2046 N N   . ARG A 1 274 ? 54.862  16.062  20.033  1.00 52.61 ? 274  ARG A N   1 
ATOM   2047 C CA  . ARG A 1 274 ? 54.517  16.192  21.453  1.00 52.25 ? 274  ARG A CA  1 
ATOM   2048 C C   . ARG A 1 274 ? 55.074  17.449  22.109  1.00 52.72 ? 274  ARG A C   1 
ATOM   2049 O O   . ARG A 1 274 ? 54.566  17.874  23.137  1.00 52.08 ? 274  ARG A O   1 
ATOM   2050 C CB  . ARG A 1 274 ? 54.955  14.957  22.244  1.00 52.33 ? 274  ARG A CB  1 
ATOM   2051 C CG  . ARG A 1 274 ? 54.100  13.706  21.997  1.00 51.50 ? 274  ARG A CG  1 
ATOM   2052 C CD  . ARG A 1 274 ? 54.358  12.635  23.059  1.00 52.53 ? 274  ARG A CD  1 
ATOM   2053 N NE  . ARG A 1 274 ? 55.789  12.317  23.188  1.00 55.36 ? 274  ARG A NE  1 
ATOM   2054 C CZ  . ARG A 1 274 ? 56.407  11.259  22.661  1.00 55.34 ? 274  ARG A CZ  1 
ATOM   2055 N NH1 . ARG A 1 274 ? 55.739  10.357  21.947  1.00 55.33 ? 274  ARG A NH1 1 
ATOM   2056 N NH2 . ARG A 1 274 ? 57.717  11.106  22.853  1.00 55.34 ? 274  ARG A NH2 1 
ATOM   2057 N N   . THR A 1 275 ? 56.111  18.042  21.519  1.00 54.11 ? 275  THR A N   1 
ATOM   2058 C CA  . THR A 1 275 ? 56.675  19.300  22.012  1.00 55.08 ? 275  THR A CA  1 
ATOM   2059 C C   . THR A 1 275 ? 55.875  20.525  21.564  1.00 55.07 ? 275  THR A C   1 
ATOM   2060 O O   . THR A 1 275 ? 56.100  21.624  22.061  1.00 55.82 ? 275  THR A O   1 
ATOM   2061 C CB  . THR A 1 275 ? 58.143  19.502  21.539  1.00 56.55 ? 275  THR A CB  1 
ATOM   2062 O OG1 . THR A 1 275 ? 58.160  19.766  20.133  1.00 55.96 ? 275  THR A OG1 1 
ATOM   2063 C CG2 . THR A 1 275 ? 59.002  18.277  21.841  1.00 55.85 ? 275  THR A CG2 1 
ATOM   2064 N N   . ARG A 1 276 ? 54.956  20.355  20.619  1.00 54.64 ? 276  ARG A N   1 
ATOM   2065 C CA  . ARG A 1 276 ? 54.236  21.492  20.066  1.00 54.86 ? 276  ARG A CA  1 
ATOM   2066 C C   . ARG A 1 276 ? 53.087  21.946  20.962  1.00 53.75 ? 276  ARG A C   1 
ATOM   2067 O O   . ARG A 1 276 ? 52.421  21.123  21.576  1.00 52.60 ? 276  ARG A O   1 
ATOM   2068 C CB  . ARG A 1 276 ? 53.711  21.154  18.668  1.00 54.94 ? 276  ARG A CB  1 
ATOM   2069 C CG  . ARG A 1 276 ? 54.826  20.963  17.658  1.00 58.44 ? 276  ARG A CG  1 
ATOM   2070 C CD  . ARG A 1 276 ? 55.668  22.227  17.548  1.00 64.14 ? 276  ARG A CD  1 
ATOM   2071 N NE  . ARG A 1 276 ? 56.782  22.051  16.630  1.00 67.58 ? 276  ARG A NE  1 
ATOM   2072 C CZ  . ARG A 1 276 ? 58.066  21.956  16.972  1.00 70.80 ? 276  ARG A CZ  1 
ATOM   2073 N NH1 . ARG A 1 276 ? 58.470  22.011  18.248  1.00 72.09 ? 276  ARG A NH1 1 
ATOM   2074 N NH2 . ARG A 1 276 ? 58.962  21.805  16.005  1.00 71.68 ? 276  ARG A NH2 1 
ATOM   2075 N N   . PRO A 1 277 ? 52.876  23.267  21.064  1.00 53.66 ? 277  PRO A N   1 
ATOM   2076 C CA  . PRO A 1 277 ? 51.669  23.783  21.709  1.00 52.67 ? 277  PRO A CA  1 
ATOM   2077 C C   . PRO A 1 277 ? 50.399  23.204  21.085  1.00 51.15 ? 277  PRO A C   1 
ATOM   2078 O O   . PRO A 1 277 ? 50.309  23.088  19.865  1.00 51.07 ? 277  PRO A O   1 
ATOM   2079 C CB  . PRO A 1 277 ? 51.745  25.286  21.444  1.00 53.26 ? 277  PRO A CB  1 
ATOM   2080 C CG  . PRO A 1 277 ? 53.210  25.568  21.259  1.00 54.94 ? 277  PRO A CG  1 
ATOM   2081 C CD  . PRO A 1 277 ? 53.767  24.350  20.594  1.00 54.98 ? 277  PRO A CD  1 
ATOM   2082 N N   . ALA A 1 278 ? 49.437  22.837  21.921  1.00 49.78 ? 278  ALA A N   1 
ATOM   2083 C CA  . ALA A 1 278 ? 48.162  22.325  21.444  1.00 48.71 ? 278  ALA A CA  1 
ATOM   2084 C C   . ALA A 1 278 ? 47.581  23.231  20.354  1.00 48.53 ? 278  ALA A C   1 
ATOM   2085 O O   . ALA A 1 278 ? 47.066  22.739  19.343  1.00 47.79 ? 278  ALA A O   1 
ATOM   2086 C CB  . ALA A 1 278 ? 47.159  22.165  22.616  1.00 47.47 ? 278  ALA A CB  1 
ATOM   2087 N N   . GLN A 1 279 ? 47.670  24.542  20.550  1.00 49.19 ? 279  GLN A N   1 
ATOM   2088 C CA  . GLN A 1 279 ? 47.020  25.480  19.633  1.00 49.72 ? 279  GLN A CA  1 
ATOM   2089 C C   . GLN A 1 279 ? 47.681  25.496  18.261  1.00 50.56 ? 279  GLN A C   1 
ATOM   2090 O O   . GLN A 1 279 ? 47.000  25.702  17.254  1.00 50.88 ? 279  GLN A O   1 
ATOM   2091 C CB  . GLN A 1 279 ? 46.962  26.894  20.209  1.00 50.06 ? 279  GLN A CB  1 
ATOM   2092 C CG  . GLN A 1 279 ? 46.073  27.870  19.416  1.00 49.47 ? 279  GLN A CG  1 
ATOM   2093 C CD  . GLN A 1 279 ? 44.608  27.480  19.426  1.00 48.41 ? 279  GLN A CD  1 
ATOM   2094 O OE1 . GLN A 1 279 ? 44.031  27.222  20.479  1.00 48.09 ? 279  GLN A OE1 1 
ATOM   2095 N NE2 . GLN A 1 279 ? 44.001  27.444  18.253  1.00 45.76 ? 279  GLN A NE2 1 
ATOM   2096 N N   . ASP A 1 280 ? 48.994  25.294  18.222  1.00 51.64 ? 280  ASP A N   1 
ATOM   2097 C CA  . ASP A 1 280 ? 49.706  25.151  16.958  1.00 52.45 ? 280  ASP A CA  1 
ATOM   2098 C C   . ASP A 1 280 ? 49.129  24.021  16.128  1.00 51.03 ? 280  ASP A C   1 
ATOM   2099 O O   . ASP A 1 280 ? 48.967  24.160  14.926  1.00 51.36 ? 280  ASP A O   1 
ATOM   2100 C CB  . ASP A 1 280 ? 51.204  24.888  17.181  1.00 54.05 ? 280  ASP A CB  1 
ATOM   2101 C CG  . ASP A 1 280 ? 51.991  26.158  17.478  1.00 58.12 ? 280  ASP A CG  1 
ATOM   2102 O OD1 . ASP A 1 280 ? 51.387  27.257  17.531  1.00 62.89 ? 280  ASP A OD1 1 
ATOM   2103 O OD2 . ASP A 1 280 ? 53.223  26.058  17.660  1.00 63.33 ? 280  ASP A OD2 1 
ATOM   2104 N N   . LEU A 1 281 ? 48.827  22.898  16.773  1.00 50.21 ? 281  LEU A N   1 
ATOM   2105 C CA  . LEU A 1 281 ? 48.283  21.753  16.066  1.00 49.10 ? 281  LEU A CA  1 
ATOM   2106 C C   . LEU A 1 281 ? 46.916  22.132  15.509  1.00 48.21 ? 281  LEU A C   1 
ATOM   2107 O O   . LEU A 1 281 ? 46.646  21.906  14.327  1.00 48.31 ? 281  LEU A O   1 
ATOM   2108 C CB  . LEU A 1 281 ? 48.211  20.515  16.971  1.00 48.84 ? 281  LEU A CB  1 
ATOM   2109 C CG  . LEU A 1 281 ? 49.534  20.003  17.605  1.00 49.31 ? 281  LEU A CG  1 
ATOM   2110 C CD1 . LEU A 1 281 ? 49.302  18.707  18.355  1.00 47.82 ? 281  LEU A CD1 1 
ATOM   2111 C CD2 . LEU A 1 281 ? 50.665  19.804  16.588  1.00 49.56 ? 281  LEU A CD2 1 
ATOM   2112 N N   . VAL A 1 282 ? 46.075  22.755  16.337  1.00 47.27 ? 282  VAL A N   1 
ATOM   2113 C CA  . VAL A 1 282 ? 44.742  23.167  15.887  1.00 46.18 ? 282  VAL A CA  1 
ATOM   2114 C C   . VAL A 1 282 ? 44.841  24.149  14.707  1.00 46.71 ? 282  VAL A C   1 
ATOM   2115 O O   . VAL A 1 282 ? 44.104  24.009  13.732  1.00 46.20 ? 282  VAL A O   1 
ATOM   2116 C CB  . VAL A 1 282 ? 43.875  23.772  17.036  1.00 45.35 ? 282  VAL A CB  1 
ATOM   2117 C CG1 . VAL A 1 282 ? 42.592  24.327  16.469  1.00 43.08 ? 282  VAL A CG1 1 
ATOM   2118 C CG2 . VAL A 1 282 ? 43.589  22.713  18.117  1.00 42.90 ? 282  VAL A CG2 1 
ATOM   2119 N N   . ASP A 1 283 ? 45.766  25.109  14.787  1.00 47.73 ? 283  ASP A N   1 
ATOM   2120 C CA  . ASP A 1 283 ? 45.962  26.092  13.706  1.00 48.94 ? 283  ASP A CA  1 
ATOM   2121 C C   . ASP A 1 283 ? 46.284  25.529  12.308  1.00 49.17 ? 283  ASP A C   1 
ATOM   2122 O O   . ASP A 1 283 ? 46.004  26.195  11.315  1.00 50.05 ? 283  ASP A O   1 
ATOM   2123 C CB  . ASP A 1 283 ? 47.026  27.127  14.086  1.00 50.01 ? 283  ASP A CB  1 
ATOM   2124 C CG  . ASP A 1 283 ? 46.581  28.051  15.224  1.00 51.13 ? 283  ASP A CG  1 
ATOM   2125 O OD1 . ASP A 1 283 ? 45.402  27.994  15.653  1.00 52.30 ? 283  ASP A OD1 1 
ATOM   2126 O OD2 . ASP A 1 283 ? 47.432  28.826  15.704  1.00 53.65 ? 283  ASP A OD2 1 
ATOM   2127 N N   . HIS A 1 284 ? 46.852  24.330  12.220  1.00 49.46 ? 284  HIS A N   1 
ATOM   2128 C CA  . HIS A 1 284 ? 47.167  23.717  10.916  1.00 49.77 ? 284  HIS A CA  1 
ATOM   2129 C C   . HIS A 1 284 ? 46.311  22.529  10.520  1.00 49.40 ? 284  HIS A C   1 
ATOM   2130 O O   . HIS A 1 284 ? 46.474  21.972  9.432   1.00 49.14 ? 284  HIS A O   1 
ATOM   2131 C CB  . HIS A 1 284 ? 48.643  23.340  10.875  1.00 50.84 ? 284  HIS A CB  1 
ATOM   2132 C CG  . HIS A 1 284 ? 49.538  24.528  10.944  1.00 52.10 ? 284  HIS A CG  1 
ATOM   2133 N ND1 . HIS A 1 284 ? 50.097  24.964  12.125  1.00 53.11 ? 284  HIS A ND1 1 
ATOM   2134 C CD2 . HIS A 1 284 ? 49.918  25.412  9.991   1.00 52.60 ? 284  HIS A CD2 1 
ATOM   2135 C CE1 . HIS A 1 284 ? 50.817  26.047  11.886  1.00 54.74 ? 284  HIS A CE1 1 
ATOM   2136 N NE2 . HIS A 1 284 ? 50.726  26.338  10.600  1.00 53.31 ? 284  HIS A NE2 1 
ATOM   2137 N N   . GLU A 1 285 ? 45.379  22.189  11.395  1.00 49.20 ? 285  GLU A N   1 
ATOM   2138 C CA  . GLU A 1 285 ? 44.517  21.032  11.261  1.00 49.94 ? 285  GLU A CA  1 
ATOM   2139 C C   . GLU A 1 285 ? 43.775  20.948  9.915   1.00 49.35 ? 285  GLU A C   1 
ATOM   2140 O O   . GLU A 1 285 ? 43.684  19.892  9.303   1.00 48.40 ? 285  GLU A O   1 
ATOM   2141 C CB  . GLU A 1 285 ? 43.530  21.076  12.426  1.00 49.31 ? 285  GLU A CB  1 
ATOM   2142 C CG  . GLU A 1 285 ? 42.553  19.964  12.479  1.00 51.45 ? 285  GLU A CG  1 
ATOM   2143 C CD  . GLU A 1 285 ? 41.793  19.923  13.791  1.00 51.04 ? 285  GLU A CD  1 
ATOM   2144 O OE1 . GLU A 1 285 ? 41.695  20.963  14.481  1.00 54.43 ? 285  GLU A OE1 1 
ATOM   2145 O OE2 . GLU A 1 285 ? 41.280  18.835  14.112  1.00 55.98 ? 285  GLU A OE2 1 
ATOM   2146 N N   . TRP A 1 286 ? 43.272  22.077  9.446   1.00 50.51 ? 286  TRP A N   1 
ATOM   2147 C CA  . TRP A 1 286 ? 42.483  22.111  8.221   1.00 51.05 ? 286  TRP A CA  1 
ATOM   2148 C C   . TRP A 1 286 ? 43.334  22.149  6.961   1.00 51.53 ? 286  TRP A C   1 
ATOM   2149 O O   . TRP A 1 286 ? 42.803  22.029  5.870   1.00 52.98 ? 286  TRP A O   1 
ATOM   2150 C CB  . TRP A 1 286 ? 41.467  23.262  8.281   1.00 51.82 ? 286  TRP A CB  1 
ATOM   2151 C CG  . TRP A 1 286 ? 40.546  22.983  9.390   1.00 52.21 ? 286  TRP A CG  1 
ATOM   2152 C CD1 . TRP A 1 286 ? 40.588  23.503  10.639  1.00 52.90 ? 286  TRP A CD1 1 
ATOM   2153 C CD2 . TRP A 1 286 ? 39.515  21.992  9.397   1.00 52.46 ? 286  TRP A CD2 1 
ATOM   2154 N NE1 . TRP A 1 286 ? 39.621  22.927  11.425  1.00 52.52 ? 286  TRP A NE1 1 
ATOM   2155 C CE2 . TRP A 1 286 ? 38.944  21.997  10.684  1.00 52.80 ? 286  TRP A CE2 1 
ATOM   2156 C CE3 . TRP A 1 286 ? 39.015  21.105  8.432   1.00 52.42 ? 286  TRP A CE3 1 
ATOM   2157 C CZ2 . TRP A 1 286 ? 37.884  21.160  11.036  1.00 52.45 ? 286  TRP A CZ2 1 
ATOM   2158 C CZ3 . TRP A 1 286 ? 37.962  20.272  8.771   1.00 51.73 ? 286  TRP A CZ3 1 
ATOM   2159 C CH2 . TRP A 1 286 ? 37.407  20.302  10.067  1.00 52.46 ? 286  TRP A CH2 1 
ATOM   2160 N N   . HIS A 1 287 ? 44.651  22.250  7.104   1.00 51.38 ? 287  HIS A N   1 
ATOM   2161 C CA  . HIS A 1 287 ? 45.525  22.368  5.945   1.00 51.29 ? 287  HIS A CA  1 
ATOM   2162 C C   . HIS A 1 287 ? 45.930  21.041  5.305   1.00 50.82 ? 287  HIS A C   1 
ATOM   2163 O O   . HIS A 1 287 ? 46.678  21.055  4.321   1.00 51.16 ? 287  HIS A O   1 
ATOM   2164 C CB  . HIS A 1 287 ? 46.791  23.140  6.318   1.00 52.57 ? 287  HIS A CB  1 
ATOM   2165 C CG  . HIS A 1 287 ? 46.532  24.538  6.776   1.00 54.55 ? 287  HIS A CG  1 
ATOM   2166 N ND1 . HIS A 1 287 ? 45.602  25.360  6.176   1.00 57.71 ? 287  HIS A ND1 1 
ATOM   2167 C CD2 . HIS A 1 287 ? 47.104  25.272  7.754   1.00 56.77 ? 287  HIS A CD2 1 
ATOM   2168 C CE1 . HIS A 1 287 ? 45.590  26.529  6.789   1.00 57.62 ? 287  HIS A CE1 1 
ATOM   2169 N NE2 . HIS A 1 287 ? 46.499  26.503  7.746   1.00 58.01 ? 287  HIS A NE2 1 
ATOM   2170 N N   . VAL A 1 288 ? 45.461  19.908  5.835   1.00 48.91 ? 288  VAL A N   1 
ATOM   2171 C CA  . VAL A 1 288 ? 45.929  18.597  5.349   1.00 48.69 ? 288  VAL A CA  1 
ATOM   2172 C C   . VAL A 1 288 ? 44.916  17.790  4.534   1.00 47.96 ? 288  VAL A C   1 
ATOM   2173 O O   . VAL A 1 288 ? 45.228  16.668  4.110   1.00 47.93 ? 288  VAL A O   1 
ATOM   2174 C CB  . VAL A 1 288 ? 46.460  17.713  6.520   1.00 48.62 ? 288  VAL A CB  1 
ATOM   2175 C CG1 . VAL A 1 288 ? 47.570  18.457  7.300   1.00 47.11 ? 288  VAL A CG1 1 
ATOM   2176 C CG2 . VAL A 1 288 ? 45.312  17.276  7.444   1.00 46.80 ? 288  VAL A CG2 1 
ATOM   2177 N N   . LEU A 1 289 ? 43.720  18.335  4.306   1.00 47.08 ? 289  LEU A N   1 
ATOM   2178 C CA  . LEU A 1 289 ? 42.696  17.647  3.502   1.00 47.23 ? 289  LEU A CA  1 
ATOM   2179 C C   . LEU A 1 289 ? 43.125  17.648  2.037   1.00 48.26 ? 289  LEU A C   1 
ATOM   2180 O O   . LEU A 1 289 ? 43.605  18.660  1.549   1.00 49.09 ? 289  LEU A O   1 
ATOM   2181 C CB  . LEU A 1 289 ? 41.308  18.306  3.645   1.00 46.03 ? 289  LEU A CB  1 
ATOM   2182 C CG  . LEU A 1 289 ? 40.542  18.071  4.965   1.00 44.97 ? 289  LEU A CG  1 
ATOM   2183 C CD1 . LEU A 1 289 ? 39.308  19.005  5.081   1.00 42.21 ? 289  LEU A CD1 1 
ATOM   2184 C CD2 . LEU A 1 289 ? 40.141  16.593  5.154   1.00 39.72 ? 289  LEU A CD2 1 
ATOM   2185 N N   . PRO A 1 290 ? 42.962  16.513  1.333   1.00 48.97 ? 290  PRO A N   1 
ATOM   2186 C CA  . PRO A 1 290 ? 43.452  16.363  -0.046  1.00 49.89 ? 290  PRO A CA  1 
ATOM   2187 C C   . PRO A 1 290 ? 42.733  17.209  -1.100  1.00 50.68 ? 290  PRO A C   1 
ATOM   2188 O O   . PRO A 1 290 ? 43.300  17.487  -2.153  1.00 51.01 ? 290  PRO A O   1 
ATOM   2189 C CB  . PRO A 1 290 ? 43.241  14.881  -0.339  1.00 50.33 ? 290  PRO A CB  1 
ATOM   2190 C CG  . PRO A 1 290 ? 42.224  14.424  0.620   1.00 49.52 ? 290  PRO A CG  1 
ATOM   2191 C CD  . PRO A 1 290 ? 42.311  15.291  1.825   1.00 48.63 ? 290  PRO A CD  1 
ATOM   2192 N N   . GLN A 1 291 ? 41.501  17.609  -0.816  1.00 51.05 ? 291  GLN A N   1 
ATOM   2193 C CA  . GLN A 1 291 ? 40.727  18.421  -1.745  1.00 52.05 ? 291  GLN A CA  1 
ATOM   2194 C C   . GLN A 1 291 ? 40.037  19.560  -1.004  1.00 51.35 ? 291  GLN A C   1 
ATOM   2195 O O   . GLN A 1 291 ? 39.863  19.521  0.216   1.00 51.02 ? 291  GLN A O   1 
ATOM   2196 C CB  . GLN A 1 291 ? 39.690  17.547  -2.491  1.00 52.40 ? 291  GLN A CB  1 
ATOM   2197 C CG  . GLN A 1 291 ? 40.292  16.366  -3.314  1.00 56.11 ? 291  GLN A CG  1 
ATOM   2198 C CD  . GLN A 1 291 ? 40.355  15.054  -2.518  1.00 61.96 ? 291  GLN A CD  1 
ATOM   2199 O OE1 . GLN A 1 291 ? 41.006  14.061  -2.924  1.00 63.98 ? 291  GLN A OE1 1 
ATOM   2200 N NE2 . GLN A 1 291 ? 39.668  15.041  -1.366  1.00 65.36 ? 291  GLN A NE2 1 
ATOM   2201 N N   . GLU A 1 292 ? 39.673  20.588  -1.750  1.00 51.33 ? 292  GLU A N   1 
ATOM   2202 C CA  . GLU A 1 292 ? 38.731  21.587  -1.277  1.00 51.73 ? 292  GLU A CA  1 
ATOM   2203 C C   . GLU A 1 292 ? 37.391  20.863  -1.086  1.00 49.60 ? 292  GLU A C   1 
ATOM   2204 O O   . GLU A 1 292 ? 36.840  20.315  -2.038  1.00 49.69 ? 292  GLU A O   1 
ATOM   2205 C CB  . GLU A 1 292 ? 38.590  22.716  -2.312  1.00 51.99 ? 292  GLU A CB  1 
ATOM   2206 C CG  . GLU A 1 292 ? 37.718  23.881  -1.848  1.00 54.47 ? 292  GLU A CG  1 
ATOM   2207 C CD  . GLU A 1 292 ? 37.529  24.982  -2.902  1.00 56.80 ? 292  GLU A CD  1 
ATOM   2208 O OE1 . GLU A 1 292 ? 37.999  24.823  -4.064  1.00 64.47 ? 292  GLU A OE1 1 
ATOM   2209 O OE2 . GLU A 1 292 ? 36.887  26.017  -2.568  1.00 62.77 ? 292  GLU A OE2 1 
ATOM   2210 N N   . SER A 1 293 ? 36.872  20.860  0.136   1.00 47.94 ? 293  SER A N   1 
ATOM   2211 C CA  . SER A 1 293 ? 35.704  20.048  0.459   1.00 46.54 ? 293  SER A CA  1 
ATOM   2212 C C   . SER A 1 293 ? 34.820  20.594  1.574   1.00 45.53 ? 293  SER A C   1 
ATOM   2213 O O   . SER A 1 293 ? 35.218  21.480  2.327   1.00 45.52 ? 293  SER A O   1 
ATOM   2214 C CB  . SER A 1 293 ? 36.170  18.639  0.844   1.00 46.62 ? 293  SER A CB  1 
ATOM   2215 O OG  . SER A 1 293 ? 37.173  18.687  1.821   1.00 45.90 ? 293  SER A OG  1 
ATOM   2216 N N   . ILE A 1 294 ? 33.603  20.061  1.654   1.00 44.14 ? 294  ILE A N   1 
ATOM   2217 C CA  . ILE A 1 294 ? 32.777  20.170  2.861   1.00 43.07 ? 294  ILE A CA  1 
ATOM   2218 C C   . ILE A 1 294 ? 32.426  18.747  3.328   1.00 42.11 ? 294  ILE A C   1 
ATOM   2219 O O   . ILE A 1 294 ? 32.609  17.782  2.577   1.00 41.52 ? 294  ILE A O   1 
ATOM   2220 C CB  . ILE A 1 294 ? 31.488  21.020  2.641   1.00 43.25 ? 294  ILE A CB  1 
ATOM   2221 C CG1 . ILE A 1 294 ? 30.641  20.452  1.499   1.00 43.52 ? 294  ILE A CG1 1 
ATOM   2222 C CG2 . ILE A 1 294 ? 31.861  22.480  2.396   1.00 42.27 ? 294  ILE A CG2 1 
ATOM   2223 C CD1 . ILE A 1 294 ? 29.254  21.054  1.382   1.00 43.41 ? 294  ILE A CD1 1 
ATOM   2224 N N   . PHE A 1 295 ? 31.970  18.636  4.575   1.00 41.03 ? 295  PHE A N   1 
ATOM   2225 C CA  . PHE A 1 295 ? 31.701  17.349  5.222   1.00 40.80 ? 295  PHE A CA  1 
ATOM   2226 C C   . PHE A 1 295 ? 32.921  16.411  5.155   1.00 40.73 ? 295  PHE A C   1 
ATOM   2227 O O   . PHE A 1 295 ? 32.786  15.192  4.996   1.00 40.14 ? 295  PHE A O   1 
ATOM   2228 C CB  . PHE A 1 295 ? 30.467  16.686  4.608   1.00 40.95 ? 295  PHE A CB  1 
ATOM   2229 C CG  . PHE A 1 295 ? 29.553  16.031  5.615   1.00 42.30 ? 295  PHE A CG  1 
ATOM   2230 C CD1 . PHE A 1 295 ? 30.055  15.228  6.633   1.00 42.03 ? 295  PHE A CD1 1 
ATOM   2231 C CD2 . PHE A 1 295 ? 28.169  16.208  5.531   1.00 42.51 ? 295  PHE A CD2 1 
ATOM   2232 C CE1 . PHE A 1 295 ? 29.200  14.620  7.551   1.00 42.22 ? 295  PHE A CE1 1 
ATOM   2233 C CE2 . PHE A 1 295 ? 27.308  15.600  6.452   1.00 42.00 ? 295  PHE A CE2 1 
ATOM   2234 C CZ  . PHE A 1 295 ? 27.824  14.812  7.464   1.00 41.89 ? 295  PHE A CZ  1 
ATOM   2235 N N   . ARG A 1 296 ? 34.116  16.979  5.290   1.00 40.50 ? 296  ARG A N   1 
ATOM   2236 C CA  . ARG A 1 296 ? 35.322  16.160  5.470   1.00 40.80 ? 296  ARG A CA  1 
ATOM   2237 C C   . ARG A 1 296 ? 36.149  16.729  6.605   1.00 40.90 ? 296  ARG A C   1 
ATOM   2238 O O   . ARG A 1 296 ? 36.246  17.935  6.775   1.00 41.25 ? 296  ARG A O   1 
ATOM   2239 C CB  . ARG A 1 296 ? 36.155  16.099  4.195   1.00 41.12 ? 296  ARG A CB  1 
ATOM   2240 C CG  . ARG A 1 296 ? 35.473  15.442  3.024   1.00 40.44 ? 296  ARG A CG  1 
ATOM   2241 C CD  . ARG A 1 296 ? 35.376  13.945  3.207   1.00 41.39 ? 296  ARG A CD  1 
ATOM   2242 N NE  . ARG A 1 296 ? 34.860  13.329  1.998   1.00 40.64 ? 296  ARG A NE  1 
ATOM   2243 C CZ  . ARG A 1 296 ? 33.579  13.262  1.660   1.00 41.07 ? 296  ARG A CZ  1 
ATOM   2244 N NH1 . ARG A 1 296 ? 32.630  13.729  2.446   1.00 43.14 ? 296  ARG A NH1 1 
ATOM   2245 N NH2 . ARG A 1 296 ? 33.238  12.705  0.516   1.00 43.54 ? 296  ARG A NH2 1 
ATOM   2246 N N   . PHE A 1 297 ? 36.745  15.835  7.381   1.00 41.38 ? 297  PHE A N   1 
ATOM   2247 C CA  . PHE A 1 297 ? 37.430  16.198  8.607   1.00 40.95 ? 297  PHE A CA  1 
ATOM   2248 C C   . PHE A 1 297 ? 38.803  15.537  8.576   1.00 41.18 ? 297  PHE A C   1 
ATOM   2249 O O   . PHE A 1 297 ? 38.936  14.414  8.112   1.00 40.65 ? 297  PHE A O   1 
ATOM   2250 C CB  . PHE A 1 297 ? 36.570  15.746  9.786   1.00 40.99 ? 297  PHE A CB  1 
ATOM   2251 C CG  . PHE A 1 297 ? 35.095  16.047  9.592   1.00 40.81 ? 297  PHE A CG  1 
ATOM   2252 C CD1 . PHE A 1 297 ? 34.649  17.365  9.561   1.00 40.30 ? 297  PHE A CD1 1 
ATOM   2253 C CD2 . PHE A 1 297 ? 34.174  15.024  9.375   1.00 41.03 ? 297  PHE A CD2 1 
ATOM   2254 C CE1 . PHE A 1 297 ? 33.289  17.662  9.356   1.00 40.81 ? 297  PHE A CE1 1 
ATOM   2255 C CE2 . PHE A 1 297 ? 32.800  15.313  9.159   1.00 40.67 ? 297  PHE A CE2 1 
ATOM   2256 C CZ  . PHE A 1 297 ? 32.362  16.620  9.154   1.00 39.14 ? 297  PHE A CZ  1 
ATOM   2257 N N   . SER A 1 298 ? 39.814  16.262  9.039   1.00 41.22 ? 298  SER A N   1 
ATOM   2258 C CA  . SER A 1 298 ? 41.191  15.892  8.833   1.00 41.97 ? 298  SER A CA  1 
ATOM   2259 C C   . SER A 1 298 ? 41.603  14.648  9.608   1.00 41.85 ? 298  SER A C   1 
ATOM   2260 O O   . SER A 1 298 ? 42.275  13.771  9.062   1.00 42.37 ? 298  SER A O   1 
ATOM   2261 C CB  . SER A 1 298 ? 42.102  17.056  9.223   1.00 42.58 ? 298  SER A CB  1 
ATOM   2262 O OG  . SER A 1 298 ? 41.938  18.135  8.330   1.00 43.67 ? 298  SER A OG  1 
ATOM   2263 N N   . PHE A 1 299 ? 41.216  14.589  10.876  1.00 41.27 ? 299  PHE A N   1 
ATOM   2264 C CA  . PHE A 1 299 ? 41.653  13.528  11.776  1.00 40.69 ? 299  PHE A CA  1 
ATOM   2265 C C   . PHE A 1 299 ? 40.455  12.772  12.343  1.00 40.10 ? 299  PHE A C   1 
ATOM   2266 O O   . PHE A 1 299 ? 39.761  13.260  13.212  1.00 39.80 ? 299  PHE A O   1 
ATOM   2267 C CB  . PHE A 1 299 ? 42.579  14.120  12.838  1.00 40.71 ? 299  PHE A CB  1 
ATOM   2268 C CG  . PHE A 1 299 ? 43.843  14.666  12.246  1.00 40.45 ? 299  PHE A CG  1 
ATOM   2269 C CD1 . PHE A 1 299 ? 44.871  13.810  11.892  1.00 39.65 ? 299  PHE A CD1 1 
ATOM   2270 C CD2 . PHE A 1 299 ? 43.970  16.014  11.964  1.00 39.64 ? 299  PHE A CD2 1 
ATOM   2271 C CE1 . PHE A 1 299 ? 46.024  14.286  11.286  1.00 41.30 ? 299  PHE A CE1 1 
ATOM   2272 C CE2 . PHE A 1 299 ? 45.140  16.516  11.348  1.00 40.80 ? 299  PHE A CE2 1 
ATOM   2273 C CZ  . PHE A 1 299 ? 46.164  15.657  11.022  1.00 41.64 ? 299  PHE A CZ  1 
ATOM   2274 N N   . VAL A 1 300 ? 40.240  11.570  11.807  1.00 40.58 ? 300  VAL A N   1 
ATOM   2275 C CA  . VAL A 1 300 ? 39.055  10.740  12.066  1.00 40.14 ? 300  VAL A CA  1 
ATOM   2276 C C   . VAL A 1 300 ? 39.520  9.299   12.317  1.00 40.68 ? 300  VAL A C   1 
ATOM   2277 O O   . VAL A 1 300 ? 40.701  8.992   12.150  1.00 41.42 ? 300  VAL A O   1 
ATOM   2278 C CB  . VAL A 1 300 ? 38.080  10.783  10.856  1.00 40.19 ? 300  VAL A CB  1 
ATOM   2279 C CG1 . VAL A 1 300 ? 37.534  12.215  10.625  1.00 38.91 ? 300  VAL A CG1 1 
ATOM   2280 C CG2 . VAL A 1 300 ? 38.773  10.271  9.593   1.00 39.77 ? 300  VAL A CG2 1 
ATOM   2281 N N   . PRO A 1 301 ? 38.617  8.415   12.765  1.00 40.73 ? 301  PRO A N   1 
ATOM   2282 C CA  . PRO A 1 301 ? 39.003  6.997   12.864  1.00 41.41 ? 301  PRO A CA  1 
ATOM   2283 C C   . PRO A 1 301 ? 39.732  6.414   11.641  1.00 42.64 ? 301  PRO A C   1 
ATOM   2284 O O   . PRO A 1 301 ? 39.398  6.696   10.487  1.00 42.60 ? 301  PRO A O   1 
ATOM   2285 C CB  . PRO A 1 301 ? 37.674  6.290   13.116  1.00 41.16 ? 301  PRO A CB  1 
ATOM   2286 C CG  . PRO A 1 301 ? 36.869  7.310   13.894  1.00 40.60 ? 301  PRO A CG  1 
ATOM   2287 C CD  . PRO A 1 301 ? 37.261  8.655   13.299  1.00 40.30 ? 301  PRO A CD  1 
ATOM   2288 N N   . VAL A 1 302 ? 40.749  5.615   11.921  1.00 44.16 ? 302  VAL A N   1 
ATOM   2289 C CA  . VAL A 1 302 ? 41.562  4.994   10.891  1.00 45.56 ? 302  VAL A CA  1 
ATOM   2290 C C   . VAL A 1 302 ? 41.297  3.480   10.860  1.00 46.85 ? 302  VAL A C   1 
ATOM   2291 O O   . VAL A 1 302 ? 41.127  2.833   11.909  1.00 47.70 ? 302  VAL A O   1 
ATOM   2292 C CB  . VAL A 1 302 ? 43.065  5.280   11.123  1.00 45.95 ? 302  VAL A CB  1 
ATOM   2293 C CG1 . VAL A 1 302 ? 43.487  4.822   12.513  1.00 45.41 ? 302  VAL A CG1 1 
ATOM   2294 C CG2 . VAL A 1 302 ? 43.909  4.605   10.050  1.00 46.58 ? 302  VAL A CG2 1 
ATOM   2295 N N   . VAL A 1 303 ? 41.253  2.919   9.657   1.00 47.62 ? 303  VAL A N   1 
ATOM   2296 C CA  . VAL A 1 303 ? 41.215  1.467   9.514   1.00 48.66 ? 303  VAL A CA  1 
ATOM   2297 C C   . VAL A 1 303 ? 42.630  0.953   9.806   1.00 49.54 ? 303  VAL A C   1 
ATOM   2298 O O   . VAL A 1 303 ? 43.507  0.954   8.953   1.00 49.96 ? 303  VAL A O   1 
ATOM   2299 C CB  . VAL A 1 303 ? 40.690  1.058   8.136   1.00 49.03 ? 303  VAL A CB  1 
ATOM   2300 C CG1 . VAL A 1 303 ? 40.612  -0.455  8.013   1.00 50.00 ? 303  VAL A CG1 1 
ATOM   2301 C CG2 . VAL A 1 303 ? 39.327  1.687   7.913   1.00 47.08 ? 303  VAL A CG2 1 
ATOM   2302 N N   . ASP A 1 304 ? 42.825  0.559   11.058  1.00 50.34 ? 304  ASP A N   1 
ATOM   2303 C CA  . ASP A 1 304 ? 44.130  0.222   11.623  1.00 51.02 ? 304  ASP A CA  1 
ATOM   2304 C C   . ASP A 1 304 ? 44.411  -1.282  11.657  1.00 52.58 ? 304  ASP A C   1 
ATOM   2305 O O   . ASP A 1 304 ? 45.530  -1.697  11.963  1.00 53.20 ? 304  ASP A O   1 
ATOM   2306 C CB  . ASP A 1 304 ? 44.240  0.785   13.055  1.00 50.17 ? 304  ASP A CB  1 
ATOM   2307 C CG  . ASP A 1 304 ? 43.109  0.306   13.989  1.00 50.17 ? 304  ASP A CG  1 
ATOM   2308 O OD1 . ASP A 1 304 ? 42.128  -0.325  13.519  1.00 49.49 ? 304  ASP A OD1 1 
ATOM   2309 O OD2 . ASP A 1 304 ? 43.190  0.570   15.214  1.00 50.23 ? 304  ASP A OD2 1 
ATOM   2310 N N   . GLY A 1 305 ? 43.400  -2.091  11.365  1.00 53.08 ? 305  GLY A N   1 
ATOM   2311 C CA  . GLY A 1 305 ? 43.511  -3.536  11.515  1.00 54.62 ? 305  GLY A CA  1 
ATOM   2312 C C   . GLY A 1 305 ? 43.546  -3.980  12.975  1.00 55.09 ? 305  GLY A C   1 
ATOM   2313 O O   . GLY A 1 305 ? 44.002  -5.074  13.272  1.00 56.37 ? 305  GLY A O   1 
ATOM   2314 N N   . ASP A 1 306 ? 43.067  -3.128  13.881  1.00 54.60 ? 306  ASP A N   1 
ATOM   2315 C CA  . ASP A 1 306 ? 43.047  -3.418  15.321  1.00 54.54 ? 306  ASP A CA  1 
ATOM   2316 C C   . ASP A 1 306 ? 41.666  -3.080  15.901  1.00 53.38 ? 306  ASP A C   1 
ATOM   2317 O O   . ASP A 1 306 ? 40.826  -3.974  16.011  1.00 53.51 ? 306  ASP A O   1 
ATOM   2318 C CB  . ASP A 1 306 ? 44.175  -2.662  16.042  1.00 54.99 ? 306  ASP A CB  1 
ATOM   2319 C CG  . ASP A 1 306 ? 44.268  -3.007  17.520  1.00 56.02 ? 306  ASP A CG  1 
ATOM   2320 O OD1 . ASP A 1 306 ? 43.736  -4.055  17.957  1.00 58.66 ? 306  ASP A OD1 1 
ATOM   2321 O OD2 . ASP A 1 306 ? 44.912  -2.238  18.248  1.00 57.87 ? 306  ASP A OD2 1 
ATOM   2322 N N   . PHE A 1 307 ? 41.423  -1.812  16.255  1.00 52.15 ? 307  PHE A N   1 
ATOM   2323 C CA  . PHE A 1 307 ? 40.072  -1.363  16.628  1.00 50.76 ? 307  PHE A CA  1 
ATOM   2324 C C   . PHE A 1 307 ? 39.106  -1.708  15.493  1.00 50.31 ? 307  PHE A C   1 
ATOM   2325 O O   . PHE A 1 307 ? 38.072  -2.338  15.707  1.00 49.87 ? 307  PHE A O   1 
ATOM   2326 C CB  . PHE A 1 307 ? 40.036  0.142   16.919  1.00 49.82 ? 307  PHE A CB  1 
ATOM   2327 C CG  . PHE A 1 307 ? 38.800  0.589   17.669  1.00 48.69 ? 307  PHE A CG  1 
ATOM   2328 C CD1 . PHE A 1 307 ? 37.567  0.678   17.025  1.00 48.45 ? 307  PHE A CD1 1 
ATOM   2329 C CD2 . PHE A 1 307 ? 38.872  0.924   19.017  1.00 48.31 ? 307  PHE A CD2 1 
ATOM   2330 C CE1 . PHE A 1 307 ? 36.419  1.073   17.720  1.00 47.28 ? 307  PHE A CE1 1 
ATOM   2331 C CE2 . PHE A 1 307 ? 37.736  1.328   19.719  1.00 47.60 ? 307  PHE A CE2 1 
ATOM   2332 C CZ  . PHE A 1 307 ? 36.509  1.402   19.068  1.00 47.79 ? 307  PHE A CZ  1 
ATOM   2333 N N   . LEU A 1 308 ? 39.474  -1.310  14.281  1.00 50.11 ? 308  LEU A N   1 
ATOM   2334 C CA  . LEU A 1 308 ? 38.742  -1.688  13.089  1.00 49.98 ? 308  LEU A CA  1 
ATOM   2335 C C   . LEU A 1 308 ? 39.557  -2.737  12.346  1.00 51.56 ? 308  LEU A C   1 
ATOM   2336 O O   . LEU A 1 308 ? 40.569  -2.417  11.725  1.00 51.60 ? 308  LEU A O   1 
ATOM   2337 C CB  . LEU A 1 308 ? 38.497  -0.461  12.212  1.00 49.23 ? 308  LEU A CB  1 
ATOM   2338 C CG  . LEU A 1 308 ? 37.528  0.571   12.819  1.00 47.57 ? 308  LEU A CG  1 
ATOM   2339 C CD1 . LEU A 1 308 ? 37.353  1.773   11.889  1.00 45.30 ? 308  LEU A CD1 1 
ATOM   2340 C CD2 . LEU A 1 308 ? 36.161  -0.077  13.149  1.00 45.03 ? 308  LEU A CD2 1 
ATOM   2341 N N   . SER A 1 309 ? 39.119  -3.992  12.426  1.00 52.20 ? 309  SER A N   1 
ATOM   2342 C CA  . SER A 1 309 ? 39.877  -5.099  11.853  1.00 54.24 ? 309  SER A CA  1 
ATOM   2343 C C   . SER A 1 309 ? 39.870  -5.051  10.323  1.00 54.40 ? 309  SER A C   1 
ATOM   2344 O O   . SER A 1 309 ? 40.762  -5.584  9.677   1.00 55.28 ? 309  SER A O   1 
ATOM   2345 C CB  . SER A 1 309 ? 39.334  -6.446  12.366  1.00 54.88 ? 309  SER A CB  1 
ATOM   2346 O OG  . SER A 1 309 ? 38.021  -6.670  11.890  1.00 55.64 ? 309  SER A OG  1 
ATOM   2347 N N   . ASP A 1 310 ? 38.857  -4.397  9.762   1.00 54.09 ? 310  ASP A N   1 
ATOM   2348 C CA  . ASP A 1 310 ? 38.756  -4.164  8.326   1.00 54.47 ? 310  ASP A CA  1 
ATOM   2349 C C   . ASP A 1 310 ? 37.937  -2.885  8.117   1.00 53.53 ? 310  ASP A C   1 
ATOM   2350 O O   . ASP A 1 310 ? 37.530  -2.240  9.089   1.00 52.27 ? 310  ASP A O   1 
ATOM   2351 C CB  . ASP A 1 310 ? 38.053  -5.348  7.677   1.00 55.64 ? 310  ASP A CB  1 
ATOM   2352 C CG  . ASP A 1 310 ? 38.447  -5.559  6.228   1.00 57.29 ? 310  ASP A CG  1 
ATOM   2353 O OD1 . ASP A 1 310 ? 38.815  -4.589  5.523   1.00 57.57 ? 310  ASP A OD1 1 
ATOM   2354 O OD2 . ASP A 1 310 ? 38.371  -6.723  5.793   1.00 61.13 ? 310  ASP A OD2 1 
ATOM   2355 N N   . THR A 1 311 ? 37.685  -2.522  6.864   1.00 53.85 ? 311  THR A N   1 
ATOM   2356 C CA  . THR A 1 311 ? 36.862  -1.347  6.575   1.00 53.43 ? 311  THR A CA  1 
ATOM   2357 C C   . THR A 1 311 ? 35.468  -1.564  7.164   1.00 53.69 ? 311  THR A C   1 
ATOM   2358 O O   . THR A 1 311 ? 35.005  -2.697  7.243   1.00 53.82 ? 311  THR A O   1 
ATOM   2359 C CB  . THR A 1 311 ? 36.739  -1.075  5.061   1.00 53.61 ? 311  THR A CB  1 
ATOM   2360 O OG1 . THR A 1 311 ? 35.968  -2.115  4.446   1.00 54.76 ? 311  THR A OG1 1 
ATOM   2361 C CG2 . THR A 1 311 ? 38.122  -0.981  4.394   1.00 52.85 ? 311  THR A CG2 1 
ATOM   2362 N N   . PRO A 1 312 ? 34.805  -0.481  7.615   1.00 54.01 ? 312  PRO A N   1 
ATOM   2363 C CA  . PRO A 1 312 ? 33.407  -0.604  8.041   1.00 54.39 ? 312  PRO A CA  1 
ATOM   2364 C C   . PRO A 1 312 ? 32.516  -1.272  7.000   1.00 55.54 ? 312  PRO A C   1 
ATOM   2365 O O   . PRO A 1 312 ? 31.629  -2.026  7.364   1.00 55.17 ? 312  PRO A O   1 
ATOM   2366 C CB  . PRO A 1 312 ? 32.982  0.844   8.261   1.00 53.30 ? 312  PRO A CB  1 
ATOM   2367 C CG  . PRO A 1 312 ? 34.230  1.542   8.603   1.00 53.05 ? 312  PRO A CG  1 
ATOM   2368 C CD  . PRO A 1 312 ? 35.305  0.892   7.790   1.00 53.19 ? 312  PRO A CD  1 
ATOM   2369 N N   . GLU A 1 313 ? 32.770  -0.993  5.725   1.00 57.36 ? 313  GLU A N   1 
ATOM   2370 C CA  . GLU A 1 313 ? 32.053  -1.630  4.615   1.00 59.20 ? 313  GLU A CA  1 
ATOM   2371 C C   . GLU A 1 313 ? 32.200  -3.156  4.644   1.00 60.15 ? 313  GLU A C   1 
ATOM   2372 O O   . GLU A 1 313 ? 31.203  -3.875  4.545   1.00 61.04 ? 313  GLU A O   1 
ATOM   2373 C CB  . GLU A 1 313 ? 32.547  -1.073  3.269   1.00 59.34 ? 313  GLU A CB  1 
ATOM   2374 C CG  . GLU A 1 313 ? 31.797  -1.621  2.045   1.00 61.05 ? 313  GLU A CG  1 
ATOM   2375 C CD  . GLU A 1 313 ? 32.488  -1.313  0.712   1.00 63.49 ? 313  GLU A CD  1 
ATOM   2376 O OE1 . GLU A 1 313 ? 33.497  -0.558  0.701   1.00 69.11 ? 313  GLU A OE1 1 
ATOM   2377 O OE2 . GLU A 1 313 ? 32.023  -1.841  -0.331  1.00 68.19 ? 313  GLU A OE2 1 
ATOM   2378 N N   . ALA A 1 314 ? 33.428  -3.654  4.795   1.00 60.37 ? 314  ALA A N   1 
ATOM   2379 C CA  . ALA A 1 314 ? 33.632  -5.096  4.891   1.00 61.69 ? 314  ALA A CA  1 
ATOM   2380 C C   . ALA A 1 314 ? 32.913  -5.629  6.116   1.00 61.74 ? 314  ALA A C   1 
ATOM   2381 O O   . ALA A 1 314 ? 32.212  -6.625  6.034   1.00 62.27 ? 314  ALA A O   1 
ATOM   2382 C CB  . ALA A 1 314 ? 35.115  -5.461  4.946   1.00 61.95 ? 314  ALA A CB  1 
ATOM   2383 N N   . LEU A 1 315 ? 33.069  -4.937  7.241   1.00 61.53 ? 315  LEU A N   1 
ATOM   2384 C CA  . LEU A 1 315 ? 32.553  -5.417  8.523   1.00 61.70 ? 315  LEU A CA  1 
ATOM   2385 C C   . LEU A 1 315 ? 31.027  -5.444  8.601   1.00 62.35 ? 315  LEU A C   1 
ATOM   2386 O O   . LEU A 1 315 ? 30.472  -6.336  9.231   1.00 63.26 ? 315  LEU A O   1 
ATOM   2387 C CB  . LEU A 1 315 ? 33.128  -4.600  9.686   1.00 60.67 ? 315  LEU A CB  1 
ATOM   2388 C CG  . LEU A 1 315 ? 34.643  -4.664  9.895   1.00 60.06 ? 315  LEU A CG  1 
ATOM   2389 C CD1 . LEU A 1 315 ? 35.049  -3.784  11.059  1.00 57.56 ? 315  LEU A CD1 1 
ATOM   2390 C CD2 . LEU A 1 315 ? 35.114  -6.090  10.100  1.00 59.29 ? 315  LEU A CD2 1 
ATOM   2391 N N   . ILE A 1 316 ? 30.338  -4.497  7.979   1.00 62.92 ? 316  ILE A N   1 
ATOM   2392 C CA  . ILE A 1 316 ? 28.875  -4.563  7.980   1.00 64.35 ? 316  ILE A CA  1 
ATOM   2393 C C   . ILE A 1 316 ? 28.341  -5.605  6.973   1.00 65.95 ? 316  ILE A C   1 
ATOM   2394 O O   . ILE A 1 316 ? 27.230  -6.089  7.139   1.00 66.53 ? 316  ILE A O   1 
ATOM   2395 C CB  . ILE A 1 316 ? 28.176  -3.169  7.795   1.00 63.04 ? 316  ILE A CB  1 
ATOM   2396 C CG1 . ILE A 1 316 ? 28.323  -2.623  6.372   1.00 63.25 ? 316  ILE A CG1 1 
ATOM   2397 C CG2 . ILE A 1 316 ? 28.705  -2.161  8.804   1.00 62.72 ? 316  ILE A CG2 1 
ATOM   2398 C CD1 . ILE A 1 316 ? 27.691  -1.220  6.169   1.00 62.55 ? 316  ILE A CD1 1 
ATOM   2399 N N   . ASN A 1 317 ? 29.120  -5.945  5.944   1.00 67.46 ? 317  ASN A N   1 
ATOM   2400 C CA  . ASN A 1 317 ? 28.686  -6.943  4.949   1.00 69.16 ? 317  ASN A CA  1 
ATOM   2401 C C   . ASN A 1 317 ? 28.831  -8.373  5.441   1.00 71.05 ? 317  ASN A C   1 
ATOM   2402 O O   . ASN A 1 317 ? 28.130  -9.260  4.972   1.00 72.67 ? 317  ASN A O   1 
ATOM   2403 C CB  . ASN A 1 317 ? 29.461  -6.804  3.626   1.00 69.76 ? 317  ASN A CB  1 
ATOM   2404 C CG  . ASN A 1 317 ? 29.197  -5.479  2.917   1.00 70.25 ? 317  ASN A CG  1 
ATOM   2405 O OD1 . ASN A 1 317 ? 28.312  -4.710  3.308   1.00 72.21 ? 317  ASN A OD1 1 
ATOM   2406 N ND2 . ASN A 1 317 ? 29.977  -5.201  1.870   1.00 71.96 ? 317  ASN A ND2 1 
ATOM   2407 N N   . THR A 1 318 ? 29.755  -8.602  6.368   1.00 71.59 ? 318  THR A N   1 
ATOM   2408 C CA  . THR A 1 318 ? 30.078  -9.949  6.827   1.00 72.99 ? 318  THR A CA  1 
ATOM   2409 C C   . THR A 1 318 ? 29.781  -10.160 8.308   1.00 73.40 ? 318  THR A C   1 
ATOM   2410 O O   . THR A 1 318 ? 30.037  -11.235 8.846   1.00 74.37 ? 318  THR A O   1 
ATOM   2411 C CB  . THR A 1 318 ? 31.572  -10.229 6.620   1.00 73.45 ? 318  THR A CB  1 
ATOM   2412 O OG1 . THR A 1 318 ? 32.339  -9.371  7.477   1.00 72.01 ? 318  THR A OG1 1 
ATOM   2413 C CG2 . THR A 1 318 ? 31.970  -9.998  5.162   1.00 73.75 ? 318  THR A CG2 1 
ATOM   2414 N N   . GLY A 1 319 ? 29.258  -9.139  8.977   1.00 72.94 ? 319  GLY A N   1 
ATOM   2415 C CA  . GLY A 1 319 ? 29.029  -9.224  10.409  1.00 73.25 ? 319  GLY A CA  1 
ATOM   2416 C C   . GLY A 1 319 ? 27.823  -10.080 10.750  1.00 74.38 ? 319  GLY A C   1 
ATOM   2417 O O   . GLY A 1 319 ? 26.900  -10.228 9.936   1.00 74.70 ? 319  GLY A O   1 
ATOM   2418 N N   . ASP A 1 320 ? 27.856  -10.655 11.953  1.00 75.08 ? 320  ASP A N   1 
ATOM   2419 C CA  . ASP A 1 320 ? 26.706  -11.315 12.557  1.00 75.86 ? 320  ASP A CA  1 
ATOM   2420 C C   . ASP A 1 320 ? 26.144  -10.339 13.588  1.00 74.35 ? 320  ASP A C   1 
ATOM   2421 O O   . ASP A 1 320 ? 26.795  -10.053 14.600  1.00 73.76 ? 320  ASP A O   1 
ATOM   2422 C CB  . ASP A 1 320 ? 27.136  -12.629 13.230  1.00 77.48 ? 320  ASP A CB  1 
ATOM   2423 C CG  . ASP A 1 320 ? 25.964  -13.576 13.506  1.00 80.03 ? 320  ASP A CG  1 
ATOM   2424 O OD1 . ASP A 1 320 ? 24.893  -13.439 12.868  1.00 82.36 ? 320  ASP A OD1 1 
ATOM   2425 O OD2 . ASP A 1 320 ? 26.128  -14.488 14.350  1.00 83.06 ? 320  ASP A OD2 1 
ATOM   2426 N N   . PHE A 1 321 ? 24.953  -9.806  13.316  1.00 73.53 ? 321  PHE A N   1 
ATOM   2427 C CA  . PHE A 1 321 ? 24.328  -8.817  14.201  1.00 72.13 ? 321  PHE A CA  1 
ATOM   2428 C C   . PHE A 1 321 ? 23.032  -9.362  14.777  1.00 72.69 ? 321  PHE A C   1 
ATOM   2429 O O   . PHE A 1 321 ? 22.060  -8.634  14.963  1.00 71.92 ? 321  PHE A O   1 
ATOM   2430 C CB  . PHE A 1 321 ? 24.102  -7.510  13.440  1.00 71.05 ? 321  PHE A CB  1 
ATOM   2431 C CG  . PHE A 1 321 ? 25.353  -6.968  12.815  1.00 69.90 ? 321  PHE A CG  1 
ATOM   2432 C CD1 . PHE A 1 321 ? 26.393  -6.520  13.611  1.00 68.72 ? 321  PHE A CD1 1 
ATOM   2433 C CD2 . PHE A 1 321 ? 25.507  -6.942  11.443  1.00 70.17 ? 321  PHE A CD2 1 
ATOM   2434 C CE1 . PHE A 1 321 ? 27.557  -6.037  13.055  1.00 68.44 ? 321  PHE A CE1 1 
ATOM   2435 C CE2 . PHE A 1 321 ? 26.675  -6.456  10.875  1.00 70.26 ? 321  PHE A CE2 1 
ATOM   2436 C CZ  . PHE A 1 321 ? 27.700  -5.999  11.690  1.00 69.22 ? 321  PHE A CZ  1 
ATOM   2437 N N   . GLN A 1 322 ? 23.057  -10.655 15.094  1.00 73.80 ? 322  GLN A N   1 
ATOM   2438 C CA  . GLN A 1 322 ? 21.884  -11.399 15.542  1.00 74.78 ? 322  GLN A CA  1 
ATOM   2439 C C   . GLN A 1 322 ? 21.280  -10.800 16.815  1.00 73.49 ? 322  GLN A C   1 
ATOM   2440 O O   . GLN A 1 322 ? 20.064  -10.595 16.896  1.00 73.85 ? 322  GLN A O   1 
ATOM   2441 C CB  . GLN A 1 322 ? 22.269  -12.859 15.803  1.00 76.06 ? 322  GLN A CB  1 
ATOM   2442 C CG  . GLN A 1 322 ? 21.440  -13.878 15.052  1.00 78.43 ? 322  GLN A CG  1 
ATOM   2443 C CD  . GLN A 1 322 ? 21.873  -15.315 15.359  1.00 80.59 ? 322  GLN A CD  1 
ATOM   2444 O OE1 . GLN A 1 322 ? 21.681  -16.223 14.542  1.00 84.04 ? 322  GLN A OE1 1 
ATOM   2445 N NE2 . GLN A 1 322 ? 22.465  -15.522 16.544  1.00 82.15 ? 322  GLN A NE2 1 
ATOM   2446 N N   . ASP A 1 323 ? 22.128  -10.506 17.797  1.00 71.94 ? 323  ASP A N   1 
ATOM   2447 C CA  . ASP A 1 323 ? 21.652  -10.063 19.115  1.00 71.36 ? 323  ASP A CA  1 
ATOM   2448 C C   . ASP A 1 323 ? 21.643  -8.536  19.311  1.00 68.53 ? 323  ASP A C   1 
ATOM   2449 O O   . ASP A 1 323 ? 21.690  -8.050  20.434  1.00 68.16 ? 323  ASP A O   1 
ATOM   2450 C CB  . ASP A 1 323 ? 22.459  -10.757 20.235  1.00 72.24 ? 323  ASP A CB  1 
ATOM   2451 C CG  . ASP A 1 323 ? 21.826  -12.086 20.681  1.00 75.79 ? 323  ASP A CG  1 
ATOM   2452 O OD1 . ASP A 1 323 ? 21.424  -12.180 21.868  1.00 79.52 ? 323  ASP A OD1 1 
ATOM   2453 O OD2 . ASP A 1 323 ? 21.712  -13.025 19.852  1.00 79.03 ? 323  ASP A OD2 1 
ATOM   2454 N N   . LEU A 1 324 ? 21.539  -7.787  18.222  1.00 66.23 ? 324  LEU A N   1 
ATOM   2455 C CA  . LEU A 1 324 ? 21.597  -6.330  18.282  1.00 63.84 ? 324  LEU A CA  1 
ATOM   2456 C C   . LEU A 1 324 ? 20.248  -5.735  17.911  1.00 61.69 ? 324  LEU A C   1 
ATOM   2457 O O   . LEU A 1 324 ? 19.619  -6.161  16.934  1.00 61.71 ? 324  LEU A O   1 
ATOM   2458 C CB  . LEU A 1 324 ? 22.665  -5.823  17.315  1.00 63.37 ? 324  LEU A CB  1 
ATOM   2459 C CG  . LEU A 1 324 ? 23.146  -4.383  17.461  1.00 63.16 ? 324  LEU A CG  1 
ATOM   2460 C CD1 . LEU A 1 324 ? 23.869  -4.149  18.791  1.00 63.92 ? 324  LEU A CD1 1 
ATOM   2461 C CD2 . LEU A 1 324 ? 24.051  -4.059  16.290  1.00 62.60 ? 324  LEU A CD2 1 
ATOM   2462 N N   . GLN A 1 325 ? 19.791  -4.783  18.719  1.00 58.86 ? 325  GLN A N   1 
ATOM   2463 C CA  . GLN A 1 325 ? 18.718  -3.902  18.312  1.00 57.37 ? 325  GLN A CA  1 
ATOM   2464 C C   . GLN A 1 325 ? 19.319  -2.513  18.083  1.00 54.88 ? 325  GLN A C   1 
ATOM   2465 O O   . GLN A 1 325 ? 20.144  -2.053  18.881  1.00 53.40 ? 325  GLN A O   1 
ATOM   2466 C CB  . GLN A 1 325 ? 17.597  -3.847  19.338  1.00 57.61 ? 325  GLN A CB  1 
ATOM   2467 C CG  . GLN A 1 325 ? 17.055  -5.195  19.748  1.00 60.01 ? 325  GLN A CG  1 
ATOM   2468 C CD  . GLN A 1 325 ? 17.660  -5.691  21.037  1.00 62.05 ? 325  GLN A CD  1 
ATOM   2469 O OE1 . GLN A 1 325 ? 17.710  -4.965  22.025  1.00 61.06 ? 325  GLN A OE1 1 
ATOM   2470 N NE2 . GLN A 1 325 ? 18.118  -6.937  21.038  1.00 63.08 ? 325  GLN A NE2 1 
ATOM   2471 N N   . VAL A 1 326 ? 18.901  -1.876  16.984  1.00 53.34 ? 326  VAL A N   1 
ATOM   2472 C CA  . VAL A 1 326 ? 19.431  -0.578  16.552  1.00 51.77 ? 326  VAL A CA  1 
ATOM   2473 C C   . VAL A 1 326 ? 18.297  0.333   16.086  1.00 50.83 ? 326  VAL A C   1 
ATOM   2474 O O   . VAL A 1 326 ? 17.383  -0.094  15.386  1.00 50.92 ? 326  VAL A O   1 
ATOM   2475 C CB  . VAL A 1 326 ? 20.449  -0.721  15.390  1.00 51.71 ? 326  VAL A CB  1 
ATOM   2476 C CG1 . VAL A 1 326 ? 21.061  0.614   15.044  1.00 50.43 ? 326  VAL A CG1 1 
ATOM   2477 C CG2 . VAL A 1 326 ? 21.554  -1.703  15.752  1.00 52.69 ? 326  VAL A CG2 1 
ATOM   2478 N N   . LEU A 1 327 ? 18.363  1.586   16.506  1.00 49.15 ? 327  LEU A N   1 
ATOM   2479 C CA  . LEU A 1 327 ? 17.478  2.613   16.030  1.00 48.63 ? 327  LEU A CA  1 
ATOM   2480 C C   . LEU A 1 327 ? 18.356  3.599   15.242  1.00 47.54 ? 327  LEU A C   1 
ATOM   2481 O O   . LEU A 1 327 ? 19.426  4.001   15.717  1.00 46.49 ? 327  LEU A O   1 
ATOM   2482 C CB  . LEU A 1 327 ? 16.792  3.269   17.217  1.00 48.54 ? 327  LEU A CB  1 
ATOM   2483 C CG  . LEU A 1 327 ? 15.937  4.530   17.041  1.00 49.57 ? 327  LEU A CG  1 
ATOM   2484 C CD1 . LEU A 1 327 ? 14.740  4.282   16.132  1.00 50.77 ? 327  LEU A CD1 1 
ATOM   2485 C CD2 . LEU A 1 327 ? 15.472  5.014   18.438  1.00 49.44 ? 327  LEU A CD2 1 
ATOM   2486 N N   . VAL A 1 328 ? 17.930  3.942   14.023  1.00 46.54 ? 328  VAL A N   1 
ATOM   2487 C CA  . VAL A 1 328 ? 18.721  4.809   13.150  1.00 45.46 ? 328  VAL A CA  1 
ATOM   2488 C C   . VAL A 1 328 ? 17.816  5.796   12.440  1.00 44.75 ? 328  VAL A C   1 
ATOM   2489 O O   . VAL A 1 328 ? 16.627  5.529   12.220  1.00 45.26 ? 328  VAL A O   1 
ATOM   2490 C CB  . VAL A 1 328 ? 19.511  4.009   12.066  1.00 45.76 ? 328  VAL A CB  1 
ATOM   2491 C CG1 . VAL A 1 328 ? 20.382  2.950   12.705  1.00 46.48 ? 328  VAL A CG1 1 
ATOM   2492 C CG2 . VAL A 1 328 ? 18.552  3.358   11.058  1.00 45.90 ? 328  VAL A CG2 1 
ATOM   2493 N N   . GLY A 1 329 ? 18.375  6.931   12.051  1.00 43.24 ? 329  GLY A N   1 
ATOM   2494 C CA  . GLY A 1 329 ? 17.575  7.898   11.316  1.00 42.99 ? 329  GLY A CA  1 
ATOM   2495 C C   . GLY A 1 329 ? 18.338  9.102   10.878  1.00 41.76 ? 329  GLY A C   1 
ATOM   2496 O O   . GLY A 1 329 ? 19.539  9.204   11.099  1.00 41.57 ? 329  GLY A O   1 
ATOM   2497 N N   . VAL A 1 330 ? 17.597  10.005  10.258  1.00 41.79 ? 330  VAL A N   1 
ATOM   2498 C CA  . VAL A 1 330 ? 18.121  11.180  9.594   1.00 41.50 ? 330  VAL A CA  1 
ATOM   2499 C C   . VAL A 1 330 ? 17.140  12.321  9.838   1.00 41.39 ? 330  VAL A C   1 
ATOM   2500 O O   . VAL A 1 330 ? 15.983  12.069  10.182  1.00 41.69 ? 330  VAL A O   1 
ATOM   2501 C CB  . VAL A 1 330 ? 18.249  10.924  8.069   1.00 41.86 ? 330  VAL A CB  1 
ATOM   2502 C CG1 . VAL A 1 330 ? 19.092  9.672   7.796   1.00 42.21 ? 330  VAL A CG1 1 
ATOM   2503 C CG2 . VAL A 1 330 ? 16.877  10.763  7.441   1.00 42.62 ? 330  VAL A CG2 1 
ATOM   2504 N N   . VAL A 1 331 ? 17.608  13.563  9.686   1.00 40.97 ? 331  VAL A N   1 
ATOM   2505 C CA  . VAL A 1 331 ? 16.733  14.746  9.692   1.00 40.71 ? 331  VAL A CA  1 
ATOM   2506 C C   . VAL A 1 331 ? 16.339  15.066  8.253   1.00 41.90 ? 331  VAL A C   1 
ATOM   2507 O O   . VAL A 1 331 ? 16.934  14.528  7.315   1.00 41.77 ? 331  VAL A O   1 
ATOM   2508 C CB  . VAL A 1 331 ? 17.399  15.988  10.341  1.00 40.61 ? 331  VAL A CB  1 
ATOM   2509 C CG1 . VAL A 1 331 ? 17.658  15.746  11.820  1.00 39.03 ? 331  VAL A CG1 1 
ATOM   2510 C CG2 . VAL A 1 331 ? 18.685  16.435  9.594   1.00 38.20 ? 331  VAL A CG2 1 
ATOM   2511 N N   . LYS A 1 332 ? 15.358  15.951  8.066   1.00 42.94 ? 332  LYS A N   1 
ATOM   2512 C CA  . LYS A 1 332 ? 14.829  16.214  6.730   1.00 43.86 ? 332  LYS A CA  1 
ATOM   2513 C C   . LYS A 1 332 ? 15.885  16.799  5.778   1.00 43.47 ? 332  LYS A C   1 
ATOM   2514 O O   . LYS A 1 332 ? 15.937  16.424  4.596   1.00 42.81 ? 332  LYS A O   1 
ATOM   2515 C CB  . LYS A 1 332 ? 13.589  17.113  6.813   1.00 44.50 ? 332  LYS A CB  1 
ATOM   2516 C CG  . LYS A 1 332 ? 12.761  17.249  5.513   1.00 45.35 ? 332  LYS A CG  1 
ATOM   2517 C CD  . LYS A 1 332 ? 11.542  18.206  5.742   1.00 48.41 ? 332  LYS A CD  1 
ATOM   2518 C CE  . LYS A 1 332 ? 11.622  19.558  4.943   1.00 54.74 ? 332  LYS A CE  1 
ATOM   2519 N NZ  . LYS A 1 332 ? 12.320  20.752  5.605   1.00 54.93 ? 332  LYS A NZ  1 
ATOM   2520 N N   . ASP A 1 333 ? 16.734  17.691  6.295   1.00 43.15 ? 333  ASP A N   1 
ATOM   2521 C CA  . ASP A 1 333 ? 17.708  18.414  5.459   1.00 43.26 ? 333  ASP A CA  1 
ATOM   2522 C C   . ASP A 1 333 ? 19.156  18.258  5.918   1.00 42.84 ? 333  ASP A C   1 
ATOM   2523 O O   . ASP A 1 333 ? 19.773  19.208  6.406   1.00 42.35 ? 333  ASP A O   1 
ATOM   2524 C CB  . ASP A 1 333 ? 17.323  19.899  5.396   1.00 43.58 ? 333  ASP A CB  1 
ATOM   2525 C CG  . ASP A 1 333 ? 15.931  20.096  4.859   1.00 44.51 ? 333  ASP A CG  1 
ATOM   2526 O OD1 . ASP A 1 333 ? 14.949  20.035  5.642   1.00 46.10 ? 333  ASP A OD1 1 
ATOM   2527 O OD2 . ASP A 1 333 ? 15.822  20.256  3.637   1.00 45.33 ? 333  ASP A OD2 1 
ATOM   2528 N N   . GLU A 1 334 ? 19.705  17.059  5.731   1.00 42.86 ? 334  GLU A N   1 
ATOM   2529 C CA  . GLU A 1 334 ? 21.023  16.738  6.269   1.00 42.35 ? 334  GLU A CA  1 
ATOM   2530 C C   . GLU A 1 334 ? 22.148  17.600  5.693   1.00 42.22 ? 334  GLU A C   1 
ATOM   2531 O O   . GLU A 1 334 ? 23.120  17.881  6.379   1.00 42.26 ? 334  GLU A O   1 
ATOM   2532 C CB  . GLU A 1 334 ? 21.345  15.259  6.034   1.00 42.72 ? 334  GLU A CB  1 
ATOM   2533 C CG  . GLU A 1 334 ? 20.516  14.286  6.856   1.00 43.77 ? 334  GLU A CG  1 
ATOM   2534 C CD  . GLU A 1 334 ? 20.939  14.236  8.325   1.00 44.87 ? 334  GLU A CD  1 
ATOM   2535 O OE1 . GLU A 1 334 ? 21.913  14.935  8.705   1.00 44.40 ? 334  GLU A OE1 1 
ATOM   2536 O OE2 . GLU A 1 334 ? 20.290  13.490  9.094   1.00 45.38 ? 334  GLU A OE2 1 
ATOM   2537 N N   . GLY A 1 335 ? 22.020  18.030  4.439   1.00 42.61 ? 335  GLY A N   1 
ATOM   2538 C CA  . GLY A 1 335 ? 23.101  18.749  3.774   1.00 42.01 ? 335  GLY A CA  1 
ATOM   2539 C C   . GLY A 1 335 ? 23.223  20.239  4.011   1.00 42.11 ? 335  GLY A C   1 
ATOM   2540 O O   . GLY A 1 335 ? 24.322  20.799  3.873   1.00 40.84 ? 335  GLY A O   1 
ATOM   2541 N N   . SER A 1 336 ? 22.115  20.902  4.340   1.00 42.92 ? 336  SER A N   1 
ATOM   2542 C CA  . SER A 1 336 ? 22.067  22.373  4.256   1.00 43.64 ? 336  SER A CA  1 
ATOM   2543 C C   . SER A 1 336 ? 23.102  23.068  5.148   1.00 44.70 ? 336  SER A C   1 
ATOM   2544 O O   . SER A 1 336 ? 23.755  24.013  4.720   1.00 44.06 ? 336  SER A O   1 
ATOM   2545 C CB  . SER A 1 336 ? 20.655  22.912  4.528   1.00 43.80 ? 336  SER A CB  1 
ATOM   2546 O OG  . SER A 1 336 ? 20.151  22.516  5.792   1.00 43.38 ? 336  SER A OG  1 
ATOM   2547 N N   . TYR A 1 337 ? 23.255  22.580  6.375   1.00 46.34 ? 337  TYR A N   1 
ATOM   2548 C CA  . TYR A 1 337 ? 24.231  23.121  7.338   1.00 48.15 ? 337  TYR A CA  1 
ATOM   2549 C C   . TYR A 1 337 ? 25.629  23.285  6.745   1.00 48.10 ? 337  TYR A C   1 
ATOM   2550 O O   . TYR A 1 337 ? 26.301  24.296  6.952   1.00 48.40 ? 337  TYR A O   1 
ATOM   2551 C CB  . TYR A 1 337 ? 24.307  22.185  8.549   1.00 49.53 ? 337  TYR A CB  1 
ATOM   2552 C CG  . TYR A 1 337 ? 25.115  22.702  9.706   1.00 51.87 ? 337  TYR A CG  1 
ATOM   2553 C CD1 . TYR A 1 337 ? 24.508  23.423  10.725  1.00 54.44 ? 337  TYR A CD1 1 
ATOM   2554 C CD2 . TYR A 1 337 ? 26.485  22.449  9.804   1.00 53.81 ? 337  TYR A CD2 1 
ATOM   2555 C CE1 . TYR A 1 337 ? 25.245  23.910  11.818  1.00 54.72 ? 337  TYR A CE1 1 
ATOM   2556 C CE2 . TYR A 1 337 ? 27.233  22.941  10.881  1.00 54.50 ? 337  TYR A CE2 1 
ATOM   2557 C CZ  . TYR A 1 337 ? 26.598  23.670  11.887  1.00 54.33 ? 337  TYR A CZ  1 
ATOM   2558 O OH  . TYR A 1 337 ? 27.305  24.150  12.981  1.00 55.46 ? 337  TYR A OH  1 
ATOM   2559 N N   . PHE A 1 338 ? 26.054  22.278  5.995   1.00 47.64 ? 338  PHE A N   1 
ATOM   2560 C CA  . PHE A 1 338 ? 27.420  22.211  5.500   1.00 47.48 ? 338  PHE A CA  1 
ATOM   2561 C C   . PHE A 1 338 ? 27.711  23.136  4.310   1.00 47.97 ? 338  PHE A C   1 
ATOM   2562 O O   . PHE A 1 338 ? 28.889  23.461  4.046   1.00 47.50 ? 338  PHE A O   1 
ATOM   2563 C CB  . PHE A 1 338 ? 27.751  20.755  5.179   1.00 46.92 ? 338  PHE A CB  1 
ATOM   2564 C CG  . PHE A 1 338 ? 27.707  19.865  6.391   1.00 46.83 ? 338  PHE A CG  1 
ATOM   2565 C CD1 . PHE A 1 338 ? 26.528  19.238  6.770   1.00 46.24 ? 338  PHE A CD1 1 
ATOM   2566 C CD2 . PHE A 1 338 ? 28.839  19.693  7.180   1.00 46.44 ? 338  PHE A CD2 1 
ATOM   2567 C CE1 . PHE A 1 338 ? 26.482  18.450  7.905   1.00 45.79 ? 338  PHE A CE1 1 
ATOM   2568 C CE2 . PHE A 1 338 ? 28.801  18.890  8.314   1.00 46.55 ? 338  PHE A CE2 1 
ATOM   2569 C CZ  . PHE A 1 338 ? 27.628  18.266  8.673   1.00 45.62 ? 338  PHE A CZ  1 
ATOM   2570 N N   . LEU A 1 339 ? 26.654  23.579  3.617   1.00 48.22 ? 339  LEU A N   1 
ATOM   2571 C CA  . LEU A 1 339 ? 26.816  24.415  2.410   1.00 48.90 ? 339  LEU A CA  1 
ATOM   2572 C C   . LEU A 1 339 ? 27.403  25.793  2.678   1.00 50.20 ? 339  LEU A C   1 
ATOM   2573 O O   . LEU A 1 339 ? 28.170  26.333  1.857   1.00 50.36 ? 339  LEU A O   1 
ATOM   2574 C CB  . LEU A 1 339 ? 25.483  24.569  1.675   1.00 48.89 ? 339  LEU A CB  1 
ATOM   2575 C CG  . LEU A 1 339 ? 24.856  23.271  1.173   1.00 47.55 ? 339  LEU A CG  1 
ATOM   2576 C CD1 . LEU A 1 339 ? 23.610  23.524  0.375   1.00 46.11 ? 339  LEU A CD1 1 
ATOM   2577 C CD2 . LEU A 1 339 ? 25.872  22.491  0.370   1.00 47.33 ? 339  LEU A CD2 1 
ATOM   2578 N N   . VAL A 1 340 ? 27.032  26.380  3.810   1.00 51.87 ? 340  VAL A N   1 
ATOM   2579 C CA  . VAL A 1 340 ? 27.509  27.728  4.173   1.00 53.26 ? 340  VAL A CA  1 
ATOM   2580 C C   . VAL A 1 340 ? 28.967  27.747  4.668   1.00 54.46 ? 340  VAL A C   1 
ATOM   2581 O O   . VAL A 1 340 ? 29.525  28.811  4.903   1.00 55.48 ? 340  VAL A O   1 
ATOM   2582 C CB  . VAL A 1 340 ? 26.594  28.385  5.231   1.00 53.57 ? 340  VAL A CB  1 
ATOM   2583 C CG1 . VAL A 1 340 ? 25.161  28.506  4.687   1.00 54.25 ? 340  VAL A CG1 1 
ATOM   2584 C CG2 . VAL A 1 340 ? 26.607  27.594  6.554   1.00 53.18 ? 340  VAL A CG2 1 
ATOM   2585 N N   . TYR A 1 341 ? 29.585  26.579  4.813   1.00 55.39 ? 341  TYR A N   1 
ATOM   2586 C CA  . TYR A 1 341 ? 30.977  26.478  5.234   1.00 56.60 ? 341  TYR A CA  1 
ATOM   2587 C C   . TYR A 1 341 ? 31.945  26.162  4.087   1.00 56.98 ? 341  TYR A C   1 
ATOM   2588 O O   . TYR A 1 341 ? 33.034  25.625  4.327   1.00 57.78 ? 341  TYR A O   1 
ATOM   2589 C CB  . TYR A 1 341 ? 31.115  25.379  6.308   1.00 57.47 ? 341  TYR A CB  1 
ATOM   2590 C CG  . TYR A 1 341 ? 30.624  25.785  7.671   1.00 58.35 ? 341  TYR A CG  1 
ATOM   2591 C CD1 . TYR A 1 341 ? 29.317  25.514  8.081   1.00 58.43 ? 341  TYR A CD1 1 
ATOM   2592 C CD2 . TYR A 1 341 ? 31.471  26.450  8.553   1.00 59.80 ? 341  TYR A CD2 1 
ATOM   2593 C CE1 . TYR A 1 341 ? 28.865  25.903  9.344   1.00 59.57 ? 341  TYR A CE1 1 
ATOM   2594 C CE2 . TYR A 1 341 ? 31.032  26.847  9.809   1.00 60.42 ? 341  TYR A CE2 1 
ATOM   2595 C CZ  . TYR A 1 341 ? 29.733  26.568  10.204  1.00 59.68 ? 341  TYR A CZ  1 
ATOM   2596 O OH  . TYR A 1 341 ? 29.320  26.962  11.452  1.00 60.27 ? 341  TYR A OH  1 
ATOM   2597 N N   . GLY A 1 342 ? 31.591  26.462  2.844   1.00 56.82 ? 342  GLY A N   1 
ATOM   2598 C CA  . GLY A 1 342 ? 32.500  26.096  1.758   1.00 56.55 ? 342  GLY A CA  1 
ATOM   2599 C C   . GLY A 1 342 ? 32.042  26.198  0.320   1.00 56.10 ? 342  GLY A C   1 
ATOM   2600 O O   . GLY A 1 342 ? 32.883  26.312  -0.569  1.00 56.92 ? 342  GLY A O   1 
ATOM   2601 N N   . VAL A 1 343 ? 30.739  26.126  0.067   1.00 54.74 ? 343  VAL A N   1 
ATOM   2602 C CA  . VAL A 1 343 ? 30.241  26.229  -1.304  1.00 54.06 ? 343  VAL A CA  1 
ATOM   2603 C C   . VAL A 1 343 ? 29.969  27.705  -1.672  1.00 54.18 ? 343  VAL A C   1 
ATOM   2604 O O   . VAL A 1 343 ? 29.129  28.374  -1.054  1.00 53.79 ? 343  VAL A O   1 
ATOM   2605 C CB  . VAL A 1 343 ? 28.993  25.345  -1.520  1.00 53.79 ? 343  VAL A CB  1 
ATOM   2606 C CG1 . VAL A 1 343 ? 28.549  25.385  -2.983  1.00 53.22 ? 343  VAL A CG1 1 
ATOM   2607 C CG2 . VAL A 1 343 ? 29.285  23.913  -1.092  1.00 52.63 ? 343  VAL A CG2 1 
ATOM   2608 N N   . PRO A 1 344 ? 30.704  28.236  -2.662  1.00 54.14 ? 344  PRO A N   1 
ATOM   2609 C CA  . PRO A 1 344 ? 30.384  29.606  -3.045  1.00 54.51 ? 344  PRO A CA  1 
ATOM   2610 C C   . PRO A 1 344 ? 28.915  29.749  -3.476  1.00 54.19 ? 344  PRO A C   1 
ATOM   2611 O O   . PRO A 1 344 ? 28.370  28.882  -4.188  1.00 52.66 ? 344  PRO A O   1 
ATOM   2612 C CB  . PRO A 1 344 ? 31.343  29.880  -4.215  1.00 55.18 ? 344  PRO A CB  1 
ATOM   2613 C CG  . PRO A 1 344 ? 32.496  28.927  -3.980  1.00 54.46 ? 344  PRO A CG  1 
ATOM   2614 C CD  . PRO A 1 344 ? 31.817  27.693  -3.459  1.00 54.65 ? 344  PRO A CD  1 
ATOM   2615 N N   . GLY A 1 345 ? 28.301  30.828  -2.996  1.00 54.20 ? 345  GLY A N   1 
ATOM   2616 C CA  . GLY A 1 345 ? 26.932  31.171  -3.315  1.00 54.34 ? 345  GLY A CA  1 
ATOM   2617 C C   . GLY A 1 345 ? 26.005  30.975  -2.149  1.00 53.74 ? 345  GLY A C   1 
ATOM   2618 O O   . GLY A 1 345 ? 24.898  31.483  -2.167  1.00 54.55 ? 345  GLY A O   1 
ATOM   2619 N N   . PHE A 1 346 ? 26.452  30.249  -1.128  1.00 53.51 ? 346  PHE A N   1 
ATOM   2620 C CA  . PHE A 1 346 ? 25.579  29.882  -0.008  1.00 53.19 ? 346  PHE A CA  1 
ATOM   2621 C C   . PHE A 1 346 ? 25.850  30.733  1.235   1.00 54.25 ? 346  PHE A C   1 
ATOM   2622 O O   . PHE A 1 346 ? 26.990  31.074  1.540   1.00 54.35 ? 346  PHE A O   1 
ATOM   2623 C CB  . PHE A 1 346 ? 25.692  28.386  0.296   1.00 52.08 ? 346  PHE A CB  1 
ATOM   2624 C CG  . PHE A 1 346 ? 25.071  27.490  -0.788  1.00 50.22 ? 346  PHE A CG  1 
ATOM   2625 C CD1 . PHE A 1 346 ? 25.781  27.158  -1.915  1.00 47.67 ? 346  PHE A CD1 1 
ATOM   2626 C CD2 . PHE A 1 346 ? 23.776  26.991  -0.647  1.00 49.24 ? 346  PHE A CD2 1 
ATOM   2627 C CE1 . PHE A 1 346 ? 25.209  26.350  -2.909  1.00 50.09 ? 346  PHE A CE1 1 
ATOM   2628 C CE2 . PHE A 1 346 ? 23.205  26.186  -1.617  1.00 49.79 ? 346  PHE A CE2 1 
ATOM   2629 C CZ  . PHE A 1 346 ? 23.918  25.867  -2.757  1.00 49.60 ? 346  PHE A CZ  1 
ATOM   2630 N N   . SER A 1 347 ? 24.775  31.095  1.928   1.00 55.09 ? 347  SER A N   1 
ATOM   2631 C CA  . SER A 1 347 ? 24.852  31.989  3.075   1.00 55.88 ? 347  SER A CA  1 
ATOM   2632 C C   . SER A 1 347 ? 23.630  31.813  3.946   1.00 55.66 ? 347  SER A C   1 
ATOM   2633 O O   . SER A 1 347 ? 22.553  31.515  3.440   1.00 55.85 ? 347  SER A O   1 
ATOM   2634 C CB  . SER A 1 347 ? 24.944  33.443  2.606   1.00 56.73 ? 347  SER A CB  1 
ATOM   2635 O OG  . SER A 1 347 ? 25.040  34.329  3.706   1.00 58.49 ? 347  SER A OG  1 
ATOM   2636 N N   . LYS A 1 348 ? 23.802  31.984  5.254   1.00 55.82 ? 348  LYS A N   1 
ATOM   2637 C CA  . LYS A 1 348 ? 22.664  32.013  6.173   1.00 56.12 ? 348  LYS A CA  1 
ATOM   2638 C C   . LYS A 1 348 ? 21.917  33.338  6.057   1.00 56.36 ? 348  LYS A C   1 
ATOM   2639 O O   . LYS A 1 348 ? 20.766  33.421  6.449   1.00 56.48 ? 348  LYS A O   1 
ATOM   2640 C CB  . LYS A 1 348 ? 23.107  31.792  7.632   1.00 56.05 ? 348  LYS A CB  1 
ATOM   2641 C CG  . LYS A 1 348 ? 23.673  33.029  8.335   1.00 57.07 ? 348  LYS A CG  1 
ATOM   2642 C CD  . LYS A 1 348 ? 23.756  32.862  9.853   1.00 57.55 ? 348  LYS A CD  1 
ATOM   2643 C CE  . LYS A 1 348 ? 24.090  34.195  10.566  1.00 58.90 ? 348  LYS A CE  1 
ATOM   2644 N NZ  . LYS A 1 348 ? 22.904  35.114  10.655  1.00 60.34 ? 348  LYS A NZ  1 
ATOM   2645 N N   . ASP A 1 349 ? 22.587  34.370  5.536   1.00 56.68 ? 349  ASP A N   1 
ATOM   2646 C CA  . ASP A 1 349 ? 22.033  35.742  5.519   1.00 57.65 ? 349  ASP A CA  1 
ATOM   2647 C C   . ASP A 1 349 ? 21.250  36.116  4.245   1.00 58.16 ? 349  ASP A C   1 
ATOM   2648 O O   . ASP A 1 349 ? 20.723  37.219  4.156   1.00 58.63 ? 349  ASP A O   1 
ATOM   2649 C CB  . ASP A 1 349 ? 23.142  36.764  5.799   1.00 57.86 ? 349  ASP A CB  1 
ATOM   2650 C CG  . ASP A 1 349 ? 23.774  36.577  7.181   1.00 58.46 ? 349  ASP A CG  1 
ATOM   2651 O OD1 . ASP A 1 349 ? 23.030  36.325  8.158   1.00 57.87 ? 349  ASP A OD1 1 
ATOM   2652 O OD2 . ASP A 1 349 ? 25.022  36.656  7.287   1.00 60.37 ? 349  ASP A OD2 1 
ATOM   2653 N N   . ASN A 1 350 ? 21.166  35.198  3.281   1.00 57.92 ? 350  ASN A N   1 
ATOM   2654 C CA  . ASN A 1 350 ? 20.239  35.330  2.157   1.00 58.66 ? 350  ASN A CA  1 
ATOM   2655 C C   . ASN A 1 350 ? 19.662  33.976  1.735   1.00 57.50 ? 350  ASN A C   1 
ATOM   2656 O O   . ASN A 1 350 ? 19.995  32.936  2.320   1.00 56.89 ? 350  ASN A O   1 
ATOM   2657 C CB  . ASN A 1 350 ? 20.887  36.083  0.975   1.00 59.43 ? 350  ASN A CB  1 
ATOM   2658 C CG  . ASN A 1 350 ? 22.073  35.360  0.370   1.00 62.38 ? 350  ASN A CG  1 
ATOM   2659 O OD1 . ASN A 1 350 ? 22.044  34.145  0.169   1.00 63.06 ? 350  ASN A OD1 1 
ATOM   2660 N ND2 . ASN A 1 350 ? 23.132  36.135  0.043   1.00 70.33 ? 350  ASN A ND2 1 
ATOM   2661 N N   . GLU A 1 351 ? 18.791  34.000  0.727   1.00 56.99 ? 351  GLU A N   1 
ATOM   2662 C CA  . GLU A 1 351 ? 18.103  32.797  0.238   1.00 55.93 ? 351  GLU A CA  1 
ATOM   2663 C C   . GLU A 1 351 ? 18.982  31.782  -0.505  1.00 54.21 ? 351  GLU A C   1 
ATOM   2664 O O   . GLU A 1 351 ? 18.522  30.688  -0.804  1.00 52.63 ? 351  GLU A O   1 
ATOM   2665 C CB  . GLU A 1 351 ? 16.945  33.202  -0.676  1.00 57.22 ? 351  GLU A CB  1 
ATOM   2666 C CG  . GLU A 1 351 ? 15.827  33.888  0.057   1.00 60.93 ? 351  GLU A CG  1 
ATOM   2667 C CD  . GLU A 1 351 ? 15.221  32.980  1.105   1.00 64.96 ? 351  GLU A CD  1 
ATOM   2668 O OE1 . GLU A 1 351 ? 14.487  32.024  0.737   1.00 68.44 ? 351  GLU A OE1 1 
ATOM   2669 O OE2 . GLU A 1 351 ? 15.502  33.214  2.300   1.00 67.20 ? 351  GLU A OE2 1 
ATOM   2670 N N   . SER A 1 352 ? 20.219  32.164  -0.818  1.00 53.45 ? 352  SER A N   1 
ATOM   2671 C CA  . SER A 1 352 ? 21.214  31.263  -1.429  1.00 52.90 ? 352  SER A CA  1 
ATOM   2672 C C   . SER A 1 352 ? 20.748  30.669  -2.750  1.00 52.20 ? 352  SER A C   1 
ATOM   2673 O O   . SER A 1 352 ? 21.057  29.531  -3.058  1.00 51.31 ? 352  SER A O   1 
ATOM   2674 C CB  . SER A 1 352 ? 21.636  30.156  -0.454  1.00 51.78 ? 352  SER A CB  1 
ATOM   2675 O OG  . SER A 1 352 ? 22.292  30.724  0.659   1.00 52.27 ? 352  SER A OG  1 
ATOM   2676 N N   . LEU A 1 353 ? 20.034  31.467  -3.543  1.00 52.28 ? 353  LEU A N   1 
ATOM   2677 C CA  . LEU A 1 353 ? 19.651  31.055  -4.884  1.00 52.39 ? 353  LEU A CA  1 
ATOM   2678 C C   . LEU A 1 353 ? 20.920  31.036  -5.734  1.00 51.66 ? 353  LEU A C   1 
ATOM   2679 O O   . LEU A 1 353 ? 21.586  32.045  -5.868  1.00 53.42 ? 353  LEU A O   1 
ATOM   2680 C CB  . LEU A 1 353 ? 18.627  32.026  -5.450  1.00 53.24 ? 353  LEU A CB  1 
ATOM   2681 C CG  . LEU A 1 353 ? 17.337  32.123  -4.634  1.00 54.73 ? 353  LEU A CG  1 
ATOM   2682 C CD1 . LEU A 1 353 ? 16.502  33.319  -5.087  1.00 58.18 ? 353  LEU A CD1 1 
ATOM   2683 C CD2 . LEU A 1 353 ? 16.547  30.836  -4.727  1.00 54.96 ? 353  LEU A CD2 1 
ATOM   2684 N N   . ILE A 1 354 ? 21.277  29.883  -6.277  1.00 50.20 ? 354  ILE A N   1 
ATOM   2685 C CA  . ILE A 1 354 ? 22.545  29.739  -6.988  1.00 48.82 ? 354  ILE A CA  1 
ATOM   2686 C C   . ILE A 1 354 ? 22.339  29.520  -8.479  1.00 48.88 ? 354  ILE A C   1 
ATOM   2687 O O   . ILE A 1 354 ? 21.277  29.113  -8.917  1.00 49.22 ? 354  ILE A O   1 
ATOM   2688 C CB  . ILE A 1 354 ? 23.410  28.595  -6.388  1.00 48.17 ? 354  ILE A CB  1 
ATOM   2689 C CG1 . ILE A 1 354 ? 22.647  27.258  -6.367  1.00 46.41 ? 354  ILE A CG1 1 
ATOM   2690 C CG2 . ILE A 1 354 ? 23.868  28.966  -4.981  1.00 47.20 ? 354  ILE A CG2 1 
ATOM   2691 C CD1 . ILE A 1 354 ? 23.536  26.036  -6.354  1.00 46.43 ? 354  ILE A CD1 1 
ATOM   2692 N N   . SER A 1 355 ? 23.370  29.812  -9.255  1.00 49.00 ? 355  SER A N   1 
ATOM   2693 C CA  . SER A 1 355 ? 23.366  29.556  -10.687 1.00 49.68 ? 355  SER A CA  1 
ATOM   2694 C C   . SER A 1 355 ? 23.750  28.103  -10.943 1.00 49.32 ? 355  SER A C   1 
ATOM   2695 O O   . SER A 1 355 ? 24.194  27.397  -10.047 1.00 48.20 ? 355  SER A O   1 
ATOM   2696 C CB  . SER A 1 355 ? 24.371  30.471  -11.395 1.00 50.45 ? 355  SER A CB  1 
ATOM   2697 O OG  . SER A 1 355 ? 25.713  30.200  -10.962 1.00 51.34 ? 355  SER A OG  1 
ATOM   2698 N N   . ARG A 1 356 ? 23.580  27.673  -12.184 1.00 50.20 ? 356  ARG A N   1 
ATOM   2699 C CA  . ARG A 1 356 ? 23.991  26.350  -12.587 1.00 50.59 ? 356  ARG A CA  1 
ATOM   2700 C C   . ARG A 1 356 ? 25.519  26.187  -12.514 1.00 50.46 ? 356  ARG A C   1 
ATOM   2701 O O   . ARG A 1 356 ? 26.007  25.146  -12.090 1.00 49.81 ? 356  ARG A O   1 
ATOM   2702 C CB  . ARG A 1 356 ? 23.474  26.046  -13.987 1.00 51.53 ? 356  ARG A CB  1 
ATOM   2703 C CG  . ARG A 1 356 ? 23.825  24.667  -14.440 1.00 53.07 ? 356  ARG A CG  1 
ATOM   2704 C CD  . ARG A 1 356 ? 22.850  24.119  -15.433 1.00 56.31 ? 356  ARG A CD  1 
ATOM   2705 N NE  . ARG A 1 356 ? 23.151  22.708  -15.631 1.00 57.88 ? 356  ARG A NE  1 
ATOM   2706 C CZ  . ARG A 1 356 ? 22.650  21.713  -14.906 1.00 56.58 ? 356  ARG A CZ  1 
ATOM   2707 N NH1 . ARG A 1 356 ? 21.754  21.941  -13.950 1.00 56.78 ? 356  ARG A NH1 1 
ATOM   2708 N NH2 . ARG A 1 356 ? 23.031  20.475  -15.174 1.00 56.33 ? 356  ARG A NH2 1 
ATOM   2709 N N   . ALA A 1 357 ? 26.265  27.220  -12.902 1.00 50.56 ? 357  ALA A N   1 
ATOM   2710 C CA  . ALA A 1 357 ? 27.720  27.212  -12.732 1.00 50.45 ? 357  ALA A CA  1 
ATOM   2711 C C   . ALA A 1 357 ? 28.113  26.928  -11.264 1.00 49.59 ? 357  ALA A C   1 
ATOM   2712 O O   . ALA A 1 357 ? 29.031  26.150  -10.986 1.00 49.61 ? 357  ALA A O   1 
ATOM   2713 C CB  . ALA A 1 357 ? 28.339  28.562  -13.217 1.00 50.76 ? 357  ALA A CB  1 
ATOM   2714 N N   . GLN A 1 358 ? 27.420  27.578  -10.338 1.00 49.20 ? 358  GLN A N   1 
ATOM   2715 C CA  . GLN A 1 358 ? 27.677  27.421  -8.912  1.00 48.36 ? 358  GLN A CA  1 
ATOM   2716 C C   . GLN A 1 358 ? 27.280  26.042  -8.405  1.00 47.50 ? 358  GLN A C   1 
ATOM   2717 O O   . GLN A 1 358 ? 27.907  25.508  -7.487  1.00 47.12 ? 358  GLN A O   1 
ATOM   2718 C CB  . GLN A 1 358 ? 26.947  28.507  -8.119  1.00 48.53 ? 358  GLN A CB  1 
ATOM   2719 C CG  . GLN A 1 358 ? 27.539  29.907  -8.275  1.00 49.35 ? 358  GLN A CG  1 
ATOM   2720 C CD  . GLN A 1 358 ? 26.706  30.982  -7.603  1.00 49.90 ? 358  GLN A CD  1 
ATOM   2721 O OE1 . GLN A 1 358 ? 25.485  30.977  -7.686  1.00 51.63 ? 358  GLN A OE1 1 
ATOM   2722 N NE2 . GLN A 1 358 ? 27.370  31.920  -6.940  1.00 51.45 ? 358  GLN A NE2 1 
ATOM   2723 N N   . PHE A 1 359 ? 26.247  25.460  -9.000  1.00 47.25 ? 359  PHE A N   1 
ATOM   2724 C CA  . PHE A 1 359 ? 25.874  24.083  -8.699  1.00 46.65 ? 359  PHE A CA  1 
ATOM   2725 C C   . PHE A 1 359 ? 26.968  23.095  -9.109  1.00 46.36 ? 359  PHE A C   1 
ATOM   2726 O O   . PHE A 1 359 ? 27.349  22.250  -8.323  1.00 45.10 ? 359  PHE A O   1 
ATOM   2727 C CB  . PHE A 1 359 ? 24.570  23.747  -9.403  1.00 47.50 ? 359  PHE A CB  1 
ATOM   2728 C CG  . PHE A 1 359 ? 24.104  22.337  -9.205  1.00 46.86 ? 359  PHE A CG  1 
ATOM   2729 C CD1 . PHE A 1 359 ? 23.993  21.478  -10.281 1.00 48.58 ? 359  PHE A CD1 1 
ATOM   2730 C CD2 . PHE A 1 359 ? 23.746  21.883  -7.957  1.00 47.71 ? 359  PHE A CD2 1 
ATOM   2731 C CE1 . PHE A 1 359 ? 23.538  20.180  -10.115 1.00 48.92 ? 359  PHE A CE1 1 
ATOM   2732 C CE2 . PHE A 1 359 ? 23.294  20.576  -7.776  1.00 48.81 ? 359  PHE A CE2 1 
ATOM   2733 C CZ  . PHE A 1 359 ? 23.188  19.728  -8.858  1.00 48.76 ? 359  PHE A CZ  1 
ATOM   2734 N N   . LEU A 1 360 ? 27.472  23.211  -10.335 1.00 47.19 ? 360  LEU A N   1 
ATOM   2735 C CA  . LEU A 1 360 ? 28.538  22.313  -10.816 1.00 47.89 ? 360  LEU A CA  1 
ATOM   2736 C C   . LEU A 1 360 ? 29.803  22.438  -9.967  1.00 47.51 ? 360  LEU A C   1 
ATOM   2737 O O   . LEU A 1 360 ? 30.420  21.438  -9.617  1.00 47.64 ? 360  LEU A O   1 
ATOM   2738 C CB  . LEU A 1 360 ? 28.894  22.606  -12.280 1.00 48.83 ? 360  LEU A CB  1 
ATOM   2739 C CG  . LEU A 1 360 ? 27.816  22.563  -13.381 1.00 51.01 ? 360  LEU A CG  1 
ATOM   2740 C CD1 . LEU A 1 360 ? 28.488  22.559  -14.788 1.00 52.75 ? 360  LEU A CD1 1 
ATOM   2741 C CD2 . LEU A 1 360 ? 26.867  21.391  -13.257 1.00 48.65 ? 360  LEU A CD2 1 
ATOM   2742 N N   . ALA A 1 361 ? 30.189  23.672  -9.646  1.00 47.50 ? 361  ALA A N   1 
ATOM   2743 C CA  . ALA A 1 361 ? 31.326  23.923  -8.754  1.00 47.26 ? 361  ALA A CA  1 
ATOM   2744 C C   . ALA A 1 361 ? 31.059  23.328  -7.380  1.00 46.67 ? 361  ALA A C   1 
ATOM   2745 O O   . ALA A 1 361 ? 31.953  22.693  -6.781  1.00 47.01 ? 361  ALA A O   1 
ATOM   2746 C CB  . ALA A 1 361 ? 31.608  25.428  -8.636  1.00 47.40 ? 361  ALA A CB  1 
ATOM   2747 N N   . GLY A 1 362 ? 29.830  23.529  -6.894  1.00 45.72 ? 362  GLY A N   1 
ATOM   2748 C CA  . GLY A 1 362 ? 29.384  23.019  -5.601  1.00 45.01 ? 362  GLY A CA  1 
ATOM   2749 C C   . GLY A 1 362 ? 29.485  21.506  -5.476  1.00 45.08 ? 362  GLY A C   1 
ATOM   2750 O O   . GLY A 1 362 ? 29.902  20.983  -4.433  1.00 44.15 ? 362  GLY A O   1 
ATOM   2751 N N   . VAL A 1 363 ? 29.084  20.806  -6.536  1.00 45.51 ? 363  VAL A N   1 
ATOM   2752 C CA  . VAL A 1 363 ? 29.143  19.348  -6.579  1.00 45.77 ? 363  VAL A CA  1 
ATOM   2753 C C   . VAL A 1 363 ? 30.569  18.816  -6.430  1.00 46.42 ? 363  VAL A C   1 
ATOM   2754 O O   . VAL A 1 363 ? 30.771  17.794  -5.776  1.00 46.37 ? 363  VAL A O   1 
ATOM   2755 C CB  . VAL A 1 363 ? 28.514  18.782  -7.872  1.00 46.45 ? 363  VAL A CB  1 
ATOM   2756 C CG1 . VAL A 1 363 ? 28.851  17.286  -8.039  1.00 45.86 ? 363  VAL A CG1 1 
ATOM   2757 C CG2 . VAL A 1 363 ? 26.990  18.979  -7.856  1.00 46.08 ? 363  VAL A CG2 1 
ATOM   2758 N N   . ARG A 1 364 ? 31.549  19.496  -7.031  1.00 47.01 ? 364  ARG A N   1 
ATOM   2759 C CA  . ARG A 1 364 ? 32.951  19.114  -6.863  1.00 47.37 ? 364  ARG A CA  1 
ATOM   2760 C C   . ARG A 1 364 ? 33.417  19.282  -5.406  1.00 46.07 ? 364  ARG A C   1 
ATOM   2761 O O   . ARG A 1 364 ? 34.235  18.512  -4.939  1.00 46.02 ? 364  ARG A O   1 
ATOM   2762 C CB  . ARG A 1 364 ? 33.879  19.926  -7.789  1.00 48.27 ? 364  ARG A CB  1 
ATOM   2763 C CG  . ARG A 1 364 ? 33.627  19.791  -9.290  1.00 51.47 ? 364  ARG A CG  1 
ATOM   2764 C CD  . ARG A 1 364 ? 33.177  18.391  -9.734  1.00 53.97 ? 364  ARG A CD  1 
ATOM   2765 N NE  . ARG A 1 364 ? 34.206  17.352  -9.595  1.00 55.76 ? 364  ARG A NE  1 
ATOM   2766 C CZ  . ARG A 1 364 ? 35.077  16.998  -10.554 1.00 57.75 ? 364  ARG A CZ  1 
ATOM   2767 N NH1 . ARG A 1 364 ? 35.075  17.594  -11.749 1.00 57.80 ? 364  ARG A NH1 1 
ATOM   2768 N NH2 . ARG A 1 364 ? 35.959  16.028  -10.318 1.00 57.39 ? 364  ARG A NH2 1 
ATOM   2769 N N   . ILE A 1 365 ? 32.917  20.293  -4.702  1.00 45.00 ? 365  ILE A N   1 
ATOM   2770 C CA  . ILE A 1 365 ? 33.296  20.508  -3.304  1.00 44.14 ? 365  ILE A CA  1 
ATOM   2771 C C   . ILE A 1 365 ? 32.541  19.543  -2.385  1.00 43.67 ? 365  ILE A C   1 
ATOM   2772 O O   . ILE A 1 365 ? 33.095  19.036  -1.397  1.00 43.15 ? 365  ILE A O   1 
ATOM   2773 C CB  . ILE A 1 365 ? 33.090  21.966  -2.863  1.00 43.96 ? 365  ILE A CB  1 
ATOM   2774 C CG1 . ILE A 1 365 ? 33.941  22.911  -3.712  1.00 44.43 ? 365  ILE A CG1 1 
ATOM   2775 C CG2 . ILE A 1 365 ? 33.456  22.163  -1.376  1.00 43.80 ? 365  ILE A CG2 1 
ATOM   2776 C CD1 . ILE A 1 365 ? 33.421  24.338  -3.718  1.00 44.60 ? 365  ILE A CD1 1 
ATOM   2777 N N   . GLY A 1 366 ? 31.296  19.259  -2.737  1.00 43.42 ? 366  GLY A N   1 
ATOM   2778 C CA  . GLY A 1 366 ? 30.452  18.376  -1.937  1.00 43.37 ? 366  GLY A CA  1 
ATOM   2779 C C   . GLY A 1 366 ? 30.651  16.892  -2.168  1.00 43.40 ? 366  GLY A C   1 
ATOM   2780 O O   . GLY A 1 366 ? 30.224  16.081  -1.341  1.00 44.01 ? 366  GLY A O   1 
ATOM   2781 N N   . VAL A 1 367 ? 31.258  16.517  -3.292  1.00 43.79 ? 367  VAL A N   1 
ATOM   2782 C CA  . VAL A 1 367 ? 31.605  15.114  -3.561  1.00 43.47 ? 367  VAL A CA  1 
ATOM   2783 C C   . VAL A 1 367 ? 33.065  15.122  -3.963  1.00 44.04 ? 367  VAL A C   1 
ATOM   2784 O O   . VAL A 1 367 ? 33.411  14.861  -5.122  1.00 44.34 ? 367  VAL A O   1 
ATOM   2785 C CB  . VAL A 1 367 ? 30.720  14.479  -4.656  1.00 43.86 ? 367  VAL A CB  1 
ATOM   2786 C CG1 . VAL A 1 367 ? 30.872  12.951  -4.613  1.00 43.71 ? 367  VAL A CG1 1 
ATOM   2787 C CG2 . VAL A 1 367 ? 29.266  14.881  -4.458  1.00 42.10 ? 367  VAL A CG2 1 
ATOM   2788 N N   . PRO A 1 368 ? 33.931  15.495  -3.004  1.00 43.91 ? 368  PRO A N   1 
ATOM   2789 C CA  . PRO A 1 368 ? 35.315  15.865  -3.310  1.00 44.64 ? 368  PRO A CA  1 
ATOM   2790 C C   . PRO A 1 368 ? 36.180  14.730  -3.869  1.00 45.98 ? 368  PRO A C   1 
ATOM   2791 O O   . PRO A 1 368 ? 37.197  15.008  -4.479  1.00 45.84 ? 368  PRO A O   1 
ATOM   2792 C CB  . PRO A 1 368 ? 35.851  16.368  -1.964  1.00 43.80 ? 368  PRO A CB  1 
ATOM   2793 C CG  . PRO A 1 368 ? 34.971  15.791  -0.949  1.00 43.19 ? 368  PRO A CG  1 
ATOM   2794 C CD  . PRO A 1 368 ? 33.628  15.641  -1.570  1.00 43.12 ? 368  PRO A CD  1 
ATOM   2795 N N   . GLN A 1 369 ? 35.774  13.480  -3.661  1.00 46.74 ? 369  GLN A N   1 
ATOM   2796 C CA  . GLN A 1 369 ? 36.533  12.329  -4.164  1.00 48.61 ? 369  GLN A CA  1 
ATOM   2797 C C   . GLN A 1 369 ? 36.001  11.832  -5.501  1.00 49.83 ? 369  GLN A C   1 
ATOM   2798 O O   . GLN A 1 369 ? 36.530  10.871  -6.051  1.00 51.02 ? 369  GLN A O   1 
ATOM   2799 C CB  . GLN A 1 369 ? 36.521  11.173  -3.146  1.00 48.50 ? 369  GLN A CB  1 
ATOM   2800 C CG  . GLN A 1 369 ? 37.601  11.288  -2.067  1.00 48.36 ? 369  GLN A CG  1 
ATOM   2801 C CD  . GLN A 1 369 ? 37.272  12.312  -0.990  1.00 48.29 ? 369  GLN A CD  1 
ATOM   2802 O OE1 . GLN A 1 369 ? 36.374  12.102  -0.159  1.00 45.05 ? 369  GLN A OE1 1 
ATOM   2803 N NE2 . GLN A 1 369 ? 38.018  13.419  -0.981  1.00 45.92 ? 369  GLN A NE2 1 
ATOM   2804 N N   . ALA A 1 370 ? 34.970  12.483  -6.032  1.00 50.30 ? 370  ALA A N   1 
ATOM   2805 C CA  . ALA A 1 370 ? 34.434  12.118  -7.350  1.00 51.11 ? 370  ALA A CA  1 
ATOM   2806 C C   . ALA A 1 370 ? 35.367  12.510  -8.495  1.00 52.13 ? 370  ALA A C   1 
ATOM   2807 O O   . ALA A 1 370 ? 35.839  13.647  -8.587  1.00 51.60 ? 370  ALA A O   1 
ATOM   2808 C CB  . ALA A 1 370 ? 33.067  12.742  -7.571  1.00 50.49 ? 370  ALA A CB  1 
ATOM   2809 N N   . SER A 1 371 ? 35.611  11.549  -9.380  1.00 53.51 ? 371  SER A N   1 
ATOM   2810 C CA  . SER A 1 371 ? 36.176  11.819  -10.696 1.00 54.31 ? 371  SER A CA  1 
ATOM   2811 C C   . SER A 1 371 ? 35.271  12.764  -11.478 1.00 54.48 ? 371  SER A C   1 
ATOM   2812 O O   . SER A 1 371 ? 34.153  13.064  -11.059 1.00 53.20 ? 371  SER A O   1 
ATOM   2813 C CB  . SER A 1 371 ? 36.285  10.505  -11.465 1.00 55.42 ? 371  SER A CB  1 
ATOM   2814 O OG  . SER A 1 371 ? 34.990  9.927   -11.694 1.00 56.18 ? 371  SER A OG  1 
ATOM   2815 N N   . ASP A 1 372 ? 35.747  13.210  -12.634 1.00 55.66 ? 372  ASP A N   1 
ATOM   2816 C CA  . ASP A 1 372 ? 34.950  14.047  -13.525 1.00 56.07 ? 372  ASP A CA  1 
ATOM   2817 C C   . ASP A 1 372 ? 33.671  13.328  -13.996 1.00 55.89 ? 372  ASP A C   1 
ATOM   2818 O O   . ASP A 1 372 ? 32.598  13.928  -14.037 1.00 55.22 ? 372  ASP A O   1 
ATOM   2819 C CB  . ASP A 1 372 ? 35.772  14.483  -14.752 1.00 57.52 ? 372  ASP A CB  1 
ATOM   2820 C CG  . ASP A 1 372 ? 36.928  15.425  -14.401 1.00 59.80 ? 372  ASP A CG  1 
ATOM   2821 O OD1 . ASP A 1 372 ? 36.988  15.944  -13.267 1.00 61.51 ? 372  ASP A OD1 1 
ATOM   2822 O OD2 . ASP A 1 372 ? 37.787  15.656  -15.284 1.00 64.42 ? 372  ASP A OD2 1 
ATOM   2823 N N   . LEU A 1 373 ? 33.796  12.053  -14.359 1.00 56.11 ? 373  LEU A N   1 
ATOM   2824 C CA  . LEU A 1 373 ? 32.651  11.268  -14.836 1.00 56.14 ? 373  LEU A CA  1 
ATOM   2825 C C   . LEU A 1 373 ? 31.627  11.044  -13.721 1.00 54.93 ? 373  LEU A C   1 
ATOM   2826 O O   . LEU A 1 373 ? 30.429  11.192  -13.945 1.00 54.90 ? 373  LEU A O   1 
ATOM   2827 C CB  . LEU A 1 373 ? 33.107  9.915   -15.406 1.00 56.84 ? 373  LEU A CB  1 
ATOM   2828 C CG  . LEU A 1 373 ? 32.042  9.042   -16.094 1.00 57.80 ? 373  LEU A CG  1 
ATOM   2829 C CD1 . LEU A 1 373 ? 31.291  9.801   -17.207 1.00 56.68 ? 373  LEU A CD1 1 
ATOM   2830 C CD2 . LEU A 1 373 ? 32.654  7.748   -16.649 1.00 58.11 ? 373  LEU A CD2 1 
ATOM   2831 N N   . ALA A 1 374 ? 32.100  10.681  -12.531 1.00 53.93 ? 374  ALA A N   1 
ATOM   2832 C CA  . ALA A 1 374 ? 31.222  10.490  -11.374 1.00 53.04 ? 374  ALA A CA  1 
ATOM   2833 C C   . ALA A 1 374 ? 30.474  11.775  -11.031 1.00 52.05 ? 374  ALA A C   1 
ATOM   2834 O O   . ALA A 1 374 ? 29.288  11.733  -10.742 1.00 51.95 ? 374  ALA A O   1 
ATOM   2835 C CB  . ALA A 1 374 ? 32.015  9.978   -10.153 1.00 52.53 ? 374  ALA A CB  1 
ATOM   2836 N N   . ALA A 1 375 ? 31.161  12.913  -11.088 1.00 51.68 ? 375  ALA A N   1 
ATOM   2837 C CA  . ALA A 1 375 ? 30.546  14.202  -10.761 1.00 51.25 ? 375  ALA A CA  1 
ATOM   2838 C C   . ALA A 1 375 ? 29.495  14.632  -11.792 1.00 51.95 ? 375  ALA A C   1 
ATOM   2839 O O   . ALA A 1 375 ? 28.498  15.279  -11.438 1.00 51.54 ? 375  ALA A O   1 
ATOM   2840 C CB  . ALA A 1 375 ? 31.601  15.279  -10.599 1.00 50.61 ? 375  ALA A CB  1 
ATOM   2841 N N   . GLU A 1 376 ? 29.708  14.304  -13.066 1.00 52.74 ? 376  GLU A N   1 
ATOM   2842 C CA  . GLU A 1 376 ? 28.681  14.596  -14.069 1.00 53.37 ? 376  GLU A CA  1 
ATOM   2843 C C   . GLU A 1 376 ? 27.501  13.649  -13.885 1.00 51.78 ? 376  GLU A C   1 
ATOM   2844 O O   . GLU A 1 376 ? 26.367  14.035  -14.118 1.00 51.99 ? 376  GLU A O   1 
ATOM   2845 C CB  . GLU A 1 376 ? 29.221  14.554  -15.515 1.00 55.30 ? 376  GLU A CB  1 
ATOM   2846 C CG  . GLU A 1 376 ? 29.515  15.964  -16.148 1.00 59.86 ? 376  GLU A CG  1 
ATOM   2847 C CD  . GLU A 1 376 ? 28.359  17.014  -15.958 1.00 65.19 ? 376  GLU A CD  1 
ATOM   2848 O OE1 . GLU A 1 376 ? 28.658  18.153  -15.474 1.00 66.56 ? 376  GLU A OE1 1 
ATOM   2849 O OE2 . GLU A 1 376 ? 27.169  16.698  -16.277 1.00 66.71 ? 376  GLU A OE2 1 
ATOM   2850 N N   . ALA A 1 377 ? 27.762  12.422  -13.449 1.00 50.27 ? 377  ALA A N   1 
ATOM   2851 C CA  . ALA A 1 377 ? 26.687  11.499  -13.079 1.00 49.39 ? 377  ALA A CA  1 
ATOM   2852 C C   . ALA A 1 377 ? 25.802  12.093  -11.973 1.00 47.97 ? 377  ALA A C   1 
ATOM   2853 O O   . ALA A 1 377 ? 24.568  11.992  -12.033 1.00 47.41 ? 377  ALA A O   1 
ATOM   2854 C CB  . ALA A 1 377 ? 27.250  10.172  -12.640 1.00 49.39 ? 377  ALA A CB  1 
ATOM   2855 N N   . VAL A 1 378 ? 26.442  12.708  -10.976 1.00 46.42 ? 378  VAL A N   1 
ATOM   2856 C CA  . VAL A 1 378 ? 25.740  13.341  -9.864  1.00 45.16 ? 378  VAL A CA  1 
ATOM   2857 C C   . VAL A 1 378 ? 24.913  14.512  -10.368 1.00 45.46 ? 378  VAL A C   1 
ATOM   2858 O O   . VAL A 1 378 ? 23.715  14.598  -10.106 1.00 45.61 ? 378  VAL A O   1 
ATOM   2859 C CB  . VAL A 1 378 ? 26.711  13.850  -8.778  1.00 44.46 ? 378  VAL A CB  1 
ATOM   2860 C CG1 . VAL A 1 378 ? 25.982  14.772  -7.795  1.00 42.23 ? 378  VAL A CG1 1 
ATOM   2861 C CG2 . VAL A 1 378 ? 27.374  12.673  -8.058  1.00 42.68 ? 378  VAL A CG2 1 
ATOM   2862 N N   . VAL A 1 379 ? 25.559  15.401  -11.113 1.00 45.77 ? 379  VAL A N   1 
ATOM   2863 C CA  . VAL A 1 379 ? 24.883  16.553  -11.699 1.00 45.79 ? 379  VAL A CA  1 
ATOM   2864 C C   . VAL A 1 379 ? 23.669  16.140  -12.549 1.00 46.72 ? 379  VAL A C   1 
ATOM   2865 O O   . VAL A 1 379 ? 22.626  16.770  -12.483 1.00 46.60 ? 379  VAL A O   1 
ATOM   2866 C CB  . VAL A 1 379 ? 25.857  17.393  -12.554 1.00 46.05 ? 379  VAL A CB  1 
ATOM   2867 C CG1 . VAL A 1 379 ? 25.093  18.382  -13.456 1.00 45.23 ? 379  VAL A CG1 1 
ATOM   2868 C CG2 . VAL A 1 379 ? 26.866  18.116  -11.655 1.00 43.90 ? 379  VAL A CG2 1 
ATOM   2869 N N   . LEU A 1 380 ? 23.809  15.084  -13.339 1.00 47.82 ? 380  LEU A N   1 
ATOM   2870 C CA  . LEU A 1 380 ? 22.736  14.673  -14.235 1.00 48.93 ? 380  LEU A CA  1 
ATOM   2871 C C   . LEU A 1 380 ? 21.577  14.037  -13.476 1.00 48.37 ? 380  LEU A C   1 
ATOM   2872 O O   . LEU A 1 380 ? 20.427  14.175  -13.874 1.00 48.25 ? 380  LEU A O   1 
ATOM   2873 C CB  . LEU A 1 380 ? 23.261  13.753  -15.336 1.00 50.38 ? 380  LEU A CB  1 
ATOM   2874 C CG  . LEU A 1 380 ? 24.293  14.396  -16.297 1.00 53.46 ? 380  LEU A CG  1 
ATOM   2875 C CD1 . LEU A 1 380 ? 24.829  13.365  -17.294 1.00 55.08 ? 380  LEU A CD1 1 
ATOM   2876 C CD2 . LEU A 1 380 ? 23.762  15.632  -17.055 1.00 56.12 ? 380  LEU A CD2 1 
ATOM   2877 N N   . HIS A 1 381 ? 21.881  13.365  -12.371 1.00 47.64 ? 381  HIS A N   1 
ATOM   2878 C CA  . HIS A 1 381 ? 20.859  12.747  -11.540 1.00 47.41 ? 381  HIS A CA  1 
ATOM   2879 C C   . HIS A 1 381 ? 20.036  13.776  -10.757 1.00 46.76 ? 381  HIS A C   1 
ATOM   2880 O O   . HIS A 1 381 ? 18.829  13.617  -10.602 1.00 46.22 ? 381  HIS A O   1 
ATOM   2881 C CB  . HIS A 1 381 ? 21.499  11.762  -10.561 1.00 47.38 ? 381  HIS A CB  1 
ATOM   2882 C CG  . HIS A 1 381 ? 20.512  11.044  -9.698  1.00 48.12 ? 381  HIS A CG  1 
ATOM   2883 N ND1 . HIS A 1 381 ? 19.817  9.936   -10.126 1.00 50.80 ? 381  HIS A ND1 1 
ATOM   2884 C CD2 . HIS A 1 381 ? 20.098  11.280  -8.430  1.00 49.52 ? 381  HIS A CD2 1 
ATOM   2885 C CE1 . HIS A 1 381 ? 19.014  9.522   -9.159  1.00 51.80 ? 381  HIS A CE1 1 
ATOM   2886 N NE2 . HIS A 1 381 ? 19.162  10.324  -8.120  1.00 49.99 ? 381  HIS A NE2 1 
ATOM   2887 N N   . TYR A 1 382 ? 20.698  14.813  -10.250 1.00 46.14 ? 382  TYR A N   1 
ATOM   2888 C CA  . TYR A 1 382 ? 20.056  15.779  -9.352  1.00 45.51 ? 382  TYR A CA  1 
ATOM   2889 C C   . TYR A 1 382 ? 19.499  16.982  -10.089 1.00 45.96 ? 382  TYR A C   1 
ATOM   2890 O O   . TYR A 1 382 ? 18.689  17.716  -9.533  1.00 46.51 ? 382  TYR A O   1 
ATOM   2891 C CB  . TYR A 1 382 ? 21.031  16.228  -8.267  1.00 45.00 ? 382  TYR A CB  1 
ATOM   2892 C CG  . TYR A 1 382 ? 21.177  15.240  -7.132  1.00 44.08 ? 382  TYR A CG  1 
ATOM   2893 C CD1 . TYR A 1 382 ? 22.128  14.234  -7.174  1.00 43.79 ? 382  TYR A CD1 1 
ATOM   2894 C CD2 . TYR A 1 382 ? 20.351  15.317  -6.013  1.00 44.17 ? 382  TYR A CD2 1 
ATOM   2895 C CE1 . TYR A 1 382 ? 22.253  13.326  -6.126  1.00 44.67 ? 382  TYR A CE1 1 
ATOM   2896 C CE2 . TYR A 1 382 ? 20.461  14.426  -4.969  1.00 43.10 ? 382  TYR A CE2 1 
ATOM   2897 C CZ  . TYR A 1 382 ? 21.413  13.435  -5.023  1.00 44.44 ? 382  TYR A CZ  1 
ATOM   2898 O OH  . TYR A 1 382 ? 21.521  12.562  -3.973  1.00 43.11 ? 382  TYR A OH  1 
ATOM   2899 N N   . THR A 1 383 ? 19.927  17.199  -11.331 1.00 46.24 ? 383  THR A N   1 
ATOM   2900 C CA  . THR A 1 383 ? 19.324  18.222  -12.154 1.00 46.39 ? 383  THR A CA  1 
ATOM   2901 C C   . THR A 1 383 ? 17.884  17.848  -12.427 1.00 47.42 ? 383  THR A C   1 
ATOM   2902 O O   . THR A 1 383 ? 17.582  16.700  -12.718 1.00 47.84 ? 383  THR A O   1 
ATOM   2903 C CB  . THR A 1 383 ? 20.093  18.421  -13.478 1.00 46.91 ? 383  THR A CB  1 
ATOM   2904 O OG1 . THR A 1 383 ? 21.374  18.989  -13.189 1.00 45.60 ? 383  THR A OG1 1 
ATOM   2905 C CG2 . THR A 1 383 ? 19.339  19.340  -14.453 1.00 45.90 ? 383  THR A CG2 1 
ATOM   2906 N N   . ASP A 1 384 ? 16.999  18.827  -12.307 1.00 48.33 ? 384  ASP A N   1 
ATOM   2907 C CA  . ASP A 1 384 ? 15.631  18.707  -12.790 1.00 49.68 ? 384  ASP A CA  1 
ATOM   2908 C C   . ASP A 1 384 ? 15.624  19.161  -14.227 1.00 50.55 ? 384  ASP A C   1 
ATOM   2909 O O   . ASP A 1 384 ? 15.777  20.347  -14.489 1.00 51.37 ? 384  ASP A O   1 
ATOM   2910 C CB  . ASP A 1 384 ? 14.688  19.593  -11.979 1.00 49.74 ? 384  ASP A CB  1 
ATOM   2911 C CG  . ASP A 1 384 ? 13.240  19.515  -12.468 1.00 52.52 ? 384  ASP A CG  1 
ATOM   2912 O OD1 . ASP A 1 384 ? 12.998  19.328  -13.677 1.00 52.77 ? 384  ASP A OD1 1 
ATOM   2913 O OD2 . ASP A 1 384 ? 12.336  19.654  -11.628 1.00 56.51 ? 384  ASP A OD2 1 
ATOM   2914 N N   . TRP A 1 385 ? 15.425  18.237  -15.165 1.00 51.28 ? 385  TRP A N   1 
ATOM   2915 C CA  . TRP A 1 385 ? 15.586  18.574  -16.579 1.00 51.82 ? 385  TRP A CA  1 
ATOM   2916 C C   . TRP A 1 385 ? 14.406  19.336  -17.177 1.00 52.97 ? 385  TRP A C   1 
ATOM   2917 O O   . TRP A 1 385 ? 14.500  19.837  -18.295 1.00 53.64 ? 385  TRP A O   1 
ATOM   2918 C CB  . TRP A 1 385 ? 16.000  17.345  -17.393 1.00 51.83 ? 385  TRP A CB  1 
ATOM   2919 C CG  . TRP A 1 385 ? 17.356  16.915  -16.978 1.00 50.47 ? 385  TRP A CG  1 
ATOM   2920 C CD1 . TRP A 1 385 ? 17.665  15.920  -16.117 1.00 49.86 ? 385  TRP A CD1 1 
ATOM   2921 C CD2 . TRP A 1 385 ? 18.592  17.535  -17.340 1.00 49.40 ? 385  TRP A CD2 1 
ATOM   2922 N NE1 . TRP A 1 385 ? 19.022  15.855  -15.935 1.00 49.31 ? 385  TRP A NE1 1 
ATOM   2923 C CE2 . TRP A 1 385 ? 19.618  16.833  -16.680 1.00 48.89 ? 385  TRP A CE2 1 
ATOM   2924 C CE3 . TRP A 1 385 ? 18.929  18.612  -18.165 1.00 50.88 ? 385  TRP A CE3 1 
ATOM   2925 C CZ2 . TRP A 1 385 ? 20.961  17.169  -16.805 1.00 49.13 ? 385  TRP A CZ2 1 
ATOM   2926 C CZ3 . TRP A 1 385 ? 20.272  18.948  -18.304 1.00 50.87 ? 385  TRP A CZ3 1 
ATOM   2927 C CH2 . TRP A 1 385 ? 21.274  18.219  -17.628 1.00 50.34 ? 385  TRP A CH2 1 
ATOM   2928 N N   . LEU A 1 386 ? 13.320  19.462  -16.426 1.00 53.71 ? 386  LEU A N   1 
ATOM   2929 C CA  . LEU A 1 386 ? 12.295  20.455  -16.759 1.00 55.12 ? 386  LEU A CA  1 
ATOM   2930 C C   . LEU A 1 386 ? 12.763  21.871  -16.441 1.00 55.13 ? 386  LEU A C   1 
ATOM   2931 O O   . LEU A 1 386 ? 12.397  22.811  -17.139 1.00 56.34 ? 386  LEU A O   1 
ATOM   2932 C CB  . LEU A 1 386 ? 10.990  20.187  -16.016 1.00 55.73 ? 386  LEU A CB  1 
ATOM   2933 C CG  . LEU A 1 386 ? 10.064  19.158  -16.671 1.00 57.90 ? 386  LEU A CG  1 
ATOM   2934 C CD1 . LEU A 1 386 ? 8.847   18.941  -15.792 1.00 58.85 ? 386  LEU A CD1 1 
ATOM   2935 C CD2 . LEU A 1 386 ? 9.668   19.619  -18.080 1.00 59.42 ? 386  LEU A CD2 1 
ATOM   2936 N N   . HIS A 1 387 ? 13.566  22.023  -15.388 1.00 54.09 ? 387  HIS A N   1 
ATOM   2937 C CA  . HIS A 1 387 ? 13.961  23.348  -14.915 1.00 53.76 ? 387  HIS A CA  1 
ATOM   2938 C C   . HIS A 1 387 ? 15.439  23.362  -14.584 1.00 52.38 ? 387  HIS A C   1 
ATOM   2939 O O   . HIS A 1 387 ? 15.812  23.627  -13.457 1.00 51.24 ? 387  HIS A O   1 
ATOM   2940 C CB  . HIS A 1 387 ? 13.133  23.730  -13.678 1.00 53.62 ? 387  HIS A CB  1 
ATOM   2941 C CG  . HIS A 1 387 ? 11.653  23.688  -13.906 1.00 54.83 ? 387  HIS A CG  1 
ATOM   2942 N ND1 . HIS A 1 387 ? 10.843  22.715  -13.360 1.00 55.08 ? 387  HIS A ND1 1 
ATOM   2943 C CD2 . HIS A 1 387 ? 10.838  24.497  -14.624 1.00 57.12 ? 387  HIS A CD2 1 
ATOM   2944 C CE1 . HIS A 1 387 ? 9.593   22.930  -13.728 1.00 56.44 ? 387  HIS A CE1 1 
ATOM   2945 N NE2 . HIS A 1 387 ? 9.562   24.004  -14.497 1.00 56.92 ? 387  HIS A NE2 1 
ATOM   2946 N N   . PRO A 1 388 ? 16.290  23.065  -15.577 1.00 52.49 ? 388  PRO A N   1 
ATOM   2947 C CA  . PRO A 1 388 ? 17.711  22.850  -15.310 1.00 51.76 ? 388  PRO A CA  1 
ATOM   2948 C C   . PRO A 1 388 ? 18.478  24.058  -14.754 1.00 51.27 ? 388  PRO A C   1 
ATOM   2949 O O   . PRO A 1 388 ? 19.565  23.877  -14.220 1.00 50.66 ? 388  PRO A O   1 
ATOM   2950 C CB  . PRO A 1 388 ? 18.274  22.435  -16.677 1.00 52.19 ? 388  PRO A CB  1 
ATOM   2951 C CG  . PRO A 1 388 ? 17.304  22.933  -17.670 1.00 53.34 ? 388  PRO A CG  1 
ATOM   2952 C CD  . PRO A 1 388 ? 15.968  22.903  -17.006 1.00 53.67 ? 388  PRO A CD  1 
ATOM   2953 N N   . GLU A 1 389 ? 17.932  25.265  -14.869 1.00 51.68 ? 389  GLU A N   1 
ATOM   2954 C CA  . GLU A 1 389 ? 18.628  26.462  -14.397 1.00 51.98 ? 389  GLU A CA  1 
ATOM   2955 C C   . GLU A 1 389 ? 17.861  27.246  -13.335 1.00 50.95 ? 389  GLU A C   1 
ATOM   2956 O O   . GLU A 1 389 ? 18.172  28.411  -13.054 1.00 50.99 ? 389  GLU A O   1 
ATOM   2957 C CB  . GLU A 1 389 ? 18.946  27.358  -15.593 1.00 53.49 ? 389  GLU A CB  1 
ATOM   2958 C CG  . GLU A 1 389 ? 19.974  26.723  -16.502 1.00 56.84 ? 389  GLU A CG  1 
ATOM   2959 C CD  . GLU A 1 389 ? 20.631  27.709  -17.426 1.00 62.55 ? 389  GLU A CD  1 
ATOM   2960 O OE1 . GLU A 1 389 ? 21.853  27.962  -17.220 1.00 65.41 ? 389  GLU A OE1 1 
ATOM   2961 O OE2 . GLU A 1 389 ? 19.917  28.235  -18.327 1.00 64.19 ? 389  GLU A OE2 1 
ATOM   2962 N N   . ASP A 1 390 ? 16.860  26.612  -12.742 1.00 50.00 ? 390  ASP A N   1 
ATOM   2963 C CA  . ASP A 1 390 ? 16.093  27.252  -11.690 1.00 49.16 ? 390  ASP A CA  1 
ATOM   2964 C C   . ASP A 1 390 ? 16.923  27.354  -10.400 1.00 47.95 ? 390  ASP A C   1 
ATOM   2965 O O   . ASP A 1 390 ? 17.265  26.339  -9.803  1.00 46.48 ? 390  ASP A O   1 
ATOM   2966 C CB  . ASP A 1 390 ? 14.808  26.489  -11.406 1.00 49.32 ? 390  ASP A CB  1 
ATOM   2967 C CG  . ASP A 1 390 ? 13.972  27.192  -10.383 1.00 49.89 ? 390  ASP A CG  1 
ATOM   2968 O OD1 . ASP A 1 390 ? 13.237  28.100  -10.768 1.00 53.70 ? 390  ASP A OD1 1 
ATOM   2969 O OD2 . ASP A 1 390 ? 14.109  26.911  -9.188  1.00 50.97 ? 390  ASP A OD2 1 
ATOM   2970 N N   . PRO A 1 391 ? 17.224  28.584  -9.951  1.00 48.20 ? 391  PRO A N   1 
ATOM   2971 C CA  . PRO A 1 391 ? 18.065  28.778  -8.760  1.00 47.73 ? 391  PRO A CA  1 
ATOM   2972 C C   . PRO A 1 391 ? 17.555  28.118  -7.477  1.00 47.03 ? 391  PRO A C   1 
ATOM   2973 O O   . PRO A 1 391 ? 18.365  27.672  -6.683  1.00 46.71 ? 391  PRO A O   1 
ATOM   2974 C CB  . PRO A 1 391 ? 18.074  30.299  -8.579  1.00 47.70 ? 391  PRO A CB  1 
ATOM   2975 C CG  . PRO A 1 391 ? 17.754  30.839  -9.871  1.00 49.47 ? 391  PRO A CG  1 
ATOM   2976 C CD  . PRO A 1 391 ? 16.806  29.875  -10.517 1.00 49.21 ? 391  PRO A CD  1 
ATOM   2977 N N   . THR A 1 392 ? 16.241  28.070  -7.278  1.00 47.51 ? 392  THR A N   1 
ATOM   2978 C CA  . THR A 1 392 ? 15.670  27.437  -6.086  1.00 47.67 ? 392  THR A CA  1 
ATOM   2979 C C   . THR A 1 392 ? 15.885  25.932  -6.121  1.00 47.69 ? 392  THR A C   1 
ATOM   2980 O O   . THR A 1 392 ? 16.310  25.350  -5.114  1.00 47.02 ? 392  THR A O   1 
ATOM   2981 C CB  . THR A 1 392 ? 14.163  27.737  -5.911  1.00 48.32 ? 392  THR A CB  1 
ATOM   2982 O OG1 . THR A 1 392 ? 13.973  29.150  -5.816  1.00 48.53 ? 392  THR A OG1 1 
ATOM   2983 C CG2 . THR A 1 392 ? 13.618  27.081  -4.637  1.00 47.37 ? 392  THR A CG2 1 
ATOM   2984 N N   . HIS A 1 393 ? 15.611  25.305  -7.268  1.00 48.49 ? 393  HIS A N   1 
ATOM   2985 C CA  . HIS A 1 393 ? 15.863  23.877  -7.399  1.00 48.96 ? 393  HIS A CA  1 
ATOM   2986 C C   . HIS A 1 393 ? 17.339  23.551  -7.232  1.00 47.64 ? 393  HIS A C   1 
ATOM   2987 O O   . HIS A 1 393 ? 17.675  22.572  -6.595  1.00 47.66 ? 393  HIS A O   1 
ATOM   2988 C CB  . HIS A 1 393 ? 15.397  23.281  -8.733  1.00 50.45 ? 393  HIS A CB  1 
ATOM   2989 C CG  . HIS A 1 393 ? 15.855  21.863  -8.914  1.00 53.20 ? 393  HIS A CG  1 
ATOM   2990 N ND1 . HIS A 1 393 ? 15.215  20.790  -8.318  1.00 57.07 ? 393  HIS A ND1 1 
ATOM   2991 C CD2 . HIS A 1 393 ? 16.954  21.351  -9.526  1.00 55.44 ? 393  HIS A CD2 1 
ATOM   2992 C CE1 . HIS A 1 393 ? 15.879  19.677  -8.594  1.00 56.40 ? 393  HIS A CE1 1 
ATOM   2993 N NE2 . HIS A 1 393 ? 16.935  19.991  -9.330  1.00 56.20 ? 393  HIS A NE2 1 
ATOM   2994 N N   . LEU A 1 394 ? 18.205  24.351  -7.840  1.00 47.10 ? 394  LEU A N   1 
ATOM   2995 C CA  . LEU A 1 394 ? 19.647  24.124  -7.782  1.00 46.32 ? 394  LEU A CA  1 
ATOM   2996 C C   . LEU A 1 394 ? 20.167  24.225  -6.346  1.00 45.74 ? 394  LEU A C   1 
ATOM   2997 O O   . LEU A 1 394 ? 20.969  23.397  -5.899  1.00 45.24 ? 394  LEU A O   1 
ATOM   2998 C CB  . LEU A 1 394 ? 20.379  25.118  -8.696  1.00 46.46 ? 394  LEU A CB  1 
ATOM   2999 C CG  . LEU A 1 394 ? 20.202  24.906  -10.212 1.00 47.44 ? 394  LEU A CG  1 
ATOM   3000 C CD1 . LEU A 1 394 ? 20.843  26.045  -11.015 1.00 46.56 ? 394  LEU A CD1 1 
ATOM   3001 C CD2 . LEU A 1 394 ? 20.794  23.579  -10.641 1.00 46.97 ? 394  LEU A CD2 1 
ATOM   3002 N N   . ARG A 1 395 ? 19.696  25.233  -5.622  1.00 45.69 ? 395  ARG A N   1 
ATOM   3003 C CA  . ARG A 1 395 ? 20.058  25.388  -4.223  1.00 45.44 ? 395  ARG A CA  1 
ATOM   3004 C C   . ARG A 1 395 ? 19.653  24.150  -3.428  1.00 45.07 ? 395  ARG A C   1 
ATOM   3005 O O   . ARG A 1 395 ? 20.495  23.520  -2.766  1.00 44.92 ? 395  ARG A O   1 
ATOM   3006 C CB  . ARG A 1 395 ? 19.432  26.664  -3.661  1.00 45.69 ? 395  ARG A CB  1 
ATOM   3007 C CG  . ARG A 1 395 ? 19.541  26.820  -2.144  1.00 45.62 ? 395  ARG A CG  1 
ATOM   3008 C CD  . ARG A 1 395 ? 18.185  26.602  -1.522  1.00 47.22 ? 395  ARG A CD  1 
ATOM   3009 N NE  . ARG A 1 395 ? 17.504  27.860  -1.397  1.00 47.27 ? 395  ARG A NE  1 
ATOM   3010 C CZ  . ARG A 1 395 ? 16.195  28.034  -1.287  1.00 46.70 ? 395  ARG A CZ  1 
ATOM   3011 N NH1 . ARG A 1 395 ? 15.340  27.025  -1.307  1.00 45.80 ? 395  ARG A NH1 1 
ATOM   3012 N NH2 . ARG A 1 395 ? 15.746  29.278  -1.146  1.00 49.50 ? 395  ARG A NH2 1 
ATOM   3013 N N   . ASP A 1 396 ? 18.384  23.770  -3.542  1.00 44.95 ? 396  ASP A N   1 
ATOM   3014 C CA  . ASP A 1 396 ? 17.863  22.598  -2.841  1.00 44.36 ? 396  ASP A CA  1 
ATOM   3015 C C   . ASP A 1 396 ? 18.503  21.291  -3.296  1.00 43.95 ? 396  ASP A C   1 
ATOM   3016 O O   . ASP A 1 396 ? 18.663  20.369  -2.493  1.00 43.37 ? 396  ASP A O   1 
ATOM   3017 C CB  . ASP A 1 396 ? 16.335  22.539  -2.968  1.00 44.87 ? 396  ASP A CB  1 
ATOM   3018 C CG  . ASP A 1 396 ? 15.655  23.682  -2.226  1.00 46.09 ? 396  ASP A CG  1 
ATOM   3019 O OD1 . ASP A 1 396 ? 16.274  24.259  -1.302  1.00 46.42 ? 396  ASP A OD1 1 
ATOM   3020 O OD2 . ASP A 1 396 ? 14.513  24.025  -2.570  1.00 51.39 ? 396  ASP A OD2 1 
ATOM   3021 N N   . ALA A 1 397 ? 18.881  21.208  -4.567  1.00 44.00 ? 397  ALA A N   1 
ATOM   3022 C CA  . ALA A 1 397 ? 19.564  20.007  -5.083  1.00 44.16 ? 397  ALA A CA  1 
ATOM   3023 C C   . ALA A 1 397 ? 20.982  19.888  -4.524  1.00 43.43 ? 397  ALA A C   1 
ATOM   3024 O O   . ALA A 1 397 ? 21.462  18.787  -4.253  1.00 44.52 ? 397  ALA A O   1 
ATOM   3025 C CB  . ALA A 1 397 ? 19.594  20.006  -6.611  1.00 44.18 ? 397  ALA A CB  1 
ATOM   3026 N N   . MET A 1 398 ? 21.656  21.016  -4.358  1.00 43.22 ? 398  MET A N   1 
ATOM   3027 C CA  . MET A 1 398 ? 22.994  21.020  -3.775  1.00 42.77 ? 398  MET A CA  1 
ATOM   3028 C C   . MET A 1 398 ? 22.963  20.476  -2.343  1.00 41.96 ? 398  MET A C   1 
ATOM   3029 O O   . MET A 1 398 ? 23.779  19.631  -1.964  1.00 41.88 ? 398  MET A O   1 
ATOM   3030 C CB  . MET A 1 398 ? 23.566  22.437  -3.793  1.00 42.73 ? 398  MET A CB  1 
ATOM   3031 C CG  . MET A 1 398 ? 25.049  22.504  -3.457  1.00 43.72 ? 398  MET A CG  1 
ATOM   3032 S SD  . MET A 1 398 ? 26.112  21.627  -4.621  1.00 44.31 ? 398  MET A SD  1 
ATOM   3033 C CE  . MET A 1 398 ? 26.660  20.248  -3.604  1.00 42.86 ? 398  MET A CE  1 
ATOM   3034 N N   . SER A 1 399 ? 22.012  20.965  -1.558  1.00 41.62 ? 399  SER A N   1 
ATOM   3035 C CA  . SER A 1 399 ? 21.770  20.452  -0.219  1.00 41.25 ? 399  SER A CA  1 
ATOM   3036 C C   . SER A 1 399 ? 21.541  18.952  -0.231  1.00 40.86 ? 399  SER A C   1 
ATOM   3037 O O   . SER A 1 399 ? 22.171  18.215  0.550   1.00 40.75 ? 399  SER A O   1 
ATOM   3038 C CB  . SER A 1 399 ? 20.556  21.154  0.411   1.00 41.67 ? 399  SER A CB  1 
ATOM   3039 O OG  . SER A 1 399 ? 20.282  20.640  1.706   1.00 41.59 ? 399  SER A OG  1 
ATOM   3040 N N   . ALA A 1 400 ? 20.650  18.500  -1.113  1.00 40.64 ? 400  ALA A N   1 
ATOM   3041 C CA  . ALA A 1 400 ? 20.321  17.065  -1.236  1.00 40.50 ? 400  ALA A CA  1 
ATOM   3042 C C   . ALA A 1 400 ? 21.551  16.196  -1.576  1.00 40.23 ? 400  ALA A C   1 
ATOM   3043 O O   . ALA A 1 400 ? 21.728  15.122  -1.013  1.00 40.40 ? 400  ALA A O   1 
ATOM   3044 C CB  . ALA A 1 400 ? 19.223  16.852  -2.271  1.00 40.80 ? 400  ALA A CB  1 
ATOM   3045 N N   . VAL A 1 401 ? 22.385  16.661  -2.499  1.00 40.28 ? 401  VAL A N   1 
ATOM   3046 C CA  . VAL A 1 401 ? 23.619  15.952  -2.857  1.00 40.37 ? 401  VAL A CA  1 
ATOM   3047 C C   . VAL A 1 401 ? 24.496  15.663  -1.633  1.00 40.32 ? 401  VAL A C   1 
ATOM   3048 O O   . VAL A 1 401 ? 24.909  14.530  -1.412  1.00 39.86 ? 401  VAL A O   1 
ATOM   3049 C CB  . VAL A 1 401 ? 24.455  16.750  -3.911  1.00 40.79 ? 401  VAL A CB  1 
ATOM   3050 C CG1 . VAL A 1 401 ? 25.904  16.199  -4.015  1.00 39.27 ? 401  VAL A CG1 1 
ATOM   3051 C CG2 . VAL A 1 401 ? 23.758  16.739  -5.293  1.00 39.54 ? 401  VAL A CG2 1 
ATOM   3052 N N   . VAL A 1 402 ? 24.780  16.708  -0.861  1.00 40.58 ? 402  VAL A N   1 
ATOM   3053 C CA  . VAL A 1 402 ? 25.658  16.622  0.304   1.00 40.55 ? 402  VAL A CA  1 
ATOM   3054 C C   . VAL A 1 402 ? 25.004  15.757  1.402   1.00 40.85 ? 402  VAL A C   1 
ATOM   3055 O O   . VAL A 1 402 ? 25.646  14.891  2.002   1.00 41.22 ? 402  VAL A O   1 
ATOM   3056 C CB  . VAL A 1 402 ? 25.982  18.045  0.833   1.00 40.56 ? 402  VAL A CB  1 
ATOM   3057 C CG1 . VAL A 1 402 ? 26.746  17.995  2.167   1.00 41.11 ? 402  VAL A CG1 1 
ATOM   3058 C CG2 . VAL A 1 402 ? 26.766  18.837  -0.208  1.00 39.75 ? 402  VAL A CG2 1 
ATOM   3059 N N   . GLY A 1 403 ? 23.723  15.996  1.647   1.00 40.45 ? 403  GLY A N   1 
ATOM   3060 C CA  . GLY A 1 403 ? 22.974  15.212  2.602   1.00 40.81 ? 403  GLY A CA  1 
ATOM   3061 C C   . GLY A 1 403 ? 22.902  13.743  2.239   1.00 41.01 ? 403  GLY A C   1 
ATOM   3062 O O   . GLY A 1 403 ? 23.152  12.894  3.088   1.00 41.46 ? 403  GLY A O   1 
ATOM   3063 N N   . ASP A 1 404 ? 22.590  13.438  0.980   1.00 41.30 ? 404  ASP A N   1 
ATOM   3064 C CA  . ASP A 1 404 ? 22.446  12.049  0.545   1.00 41.74 ? 404  ASP A CA  1 
ATOM   3065 C C   . ASP A 1 404 ? 23.788  11.323  0.528   1.00 42.04 ? 404  ASP A C   1 
ATOM   3066 O O   . ASP A 1 404 ? 23.904  10.175  0.972   1.00 41.66 ? 404  ASP A O   1 
ATOM   3067 C CB  . ASP A 1 404 ? 21.854  11.975  -0.855  1.00 42.47 ? 404  ASP A CB  1 
ATOM   3068 C CG  . ASP A 1 404 ? 20.416  12.483  -0.938  1.00 43.12 ? 404  ASP A CG  1 
ATOM   3069 O OD1 . ASP A 1 404 ? 19.710  12.642  0.093   1.00 42.89 ? 404  ASP A OD1 1 
ATOM   3070 O OD2 . ASP A 1 404 ? 19.997  12.734  -2.078  1.00 44.53 ? 404  ASP A OD2 1 
ATOM   3071 N N   . HIS A 1 405 ? 24.802  11.985  -0.014  1.00 41.81 ? 405  HIS A N   1 
ATOM   3072 C CA  . HIS A 1 405 ? 26.132  11.378  -0.130  1.00 42.05 ? 405  HIS A CA  1 
ATOM   3073 C C   . HIS A 1 405 ? 26.700  10.989  1.246   1.00 42.01 ? 405  HIS A C   1 
ATOM   3074 O O   . HIS A 1 405 ? 27.212  9.880   1.440   1.00 42.30 ? 405  HIS A O   1 
ATOM   3075 C CB  . HIS A 1 405 ? 27.045  12.371  -0.855  1.00 41.83 ? 405  HIS A CB  1 
ATOM   3076 C CG  . HIS A 1 405 ? 28.470  11.944  -0.967  1.00 41.25 ? 405  HIS A CG  1 
ATOM   3077 N ND1 . HIS A 1 405 ? 28.848  10.678  -1.355  1.00 40.99 ? 405  HIS A ND1 1 
ATOM   3078 C CD2 . HIS A 1 405 ? 29.616  12.636  -0.766  1.00 41.45 ? 405  HIS A CD2 1 
ATOM   3079 C CE1 . HIS A 1 405 ? 30.168  10.609  -1.385  1.00 41.76 ? 405  HIS A CE1 1 
ATOM   3080 N NE2 . HIS A 1 405 ? 30.657  11.777  -1.011  1.00 42.34 ? 405  HIS A NE2 1 
ATOM   3081 N N   . ASN A 1 406 ? 26.557  11.898  2.207   1.00 41.31 ? 406  ASN A N   1 
ATOM   3082 C CA  . ASN A 1 406 ? 27.254  11.788  3.485   1.00 40.82 ? 406  ASN A CA  1 
ATOM   3083 C C   . ASN A 1 406 ? 26.449  11.121  4.590   1.00 40.29 ? 406  ASN A C   1 
ATOM   3084 O O   . ASN A 1 406 ? 27.024  10.484  5.457   1.00 40.36 ? 406  ASN A O   1 
ATOM   3085 C CB  . ASN A 1 406 ? 27.711  13.179  3.940   1.00 40.62 ? 406  ASN A CB  1 
ATOM   3086 C CG  . ASN A 1 406 ? 28.813  13.726  3.076   1.00 40.64 ? 406  ASN A CG  1 
ATOM   3087 O OD1 . ASN A 1 406 ? 29.911  13.158  3.021   1.00 40.96 ? 406  ASN A OD1 1 
ATOM   3088 N ND2 . ASN A 1 406 ? 28.532  14.812  2.379   1.00 37.46 ? 406  ASN A ND2 1 
ATOM   3089 N N   . VAL A 1 407 ? 25.127  11.246  4.553   1.00 40.11 ? 407  VAL A N   1 
ATOM   3090 C CA  . VAL A 1 407 ? 24.296  10.769  5.654   1.00 39.51 ? 407  VAL A CA  1 
ATOM   3091 C C   . VAL A 1 407 ? 23.194  9.825   5.194   1.00 40.54 ? 407  VAL A C   1 
ATOM   3092 O O   . VAL A 1 407 ? 23.159  8.672   5.624   1.00 41.08 ? 407  VAL A O   1 
ATOM   3093 C CB  . VAL A 1 407 ? 23.671  11.947  6.465   1.00 39.20 ? 407  VAL A CB  1 
ATOM   3094 C CG1 . VAL A 1 407 ? 22.884  11.421  7.666   1.00 38.14 ? 407  VAL A CG1 1 
ATOM   3095 C CG2 . VAL A 1 407 ? 24.764  12.956  6.935   1.00 36.51 ? 407  VAL A CG2 1 
ATOM   3096 N N   . VAL A 1 408 ? 22.297  10.292  4.331   1.00 41.23 ? 408  VAL A N   1 
ATOM   3097 C CA  . VAL A 1 408 ? 21.063  9.541   4.092   1.00 42.19 ? 408  VAL A CA  1 
ATOM   3098 C C   . VAL A 1 408 ? 21.367  8.189   3.467   1.00 43.42 ? 408  VAL A C   1 
ATOM   3099 O O   . VAL A 1 408 ? 20.852  7.165   3.924   1.00 44.18 ? 408  VAL A O   1 
ATOM   3100 C CB  . VAL A 1 408 ? 20.031  10.295  3.210   1.00 42.20 ? 408  VAL A CB  1 
ATOM   3101 C CG1 . VAL A 1 408 ? 18.784  9.428   3.017   1.00 42.27 ? 408  VAL A CG1 1 
ATOM   3102 C CG2 . VAL A 1 408 ? 19.646  11.611  3.846   1.00 41.67 ? 408  VAL A CG2 1 
ATOM   3103 N N   . CYS A 1 409 ? 22.214  8.174   2.441   1.00 43.70 ? 409  CYS A N   1 
ATOM   3104 C CA  . CYS A 1 409 ? 22.486  6.916   1.758   1.00 44.69 ? 409  CYS A CA  1 
ATOM   3105 C C   . CYS A 1 409 ? 23.376  5.943   2.549   1.00 44.43 ? 409  CYS A C   1 
ATOM   3106 O O   . CYS A 1 409 ? 23.139  4.735   2.509   1.00 45.53 ? 409  CYS A O   1 
ATOM   3107 C CB  . CYS A 1 409 ? 22.982  7.181   0.340   1.00 44.99 ? 409  CYS A CB  1 
ATOM   3108 S SG  . CYS A 1 409 ? 21.667  7.988   -0.665  1.00 45.80 ? 409  CYS A SG  1 
ATOM   3109 N N   . PRO A 1 410 ? 24.410  6.442   3.237   1.00 43.36 ? 410  PRO A N   1 
ATOM   3110 C CA  . PRO A 1 410 ? 25.079  5.607   4.229   1.00 43.01 ? 410  PRO A CA  1 
ATOM   3111 C C   . PRO A 1 410 ? 24.163  5.024   5.310   1.00 42.99 ? 410  PRO A C   1 
ATOM   3112 O O   . PRO A 1 410 ? 24.352  3.880   5.704   1.00 43.36 ? 410  PRO A O   1 
ATOM   3113 C CB  . PRO A 1 410 ? 26.116  6.554   4.837   1.00 42.03 ? 410  PRO A CB  1 
ATOM   3114 C CG  . PRO A 1 410 ? 26.470  7.453   3.705   1.00 42.57 ? 410  PRO A CG  1 
ATOM   3115 C CD  . PRO A 1 410 ? 25.110  7.731   3.068   1.00 43.35 ? 410  PRO A CD  1 
ATOM   3116 N N   . VAL A 1 411 ? 23.190  5.792   5.793   1.00 42.89 ? 411  VAL A N   1 
ATOM   3117 C CA  . VAL A 1 411 ? 22.244  5.262   6.761   1.00 42.85 ? 411  VAL A CA  1 
ATOM   3118 C C   . VAL A 1 411 ? 21.376  4.169   6.122   1.00 44.71 ? 411  VAL A C   1 
ATOM   3119 O O   . VAL A 1 411 ? 21.199  3.098   6.714   1.00 45.38 ? 411  VAL A O   1 
ATOM   3120 C CB  . VAL A 1 411 ? 21.353  6.358   7.388   1.00 43.02 ? 411  VAL A CB  1 
ATOM   3121 C CG1 . VAL A 1 411 ? 20.151  5.720   8.131   1.00 41.34 ? 411  VAL A CG1 1 
ATOM   3122 C CG2 . VAL A 1 411 ? 22.178  7.254   8.332   1.00 40.27 ? 411  VAL A CG2 1 
ATOM   3123 N N   . ALA A 1 412 ? 20.858  4.408   4.919   1.00 45.11 ? 412  ALA A N   1 
ATOM   3124 C CA  . ALA A 1 412 ? 20.088  3.368   4.226   1.00 46.82 ? 412  ALA A CA  1 
ATOM   3125 C C   . ALA A 1 412 ? 20.909  2.085   4.042   1.00 47.51 ? 412  ALA A C   1 
ATOM   3126 O O   . ALA A 1 412 ? 20.419  0.985   4.304   1.00 48.30 ? 412  ALA A O   1 
ATOM   3127 C CB  . ALA A 1 412 ? 19.575  3.871   2.876   1.00 46.52 ? 412  ALA A CB  1 
ATOM   3128 N N   . GLN A 1 413 ? 22.150  2.236   3.594   1.00 48.38 ? 413  GLN A N   1 
ATOM   3129 C CA  . GLN A 1 413 ? 23.069  1.101   3.435   1.00 49.25 ? 413  GLN A CA  1 
ATOM   3130 C C   . GLN A 1 413 ? 23.260  0.346   4.749   1.00 49.27 ? 413  GLN A C   1 
ATOM   3131 O O   . GLN A 1 413 ? 23.150  -0.867  4.780   1.00 50.16 ? 413  GLN A O   1 
ATOM   3132 C CB  . GLN A 1 413 ? 24.437  1.580   2.947   1.00 49.54 ? 413  GLN A CB  1 
ATOM   3133 C CG  . GLN A 1 413 ? 25.445  0.459   2.672   1.00 51.72 ? 413  GLN A CG  1 
ATOM   3134 C CD  . GLN A 1 413 ? 25.451  0.052   1.219   1.00 59.14 ? 413  GLN A CD  1 
ATOM   3135 O OE1 . GLN A 1 413 ? 24.476  -0.520  0.712   1.00 62.26 ? 413  GLN A OE1 1 
ATOM   3136 N NE2 . GLN A 1 413 ? 26.544  0.388   0.513   1.00 63.02 ? 413  GLN A NE2 1 
ATOM   3137 N N   . LEU A 1 414 ? 23.564  1.071   5.825   1.00 48.48 ? 414  LEU A N   1 
ATOM   3138 C CA  . LEU A 1 414 ? 23.736  0.460   7.137   1.00 48.36 ? 414  LEU A CA  1 
ATOM   3139 C C   . LEU A 1 414 ? 22.487  -0.307  7.577   1.00 48.99 ? 414  LEU A C   1 
ATOM   3140 O O   . LEU A 1 414 ? 22.583  -1.476  7.948   1.00 49.23 ? 414  LEU A O   1 
ATOM   3141 C CB  . LEU A 1 414 ? 24.098  1.511   8.195   1.00 47.60 ? 414  LEU A CB  1 
ATOM   3142 C CG  . LEU A 1 414 ? 24.377  0.973   9.604   1.00 47.44 ? 414  LEU A CG  1 
ATOM   3143 C CD1 . LEU A 1 414 ? 25.593  0.038   9.615   1.00 45.93 ? 414  LEU A CD1 1 
ATOM   3144 C CD2 . LEU A 1 414 ? 24.552  2.109   10.581  1.00 45.77 ? 414  LEU A CD2 1 
ATOM   3145 N N   . ALA A 1 415 ? 21.330  0.354   7.535   1.00 48.71 ? 415  ALA A N   1 
ATOM   3146 C CA  . ALA A 1 415 ? 20.053  -0.258  7.934   1.00 49.43 ? 415  ALA A CA  1 
ATOM   3147 C C   . ALA A 1 415 ? 19.778  -1.553  7.162   1.00 51.14 ? 415  ALA A C   1 
ATOM   3148 O O   . ALA A 1 415 ? 19.335  -2.553  7.723   1.00 51.71 ? 415  ALA A O   1 
ATOM   3149 C CB  . ALA A 1 415 ? 18.898  0.734   7.732   1.00 48.46 ? 415  ALA A CB  1 
ATOM   3150 N N   . GLY A 1 416 ? 20.045  -1.526  5.864   1.00 52.28 ? 416  GLY A N   1 
ATOM   3151 C CA  . GLY A 1 416 ? 19.869  -2.700  5.034   1.00 54.10 ? 416  GLY A CA  1 
ATOM   3152 C C   . GLY A 1 416 ? 20.797  -3.832  5.421   1.00 55.18 ? 416  GLY A C   1 
ATOM   3153 O O   . GLY A 1 416 ? 20.359  -4.973  5.563   1.00 56.03 ? 416  GLY A O   1 
ATOM   3154 N N   . ARG A 1 417 ? 22.082  -3.533  5.595   1.00 55.47 ? 417  ARG A N   1 
ATOM   3155 C CA  . ARG A 1 417 ? 23.039  -4.596  5.909   1.00 56.91 ? 417  ARG A CA  1 
ATOM   3156 C C   . ARG A 1 417 ? 22.760  -5.174  7.292   1.00 57.00 ? 417  ARG A C   1 
ATOM   3157 O O   . ARG A 1 417 ? 22.707  -6.388  7.451   1.00 58.24 ? 417  ARG A O   1 
ATOM   3158 C CB  . ARG A 1 417 ? 24.484  -4.111  5.813   1.00 56.89 ? 417  ARG A CB  1 
ATOM   3159 C CG  . ARG A 1 417 ? 24.947  -3.674  4.417   1.00 59.55 ? 417  ARG A CG  1 
ATOM   3160 C CD  . ARG A 1 417 ? 24.638  -4.670  3.280   1.00 65.62 ? 417  ARG A CD  1 
ATOM   3161 N NE  . ARG A 1 417 ? 25.312  -5.954  3.468   1.00 69.44 ? 417  ARG A NE  1 
ATOM   3162 C CZ  . ARG A 1 417 ? 25.684  -6.788  2.490   1.00 72.77 ? 417  ARG A CZ  1 
ATOM   3163 N NH1 . ARG A 1 417 ? 25.465  -6.496  1.202   1.00 74.38 ? 417  ARG A NH1 1 
ATOM   3164 N NH2 . ARG A 1 417 ? 26.305  -7.928  2.803   1.00 73.03 ? 417  ARG A NH2 1 
ATOM   3165 N N   . LEU A 1 418 ? 22.557  -4.311  8.280   1.00 56.12 ? 418  LEU A N   1 
ATOM   3166 C CA  . LEU A 1 418 ? 22.241  -4.769  9.624   1.00 56.51 ? 418  LEU A CA  1 
ATOM   3167 C C   . LEU A 1 418 ? 20.987  -5.651  9.651   1.00 57.52 ? 418  LEU A C   1 
ATOM   3168 O O   . LEU A 1 418 ? 20.983  -6.689  10.293  1.00 57.76 ? 418  LEU A O   1 
ATOM   3169 C CB  . LEU A 1 418 ? 22.088  -3.594  10.594  1.00 55.21 ? 418  LEU A CB  1 
ATOM   3170 C CG  . LEU A 1 418 ? 23.353  -2.753  10.852  1.00 55.07 ? 418  LEU A CG  1 
ATOM   3171 C CD1 . LEU A 1 418 ? 23.081  -1.691  11.906  1.00 52.45 ? 418  LEU A CD1 1 
ATOM   3172 C CD2 . LEU A 1 418 ? 24.564  -3.596  11.253  1.00 54.59 ? 418  LEU A CD2 1 
ATOM   3173 N N   . ALA A 1 419 ? 19.935  -5.233  8.958   1.00 58.10 ? 419  ALA A N   1 
ATOM   3174 C CA  . ALA A 1 419 ? 18.686  -6.000  8.920   1.00 59.37 ? 419  ALA A CA  1 
ATOM   3175 C C   . ALA A 1 419 ? 18.876  -7.351  8.211   1.00 61.18 ? 419  ALA A C   1 
ATOM   3176 O O   . ALA A 1 419 ? 18.357  -8.380  8.664   1.00 62.13 ? 419  ALA A O   1 
ATOM   3177 C CB  . ALA A 1 419 ? 17.577  -5.188  8.237   1.00 58.86 ? 419  ALA A CB  1 
ATOM   3178 N N   . ALA A 1 420 ? 19.621  -7.348  7.106   1.00 61.65 ? 420  ALA A N   1 
ATOM   3179 C CA  . ALA A 1 420 ? 19.875  -8.581  6.355   1.00 63.59 ? 420  ALA A CA  1 
ATOM   3180 C C   . ALA A 1 420 ? 20.674  -9.585  7.181   1.00 64.66 ? 420  ALA A C   1 
ATOM   3181 O O   . ALA A 1 420 ? 20.591  -10.783 6.943   1.00 66.19 ? 420  ALA A O   1 
ATOM   3182 C CB  . ALA A 1 420 ? 20.602  -8.281  5.039   1.00 63.35 ? 420  ALA A CB  1 
ATOM   3183 N N   . GLN A 1 421 ? 21.426  -9.093  8.163   1.00 64.29 ? 421  GLN A N   1 
ATOM   3184 C CA  . GLN A 1 421 ? 22.338  -9.928  8.929   1.00 65.00 ? 421  GLN A CA  1 
ATOM   3185 C C   . GLN A 1 421 ? 21.922  -10.137 10.391  1.00 64.26 ? 421  GLN A C   1 
ATOM   3186 O O   . GLN A 1 421 ? 22.759  -10.417 11.253  1.00 64.13 ? 421  GLN A O   1 
ATOM   3187 C CB  . GLN A 1 421 ? 23.760  -9.365  8.784   1.00 64.69 ? 421  GLN A CB  1 
ATOM   3188 C CG  . GLN A 1 421 ? 24.384  -9.814  7.437   1.00 68.31 ? 421  GLN A CG  1 
ATOM   3189 C CD  . GLN A 1 421 ? 25.203  -8.742  6.780   1.00 71.15 ? 421  GLN A CD  1 
ATOM   3190 O OE1 . GLN A 1 421 ? 25.080  -8.491  5.572   1.00 74.73 ? 421  GLN A OE1 1 
ATOM   3191 N NE2 . GLN A 1 421 ? 26.034  -8.080  7.568   1.00 72.51 ? 421  GLN A NE2 1 
ATOM   3192 N N   . GLY A 1 422 ? 20.619  -10.024 10.650  1.00 63.77 ? 422  GLY A N   1 
ATOM   3193 C CA  . GLY A 1 422 ? 20.023  -10.493 11.906  1.00 63.40 ? 422  GLY A CA  1 
ATOM   3194 C C   . GLY A 1 422 ? 19.596  -9.465  12.944  1.00 61.86 ? 422  GLY A C   1 
ATOM   3195 O O   . GLY A 1 422 ? 18.941  -9.828  13.928  1.00 62.49 ? 422  GLY A O   1 
ATOM   3196 N N   . ALA A 1 423 ? 19.949  -8.194  12.752  1.00 59.53 ? 423  ALA A N   1 
ATOM   3197 C CA  . ALA A 1 423 ? 19.608  -7.165  13.732  1.00 58.07 ? 423  ALA A CA  1 
ATOM   3198 C C   . ALA A 1 423 ? 18.153  -6.754  13.628  1.00 57.59 ? 423  ALA A C   1 
ATOM   3199 O O   . ALA A 1 423 ? 17.561  -6.820  12.561  1.00 57.74 ? 423  ALA A O   1 
ATOM   3200 C CB  . ALA A 1 423 ? 20.527  -5.923  13.582  1.00 56.59 ? 423  ALA A CB  1 
ATOM   3201 N N   . ARG A 1 424 ? 17.585  -6.335  14.756  1.00 57.28 ? 424  ARG A N   1 
ATOM   3202 C CA  . ARG A 1 424 ? 16.305  -5.646  14.758  1.00 56.53 ? 424  ARG A CA  1 
ATOM   3203 C C   . ARG A 1 424 ? 16.587  -4.167  14.588  1.00 53.78 ? 424  ARG A C   1 
ATOM   3204 O O   . ARG A 1 424 ? 17.252  -3.557  15.422  1.00 52.40 ? 424  ARG A O   1 
ATOM   3205 C CB  . ARG A 1 424 ? 15.516  -5.889  16.049  1.00 57.53 ? 424  ARG A CB  1 
ATOM   3206 C CG  . ARG A 1 424 ? 14.068  -5.363  15.957  1.00 60.36 ? 424  ARG A CG  1 
ATOM   3207 C CD  . ARG A 1 424 ? 13.024  -6.287  16.639  1.00 68.85 ? 424  ARG A CD  1 
ATOM   3208 N NE  . ARG A 1 424 ? 12.884  -5.995  18.076  1.00 71.60 ? 424  ARG A NE  1 
ATOM   3209 C CZ  . ARG A 1 424 ? 13.385  -6.728  19.076  1.00 74.54 ? 424  ARG A CZ  1 
ATOM   3210 N NH1 . ARG A 1 424 ? 14.077  -7.845  18.835  1.00 76.93 ? 424  ARG A NH1 1 
ATOM   3211 N NH2 . ARG A 1 424 ? 13.179  -6.345  20.340  1.00 73.81 ? 424  ARG A NH2 1 
ATOM   3212 N N   . VAL A 1 425 ? 16.084  -3.602  13.494  1.00 52.26 ? 425  VAL A N   1 
ATOM   3213 C CA  . VAL A 1 425 ? 16.362  -2.219  13.128  1.00 49.71 ? 425  VAL A CA  1 
ATOM   3214 C C   . VAL A 1 425 ? 15.062  -1.424  13.075  1.00 49.22 ? 425  VAL A C   1 
ATOM   3215 O O   . VAL A 1 425 ? 14.063  -1.908  12.519  1.00 49.85 ? 425  VAL A O   1 
ATOM   3216 C CB  . VAL A 1 425 ? 17.085  -2.139  11.752  1.00 49.66 ? 425  VAL A CB  1 
ATOM   3217 C CG1 . VAL A 1 425 ? 17.483  -0.687  11.419  1.00 47.11 ? 425  VAL A CG1 1 
ATOM   3218 C CG2 . VAL A 1 425 ? 18.317  -3.060  11.721  1.00 49.07 ? 425  VAL A CG2 1 
ATOM   3219 N N   . TYR A 1 426 ? 15.079  -0.227  13.670  1.00 47.72 ? 426  TYR A N   1 
ATOM   3220 C CA  . TYR A 1 426 ? 13.999  0.765   13.541  1.00 47.35 ? 426  TYR A CA  1 
ATOM   3221 C C   . TYR A 1 426 ? 14.575  2.032   12.925  1.00 46.56 ? 426  TYR A C   1 
ATOM   3222 O O   . TYR A 1 426 ? 15.670  2.459   13.284  1.00 46.32 ? 426  TYR A O   1 
ATOM   3223 C CB  . TYR A 1 426 ? 13.351  1.095   14.891  1.00 47.18 ? 426  TYR A CB  1 
ATOM   3224 C CG  . TYR A 1 426 ? 12.644  -0.082  15.553  1.00 47.98 ? 426  TYR A CG  1 
ATOM   3225 C CD1 . TYR A 1 426 ? 13.329  -0.925  16.419  1.00 46.42 ? 426  TYR A CD1 1 
ATOM   3226 C CD2 . TYR A 1 426 ? 11.293  -0.341  15.315  1.00 48.36 ? 426  TYR A CD2 1 
ATOM   3227 C CE1 . TYR A 1 426 ? 12.697  -1.994  17.030  1.00 50.03 ? 426  TYR A CE1 1 
ATOM   3228 C CE2 . TYR A 1 426 ? 10.646  -1.424  15.926  1.00 50.19 ? 426  TYR A CE2 1 
ATOM   3229 C CZ  . TYR A 1 426 ? 11.362  -2.249  16.778  1.00 50.38 ? 426  TYR A CZ  1 
ATOM   3230 O OH  . TYR A 1 426 ? 10.755  -3.309  17.398  1.00 51.40 ? 426  TYR A OH  1 
ATOM   3231 N N   . ALA A 1 427 ? 13.840  2.623   11.989  1.00 46.40 ? 427  ALA A N   1 
ATOM   3232 C CA  . ALA A 1 427 ? 14.334  3.745   11.199  1.00 45.75 ? 427  ALA A CA  1 
ATOM   3233 C C   . ALA A 1 427 ? 13.348  4.909   11.271  1.00 45.96 ? 427  ALA A C   1 
ATOM   3234 O O   . ALA A 1 427 ? 12.141  4.689   11.346  1.00 46.31 ? 427  ALA A O   1 
ATOM   3235 C CB  . ALA A 1 427 ? 14.563  3.313   9.743   1.00 45.61 ? 427  ALA A CB  1 
ATOM   3236 N N   . TYR A 1 428 ? 13.866  6.142   11.263  1.00 45.71 ? 428  TYR A N   1 
ATOM   3237 C CA  . TYR A 1 428 ? 13.031  7.337   11.292  1.00 46.11 ? 428  TYR A CA  1 
ATOM   3238 C C   . TYR A 1 428 ? 13.569  8.405   10.341  1.00 46.62 ? 428  TYR A C   1 
ATOM   3239 O O   . TYR A 1 428 ? 14.758  8.388   9.967   1.00 46.47 ? 428  TYR A O   1 
ATOM   3240 C CB  . TYR A 1 428 ? 12.931  7.917   12.718  1.00 45.72 ? 428  TYR A CB  1 
ATOM   3241 C CG  . TYR A 1 428 ? 14.235  8.492   13.240  1.00 44.79 ? 428  TYR A CG  1 
ATOM   3242 C CD1 . TYR A 1 428 ? 14.633  9.781   12.913  1.00 44.06 ? 428  TYR A CD1 1 
ATOM   3243 C CD2 . TYR A 1 428 ? 15.083  7.740   14.045  1.00 44.69 ? 428  TYR A CD2 1 
ATOM   3244 C CE1 . TYR A 1 428 ? 15.840  10.305  13.373  1.00 43.39 ? 428  TYR A CE1 1 
ATOM   3245 C CE2 . TYR A 1 428 ? 16.309  8.270   14.517  1.00 43.49 ? 428  TYR A CE2 1 
ATOM   3246 C CZ  . TYR A 1 428 ? 16.672  9.542   14.173  1.00 43.01 ? 428  TYR A CZ  1 
ATOM   3247 O OH  . TYR A 1 428 ? 17.874  10.075  14.604  1.00 43.40 ? 428  TYR A OH  1 
ATOM   3248 N N   . ILE A 1 429 ? 12.679  9.325   9.959   1.00 47.04 ? 429  ILE A N   1 
ATOM   3249 C CA  . ILE A 1 429 ? 13.069  10.636  9.423   1.00 46.83 ? 429  ILE A CA  1 
ATOM   3250 C C   . ILE A 1 429 ? 12.458  11.684  10.357  1.00 46.56 ? 429  ILE A C   1 
ATOM   3251 O O   . ILE A 1 429 ? 11.281  11.611  10.700  1.00 47.41 ? 429  ILE A O   1 
ATOM   3252 C CB  . ILE A 1 429 ? 12.619  10.841  7.946   1.00 47.25 ? 429  ILE A CB  1 
ATOM   3253 C CG1 . ILE A 1 429 ? 13.123  12.175  7.402   1.00 47.99 ? 429  ILE A CG1 1 
ATOM   3254 C CG2 . ILE A 1 429 ? 11.087  10.753  7.799   1.00 48.03 ? 429  ILE A CG2 1 
ATOM   3255 C CD1 . ILE A 1 429 ? 12.949  12.324  5.885   1.00 48.23 ? 429  ILE A CD1 1 
ATOM   3256 N N   . PHE A 1 430 ? 13.288  12.611  10.821  1.00 46.20 ? 430  PHE A N   1 
ATOM   3257 C CA  . PHE A 1 430 ? 12.869  13.694  11.707  1.00 46.29 ? 430  PHE A CA  1 
ATOM   3258 C C   . PHE A 1 430 ? 12.610  14.942  10.873  1.00 46.61 ? 430  PHE A C   1 
ATOM   3259 O O   . PHE A 1 430 ? 13.511  15.437  10.192  1.00 44.85 ? 430  PHE A O   1 
ATOM   3260 C CB  . PHE A 1 430 ? 13.968  13.956  12.723  1.00 45.76 ? 430  PHE A CB  1 
ATOM   3261 C CG  . PHE A 1 430 ? 13.605  14.966  13.747  1.00 46.11 ? 430  PHE A CG  1 
ATOM   3262 C CD1 . PHE A 1 430 ? 13.835  16.304  13.524  1.00 45.31 ? 430  PHE A CD1 1 
ATOM   3263 C CD2 . PHE A 1 430 ? 13.045  14.579  14.954  1.00 47.15 ? 430  PHE A CD2 1 
ATOM   3264 C CE1 . PHE A 1 430 ? 13.505  17.229  14.472  1.00 46.10 ? 430  PHE A CE1 1 
ATOM   3265 C CE2 . PHE A 1 430 ? 12.716  15.512  15.897  1.00 46.36 ? 430  PHE A CE2 1 
ATOM   3266 C CZ  . PHE A 1 430 ? 12.937  16.835  15.650  1.00 46.18 ? 430  PHE A CZ  1 
ATOM   3267 N N   . GLU A 1 431 ? 11.381  15.452  10.930  1.00 48.34 ? 431  GLU A N   1 
ATOM   3268 C CA  . GLU A 1 431 ? 10.948  16.508  10.003  1.00 49.49 ? 431  GLU A CA  1 
ATOM   3269 C C   . GLU A 1 431 ? 10.410  17.768  10.654  1.00 50.06 ? 431  GLU A C   1 
ATOM   3270 O O   . GLU A 1 431 ? 9.829   18.624  9.967   1.00 50.55 ? 431  GLU A O   1 
ATOM   3271 C CB  . GLU A 1 431 ? 9.850   15.975  9.100   1.00 50.31 ? 431  GLU A CB  1 
ATOM   3272 C CG  . GLU A 1 431 ? 10.184  14.731  8.344   1.00 51.08 ? 431  GLU A CG  1 
ATOM   3273 C CD  . GLU A 1 431 ? 9.102   14.409  7.347   1.00 51.95 ? 431  GLU A CD  1 
ATOM   3274 O OE1 . GLU A 1 431 ? 7.918   14.378  7.748   1.00 53.46 ? 431  GLU A OE1 1 
ATOM   3275 O OE2 . GLU A 1 431 ? 9.427   14.232  6.155   1.00 55.89 ? 431  GLU A OE2 1 
ATOM   3276 N N   . HIS A 1 432 ? 10.571  17.899  11.962  1.00 50.23 ? 432  HIS A N   1 
ATOM   3277 C CA  . HIS A 1 432 ? 10.096  19.103  12.619  1.00 50.78 ? 432  HIS A CA  1 
ATOM   3278 C C   . HIS A 1 432 ? 11.199  20.167  12.760  1.00 50.54 ? 432  HIS A C   1 
ATOM   3279 O O   . HIS A 1 432 ? 12.264  19.908  13.324  1.00 49.54 ? 432  HIS A O   1 
ATOM   3280 C CB  . HIS A 1 432 ? 9.505   18.792  13.987  1.00 50.99 ? 432  HIS A CB  1 
ATOM   3281 C CG  . HIS A 1 432 ? 9.127   20.021  14.738  1.00 51.47 ? 432  HIS A CG  1 
ATOM   3282 N ND1 . HIS A 1 432 ? 8.069   20.816  14.362  1.00 52.09 ? 432  HIS A ND1 1 
ATOM   3283 C CD2 . HIS A 1 432 ? 9.709   20.636  15.793  1.00 51.96 ? 432  HIS A CD2 1 
ATOM   3284 C CE1 . HIS A 1 432 ? 7.987   21.849  15.181  1.00 53.20 ? 432  HIS A CE1 1 
ATOM   3285 N NE2 . HIS A 1 432 ? 8.973   21.766  16.057  1.00 53.71 ? 432  HIS A NE2 1 
ATOM   3286 N N   . ARG A 1 433 ? 10.917  21.364  12.255  1.00 51.29 ? 433  ARG A N   1 
ATOM   3287 C CA  . ARG A 1 433 ? 11.819  22.512  12.404  1.00 51.49 ? 433  ARG A CA  1 
ATOM   3288 C C   . ARG A 1 433 ? 11.457  23.288  13.667  1.00 51.57 ? 433  ARG A C   1 
ATOM   3289 O O   . ARG A 1 433 ? 10.312  23.730  13.837  1.00 51.92 ? 433  ARG A O   1 
ATOM   3290 C CB  . ARG A 1 433 ? 11.696  23.428  11.187  1.00 51.68 ? 433  ARG A CB  1 
ATOM   3291 C CG  . ARG A 1 433 ? 12.646  24.619  11.174  1.00 52.06 ? 433  ARG A CG  1 
ATOM   3292 C CD  . ARG A 1 433 ? 12.297  25.558  10.032  1.00 53.17 ? 433  ARG A CD  1 
ATOM   3293 N NE  . ARG A 1 433 ? 12.811  26.905  10.251  1.00 54.26 ? 433  ARG A NE  1 
ATOM   3294 C CZ  . ARG A 1 433 ? 14.003  27.339  9.852   1.00 55.86 ? 433  ARG A CZ  1 
ATOM   3295 N NH1 . ARG A 1 433 ? 14.842  26.553  9.173   1.00 55.38 ? 433  ARG A NH1 1 
ATOM   3296 N NH2 . ARG A 1 433 ? 14.356  28.591  10.120  1.00 56.66 ? 433  ARG A NH2 1 
ATOM   3297 N N   . ALA A 1 434 ? 12.437  23.467  14.543  1.00 51.33 ? 434  ALA A N   1 
ATOM   3298 C CA  . ALA A 1 434 ? 12.202  24.134  15.816  1.00 51.75 ? 434  ALA A CA  1 
ATOM   3299 C C   . ALA A 1 434 ? 11.681  25.539  15.553  1.00 52.47 ? 434  ALA A C   1 
ATOM   3300 O O   . ALA A 1 434 ? 12.210  26.259  14.698  1.00 52.48 ? 434  ALA A O   1 
ATOM   3301 C CB  . ALA A 1 434 ? 13.479  24.169  16.639  1.00 51.08 ? 434  ALA A CB  1 
ATOM   3302 N N   . SER A 1 435 ? 10.634  25.925  16.269  1.00 53.37 ? 435  SER A N   1 
ATOM   3303 C CA  . SER A 1 435 ? 10.087  27.281  16.154  1.00 54.47 ? 435  SER A CA  1 
ATOM   3304 C C   . SER A 1 435 ? 11.110  28.346  16.581  1.00 54.73 ? 435  SER A C   1 
ATOM   3305 O O   . SER A 1 435 ? 10.974  29.511  16.230  1.00 55.63 ? 435  SER A O   1 
ATOM   3306 C CB  . SER A 1 435 ? 8.821   27.420  17.004  1.00 55.30 ? 435  SER A CB  1 
ATOM   3307 O OG  . SER A 1 435 ? 9.137   27.367  18.382  1.00 54.45 ? 435  SER A OG  1 
ATOM   3308 N N   . THR A 1 436 ? 12.115  27.923  17.339  1.00 54.46 ? 436  THR A N   1 
ATOM   3309 C CA  . THR A 1 436 ? 13.177  28.767  17.859  1.00 54.77 ? 436  THR A CA  1 
ATOM   3310 C C   . THR A 1 436 ? 14.451  28.733  17.002  1.00 54.90 ? 436  THR A C   1 
ATOM   3311 O O   . THR A 1 436 ? 15.475  29.290  17.399  1.00 54.53 ? 436  THR A O   1 
ATOM   3312 C CB  . THR A 1 436 ? 13.581  28.264  19.284  1.00 55.02 ? 436  THR A CB  1 
ATOM   3313 O OG1 . THR A 1 436 ? 14.100  26.929  19.194  1.00 52.62 ? 436  THR A OG1 1 
ATOM   3314 C CG2 . THR A 1 436 ? 12.377  28.259  20.238  1.00 55.69 ? 436  THR A CG2 1 
ATOM   3315 N N   . LEU A 1 437 ? 14.406  28.060  15.848  1.00 55.44 ? 437  LEU A N   1 
ATOM   3316 C CA  . LEU A 1 437 ? 15.602  27.892  15.013  1.00 55.24 ? 437  LEU A CA  1 
ATOM   3317 C C   . LEU A 1 437 ? 16.053  29.246  14.463  1.00 55.51 ? 437  LEU A C   1 
ATOM   3318 O O   . LEU A 1 437 ? 15.224  30.029  14.009  1.00 56.23 ? 437  LEU A O   1 
ATOM   3319 C CB  . LEU A 1 437 ? 15.323  26.914  13.863  1.00 55.15 ? 437  LEU A CB  1 
ATOM   3320 C CG  . LEU A 1 437 ? 16.518  26.167  13.251  1.00 54.56 ? 437  LEU A CG  1 
ATOM   3321 C CD1 . LEU A 1 437 ? 17.035  25.115  14.177  1.00 53.50 ? 437  LEU A CD1 1 
ATOM   3322 C CD2 . LEU A 1 437 ? 16.109  25.528  11.929  1.00 55.46 ? 437  LEU A CD2 1 
ATOM   3323 N N   . THR A 1 438 ? 17.355  29.528  14.533  1.00 55.18 ? 438  THR A N   1 
ATOM   3324 C CA  . THR A 1 438 ? 17.898  30.819  14.083  1.00 55.45 ? 438  THR A CA  1 
ATOM   3325 C C   . THR A 1 438 ? 18.492  30.747  12.667  1.00 55.29 ? 438  THR A C   1 
ATOM   3326 O O   . THR A 1 438 ? 18.680  31.789  12.024  1.00 55.92 ? 438  THR A O   1 
ATOM   3327 C CB  . THR A 1 438 ? 18.948  31.399  15.079  1.00 55.75 ? 438  THR A CB  1 
ATOM   3328 O OG1 . THR A 1 438 ? 20.038  30.484  15.260  1.00 55.71 ? 438  THR A OG1 1 
ATOM   3329 C CG2 . THR A 1 438 ? 18.319  31.665  16.433  1.00 56.88 ? 438  THR A CG2 1 
ATOM   3330 N N   . TRP A 1 439 ? 18.773  29.534  12.169  1.00 54.20 ? 439  TRP A N   1 
ATOM   3331 C CA  . TRP A 1 439 ? 19.150  29.352  10.751  1.00 53.36 ? 439  TRP A CA  1 
ATOM   3332 C C   . TRP A 1 439 ? 17.965  29.726  9.874   1.00 52.99 ? 439  TRP A C   1 
ATOM   3333 O O   . TRP A 1 439 ? 16.831  29.694  10.347  1.00 53.60 ? 439  TRP A O   1 
ATOM   3334 C CB  . TRP A 1 439 ? 19.573  27.919  10.459  1.00 52.64 ? 439  TRP A CB  1 
ATOM   3335 C CG  . TRP A 1 439 ? 20.810  27.501  11.134  1.00 51.44 ? 439  TRP A CG  1 
ATOM   3336 C CD1 . TRP A 1 439 ? 20.901  26.715  12.237  1.00 51.58 ? 439  TRP A CD1 1 
ATOM   3337 C CD2 . TRP A 1 439 ? 22.145  27.827  10.761  1.00 50.80 ? 439  TRP A CD2 1 
ATOM   3338 N NE1 . TRP A 1 439 ? 22.213  26.541  12.587  1.00 51.26 ? 439  TRP A NE1 1 
ATOM   3339 C CE2 . TRP A 1 439 ? 23.001  27.206  11.691  1.00 51.32 ? 439  TRP A CE2 1 
ATOM   3340 C CE3 . TRP A 1 439 ? 22.706  28.582  9.734   1.00 51.95 ? 439  TRP A CE3 1 
ATOM   3341 C CZ2 . TRP A 1 439 ? 24.387  27.316  11.627  1.00 51.40 ? 439  TRP A CZ2 1 
ATOM   3342 C CZ3 . TRP A 1 439 ? 24.090  28.692  9.666   1.00 52.05 ? 439  TRP A CZ3 1 
ATOM   3343 C CH2 . TRP A 1 439 ? 24.914  28.061  10.606  1.00 51.69 ? 439  TRP A CH2 1 
ATOM   3344 N N   . PRO A 1 440 ? 18.216  30.122  8.605   1.00 52.37 ? 440  PRO A N   1 
ATOM   3345 C CA  . PRO A 1 440 ? 17.120  30.583  7.762   1.00 52.20 ? 440  PRO A CA  1 
ATOM   3346 C C   . PRO A 1 440 ? 16.229  29.452  7.276   1.00 51.67 ? 440  PRO A C   1 
ATOM   3347 O O   . PRO A 1 440 ? 16.613  28.281  7.363   1.00 51.28 ? 440  PRO A O   1 
ATOM   3348 C CB  . PRO A 1 440 ? 17.838  31.241  6.581   1.00 52.17 ? 440  PRO A CB  1 
ATOM   3349 C CG  . PRO A 1 440 ? 19.077  30.551  6.470   1.00 52.03 ? 440  PRO A CG  1 
ATOM   3350 C CD  . PRO A 1 440 ? 19.498  30.192  7.881   1.00 52.22 ? 440  PRO A CD  1 
ATOM   3351 N N   . LEU A 1 441 ? 15.061  29.818  6.760   1.00 51.31 ? 441  LEU A N   1 
ATOM   3352 C CA  . LEU A 1 441 ? 14.065  28.860  6.355   1.00 51.38 ? 441  LEU A CA  1 
ATOM   3353 C C   . LEU A 1 441 ? 14.523  27.911  5.267   1.00 50.15 ? 441  LEU A C   1 
ATOM   3354 O O   . LEU A 1 441 ? 14.105  26.768  5.263   1.00 50.32 ? 441  LEU A O   1 
ATOM   3355 C CB  . LEU A 1 441 ? 12.807  29.569  5.859   1.00 52.67 ? 441  LEU A CB  1 
ATOM   3356 C CG  . LEU A 1 441 ? 11.915  30.166  6.941   1.00 55.54 ? 441  LEU A CG  1 
ATOM   3357 C CD1 . LEU A 1 441 ? 10.893  31.104  6.275   1.00 57.43 ? 441  LEU A CD1 1 
ATOM   3358 C CD2 . LEU A 1 441 ? 11.224  29.043  7.770   1.00 56.78 ? 441  LEU A CD2 1 
ATOM   3359 N N   . TRP A 1 442 ? 15.343  28.379  4.328   1.00 49.18 ? 442  TRP A N   1 
ATOM   3360 C CA  . TRP A 1 442 ? 15.727  27.537  3.196   1.00 48.14 ? 442  TRP A CA  1 
ATOM   3361 C C   . TRP A 1 442 ? 16.511  26.301  3.654   1.00 47.04 ? 442  TRP A C   1 
ATOM   3362 O O   . TRP A 1 442 ? 16.467  25.267  2.992   1.00 45.38 ? 442  TRP A O   1 
ATOM   3363 C CB  . TRP A 1 442 ? 16.503  28.318  2.118   1.00 47.65 ? 442  TRP A CB  1 
ATOM   3364 C CG  . TRP A 1 442 ? 17.895  28.725  2.474   1.00 46.68 ? 442  TRP A CG  1 
ATOM   3365 C CD1 . TRP A 1 442 ? 18.308  29.955  2.889   1.00 47.12 ? 442  TRP A CD1 1 
ATOM   3366 C CD2 . TRP A 1 442 ? 19.072  27.907  2.425   1.00 46.89 ? 442  TRP A CD2 1 
ATOM   3367 N NE1 . TRP A 1 442 ? 19.666  29.956  3.122   1.00 46.20 ? 442  TRP A NE1 1 
ATOM   3368 C CE2 . TRP A 1 442 ? 20.163  28.716  2.837   1.00 45.82 ? 442  TRP A CE2 1 
ATOM   3369 C CE3 . TRP A 1 442 ? 19.316  26.580  2.064   1.00 44.53 ? 442  TRP A CE3 1 
ATOM   3370 C CZ2 . TRP A 1 442 ? 21.468  28.235  2.910   1.00 45.61 ? 442  TRP A CZ2 1 
ATOM   3371 C CZ3 . TRP A 1 442 ? 20.610  26.107  2.128   1.00 45.43 ? 442  TRP A CZ3 1 
ATOM   3372 C CH2 . TRP A 1 442 ? 21.674  26.932  2.555   1.00 45.68 ? 442  TRP A CH2 1 
ATOM   3373 N N   . MET A 1 443 ? 17.210  26.421  4.785   1.00 46.80 ? 443  MET A N   1 
ATOM   3374 C CA  . MET A 1 443 ? 17.990  25.313  5.342   1.00 46.52 ? 443  MET A CA  1 
ATOM   3375 C C   . MET A 1 443 ? 17.122  24.181  5.927   1.00 45.98 ? 443  MET A C   1 
ATOM   3376 O O   . MET A 1 443 ? 17.642  23.098  6.231   1.00 45.09 ? 443  MET A O   1 
ATOM   3377 C CB  . MET A 1 443 ? 18.961  25.823  6.408   1.00 46.71 ? 443  MET A CB  1 
ATOM   3378 C CG  . MET A 1 443 ? 20.016  26.816  5.907   1.00 46.40 ? 443  MET A CG  1 
ATOM   3379 S SD  . MET A 1 443 ? 21.405  26.899  7.050   1.00 49.17 ? 443  MET A SD  1 
ATOM   3380 C CE  . MET A 1 443 ? 22.401  28.174  6.299   1.00 52.28 ? 443  MET A CE  1 
ATOM   3381 N N   . GLY A 1 444 ? 15.816  24.426  6.075   1.00 45.43 ? 444  GLY A N   1 
ATOM   3382 C CA  . GLY A 1 444 ? 14.885  23.399  6.528   1.00 45.55 ? 444  GLY A CA  1 
ATOM   3383 C C   . GLY A 1 444 ? 15.146  22.881  7.939   1.00 44.80 ? 444  GLY A C   1 
ATOM   3384 O O   . GLY A 1 444 ? 15.209  23.659  8.880   1.00 44.88 ? 444  GLY A O   1 
ATOM   3385 N N   . VAL A 1 445 ? 15.243  21.562  8.086   1.00 44.08 ? 445  VAL A N   1 
ATOM   3386 C CA  . VAL A 1 445 ? 15.530  20.920  9.374   1.00 43.44 ? 445  VAL A CA  1 
ATOM   3387 C C   . VAL A 1 445 ? 16.969  20.430  9.280   1.00 42.81 ? 445  VAL A C   1 
ATOM   3388 O O   . VAL A 1 445 ? 17.209  19.332  8.786   1.00 42.81 ? 445  VAL A O   1 
ATOM   3389 C CB  . VAL A 1 445 ? 14.584  19.731  9.663   1.00 43.37 ? 445  VAL A CB  1 
ATOM   3390 C CG1 . VAL A 1 445 ? 14.845  19.184  11.053  1.00 43.90 ? 445  VAL A CG1 1 
ATOM   3391 C CG2 . VAL A 1 445 ? 13.110  20.131  9.519   1.00 43.43 ? 445  VAL A CG2 1 
ATOM   3392 N N   . PRO A 1 446 ? 17.938  21.261  9.697   1.00 42.22 ? 446  PRO A N   1 
ATOM   3393 C CA  . PRO A 1 446 ? 19.317  20.902  9.474   1.00 42.07 ? 446  PRO A CA  1 
ATOM   3394 C C   . PRO A 1 446 ? 19.865  19.858  10.449  1.00 42.34 ? 446  PRO A C   1 
ATOM   3395 O O   . PRO A 1 446 ? 19.300  19.617  11.520  1.00 41.83 ? 446  PRO A O   1 
ATOM   3396 C CB  . PRO A 1 446 ? 20.069  22.237  9.652   1.00 42.19 ? 446  PRO A CB  1 
ATOM   3397 C CG  . PRO A 1 446 ? 18.983  23.294  9.780   1.00 42.73 ? 446  PRO A CG  1 
ATOM   3398 C CD  . PRO A 1 446 ? 17.842  22.559  10.368  1.00 42.52 ? 446  PRO A CD  1 
ATOM   3399 N N   . HIS A 1 447 ? 20.953  19.233  10.003  1.00 42.57 ? 447  HIS A N   1 
ATOM   3400 C CA  . HIS A 1 447 ? 21.806  18.346  10.767  1.00 42.41 ? 447  HIS A CA  1 
ATOM   3401 C C   . HIS A 1 447 ? 21.977  18.853  12.194  1.00 41.96 ? 447  HIS A C   1 
ATOM   3402 O O   . HIS A 1 447 ? 22.474  19.957  12.397  1.00 42.27 ? 447  HIS A O   1 
ATOM   3403 C CB  . HIS A 1 447 ? 23.171  18.321  10.043  1.00 42.74 ? 447  HIS A CB  1 
ATOM   3404 C CG  . HIS A 1 447 ? 24.099  17.243  10.483  1.00 43.25 ? 447  HIS A CG  1 
ATOM   3405 N ND1 . HIS A 1 447 ? 23.850  15.904  10.251  1.00 45.71 ? 447  HIS A ND1 1 
ATOM   3406 C CD2 . HIS A 1 447 ? 25.318  17.305  11.072  1.00 44.38 ? 447  HIS A CD2 1 
ATOM   3407 C CE1 . HIS A 1 447 ? 24.860  15.186  10.717  1.00 44.32 ? 447  HIS A CE1 1 
ATOM   3408 N NE2 . HIS A 1 447 ? 25.760  16.011  11.227  1.00 43.53 ? 447  HIS A NE2 1 
ATOM   3409 N N   . GLY A 1 448 ? 21.547  18.048  13.167  1.00 41.58 ? 448  GLY A N   1 
ATOM   3410 C CA  . GLY A 1 448 ? 21.741  18.336  14.587  1.00 41.44 ? 448  GLY A CA  1 
ATOM   3411 C C   . GLY A 1 448 ? 20.568  18.940  15.342  1.00 41.48 ? 448  GLY A C   1 
ATOM   3412 O O   . GLY A 1 448 ? 20.589  18.994  16.571  1.00 40.95 ? 448  GLY A O   1 
ATOM   3413 N N   . TYR A 1 449 ? 19.533  19.375  14.630  1.00 41.67 ? 449  TYR A N   1 
ATOM   3414 C CA  . TYR A 1 449 ? 18.442  20.107  15.270  1.00 42.58 ? 449  TYR A CA  1 
ATOM   3415 C C   . TYR A 1 449 ? 17.272  19.243  15.753  1.00 43.01 ? 449  TYR A C   1 
ATOM   3416 O O   . TYR A 1 449 ? 16.221  19.757  16.136  1.00 44.28 ? 449  TYR A O   1 
ATOM   3417 C CB  . TYR A 1 449 ? 18.029  21.309  14.391  1.00 43.32 ? 449  TYR A CB  1 
ATOM   3418 C CG  . TYR A 1 449 ? 19.148  22.321  14.475  1.00 43.56 ? 449  TYR A CG  1 
ATOM   3419 C CD1 . TYR A 1 449 ? 20.242  22.254  13.604  1.00 44.05 ? 449  TYR A CD1 1 
ATOM   3420 C CD2 . TYR A 1 449 ? 19.194  23.240  15.512  1.00 43.78 ? 449  TYR A CD2 1 
ATOM   3421 C CE1 . TYR A 1 449 ? 21.325  23.137  13.727  1.00 43.42 ? 449  TYR A CE1 1 
ATOM   3422 C CE2 . TYR A 1 449 ? 20.267  24.131  15.636  1.00 44.29 ? 449  TYR A CE2 1 
ATOM   3423 C CZ  . TYR A 1 449 ? 21.321  24.062  14.740  1.00 43.51 ? 449  TYR A CZ  1 
ATOM   3424 O OH  . TYR A 1 449 ? 22.371  24.936  14.863  1.00 45.83 ? 449  TYR A OH  1 
ATOM   3425 N N   . GLU A 1 450 ? 17.485  17.933  15.765  1.00 42.50 ? 450  GLU A N   1 
ATOM   3426 C CA  . GLU A 1 450 ? 16.624  17.011  16.483  1.00 42.85 ? 450  GLU A CA  1 
ATOM   3427 C C   . GLU A 1 450 ? 17.063  16.792  17.936  1.00 42.48 ? 450  GLU A C   1 
ATOM   3428 O O   . GLU A 1 450 ? 16.248  16.455  18.776  1.00 42.48 ? 450  GLU A O   1 
ATOM   3429 C CB  . GLU A 1 450 ? 16.560  15.664  15.748  1.00 42.87 ? 450  GLU A CB  1 
ATOM   3430 C CG  . GLU A 1 450 ? 17.648  14.664  16.091  1.00 43.12 ? 450  GLU A CG  1 
ATOM   3431 C CD  . GLU A 1 450 ? 18.983  14.944  15.425  1.00 43.56 ? 450  GLU A CD  1 
ATOM   3432 O OE1 . GLU A 1 450 ? 19.300  16.114  15.097  1.00 42.24 ? 450  GLU A OE1 1 
ATOM   3433 O OE2 . GLU A 1 450 ? 19.739  13.970  15.274  1.00 44.98 ? 450  GLU A OE2 1 
ATOM   3434 N N   . ILE A 1 451 ? 18.347  16.998  18.224  1.00 41.97 ? 451  ILE A N   1 
ATOM   3435 C CA  . ILE A 1 451 ? 18.928  16.611  19.516  1.00 41.56 ? 451  ILE A CA  1 
ATOM   3436 C C   . ILE A 1 451 ? 18.181  17.254  20.688  1.00 42.36 ? 451  ILE A C   1 
ATOM   3437 O O   . ILE A 1 451 ? 17.767  16.551  21.627  1.00 42.75 ? 451  ILE A O   1 
ATOM   3438 C CB  . ILE A 1 451 ? 20.446  16.944  19.588  1.00 41.03 ? 451  ILE A CB  1 
ATOM   3439 C CG1 . ILE A 1 451 ? 21.207  16.264  18.434  1.00 38.88 ? 451  ILE A CG1 1 
ATOM   3440 C CG2 . ILE A 1 451 ? 21.047  16.529  20.963  1.00 40.59 ? 451  ILE A CG2 1 
ATOM   3441 C CD1 . ILE A 1 451 ? 22.695  16.703  18.313  1.00 40.07 ? 451  ILE A CD1 1 
ATOM   3442 N N   . GLU A 1 452 ? 17.972  18.567  20.607  1.00 42.55 ? 452  GLU A N   1 
ATOM   3443 C CA  . GLU A 1 452 ? 17.225  19.318  21.628  1.00 43.53 ? 452  GLU A CA  1 
ATOM   3444 C C   . GLU A 1 452 ? 15.833  18.742  21.964  1.00 43.87 ? 452  GLU A C   1 
ATOM   3445 O O   . GLU A 1 452 ? 15.366  18.883  23.083  1.00 43.97 ? 452  GLU A O   1 
ATOM   3446 C CB  . GLU A 1 452 ? 17.112  20.796  21.232  1.00 43.72 ? 452  GLU A CB  1 
ATOM   3447 C CG  . GLU A 1 452 ? 16.351  21.066  19.931  1.00 45.24 ? 452  GLU A CG  1 
ATOM   3448 C CD  . GLU A 1 452 ? 16.678  22.432  19.333  1.00 45.57 ? 452  GLU A CD  1 
ATOM   3449 O OE1 . GLU A 1 452 ? 15.858  23.358  19.467  1.00 50.36 ? 452  GLU A OE1 1 
ATOM   3450 O OE2 . GLU A 1 452 ? 17.764  22.589  18.737  1.00 46.71 ? 452  GLU A OE2 1 
ATOM   3451 N N   . PHE A 1 453 ? 15.191  18.072  21.006  1.00 44.14 ? 453  PHE A N   1 
ATOM   3452 C CA  . PHE A 1 453 ? 13.925  17.392  21.279  1.00 44.56 ? 453  PHE A CA  1 
ATOM   3453 C C   . PHE A 1 453 ? 14.077  16.069  22.012  1.00 44.40 ? 453  PHE A C   1 
ATOM   3454 O O   . PHE A 1 453 ? 13.369  15.824  22.996  1.00 45.09 ? 453  PHE A O   1 
ATOM   3455 C CB  . PHE A 1 453 ? 13.136  17.243  19.981  1.00 45.54 ? 453  PHE A CB  1 
ATOM   3456 C CG  . PHE A 1 453 ? 12.675  18.560  19.448  1.00 45.49 ? 453  PHE A CG  1 
ATOM   3457 C CD1 . PHE A 1 453 ? 11.478  19.104  19.878  1.00 46.03 ? 453  PHE A CD1 1 
ATOM   3458 C CD2 . PHE A 1 453 ? 13.481  19.294  18.589  1.00 45.76 ? 453  PHE A CD2 1 
ATOM   3459 C CE1 . PHE A 1 453 ? 11.067  20.357  19.426  1.00 47.72 ? 453  PHE A CE1 1 
ATOM   3460 C CE2 . PHE A 1 453 ? 13.070  20.552  18.127  1.00 47.09 ? 453  PHE A CE2 1 
ATOM   3461 C CZ  . PHE A 1 453 ? 11.870  21.085  18.558  1.00 46.23 ? 453  PHE A CZ  1 
ATOM   3462 N N   . ILE A 1 454 ? 15.009  15.231  21.564  1.00 43.39 ? 454  ILE A N   1 
ATOM   3463 C CA  . ILE A 1 454 ? 15.247  13.933  22.195  1.00 43.21 ? 454  ILE A CA  1 
ATOM   3464 C C   . ILE A 1 454 ? 15.685  14.109  23.656  1.00 43.44 ? 454  ILE A C   1 
ATOM   3465 O O   . ILE A 1 454 ? 15.262  13.360  24.536  1.00 43.47 ? 454  ILE A O   1 
ATOM   3466 C CB  . ILE A 1 454 ? 16.284  13.111  21.380  1.00 43.09 ? 454  ILE A CB  1 
ATOM   3467 C CG1 . ILE A 1 454 ? 15.679  12.714  20.027  1.00 43.90 ? 454  ILE A CG1 1 
ATOM   3468 C CG2 . ILE A 1 454 ? 16.740  11.866  22.140  1.00 41.39 ? 454  ILE A CG2 1 
ATOM   3469 C CD1 . ILE A 1 454 ? 16.693  12.646  18.928  1.00 45.73 ? 454  ILE A CD1 1 
ATOM   3470 N N   . PHE A 1 455 ? 16.512  15.122  23.905  1.00 43.31 ? 455  PHE A N   1 
ATOM   3471 C CA  . PHE A 1 455 ? 16.938  15.459  25.261  1.00 43.46 ? 455  PHE A CA  1 
ATOM   3472 C C   . PHE A 1 455 ? 15.882  16.167  26.127  1.00 43.67 ? 455  PHE A C   1 
ATOM   3473 O O   . PHE A 1 455 ? 16.052  16.259  27.333  1.00 43.17 ? 455  PHE A O   1 
ATOM   3474 C CB  . PHE A 1 455 ? 18.233  16.272  25.217  1.00 43.19 ? 455  PHE A CB  1 
ATOM   3475 C CG  . PHE A 1 455 ? 19.459  15.414  25.150  1.00 42.94 ? 455  PHE A CG  1 
ATOM   3476 C CD1 . PHE A 1 455 ? 19.930  14.949  23.934  1.00 42.37 ? 455  PHE A CD1 1 
ATOM   3477 C CD2 . PHE A 1 455 ? 20.127  15.049  26.314  1.00 44.14 ? 455  PHE A CD2 1 
ATOM   3478 C CE1 . PHE A 1 455 ? 21.063  14.137  23.871  1.00 43.03 ? 455  PHE A CE1 1 
ATOM   3479 C CE2 . PHE A 1 455 ? 21.267  14.234  26.272  1.00 43.01 ? 455  PHE A CE2 1 
ATOM   3480 C CZ  . PHE A 1 455 ? 21.736  13.780  25.050  1.00 43.70 ? 455  PHE A CZ  1 
ATOM   3481 N N   . GLY A 1 456 ? 14.823  16.683  25.510  1.00 44.24 ? 456  GLY A N   1 
ATOM   3482 C CA  . GLY A 1 456 ? 13.693  17.239  26.241  1.00 45.08 ? 456  GLY A CA  1 
ATOM   3483 C C   . GLY A 1 456 ? 13.780  18.697  26.626  1.00 46.01 ? 456  GLY A C   1 
ATOM   3484 O O   . GLY A 1 456 ? 13.054  19.136  27.517  1.00 46.43 ? 456  GLY A O   1 
ATOM   3485 N N   . LEU A 1 457 ? 14.619  19.475  25.943  1.00 46.38 ? 457  LEU A N   1 
ATOM   3486 C CA  . LEU A 1 457 ? 14.730  20.917  26.264  1.00 47.72 ? 457  LEU A CA  1 
ATOM   3487 C C   . LEU A 1 457 ? 13.410  21.699  26.179  1.00 48.73 ? 457  LEU A C   1 
ATOM   3488 O O   . LEU A 1 457 ? 13.179  22.587  26.979  1.00 49.57 ? 457  LEU A O   1 
ATOM   3489 C CB  . LEU A 1 457 ? 15.813  21.621  25.417  1.00 47.21 ? 457  LEU A CB  1 
ATOM   3490 C CG  . LEU A 1 457 ? 17.237  21.536  25.988  1.00 47.16 ? 457  LEU A CG  1 
ATOM   3491 C CD1 . LEU A 1 457 ? 17.732  20.099  25.947  1.00 44.99 ? 457  LEU A CD1 1 
ATOM   3492 C CD2 . LEU A 1 457 ? 18.195  22.467  25.229  1.00 46.03 ? 457  LEU A CD2 1 
ATOM   3493 N N   . PRO A 1 458 ? 12.545  21.393  25.203  1.00 49.75 ? 458  PRO A N   1 
ATOM   3494 C CA  . PRO A 1 458 ? 11.221  22.056  25.204  1.00 51.20 ? 458  PRO A CA  1 
ATOM   3495 C C   . PRO A 1 458 ? 10.371  21.948  26.498  1.00 52.11 ? 458  PRO A C   1 
ATOM   3496 O O   . PRO A 1 458 ? 9.444   22.740  26.670  1.00 52.31 ? 458  PRO A O   1 
ATOM   3497 C CB  . PRO A 1 458 ? 10.511  21.402  24.013  1.00 51.15 ? 458  PRO A CB  1 
ATOM   3498 C CG  . PRO A 1 458 ? 11.640  21.019  23.092  1.00 50.06 ? 458  PRO A CG  1 
ATOM   3499 C CD  . PRO A 1 458 ? 12.713  20.531  24.023  1.00 49.35 ? 458  PRO A CD  1 
ATOM   3500 N N   . LEU A 1 459 ? 10.707  21.016  27.398  1.00 52.57 ? 459  LEU A N   1 
ATOM   3501 C CA  . LEU A 1 459 ? 10.037  20.912  28.699  1.00 53.80 ? 459  LEU A CA  1 
ATOM   3502 C C   . LEU A 1 459 ? 10.385  22.064  29.636  1.00 55.07 ? 459  LEU A C   1 
ATOM   3503 O O   . LEU A 1 459 ? 9.692   22.279  30.640  1.00 55.70 ? 459  LEU A O   1 
ATOM   3504 C CB  . LEU A 1 459 ? 10.386  19.608  29.426  1.00 53.68 ? 459  LEU A CB  1 
ATOM   3505 C CG  . LEU A 1 459 ? 10.166  18.238  28.765  1.00 53.93 ? 459  LEU A CG  1 
ATOM   3506 C CD1 . LEU A 1 459 ? 9.483   17.322  29.750  1.00 54.13 ? 459  LEU A CD1 1 
ATOM   3507 C CD2 . LEU A 1 459 ? 9.382   18.305  27.462  1.00 54.35 ? 459  LEU A CD2 1 
ATOM   3508 N N   . ASP A 1 460 ? 11.474  22.769  29.336  1.00 55.36 ? 460  ASP A N   1 
ATOM   3509 C CA  . ASP A 1 460 ? 11.864  23.941  30.100  1.00 56.75 ? 460  ASP A CA  1 
ATOM   3510 C C   . ASP A 1 460 ? 11.085  25.154  29.578  1.00 58.05 ? 460  ASP A C   1 
ATOM   3511 O O   . ASP A 1 460 ? 11.365  25.640  28.481  1.00 57.51 ? 460  ASP A O   1 
ATOM   3512 C CB  . ASP A 1 460 ? 13.376  24.177  29.964  1.00 56.07 ? 460  ASP A CB  1 
ATOM   3513 C CG  . ASP A 1 460 ? 13.875  25.310  30.847  1.00 57.09 ? 460  ASP A CG  1 
ATOM   3514 O OD1 . ASP A 1 460 ? 13.038  26.026  31.439  1.00 58.80 ? 460  ASP A OD1 1 
ATOM   3515 O OD2 . ASP A 1 460 ? 15.110  25.484  30.949  1.00 57.66 ? 460  ASP A OD2 1 
ATOM   3516 N N   . PRO A 1 461 ? 10.112  25.655  30.362  1.00 60.30 ? 461  PRO A N   1 
ATOM   3517 C CA  . PRO A 1 461 ? 9.280   26.757  29.841  1.00 61.76 ? 461  PRO A CA  1 
ATOM   3518 C C   . PRO A 1 461 ? 10.060  28.040  29.544  1.00 62.43 ? 461  PRO A C   1 
ATOM   3519 O O   . PRO A 1 461 ? 9.646   28.815  28.686  1.00 63.24 ? 461  PRO A O   1 
ATOM   3520 C CB  . PRO A 1 461 ? 8.240   26.979  30.947  1.00 62.62 ? 461  PRO A CB  1 
ATOM   3521 C CG  . PRO A 1 461 ? 8.848   26.412  32.177  1.00 62.44 ? 461  PRO A CG  1 
ATOM   3522 C CD  . PRO A 1 461 ? 9.722   25.273  31.732  1.00 60.94 ? 461  PRO A CD  1 
ATOM   3523 N N   . SER A 1 462 ? 11.198  28.240  30.205  1.00 62.77 ? 462  SER A N   1 
ATOM   3524 C CA  . SER A 1 462 ? 12.041  29.409  29.934  1.00 63.39 ? 462  SER A CA  1 
ATOM   3525 C C   . SER A 1 462 ? 12.653  29.435  28.520  1.00 62.87 ? 462  SER A C   1 
ATOM   3526 O O   . SER A 1 462 ? 13.160  30.476  28.087  1.00 63.02 ? 462  SER A O   1 
ATOM   3527 C CB  . SER A 1 462 ? 13.159  29.503  30.975  1.00 63.17 ? 462  SER A CB  1 
ATOM   3528 O OG  . SER A 1 462 ? 14.124  28.484  30.769  1.00 63.55 ? 462  SER A OG  1 
ATOM   3529 N N   . LEU A 1 463 ? 12.614  28.305  27.805  1.00 62.49 ? 463  LEU A N   1 
ATOM   3530 C CA  . LEU A 1 463 ? 13.218  28.213  26.468  1.00 61.63 ? 463  LEU A CA  1 
ATOM   3531 C C   . LEU A 1 463 ? 12.291  28.605  25.298  1.00 61.98 ? 463  LEU A C   1 
ATOM   3532 O O   . LEU A 1 463 ? 12.720  28.622  24.143  1.00 61.38 ? 463  LEU A O   1 
ATOM   3533 C CB  . LEU A 1 463 ? 13.811  26.813  26.252  1.00 60.68 ? 463  LEU A CB  1 
ATOM   3534 C CG  . LEU A 1 463 ? 15.064  26.480  27.070  1.00 60.23 ? 463  LEU A CG  1 
ATOM   3535 C CD1 . LEU A 1 463 ? 15.629  25.142  26.622  1.00 58.19 ? 463  LEU A CD1 1 
ATOM   3536 C CD2 . LEU A 1 463 ? 16.142  27.578  26.970  1.00 59.28 ? 463  LEU A CD2 1 
ATOM   3537 N N   . ASN A 1 464 ? 11.033  28.916  25.591  1.00 63.21 ? 464  ASN A N   1 
ATOM   3538 C CA  . ASN A 1 464 ? 10.109  29.522  24.605  1.00 64.07 ? 464  ASN A CA  1 
ATOM   3539 C C   . ASN A 1 464 ? 9.661   28.621  23.447  1.00 62.49 ? 464  ASN A C   1 
ATOM   3540 O O   . ASN A 1 464 ? 9.243   29.124  22.400  1.00 62.27 ? 464  ASN A O   1 
ATOM   3541 C CB  . ASN A 1 464 ? 10.688  30.827  24.020  1.00 65.19 ? 464  ASN A CB  1 
ATOM   3542 C CG  . ASN A 1 464 ? 10.840  31.926  25.055  1.00 69.62 ? 464  ASN A CG  1 
ATOM   3543 O OD1 . ASN A 1 464 ? 10.222  31.895  26.129  1.00 70.59 ? 464  ASN A OD1 1 
ATOM   3544 N ND2 . ASN A 1 464 ? 11.674  32.925  24.717  1.00 77.61 ? 464  ASN A ND2 1 
ATOM   3545 N N   . TYR A 1 465 ? 9.727   27.305  23.631  1.00 60.43 ? 465  TYR A N   1 
ATOM   3546 C CA  . TYR A 1 465 ? 9.132   26.388  22.665  1.00 59.14 ? 465  TYR A CA  1 
ATOM   3547 C C   . TYR A 1 465 ? 7.614   26.429  22.803  1.00 59.50 ? 465  TYR A C   1 
ATOM   3548 O O   . TYR A 1 465 ? 7.086   26.832  23.836  1.00 59.78 ? 465  TYR A O   1 
ATOM   3549 C CB  . TYR A 1 465 ? 9.615   24.958  22.886  1.00 58.04 ? 465  TYR A CB  1 
ATOM   3550 C CG  . TYR A 1 465 ? 11.075  24.702  22.575  1.00 56.67 ? 465  TYR A CG  1 
ATOM   3551 C CD1 . TYR A 1 465 ? 11.470  24.257  21.318  1.00 55.78 ? 465  TYR A CD1 1 
ATOM   3552 C CD2 . TYR A 1 465 ? 12.059  24.875  23.550  1.00 55.36 ? 465  TYR A CD2 1 
ATOM   3553 C CE1 . TYR A 1 465 ? 12.807  24.002  21.036  1.00 55.81 ? 465  TYR A CE1 1 
ATOM   3554 C CE2 . TYR A 1 465 ? 13.384  24.611  23.285  1.00 54.70 ? 465  TYR A CE2 1 
ATOM   3555 C CZ  . TYR A 1 465 ? 13.757  24.177  22.030  1.00 55.30 ? 465  TYR A CZ  1 
ATOM   3556 O OH  . TYR A 1 465 ? 15.076  23.907  21.770  1.00 54.42 ? 465  TYR A OH  1 
ATOM   3557 N N   . THR A 1 466 ? 6.917   25.994  21.760  1.00 59.29 ? 466  THR A N   1 
ATOM   3558 C CA  . THR A 1 466 ? 5.459   25.917  21.792  1.00 59.94 ? 466  THR A CA  1 
ATOM   3559 C C   . THR A 1 466 ? 5.006   24.734  22.645  1.00 60.13 ? 466  THR A C   1 
ATOM   3560 O O   . THR A 1 466 ? 5.776   23.804  22.910  1.00 59.01 ? 466  THR A O   1 
ATOM   3561 C CB  . THR A 1 466 ? 4.863   25.752  20.378  1.00 60.11 ? 466  THR A CB  1 
ATOM   3562 O OG1 . THR A 1 466 ? 5.252   24.484  19.843  1.00 59.56 ? 466  THR A OG1 1 
ATOM   3563 C CG2 . THR A 1 466 ? 5.332   26.858  19.441  1.00 58.80 ? 466  THR A CG2 1 
ATOM   3564 N N   . THR A 1 467 ? 3.744   24.783  23.064  1.00 61.34 ? 467  THR A N   1 
ATOM   3565 C CA  . THR A 1 467 ? 3.094   23.684  23.784  1.00 61.90 ? 467  THR A CA  1 
ATOM   3566 C C   . THR A 1 467 ? 3.131   22.381  22.990  1.00 61.15 ? 467  THR A C   1 
ATOM   3567 O O   . THR A 1 467 ? 3.366   21.316  23.550  1.00 60.63 ? 467  THR A O   1 
ATOM   3568 C CB  . THR A 1 467 ? 1.624   24.031  24.114  1.00 63.33 ? 467  THR A CB  1 
ATOM   3569 O OG1 . THR A 1 467 ? 1.590   24.973  25.194  1.00 64.59 ? 467  THR A OG1 1 
ATOM   3570 C CG2 . THR A 1 467 ? 0.846   22.790  24.522  1.00 64.40 ? 467  THR A CG2 1 
ATOM   3571 N N   . GLU A 1 468 ? 2.921   22.476  21.683  1.00 61.00 ? 468  GLU A N   1 
ATOM   3572 C CA  . GLU A 1 468 ? 2.949   21.297  20.819  1.00 61.08 ? 468  GLU A CA  1 
ATOM   3573 C C   . GLU A 1 468 ? 4.353   20.697  20.777  1.00 58.87 ? 468  GLU A C   1 
ATOM   3574 O O   . GLU A 1 468 ? 4.510   19.481  20.771  1.00 58.08 ? 468  GLU A O   1 
ATOM   3575 C CB  . GLU A 1 468 ? 2.473   21.636  19.403  1.00 62.03 ? 468  GLU A CB  1 
ATOM   3576 C CG  . GLU A 1 468 ? 1.099   22.318  19.358  1.00 66.65 ? 468  GLU A CG  1 
ATOM   3577 C CD  . GLU A 1 468 ? 1.186   23.853  19.382  1.00 71.38 ? 468  GLU A CD  1 
ATOM   3578 O OE1 . GLU A 1 468 ? 0.835   24.468  20.428  1.00 72.07 ? 468  GLU A OE1 1 
ATOM   3579 O OE2 . GLU A 1 468 ? 1.617   24.431  18.345  1.00 75.42 ? 468  GLU A OE2 1 
ATOM   3580 N N   . GLU A 1 469 ? 5.363   21.560  20.754  1.00 57.45 ? 469  GLU A N   1 
ATOM   3581 C CA  . GLU A 1 469 ? 6.754   21.124  20.826  1.00 56.19 ? 469  GLU A CA  1 
ATOM   3582 C C   . GLU A 1 469 ? 7.096   20.424  22.155  1.00 55.66 ? 469  GLU A C   1 
ATOM   3583 O O   . GLU A 1 469 ? 7.847   19.462  22.158  1.00 54.68 ? 469  GLU A O   1 
ATOM   3584 C CB  . GLU A 1 469 ? 7.701   22.298  20.553  1.00 55.54 ? 469  GLU A CB  1 
ATOM   3585 C CG  . GLU A 1 469 ? 7.777   22.644  19.083  1.00 55.70 ? 469  GLU A CG  1 
ATOM   3586 C CD  . GLU A 1 469 ? 8.609   23.878  18.793  1.00 55.11 ? 469  GLU A CD  1 
ATOM   3587 O OE1 . GLU A 1 469 ? 8.535   24.847  19.573  1.00 53.64 ? 469  GLU A OE1 1 
ATOM   3588 O OE2 . GLU A 1 469 ? 9.326   23.879  17.771  1.00 55.80 ? 469  GLU A OE2 1 
ATOM   3589 N N   . ARG A 1 470 ? 6.522   20.892  23.263  1.00 56.37 ? 470  ARG A N   1 
ATOM   3590 C CA  . ARG A 1 470 ? 6.632   20.202  24.553  1.00 56.78 ? 470  ARG A CA  1 
ATOM   3591 C C   . ARG A 1 470 ? 6.101   18.773  24.463  1.00 55.54 ? 470  ARG A C   1 
ATOM   3592 O O   . ARG A 1 470 ? 6.746   17.842  24.916  1.00 55.07 ? 470  ARG A O   1 
ATOM   3593 C CB  . ARG A 1 470 ? 5.854   20.937  25.664  1.00 57.70 ? 470  ARG A CB  1 
ATOM   3594 C CG  . ARG A 1 470 ? 6.436   20.715  27.077  1.00 59.74 ? 470  ARG A CG  1 
ATOM   3595 C CD  . ARG A 1 470 ? 5.418   20.396  28.224  1.00 62.51 ? 470  ARG A CD  1 
ATOM   3596 N NE  . ARG A 1 470 ? 4.046   20.885  28.004  1.00 67.44 ? 470  ARG A NE  1 
ATOM   3597 C CZ  . ARG A 1 470 ? 2.949   20.119  27.954  1.00 69.71 ? 470  ARG A CZ  1 
ATOM   3598 N NH1 . ARG A 1 470 ? 3.018   18.796  28.110  1.00 70.50 ? 470  ARG A NH1 1 
ATOM   3599 N NH2 . ARG A 1 470 ? 1.759   20.684  27.745  1.00 70.94 ? 470  ARG A NH2 1 
ATOM   3600 N N   . ILE A 1 471 ? 4.910   18.619  23.898  1.00 55.09 ? 471  ILE A N   1 
ATOM   3601 C CA  . ILE A 1 471 ? 4.265   17.311  23.745  1.00 54.86 ? 471  ILE A CA  1 
ATOM   3602 C C   . ILE A 1 471 ? 5.062   16.401  22.801  1.00 53.14 ? 471  ILE A C   1 
ATOM   3603 O O   . ILE A 1 471 ? 5.214   15.202  23.040  1.00 52.36 ? 471  ILE A O   1 
ATOM   3604 C CB  . ILE A 1 471 ? 2.792   17.488  23.248  1.00 56.07 ? 471  ILE A CB  1 
ATOM   3605 C CG1 . ILE A 1 471 ? 1.918   18.028  24.387  1.00 57.22 ? 471  ILE A CG1 1 
ATOM   3606 C CG2 . ILE A 1 471 ? 2.211   16.180  22.719  1.00 57.04 ? 471  ILE A CG2 1 
ATOM   3607 C CD1 . ILE A 1 471 ? 0.699   18.791  23.909  1.00 58.40 ? 471  ILE A CD1 1 
ATOM   3608 N N   . PHE A 1 472 ? 5.580   16.998  21.737  1.00 51.82 ? 472  PHE A N   1 
ATOM   3609 C CA  . PHE A 1 472 ? 6.414   16.299  20.773  1.00 50.71 ? 472  PHE A CA  1 
ATOM   3610 C C   . PHE A 1 472 ? 7.689   15.774  21.442  1.00 49.63 ? 472  PHE A C   1 
ATOM   3611 O O   . PHE A 1 472 ? 8.012   14.601  21.318  1.00 49.21 ? 472  PHE A O   1 
ATOM   3612 C CB  . PHE A 1 472 ? 6.720   17.251  19.616  1.00 50.45 ? 472  PHE A CB  1 
ATOM   3613 C CG  . PHE A 1 472 ? 7.590   16.674  18.552  1.00 48.76 ? 472  PHE A CG  1 
ATOM   3614 C CD1 . PHE A 1 472 ? 7.302   15.446  17.987  1.00 48.67 ? 472  PHE A CD1 1 
ATOM   3615 C CD2 . PHE A 1 472 ? 8.674   17.397  18.077  1.00 48.34 ? 472  PHE A CD2 1 
ATOM   3616 C CE1 . PHE A 1 472 ? 8.102   14.918  16.982  1.00 49.28 ? 472  PHE A CE1 1 
ATOM   3617 C CE2 . PHE A 1 472 ? 9.492   16.884  17.075  1.00 48.35 ? 472  PHE A CE2 1 
ATOM   3618 C CZ  . PHE A 1 472 ? 9.201   15.640  16.515  1.00 48.92 ? 472  PHE A CZ  1 
ATOM   3619 N N   . ALA A 1 473 ? 8.378   16.632  22.188  1.00 49.21 ? 473  ALA A N   1 
ATOM   3620 C CA  . ALA A 1 473 ? 9.576   16.225  22.932  1.00 48.84 ? 473  ALA A CA  1 
ATOM   3621 C C   . ALA A 1 473 ? 9.295   15.028  23.837  1.00 49.42 ? 473  ALA A C   1 
ATOM   3622 O O   . ALA A 1 473 ? 10.060  14.076  23.857  1.00 49.06 ? 473  ALA A O   1 
ATOM   3623 C CB  . ALA A 1 473 ? 10.122  17.386  23.754  1.00 48.34 ? 473  ALA A CB  1 
ATOM   3624 N N   . GLN A 1 474 ? 8.185   15.076  24.567  1.00 50.47 ? 474  GLN A N   1 
ATOM   3625 C CA  . GLN A 1 474 ? 7.799   13.986  25.470  1.00 51.35 ? 474  GLN A CA  1 
ATOM   3626 C C   . GLN A 1 474 ? 7.626   12.659  24.727  1.00 51.26 ? 474  GLN A C   1 
ATOM   3627 O O   . GLN A 1 474 ? 8.049   11.614  25.211  1.00 51.32 ? 474  GLN A O   1 
ATOM   3628 C CB  . GLN A 1 474 ? 6.518   14.354  26.223  1.00 52.17 ? 474  GLN A CB  1 
ATOM   3629 C CG  . GLN A 1 474 ? 6.686   15.523  27.210  1.00 53.06 ? 474  GLN A CG  1 
ATOM   3630 C CD  . GLN A 1 474 ? 5.376   15.897  27.903  1.00 54.86 ? 474  GLN A CD  1 
ATOM   3631 O OE1 . GLN A 1 474 ? 4.446   16.415  27.280  1.00 58.02 ? 474  GLN A OE1 1 
ATOM   3632 N NE2 . GLN A 1 474 ? 5.299   15.623  29.186  1.00 57.10 ? 474  GLN A NE2 1 
ATOM   3633 N N   . ARG A 1 475 ? 7.001   12.706  23.553  1.00 51.68 ? 475  ARG A N   1 
ATOM   3634 C CA  . ARG A 1 475 ? 6.903   11.530  22.676  1.00 52.14 ? 475  ARG A CA  1 
ATOM   3635 C C   . ARG A 1 475 ? 8.273   10.956  22.313  1.00 50.63 ? 475  ARG A C   1 
ATOM   3636 O O   . ARG A 1 475 ? 8.493   9.751   22.404  1.00 50.21 ? 475  ARG A O   1 
ATOM   3637 C CB  . ARG A 1 475 ? 6.151   11.866  21.375  1.00 52.31 ? 475  ARG A CB  1 
ATOM   3638 C CG  . ARG A 1 475 ? 4.664   11.755  21.497  1.00 54.42 ? 475  ARG A CG  1 
ATOM   3639 C CD  . ARG A 1 475 ? 3.968   12.185  20.208  1.00 55.07 ? 475  ARG A CD  1 
ATOM   3640 N NE  . ARG A 1 475 ? 4.393   11.357  19.093  1.00 54.35 ? 475  ARG A NE  1 
ATOM   3641 C CZ  . ARG A 1 475 ? 4.576   11.780  17.847  1.00 54.04 ? 475  ARG A CZ  1 
ATOM   3642 N NH1 . ARG A 1 475 ? 4.366   13.044  17.505  1.00 53.85 ? 475  ARG A NH1 1 
ATOM   3643 N NH2 . ARG A 1 475 ? 4.983   10.918  16.928  1.00 55.07 ? 475  ARG A NH2 1 
ATOM   3644 N N   . LEU A 1 476 ? 9.175   11.826  21.879  1.00 49.87 ? 476  LEU A N   1 
ATOM   3645 C CA  . LEU A 1 476 ? 10.502  11.389  21.443  1.00 49.31 ? 476  LEU A CA  1 
ATOM   3646 C C   . LEU A 1 476 ? 11.280  10.744  22.581  1.00 49.34 ? 476  LEU A C   1 
ATOM   3647 O O   . LEU A 1 476 ? 11.849  9.662   22.403  1.00 48.85 ? 476  LEU A O   1 
ATOM   3648 C CB  . LEU A 1 476 ? 11.282  12.549  20.835  1.00 48.56 ? 476  LEU A CB  1 
ATOM   3649 C CG  . LEU A 1 476 ? 10.666  13.094  19.543  1.00 48.94 ? 476  LEU A CG  1 
ATOM   3650 C CD1 . LEU A 1 476 ? 11.484  14.221  18.997  1.00 48.64 ? 476  LEU A CD1 1 
ATOM   3651 C CD2 . LEU A 1 476 ? 10.527  12.002  18.504  1.00 49.63 ? 476  LEU A CD2 1 
ATOM   3652 N N   . MET A 1 477 ? 11.260  11.390  23.747  1.00 49.50 ? 477  MET A N   1 
ATOM   3653 C CA  . MET A 1 477 ? 11.870  10.847  24.963  1.00 50.27 ? 477  MET A CA  1 
ATOM   3654 C C   . MET A 1 477 ? 11.331  9.449   25.298  1.00 50.43 ? 477  MET A C   1 
ATOM   3655 O O   . MET A 1 477 ? 12.101  8.562   25.679  1.00 50.16 ? 477  MET A O   1 
ATOM   3656 C CB  . MET A 1 477 ? 11.638  11.786  26.152  1.00 50.13 ? 477  MET A CB  1 
ATOM   3657 C CG  . MET A 1 477 ? 12.336  13.134  26.068  1.00 50.85 ? 477  MET A CG  1 
ATOM   3658 S SD  . MET A 1 477 ? 11.744  14.331  27.312  1.00 53.55 ? 477  MET A SD  1 
ATOM   3659 C CE  . MET A 1 477 ? 12.607  13.779  28.755  1.00 49.36 ? 477  MET A CE  1 
ATOM   3660 N N   . LYS A 1 478 ? 10.018  9.259   25.156  1.00 50.98 ? 478  LYS A N   1 
ATOM   3661 C CA  . LYS A 1 478 ? 9.397   7.947   25.353  1.00 51.87 ? 478  LYS A CA  1 
ATOM   3662 C C   . LYS A 1 478 ? 9.889   6.902   24.342  1.00 50.68 ? 478  LYS A C   1 
ATOM   3663 O O   . LYS A 1 478 ? 10.187  5.766   24.716  1.00 50.28 ? 478  LYS A O   1 
ATOM   3664 C CB  . LYS A 1 478 ? 7.875   8.044   25.252  1.00 53.78 ? 478  LYS A CB  1 
ATOM   3665 C CG  . LYS A 1 478 ? 7.195   8.648   26.452  1.00 56.30 ? 478  LYS A CG  1 
ATOM   3666 C CD  . LYS A 1 478 ? 6.427   7.598   27.261  1.00 60.07 ? 478  LYS A CD  1 
ATOM   3667 C CE  . LYS A 1 478 ? 6.102   8.107   28.664  1.00 61.34 ? 478  LYS A CE  1 
ATOM   3668 N NZ  . LYS A 1 478 ? 5.543   9.512   28.620  1.00 64.02 ? 478  LYS A NZ  1 
ATOM   3669 N N   . TYR A 1 479 ? 9.953   7.275   23.066  1.00 49.30 ? 479  TYR A N   1 
ATOM   3670 C CA  . TYR A 1 479 ? 10.456  6.353   22.046  1.00 48.74 ? 479  TYR A CA  1 
ATOM   3671 C C   . TYR A 1 479 ? 11.871  5.895   22.374  1.00 47.82 ? 479  TYR A C   1 
ATOM   3672 O O   . TYR A 1 479 ? 12.156  4.695   22.376  1.00 48.29 ? 479  TYR A O   1 
ATOM   3673 C CB  . TYR A 1 479 ? 10.469  6.989   20.653  1.00 48.38 ? 479  TYR A CB  1 
ATOM   3674 C CG  . TYR A 1 479 ? 9.124   7.268   20.036  1.00 47.89 ? 479  TYR A CG  1 
ATOM   3675 C CD1 . TYR A 1 479 ? 8.091   6.329   20.077  1.00 48.44 ? 479  TYR A CD1 1 
ATOM   3676 C CD2 . TYR A 1 479 ? 8.904   8.453   19.355  1.00 48.03 ? 479  TYR A CD2 1 
ATOM   3677 C CE1 . TYR A 1 479 ? 6.862   6.592   19.489  1.00 49.31 ? 479  TYR A CE1 1 
ATOM   3678 C CE2 . TYR A 1 479 ? 7.675   8.732   18.762  1.00 48.72 ? 479  TYR A CE2 1 
ATOM   3679 C CZ  . TYR A 1 479 ? 6.664   7.801   18.827  1.00 50.09 ? 479  TYR A CZ  1 
ATOM   3680 O OH  . TYR A 1 479 ? 5.463   8.102   18.239  1.00 50.51 ? 479  TYR A OH  1 
ATOM   3681 N N   . TRP A 1 480 ? 12.739  6.859   22.660  1.00 46.53 ? 480  TRP A N   1 
ATOM   3682 C CA  . TRP A 1 480 ? 14.151  6.592   22.869  1.00 46.08 ? 480  TRP A CA  1 
ATOM   3683 C C   . TRP A 1 480 ? 14.376  5.762   24.127  1.00 46.09 ? 480  TRP A C   1 
ATOM   3684 O O   . TRP A 1 480 ? 15.178  4.831   24.107  1.00 45.80 ? 480  TRP A O   1 
ATOM   3685 C CB  . TRP A 1 480 ? 14.952  7.898   22.954  1.00 45.93 ? 480  TRP A CB  1 
ATOM   3686 C CG  . TRP A 1 480 ? 15.717  8.281   21.706  1.00 45.64 ? 480  TRP A CG  1 
ATOM   3687 C CD1 . TRP A 1 480 ? 17.069  8.449   21.599  1.00 45.22 ? 480  TRP A CD1 1 
ATOM   3688 C CD2 . TRP A 1 480 ? 15.176  8.583   20.410  1.00 45.96 ? 480  TRP A CD2 1 
ATOM   3689 N NE1 . TRP A 1 480 ? 17.402  8.814   20.320  1.00 44.52 ? 480  TRP A NE1 1 
ATOM   3690 C CE2 . TRP A 1 480 ? 16.262  8.903   19.570  1.00 44.30 ? 480  TRP A CE2 1 
ATOM   3691 C CE3 . TRP A 1 480 ? 13.884  8.599   19.877  1.00 46.10 ? 480  TRP A CE3 1 
ATOM   3692 C CZ2 . TRP A 1 480 ? 16.094  9.246   18.234  1.00 45.65 ? 480  TRP A CZ2 1 
ATOM   3693 C CZ3 . TRP A 1 480 ? 13.718  8.928   18.543  1.00 46.58 ? 480  TRP A CZ3 1 
ATOM   3694 C CH2 . TRP A 1 480 ? 14.817  9.249   17.733  1.00 45.93 ? 480  TRP A CH2 1 
ATOM   3695 N N   . THR A 1 481 ? 13.665  6.095   25.207  1.00 46.10 ? 481  THR A N   1 
ATOM   3696 C CA  . THR A 1 481 ? 13.790  5.365   26.469  1.00 46.35 ? 481  THR A CA  1 
ATOM   3697 C C   . THR A 1 481 ? 13.055  4.023   26.444  1.00 47.02 ? 481  THR A C   1 
ATOM   3698 O O   . THR A 1 481 ? 13.506  3.074   27.087  1.00 47.29 ? 481  THR A O   1 
ATOM   3699 C CB  . THR A 1 481 ? 13.356  6.209   27.696  1.00 46.60 ? 481  THR A CB  1 
ATOM   3700 O OG1 . THR A 1 481 ? 12.028  6.722   27.499  1.00 47.38 ? 481  THR A OG1 1 
ATOM   3701 C CG2 . THR A 1 481 ? 14.339  7.373   27.926  1.00 46.11 ? 481  THR A CG2 1 
ATOM   3702 N N   . ASN A 1 482 ? 11.957  3.911   25.701  1.00 47.51 ? 482  ASN A N   1 
ATOM   3703 C CA  . ASN A 1 482 ? 11.348  2.576   25.480  1.00 48.46 ? 482  ASN A CA  1 
ATOM   3704 C C   . ASN A 1 482 ? 12.327  1.681   24.732  1.00 48.35 ? 482  ASN A C   1 
ATOM   3705 O O   . ASN A 1 482 ? 12.489  0.522   25.088  1.00 48.51 ? 482  ASN A O   1 
ATOM   3706 C CB  . ASN A 1 482 ? 10.021  2.636   24.703  1.00 49.03 ? 482  ASN A CB  1 
ATOM   3707 C CG  . ASN A 1 482 ? 8.862   3.164   25.541  1.00 50.20 ? 482  ASN A CG  1 
ATOM   3708 O OD1 . ASN A 1 482 ? 8.859   3.060   26.762  1.00 51.42 ? 482  ASN A OD1 1 
ATOM   3709 N ND2 . ASN A 1 482 ? 7.861   3.712   24.872  1.00 51.62 ? 482  ASN A ND2 1 
ATOM   3710 N N   . PHE A 1 483 ? 12.972  2.223   23.697  1.00 48.22 ? 483  PHE A N   1 
ATOM   3711 C CA  . PHE A 1 483 ? 14.013  1.485   22.972  1.00 48.65 ? 483  PHE A CA  1 
ATOM   3712 C C   . PHE A 1 483 ? 15.176  1.081   23.884  1.00 48.46 ? 483  PHE A C   1 
ATOM   3713 O O   . PHE A 1 483 ? 15.673  -0.043  23.808  1.00 48.42 ? 483  PHE A O   1 
ATOM   3714 C CB  . PHE A 1 483 ? 14.562  2.278   21.782  1.00 48.00 ? 483  PHE A CB  1 
ATOM   3715 C CG  . PHE A 1 483 ? 15.638  1.549   21.033  1.00 48.01 ? 483  PHE A CG  1 
ATOM   3716 C CD1 . PHE A 1 483 ? 15.315  0.536   20.145  1.00 49.05 ? 483  PHE A CD1 1 
ATOM   3717 C CD2 . PHE A 1 483 ? 16.977  1.844   21.246  1.00 47.71 ? 483  PHE A CD2 1 
ATOM   3718 C CE1 . PHE A 1 483 ? 16.306  -0.154  19.463  1.00 48.73 ? 483  PHE A CE1 1 
ATOM   3719 C CE2 . PHE A 1 483 ? 17.969  1.147   20.578  1.00 47.27 ? 483  PHE A CE2 1 
ATOM   3720 C CZ  . PHE A 1 483 ? 17.634  0.147   19.686  1.00 47.32 ? 483  PHE A CZ  1 
ATOM   3721 N N   . ALA A 1 484 ? 15.619  2.003   24.728  1.00 48.75 ? 484  ALA A N   1 
ATOM   3722 C CA  . ALA A 1 484 ? 16.662  1.682   25.712  1.00 49.01 ? 484  ALA A CA  1 
ATOM   3723 C C   . ALA A 1 484 ? 16.224  0.522   26.619  1.00 50.28 ? 484  ALA A C   1 
ATOM   3724 O O   . ALA A 1 484 ? 16.986  -0.421  26.840  1.00 50.85 ? 484  ALA A O   1 
ATOM   3725 C CB  . ALA A 1 484 ? 17.003  2.886   26.529  1.00 47.84 ? 484  ALA A CB  1 
ATOM   3726 N N   . ARG A 1 485 ? 14.996  0.582   27.117  1.00 51.29 ? 485  ARG A N   1 
ATOM   3727 C CA  . ARG A 1 485 ? 14.494  -0.429  28.052  1.00 53.63 ? 485  ARG A CA  1 
ATOM   3728 C C   . ARG A 1 485 ? 14.311  -1.817  27.411  1.00 53.49 ? 485  ARG A C   1 
ATOM   3729 O O   . ARG A 1 485 ? 14.638  -2.828  28.032  1.00 53.71 ? 485  ARG A O   1 
ATOM   3730 C CB  . ARG A 1 485 ? 13.155  0.021   28.686  1.00 54.36 ? 485  ARG A CB  1 
ATOM   3731 C CG  . ARG A 1 485 ? 13.264  1.159   29.727  1.00 56.92 ? 485  ARG A CG  1 
ATOM   3732 C CD  . ARG A 1 485 ? 11.885  1.597   30.310  1.00 58.17 ? 485  ARG A CD  1 
ATOM   3733 N NE  . ARG A 1 485 ? 11.230  2.565   29.428  1.00 62.01 ? 485  ARG A NE  1 
ATOM   3734 C CZ  . ARG A 1 485 ? 11.079  3.876   29.656  1.00 61.93 ? 485  ARG A CZ  1 
ATOM   3735 N NH1 . ARG A 1 485 ? 11.491  4.443   30.789  1.00 62.03 ? 485  ARG A NH1 1 
ATOM   3736 N NH2 . ARG A 1 485 ? 10.475  4.629   28.729  1.00 61.42 ? 485  ARG A NH2 1 
ATOM   3737 N N   . THR A 1 486 ? 13.795  -1.857  26.182  1.00 52.86 ? 486  THR A N   1 
ATOM   3738 C CA  . THR A 1 486 ? 13.277  -3.107  25.602  1.00 53.67 ? 486  THR A CA  1 
ATOM   3739 C C   . THR A 1 486 ? 13.812  -3.486  24.222  1.00 53.61 ? 486  THR A C   1 
ATOM   3740 O O   . THR A 1 486 ? 13.562  -4.595  23.762  1.00 54.53 ? 486  THR A O   1 
ATOM   3741 C CB  . THR A 1 486 ? 11.733  -3.054  25.463  1.00 54.11 ? 486  THR A CB  1 
ATOM   3742 O OG1 . THR A 1 486 ? 11.373  -2.106  24.461  1.00 53.09 ? 486  THR A OG1 1 
ATOM   3743 C CG2 . THR A 1 486 ? 11.067  -2.666  26.784  1.00 53.68 ? 486  THR A CG2 1 
ATOM   3744 N N   . GLY A 1 487 ? 14.535  -2.584  23.566  1.00 52.93 ? 487  GLY A N   1 
ATOM   3745 C CA  . GLY A 1 487 ? 14.897  -2.758  22.157  1.00 53.14 ? 487  GLY A CA  1 
ATOM   3746 C C   . GLY A 1 487 ? 13.734  -2.517  21.203  1.00 53.94 ? 487  GLY A C   1 
ATOM   3747 O O   . GLY A 1 487 ? 13.784  -2.932  20.061  1.00 54.34 ? 487  GLY A O   1 
ATOM   3748 N N   . ASP A 1 488 ? 12.692  -1.836  21.679  1.00 54.87 ? 488  ASP A N   1 
ATOM   3749 C CA  . ASP A 1 488 ? 11.482  -1.552  20.901  1.00 55.89 ? 488  ASP A CA  1 
ATOM   3750 C C   . ASP A 1 488 ? 10.963  -0.184  21.322  1.00 56.04 ? 488  ASP A C   1 
ATOM   3751 O O   . ASP A 1 488 ? 10.611  -0.011  22.477  1.00 55.79 ? 488  ASP A O   1 
ATOM   3752 C CB  . ASP A 1 488 ? 10.413  -2.609  21.178  1.00 57.24 ? 488  ASP A CB  1 
ATOM   3753 C CG  . ASP A 1 488 ? 9.152   -2.433  20.328  1.00 57.89 ? 488  ASP A CG  1 
ATOM   3754 O OD1 . ASP A 1 488 ? 8.955   -1.375  19.703  1.00 58.11 ? 488  ASP A OD1 1 
ATOM   3755 O OD2 . ASP A 1 488 ? 8.340   -3.374  20.293  1.00 58.69 ? 488  ASP A OD2 1 
ATOM   3756 N N   . PRO A 1 489 ? 10.930  0.793   20.390  1.00 56.60 ? 489  PRO A N   1 
ATOM   3757 C CA  . PRO A 1 489 ? 10.468  2.143   20.726  1.00 57.26 ? 489  PRO A CA  1 
ATOM   3758 C C   . PRO A 1 489 ? 8.963   2.270   21.026  1.00 59.38 ? 489  PRO A C   1 
ATOM   3759 O O   . PRO A 1 489 ? 8.544   3.267   21.596  1.00 59.11 ? 489  PRO A O   1 
ATOM   3760 C CB  . PRO A 1 489 ? 10.844  2.952   19.480  1.00 56.51 ? 489  PRO A CB  1 
ATOM   3761 C CG  . PRO A 1 489 ? 10.853  1.973   18.383  1.00 56.07 ? 489  PRO A CG  1 
ATOM   3762 C CD  . PRO A 1 489 ? 11.330  0.696   18.974  1.00 56.06 ? 489  PRO A CD  1 
ATOM   3763 N N   . ASN A 1 490 ? 8.171   1.272   20.652  1.00 62.30 ? 490  ASN A N   1 
ATOM   3764 C CA  . ASN A 1 490 ? 6.726   1.304   20.866  1.00 65.06 ? 490  ASN A CA  1 
ATOM   3765 C C   . ASN A 1 490 ? 6.374   1.152   22.338  1.00 68.32 ? 490  ASN A C   1 
ATOM   3766 O O   . ASN A 1 490 ? 7.108   0.512   23.092  1.00 68.09 ? 490  ASN A O   1 
ATOM   3767 C CB  . ASN A 1 490 ? 6.048   0.185   20.073  1.00 65.50 ? 490  ASN A CB  1 
ATOM   3768 C CG  . ASN A 1 490 ? 6.194   0.363   18.582  1.00 63.26 ? 490  ASN A CG  1 
ATOM   3769 O OD1 . ASN A 1 490 ? 5.589   1.261   18.002  1.00 60.28 ? 490  ASN A OD1 1 
ATOM   3770 N ND2 . ASN A 1 490 ? 7.000   -0.488  17.952  1.00 57.63 ? 490  ASN A ND2 1 
ATOM   3771 N N   . ASP A 1 491 ? 5.256   1.746   22.742  1.00 72.37 ? 491  ASP A N   1 
ATOM   3772 C CA  . ASP A 1 491 ? 4.749   1.566   24.097  1.00 76.41 ? 491  ASP A CA  1 
ATOM   3773 C C   . ASP A 1 491 ? 3.962   0.260   24.175  1.00 78.87 ? 491  ASP A C   1 
ATOM   3774 O O   . ASP A 1 491 ? 3.036   0.042   23.380  1.00 80.03 ? 491  ASP A O   1 
ATOM   3775 C CB  . ASP A 1 491 ? 3.860   2.737   24.525  1.00 76.81 ? 491  ASP A CB  1 
ATOM   3776 C CG  . ASP A 1 491 ? 3.690   2.820   26.049  1.00 79.13 ? 491  ASP A CG  1 
ATOM   3777 O OD1 . ASP A 1 491 ? 4.169   3.818   26.646  1.00 79.99 ? 491  ASP A OD1 1 
ATOM   3778 O OD2 . ASP A 1 491 ? 3.095   1.889   26.648  1.00 81.71 ? 491  ASP A OD2 1 
ATOM   3779 N N   . PRO A 1 492 ? 4.327   -0.617  25.128  1.00 81.20 ? 492  PRO A N   1 
ATOM   3780 C CA  . PRO A 1 492 ? 3.589   -1.884  25.334  1.00 83.46 ? 492  PRO A CA  1 
ATOM   3781 C C   . PRO A 1 492 ? 2.124   -1.700  25.750  1.00 86.94 ? 492  PRO A C   1 
ATOM   3782 O O   . PRO A 1 492 ? 1.281   -2.522  25.398  1.00 88.33 ? 492  PRO A O   1 
ATOM   3783 C CB  . PRO A 1 492 ? 4.360   -2.578  26.467  1.00 83.69 ? 492  PRO A CB  1 
ATOM   3784 C CG  . PRO A 1 492 ? 5.653   -1.842  26.607  1.00 81.89 ? 492  PRO A CG  1 
ATOM   3785 C CD  . PRO A 1 492 ? 5.464   -0.467  26.055  1.00 80.28 ? 492  PRO A CD  1 
ATOM   3786 N N   . ARG A 1 493 ? 1.835   -0.628  26.486  1.00 88.94 ? 493  ARG A N   1 
ATOM   3787 C CA  . ARG A 1 493 ? 0.493   -0.385  27.037  1.00 92.11 ? 493  ARG A CA  1 
ATOM   3788 C C   . ARG A 1 493 ? -0.435  0.176   25.976  1.00 93.07 ? 493  ARG A C   1 
ATOM   3789 O O   . ARG A 1 493 ? -1.553  -0.316  25.775  1.00 95.01 ? 493  ARG A O   1 
ATOM   3790 C CB  . ARG A 1 493 ? 0.555   0.625   28.189  1.00 91.88 ? 493  ARG A CB  1 
ATOM   3791 C CG  . ARG A 1 493 ? 1.544   0.278   29.291  1.00 92.62 ? 493  ARG A CG  1 
ATOM   3792 C CD  . ARG A 1 493 ? 1.870   1.501   30.120  1.00 92.83 ? 493  ARG A CD  1 
ATOM   3793 N NE  . ARG A 1 493 ? 2.955   1.236   31.063  1.00 94.94 ? 493  ARG A NE  1 
ATOM   3794 C CZ  . ARG A 1 493 ? 3.247   1.990   32.125  1.00 95.81 ? 493  ARG A CZ  1 
ATOM   3795 N NH1 . ARG A 1 493 ? 2.533   3.081   32.410  1.00 96.85 ? 493  ARG A NH1 1 
ATOM   3796 N NH2 . ARG A 1 493 ? 4.262   1.646   32.916  1.00 95.18 ? 493  ARG A NH2 1 
ATOM   3797 N N   . ASP A 1 494 ? 0.045   1.227   25.318  1.00 92.65 ? 494  ASP A N   1 
ATOM   3798 C CA  . ASP A 1 494 ? -0.692  1.930   24.274  1.00 93.26 ? 494  ASP A CA  1 
ATOM   3799 C C   . ASP A 1 494 ? -0.863  1.052   23.026  1.00 93.68 ? 494  ASP A C   1 
ATOM   3800 O O   . ASP A 1 494 ? -0.126  0.076   22.835  1.00 93.78 ? 494  ASP A O   1 
ATOM   3801 C CB  . ASP A 1 494 ? 0.074   3.212   23.912  1.00 92.10 ? 494  ASP A CB  1 
ATOM   3802 C CG  . ASP A 1 494 ? -0.796  4.261   23.255  1.00 93.44 ? 494  ASP A CG  1 
ATOM   3803 O OD1 . ASP A 1 494 ? -1.874  3.921   22.707  1.00 96.02 ? 494  ASP A OD1 1 
ATOM   3804 O OD2 . ASP A 1 494 ? -0.384  5.443   23.281  1.00 93.86 ? 494  ASP A OD2 1 
ATOM   3805 N N   . SER A 1 495 ? -1.849  1.390   22.194  1.00 94.13 ? 495  SER A N   1 
ATOM   3806 C CA  . SER A 1 495 ? -1.978  0.785   20.863  1.00 94.10 ? 495  SER A CA  1 
ATOM   3807 C C   . SER A 1 495 ? -2.928  1.593   19.971  1.00 93.93 ? 495  SER A C   1 
ATOM   3808 O O   . SER A 1 495 ? -4.095  1.810   20.328  1.00 95.11 ? 495  SER A O   1 
ATOM   3809 C CB  . SER A 1 495 ? -2.451  -0.670  20.949  1.00 95.53 ? 495  SER A CB  1 
ATOM   3810 O OG  . SER A 1 495 ? -2.051  -1.376  19.784  1.00 95.96 ? 495  SER A OG  1 
ATOM   3811 N N   . LYS A 1 496 ? -2.414  2.014   18.810  1.00 92.13 ? 496  LYS A N   1 
ATOM   3812 C CA  . LYS A 1 496 ? -3.133  2.893   17.873  1.00 91.30 ? 496  LYS A CA  1 
ATOM   3813 C C   . LYS A 1 496 ? -3.761  4.093   18.603  1.00 90.19 ? 496  LYS A C   1 
ATOM   3814 O O   . LYS A 1 496 ? -4.991  4.121   18.747  1.00 91.87 ? 496  LYS A O   1 
ATOM   3815 C CB  . LYS A 1 496 ? -4.212  2.094   17.127  1.00 92.93 ? 496  LYS A CB  1 
ATOM   3816 N N   . SER A 1 497 ? -2.994  5.087   19.082  1.00 87.12 ? 497  SER A N   1 
ATOM   3817 C CA  . SER A 1 497 ? -1.536  5.335   18.889  1.00 83.61 ? 497  SER A CA  1 
ATOM   3818 C C   . SER A 1 497 ? -0.704  4.417   17.970  1.00 82.35 ? 497  SER A C   1 
ATOM   3819 O O   . SER A 1 497 ? -0.306  3.313   18.380  1.00 82.41 ? 497  SER A O   1 
ATOM   3820 C CB  . SER A 1 497 ? -0.851  5.445   20.254  1.00 83.26 ? 497  SER A CB  1 
ATOM   3821 O OG  . SER A 1 497 ? 0.214   6.377   20.210  1.00 81.57 ? 497  SER A OG  1 
ATOM   3822 N N   . PRO A 1 498 ? -0.396  4.898   16.744  1.00 80.14 ? 498  PRO A N   1 
ATOM   3823 C CA  . PRO A 1 498 ? 0.181   4.059   15.678  1.00 78.93 ? 498  PRO A CA  1 
ATOM   3824 C C   . PRO A 1 498 ? 1.531   3.442   16.040  1.00 75.39 ? 498  PRO A C   1 
ATOM   3825 O O   . PRO A 1 498 ? 2.294   4.026   16.812  1.00 74.20 ? 498  PRO A O   1 
ATOM   3826 C CB  . PRO A 1 498 ? 0.323   5.026   14.489  1.00 78.32 ? 498  PRO A CB  1 
ATOM   3827 C CG  . PRO A 1 498 ? 0.259   6.387   15.066  1.00 78.47 ? 498  PRO A CG  1 
ATOM   3828 C CD  . PRO A 1 498 ? -0.552  6.302   16.316  1.00 79.88 ? 498  PRO A CD  1 
ATOM   3829 N N   . GLN A 1 499 ? 1.798   2.263   15.481  1.00 73.07 ? 499  GLN A N   1 
ATOM   3830 C CA  . GLN A 1 499 ? 2.985   1.481   15.809  1.00 70.25 ? 499  GLN A CA  1 
ATOM   3831 C C   . GLN A 1 499 ? 4.122   1.743   14.828  1.00 67.13 ? 499  GLN A C   1 
ATOM   3832 O O   . GLN A 1 499 ? 3.901   2.052   13.660  1.00 67.06 ? 499  GLN A O   1 
ATOM   3833 C CB  . GLN A 1 499 ? 2.658   -0.019  15.834  1.00 71.46 ? 499  GLN A CB  1 
ATOM   3834 C CG  . GLN A 1 499 ? 1.582   -0.422  16.861  1.00 72.76 ? 499  GLN A CG  1 
ATOM   3835 C CD  . GLN A 1 499 ? 1.966   -0.090  18.306  1.00 71.79 ? 499  GLN A CD  1 
ATOM   3836 O OE1 . GLN A 1 499 ? 2.823   -0.745  18.898  1.00 71.08 ? 499  GLN A OE1 1 
ATOM   3837 N NE2 . GLN A 1 499 ? 1.321   0.928   18.877  1.00 71.13 ? 499  GLN A NE2 1 
ATOM   3838 N N   . TRP A 1 500 ? 5.338   1.613   15.340  1.00 63.48 ? 500  TRP A N   1 
ATOM   3839 C CA  . TRP A 1 500 ? 6.559   1.798   14.594  1.00 60.55 ? 500  TRP A CA  1 
ATOM   3840 C C   . TRP A 1 500 ? 7.057   0.397   14.213  1.00 59.71 ? 500  TRP A C   1 
ATOM   3841 O O   . TRP A 1 500 ? 7.552   -0.336  15.066  1.00 59.33 ? 500  TRP A O   1 
ATOM   3842 C CB  . TRP A 1 500 ? 7.555   2.538   15.495  1.00 58.76 ? 500  TRP A CB  1 
ATOM   3843 C CG  . TRP A 1 500 ? 8.849   2.986   14.885  1.00 56.88 ? 500  TRP A CG  1 
ATOM   3844 C CD1 . TRP A 1 500 ? 9.471   2.479   13.779  1.00 56.33 ? 500  TRP A CD1 1 
ATOM   3845 C CD2 . TRP A 1 500 ? 9.717   4.011   15.397  1.00 55.89 ? 500  TRP A CD2 1 
ATOM   3846 N NE1 . TRP A 1 500 ? 10.655  3.145   13.551  1.00 55.66 ? 500  TRP A NE1 1 
ATOM   3847 C CE2 . TRP A 1 500 ? 10.831  4.089   14.530  1.00 54.53 ? 500  TRP A CE2 1 
ATOM   3848 C CE3 . TRP A 1 500 ? 9.647   4.887   16.489  1.00 54.63 ? 500  TRP A CE3 1 
ATOM   3849 C CZ2 . TRP A 1 500 ? 11.865  4.993   14.727  1.00 53.73 ? 500  TRP A CZ2 1 
ATOM   3850 C CZ3 . TRP A 1 500 ? 10.681  5.793   16.683  1.00 54.02 ? 500  TRP A CZ3 1 
ATOM   3851 C CH2 . TRP A 1 500 ? 11.776  5.838   15.806  1.00 53.64 ? 500  TRP A CH2 1 
ATOM   3852 N N   . PRO A 1 501 ? 6.909   0.007   12.930  1.00 59.13 ? 501  PRO A N   1 
ATOM   3853 C CA  . PRO A 1 501 ? 7.348   -1.326  12.531  1.00 58.97 ? 501  PRO A CA  1 
ATOM   3854 C C   . PRO A 1 501 ? 8.842   -1.337  12.323  1.00 57.38 ? 501  PRO A C   1 
ATOM   3855 O O   . PRO A 1 501 ? 9.391   -0.307  11.964  1.00 56.23 ? 501  PRO A O   1 
ATOM   3856 C CB  . PRO A 1 501 ? 6.650   -1.528  11.187  1.00 59.82 ? 501  PRO A CB  1 
ATOM   3857 C CG  . PRO A 1 501 ? 6.570   -0.171  10.611  1.00 59.29 ? 501  PRO A CG  1 
ATOM   3858 C CD  . PRO A 1 501 ? 6.360   0.757   11.782  1.00 59.14 ? 501  PRO A CD  1 
ATOM   3859 N N   . PRO A 1 502 ? 9.502   -2.482  12.544  1.00 57.08 ? 502  PRO A N   1 
ATOM   3860 C CA  . PRO A 1 502 ? 10.912  -2.578  12.186  1.00 56.16 ? 502  PRO A CA  1 
ATOM   3861 C C   . PRO A 1 502 ? 11.220  -2.354  10.688  1.00 56.24 ? 502  PRO A C   1 
ATOM   3862 O O   . PRO A 1 502 ? 10.398  -2.667  9.818   1.00 56.50 ? 502  PRO A O   1 
ATOM   3863 C CB  . PRO A 1 502 ? 11.287  -4.008  12.582  1.00 57.03 ? 502  PRO A CB  1 
ATOM   3864 C CG  . PRO A 1 502 ? 10.218  -4.466  13.549  1.00 57.97 ? 502  PRO A CG  1 
ATOM   3865 C CD  . PRO A 1 502 ? 8.987   -3.721  13.163  1.00 58.50 ? 502  PRO A CD  1 
ATOM   3866 N N   . TYR A 1 503 ? 12.405  -1.805  10.417  1.00 55.32 ? 503  TYR A N   1 
ATOM   3867 C CA  . TYR A 1 503 ? 12.935  -1.714  9.072   1.00 55.38 ? 503  TYR A CA  1 
ATOM   3868 C C   . TYR A 1 503 ? 13.398  -3.088  8.597   1.00 56.45 ? 503  TYR A C   1 
ATOM   3869 O O   . TYR A 1 503 ? 14.139  -3.781  9.299   1.00 56.86 ? 503  TYR A O   1 
ATOM   3870 C CB  . TYR A 1 503 ? 14.110  -0.733  9.036   1.00 54.71 ? 503  TYR A CB  1 
ATOM   3871 C CG  . TYR A 1 503 ? 14.703  -0.515  7.664   1.00 54.11 ? 503  TYR A CG  1 
ATOM   3872 C CD1 . TYR A 1 503 ? 15.792  -1.269  7.229   1.00 54.33 ? 503  TYR A CD1 1 
ATOM   3873 C CD2 . TYR A 1 503 ? 14.166  0.427   6.793   1.00 54.42 ? 503  TYR A CD2 1 
ATOM   3874 C CE1 . TYR A 1 503 ? 16.337  -1.085  5.966   1.00 54.15 ? 503  TYR A CE1 1 
ATOM   3875 C CE2 . TYR A 1 503 ? 14.711  0.629   5.533   1.00 55.21 ? 503  TYR A CE2 1 
ATOM   3876 C CZ  . TYR A 1 503 ? 15.800  -0.132  5.128   1.00 55.17 ? 503  TYR A CZ  1 
ATOM   3877 O OH  . TYR A 1 503 ? 16.336  0.048   3.877   1.00 55.91 ? 503  TYR A OH  1 
ATOM   3878 N N   . THR A 1 504 ? 12.961  -3.470  7.403   1.00 57.10 ? 504  THR A N   1 
ATOM   3879 C CA  . THR A 1 504 ? 13.356  -4.723  6.779   1.00 58.27 ? 504  THR A CA  1 
ATOM   3880 C C   . THR A 1 504 ? 13.798  -4.443  5.343   1.00 58.58 ? 504  THR A C   1 
ATOM   3881 O O   . THR A 1 504 ? 13.322  -3.514  4.713   1.00 57.90 ? 504  THR A O   1 
ATOM   3882 C CB  . THR A 1 504 ? 12.164  -5.726  6.713   1.00 59.68 ? 504  THR A CB  1 
ATOM   3883 O OG1 . THR A 1 504 ? 11.062  -5.104  6.037   1.00 59.24 ? 504  THR A OG1 1 
ATOM   3884 C CG2 . THR A 1 504 ? 11.714  -6.166  8.118   1.00 58.90 ? 504  THR A CG2 1 
ATOM   3885 N N   . THR A 1 505 ? 14.686  -5.275  4.821   1.00 59.74 ? 505  THR A N   1 
ATOM   3886 C CA  . THR A 1 505 ? 15.110  -5.156  3.431   1.00 60.22 ? 505  THR A CA  1 
ATOM   3887 C C   . THR A 1 505 ? 13.933  -5.390  2.486   1.00 61.22 ? 505  THR A C   1 
ATOM   3888 O O   . THR A 1 505 ? 13.846  -4.762  1.439   1.00 61.07 ? 505  THR A O   1 
ATOM   3889 C CB  . THR A 1 505 ? 16.223  -6.164  3.085   1.00 60.94 ? 505  THR A CB  1 
ATOM   3890 O OG1 . THR A 1 505 ? 15.706  -7.493  3.165   1.00 61.49 ? 505  THR A OG1 1 
ATOM   3891 C CG2 . THR A 1 505 ? 17.424  -5.999  4.041   1.00 60.39 ? 505  THR A CG2 1 
ATOM   3892 N N   . ALA A 1 506 ? 13.022  -6.273  2.884   1.00 62.19 ? 506  ALA A N   1 
ATOM   3893 C CA  . ALA A 1 506 ? 11.855  -6.605  2.076   1.00 63.47 ? 506  ALA A CA  1 
ATOM   3894 C C   . ALA A 1 506 ? 10.915  -5.423  1.920   1.00 62.91 ? 506  ALA A C   1 
ATOM   3895 O O   . ALA A 1 506 ? 10.504  -5.108  0.808   1.00 64.00 ? 506  ALA A O   1 
ATOM   3896 C CB  . ALA A 1 506 ? 11.094  -7.777  2.689   1.00 64.65 ? 506  ALA A CB  1 
ATOM   3897 N N   . ALA A 1 507 ? 10.565  -4.793  3.039   1.00 61.51 ? 507  ALA A N   1 
ATOM   3898 C CA  . ALA A 1 507 ? 9.519   -3.769  3.073   1.00 60.45 ? 507  ALA A CA  1 
ATOM   3899 C C   . ALA A 1 507 ? 10.059  -2.347  3.252   1.00 58.68 ? 507  ALA A C   1 
ATOM   3900 O O   . ALA A 1 507 ? 9.372   -1.395  2.904   1.00 58.85 ? 507  ALA A O   1 
ATOM   3901 C CB  . ALA A 1 507 ? 8.520   -4.093  4.181   1.00 60.96 ? 507  ALA A CB  1 
ATOM   3902 N N   . GLN A 1 508 ? 11.260  -2.205  3.816   1.00 57.05 ? 508  GLN A N   1 
ATOM   3903 C CA  . GLN A 1 508 ? 11.946  -0.902  3.943   1.00 55.70 ? 508  GLN A CA  1 
ATOM   3904 C C   . GLN A 1 508 ? 11.155  0.183   4.698   1.00 54.33 ? 508  GLN A C   1 
ATOM   3905 O O   . GLN A 1 508 ? 11.205  1.363   4.340   1.00 53.08 ? 508  GLN A O   1 
ATOM   3906 C CB  . GLN A 1 508 ? 12.374  -0.388  2.557   1.00 55.39 ? 508  GLN A CB  1 
ATOM   3907 C CG  . GLN A 1 508 ? 13.313  -1.348  1.817   1.00 56.73 ? 508  GLN A CG  1 
ATOM   3908 C CD  . GLN A 1 508 ? 13.738  -0.852  0.441   1.00 56.58 ? 508  GLN A CD  1 
ATOM   3909 O OE1 . GLN A 1 508 ? 14.442  0.148   0.323   1.00 58.67 ? 508  GLN A OE1 1 
ATOM   3910 N NE2 . GLN A 1 508 ? 13.335  -1.570  -0.606  1.00 58.47 ? 508  GLN A NE2 1 
ATOM   3911 N N   . GLN A 1 509 ? 10.463  -0.215  5.764   1.00 53.87 ? 509  GLN A N   1 
ATOM   3912 C CA  . GLN A 1 509 ? 9.601   0.706   6.517   1.00 53.20 ? 509  GLN A CA  1 
ATOM   3913 C C   . GLN A 1 509 ? 10.341  1.570   7.560   1.00 51.66 ? 509  GLN A C   1 
ATOM   3914 O O   . GLN A 1 509 ? 11.190  1.073   8.316   1.00 50.82 ? 509  GLN A O   1 
ATOM   3915 C CB  . GLN A 1 509 ? 8.489   -0.068  7.223   1.00 54.21 ? 509  GLN A CB  1 
ATOM   3916 C CG  . GLN A 1 509 ? 7.502   -0.726  6.293   1.00 55.42 ? 509  GLN A CG  1 
ATOM   3917 C CD  . GLN A 1 509 ? 6.539   -1.617  7.039   1.00 56.44 ? 509  GLN A CD  1 
ATOM   3918 O OE1 . GLN A 1 509 ? 6.942   -2.616  7.642   1.00 57.23 ? 509  GLN A OE1 1 
ATOM   3919 N NE2 . GLN A 1 509 ? 5.268   -1.259  7.016   1.00 55.70 ? 509  GLN A NE2 1 
ATOM   3920 N N   . TYR A 1 510 ? 9.989   2.857   7.578   1.00 51.02 ? 510  TYR A N   1 
ATOM   3921 C CA  . TYR A 1 510 ? 10.477  3.842   8.550   1.00 50.22 ? 510  TYR A CA  1 
ATOM   3922 C C   . TYR A 1 510 ? 9.338   4.799   8.874   1.00 50.59 ? 510  TYR A C   1 
ATOM   3923 O O   . TYR A 1 510 ? 8.322   4.793   8.189   1.00 51.60 ? 510  TYR A O   1 
ATOM   3924 C CB  . TYR A 1 510 ? 11.686  4.619   8.005   1.00 49.31 ? 510  TYR A CB  1 
ATOM   3925 C CG  . TYR A 1 510 ? 11.405  5.480   6.785   1.00 48.95 ? 510  TYR A CG  1 
ATOM   3926 C CD1 . TYR A 1 510 ? 11.221  4.909   5.516   1.00 49.09 ? 510  TYR A CD1 1 
ATOM   3927 C CD2 . TYR A 1 510 ? 11.330  6.865   6.895   1.00 48.84 ? 510  TYR A CD2 1 
ATOM   3928 C CE1 . TYR A 1 510 ? 10.962  5.706   4.394   1.00 48.74 ? 510  TYR A CE1 1 
ATOM   3929 C CE2 . TYR A 1 510 ? 11.086  7.669   5.780   1.00 48.62 ? 510  TYR A CE2 1 
ATOM   3930 C CZ  . TYR A 1 510 ? 10.907  7.090   4.538   1.00 48.91 ? 510  TYR A CZ  1 
ATOM   3931 O OH  . TYR A 1 510 ? 10.659  7.907   3.452   1.00 49.47 ? 510  TYR A OH  1 
ATOM   3932 N N   . VAL A 1 511 ? 9.497   5.612   9.920   1.00 50.48 ? 511  VAL A N   1 
ATOM   3933 C CA  . VAL A 1 511 ? 8.424   6.533   10.347  1.00 50.67 ? 511  VAL A CA  1 
ATOM   3934 C C   . VAL A 1 511 ? 8.832   8.007   10.276  1.00 49.89 ? 511  VAL A C   1 
ATOM   3935 O O   . VAL A 1 511 ? 10.001  8.330   10.383  1.00 49.10 ? 511  VAL A O   1 
ATOM   3936 C CB  . VAL A 1 511 ? 7.936   6.216   11.771  1.00 50.91 ? 511  VAL A CB  1 
ATOM   3937 C CG1 . VAL A 1 511 ? 7.327   4.812   11.819  1.00 52.02 ? 511  VAL A CG1 1 
ATOM   3938 C CG2 . VAL A 1 511 ? 9.074   6.359   12.779  1.00 49.55 ? 511  VAL A CG2 1 
ATOM   3939 N N   . SER A 1 512 ? 7.852   8.880   10.063  1.00 50.49 ? 512  SER A N   1 
ATOM   3940 C CA  . SER A 1 512 ? 8.035   10.331  10.187  1.00 49.77 ? 512  SER A CA  1 
ATOM   3941 C C   . SER A 1 512 ? 7.878   10.758  11.643  1.00 49.38 ? 512  SER A C   1 
ATOM   3942 O O   . SER A 1 512 ? 6.862   10.462  12.291  1.00 49.32 ? 512  SER A O   1 
ATOM   3943 C CB  . SER A 1 512 ? 7.030   11.099  9.306   1.00 50.49 ? 512  SER A CB  1 
ATOM   3944 O OG  . SER A 1 512 ? 5.689   10.667  9.519   1.00 51.39 ? 512  SER A OG  1 
ATOM   3945 N N   . LEU A 1 513 ? 8.910   11.431  12.153  1.00 48.52 ? 513  LEU A N   1 
ATOM   3946 C CA  . LEU A 1 513 ? 8.862   12.080  13.462  1.00 48.11 ? 513  LEU A CA  1 
ATOM   3947 C C   . LEU A 1 513 ? 8.601   13.573  13.240  1.00 48.43 ? 513  LEU A C   1 
ATOM   3948 O O   . LEU A 1 513 ? 9.473   14.302  12.760  1.00 47.61 ? 513  LEU A O   1 
ATOM   3949 C CB  . LEU A 1 513 ? 10.172  11.852  14.238  1.00 47.22 ? 513  LEU A CB  1 
ATOM   3950 C CG  . LEU A 1 513 ? 10.526  10.394  14.576  1.00 46.30 ? 513  LEU A CG  1 
ATOM   3951 C CD1 . LEU A 1 513 ? 11.858  10.272  15.355  1.00 42.16 ? 513  LEU A CD1 1 
ATOM   3952 C CD2 . LEU A 1 513 ? 9.384   9.727   15.349  1.00 45.91 ? 513  LEU A CD2 1 
ATOM   3953 N N   . ASN A 1 514 ? 7.376   13.999  13.545  1.00 49.53 ? 514  ASN A N   1 
ATOM   3954 C CA  . ASN A 1 514 ? 6.972   15.400  13.469  1.00 50.27 ? 514  ASN A CA  1 
ATOM   3955 C C   . ASN A 1 514 ? 5.805   15.638  14.428  1.00 51.36 ? 514  ASN A C   1 
ATOM   3956 O O   . ASN A 1 514 ? 5.534   14.789  15.270  1.00 52.29 ? 514  ASN A O   1 
ATOM   3957 C CB  . ASN A 1 514 ? 6.665   15.808  12.012  1.00 50.36 ? 514  ASN A CB  1 
ATOM   3958 C CG  . ASN A 1 514 ? 5.622   14.918  11.338  1.00 51.01 ? 514  ASN A CG  1 
ATOM   3959 O OD1 . ASN A 1 514 ? 4.611   14.538  11.945  1.00 52.55 ? 514  ASN A OD1 1 
ATOM   3960 N ND2 . ASN A 1 514 ? 5.858   14.596  10.065  1.00 47.88 ? 514  ASN A ND2 1 
ATOM   3961 N N   . LEU A 1 515 ? 5.114   16.770  14.339  1.00 52.62 ? 515  LEU A N   1 
ATOM   3962 C CA  . LEU A 1 515 ? 4.038   17.064  15.310  1.00 53.77 ? 515  LEU A CA  1 
ATOM   3963 C C   . LEU A 1 515 ? 2.789   16.207  15.125  1.00 55.61 ? 515  LEU A C   1 
ATOM   3964 O O   . LEU A 1 515 ? 1.938   16.165  16.000  1.00 56.38 ? 515  LEU A O   1 
ATOM   3965 C CB  . LEU A 1 515 ? 3.629   18.536  15.253  1.00 54.34 ? 515  LEU A CB  1 
ATOM   3966 C CG  . LEU A 1 515 ? 4.728   19.560  15.511  1.00 53.35 ? 515  LEU A CG  1 
ATOM   3967 C CD1 . LEU A 1 515 ? 4.169   20.965  15.381  1.00 53.94 ? 515  LEU A CD1 1 
ATOM   3968 C CD2 . LEU A 1 515 ? 5.340   19.335  16.878  1.00 51.84 ? 515  LEU A CD2 1 
ATOM   3969 N N   . LYS A 1 516 ? 2.668   15.553  13.977  1.00 56.66 ? 516  LYS A N   1 
ATOM   3970 C CA  . LYS A 1 516 ? 1.555   14.651  13.721  1.00 58.50 ? 516  LYS A CA  1 
ATOM   3971 C C   . LYS A 1 516 ? 1.890   13.249  14.220  1.00 58.27 ? 516  LYS A C   1 
ATOM   3972 O O   . LYS A 1 516 ? 3.062   12.910  14.379  1.00 57.13 ? 516  LYS A O   1 
ATOM   3973 C CB  . LYS A 1 516 ? 1.247   14.610  12.226  1.00 58.97 ? 516  LYS A CB  1 
ATOM   3974 C CG  . LYS A 1 516 ? 0.910   15.981  11.626  1.00 60.65 ? 516  LYS A CG  1 
ATOM   3975 C CD  . LYS A 1 516 ? 0.514   15.871  10.147  1.00 61.38 ? 516  LYS A CD  1 
ATOM   3976 C CE  . LYS A 1 516 ? 1.745   15.783  9.232   1.00 62.80 ? 516  LYS A CE  1 
ATOM   3977 N NZ  . LYS A 1 516 ? 1.335   15.498  7.813   1.00 64.53 ? 516  LYS A NZ  1 
ATOM   3978 N N   . PRO A 1 517 ? 0.856   12.422  14.467  1.00 59.48 ? 517  PRO A N   1 
ATOM   3979 C CA  . PRO A 1 517 ? 1.088   11.040  14.883  1.00 59.36 ? 517  PRO A CA  1 
ATOM   3980 C C   . PRO A 1 517 ? 1.924   10.285  13.859  1.00 58.80 ? 517  PRO A C   1 
ATOM   3981 O O   . PRO A 1 517 ? 1.837   10.588  12.670  1.00 58.83 ? 517  PRO A O   1 
ATOM   3982 C CB  . PRO A 1 517 ? -0.324  10.458  14.959  1.00 61.03 ? 517  PRO A CB  1 
ATOM   3983 C CG  . PRO A 1 517 ? -1.229  11.636  15.101  1.00 61.36 ? 517  PRO A CG  1 
ATOM   3984 C CD  . PRO A 1 517 ? -0.584  12.739  14.369  1.00 60.51 ? 517  PRO A CD  1 
ATOM   3985 N N   . LEU A 1 518 ? 2.724   9.320   14.314  1.00 58.41 ? 518  LEU A N   1 
ATOM   3986 C CA  . LEU A 1 518 ? 3.608   8.548   13.427  1.00 58.10 ? 518  LEU A CA  1 
ATOM   3987 C C   . LEU A 1 518 ? 2.933   8.149   12.124  1.00 58.79 ? 518  LEU A C   1 
ATOM   3988 O O   . LEU A 1 518 ? 1.836   7.598   12.139  1.00 59.96 ? 518  LEU A O   1 
ATOM   3989 C CB  . LEU A 1 518 ? 4.057   7.241   14.088  1.00 58.05 ? 518  LEU A CB  1 
ATOM   3990 C CG  . LEU A 1 518 ? 5.080   7.247   15.204  1.00 57.58 ? 518  LEU A CG  1 
ATOM   3991 C CD1 . LEU A 1 518 ? 5.535   5.815   15.478  1.00 57.08 ? 518  LEU A CD1 1 
ATOM   3992 C CD2 . LEU A 1 518 ? 6.262   8.133   14.886  1.00 56.14 ? 518  LEU A CD2 1 
ATOM   3993 N N   . GLU A 1 519 ? 3.604   8.411   11.012  1.00 58.12 ? 519  GLU A N   1 
ATOM   3994 C CA  . GLU A 1 519 ? 3.194   7.890   9.719   1.00 59.21 ? 519  GLU A CA  1 
ATOM   3995 C C   . GLU A 1 519 ? 4.286   6.970   9.207   1.00 57.72 ? 519  GLU A C   1 
ATOM   3996 O O   . GLU A 1 519 ? 5.467   7.306   9.290   1.00 56.75 ? 519  GLU A O   1 
ATOM   3997 C CB  . GLU A 1 519 ? 2.930   9.036   8.737   1.00 59.24 ? 519  GLU A CB  1 
ATOM   3998 C CG  . GLU A 1 519 ? 3.170   8.717   7.251   1.00 60.78 ? 519  GLU A CG  1 
ATOM   3999 C CD  . GLU A 1 519 ? 2.929   9.930   6.348   1.00 61.67 ? 519  GLU A CD  1 
ATOM   4000 O OE1 . GLU A 1 519 ? 1.853   10.566  6.490   1.00 66.21 ? 519  GLU A OE1 1 
ATOM   4001 O OE2 . GLU A 1 519 ? 3.806   10.246  5.502   1.00 62.59 ? 519  GLU A OE2 1 
ATOM   4002 N N   . VAL A 1 520 ? 3.880   5.813   8.689   1.00 57.70 ? 520  VAL A N   1 
ATOM   4003 C CA  . VAL A 1 520 ? 4.801   4.823   8.146   1.00 56.81 ? 520  VAL A CA  1 
ATOM   4004 C C   . VAL A 1 520 ? 5.038   5.068   6.650   1.00 57.02 ? 520  VAL A C   1 
ATOM   4005 O O   . VAL A 1 520 ? 4.090   5.208   5.866   1.00 57.50 ? 520  VAL A O   1 
ATOM   4006 C CB  . VAL A 1 520 ? 4.269   3.391   8.354   1.00 57.77 ? 520  VAL A CB  1 
ATOM   4007 C CG1 . VAL A 1 520 ? 5.232   2.367   7.762   1.00 56.74 ? 520  VAL A CG1 1 
ATOM   4008 C CG2 . VAL A 1 520 ? 4.002   3.121   9.857   1.00 56.02 ? 520  VAL A CG2 1 
ATOM   4009 N N   . ARG A 1 521 ? 6.312   5.117   6.271   1.00 56.15 ? 521  ARG A N   1 
ATOM   4010 C CA  . ARG A 1 521 ? 6.717   5.299   4.881   1.00 56.44 ? 521  ARG A CA  1 
ATOM   4011 C C   . ARG A 1 521 ? 7.608   4.150   4.452   1.00 56.50 ? 521  ARG A C   1 
ATOM   4012 O O   . ARG A 1 521 ? 8.123   3.408   5.289   1.00 55.79 ? 521  ARG A O   1 
ATOM   4013 C CB  . ARG A 1 521 ? 7.456   6.628   4.726   1.00 55.32 ? 521  ARG A CB  1 
ATOM   4014 C CG  . ARG A 1 521 ? 6.532   7.812   4.906   1.00 56.23 ? 521  ARG A CG  1 
ATOM   4015 C CD  . ARG A 1 521 ? 7.261   9.136   4.874   1.00 55.41 ? 521  ARG A CD  1 
ATOM   4016 N NE  . ARG A 1 521 ? 6.480   10.202  5.506   1.00 56.45 ? 521  ARG A NE  1 
ATOM   4017 C CZ  . ARG A 1 521 ? 6.927   11.443  5.693   1.00 55.27 ? 521  ARG A CZ  1 
ATOM   4018 N NH1 . ARG A 1 521 ? 8.155   11.768  5.332   1.00 53.90 ? 521  ARG A NH1 1 
ATOM   4019 N NH2 . ARG A 1 521 ? 6.154   12.352  6.282   1.00 54.83 ? 521  ARG A NH2 1 
ATOM   4020 N N   . ARG A 1 522 ? 7.798   4.019   3.147   1.00 57.32 ? 522  ARG A N   1 
ATOM   4021 C CA  . ARG A 1 522 ? 8.567   2.910   2.585   1.00 58.56 ? 522  ARG A CA  1 
ATOM   4022 C C   . ARG A 1 522 ? 9.714   3.388   1.713   1.00 57.67 ? 522  ARG A C   1 
ATOM   4023 O O   . ARG A 1 522 ? 9.538   4.262   0.877   1.00 57.93 ? 522  ARG A O   1 
ATOM   4024 C CB  . ARG A 1 522 ? 7.636   1.975   1.808   1.00 60.37 ? 522  ARG A CB  1 
ATOM   4025 C CG  . ARG A 1 522 ? 6.917   1.022   2.739   1.00 64.18 ? 522  ARG A CG  1 
ATOM   4026 C CD  . ARG A 1 522 ? 5.547   0.610   2.273   1.00 70.62 ? 522  ARG A CD  1 
ATOM   4027 N NE  . ARG A 1 522 ? 4.758   0.181   3.436   1.00 75.02 ? 522  ARG A NE  1 
ATOM   4028 C CZ  . ARG A 1 522 ? 4.110   1.001   4.278   1.00 75.84 ? 522  ARG A CZ  1 
ATOM   4029 N NH1 . ARG A 1 522 ? 4.119   2.329   4.097   1.00 75.43 ? 522  ARG A NH1 1 
ATOM   4030 N NH2 . ARG A 1 522 ? 3.439   0.489   5.311   1.00 75.26 ? 522  ARG A NH2 1 
ATOM   4031 N N   . GLY A 1 523 ? 10.892  2.820   1.941   1.00 57.32 ? 523  GLY A N   1 
ATOM   4032 C CA  . GLY A 1 523 ? 12.080  3.125   1.159   1.00 57.30 ? 523  GLY A CA  1 
ATOM   4033 C C   . GLY A 1 523 ? 12.736  4.453   1.499   1.00 56.48 ? 523  GLY A C   1 
ATOM   4034 O O   . GLY A 1 523 ? 12.159  5.512   1.261   1.00 56.41 ? 523  GLY A O   1 
ATOM   4035 N N   . LEU A 1 524 ? 13.945  4.399   2.055   1.00 56.06 ? 524  LEU A N   1 
ATOM   4036 C CA  . LEU A 1 524 ? 14.712  5.611   2.324   1.00 55.92 ? 524  LEU A CA  1 
ATOM   4037 C C   . LEU A 1 524 ? 15.436  6.079   1.082   1.00 55.12 ? 524  LEU A C   1 
ATOM   4038 O O   . LEU A 1 524 ? 16.544  5.620   0.799   1.00 55.22 ? 524  LEU A O   1 
ATOM   4039 C CB  . LEU A 1 524 ? 15.725  5.396   3.458   1.00 56.13 ? 524  LEU A CB  1 
ATOM   4040 C CG  . LEU A 1 524 ? 15.263  5.983   4.791   1.00 58.66 ? 524  LEU A CG  1 
ATOM   4041 C CD1 . LEU A 1 524 ? 16.087  5.397   5.936   1.00 60.51 ? 524  LEU A CD1 1 
ATOM   4042 C CD2 . LEU A 1 524 ? 15.328  7.549   4.734   1.00 59.57 ? 524  LEU A CD2 1 
ATOM   4043 N N   . ARG A 1 525 ? 14.818  7.008   0.359   1.00 54.67 ? 525  ARG A N   1 
ATOM   4044 C CA  . ARG A 1 525 ? 15.380  7.520   -0.888  1.00 54.87 ? 525  ARG A CA  1 
ATOM   4045 C C   . ARG A 1 525 ? 15.872  6.338   -1.698  1.00 53.66 ? 525  ARG A C   1 
ATOM   4046 O O   . ARG A 1 525 ? 17.012  6.331   -2.146  1.00 52.98 ? 525  ARG A O   1 
ATOM   4047 C CB  . ARG A 1 525 ? 16.547  8.486   -0.631  1.00 54.69 ? 525  ARG A CB  1 
ATOM   4048 C CG  . ARG A 1 525 ? 16.210  9.644   0.279   1.00 58.00 ? 525  ARG A CG  1 
ATOM   4049 C CD  . ARG A 1 525 ? 15.638  10.814  -0.461  1.00 61.52 ? 525  ARG A CD  1 
ATOM   4050 N NE  . ARG A 1 525 ? 16.507  11.985  -0.397  1.00 63.47 ? 525  ARG A NE  1 
ATOM   4051 C CZ  . ARG A 1 525 ? 16.477  12.916  0.557   1.00 63.92 ? 525  ARG A CZ  1 
ATOM   4052 N NH1 . ARG A 1 525 ? 15.641  12.825  1.580   1.00 66.22 ? 525  ARG A NH1 1 
ATOM   4053 N NH2 . ARG A 1 525 ? 17.302  13.953  0.492   1.00 64.36 ? 525  ARG A NH2 1 
ATOM   4054 N N   . ALA A 1 526 ? 15.002  5.339   -1.852  1.00 53.29 ? 526  ALA A N   1 
ATOM   4055 C CA  . ALA A 1 526 ? 15.343  4.077   -2.496  1.00 52.87 ? 526  ALA A CA  1 
ATOM   4056 C C   . ALA A 1 526 ? 16.053  4.267   -3.835  1.00 52.24 ? 526  ALA A C   1 
ATOM   4057 O O   . ALA A 1 526 ? 17.146  3.766   -3.982  1.00 51.89 ? 526  ALA A O   1 
ATOM   4058 C CB  . ALA A 1 526 ? 14.093  3.192   -2.655  1.00 53.94 ? 526  ALA A CB  1 
ATOM   4059 N N   . GLN A 1 527 ? 15.464  5.004   -4.781  1.00 52.12 ? 527  GLN A N   1 
ATOM   4060 C CA  . GLN A 1 527 ? 16.061  5.150   -6.129  1.00 52.86 ? 527  GLN A CA  1 
ATOM   4061 C C   . GLN A 1 527 ? 17.398  5.850   -6.088  1.00 51.79 ? 527  GLN A C   1 
ATOM   4062 O O   . GLN A 1 527 ? 18.373  5.351   -6.646  1.00 52.53 ? 527  GLN A O   1 
ATOM   4063 C CB  . GLN A 1 527 ? 15.166  5.928   -7.121  1.00 53.15 ? 527  GLN A CB  1 
ATOM   4064 C CG  . GLN A 1 527 ? 14.024  5.154   -7.752  1.00 55.60 ? 527  GLN A CG  1 
ATOM   4065 C CD  . GLN A 1 527 ? 14.399  3.752   -8.204  1.00 56.73 ? 527  GLN A CD  1 
ATOM   4066 O OE1 . GLN A 1 527 ? 14.013  2.777   -7.563  1.00 59.19 ? 527  GLN A OE1 1 
ATOM   4067 N NE2 . GLN A 1 527 ? 15.160  3.647   -9.292  1.00 55.03 ? 527  GLN A NE2 1 
ATOM   4068 N N   . THR A 1 528 ? 17.428  7.011   -5.446  1.00 50.53 ? 528  THR A N   1 
ATOM   4069 C CA  . THR A 1 528 ? 18.649  7.805   -5.333  1.00 49.76 ? 528  THR A CA  1 
ATOM   4070 C C   . THR A 1 528 ? 19.747  7.066   -4.575  1.00 49.38 ? 528  THR A C   1 
ATOM   4071 O O   . THR A 1 528 ? 20.913  7.143   -4.949  1.00 49.29 ? 528  THR A O   1 
ATOM   4072 C CB  . THR A 1 528 ? 18.378  9.175   -4.662  1.00 49.02 ? 528  THR A CB  1 
ATOM   4073 O OG1 . THR A 1 528 ? 17.613  9.988   -5.559  1.00 49.50 ? 528  THR A OG1 1 
ATOM   4074 C CG2 . THR A 1 528 ? 19.695  9.904   -4.305  1.00 48.38 ? 528  THR A CG2 1 
ATOM   4075 N N   . CYS A 1 529 ? 19.408  6.334   -3.521  1.00 49.24 ? 529  CYS A N   1 
ATOM   4076 C CA  . CYS A 1 529 ? 20.483  5.678   -2.783  1.00 49.21 ? 529  CYS A CA  1 
ATOM   4077 C C   . CYS A 1 529 ? 21.048  4.487   -3.545  1.00 49.59 ? 529  CYS A C   1 
ATOM   4078 O O   . CYS A 1 529 ? 22.183  4.094   -3.291  1.00 49.67 ? 529  CYS A O   1 
ATOM   4079 C CB  . CYS A 1 529 ? 20.096  5.356   -1.338  1.00 49.08 ? 529  CYS A CB  1 
ATOM   4080 S SG  . CYS A 1 529 ? 19.970  6.882   -0.309  1.00 49.57 ? 529  CYS A SG  1 
ATOM   4081 N N   . ALA A 1 530 ? 20.297  3.960   -4.516  1.00 49.95 ? 530  ALA A N   1 
ATOM   4082 C CA  . ALA A 1 530 ? 20.845  2.965   -5.442  1.00 50.60 ? 530  ALA A CA  1 
ATOM   4083 C C   . ALA A 1 530 ? 21.912  3.587   -6.333  1.00 50.28 ? 530  ALA A C   1 
ATOM   4084 O O   . ALA A 1 530 ? 22.894  2.935   -6.676  1.00 50.92 ? 530  ALA A O   1 
ATOM   4085 C CB  . ALA A 1 530 ? 19.737  2.319   -6.304  1.00 51.50 ? 530  ALA A CB  1 
ATOM   4086 N N   . PHE A 1 531 ? 21.722  4.844   -6.717  1.00 49.66 ? 531  PHE A N   1 
ATOM   4087 C CA  . PHE A 1 531 ? 22.757  5.558   -7.461  1.00 49.47 ? 531  PHE A CA  1 
ATOM   4088 C C   . PHE A 1 531 ? 24.060  5.644   -6.638  1.00 48.55 ? 531  PHE A C   1 
ATOM   4089 O O   . PHE A 1 531 ? 25.124  5.249   -7.104  1.00 48.09 ? 531  PHE A O   1 
ATOM   4090 C CB  . PHE A 1 531 ? 22.248  6.937   -7.871  1.00 49.03 ? 531  PHE A CB  1 
ATOM   4091 C CG  . PHE A 1 531 ? 23.325  7.883   -8.320  1.00 48.61 ? 531  PHE A CG  1 
ATOM   4092 C CD1 . PHE A 1 531 ? 23.840  7.807   -9.609  1.00 49.32 ? 531  PHE A CD1 1 
ATOM   4093 C CD2 . PHE A 1 531 ? 23.799  8.872   -7.459  1.00 48.72 ? 531  PHE A CD2 1 
ATOM   4094 C CE1 . PHE A 1 531 ? 24.809  8.680   -10.037 1.00 49.21 ? 531  PHE A CE1 1 
ATOM   4095 C CE2 . PHE A 1 531 ? 24.781  9.760   -7.870  1.00 48.48 ? 531  PHE A CE2 1 
ATOM   4096 C CZ  . PHE A 1 531 ? 25.298  9.662   -9.162  1.00 49.41 ? 531  PHE A CZ  1 
ATOM   4097 N N   . TRP A 1 532 ? 23.953  6.141   -5.411  1.00 48.12 ? 532  TRP A N   1 
ATOM   4098 C CA  . TRP A 1 532 ? 25.120  6.301   -4.526  1.00 47.86 ? 532  TRP A CA  1 
ATOM   4099 C C   . TRP A 1 532 ? 25.726  4.984   -4.079  1.00 49.03 ? 532  TRP A C   1 
ATOM   4100 O O   . TRP A 1 532 ? 26.942  4.824   -4.092  1.00 49.02 ? 532  TRP A O   1 
ATOM   4101 C CB  . TRP A 1 532 ? 24.743  7.100   -3.285  1.00 46.50 ? 532  TRP A CB  1 
ATOM   4102 C CG  . TRP A 1 532 ? 24.474  8.527   -3.576  1.00 45.47 ? 532  TRP A CG  1 
ATOM   4103 C CD1 . TRP A 1 532 ? 23.262  9.137   -3.636  1.00 44.54 ? 532  TRP A CD1 1 
ATOM   4104 C CD2 . TRP A 1 532 ? 25.449  9.535   -3.874  1.00 45.08 ? 532  TRP A CD2 1 
ATOM   4105 N NE1 . TRP A 1 532 ? 23.416  10.468  -3.923  1.00 44.61 ? 532  TRP A NE1 1 
ATOM   4106 C CE2 . TRP A 1 532 ? 24.752  10.739  -4.080  1.00 44.20 ? 532  TRP A CE2 1 
ATOM   4107 C CE3 . TRP A 1 532 ? 26.845  9.536   -3.977  1.00 45.16 ? 532  TRP A CE3 1 
ATOM   4108 C CZ2 . TRP A 1 532 ? 25.400  11.935  -4.391  1.00 44.09 ? 532  TRP A CZ2 1 
ATOM   4109 C CZ3 . TRP A 1 532 ? 27.489  10.732  -4.284  1.00 44.59 ? 532  TRP A CZ3 1 
ATOM   4110 C CH2 . TRP A 1 532 ? 26.760  11.913  -4.485  1.00 43.99 ? 532  TRP A CH2 1 
ATOM   4111 N N   . ASN A 1 533 ? 24.872  4.038   -3.702  1.00 50.41 ? 533  ASN A N   1 
ATOM   4112 C CA  . ASN A 1 533 ? 25.330  2.830   -3.015  1.00 51.75 ? 533  ASN A CA  1 
ATOM   4113 C C   . ASN A 1 533 ? 25.645  1.658   -3.923  1.00 53.44 ? 533  ASN A C   1 
ATOM   4114 O O   . ASN A 1 533 ? 26.359  0.760   -3.511  1.00 54.31 ? 533  ASN A O   1 
ATOM   4115 C CB  . ASN A 1 533 ? 24.297  2.370   -1.975  1.00 51.75 ? 533  ASN A CB  1 
ATOM   4116 C CG  . ASN A 1 533 ? 24.132  3.349   -0.841  1.00 50.73 ? 533  ASN A CG  1 
ATOM   4117 O OD1 . ASN A 1 533 ? 24.987  4.193   -0.624  1.00 53.46 ? 533  ASN A OD1 1 
ATOM   4118 N ND2 . ASN A 1 533 ? 23.027  3.244   -0.109  1.00 50.70 ? 533  ASN A ND2 1 
ATOM   4119 N N   . ARG A 1 534 ? 25.078  1.640   -5.125  1.00 54.69 ? 534  ARG A N   1 
ATOM   4120 C CA  . ARG A 1 534 ? 25.291  0.532   -6.058  1.00 56.29 ? 534  ARG A CA  1 
ATOM   4121 C C   . ARG A 1 534 ? 25.988  0.986   -7.330  1.00 56.75 ? 534  ARG A C   1 
ATOM   4122 O O   . ARG A 1 534 ? 26.935  0.337   -7.767  1.00 57.35 ? 534  ARG A O   1 
ATOM   4123 C CB  . ARG A 1 534 ? 23.977  -0.150  -6.426  1.00 56.93 ? 534  ARG A CB  1 
ATOM   4124 C CG  . ARG A 1 534 ? 23.185  -0.689  -5.247  1.00 57.58 ? 534  ARG A CG  1 
ATOM   4125 C CD  . ARG A 1 534 ? 21.790  -1.128  -5.673  1.00 58.38 ? 534  ARG A CD  1 
ATOM   4126 N NE  . ARG A 1 534 ? 20.983  -1.528  -4.524  1.00 59.94 ? 534  ARG A NE  1 
ATOM   4127 C CZ  . ARG A 1 534 ? 20.905  -2.768  -4.031  1.00 61.05 ? 534  ARG A CZ  1 
ATOM   4128 N NH1 . ARG A 1 534 ? 21.549  -3.787  -4.598  1.00 61.52 ? 534  ARG A NH1 1 
ATOM   4129 N NH2 . ARG A 1 534 ? 20.145  -2.991  -2.963  1.00 60.98 ? 534  ARG A NH2 1 
ATOM   4130 N N   . PHE A 1 535 ? 25.541  2.087   -7.936  1.00 56.85 ? 535  PHE A N   1 
ATOM   4131 C CA  . PHE A 1 535 ? 26.112  2.466   -9.232  1.00 57.64 ? 535  PHE A CA  1 
ATOM   4132 C C   . PHE A 1 535 ? 27.491  3.111   -9.125  1.00 57.67 ? 535  PHE A C   1 
ATOM   4133 O O   . PHE A 1 535 ? 28.420  2.646   -9.763  1.00 57.93 ? 535  PHE A O   1 
ATOM   4134 C CB  . PHE A 1 535 ? 25.184  3.343   -10.089 1.00 57.25 ? 535  PHE A CB  1 
ATOM   4135 C CG  . PHE A 1 535 ? 25.848  3.822   -11.345 1.00 56.53 ? 535  PHE A CG  1 
ATOM   4136 C CD1 . PHE A 1 535 ? 26.136  2.932   -12.365 1.00 57.84 ? 535  PHE A CD1 1 
ATOM   4137 C CD2 . PHE A 1 535 ? 26.260  5.126   -11.471 1.00 54.84 ? 535  PHE A CD2 1 
ATOM   4138 C CE1 . PHE A 1 535 ? 26.783  3.349   -13.507 1.00 57.94 ? 535  PHE A CE1 1 
ATOM   4139 C CE2 . PHE A 1 535 ? 26.902  5.553   -12.611 1.00 55.92 ? 535  PHE A CE2 1 
ATOM   4140 C CZ  . PHE A 1 535 ? 27.164  4.672   -13.630 1.00 57.40 ? 535  PHE A CZ  1 
ATOM   4141 N N   . LEU A 1 536 ? 27.630  4.176   -8.347  1.00 58.25 ? 536  LEU A N   1 
ATOM   4142 C CA  . LEU A 1 536 ? 28.932  4.868   -8.262  1.00 59.55 ? 536  LEU A CA  1 
ATOM   4143 C C   . LEU A 1 536 ? 30.111  3.934   -7.894  1.00 61.42 ? 536  LEU A C   1 
ATOM   4144 O O   . LEU A 1 536 ? 31.165  3.998   -8.518  1.00 62.27 ? 536  LEU A O   1 
ATOM   4145 C CB  . LEU A 1 536 ? 28.882  6.068   -7.311  1.00 58.24 ? 536  LEU A CB  1 
ATOM   4146 C CG  . LEU A 1 536 ? 28.232  7.346   -7.848  1.00 58.63 ? 536  LEU A CG  1 
ATOM   4147 C CD1 . LEU A 1 536 ? 28.400  8.487   -6.848  1.00 55.34 ? 536  LEU A CD1 1 
ATOM   4148 C CD2 . LEU A 1 536 ? 28.770  7.760   -9.238  1.00 58.72 ? 536  LEU A CD2 1 
ATOM   4149 N N   . PRO A 1 537 ? 29.938  3.059   -6.892  1.00 63.20 ? 537  PRO A N   1 
ATOM   4150 C CA  . PRO A 1 537 ? 31.003  2.082   -6.646  1.00 65.17 ? 537  PRO A CA  1 
ATOM   4151 C C   . PRO A 1 537 ? 31.361  1.235   -7.879  1.00 67.63 ? 537  PRO A C   1 
ATOM   4152 O O   . PRO A 1 537 ? 32.537  0.941   -8.103  1.00 68.66 ? 537  PRO A O   1 
ATOM   4153 C CB  . PRO A 1 537 ? 30.424  1.195   -5.529  1.00 65.08 ? 537  PRO A CB  1 
ATOM   4154 C CG  . PRO A 1 537 ? 29.419  2.066   -4.848  1.00 63.80 ? 537  PRO A CG  1 
ATOM   4155 C CD  . PRO A 1 537 ? 28.827  2.916   -5.937  1.00 62.73 ? 537  PRO A CD  1 
ATOM   4156 N N   . LYS A 1 538 ? 30.365  0.841   -8.667  1.00 69.54 ? 538  LYS A N   1 
ATOM   4157 C CA  . LYS A 1 538 ? 30.628  0.053   -9.869  1.00 71.55 ? 538  LYS A CA  1 
ATOM   4158 C C   . LYS A 1 538 ? 31.367  0.878   -10.906 1.00 72.30 ? 538  LYS A C   1 
ATOM   4159 O O   . LYS A 1 538 ? 32.241  0.365   -11.595 1.00 73.55 ? 538  LYS A O   1 
ATOM   4160 C CB  . LYS A 1 538 ? 29.342  -0.528  -10.451 1.00 72.26 ? 538  LYS A CB  1 
ATOM   4161 C CG  . LYS A 1 538 ? 28.882  -1.783  -9.731  1.00 73.03 ? 538  LYS A CG  1 
ATOM   4162 C CD  . LYS A 1 538 ? 27.594  -2.317  -10.323 1.00 74.07 ? 538  LYS A CD  1 
ATOM   4163 C CE  . LYS A 1 538 ? 27.274  -3.711  -9.778  1.00 75.66 ? 538  LYS A CE  1 
ATOM   4164 N NZ  . LYS A 1 538 ? 26.044  -4.286  -10.407 1.00 77.46 ? 538  LYS A NZ  1 
ATOM   4165 N N   . LEU A 1 539 ? 31.020  2.154   -11.007 1.00 72.56 ? 539  LEU A N   1 
ATOM   4166 C CA  . LEU A 1 539 ? 31.749  3.083   -11.858 1.00 73.29 ? 539  LEU A CA  1 
ATOM   4167 C C   . LEU A 1 539 ? 33.208  3.122   -11.427 1.00 74.40 ? 539  LEU A C   1 
ATOM   4168 O O   . LEU A 1 539 ? 34.111  2.973   -12.246 1.00 75.05 ? 539  LEU A O   1 
ATOM   4169 C CB  . LEU A 1 539 ? 31.124  4.480   -11.765 1.00 72.53 ? 539  LEU A CB  1 
ATOM   4170 C CG  . LEU A 1 539 ? 31.629  5.591   -12.679 1.00 71.81 ? 539  LEU A CG  1 
ATOM   4171 C CD1 . LEU A 1 539 ? 31.679  5.106   -14.116 1.00 72.63 ? 539  LEU A CD1 1 
ATOM   4172 C CD2 . LEU A 1 539 ? 30.733  6.819   -12.546 1.00 71.07 ? 539  LEU A CD2 1 
ATOM   4173 N N   . LEU A 1 540 ? 33.413  3.298   -10.123 1.00 75.22 ? 540  LEU A N   1 
ATOM   4174 C CA  . LEU A 1 540 ? 34.744  3.336   -9.496  1.00 76.26 ? 540  LEU A CA  1 
ATOM   4175 C C   . LEU A 1 540 ? 35.593  2.081   -9.793  1.00 77.84 ? 540  LEU A C   1 
ATOM   4176 O O   . LEU A 1 540 ? 36.760  2.184   -10.191 1.00 78.24 ? 540  LEU A O   1 
ATOM   4177 C CB  . LEU A 1 540 ? 34.562  3.519   -7.975  1.00 75.20 ? 540  LEU A CB  1 
ATOM   4178 C CG  . LEU A 1 540 ? 35.761  3.844   -7.085  1.00 74.53 ? 540  LEU A CG  1 
ATOM   4179 C CD1 . LEU A 1 540 ? 36.429  5.153   -7.478  1.00 73.39 ? 540  LEU A CD1 1 
ATOM   4180 C CD2 . LEU A 1 540 ? 35.297  3.884   -5.635  1.00 74.13 ? 540  LEU A CD2 1 
ATOM   4181 N N   . SER A 1 541 ? 34.992  0.907   -9.606  1.00 79.26 ? 541  SER A N   1 
ATOM   4182 C CA  . SER A 1 541 ? 35.663  -0.382  -9.841  1.00 81.03 ? 541  SER A CA  1 
ATOM   4183 C C   . SER A 1 541 ? 36.123  -0.572  -11.288 1.00 83.23 ? 541  SER A C   1 
ATOM   4184 O O   . SER A 1 541 ? 37.202  -1.129  -11.537 1.00 84.42 ? 541  SER A O   1 
ATOM   4185 C CB  . SER A 1 541 ? 34.732  -1.540  -9.476  1.00 81.55 ? 541  SER A CB  1 
ATOM   4186 O OG  . SER A 1 541 ? 34.259  -1.414  -8.148  1.00 81.49 ? 541  SER A OG  1 
ATOM   4187 N N   . ALA A 1 542 ? 35.293  -0.131  -12.233 1.00 84.12 ? 542  ALA A N   1 
ATOM   4188 C CA  . ALA A 1 542 ? 35.608  -0.225  -13.656 1.00 85.75 ? 542  ALA A CA  1 
ATOM   4189 C C   . ALA A 1 542 ? 36.568  0.889   -14.092 1.00 86.00 ? 542  ALA A C   1 
ATOM   4190 O O   . ALA A 1 542 ? 37.487  0.636   -14.875 1.00 87.21 ? 542  ALA A O   1 
ATOM   4191 C CB  . ALA A 1 542 ? 34.321  -0.177  -14.486 1.00 85.78 ? 542  ALA A CB  1 
ATOM   4192 N N   . THR A 1 543 ? 36.353  2.110   -13.587 1.00 85.30 ? 543  THR A N   1 
ATOM   4193 C CA  . THR A 1 543 ? 37.132  3.287   -14.008 1.00 85.19 ? 543  THR A CA  1 
ATOM   4194 C C   . THR A 1 543 ? 38.441  3.403   -13.230 1.00 85.50 ? 543  THR A C   1 
ATOM   4195 O O   . THR A 1 543 ? 39.168  2.416   -13.061 1.00 86.50 ? 543  THR A O   1 
ATOM   4196 C CB  . THR A 1 543 ? 36.306  4.559   -13.853 1.00 84.20 ? 543  THR A CB  1 
ATOM   4197 N N   . GLU B 1 4   ? -17.076 5.088   -69.317 1.00 83.96 ? 4    GLU B N   1 
ATOM   4198 C CA  . GLU B 1 4   ? -15.883 5.907   -68.935 1.00 82.47 ? 4    GLU B CA  1 
ATOM   4199 C C   . GLU B 1 4   ? -16.296 7.149   -68.116 1.00 81.78 ? 4    GLU B C   1 
ATOM   4200 O O   . GLU B 1 4   ? -17.068 7.995   -68.584 1.00 82.91 ? 4    GLU B O   1 
ATOM   4201 C CB  . GLU B 1 4   ? -15.106 6.321   -70.193 1.00 82.73 ? 4    GLU B CB  1 
ATOM   4202 C CG  . GLU B 1 4   ? -13.687 6.868   -69.932 1.00 82.18 ? 4    GLU B CG  1 
ATOM   4203 C CD  . GLU B 1 4   ? -12.601 5.788   -69.873 1.00 83.31 ? 4    GLU B CD  1 
ATOM   4204 O OE1 . GLU B 1 4   ? -11.681 5.927   -69.043 1.00 82.98 ? 4    GLU B OE1 1 
ATOM   4205 O OE2 . GLU B 1 4   ? -12.650 4.816   -70.659 1.00 85.01 ? 4    GLU B OE2 1 
ATOM   4206 N N   . ASP B 1 5   ? -15.768 7.241   -66.898 1.00 79.61 ? 5    ASP B N   1 
ATOM   4207 C CA  . ASP B 1 5   ? -16.040 8.351   -65.983 1.00 78.57 ? 5    ASP B CA  1 
ATOM   4208 C C   . ASP B 1 5   ? -14.880 9.355   -66.049 1.00 77.03 ? 5    ASP B C   1 
ATOM   4209 O O   . ASP B 1 5   ? -13.764 9.042   -65.629 1.00 76.01 ? 5    ASP B O   1 
ATOM   4210 C CB  . ASP B 1 5   ? -16.195 7.801   -64.560 1.00 77.97 ? 5    ASP B CB  1 
ATOM   4211 C CG  . ASP B 1 5   ? -16.636 8.847   -63.553 1.00 77.26 ? 5    ASP B CG  1 
ATOM   4212 O OD1 . ASP B 1 5   ? -17.119 8.420   -62.485 1.00 75.34 ? 5    ASP B OD1 1 
ATOM   4213 O OD2 . ASP B 1 5   ? -16.497 10.068  -63.807 1.00 75.99 ? 5    ASP B OD2 1 
ATOM   4214 N N   . PRO B 1 6   ? -15.135 10.567  -66.568 1.00 76.79 ? 6    PRO B N   1 
ATOM   4215 C CA  . PRO B 1 6   ? -14.046 11.540  -66.747 1.00 75.28 ? 6    PRO B CA  1 
ATOM   4216 C C   . PRO B 1 6   ? -13.300 11.957  -65.468 1.00 73.75 ? 6    PRO B C   1 
ATOM   4217 O O   . PRO B 1 6   ? -12.180 12.467  -65.561 1.00 72.61 ? 6    PRO B O   1 
ATOM   4218 C CB  . PRO B 1 6   ? -14.748 12.754  -67.376 1.00 76.85 ? 6    PRO B CB  1 
ATOM   4219 C CG  . PRO B 1 6   ? -16.196 12.562  -67.123 1.00 78.28 ? 6    PRO B CG  1 
ATOM   4220 C CD  . PRO B 1 6   ? -16.435 11.098  -67.021 1.00 78.33 ? 6    PRO B CD  1 
ATOM   4221 N N   . GLN B 1 7   ? -13.918 11.764  -64.301 1.00 72.93 ? 7    GLN B N   1 
ATOM   4222 C CA  . GLN B 1 7   ? -13.249 12.024  -63.021 1.00 71.49 ? 7    GLN B CA  1 
ATOM   4223 C C   . GLN B 1 7   ? -12.135 11.016  -62.760 1.00 68.88 ? 7    GLN B C   1 
ATOM   4224 O O   . GLN B 1 7   ? -11.200 11.294  -62.001 1.00 67.76 ? 7    GLN B O   1 
ATOM   4225 C CB  . GLN B 1 7   ? -14.250 11.964  -61.864 1.00 71.86 ? 7    GLN B CB  1 
ATOM   4226 C CG  . GLN B 1 7   ? -15.300 13.066  -61.883 1.00 74.01 ? 7    GLN B CG  1 
ATOM   4227 C CD  . GLN B 1 7   ? -14.746 14.421  -61.488 1.00 74.28 ? 7    GLN B CD  1 
ATOM   4228 O OE1 . GLN B 1 7   ? -13.763 14.519  -60.759 1.00 72.30 ? 7    GLN B OE1 1 
ATOM   4229 N NE2 . GLN B 1 7   ? -15.388 15.478  -61.963 1.00 76.68 ? 7    GLN B NE2 1 
ATOM   4230 N N   . LEU B 1 8   ? -12.254 9.845   -63.380 1.00 67.49 ? 8    LEU B N   1 
ATOM   4231 C CA  . LEU B 1 8   ? -11.307 8.764   -63.189 1.00 65.60 ? 8    LEU B CA  1 
ATOM   4232 C C   . LEU B 1 8   ? -10.211 8.757   -64.259 1.00 64.73 ? 8    LEU B C   1 
ATOM   4233 O O   . LEU B 1 8   ? -9.348  7.902   -64.248 1.00 63.72 ? 8    LEU B O   1 
ATOM   4234 C CB  . LEU B 1 8   ? -12.053 7.425   -63.181 1.00 65.74 ? 8    LEU B CB  1 
ATOM   4235 C CG  . LEU B 1 8   ? -13.152 7.305   -62.118 1.00 65.01 ? 8    LEU B CG  1 
ATOM   4236 C CD1 . LEU B 1 8   ? -13.910 5.996   -62.272 1.00 63.62 ? 8    LEU B CD1 1 
ATOM   4237 C CD2 . LEU B 1 8   ? -12.566 7.447   -60.709 1.00 62.73 ? 8    LEU B CD2 1 
ATOM   4238 N N   . LEU B 1 9   ? -10.236 9.719   -65.168 1.00 64.95 ? 9    LEU B N   1 
ATOM   4239 C CA  . LEU B 1 9   ? -9.224  9.808   -66.210 1.00 64.75 ? 9    LEU B CA  1 
ATOM   4240 C C   . LEU B 1 9   ? -8.291  10.979  -65.962 1.00 63.80 ? 9    LEU B C   1 
ATOM   4241 O O   . LEU B 1 9   ? -8.734  12.120  -65.920 1.00 64.30 ? 9    LEU B O   1 
ATOM   4242 C CB  . LEU B 1 9   ? -9.884  9.978   -67.578 1.00 65.99 ? 9    LEU B CB  1 
ATOM   4243 C CG  . LEU B 1 9   ? -10.038 8.703   -68.385 1.00 66.79 ? 9    LEU B CG  1 
ATOM   4244 C CD1 . LEU B 1 9   ? -11.036 8.951   -69.521 1.00 68.32 ? 9    LEU B CD1 1 
ATOM   4245 C CD2 . LEU B 1 9   ? -8.660  8.243   -68.914 1.00 66.59 ? 9    LEU B CD2 1 
ATOM   4246 N N   . VAL B 1 10  ? -6.999  10.689  -65.832 1.00 62.40 ? 10   VAL B N   1 
ATOM   4247 C CA  . VAL B 1 10  ? -5.991  11.718  -65.581 1.00 61.83 ? 10   VAL B CA  1 
ATOM   4248 C C   . VAL B 1 10  ? -4.828  11.560  -66.558 1.00 61.63 ? 10   VAL B C   1 
ATOM   4249 O O   . VAL B 1 10  ? -4.408  10.450  -66.853 1.00 61.01 ? 10   VAL B O   1 
ATOM   4250 C CB  . VAL B 1 10  ? -5.453  11.633  -64.129 1.00 60.55 ? 10   VAL B CB  1 
ATOM   4251 C CG1 . VAL B 1 10  ? -4.490  12.768  -63.839 1.00 59.40 ? 10   VAL B CG1 1 
ATOM   4252 C CG2 . VAL B 1 10  ? -6.601  11.656  -63.145 1.00 61.50 ? 10   VAL B CG2 1 
ATOM   4253 N N   . ARG B 1 11  ? -4.331  12.681  -67.068 1.00 62.30 ? 11   ARG B N   1 
ATOM   4254 C CA  . ARG B 1 11  ? -3.086  12.699  -67.810 1.00 62.74 ? 11   ARG B CA  1 
ATOM   4255 C C   . ARG B 1 11  ? -1.990  13.237  -66.915 1.00 61.30 ? 11   ARG B C   1 
ATOM   4256 O O   . ARG B 1 11  ? -2.076  14.363  -66.417 1.00 60.80 ? 11   ARG B O   1 
ATOM   4257 C CB  . ARG B 1 11  ? -3.181  13.566  -69.061 1.00 63.78 ? 11   ARG B CB  1 
ATOM   4258 C CG  . ARG B 1 11  ? -1.838  13.726  -69.773 1.00 65.15 ? 11   ARG B CG  1 
ATOM   4259 C CD  . ARG B 1 11  ? -1.970  14.269  -71.191 1.00 67.91 ? 11   ARG B CD  1 
ATOM   4260 N NE  . ARG B 1 11  ? -1.895  13.205  -72.202 1.00 72.34 ? 11   ARG B NE  1 
ATOM   4261 C CZ  . ARG B 1 11  ? -2.946  12.588  -72.740 1.00 74.95 ? 11   ARG B CZ  1 
ATOM   4262 N NH1 . ARG B 1 11  ? -4.193  12.912  -72.382 1.00 77.99 ? 11   ARG B NH1 1 
ATOM   4263 N NH2 . ARG B 1 11  ? -2.755  11.646  -73.659 1.00 74.45 ? 11   ARG B NH2 1 
ATOM   4264 N N   . VAL B 1 12  ? -0.967  12.407  -66.725 1.00 60.26 ? 12   VAL B N   1 
ATOM   4265 C CA  . VAL B 1 12  ? 0.263   12.777  -66.041 1.00 59.44 ? 12   VAL B CA  1 
ATOM   4266 C C   . VAL B 1 12  ? 1.367   12.864  -67.095 1.00 59.67 ? 12   VAL B C   1 
ATOM   4267 O O   . VAL B 1 12  ? 1.122   12.584  -68.261 1.00 59.97 ? 12   VAL B O   1 
ATOM   4268 C CB  . VAL B 1 12  ? 0.614   11.750  -64.944 1.00 58.38 ? 12   VAL B CB  1 
ATOM   4269 C CG1 . VAL B 1 12  ? -0.410  11.810  -63.836 1.00 58.20 ? 12   VAL B CG1 1 
ATOM   4270 C CG2 . VAL B 1 12  ? 0.698   10.327  -65.518 1.00 58.18 ? 12   VAL B CG2 1 
ATOM   4271 N N   . ARG B 1 13  ? 2.574   13.252  -66.699 1.00 59.48 ? 13   ARG B N   1 
ATOM   4272 C CA  . ARG B 1 13  ? 3.649   13.467  -67.671 1.00 60.51 ? 13   ARG B CA  1 
ATOM   4273 C C   . ARG B 1 13  ? 3.976   12.208  -68.485 1.00 58.87 ? 13   ARG B C   1 
ATOM   4274 O O   . ARG B 1 13  ? 4.296   12.301  -69.660 1.00 59.14 ? 13   ARG B O   1 
ATOM   4275 C CB  . ARG B 1 13  ? 4.917   14.002  -66.991 1.00 60.20 ? 13   ARG B CB  1 
ATOM   4276 C CG  . ARG B 1 13  ? 4.809   15.470  -66.563 1.00 63.29 ? 13   ARG B CG  1 
ATOM   4277 C CD  . ARG B 1 13  ? 6.188   16.081  -66.273 1.00 64.55 ? 13   ARG B CD  1 
ATOM   4278 N NE  . ARG B 1 13  ? 6.073   17.398  -65.638 1.00 69.46 ? 13   ARG B NE  1 
ATOM   4279 C CZ  . ARG B 1 13  ? 7.098   18.117  -65.163 1.00 71.23 ? 13   ARG B CZ  1 
ATOM   4280 N NH1 . ARG B 1 13  ? 8.352   17.662  -65.243 1.00 72.67 ? 13   ARG B NH1 1 
ATOM   4281 N NH2 . ARG B 1 13  ? 6.871   19.306  -64.602 1.00 70.96 ? 13   ARG B NH2 1 
ATOM   4282 N N   . GLY B 1 14  ? 3.889   11.046  -67.850 1.00 56.97 ? 14   GLY B N   1 
ATOM   4283 C CA  . GLY B 1 14  ? 4.147   9.777   -68.514 1.00 56.11 ? 14   GLY B CA  1 
ATOM   4284 C C   . GLY B 1 14  ? 3.040   9.301   -69.433 1.00 55.87 ? 14   GLY B C   1 
ATOM   4285 O O   . GLY B 1 14  ? 3.264   8.416   -70.250 1.00 55.10 ? 14   GLY B O   1 
ATOM   4286 N N   . GLY B 1 15  ? 1.848   9.881   -69.290 1.00 55.71 ? 15   GLY B N   1 
ATOM   4287 C CA  . GLY B 1 15  ? 0.700   9.511   -70.110 1.00 56.32 ? 15   GLY B CA  1 
ATOM   4288 C C   . GLY B 1 15  ? -0.591  9.424   -69.326 1.00 56.18 ? 15   GLY B C   1 
ATOM   4289 O O   . GLY B 1 15  ? -0.676  9.925   -68.209 1.00 55.44 ? 15   GLY B O   1 
ATOM   4290 N N   . GLN B 1 16  ? -1.584  8.762   -69.917 1.00 56.69 ? 16   GLN B N   1 
ATOM   4291 C CA  . GLN B 1 16  ? -2.928  8.656   -69.344 1.00 57.28 ? 16   GLN B CA  1 
ATOM   4292 C C   . GLN B 1 16  ? -3.094  7.510   -68.357 1.00 56.26 ? 16   GLN B C   1 
ATOM   4293 O O   . GLN B 1 16  ? -2.560  6.431   -68.557 1.00 55.90 ? 16   GLN B O   1 
ATOM   4294 C CB  . GLN B 1 16  ? -3.962  8.479   -70.453 1.00 58.19 ? 16   GLN B CB  1 
ATOM   4295 C CG  . GLN B 1 16  ? -4.227  9.730   -71.256 1.00 60.12 ? 16   GLN B CG  1 
ATOM   4296 C CD  . GLN B 1 16  ? -5.273  9.500   -72.339 1.00 61.93 ? 16   GLN B CD  1 
ATOM   4297 O OE1 . GLN B 1 16  ? -5.036  8.776   -73.323 1.00 64.29 ? 16   GLN B OE1 1 
ATOM   4298 N NE2 . GLN B 1 16  ? -6.442  10.101  -72.155 1.00 63.92 ? 16   GLN B NE2 1 
ATOM   4299 N N   . LEU B 1 17  ? -3.883  7.765   -67.317 1.00 56.30 ? 17   LEU B N   1 
ATOM   4300 C CA  . LEU B 1 17  ? -4.193  6.806   -66.264 1.00 56.23 ? 17   LEU B CA  1 
ATOM   4301 C C   . LEU B 1 17  ? -5.699  6.705   -66.113 1.00 56.85 ? 17   LEU B C   1 
ATOM   4302 O O   . LEU B 1 17  ? -6.392  7.688   -66.314 1.00 57.46 ? 17   LEU B O   1 
ATOM   4303 C CB  . LEU B 1 17  ? -3.655  7.302   -64.906 1.00 55.70 ? 17   LEU B CB  1 
ATOM   4304 C CG  . LEU B 1 17  ? -2.196  7.722   -64.762 1.00 55.60 ? 17   LEU B CG  1 
ATOM   4305 C CD1 . LEU B 1 17  ? -2.012  8.446   -63.456 1.00 55.57 ? 17   LEU B CD1 1 
ATOM   4306 C CD2 . LEU B 1 17  ? -1.275  6.519   -64.837 1.00 56.16 ? 17   LEU B CD2 1 
ATOM   4307 N N   . ARG B 1 18  ? -6.191  5.534   -65.721 1.00 57.04 ? 18   ARG B N   1 
ATOM   4308 C CA  . ARG B 1 18  ? -7.581  5.367   -65.330 1.00 58.37 ? 18   ARG B CA  1 
ATOM   4309 C C   . ARG B 1 18  ? -7.641  4.813   -63.921 1.00 57.35 ? 18   ARG B C   1 
ATOM   4310 O O   . ARG B 1 18  ? -7.100  3.738   -63.641 1.00 56.74 ? 18   ARG B O   1 
ATOM   4311 C CB  . ARG B 1 18  ? -8.336  4.429   -66.268 1.00 59.09 ? 18   ARG B CB  1 
ATOM   4312 C CG  . ARG B 1 18  ? -9.828  4.324   -65.923 1.00 61.71 ? 18   ARG B CG  1 
ATOM   4313 C CD  . ARG B 1 18  ? -10.663 3.809   -67.072 1.00 63.87 ? 18   ARG B CD  1 
ATOM   4314 N NE  . ARG B 1 18  ? -10.032 2.625   -67.634 1.00 67.61 ? 18   ARG B NE  1 
ATOM   4315 C CZ  . ARG B 1 18  ? -9.659  2.455   -68.903 1.00 68.45 ? 18   ARG B CZ  1 
ATOM   4316 N NH1 . ARG B 1 18  ? -9.889  3.367   -69.852 1.00 68.59 ? 18   ARG B NH1 1 
ATOM   4317 N NH2 . ARG B 1 18  ? -9.064  1.315   -69.224 1.00 69.66 ? 18   ARG B NH2 1 
ATOM   4318 N N   . GLY B 1 19  ? -8.301  5.563   -63.042 1.00 57.27 ? 19   GLY B N   1 
ATOM   4319 C CA  . GLY B 1 19  ? -8.485  5.172   -61.656 1.00 56.59 ? 19   GLY B CA  1 
ATOM   4320 C C   . GLY B 1 19  ? -9.817  4.490   -61.453 1.00 57.29 ? 19   GLY B C   1 
ATOM   4321 O O   . GLY B 1 19  ? -10.480 4.087   -62.412 1.00 57.76 ? 19   GLY B O   1 
ATOM   4322 N N   . ILE B 1 20  ? -10.207 4.381   -60.193 1.00 56.95 ? 20   ILE B N   1 
ATOM   4323 C CA  . ILE B 1 20  ? -11.401 3.656   -59.804 1.00 58.03 ? 20   ILE B CA  1 
ATOM   4324 C C   . ILE B 1 20  ? -12.129 4.482   -58.744 1.00 59.07 ? 20   ILE B C   1 
ATOM   4325 O O   . ILE B 1 20  ? -11.497 5.164   -57.928 1.00 57.86 ? 20   ILE B O   1 
ATOM   4326 C CB  . ILE B 1 20  ? -11.039 2.244   -59.278 1.00 57.59 ? 20   ILE B CB  1 
ATOM   4327 C CG1 . ILE B 1 20  ? -12.292 1.420   -58.983 1.00 58.80 ? 20   ILE B CG1 1 
ATOM   4328 C CG2 . ILE B 1 20  ? -10.157 2.330   -58.047 1.00 56.69 ? 20   ILE B CG2 1 
ATOM   4329 C CD1 . ILE B 1 20  ? -12.009 -0.034  -58.683 1.00 58.03 ? 20   ILE B CD1 1 
ATOM   4330 N N   . ARG B 1 21  ? -13.455 4.450   -58.790 1.00 60.79 ? 21   ARG B N   1 
ATOM   4331 C CA  . ARG B 1 21  ? -14.279 5.110   -57.796 1.00 62.62 ? 21   ARG B CA  1 
ATOM   4332 C C   . ARG B 1 21  ? -14.515 4.120   -56.674 1.00 62.34 ? 21   ARG B C   1 
ATOM   4333 O O   . ARG B 1 21  ? -15.058 3.049   -56.894 1.00 63.09 ? 21   ARG B O   1 
ATOM   4334 C CB  . ARG B 1 21  ? -15.606 5.552   -58.403 1.00 63.96 ? 21   ARG B CB  1 
ATOM   4335 C CG  . ARG B 1 21  ? -16.453 6.408   -57.471 1.00 66.35 ? 21   ARG B CG  1 
ATOM   4336 C CD  . ARG B 1 21  ? -17.610 7.050   -58.219 1.00 69.18 ? 21   ARG B CD  1 
ATOM   4337 N NE  . ARG B 1 21  ? -18.604 6.059   -58.610 1.00 73.40 ? 21   ARG B NE  1 
ATOM   4338 C CZ  . ARG B 1 21  ? -19.694 5.744   -57.909 1.00 76.74 ? 21   ARG B CZ  1 
ATOM   4339 N NH1 . ARG B 1 21  ? -19.981 6.356   -56.753 1.00 78.02 ? 21   ARG B NH1 1 
ATOM   4340 N NH2 . ARG B 1 21  ? -20.525 4.814   -58.383 1.00 78.34 ? 21   ARG B NH2 1 
ATOM   4341 N N   . LEU B 1 22  ? -14.074 4.475   -55.478 1.00 62.35 ? 22   LEU B N   1 
ATOM   4342 C CA  . LEU B 1 22  ? -14.212 3.621   -54.320 1.00 63.04 ? 22   LEU B CA  1 
ATOM   4343 C C   . LEU B 1 22  ? -15.220 4.242   -53.373 1.00 64.63 ? 22   LEU B C   1 
ATOM   4344 O O   . LEU B 1 22  ? -15.490 5.445   -53.429 1.00 65.21 ? 22   LEU B O   1 
ATOM   4345 C CB  . LEU B 1 22  ? -12.868 3.449   -53.614 1.00 61.79 ? 22   LEU B CB  1 
ATOM   4346 C CG  . LEU B 1 22  ? -11.746 2.739   -54.382 1.00 61.42 ? 22   LEU B CG  1 
ATOM   4347 C CD1 . LEU B 1 22  ? -10.517 2.596   -53.477 1.00 61.31 ? 22   LEU B CD1 1 
ATOM   4348 C CD2 . LEU B 1 22  ? -12.179 1.378   -54.911 1.00 61.85 ? 22   LEU B CD2 1 
ATOM   4349 N N   . LYS B 1 23  ? -15.773 3.411   -52.500 1.00 65.79 ? 23   LYS B N   1 
ATOM   4350 C CA  . LYS B 1 23  ? -16.820 3.836   -51.593 1.00 67.34 ? 23   LYS B CA  1 
ATOM   4351 C C   . LYS B 1 23  ? -16.211 4.086   -50.226 1.00 66.27 ? 23   LYS B C   1 
ATOM   4352 O O   . LYS B 1 23  ? -15.631 3.182   -49.637 1.00 65.47 ? 23   LYS B O   1 
ATOM   4353 C CB  . LYS B 1 23  ? -17.908 2.757   -51.516 1.00 69.13 ? 23   LYS B CB  1 
ATOM   4354 C CG  . LYS B 1 23  ? -19.031 3.020   -50.523 1.00 72.48 ? 23   LYS B CG  1 
ATOM   4355 C CD  . LYS B 1 23  ? -19.767 4.346   -50.788 1.00 75.14 ? 23   LYS B CD  1 
ATOM   4356 C CE  . LYS B 1 23  ? -20.874 4.598   -49.762 1.00 75.90 ? 23   LYS B CE  1 
ATOM   4357 N NZ  . LYS B 1 23  ? -21.366 6.001   -49.847 1.00 77.46 ? 23   LYS B NZ  1 
ATOM   4358 N N   . ALA B 1 24  ? -16.322 5.324   -49.744 1.00 65.99 ? 24   ALA B N   1 
ATOM   4359 C CA  . ALA B 1 24  ? -16.055 5.643   -48.342 1.00 65.29 ? 24   ALA B CA  1 
ATOM   4360 C C   . ALA B 1 24  ? -17.420 5.744   -47.648 1.00 66.60 ? 24   ALA B C   1 
ATOM   4361 O O   . ALA B 1 24  ? -18.431 5.941   -48.320 1.00 67.95 ? 24   ALA B O   1 
ATOM   4362 C CB  . ALA B 1 24  ? -15.263 6.932   -48.223 1.00 64.04 ? 24   ALA B CB  1 
ATOM   4363 N N   . PRO B 1 25  ? -17.468 5.584   -46.311 1.00 66.55 ? 25   PRO B N   1 
ATOM   4364 C CA  . PRO B 1 25  ? -18.757 5.589   -45.604 1.00 67.82 ? 25   PRO B CA  1 
ATOM   4365 C C   . PRO B 1 25  ? -19.632 6.815   -45.893 1.00 68.51 ? 25   PRO B C   1 
ATOM   4366 O O   . PRO B 1 25  ? -20.855 6.697   -45.960 1.00 69.64 ? 25   PRO B O   1 
ATOM   4367 C CB  . PRO B 1 25  ? -18.347 5.563   -44.128 1.00 67.39 ? 25   PRO B CB  1 
ATOM   4368 C CG  . PRO B 1 25  ? -17.013 4.941   -44.116 1.00 66.24 ? 25   PRO B CG  1 
ATOM   4369 C CD  . PRO B 1 25  ? -16.342 5.371   -45.386 1.00 65.47 ? 25   PRO B CD  1 
ATOM   4370 N N   . GLY B 1 26  ? -19.000 7.973   -46.065 1.00 67.57 ? 26   GLY B N   1 
ATOM   4371 C CA  . GLY B 1 26  ? -19.716 9.227   -46.289 1.00 68.24 ? 26   GLY B CA  1 
ATOM   4372 C C   . GLY B 1 26  ? -19.917 9.586   -47.748 1.00 68.22 ? 26   GLY B C   1 
ATOM   4373 O O   . GLY B 1 26  ? -20.595 10.562  -48.056 1.00 69.29 ? 26   GLY B O   1 
ATOM   4374 N N   . GLY B 1 27  ? -19.336 8.801   -48.651 1.00 67.02 ? 27   GLY B N   1 
ATOM   4375 C CA  . GLY B 1 27  ? -19.419 9.090   -50.077 1.00 66.82 ? 27   GLY B CA  1 
ATOM   4376 C C   . GLY B 1 27  ? -18.249 8.534   -50.861 1.00 65.22 ? 27   GLY B C   1 
ATOM   4377 O O   . GLY B 1 27  ? -17.369 7.887   -50.294 1.00 63.96 ? 27   GLY B O   1 
ATOM   4378 N N   . PRO B 1 28  ? -18.237 8.776   -52.180 1.00 65.12 ? 28   PRO B N   1 
ATOM   4379 C CA  . PRO B 1 28  ? -17.197 8.229   -53.044 1.00 63.83 ? 28   PRO B CA  1 
ATOM   4380 C C   . PRO B 1 28  ? -15.872 8.976   -52.973 1.00 62.24 ? 28   PRO B C   1 
ATOM   4381 O O   . PRO B 1 28  ? -15.838 10.157  -52.633 1.00 62.62 ? 28   PRO B O   1 
ATOM   4382 C CB  . PRO B 1 28  ? -17.800 8.368   -54.441 1.00 64.71 ? 28   PRO B CB  1 
ATOM   4383 C CG  . PRO B 1 28  ? -18.705 9.548   -54.344 1.00 65.86 ? 28   PRO B CG  1 
ATOM   4384 C CD  . PRO B 1 28  ? -19.238 9.551   -52.940 1.00 66.47 ? 28   PRO B CD  1 
ATOM   4385 N N   . VAL B 1 29  ? -14.796 8.263   -53.291 1.00 60.68 ? 29   VAL B N   1 
ATOM   4386 C CA  . VAL B 1 29  ? -13.485 8.859   -53.527 1.00 58.96 ? 29   VAL B CA  1 
ATOM   4387 C C   . VAL B 1 29  ? -12.947 8.301   -54.846 1.00 58.25 ? 29   VAL B C   1 
ATOM   4388 O O   . VAL B 1 29  ? -13.459 7.298   -55.355 1.00 58.65 ? 29   VAL B O   1 
ATOM   4389 C CB  . VAL B 1 29  ? -12.499 8.565   -52.362 1.00 58.02 ? 29   VAL B CB  1 
ATOM   4390 C CG1 . VAL B 1 29  ? -13.020 9.155   -51.064 1.00 57.62 ? 29   VAL B CG1 1 
ATOM   4391 C CG2 . VAL B 1 29  ? -12.278 7.069   -52.197 1.00 58.30 ? 29   VAL B CG2 1 
ATOM   4392 N N   . SER B 1 30  ? -11.953 8.979   -55.413 1.00 56.74 ? 30   SER B N   1 
ATOM   4393 C CA  . SER B 1 30  ? -11.250 8.503   -56.597 1.00 55.99 ? 30   SER B CA  1 
ATOM   4394 C C   . SER B 1 30  ? -9.903  7.956   -56.167 1.00 54.51 ? 30   SER B C   1 
ATOM   4395 O O   . SER B 1 30  ? -9.165  8.624   -55.428 1.00 54.36 ? 30   SER B O   1 
ATOM   4396 C CB  . SER B 1 30  ? -11.020 9.636   -57.590 1.00 56.08 ? 30   SER B CB  1 
ATOM   4397 O OG  . SER B 1 30  ? -12.209 10.353  -57.846 1.00 58.19 ? 30   SER B OG  1 
ATOM   4398 N N   . ALA B 1 31  ? -9.572  6.759   -56.635 1.00 53.56 ? 31   ALA B N   1 
ATOM   4399 C CA  . ALA B 1 31  ? -8.318  6.100   -56.270 1.00 52.05 ? 31   ALA B CA  1 
ATOM   4400 C C   . ALA B 1 31  ? -7.554  5.752   -57.533 1.00 51.62 ? 31   ALA B C   1 
ATOM   4401 O O   . ALA B 1 31  ? -8.105  5.140   -58.438 1.00 52.00 ? 31   ALA B O   1 
ATOM   4402 C CB  . ALA B 1 31  ? -8.598  4.845   -55.451 1.00 51.62 ? 31   ALA B CB  1 
ATOM   4403 N N   . PHE B 1 32  ? -6.296  6.175   -57.596 1.00 50.62 ? 32   PHE B N   1 
ATOM   4404 C CA  . PHE B 1 32  ? -5.392  5.820   -58.683 1.00 50.33 ? 32   PHE B CA  1 
ATOM   4405 C C   . PHE B 1 32  ? -4.253  5.011   -58.071 1.00 49.45 ? 32   PHE B C   1 
ATOM   4406 O O   . PHE B 1 32  ? -3.344  5.561   -57.446 1.00 48.26 ? 32   PHE B O   1 
ATOM   4407 C CB  . PHE B 1 32  ? -4.872  7.075   -59.379 1.00 50.64 ? 32   PHE B CB  1 
ATOM   4408 C CG  . PHE B 1 32  ? -5.960  8.015   -59.785 1.00 51.27 ? 32   PHE B CG  1 
ATOM   4409 C CD1 . PHE B 1 32  ? -6.466  8.936   -58.882 1.00 52.05 ? 32   PHE B CD1 1 
ATOM   4410 C CD2 . PHE B 1 32  ? -6.496  7.965   -61.059 1.00 52.78 ? 32   PHE B CD2 1 
ATOM   4411 C CE1 . PHE B 1 32  ? -7.484  9.792   -59.247 1.00 52.56 ? 32   PHE B CE1 1 
ATOM   4412 C CE2 . PHE B 1 32  ? -7.515  8.822   -61.436 1.00 53.11 ? 32   PHE B CE2 1 
ATOM   4413 C CZ  . PHE B 1 32  ? -8.008  9.731   -60.525 1.00 54.15 ? 32   PHE B CZ  1 
ATOM   4414 N N   . LEU B 1 33  ? -4.340  3.693   -58.240 1.00 49.20 ? 33   LEU B N   1 
ATOM   4415 C CA  . LEU B 1 33  ? -3.502  2.760   -57.526 1.00 48.35 ? 33   LEU B CA  1 
ATOM   4416 C C   . LEU B 1 33  ? -2.528  2.077   -58.471 1.00 48.37 ? 33   LEU B C   1 
ATOM   4417 O O   . LEU B 1 33  ? -2.889  1.715   -59.591 1.00 49.46 ? 33   LEU B O   1 
ATOM   4418 C CB  . LEU B 1 33  ? -4.383  1.703   -56.855 1.00 48.60 ? 33   LEU B CB  1 
ATOM   4419 C CG  . LEU B 1 33  ? -5.523  2.206   -55.967 1.00 48.91 ? 33   LEU B CG  1 
ATOM   4420 C CD1 . LEU B 1 33  ? -6.306  1.010   -55.408 1.00 46.28 ? 33   LEU B CD1 1 
ATOM   4421 C CD2 . LEU B 1 33  ? -4.972  3.121   -54.838 1.00 44.84 ? 33   LEU B CD2 1 
ATOM   4422 N N   . GLY B 1 34  ? -1.299  1.889   -58.013 1.00 47.43 ? 34   GLY B N   1 
ATOM   4423 C CA  . GLY B 1 34  ? -0.298  1.184   -58.791 1.00 47.36 ? 34   GLY B CA  1 
ATOM   4424 C C   . GLY B 1 34  ? 0.266   1.969   -59.949 1.00 46.89 ? 34   GLY B C   1 
ATOM   4425 O O   . GLY B 1 34  ? 0.492   1.412   -61.014 1.00 48.18 ? 34   GLY B O   1 
ATOM   4426 N N   . ILE B 1 35  ? 0.517   3.257   -59.739 1.00 46.12 ? 35   ILE B N   1 
ATOM   4427 C CA  . ILE B 1 35  ? 1.092   4.113   -60.769 1.00 45.06 ? 35   ILE B CA  1 
ATOM   4428 C C   . ILE B 1 35  ? 2.617   3.990   -60.754 1.00 44.92 ? 35   ILE B C   1 
ATOM   4429 O O   . ILE B 1 35  ? 3.258   4.244   -59.724 1.00 44.57 ? 35   ILE B O   1 
ATOM   4430 C CB  . ILE B 1 35  ? 0.745   5.595   -60.526 1.00 45.23 ? 35   ILE B CB  1 
ATOM   4431 C CG1 . ILE B 1 35  ? -0.777  5.808   -60.446 1.00 44.87 ? 35   ILE B CG1 1 
ATOM   4432 C CG2 . ILE B 1 35  ? 1.388   6.473   -61.604 1.00 44.24 ? 35   ILE B CG2 1 
ATOM   4433 C CD1 . ILE B 1 35  ? -1.173  7.164   -59.900 1.00 44.69 ? 35   ILE B CD1 1 
ATOM   4434 N N   . PRO B 1 36  ? 3.218   3.639   -61.903 1.00 44.95 ? 36   PRO B N   1 
ATOM   4435 C CA  . PRO B 1 36  ? 4.670   3.461   -61.902 1.00 44.46 ? 36   PRO B CA  1 
ATOM   4436 C C   . PRO B 1 36  ? 5.392   4.798   -61.839 1.00 44.07 ? 36   PRO B C   1 
ATOM   4437 O O   . PRO B 1 36  ? 5.094   5.681   -62.627 1.00 44.19 ? 36   PRO B O   1 
ATOM   4438 C CB  . PRO B 1 36  ? 4.940   2.770   -63.241 1.00 44.67 ? 36   PRO B CB  1 
ATOM   4439 C CG  . PRO B 1 36  ? 3.789   3.184   -64.120 1.00 45.63 ? 36   PRO B CG  1 
ATOM   4440 C CD  . PRO B 1 36  ? 2.619   3.419   -63.236 1.00 45.35 ? 36   PRO B CD  1 
ATOM   4441 N N   . PHE B 1 37  ? 6.328   4.939   -60.905 1.00 43.67 ? 37   PHE B N   1 
ATOM   4442 C CA  . PHE B 1 37  ? 7.137   6.160   -60.815 1.00 43.91 ? 37   PHE B CA  1 
ATOM   4443 C C   . PHE B 1 37  ? 8.623   5.945   -61.157 1.00 44.05 ? 37   PHE B C   1 
ATOM   4444 O O   . PHE B 1 37  ? 9.379   6.903   -61.277 1.00 44.09 ? 37   PHE B O   1 
ATOM   4445 C CB  . PHE B 1 37  ? 6.956   6.850   -59.446 1.00 43.36 ? 37   PHE B CB  1 
ATOM   4446 C CG  . PHE B 1 37  ? 7.559   6.112   -58.285 1.00 42.07 ? 37   PHE B CG  1 
ATOM   4447 C CD1 . PHE B 1 37  ? 8.883   6.318   -57.928 1.00 42.73 ? 37   PHE B CD1 1 
ATOM   4448 C CD2 . PHE B 1 37  ? 6.793   5.241   -57.523 1.00 42.78 ? 37   PHE B CD2 1 
ATOM   4449 C CE1 . PHE B 1 37  ? 9.456   5.650   -56.844 1.00 42.18 ? 37   PHE B CE1 1 
ATOM   4450 C CE2 . PHE B 1 37  ? 7.348   4.566   -56.436 1.00 43.14 ? 37   PHE B CE2 1 
ATOM   4451 C CZ  . PHE B 1 37  ? 8.692   4.783   -56.090 1.00 42.57 ? 37   PHE B CZ  1 
ATOM   4452 N N   . ALA B 1 38  ? 9.026   4.693   -61.340 1.00 44.28 ? 38   ALA B N   1 
ATOM   4453 C CA  . ALA B 1 38  ? 10.385  4.381   -61.729 1.00 44.71 ? 38   ALA B CA  1 
ATOM   4454 C C   . ALA B 1 38  ? 10.424  3.200   -62.715 1.00 45.48 ? 38   ALA B C   1 
ATOM   4455 O O   . ALA B 1 38  ? 9.467   2.429   -62.839 1.00 45.32 ? 38   ALA B O   1 
ATOM   4456 C CB  . ALA B 1 38  ? 11.225  4.082   -60.499 1.00 43.89 ? 38   ALA B CB  1 
ATOM   4457 N N   . GLU B 1 39  ? 11.544  3.078   -63.413 1.00 46.35 ? 39   GLU B N   1 
ATOM   4458 C CA  . GLU B 1 39  ? 11.851  1.859   -64.142 1.00 47.78 ? 39   GLU B CA  1 
ATOM   4459 C C   . GLU B 1 39  ? 12.015  0.745   -63.118 1.00 48.31 ? 39   GLU B C   1 
ATOM   4460 O O   . GLU B 1 39  ? 12.665  0.950   -62.089 1.00 48.51 ? 39   GLU B O   1 
ATOM   4461 C CB  . GLU B 1 39  ? 13.148  2.021   -64.933 1.00 48.01 ? 39   GLU B CB  1 
ATOM   4462 C CG  . GLU B 1 39  ? 13.051  3.025   -66.056 1.00 48.25 ? 39   GLU B CG  1 
ATOM   4463 C CD  . GLU B 1 39  ? 12.126  2.543   -67.145 1.00 49.09 ? 39   GLU B CD  1 
ATOM   4464 O OE1 . GLU B 1 39  ? 12.585  1.747   -67.992 1.00 50.78 ? 39   GLU B OE1 1 
ATOM   4465 O OE2 . GLU B 1 39  ? 10.944  2.941   -67.139 1.00 48.05 ? 39   GLU B OE2 1 
ATOM   4466 N N   . PRO B 1 40  ? 11.434  -0.439  -63.384 1.00 49.21 ? 40   PRO B N   1 
ATOM   4467 C CA  . PRO B 1 40  ? 11.620  -1.567  -62.462 1.00 48.87 ? 40   PRO B CA  1 
ATOM   4468 C C   . PRO B 1 40  ? 13.100  -1.842  -62.125 1.00 49.27 ? 40   PRO B C   1 
ATOM   4469 O O   . PRO B 1 40  ? 13.906  -2.048  -63.030 1.00 49.42 ? 40   PRO B O   1 
ATOM   4470 C CB  . PRO B 1 40  ? 11.012  -2.734  -63.233 1.00 49.74 ? 40   PRO B CB  1 
ATOM   4471 C CG  . PRO B 1 40  ? 9.998   -2.102  -64.150 1.00 49.05 ? 40   PRO B CG  1 
ATOM   4472 C CD  . PRO B 1 40  ? 10.589  -0.803  -64.544 1.00 49.44 ? 40   PRO B CD  1 
ATOM   4473 N N   . PRO B 1 41  ? 13.456  -1.851  -60.822 1.00 48.97 ? 41   PRO B N   1 
ATOM   4474 C CA  . PRO B 1 41  ? 14.844  -1.997  -60.396 1.00 49.00 ? 41   PRO B CA  1 
ATOM   4475 C C   . PRO B 1 41  ? 15.269  -3.461  -60.382 1.00 49.47 ? 41   PRO B C   1 
ATOM   4476 O O   . PRO B 1 41  ? 15.620  -4.008  -59.339 1.00 49.26 ? 41   PRO B O   1 
ATOM   4477 C CB  . PRO B 1 41  ? 14.823  -1.399  -58.996 1.00 48.69 ? 41   PRO B CB  1 
ATOM   4478 C CG  . PRO B 1 41  ? 13.461  -1.788  -58.478 1.00 48.31 ? 41   PRO B CG  1 
ATOM   4479 C CD  . PRO B 1 41  ? 12.546  -1.723  -59.668 1.00 48.27 ? 41   PRO B CD  1 
ATOM   4480 N N   . VAL B 1 42  ? 15.259  -4.069  -61.566 1.00 50.26 ? 42   VAL B N   1 
ATOM   4481 C CA  . VAL B 1 42  ? 15.453  -5.502  -61.729 1.00 50.43 ? 42   VAL B CA  1 
ATOM   4482 C C   . VAL B 1 42  ? 16.698  -5.801  -62.561 1.00 51.42 ? 42   VAL B C   1 
ATOM   4483 O O   . VAL B 1 42  ? 17.194  -4.955  -63.299 1.00 50.96 ? 42   VAL B O   1 
ATOM   4484 C CB  . VAL B 1 42  ? 14.198  -6.157  -62.383 1.00 50.94 ? 42   VAL B CB  1 
ATOM   4485 C CG1 . VAL B 1 42  ? 12.927  -5.881  -61.526 1.00 49.91 ? 42   VAL B CG1 1 
ATOM   4486 C CG2 . VAL B 1 42  ? 14.009  -5.685  -63.843 1.00 49.13 ? 42   VAL B CG2 1 
ATOM   4487 N N   . GLY B 1 43  ? 17.206  -7.018  -62.415 1.00 52.68 ? 43   GLY B N   1 
ATOM   4488 C CA  . GLY B 1 43  ? 18.394  -7.462  -63.127 1.00 53.77 ? 43   GLY B CA  1 
ATOM   4489 C C   . GLY B 1 43  ? 19.616  -6.639  -62.766 1.00 54.23 ? 43   GLY B C   1 
ATOM   4490 O O   . GLY B 1 43  ? 20.073  -6.652  -61.615 1.00 54.28 ? 43   GLY B O   1 
ATOM   4491 N N   . SER B 1 44  ? 20.136  -5.909  -63.747 1.00 54.65 ? 44   SER B N   1 
ATOM   4492 C CA  . SER B 1 44  ? 21.330  -5.081  -63.551 1.00 55.17 ? 44   SER B CA  1 
ATOM   4493 C C   . SER B 1 44  ? 21.069  -3.880  -62.655 1.00 54.42 ? 44   SER B C   1 
ATOM   4494 O O   . SER B 1 44  ? 22.017  -3.303  -62.109 1.00 54.69 ? 44   SER B O   1 
ATOM   4495 C CB  . SER B 1 44  ? 21.876  -4.594  -64.902 1.00 56.04 ? 44   SER B CB  1 
ATOM   4496 O OG  . SER B 1 44  ? 21.160  -3.450  -65.376 1.00 56.42 ? 44   SER B OG  1 
ATOM   4497 N N   . ARG B 1 45  ? 19.795  -3.504  -62.503 1.00 53.41 ? 45   ARG B N   1 
ATOM   4498 C CA  . ARG B 1 45  ? 19.417  -2.337  -61.710 1.00 53.05 ? 45   ARG B CA  1 
ATOM   4499 C C   . ARG B 1 45  ? 19.244  -2.629  -60.228 1.00 51.69 ? 45   ARG B C   1 
ATOM   4500 O O   . ARG B 1 45  ? 18.987  -1.711  -59.448 1.00 50.80 ? 45   ARG B O   1 
ATOM   4501 C CB  . ARG B 1 45  ? 18.127  -1.729  -62.236 1.00 52.24 ? 45   ARG B CB  1 
ATOM   4502 C CG  . ARG B 1 45  ? 18.173  -1.285  -63.688 1.00 54.38 ? 45   ARG B CG  1 
ATOM   4503 C CD  . ARG B 1 45  ? 16.735  -1.161  -64.199 1.00 56.59 ? 45   ARG B CD  1 
ATOM   4504 N NE  . ARG B 1 45  ? 16.614  -0.777  -65.611 1.00 60.52 ? 45   ARG B NE  1 
ATOM   4505 C CZ  . ARG B 1 45  ? 15.531  -0.997  -66.364 1.00 61.99 ? 45   ARG B CZ  1 
ATOM   4506 N NH1 . ARG B 1 45  ? 14.454  -1.612  -65.860 1.00 60.08 ? 45   ARG B NH1 1 
ATOM   4507 N NH2 . ARG B 1 45  ? 15.534  -0.615  -67.646 1.00 63.85 ? 45   ARG B NH2 1 
ATOM   4508 N N   . ARG B 1 46  ? 19.372  -3.890  -59.830 1.00 51.59 ? 46   ARG B N   1 
ATOM   4509 C CA  . ARG B 1 46  ? 19.327  -4.240  -58.412 1.00 51.05 ? 46   ARG B CA  1 
ATOM   4510 C C   . ARG B 1 46  ? 20.444  -3.499  -57.674 1.00 50.89 ? 46   ARG B C   1 
ATOM   4511 O O   . ARG B 1 46  ? 21.578  -3.469  -58.148 1.00 51.58 ? 46   ARG B O   1 
ATOM   4512 C CB  . ARG B 1 46  ? 19.489  -5.751  -58.213 1.00 51.80 ? 46   ARG B CB  1 
ATOM   4513 C CG  . ARG B 1 46  ? 19.251  -6.196  -56.765 1.00 51.63 ? 46   ARG B CG  1 
ATOM   4514 C CD  . ARG B 1 46  ? 19.621  -7.643  -56.565 1.00 52.23 ? 46   ARG B CD  1 
ATOM   4515 N NE  . ARG B 1 46  ? 18.519  -8.579  -56.793 1.00 52.51 ? 46   ARG B NE  1 
ATOM   4516 C CZ  . ARG B 1 46  ? 18.664  -9.902  -56.735 1.00 52.70 ? 46   ARG B CZ  1 
ATOM   4517 N NH1 . ARG B 1 46  ? 19.852  -10.430 -56.488 1.00 52.95 ? 46   ARG B NH1 1 
ATOM   4518 N NH2 . ARG B 1 46  ? 17.625  -10.697 -56.925 1.00 53.62 ? 46   ARG B NH2 1 
ATOM   4519 N N   . PHE B 1 47  ? 20.093  -2.905  -56.529 1.00 50.01 ? 47   PHE B N   1 
ATOM   4520 C CA  . PHE B 1 47  ? 20.988  -2.111  -55.668 1.00 49.65 ? 47   PHE B CA  1 
ATOM   4521 C C   . PHE B 1 47  ? 21.320  -0.727  -56.209 1.00 50.00 ? 47   PHE B C   1 
ATOM   4522 O O   . PHE B 1 47  ? 22.051  0.033   -55.553 1.00 49.50 ? 47   PHE B O   1 
ATOM   4523 C CB  . PHE B 1 47  ? 22.308  -2.827  -55.368 1.00 50.10 ? 47   PHE B CB  1 
ATOM   4524 C CG  . PHE B 1 47  ? 22.152  -4.232  -54.891 1.00 50.06 ? 47   PHE B CG  1 
ATOM   4525 C CD1 . PHE B 1 47  ? 21.351  -4.527  -53.799 1.00 49.17 ? 47   PHE B CD1 1 
ATOM   4526 C CD2 . PHE B 1 47  ? 22.829  -5.266  -55.521 1.00 50.96 ? 47   PHE B CD2 1 
ATOM   4527 C CE1 . PHE B 1 47  ? 21.214  -5.832  -53.357 1.00 49.68 ? 47   PHE B CE1 1 
ATOM   4528 C CE2 . PHE B 1 47  ? 22.696  -6.576  -55.080 1.00 50.95 ? 47   PHE B CE2 1 
ATOM   4529 C CZ  . PHE B 1 47  ? 21.896  -6.856  -53.999 1.00 49.94 ? 47   PHE B CZ  1 
ATOM   4530 N N   . MET B 1 48  ? 20.809  -0.400  -57.397 1.00 50.29 ? 48   MET B N   1 
ATOM   4531 C CA  . MET B 1 48  ? 21.150  0.848   -58.059 1.00 51.51 ? 48   MET B CA  1 
ATOM   4532 C C   . MET B 1 48  ? 20.083  1.902   -57.765 1.00 50.06 ? 48   MET B C   1 
ATOM   4533 O O   . MET B 1 48  ? 18.927  1.566   -57.497 1.00 49.01 ? 48   MET B O   1 
ATOM   4534 C CB  . MET B 1 48  ? 21.262  0.640   -59.574 1.00 52.12 ? 48   MET B CB  1 
ATOM   4535 C CG  . MET B 1 48  ? 22.284  -0.422  -60.008 1.00 54.71 ? 48   MET B CG  1 
ATOM   4536 S SD  . MET B 1 48  ? 23.056  -0.047  -61.612 1.00 58.07 ? 48   MET B SD  1 
ATOM   4537 C CE  . MET B 1 48  ? 24.075  1.340   -61.067 1.00 59.58 ? 48   MET B CE  1 
ATOM   4538 N N   . PRO B 1 49  ? 20.459  3.184   -57.819 1.00 49.78 ? 49   PRO B N   1 
ATOM   4539 C CA  . PRO B 1 49  ? 19.450  4.244   -57.738 1.00 49.20 ? 49   PRO B CA  1 
ATOM   4540 C C   . PRO B 1 49  ? 18.294  4.042   -58.738 1.00 48.92 ? 49   PRO B C   1 
ATOM   4541 O O   . PRO B 1 49  ? 18.487  3.425   -59.798 1.00 48.86 ? 49   PRO B O   1 
ATOM   4542 C CB  . PRO B 1 49  ? 20.249  5.503   -58.080 1.00 49.65 ? 49   PRO B CB  1 
ATOM   4543 C CG  . PRO B 1 49  ? 21.635  5.191   -57.594 1.00 50.22 ? 49   PRO B CG  1 
ATOM   4544 C CD  . PRO B 1 49  ? 21.822  3.732   -57.927 1.00 50.81 ? 49   PRO B CD  1 
ATOM   4545 N N   . PRO B 1 50  ? 17.093  4.547   -58.398 1.00 48.11 ? 50   PRO B N   1 
ATOM   4546 C CA  . PRO B 1 50  ? 15.953  4.399   -59.298 1.00 47.99 ? 50   PRO B CA  1 
ATOM   4547 C C   . PRO B 1 50  ? 16.069  5.357   -60.463 1.00 48.76 ? 50   PRO B C   1 
ATOM   4548 O O   . PRO B 1 50  ? 16.569  6.451   -60.287 1.00 49.42 ? 50   PRO B O   1 
ATOM   4549 C CB  . PRO B 1 50  ? 14.763  4.773   -58.415 1.00 47.08 ? 50   PRO B CB  1 
ATOM   4550 C CG  . PRO B 1 50  ? 15.317  5.722   -57.450 1.00 46.45 ? 50   PRO B CG  1 
ATOM   4551 C CD  . PRO B 1 50  ? 16.721  5.266   -57.168 1.00 47.29 ? 50   PRO B CD  1 
ATOM   4552 N N   . GLU B 1 51  ? 15.644  4.944   -61.652 1.00 49.80 ? 51   GLU B N   1 
ATOM   4553 C CA  . GLU B 1 51  ? 15.569  5.860   -62.785 1.00 50.39 ? 51   GLU B CA  1 
ATOM   4554 C C   . GLU B 1 51  ? 14.088  6.156   -63.042 1.00 50.07 ? 51   GLU B C   1 
ATOM   4555 O O   . GLU B 1 51  ? 13.226  5.302   -62.797 1.00 49.25 ? 51   GLU B O   1 
ATOM   4556 C CB  A GLU B 1 51  ? 16.182  5.224   -64.043 0.50 51.05 ? 51   GLU B CB  1 
ATOM   4557 C CB  B GLU B 1 51  ? 16.251  5.283   -64.026 0.50 51.03 ? 51   GLU B CB  1 
ATOM   4558 C CG  A GLU B 1 51  ? 17.494  4.433   -63.847 0.50 52.14 ? 51   GLU B CG  1 
ATOM   4559 C CG  B GLU B 1 51  ? 17.787  5.219   -63.940 0.50 52.19 ? 51   GLU B CG  1 
ATOM   4560 C CD  A GLU B 1 51  ? 17.705  3.362   -64.922 0.50 53.36 ? 51   GLU B CD  1 
ATOM   4561 C CD  B GLU B 1 51  ? 18.452  6.589   -63.768 0.50 53.17 ? 51   GLU B CD  1 
ATOM   4562 O OE1 A GLU B 1 51  ? 17.251  2.204   -64.727 0.50 55.18 ? 51   GLU B OE1 1 
ATOM   4563 O OE1 B GLU B 1 51  ? 17.984  7.574   -64.383 0.50 53.35 ? 51   GLU B OE1 1 
ATOM   4564 O OE2 A GLU B 1 51  ? 18.323  3.676   -65.967 0.50 56.42 ? 51   GLU B OE2 1 
ATOM   4565 O OE2 B GLU B 1 51  ? 19.446  6.674   -63.009 0.50 53.47 ? 51   GLU B OE2 1 
ATOM   4566 N N   . PRO B 1 52  ? 13.784  7.368   -63.535 1.00 50.14 ? 52   PRO B N   1 
ATOM   4567 C CA  . PRO B 1 52  ? 12.415  7.738   -63.858 1.00 49.99 ? 52   PRO B CA  1 
ATOM   4568 C C   . PRO B 1 52  ? 11.725  6.793   -64.838 1.00 49.64 ? 52   PRO B C   1 
ATOM   4569 O O   . PRO B 1 52  ? 12.349  6.295   -65.759 1.00 50.07 ? 52   PRO B O   1 
ATOM   4570 C CB  . PRO B 1 52  ? 12.559  9.128   -64.493 1.00 50.83 ? 52   PRO B CB  1 
ATOM   4571 C CG  . PRO B 1 52  ? 13.854  9.653   -64.026 1.00 51.33 ? 52   PRO B CG  1 
ATOM   4572 C CD  . PRO B 1 52  ? 14.735  8.466   -63.799 1.00 51.04 ? 52   PRO B CD  1 
ATOM   4573 N N   . LYS B 1 53  ? 10.430  6.590   -64.636 1.00 49.08 ? 53   LYS B N   1 
ATOM   4574 C CA  . LYS B 1 53  ? 9.634   5.705   -65.469 1.00 49.06 ? 53   LYS B CA  1 
ATOM   4575 C C   . LYS B 1 53  ? 9.484   6.287   -66.867 1.00 49.55 ? 53   LYS B C   1 
ATOM   4576 O O   . LYS B 1 53  ? 9.103   7.456   -67.025 1.00 49.77 ? 53   LYS B O   1 
ATOM   4577 C CB  . LYS B 1 53  ? 8.262   5.485   -64.828 1.00 48.62 ? 53   LYS B CB  1 
ATOM   4578 C CG  . LYS B 1 53  ? 7.236   4.741   -65.675 1.00 49.58 ? 53   LYS B CG  1 
ATOM   4579 C CD  . LYS B 1 53  ? 7.621   3.276   -65.897 1.00 50.09 ? 53   LYS B CD  1 
ATOM   4580 C CE  . LYS B 1 53  ? 6.587   2.523   -66.771 1.00 50.76 ? 53   LYS B CE  1 
ATOM   4581 N NZ  . LYS B 1 53  ? 6.760   2.744   -68.232 1.00 51.18 ? 53   LYS B NZ  1 
ATOM   4582 N N   . ARG B 1 54  ? 9.788   5.474   -67.880 1.00 49.39 ? 54   ARG B N   1 
ATOM   4583 C CA  . ARG B 1 54  ? 9.566   5.870   -69.272 1.00 49.83 ? 54   ARG B CA  1 
ATOM   4584 C C   . ARG B 1 54  ? 8.063   6.061   -69.531 1.00 50.09 ? 54   ARG B C   1 
ATOM   4585 O O   . ARG B 1 54  ? 7.238   5.299   -69.022 1.00 48.99 ? 54   ARG B O   1 
ATOM   4586 C CB  . ARG B 1 54  ? 10.125  4.817   -70.243 1.00 49.94 ? 54   ARG B CB  1 
ATOM   4587 C CG  . ARG B 1 54  ? 11.636  4.664   -70.216 1.00 49.25 ? 54   ARG B CG  1 
ATOM   4588 C CD  . ARG B 1 54  ? 12.116  3.508   -71.095 1.00 50.67 ? 54   ARG B CD  1 
ATOM   4589 N NE  . ARG B 1 54  ? 11.496  2.244   -70.693 1.00 50.56 ? 54   ARG B NE  1 
ATOM   4590 C CZ  . ARG B 1 54  ? 10.659  1.518   -71.429 1.00 51.45 ? 54   ARG B CZ  1 
ATOM   4591 N NH1 . ARG B 1 54  ? 10.141  0.412   -70.917 1.00 51.35 ? 54   ARG B NH1 1 
ATOM   4592 N NH2 . ARG B 1 54  ? 10.364  1.844   -72.678 1.00 53.09 ? 54   ARG B NH2 1 
ATOM   4593 N N   . PRO B 1 55  ? 7.703   7.078   -70.335 1.00 51.43 ? 55   PRO B N   1 
ATOM   4594 C CA  . PRO B 1 55  ? 6.304   7.312   -70.724 1.00 51.64 ? 55   PRO B CA  1 
ATOM   4595 C C   . PRO B 1 55  ? 5.679   6.096   -71.393 1.00 51.56 ? 55   PRO B C   1 
ATOM   4596 O O   . PRO B 1 55  ? 6.396   5.287   -71.959 1.00 51.50 ? 55   PRO B O   1 
ATOM   4597 C CB  . PRO B 1 55  ? 6.399   8.455   -71.749 1.00 52.61 ? 55   PRO B CB  1 
ATOM   4598 C CG  . PRO B 1 55  ? 7.685   9.132   -71.453 1.00 53.37 ? 55   PRO B CG  1 
ATOM   4599 C CD  . PRO B 1 55  ? 8.616   8.066   -70.947 1.00 52.34 ? 55   PRO B CD  1 
ATOM   4600 N N   . TRP B 1 56  ? 4.355   5.997   -71.332 1.00 51.53 ? 56   TRP B N   1 
ATOM   4601 C CA  . TRP B 1 56  ? 3.614   4.837   -71.843 1.00 51.80 ? 56   TRP B CA  1 
ATOM   4602 C C   . TRP B 1 56  ? 2.505   5.263   -72.793 1.00 52.68 ? 56   TRP B C   1 
ATOM   4603 O O   . TRP B 1 56  ? 1.999   6.370   -72.706 1.00 52.94 ? 56   TRP B O   1 
ATOM   4604 C CB  . TRP B 1 56  ? 2.992   4.044   -70.695 1.00 50.96 ? 56   TRP B CB  1 
ATOM   4605 C CG  . TRP B 1 56  ? 2.091   4.866   -69.852 1.00 50.42 ? 56   TRP B CG  1 
ATOM   4606 C CD1 . TRP B 1 56  ? 0.781   5.135   -70.083 1.00 50.86 ? 56   TRP B CD1 1 
ATOM   4607 C CD2 . TRP B 1 56  ? 2.440   5.558   -68.645 1.00 49.35 ? 56   TRP B CD2 1 
ATOM   4608 N NE1 . TRP B 1 56  ? 0.283   5.944   -69.093 1.00 50.94 ? 56   TRP B NE1 1 
ATOM   4609 C CE2 . TRP B 1 56  ? 1.284   6.225   -68.200 1.00 49.99 ? 56   TRP B CE2 1 
ATOM   4610 C CE3 . TRP B 1 56  ? 3.618   5.679   -67.900 1.00 49.01 ? 56   TRP B CE3 1 
ATOM   4611 C CZ2 . TRP B 1 56  ? 1.265   6.995   -67.039 1.00 49.08 ? 56   TRP B CZ2 1 
ATOM   4612 C CZ3 . TRP B 1 56  ? 3.605   6.454   -66.750 1.00 49.01 ? 56   TRP B CZ3 1 
ATOM   4613 C CH2 . TRP B 1 56  ? 2.432   7.103   -66.331 1.00 48.75 ? 56   TRP B CH2 1 
ATOM   4614 N N   . SER B 1 57  ? 2.115   4.348   -73.672 1.00 53.57 ? 57   SER B N   1 
ATOM   4615 C CA  . SER B 1 57  ? 1.067   4.591   -74.648 1.00 54.81 ? 57   SER B CA  1 
ATOM   4616 C C   . SER B 1 57  ? -0.291  4.243   -74.061 1.00 54.94 ? 57   SER B C   1 
ATOM   4617 O O   . SER B 1 57  ? -0.367  3.498   -73.105 1.00 54.31 ? 57   SER B O   1 
ATOM   4618 C CB  . SER B 1 57  ? 1.301   3.707   -75.867 1.00 55.48 ? 57   SER B CB  1 
ATOM   4619 O OG  . SER B 1 57  ? 1.128   2.340   -75.505 1.00 56.32 ? 57   SER B OG  1 
ATOM   4620 N N   . GLY B 1 58  ? -1.364  4.760   -74.649 1.00 55.52 ? 58   GLY B N   1 
ATOM   4621 C CA  . GLY B 1 58  ? -2.703  4.374   -74.226 1.00 55.98 ? 58   GLY B CA  1 
ATOM   4622 C C   . GLY B 1 58  ? -3.040  4.812   -72.813 1.00 55.54 ? 58   GLY B C   1 
ATOM   4623 O O   . GLY B 1 58  ? -2.473  5.784   -72.296 1.00 55.31 ? 58   GLY B O   1 
ATOM   4624 N N   . VAL B 1 59  ? -3.982  4.097   -72.202 1.00 55.96 ? 59   VAL B N   1 
ATOM   4625 C CA  . VAL B 1 59  ? -4.472  4.400   -70.859 1.00 55.88 ? 59   VAL B CA  1 
ATOM   4626 C C   . VAL B 1 59  ? -3.986  3.309   -69.907 1.00 55.65 ? 59   VAL B C   1 
ATOM   4627 O O   . VAL B 1 59  ? -4.282  2.128   -70.097 1.00 55.84 ? 59   VAL B O   1 
ATOM   4628 C CB  . VAL B 1 59  ? -6.025  4.487   -70.817 1.00 56.87 ? 59   VAL B CB  1 
ATOM   4629 C CG1 . VAL B 1 59  ? -6.502  4.960   -69.445 1.00 55.52 ? 59   VAL B CG1 1 
ATOM   4630 C CG2 . VAL B 1 59  ? -6.548  5.414   -71.922 1.00 56.86 ? 59   VAL B CG2 1 
ATOM   4631 N N   . LEU B 1 60  ? -3.204  3.712   -68.907 1.00 55.55 ? 60   LEU B N   1 
ATOM   4632 C CA  . LEU B 1 60  ? -2.643  2.776   -67.940 1.00 54.91 ? 60   LEU B CA  1 
ATOM   4633 C C   . LEU B 1 60  ? -3.684  2.480   -66.888 1.00 54.90 ? 60   LEU B C   1 
ATOM   4634 O O   . LEU B 1 60  ? -4.276  3.394   -66.317 1.00 54.34 ? 60   LEU B O   1 
ATOM   4635 C CB  . LEU B 1 60  ? -1.385  3.350   -67.300 1.00 54.41 ? 60   LEU B CB  1 
ATOM   4636 C CG  . LEU B 1 60  ? -0.651  2.404   -66.327 1.00 54.34 ? 60   LEU B CG  1 
ATOM   4637 C CD1 . LEU B 1 60  ? -0.082  1.167   -67.034 1.00 56.02 ? 60   LEU B CD1 1 
ATOM   4638 C CD2 . LEU B 1 60  ? 0.451   3.143   -65.646 1.00 54.01 ? 60   LEU B CD2 1 
ATOM   4639 N N   . ASP B 1 61  ? -3.909  1.197   -66.638 1.00 55.57 ? 61   ASP B N   1 
ATOM   4640 C CA  . ASP B 1 61  ? -4.888  0.759   -65.653 1.00 56.38 ? 61   ASP B CA  1 
ATOM   4641 C C   . ASP B 1 61  ? -4.336  0.979   -64.236 1.00 55.56 ? 61   ASP B C   1 
ATOM   4642 O O   . ASP B 1 61  ? -3.408  0.274   -63.810 1.00 55.34 ? 61   ASP B O   1 
ATOM   4643 C CB  . ASP B 1 61  ? -5.241  -0.709  -65.889 1.00 57.60 ? 61   ASP B CB  1 
ATOM   4644 C CG  . ASP B 1 61  ? -6.011  -1.323  -64.733 1.00 59.62 ? 61   ASP B CG  1 
ATOM   4645 O OD1 . ASP B 1 61  ? -5.611  -2.418  -64.264 1.00 61.85 ? 61   ASP B OD1 1 
ATOM   4646 O OD2 . ASP B 1 61  ? -7.001  -0.710  -64.291 1.00 61.64 ? 61   ASP B OD2 1 
ATOM   4647 N N   . ALA B 1 62  ? -4.897  1.971   -63.532 1.00 55.02 ? 62   ALA B N   1 
ATOM   4648 C CA  . ALA B 1 62  ? -4.484  2.330   -62.161 1.00 54.12 ? 62   ALA B CA  1 
ATOM   4649 C C   . ALA B 1 62  ? -5.627  2.077   -61.165 1.00 54.02 ? 62   ALA B C   1 
ATOM   4650 O O   . ALA B 1 62  ? -5.967  2.946   -60.351 1.00 53.79 ? 62   ALA B O   1 
ATOM   4651 C CB  . ALA B 1 62  ? -4.027  3.793   -62.101 1.00 53.23 ? 62   ALA B CB  1 
ATOM   4652 N N   . THR B 1 63  ? -6.201  0.878   -61.232 1.00 54.08 ? 63   THR B N   1 
ATOM   4653 C CA  . THR B 1 63  ? -7.378  0.524   -60.433 1.00 54.39 ? 63   THR B CA  1 
ATOM   4654 C C   . THR B 1 63  ? -7.104  -0.510  -59.332 1.00 53.93 ? 63   THR B C   1 
ATOM   4655 O O   . THR B 1 63  ? -8.000  -0.800  -58.539 1.00 54.05 ? 63   THR B O   1 
ATOM   4656 C CB  . THR B 1 63  ? -8.514  -0.036  -61.323 1.00 55.47 ? 63   THR B CB  1 
ATOM   4657 O OG1 . THR B 1 63  ? -8.109  -1.294  -61.890 1.00 54.68 ? 63   THR B OG1 1 
ATOM   4658 C CG2 . THR B 1 63  ? -8.882  0.950   -62.430 1.00 55.17 ? 63   THR B CG2 1 
ATOM   4659 N N   . THR B 1 64  ? -5.890  -1.064  -59.291 1.00 53.25 ? 64   THR B N   1 
ATOM   4660 C CA  . THR B 1 64  ? -5.522  -2.063  -58.284 1.00 53.34 ? 64   THR B CA  1 
ATOM   4661 C C   . THR B 1 64  ? -4.117  -1.788  -57.735 1.00 52.25 ? 64   THR B C   1 
ATOM   4662 O O   . THR B 1 64  ? -3.285  -1.178  -58.402 1.00 52.01 ? 64   THR B O   1 
ATOM   4663 C CB  . THR B 1 64  ? -5.589  -3.508  -58.854 1.00 53.91 ? 64   THR B CB  1 
ATOM   4664 O OG1 . THR B 1 64  ? -4.606  -3.670  -59.873 1.00 54.69 ? 64   THR B OG1 1 
ATOM   4665 C CG2 . THR B 1 64  ? -6.960  -3.817  -59.474 1.00 55.62 ? 64   THR B CG2 1 
ATOM   4666 N N   . PHE B 1 65  ? -3.862  -2.231  -56.509 1.00 51.97 ? 65   PHE B N   1 
ATOM   4667 C CA  . PHE B 1 65  ? -2.534  -2.096  -55.913 1.00 51.01 ? 65   PHE B CA  1 
ATOM   4668 C C   . PHE B 1 65  ? -1.533  -2.967  -56.684 1.00 50.94 ? 65   PHE B C   1 
ATOM   4669 O O   . PHE B 1 65  ? -1.864  -4.063  -57.144 1.00 50.97 ? 65   PHE B O   1 
ATOM   4670 C CB  . PHE B 1 65  ? -2.529  -2.536  -54.439 1.00 50.65 ? 65   PHE B CB  1 
ATOM   4671 C CG  . PHE B 1 65  ? -3.183  -1.561  -53.494 1.00 50.50 ? 65   PHE B CG  1 
ATOM   4672 C CD1 . PHE B 1 65  ? -2.655  -0.290  -53.308 1.00 48.77 ? 65   PHE B CD1 1 
ATOM   4673 C CD2 . PHE B 1 65  ? -4.311  -1.929  -52.763 1.00 51.35 ? 65   PHE B CD2 1 
ATOM   4674 C CE1 . PHE B 1 65  ? -3.243  0.599   -52.436 1.00 48.66 ? 65   PHE B CE1 1 
ATOM   4675 C CE2 . PHE B 1 65  ? -4.910  -1.036  -51.876 1.00 51.18 ? 65   PHE B CE2 1 
ATOM   4676 C CZ  . PHE B 1 65  ? -4.376  0.231   -51.718 1.00 50.15 ? 65   PHE B CZ  1 
ATOM   4677 N N   . GLN B 1 66  ? -0.299  -2.485  -56.775 1.00 50.31 ? 66   GLN B N   1 
ATOM   4678 C CA  . GLN B 1 66  ? 0.790   -3.244  -57.398 1.00 50.45 ? 66   GLN B CA  1 
ATOM   4679 C C   . GLN B 1 66  ? 1.479   -4.205  -56.416 1.00 50.04 ? 66   GLN B C   1 
ATOM   4680 O O   . GLN B 1 66  ? 1.073   -4.338  -55.259 1.00 49.73 ? 66   GLN B O   1 
ATOM   4681 C CB  . GLN B 1 66  ? 1.795   -2.276  -58.044 1.00 49.90 ? 66   GLN B CB  1 
ATOM   4682 C CG  . GLN B 1 66  ? 1.514   -2.069  -59.521 1.00 50.52 ? 66   GLN B CG  1 
ATOM   4683 C CD  . GLN B 1 66  ? 1.988   -3.236  -60.355 1.00 51.66 ? 66   GLN B CD  1 
ATOM   4684 O OE1 . GLN B 1 66  ? 2.596   -4.180  -59.832 1.00 53.67 ? 66   GLN B OE1 1 
ATOM   4685 N NE2 . GLN B 1 66  ? 1.714   -3.189  -61.657 1.00 49.62 ? 66   GLN B NE2 1 
ATOM   4686 N N   . ASN B 1 67  ? 2.509   -4.890  -56.896 1.00 50.18 ? 67   ASN B N   1 
ATOM   4687 C CA  . ASN B 1 67  ? 3.233   -5.850  -56.080 1.00 50.41 ? 67   ASN B CA  1 
ATOM   4688 C C   . ASN B 1 67  ? 3.986   -5.201  -54.915 1.00 49.46 ? 67   ASN B C   1 
ATOM   4689 O O   . ASN B 1 67  ? 4.345   -4.023  -54.950 1.00 49.08 ? 67   ASN B O   1 
ATOM   4690 C CB  . ASN B 1 67  ? 4.195   -6.652  -56.949 1.00 50.85 ? 67   ASN B CB  1 
ATOM   4691 C CG  . ASN B 1 67  ? 3.469   -7.547  -57.947 1.00 53.28 ? 67   ASN B CG  1 
ATOM   4692 O OD1 . ASN B 1 67  ? 2.380   -8.058  -57.667 1.00 55.11 ? 67   ASN B OD1 1 
ATOM   4693 N ND2 . ASN B 1 67  ? 4.062   -7.724  -59.121 1.00 53.19 ? 67   ASN B ND2 1 
ATOM   4694 N N   . VAL B 1 68  ? 4.193   -5.992  -53.875 1.00 49.11 ? 68   VAL B N   1 
ATOM   4695 C CA  . VAL B 1 68  ? 4.884   -5.551  -52.686 1.00 47.95 ? 68   VAL B CA  1 
ATOM   4696 C C   . VAL B 1 68  ? 6.365   -5.779  -52.930 1.00 47.74 ? 68   VAL B C   1 
ATOM   4697 O O   . VAL B 1 68  ? 6.745   -6.790  -53.517 1.00 48.14 ? 68   VAL B O   1 
ATOM   4698 C CB  . VAL B 1 68  ? 4.367   -6.325  -51.450 1.00 48.26 ? 68   VAL B CB  1 
ATOM   4699 C CG1 . VAL B 1 68  ? 5.354   -6.249  -50.285 1.00 47.19 ? 68   VAL B CG1 1 
ATOM   4700 C CG2 . VAL B 1 68  ? 2.985   -5.808  -51.060 1.00 46.88 ? 68   VAL B CG2 1 
ATOM   4701 N N   . CYS B 1 69  ? 7.195   -4.813  -52.540 1.00 46.92 ? 69   CYS B N   1 
ATOM   4702 C CA  . CYS B 1 69  ? 8.642   -4.940  -52.704 1.00 47.02 ? 69   CYS B CA  1 
ATOM   4703 C C   . CYS B 1 69  ? 9.122   -6.192  -51.984 1.00 47.26 ? 69   CYS B C   1 
ATOM   4704 O O   . CYS B 1 69  ? 8.658   -6.494  -50.884 1.00 47.07 ? 69   CYS B O   1 
ATOM   4705 C CB  . CYS B 1 69  ? 9.367   -3.701  -52.168 1.00 46.58 ? 69   CYS B CB  1 
ATOM   4706 S SG  . CYS B 1 69  ? 9.176   -2.210  -53.214 1.00 46.91 ? 69   CYS B SG  1 
ATOM   4707 N N   . TYR B 1 70  ? 10.053  -6.913  -52.608 1.00 47.48 ? 70   TYR B N   1 
ATOM   4708 C CA  . TYR B 1 70  ? 10.489  -8.178  -52.071 1.00 48.12 ? 70   TYR B CA  1 
ATOM   4709 C C   . TYR B 1 70  ? 11.044  -8.029  -50.654 1.00 48.26 ? 70   TYR B C   1 
ATOM   4710 O O   . TYR B 1 70  ? 11.908  -7.182  -50.375 1.00 47.31 ? 70   TYR B O   1 
ATOM   4711 C CB  . TYR B 1 70  ? 11.502  -8.882  -52.984 1.00 48.89 ? 70   TYR B CB  1 
ATOM   4712 C CG  . TYR B 1 70  ? 11.413  -10.377 -52.820 1.00 49.38 ? 70   TYR B CG  1 
ATOM   4713 C CD1 . TYR B 1 70  ? 10.688  -11.156 -53.715 1.00 49.99 ? 70   TYR B CD1 1 
ATOM   4714 C CD2 . TYR B 1 70  ? 12.014  -11.009 -51.740 1.00 50.38 ? 70   TYR B CD2 1 
ATOM   4715 C CE1 . TYR B 1 70  ? 10.583  -12.541 -53.546 1.00 50.78 ? 70   TYR B CE1 1 
ATOM   4716 C CE2 . TYR B 1 70  ? 11.916  -12.397 -51.563 1.00 51.00 ? 70   TYR B CE2 1 
ATOM   4717 C CZ  . TYR B 1 70  ? 11.190  -13.147 -52.456 1.00 51.36 ? 70   TYR B CZ  1 
ATOM   4718 O OH  . TYR B 1 70  ? 11.081  -14.502 -52.262 1.00 52.98 ? 70   TYR B OH  1 
ATOM   4719 N N   . GLN B 1 71  ? 10.542  -8.875  -49.763 1.00 48.97 ? 71   GLN B N   1 
ATOM   4720 C CA  . GLN B 1 71  ? 10.845  -8.734  -48.353 1.00 49.50 ? 71   GLN B CA  1 
ATOM   4721 C C   . GLN B 1 71  ? 10.607  -10.002 -47.576 1.00 51.17 ? 71   GLN B C   1 
ATOM   4722 O O   . GLN B 1 71  ? 9.835   -10.869 -47.984 1.00 51.63 ? 71   GLN B O   1 
ATOM   4723 C CB  . GLN B 1 71  ? 9.986   -7.618  -47.728 1.00 48.47 ? 71   GLN B CB  1 
ATOM   4724 C CG  . GLN B 1 71  ? 8.481   -7.897  -47.737 1.00 47.88 ? 71   GLN B CG  1 
ATOM   4725 C CD  . GLN B 1 71  ? 7.654   -6.681  -47.354 1.00 47.76 ? 71   GLN B CD  1 
ATOM   4726 O OE1 . GLN B 1 71  ? 7.037   -6.650  -46.283 1.00 45.27 ? 71   GLN B OE1 1 
ATOM   4727 N NE2 . GLN B 1 71  ? 7.667   -5.657  -48.212 1.00 44.66 ? 71   GLN B NE2 1 
ATOM   4728 N N   . TYR B 1 72  ? 11.289  -10.066 -46.437 1.00 52.98 ? 72   TYR B N   1 
ATOM   4729 C CA  . TYR B 1 72  ? 11.043  -11.043 -45.397 1.00 54.67 ? 72   TYR B CA  1 
ATOM   4730 C C   . TYR B 1 72  ? 9.594   -10.992 -44.927 1.00 55.38 ? 72   TYR B C   1 
ATOM   4731 O O   . TYR B 1 72  ? 9.026   -9.910  -44.732 1.00 54.39 ? 72   TYR B O   1 
ATOM   4732 C CB  . TYR B 1 72  ? 11.956  -10.729 -44.217 1.00 55.14 ? 72   TYR B CB  1 
ATOM   4733 C CG  . TYR B 1 72  ? 11.738  -11.623 -43.024 1.00 56.97 ? 72   TYR B CG  1 
ATOM   4734 C CD1 . TYR B 1 72  ? 11.011  -11.178 -41.912 1.00 57.07 ? 72   TYR B CD1 1 
ATOM   4735 C CD2 . TYR B 1 72  ? 12.245  -12.921 -43.007 1.00 57.42 ? 72   TYR B CD2 1 
ATOM   4736 C CE1 . TYR B 1 72  ? 10.807  -12.008 -40.816 1.00 57.52 ? 72   TYR B CE1 1 
ATOM   4737 C CE2 . TYR B 1 72  ? 12.046  -13.750 -41.921 1.00 58.24 ? 72   TYR B CE2 1 
ATOM   4738 C CZ  . TYR B 1 72  ? 11.334  -13.289 -40.830 1.00 58.03 ? 72   TYR B CZ  1 
ATOM   4739 O OH  . TYR B 1 72  ? 11.148  -14.124 -39.752 1.00 60.14 ? 72   TYR B OH  1 
ATOM   4740 N N   . VAL B 1 73  ? 9.007   -12.167 -44.737 1.00 57.32 ? 73   VAL B N   1 
ATOM   4741 C CA  . VAL B 1 73  ? 7.630   -12.290 -44.279 1.00 58.48 ? 73   VAL B CA  1 
ATOM   4742 C C   . VAL B 1 73  ? 7.645   -12.907 -42.882 1.00 60.05 ? 73   VAL B C   1 
ATOM   4743 O O   . VAL B 1 73  ? 8.293   -13.923 -42.651 1.00 60.80 ? 73   VAL B O   1 
ATOM   4744 C CB  . VAL B 1 73  ? 6.817   -13.163 -45.252 1.00 59.27 ? 73   VAL B CB  1 
ATOM   4745 C CG1 . VAL B 1 73  ? 5.407   -13.416 -44.730 1.00 59.59 ? 73   VAL B CG1 1 
ATOM   4746 C CG2 . VAL B 1 73  ? 6.784   -12.516 -46.641 1.00 59.00 ? 73   VAL B CG2 1 
ATOM   4747 N N   . ASP B 1 74  ? 6.924   -12.289 -41.953 1.00 61.25 ? 74   ASP B N   1 
ATOM   4748 C CA  . ASP B 1 74  ? 6.930   -12.721 -40.560 1.00 62.88 ? 74   ASP B CA  1 
ATOM   4749 C C   . ASP B 1 74  ? 6.283   -14.084 -40.344 1.00 64.78 ? 74   ASP B C   1 
ATOM   4750 O O   . ASP B 1 74  ? 5.231   -14.376 -40.896 1.00 65.30 ? 74   ASP B O   1 
ATOM   4751 C CB  . ASP B 1 74  ? 6.204   -11.711 -39.682 1.00 62.77 ? 74   ASP B CB  1 
ATOM   4752 C CG  . ASP B 1 74  ? 6.622   -11.810 -38.238 1.00 63.99 ? 74   ASP B CG  1 
ATOM   4753 O OD1 . ASP B 1 74  ? 6.002   -12.585 -37.482 1.00 65.73 ? 74   ASP B OD1 1 
ATOM   4754 O OD2 . ASP B 1 74  ? 7.604   -11.134 -37.881 1.00 66.30 ? 74   ASP B OD2 1 
ATOM   4755 N N   . THR B 1 75  ? 6.912   -14.892 -39.501 1.00 66.61 ? 75   THR B N   1 
ATOM   4756 C CA  . THR B 1 75  ? 6.434   -16.231 -39.187 1.00 68.77 ? 75   THR B CA  1 
ATOM   4757 C C   . THR B 1 75  ? 6.352   -16.490 -37.671 1.00 69.59 ? 75   THR B C   1 
ATOM   4758 O O   . THR B 1 75  ? 6.228   -17.634 -37.249 1.00 70.71 ? 75   THR B O   1 
ATOM   4759 C CB  . THR B 1 75  ? 7.399   -17.262 -39.788 1.00 69.82 ? 75   THR B CB  1 
ATOM   4760 O OG1 . THR B 1 75  ? 8.727   -16.974 -39.321 1.00 70.63 ? 75   THR B OG1 1 
ATOM   4761 C CG2 . THR B 1 75  ? 7.364   -17.227 -41.326 1.00 69.36 ? 75   THR B CG2 1 
ATOM   4762 N N   . LEU B 1 76  ? 6.431   -15.441 -36.852 1.00 69.31 ? 76   LEU B N   1 
ATOM   4763 C CA  . LEU B 1 76  ? 6.476   -15.623 -35.396 1.00 69.96 ? 76   LEU B CA  1 
ATOM   4764 C C   . LEU B 1 76  ? 5.201   -16.308 -34.897 1.00 71.10 ? 76   LEU B C   1 
ATOM   4765 O O   . LEU B 1 76  ? 5.265   -17.339 -34.216 1.00 72.55 ? 76   LEU B O   1 
ATOM   4766 C CB  . LEU B 1 76  ? 6.676   -14.283 -34.682 1.00 68.95 ? 76   LEU B CB  1 
ATOM   4767 C CG  . LEU B 1 76  ? 6.893   -14.293 -33.159 1.00 69.40 ? 76   LEU B CG  1 
ATOM   4768 C CD1 . LEU B 1 76  ? 8.195   -14.994 -32.781 1.00 69.94 ? 76   LEU B CD1 1 
ATOM   4769 C CD2 . LEU B 1 76  ? 6.870   -12.858 -32.614 1.00 68.05 ? 76   LEU B CD2 1 
ATOM   4770 N N   . TYR B 1 77  ? 4.053   -15.738 -35.259 1.00 70.76 ? 77   TYR B N   1 
ATOM   4771 C CA  . TYR B 1 77  ? 2.749   -16.260 -34.855 1.00 71.34 ? 77   TYR B CA  1 
ATOM   4772 C C   . TYR B 1 77  ? 1.868   -16.495 -36.083 1.00 71.41 ? 77   TYR B C   1 
ATOM   4773 O O   . TYR B 1 77  ? 1.021   -15.668 -36.413 1.00 70.26 ? 77   TYR B O   1 
ATOM   4774 C CB  . TYR B 1 77  ? 2.076   -15.281 -33.896 1.00 70.97 ? 77   TYR B CB  1 
ATOM   4775 C CG  . TYR B 1 77  ? 2.807   -15.110 -32.586 1.00 71.00 ? 77   TYR B CG  1 
ATOM   4776 C CD1 . TYR B 1 77  ? 2.865   -16.146 -31.662 1.00 72.78 ? 77   TYR B CD1 1 
ATOM   4777 C CD2 . TYR B 1 77  ? 3.425   -13.909 -32.260 1.00 70.33 ? 77   TYR B CD2 1 
ATOM   4778 C CE1 . TYR B 1 77  ? 3.526   -15.996 -30.443 1.00 72.71 ? 77   TYR B CE1 1 
ATOM   4779 C CE2 . TYR B 1 77  ? 4.086   -13.745 -31.044 1.00 70.31 ? 77   TYR B CE2 1 
ATOM   4780 C CZ  . TYR B 1 77  ? 4.136   -14.793 -30.138 1.00 71.63 ? 77   TYR B CZ  1 
ATOM   4781 O OH  . TYR B 1 77  ? 4.792   -14.642 -28.929 1.00 71.59 ? 77   TYR B OH  1 
ATOM   4782 N N   . PRO B 1 78  ? 2.071   -17.632 -36.770 1.00 72.54 ? 78   PRO B N   1 
ATOM   4783 C CA  . PRO B 1 78  ? 1.291   -17.931 -37.980 1.00 72.88 ? 78   PRO B CA  1 
ATOM   4784 C C   . PRO B 1 78  ? -0.217  -17.910 -37.737 1.00 73.36 ? 78   PRO B C   1 
ATOM   4785 O O   . PRO B 1 78  ? -0.697  -18.552 -36.807 1.00 74.38 ? 78   PRO B O   1 
ATOM   4786 C CB  . PRO B 1 78  ? 1.761   -19.342 -38.366 1.00 74.24 ? 78   PRO B CB  1 
ATOM   4787 C CG  . PRO B 1 78  ? 3.128   -19.474 -37.754 1.00 74.20 ? 78   PRO B CG  1 
ATOM   4788 C CD  . PRO B 1 78  ? 3.048   -18.695 -36.465 1.00 73.42 ? 78   PRO B CD  1 
ATOM   4789 N N   . GLY B 1 79  ? -0.946  -17.160 -38.561 1.00 72.63 ? 79   GLY B N   1 
ATOM   4790 C CA  . GLY B 1 79  ? -2.401  -17.059 -38.452 1.00 73.10 ? 79   GLY B CA  1 
ATOM   4791 C C   . GLY B 1 79  ? -2.922  -15.957 -37.536 1.00 72.44 ? 79   GLY B C   1 
ATOM   4792 O O   . GLY B 1 79  ? -4.138  -15.802 -37.391 1.00 73.11 ? 79   GLY B O   1 
ATOM   4793 N N   . PHE B 1 80  ? -2.014  -15.190 -36.924 1.00 70.97 ? 80   PHE B N   1 
ATOM   4794 C CA  . PHE B 1 80  ? -2.372  -14.182 -35.916 1.00 70.18 ? 80   PHE B CA  1 
ATOM   4795 C C   . PHE B 1 80  ? -2.462  -12.792 -36.559 1.00 69.19 ? 80   PHE B C   1 
ATOM   4796 O O   . PHE B 1 80  ? -1.503  -12.303 -37.148 1.00 67.98 ? 80   PHE B O   1 
ATOM   4797 C CB  . PHE B 1 80  ? -1.346  -14.207 -34.769 1.00 69.63 ? 80   PHE B CB  1 
ATOM   4798 C CG  . PHE B 1 80  ? -1.571  -13.153 -33.696 1.00 69.18 ? 80   PHE B CG  1 
ATOM   4799 C CD1 . PHE B 1 80  ? -2.735  -13.135 -32.945 1.00 68.89 ? 80   PHE B CD1 1 
ATOM   4800 C CD2 . PHE B 1 80  ? -0.593  -12.206 -33.418 1.00 67.30 ? 80   PHE B CD2 1 
ATOM   4801 C CE1 . PHE B 1 80  ? -2.931  -12.180 -31.952 1.00 68.28 ? 80   PHE B CE1 1 
ATOM   4802 C CE2 . PHE B 1 80  ? -0.788  -11.243 -32.420 1.00 67.07 ? 80   PHE B CE2 1 
ATOM   4803 C CZ  . PHE B 1 80  ? -1.954  -11.234 -31.692 1.00 67.33 ? 80   PHE B CZ  1 
ATOM   4804 N N   . GLU B 1 81  ? -3.627  -12.168 -36.428 1.00 69.70 ? 81   GLU B N   1 
ATOM   4805 C CA  . GLU B 1 81  ? -3.907  -10.852 -37.013 1.00 69.50 ? 81   GLU B CA  1 
ATOM   4806 C C   . GLU B 1 81  ? -2.930  -9.756  -36.587 1.00 67.17 ? 81   GLU B C   1 
ATOM   4807 O O   . GLU B 1 81  ? -2.544  -8.927  -37.399 1.00 66.17 ? 81   GLU B O   1 
ATOM   4808 C CB  . GLU B 1 81  ? -5.331  -10.436 -36.643 1.00 70.36 ? 81   GLU B CB  1 
ATOM   4809 C CG  . GLU B 1 81  ? -5.709  -8.993  -36.988 1.00 71.36 ? 81   GLU B CG  1 
ATOM   4810 C CD  . GLU B 1 81  ? -7.219  -8.833  -37.152 1.00 73.10 ? 81   GLU B CD  1 
ATOM   4811 O OE1 . GLU B 1 81  ? -7.774  -9.467  -38.087 1.00 76.91 ? 81   GLU B OE1 1 
ATOM   4812 O OE2 . GLU B 1 81  ? -7.845  -8.098  -36.341 1.00 76.64 ? 81   GLU B OE2 1 
ATOM   4813 N N   . GLY B 1 82  ? -2.543  -9.758  -35.318 1.00 66.43 ? 82   GLY B N   1 
ATOM   4814 C CA  . GLY B 1 82  ? -1.607  -8.772  -34.783 1.00 64.82 ? 82   GLY B CA  1 
ATOM   4815 C C   . GLY B 1 82  ? -0.269  -8.721  -35.497 1.00 63.30 ? 82   GLY B C   1 
ATOM   4816 O O   . GLY B 1 82  ? 0.341   -7.658  -35.588 1.00 62.20 ? 82   GLY B O   1 
ATOM   4817 N N   . THR B 1 83  ? 0.190   -9.866  -35.994 1.00 63.11 ? 83   THR B N   1 
ATOM   4818 C CA  . THR B 1 83  ? 1.395   -9.919  -36.820 1.00 62.06 ? 83   THR B CA  1 
ATOM   4819 C C   . THR B 1 83  ? 1.062   -9.869  -38.319 1.00 61.54 ? 83   THR B C   1 
ATOM   4820 O O   . THR B 1 83  ? 1.715   -9.160  -39.081 1.00 60.16 ? 83   THR B O   1 
ATOM   4821 C CB  . THR B 1 83  ? 2.258   -11.170 -36.516 1.00 62.67 ? 83   THR B CB  1 
ATOM   4822 O OG1 . THR B 1 83  ? 1.455   -12.350 -36.585 1.00 63.52 ? 83   THR B OG1 1 
ATOM   4823 C CG2 . THR B 1 83  ? 2.883   -11.073 -35.145 1.00 62.03 ? 83   THR B CG2 1 
ATOM   4824 N N   . GLU B 1 84  ? 0.032   -10.594 -38.738 1.00 62.14 ? 84   GLU B N   1 
ATOM   4825 C CA  . GLU B 1 84  ? -0.248  -10.724 -40.174 1.00 62.47 ? 84   GLU B CA  1 
ATOM   4826 C C   . GLU B 1 84  ? -0.865  -9.474  -40.810 1.00 60.71 ? 84   GLU B C   1 
ATOM   4827 O O   . GLU B 1 84  ? -0.863  -9.344  -42.036 1.00 60.24 ? 84   GLU B O   1 
ATOM   4828 C CB  . GLU B 1 84  ? -1.054  -12.006 -40.479 1.00 63.74 ? 84   GLU B CB  1 
ATOM   4829 C CG  . GLU B 1 84  ? -0.128  -13.159 -40.944 1.00 65.70 ? 84   GLU B CG  1 
ATOM   4830 C CD  . GLU B 1 84  ? -0.636  -14.552 -40.621 1.00 67.98 ? 84   GLU B CD  1 
ATOM   4831 O OE1 . GLU B 1 84  ? -1.874  -14.761 -40.561 1.00 72.89 ? 84   GLU B OE1 1 
ATOM   4832 O OE2 . GLU B 1 84  ? 0.222   -15.456 -40.436 1.00 71.10 ? 84   GLU B OE2 1 
ATOM   4833 N N   . MET B 1 85  ? -1.342  -8.538  -39.995 1.00 59.42 ? 85   MET B N   1 
ATOM   4834 C CA  . MET B 1 85  ? -1.842  -7.266  -40.530 1.00 58.53 ? 85   MET B CA  1 
ATOM   4835 C C   . MET B 1 85  ? -0.715  -6.401  -41.123 1.00 56.09 ? 85   MET B C   1 
ATOM   4836 O O   . MET B 1 85  ? -0.987  -5.464  -41.868 1.00 55.12 ? 85   MET B O   1 
ATOM   4837 C CB  . MET B 1 85  ? -2.608  -6.476  -39.469 1.00 58.69 ? 85   MET B CB  1 
ATOM   4838 C CG  . MET B 1 85  ? -1.758  -5.883  -38.359 1.00 58.76 ? 85   MET B CG  1 
ATOM   4839 S SD  . MET B 1 85  ? -2.735  -4.822  -37.263 1.00 60.59 ? 85   MET B SD  1 
ATOM   4840 C CE  . MET B 1 85  ? -3.008  -3.384  -38.300 1.00 60.48 ? 85   MET B CE  1 
ATOM   4841 N N   . TRP B 1 86  ? 0.532   -6.724  -40.785 1.00 54.49 ? 86   TRP B N   1 
ATOM   4842 C CA  . TRP B 1 86  ? 1.699   -6.031  -41.322 1.00 53.16 ? 86   TRP B CA  1 
ATOM   4843 C C   . TRP B 1 86  ? 2.379   -6.798  -42.454 1.00 52.88 ? 86   TRP B C   1 
ATOM   4844 O O   . TRP B 1 86  ? 3.293   -6.267  -43.099 1.00 52.00 ? 86   TRP B O   1 
ATOM   4845 C CB  . TRP B 1 86  ? 2.717   -5.785  -40.206 1.00 52.69 ? 86   TRP B CB  1 
ATOM   4846 C CG  . TRP B 1 86  ? 2.119   -5.135  -39.041 1.00 52.09 ? 86   TRP B CG  1 
ATOM   4847 C CD1 . TRP B 1 86  ? 1.903   -5.695  -37.829 1.00 52.44 ? 86   TRP B CD1 1 
ATOM   4848 C CD2 . TRP B 1 86  ? 1.596   -3.806  -38.978 1.00 51.45 ? 86   TRP B CD2 1 
ATOM   4849 N NE1 . TRP B 1 86  ? 1.296   -4.795  -36.999 1.00 52.77 ? 86   TRP B NE1 1 
ATOM   4850 C CE2 . TRP B 1 86  ? 1.099   -3.621  -37.678 1.00 52.49 ? 86   TRP B CE2 1 
ATOM   4851 C CE3 . TRP B 1 86  ? 1.517   -2.746  -39.890 1.00 51.60 ? 86   TRP B CE3 1 
ATOM   4852 C CZ2 . TRP B 1 86  ? 0.530   -2.413  -37.258 1.00 52.25 ? 86   TRP B CZ2 1 
ATOM   4853 C CZ3 . TRP B 1 86  ? 0.959   -1.548  -39.481 1.00 50.66 ? 86   TRP B CZ3 1 
ATOM   4854 C CH2 . TRP B 1 86  ? 0.473   -1.388  -38.175 1.00 51.66 ? 86   TRP B CH2 1 
ATOM   4855 N N   . ASN B 1 87  ? 1.952   -8.038  -42.675 1.00 53.20 ? 87   ASN B N   1 
ATOM   4856 C CA  . ASN B 1 87  ? 2.528   -8.881  -43.728 1.00 53.84 ? 87   ASN B CA  1 
ATOM   4857 C C   . ASN B 1 87  ? 2.053   -8.459  -45.117 1.00 53.53 ? 87   ASN B C   1 
ATOM   4858 O O   . ASN B 1 87  ? 1.016   -7.809  -45.246 1.00 53.54 ? 87   ASN B O   1 
ATOM   4859 C CB  . ASN B 1 87  ? 2.228   -10.368 -43.481 1.00 54.64 ? 87   ASN B CB  1 
ATOM   4860 C CG  . ASN B 1 87  ? 3.237   -11.031 -42.530 1.00 56.34 ? 87   ASN B CG  1 
ATOM   4861 O OD1 . ASN B 1 87  ? 4.343   -10.527 -42.318 1.00 57.15 ? 87   ASN B OD1 1 
ATOM   4862 N ND2 . ASN B 1 87  ? 2.857   -12.176 -41.968 1.00 58.16 ? 87   ASN B ND2 1 
ATOM   4863 N N   . PRO B 1 88  ? 2.832   -8.793  -46.164 1.00 53.55 ? 88   PRO B N   1 
ATOM   4864 C CA  . PRO B 1 88  ? 2.403   -8.414  -47.510 1.00 53.43 ? 88   PRO B CA  1 
ATOM   4865 C C   . PRO B 1 88  ? 1.008   -8.932  -47.844 1.00 53.96 ? 88   PRO B C   1 
ATOM   4866 O O   . PRO B 1 88  ? 0.665   -10.075 -47.506 1.00 54.21 ? 88   PRO B O   1 
ATOM   4867 C CB  . PRO B 1 88  ? 3.456   -9.073  -48.416 1.00 53.45 ? 88   PRO B CB  1 
ATOM   4868 C CG  . PRO B 1 88  ? 4.674   -9.219  -47.542 1.00 53.43 ? 88   PRO B CG  1 
ATOM   4869 C CD  . PRO B 1 88  ? 4.132   -9.498  -46.175 1.00 53.84 ? 88   PRO B CD  1 
ATOM   4870 N N   . ASN B 1 89  ? 0.214   -8.082  -48.482 1.00 53.58 ? 89   ASN B N   1 
ATOM   4871 C CA  . ASN B 1 89  ? -1.123  -8.461  -48.918 1.00 54.47 ? 89   ASN B CA  1 
ATOM   4872 C C   . ASN B 1 89  ? -1.243  -8.524  -50.439 1.00 54.79 ? 89   ASN B C   1 
ATOM   4873 O O   . ASN B 1 89  ? -2.331  -8.748  -50.949 1.00 55.72 ? 89   ASN B O   1 
ATOM   4874 C CB  . ASN B 1 89  ? -2.194  -7.534  -48.319 1.00 54.33 ? 89   ASN B CB  1 
ATOM   4875 C CG  . ASN B 1 89  ? -2.051  -6.092  -48.763 1.00 52.58 ? 89   ASN B CG  1 
ATOM   4876 O OD1 . ASN B 1 89  ? -1.005  -5.681  -49.259 1.00 51.23 ? 89   ASN B OD1 1 
ATOM   4877 N ND2 . ASN B 1 89  ? -3.107  -5.314  -48.575 1.00 50.10 ? 89   ASN B ND2 1 
ATOM   4878 N N   . ARG B 1 90  ? -0.129  -8.330  -51.146 1.00 54.23 ? 90   ARG B N   1 
ATOM   4879 C CA  . ARG B 1 90  ? -0.043  -8.626  -52.582 1.00 54.59 ? 90   ARG B CA  1 
ATOM   4880 C C   . ARG B 1 90  ? 1.218   -9.444  -52.834 1.00 54.34 ? 90   ARG B C   1 
ATOM   4881 O O   . ARG B 1 90  ? 2.035   -9.636  -51.928 1.00 53.78 ? 90   ARG B O   1 
ATOM   4882 C CB  . ARG B 1 90  ? -0.016  -7.334  -53.414 1.00 53.92 ? 90   ARG B CB  1 
ATOM   4883 C CG  . ARG B 1 90  ? -1.248  -6.442  -53.260 1.00 55.34 ? 90   ARG B CG  1 
ATOM   4884 C CD  . ARG B 1 90  ? -2.467  -7.130  -53.831 1.00 58.49 ? 90   ARG B CD  1 
ATOM   4885 N NE  . ARG B 1 90  ? -3.679  -6.318  -53.848 1.00 59.65 ? 90   ARG B NE  1 
ATOM   4886 C CZ  . ARG B 1 90  ? -4.516  -6.151  -52.822 1.00 60.62 ? 90   ARG B CZ  1 
ATOM   4887 N NH1 . ARG B 1 90  ? -4.268  -6.669  -51.631 1.00 60.69 ? 90   ARG B NH1 1 
ATOM   4888 N NH2 . ARG B 1 90  ? -5.607  -5.415  -52.988 1.00 61.01 ? 90   ARG B NH2 1 
ATOM   4889 N N   . GLU B 1 91  ? 1.378   -9.925  -54.064 1.00 54.77 ? 91   GLU B N   1 
ATOM   4890 C CA  . GLU B 1 91  ? 2.539   -10.747 -54.416 1.00 55.29 ? 91   GLU B CA  1 
ATOM   4891 C C   . GLU B 1 91  ? 3.818   -9.942  -54.270 1.00 53.29 ? 91   GLU B C   1 
ATOM   4892 O O   . GLU B 1 91  ? 3.823   -8.733  -54.504 1.00 52.20 ? 91   GLU B O   1 
ATOM   4893 C CB  . GLU B 1 91  ? 2.457   -11.256 -55.864 1.00 56.58 ? 91   GLU B CB  1 
ATOM   4894 C CG  . GLU B 1 91  ? 1.366   -12.283 -56.130 1.00 60.62 ? 91   GLU B CG  1 
ATOM   4895 C CD  . GLU B 1 91  ? 1.630   -13.602 -55.430 1.00 65.80 ? 91   GLU B CD  1 
ATOM   4896 O OE1 . GLU B 1 91  ? 2.748   -14.154 -55.605 1.00 67.40 ? 91   GLU B OE1 1 
ATOM   4897 O OE2 . GLU B 1 91  ? 0.718   -14.069 -54.699 1.00 68.71 ? 91   GLU B OE2 1 
ATOM   4898 N N   . LEU B 1 92  ? 4.890   -10.630 -53.894 1.00 52.36 ? 92   LEU B N   1 
ATOM   4899 C CA  . LEU B 1 92  ? 6.186   -10.016 -53.753 1.00 51.52 ? 92   LEU B CA  1 
ATOM   4900 C C   . LEU B 1 92  ? 6.847   -9.921  -55.118 1.00 51.11 ? 92   LEU B C   1 
ATOM   4901 O O   . LEU B 1 92  ? 6.759   -10.830 -55.918 1.00 51.32 ? 92   LEU B O   1 
ATOM   4902 C CB  . LEU B 1 92  ? 7.073   -10.823 -52.804 1.00 51.84 ? 92   LEU B CB  1 
ATOM   4903 C CG  . LEU B 1 92  ? 6.663   -10.913 -51.334 1.00 51.75 ? 92   LEU B CG  1 
ATOM   4904 C CD1 . LEU B 1 92  ? 7.698   -11.745 -50.604 1.00 51.60 ? 92   LEU B CD1 1 
ATOM   4905 C CD2 . LEU B 1 92  ? 6.533   -9.522  -50.707 1.00 50.33 ? 92   LEU B CD2 1 
ATOM   4906 N N   . SER B 1 93  ? 7.497   -8.800  -55.387 1.00 50.31 ? 93   SER B N   1 
ATOM   4907 C CA  . SER B 1 93  ? 8.280   -8.669  -56.607 1.00 50.00 ? 93   SER B CA  1 
ATOM   4908 C C   . SER B 1 93  ? 9.321   -7.607  -56.399 1.00 49.18 ? 93   SER B C   1 
ATOM   4909 O O   . SER B 1 93  ? 9.092   -6.650  -55.662 1.00 48.76 ? 93   SER B O   1 
ATOM   4910 C CB  . SER B 1 93  ? 7.384   -8.300  -57.798 1.00 50.15 ? 93   SER B CB  1 
ATOM   4911 O OG  . SER B 1 93  ? 8.131   -8.112  -58.992 1.00 48.93 ? 93   SER B OG  1 
ATOM   4912 N N   . GLU B 1 94  ? 10.463  -7.770  -57.054 1.00 49.04 ? 94   GLU B N   1 
ATOM   4913 C CA  . GLU B 1 94  ? 11.422  -6.680  -57.139 1.00 48.51 ? 94   GLU B CA  1 
ATOM   4914 C C   . GLU B 1 94  ? 10.909  -5.557  -58.030 1.00 47.32 ? 94   GLU B C   1 
ATOM   4915 O O   . GLU B 1 94  ? 11.382  -4.433  -57.934 1.00 46.89 ? 94   GLU B O   1 
ATOM   4916 C CB  . GLU B 1 94  ? 12.766  -7.175  -57.640 1.00 48.94 ? 94   GLU B CB  1 
ATOM   4917 C CG  . GLU B 1 94  ? 13.543  -7.959  -56.599 1.00 50.16 ? 94   GLU B CG  1 
ATOM   4918 C CD  . GLU B 1 94  ? 14.904  -8.365  -57.115 1.00 51.10 ? 94   GLU B CD  1 
ATOM   4919 O OE1 . GLU B 1 94  ? 15.789  -7.482  -57.235 1.00 51.84 ? 94   GLU B OE1 1 
ATOM   4920 O OE2 . GLU B 1 94  ? 15.076  -9.558  -57.422 1.00 53.42 ? 94   GLU B OE2 1 
ATOM   4921 N N   . ASP B 1 95  ? 9.961   -5.873  -58.910 1.00 46.78 ? 95   ASP B N   1 
ATOM   4922 C CA  . ASP B 1 95  ? 9.312   -4.863  -59.723 1.00 45.96 ? 95   ASP B CA  1 
ATOM   4923 C C   . ASP B 1 95  ? 8.190   -4.306  -58.866 1.00 45.24 ? 95   ASP B C   1 
ATOM   4924 O O   . ASP B 1 95  ? 7.064   -4.805  -58.894 1.00 44.23 ? 95   ASP B O   1 
ATOM   4925 C CB  . ASP B 1 95  ? 8.802   -5.493  -61.022 1.00 46.48 ? 95   ASP B CB  1 
ATOM   4926 C CG  . ASP B 1 95  ? 8.000   -4.538  -61.884 1.00 46.73 ? 95   ASP B CG  1 
ATOM   4927 O OD1 . ASP B 1 95  ? 7.733   -3.396  -61.472 1.00 46.11 ? 95   ASP B OD1 1 
ATOM   4928 O OD2 . ASP B 1 95  ? 7.615   -4.961  -62.989 1.00 47.68 ? 95   ASP B OD2 1 
ATOM   4929 N N   . CYS B 1 96  ? 8.510   -3.272  -58.083 1.00 44.57 ? 96   CYS B N   1 
ATOM   4930 C CA  . CYS B 1 96  ? 7.582   -2.793  -57.066 1.00 44.18 ? 96   CYS B CA  1 
ATOM   4931 C C   . CYS B 1 96  ? 7.491   -1.272  -56.913 1.00 43.94 ? 96   CYS B C   1 
ATOM   4932 O O   . CYS B 1 96  ? 6.788   -0.780  -56.010 1.00 43.91 ? 96   CYS B O   1 
ATOM   4933 C CB  . CYS B 1 96  ? 7.972   -3.426  -55.731 1.00 44.25 ? 96   CYS B CB  1 
ATOM   4934 S SG  . CYS B 1 96  ? 9.588   -2.906  -55.098 1.00 43.89 ? 96   CYS B SG  1 
ATOM   4935 N N   . LEU B 1 97  ? 8.155   -0.519  -57.795 1.00 43.65 ? 97   LEU B N   1 
ATOM   4936 C CA  . LEU B 1 97  ? 8.232   0.930   -57.629 1.00 42.98 ? 97   LEU B CA  1 
ATOM   4937 C C   . LEU B 1 97  ? 6.991   1.649   -58.213 1.00 43.08 ? 97   LEU B C   1 
ATOM   4938 O O   . LEU B 1 97  ? 7.016   2.240   -59.308 1.00 43.16 ? 97   LEU B O   1 
ATOM   4939 C CB  . LEU B 1 97  ? 9.563   1.474   -58.157 1.00 42.70 ? 97   LEU B CB  1 
ATOM   4940 C CG  . LEU B 1 97  ? 10.818  1.039   -57.376 1.00 42.51 ? 97   LEU B CG  1 
ATOM   4941 C CD1 . LEU B 1 97  ? 12.038  1.827   -57.843 1.00 41.01 ? 97   LEU B CD1 1 
ATOM   4942 C CD2 . LEU B 1 97  ? 10.662  1.168   -55.846 1.00 41.22 ? 97   LEU B CD2 1 
ATOM   4943 N N   . TYR B 1 98  ? 5.920   1.602   -57.416 1.00 42.85 ? 98   TYR B N   1 
ATOM   4944 C CA  . TYR B 1 98  ? 4.613   2.163   -57.759 1.00 42.83 ? 98   TYR B CA  1 
ATOM   4945 C C   . TYR B 1 98  ? 4.071   2.976   -56.598 1.00 42.72 ? 98   TYR B C   1 
ATOM   4946 O O   . TYR B 1 98  ? 4.393   2.705   -55.443 1.00 41.89 ? 98   TYR B O   1 
ATOM   4947 C CB  . TYR B 1 98  ? 3.625   1.035   -58.097 1.00 43.23 ? 98   TYR B CB  1 
ATOM   4948 C CG  . TYR B 1 98  ? 4.130   0.149   -59.228 1.00 42.74 ? 98   TYR B CG  1 
ATOM   4949 C CD1 . TYR B 1 98  ? 3.834   0.442   -60.553 1.00 41.70 ? 98   TYR B CD1 1 
ATOM   4950 C CD2 . TYR B 1 98  ? 4.933   -0.954  -58.966 1.00 43.17 ? 98   TYR B CD2 1 
ATOM   4951 C CE1 . TYR B 1 98  ? 4.309   -0.360  -61.597 1.00 44.12 ? 98   TYR B CE1 1 
ATOM   4952 C CE2 . TYR B 1 98  ? 5.436   -1.761  -60.006 1.00 42.82 ? 98   TYR B CE2 1 
ATOM   4953 C CZ  . TYR B 1 98  ? 5.114   -1.457  -61.319 1.00 43.76 ? 98   TYR B CZ  1 
ATOM   4954 O OH  . TYR B 1 98  ? 5.601   -2.226  -62.368 1.00 44.80 ? 98   TYR B OH  1 
ATOM   4955 N N   . LEU B 1 99  ? 3.236   3.965   -56.911 1.00 43.47 ? 99   LEU B N   1 
ATOM   4956 C CA  . LEU B 1 99  ? 2.588   4.773   -55.895 1.00 43.65 ? 99   LEU B CA  1 
ATOM   4957 C C   . LEU B 1 99  ? 1.069   4.860   -56.108 1.00 44.31 ? 99   LEU B C   1 
ATOM   4958 O O   . LEU B 1 99  ? 0.522   4.435   -57.141 1.00 45.21 ? 99   LEU B O   1 
ATOM   4959 C CB  . LEU B 1 99  ? 3.244   6.162   -55.807 1.00 43.81 ? 99   LEU B CB  1 
ATOM   4960 C CG  . LEU B 1 99  ? 3.256   7.073   -57.043 1.00 45.14 ? 99   LEU B CG  1 
ATOM   4961 C CD1 . LEU B 1 99  ? 1.842   7.666   -57.342 1.00 44.39 ? 99   LEU B CD1 1 
ATOM   4962 C CD2 . LEU B 1 99  ? 4.306   8.201   -56.861 1.00 44.35 ? 99   LEU B CD2 1 
ATOM   4963 N N   . ASN B 1 100 ? 0.399   5.364   -55.078 1.00 43.81 ? 100  ASN B N   1 
ATOM   4964 C CA  . ASN B 1 100 ? -1.051  5.364   -54.975 1.00 43.96 ? 100  ASN B CA  1 
ATOM   4965 C C   . ASN B 1 100 ? -1.514  6.775   -54.605 1.00 43.76 ? 100  ASN B C   1 
ATOM   4966 O O   . ASN B 1 100 ? -0.906  7.411   -53.746 1.00 43.27 ? 100  ASN B O   1 
ATOM   4967 C CB  . ASN B 1 100 ? -1.504  4.392   -53.875 1.00 43.30 ? 100  ASN B CB  1 
ATOM   4968 C CG  . ASN B 1 100 ? -0.852  3.026   -53.988 1.00 43.06 ? 100  ASN B CG  1 
ATOM   4969 O OD1 . ASN B 1 100 ? -1.041  2.322   -54.982 1.00 43.39 ? 100  ASN B OD1 1 
ATOM   4970 N ND2 . ASN B 1 100 ? -0.108  2.628   -52.954 1.00 39.37 ? 100  ASN B ND2 1 
ATOM   4971 N N   . VAL B 1 101 ? -2.579  7.241   -55.254 1.00 44.60 ? 101  VAL B N   1 
ATOM   4972 C CA  . VAL B 1 101 ? -3.196  8.550   -54.978 1.00 44.82 ? 101  VAL B CA  1 
ATOM   4973 C C   . VAL B 1 101 ? -4.688  8.358   -54.710 1.00 46.14 ? 101  VAL B C   1 
ATOM   4974 O O   . VAL B 1 101 ? -5.379  7.760   -55.518 1.00 46.22 ? 101  VAL B O   1 
ATOM   4975 C CB  . VAL B 1 101 ? -3.045  9.517   -56.181 1.00 44.89 ? 101  VAL B CB  1 
ATOM   4976 C CG1 . VAL B 1 101 ? -3.640  10.895  -55.862 1.00 44.23 ? 101  VAL B CG1 1 
ATOM   4977 C CG2 . VAL B 1 101 ? -1.587  9.644   -56.607 1.00 43.78 ? 101  VAL B CG2 1 
ATOM   4978 N N   . TRP B 1 102 ? -5.166  8.840   -53.563 1.00 47.51 ? 102  TRP B N   1 
ATOM   4979 C CA  . TRP B 1 102 ? -6.614  9.015   -53.304 1.00 49.11 ? 102  TRP B CA  1 
ATOM   4980 C C   . TRP B 1 102 ? -6.940  10.491  -53.340 1.00 50.04 ? 102  TRP B C   1 
ATOM   4981 O O   . TRP B 1 102 ? -6.178  11.302  -52.815 1.00 49.56 ? 102  TRP B O   1 
ATOM   4982 C CB  . TRP B 1 102 ? -7.012  8.516   -51.918 1.00 48.99 ? 102  TRP B CB  1 
ATOM   4983 C CG  . TRP B 1 102 ? -6.926  7.049   -51.727 1.00 48.74 ? 102  TRP B CG  1 
ATOM   4984 C CD1 . TRP B 1 102 ? -7.951  6.144   -51.826 1.00 49.87 ? 102  TRP B CD1 1 
ATOM   4985 C CD2 . TRP B 1 102 ? -5.764  6.305   -51.364 1.00 46.38 ? 102  TRP B CD2 1 
ATOM   4986 N NE1 . TRP B 1 102 ? -7.489  4.876   -51.557 1.00 49.94 ? 102  TRP B NE1 1 
ATOM   4987 C CE2 . TRP B 1 102 ? -6.149  4.947   -51.270 1.00 47.37 ? 102  TRP B CE2 1 
ATOM   4988 C CE3 . TRP B 1 102 ? -4.436  6.650   -51.115 1.00 47.22 ? 102  TRP B CE3 1 
ATOM   4989 C CZ2 . TRP B 1 102 ? -5.257  3.939   -50.936 1.00 47.24 ? 102  TRP B CZ2 1 
ATOM   4990 C CZ3 . TRP B 1 102 ? -3.536  5.636   -50.780 1.00 47.28 ? 102  TRP B CZ3 1 
ATOM   4991 C CH2 . TRP B 1 102 ? -3.955  4.297   -50.694 1.00 47.28 ? 102  TRP B CH2 1 
ATOM   4992 N N   . THR B 1 103 ? -8.065  10.831  -53.956 1.00 52.05 ? 103  THR B N   1 
ATOM   4993 C CA  . THR B 1 103 ? -8.582  12.200  -53.960 1.00 53.71 ? 103  THR B CA  1 
ATOM   4994 C C   . THR B 1 103 ? -10.082 12.168  -53.732 1.00 55.36 ? 103  THR B C   1 
ATOM   4995 O O   . THR B 1 103 ? -10.705 11.116  -53.882 1.00 55.18 ? 103  THR B O   1 
ATOM   4996 C CB  . THR B 1 103 ? -8.315  12.947  -55.302 1.00 54.21 ? 103  THR B CB  1 
ATOM   4997 O OG1 . THR B 1 103 ? -9.281  12.550  -56.292 1.00 56.68 ? 103  THR B OG1 1 
ATOM   4998 C CG2 . THR B 1 103 ? -6.926  12.660  -55.810 1.00 53.42 ? 103  THR B CG2 1 
ATOM   4999 N N   . PRO B 1 104 ? -10.665 13.320  -53.337 1.00 57.15 ? 104  PRO B N   1 
ATOM   5000 C CA  . PRO B 1 104 ? -12.115 13.481  -53.311 1.00 58.91 ? 104  PRO B CA  1 
ATOM   5001 C C   . PRO B 1 104 ? -12.775 13.255  -54.670 1.00 60.30 ? 104  PRO B C   1 
ATOM   5002 O O   . PRO B 1 104 ? -12.181 13.559  -55.705 1.00 59.95 ? 104  PRO B O   1 
ATOM   5003 C CB  . PRO B 1 104 ? -12.292 14.936  -52.876 1.00 59.28 ? 104  PRO B CB  1 
ATOM   5004 C CG  . PRO B 1 104 ? -11.081 15.220  -52.082 1.00 58.40 ? 104  PRO B CG  1 
ATOM   5005 C CD  . PRO B 1 104 ? -9.986  14.523  -52.827 1.00 56.93 ? 104  PRO B CD  1 
ATOM   5006 N N   . TYR B 1 105 ? -13.986 12.707  -54.635 1.00 62.38 ? 105  TYR B N   1 
ATOM   5007 C CA  . TYR B 1 105 ? -14.837 12.554  -55.809 1.00 64.57 ? 105  TYR B CA  1 
ATOM   5008 C C   . TYR B 1 105 ? -16.062 13.452  -55.633 1.00 67.12 ? 105  TYR B C   1 
ATOM   5009 O O   . TYR B 1 105 ? -16.852 13.238  -54.713 1.00 67.89 ? 105  TYR B O   1 
ATOM   5010 C CB  . TYR B 1 105 ? -15.283 11.093  -55.962 1.00 64.59 ? 105  TYR B CB  1 
ATOM   5011 C CG  . TYR B 1 105 ? -16.011 10.818  -57.257 1.00 65.52 ? 105  TYR B CG  1 
ATOM   5012 C CD1 . TYR B 1 105 ? -15.362 10.208  -58.325 1.00 64.73 ? 105  TYR B CD1 1 
ATOM   5013 C CD2 . TYR B 1 105 ? -17.345 11.194  -57.426 1.00 66.79 ? 105  TYR B CD2 1 
ATOM   5014 C CE1 . TYR B 1 105 ? -16.015 9.967   -59.521 1.00 66.11 ? 105  TYR B CE1 1 
ATOM   5015 C CE2 . TYR B 1 105 ? -18.009 10.956  -58.622 1.00 67.98 ? 105  TYR B CE2 1 
ATOM   5016 C CZ  . TYR B 1 105 ? -17.340 10.339  -59.666 1.00 67.66 ? 105  TYR B CZ  1 
ATOM   5017 O OH  . TYR B 1 105 ? -17.989 10.094  -60.852 1.00 68.68 ? 105  TYR B OH  1 
ATOM   5018 N N   . PRO B 1 106 ? -16.240 14.458  -56.509 1.00 69.29 ? 106  PRO B N   1 
ATOM   5019 C CA  . PRO B 1 106 ? -15.403 14.822  -57.648 1.00 69.73 ? 106  PRO B CA  1 
ATOM   5020 C C   . PRO B 1 106 ? -14.055 15.435  -57.262 1.00 69.44 ? 106  PRO B C   1 
ATOM   5021 O O   . PRO B 1 106 ? -13.879 15.921  -56.146 1.00 68.85 ? 106  PRO B O   1 
ATOM   5022 C CB  . PRO B 1 106 ? -16.263 15.850  -58.398 1.00 71.11 ? 106  PRO B CB  1 
ATOM   5023 C CG  . PRO B 1 106 ? -17.113 16.454  -57.359 1.00 71.37 ? 106  PRO B CG  1 
ATOM   5024 C CD  . PRO B 1 106 ? -17.409 15.352  -56.391 1.00 70.73 ? 106  PRO B CD  1 
ATOM   5025 N N   . ARG B 1 107 ? -13.131 15.383  -58.219 1.00 70.33 ? 107  ARG B N   1 
ATOM   5026 C CA  . ARG B 1 107 ? -11.795 15.975  -58.141 1.00 69.95 ? 107  ARG B CA  1 
ATOM   5027 C C   . ARG B 1 107 ? -11.896 17.406  -57.634 1.00 70.55 ? 107  ARG B C   1 
ATOM   5028 O O   . ARG B 1 107 ? -12.765 18.145  -58.090 1.00 72.14 ? 107  ARG B O   1 
ATOM   5029 C CB  . ARG B 1 107 ? -11.162 15.919  -59.548 1.00 70.45 ? 107  ARG B CB  1 
ATOM   5030 C CG  . ARG B 1 107 ? -9.730  16.451  -59.712 1.00 70.22 ? 107  ARG B CG  1 
ATOM   5031 C CD  . ARG B 1 107 ? -8.766  15.382  -60.295 1.00 72.91 ? 107  ARG B CD  1 
ATOM   5032 N NE  . ARG B 1 107 ? -9.328  14.472  -61.314 1.00 74.59 ? 107  ARG B NE  1 
ATOM   5033 C CZ  . ARG B 1 107 ? -9.176  14.600  -62.639 1.00 76.01 ? 107  ARG B CZ  1 
ATOM   5034 N NH1 . ARG B 1 107 ? -9.721  13.710  -63.464 1.00 75.30 ? 107  ARG B NH1 1 
ATOM   5035 N NH2 . ARG B 1 107 ? -8.487  15.615  -63.160 1.00 77.54 ? 107  ARG B NH2 1 
ATOM   5036 N N   . PRO B 1 108 ? -11.037 17.797  -56.666 1.00 69.76 ? 108  PRO B N   1 
ATOM   5037 C CA  . PRO B 1 108 ? -11.157 19.129  -56.072 1.00 70.33 ? 108  PRO B CA  1 
ATOM   5038 C C   . PRO B 1 108 ? -11.078 20.276  -57.090 1.00 71.29 ? 108  PRO B C   1 
ATOM   5039 O O   . PRO B 1 108 ? -10.304 20.210  -58.051 1.00 70.97 ? 108  PRO B O   1 
ATOM   5040 C CB  . PRO B 1 108 ? -9.965  19.198  -55.104 1.00 69.40 ? 108  PRO B CB  1 
ATOM   5041 C CG  . PRO B 1 108 ? -9.601  17.785  -54.821 1.00 68.16 ? 108  PRO B CG  1 
ATOM   5042 C CD  . PRO B 1 108 ? -9.925  17.028  -56.069 1.00 68.34 ? 108  PRO B CD  1 
ATOM   5043 N N   . ALA B 1 109 ? -11.879 21.316  -56.852 1.00 72.43 ? 109  ALA B N   1 
ATOM   5044 C CA  . ALA B 1 109 ? -11.947 22.496  -57.718 1.00 73.28 ? 109  ALA B CA  1 
ATOM   5045 C C   . ALA B 1 109 ? -10.715 23.405  -57.573 1.00 72.45 ? 109  ALA B C   1 
ATOM   5046 O O   . ALA B 1 109 ? -10.258 24.003  -58.552 1.00 72.98 ? 109  ALA B O   1 
ATOM   5047 C CB  . ALA B 1 109 ? -13.215 23.291  -57.407 1.00 74.90 ? 109  ALA B CB  1 
ATOM   5048 N N   . SER B 1 110 ? -10.196 23.514  -56.351 1.00 70.82 ? 110  SER B N   1 
ATOM   5049 C CA  . SER B 1 110 ? -8.997  24.311  -56.081 1.00 69.63 ? 110  SER B CA  1 
ATOM   5050 C C   . SER B 1 110 ? -7.861  23.431  -55.541 1.00 67.50 ? 110  SER B C   1 
ATOM   5051 O O   . SER B 1 110 ? -8.121  22.357  -54.993 1.00 66.83 ? 110  SER B O   1 
ATOM   5052 C CB  . SER B 1 110 ? -9.330  25.390  -55.066 1.00 70.41 ? 110  SER B CB  1 
ATOM   5053 O OG  . SER B 1 110 ? -9.996  24.801  -53.972 1.00 71.30 ? 110  SER B OG  1 
ATOM   5054 N N   . PRO B 1 111 ? -6.598  23.878  -55.702 1.00 66.05 ? 111  PRO B N   1 
ATOM   5055 C CA  . PRO B 1 111 ? -5.427  23.116  -55.222 1.00 64.20 ? 111  PRO B CA  1 
ATOM   5056 C C   . PRO B 1 111 ? -5.511  22.688  -53.755 1.00 61.83 ? 111  PRO B C   1 
ATOM   5057 O O   . PRO B 1 111 ? -5.670  23.527  -52.879 1.00 61.93 ? 111  PRO B O   1 
ATOM   5058 C CB  . PRO B 1 111 ? -4.267  24.093  -55.442 1.00 64.22 ? 111  PRO B CB  1 
ATOM   5059 C CG  . PRO B 1 111 ? -4.712  24.898  -56.626 1.00 66.03 ? 111  PRO B CG  1 
ATOM   5060 C CD  . PRO B 1 111 ? -6.183  25.119  -56.383 1.00 66.99 ? 111  PRO B CD  1 
ATOM   5061 N N   . THR B 1 112 ? -5.401  21.386  -53.507 1.00 59.57 ? 112  THR B N   1 
ATOM   5062 C CA  . THR B 1 112 ? -5.639  20.822  -52.183 1.00 58.29 ? 112  THR B CA  1 
ATOM   5063 C C   . THR B 1 112 ? -4.350  20.346  -51.518 1.00 56.60 ? 112  THR B C   1 
ATOM   5064 O O   . THR B 1 112 ? -3.490  19.734  -52.167 1.00 56.49 ? 112  THR B O   1 
ATOM   5065 C CB  . THR B 1 112 ? -6.621  19.657  -52.271 1.00 58.29 ? 112  THR B CB  1 
ATOM   5066 O OG1 . THR B 1 112 ? -7.782  20.076  -52.998 1.00 59.80 ? 112  THR B OG1 1 
ATOM   5067 C CG2 . THR B 1 112 ? -7.032  19.189  -50.886 1.00 58.14 ? 112  THR B CG2 1 
ATOM   5068 N N   . PRO B 1 113 ? -4.189  20.637  -50.222 1.00 55.34 ? 113  PRO B N   1 
ATOM   5069 C CA  . PRO B 1 113 ? -3.030  20.113  -49.502 1.00 53.60 ? 113  PRO B CA  1 
ATOM   5070 C C   . PRO B 1 113 ? -2.839  18.609  -49.654 1.00 51.61 ? 113  PRO B C   1 
ATOM   5071 O O   . PRO B 1 113 ? -3.805  17.855  -49.595 1.00 51.98 ? 113  PRO B O   1 
ATOM   5072 C CB  . PRO B 1 113 ? -3.325  20.484  -48.047 1.00 53.66 ? 113  PRO B CB  1 
ATOM   5073 C CG  . PRO B 1 113 ? -4.163  21.698  -48.150 1.00 55.43 ? 113  PRO B CG  1 
ATOM   5074 C CD  . PRO B 1 113 ? -5.005  21.523  -49.373 1.00 56.35 ? 113  PRO B CD  1 
ATOM   5075 N N   . VAL B 1 114 ? -1.587  18.205  -49.841 1.00 49.65 ? 114  VAL B N   1 
ATOM   5076 C CA  . VAL B 1 114 ? -1.219  16.829  -50.101 1.00 48.21 ? 114  VAL B CA  1 
ATOM   5077 C C   . VAL B 1 114 ? -0.532  16.226  -48.886 1.00 47.18 ? 114  VAL B C   1 
ATOM   5078 O O   . VAL B 1 114 ? 0.341   16.846  -48.296 1.00 46.45 ? 114  VAL B O   1 
ATOM   5079 C CB  . VAL B 1 114 ? -0.259  16.733  -51.315 1.00 47.90 ? 114  VAL B CB  1 
ATOM   5080 C CG1 . VAL B 1 114 ? 0.155   15.307  -51.557 1.00 46.10 ? 114  VAL B CG1 1 
ATOM   5081 C CG2 . VAL B 1 114 ? -0.918  17.314  -52.556 1.00 48.09 ? 114  VAL B CG2 1 
ATOM   5082 N N   . LEU B 1 115 ? -0.935  15.010  -48.526 1.00 46.79 ? 115  LEU B N   1 
ATOM   5083 C CA  . LEU B 1 115 ? -0.261  14.208  -47.488 1.00 45.93 ? 115  LEU B CA  1 
ATOM   5084 C C   . LEU B 1 115 ? 0.395   13.008  -48.170 1.00 44.98 ? 115  LEU B C   1 
ATOM   5085 O O   . LEU B 1 115 ? -0.267  12.297  -48.926 1.00 44.80 ? 115  LEU B O   1 
ATOM   5086 C CB  . LEU B 1 115 ? -1.271  13.704  -46.445 1.00 46.20 ? 115  LEU B CB  1 
ATOM   5087 C CG  . LEU B 1 115 ? -1.567  14.539  -45.196 1.00 46.73 ? 115  LEU B CG  1 
ATOM   5088 C CD1 . LEU B 1 115 ? -2.808  14.082  -44.513 1.00 46.82 ? 115  LEU B CD1 1 
ATOM   5089 C CD2 . LEU B 1 115 ? -0.416  14.417  -44.225 1.00 47.33 ? 115  LEU B CD2 1 
ATOM   5090 N N   . ILE B 1 116 ? 1.691   12.808  -47.928 1.00 43.89 ? 116  ILE B N   1 
ATOM   5091 C CA  . ILE B 1 116 ? 2.420   11.673  -48.491 1.00 43.01 ? 116  ILE B CA  1 
ATOM   5092 C C   . ILE B 1 116 ? 2.826   10.743  -47.369 1.00 42.59 ? 116  ILE B C   1 
ATOM   5093 O O   . ILE B 1 116 ? 3.626   11.121  -46.518 1.00 42.53 ? 116  ILE B O   1 
ATOM   5094 C CB  . ILE B 1 116 ? 3.703   12.096  -49.244 1.00 43.24 ? 116  ILE B CB  1 
ATOM   5095 C CG1 . ILE B 1 116 ? 3.395   13.154  -50.318 1.00 43.24 ? 116  ILE B CG1 1 
ATOM   5096 C CG2 . ILE B 1 116 ? 4.391   10.846  -49.857 1.00 41.84 ? 116  ILE B CG2 1 
ATOM   5097 C CD1 . ILE B 1 116 ? 4.602   13.493  -51.232 1.00 42.73 ? 116  ILE B CD1 1 
ATOM   5098 N N   . TRP B 1 117 ? 2.284   9.527   -47.379 1.00 42.37 ? 117  TRP B N   1 
ATOM   5099 C CA  . TRP B 1 117 ? 2.586   8.509   -46.369 1.00 41.75 ? 117  TRP B CA  1 
ATOM   5100 C C   . TRP B 1 117 ? 3.795   7.697   -46.770 1.00 41.89 ? 117  TRP B C   1 
ATOM   5101 O O   . TRP B 1 117 ? 3.877   7.232   -47.917 1.00 41.87 ? 117  TRP B O   1 
ATOM   5102 C CB  . TRP B 1 117 ? 1.390   7.560   -46.213 1.00 42.26 ? 117  TRP B CB  1 
ATOM   5103 C CG  . TRP B 1 117 ? 1.620   6.459   -45.280 1.00 41.91 ? 117  TRP B CG  1 
ATOM   5104 C CD1 . TRP B 1 117 ? 1.791   5.145   -45.592 1.00 41.96 ? 117  TRP B CD1 1 
ATOM   5105 C CD2 . TRP B 1 117 ? 1.747   6.556   -43.857 1.00 42.54 ? 117  TRP B CD2 1 
ATOM   5106 N NE1 . TRP B 1 117 ? 2.003   4.413   -44.449 1.00 42.08 ? 117  TRP B NE1 1 
ATOM   5107 C CE2 . TRP B 1 117 ? 1.974   5.253   -43.369 1.00 42.22 ? 117  TRP B CE2 1 
ATOM   5108 C CE3 . TRP B 1 117 ? 1.686   7.617   -42.946 1.00 41.70 ? 117  TRP B CE3 1 
ATOM   5109 C CZ2 . TRP B 1 117 ? 2.133   4.983   -42.009 1.00 42.93 ? 117  TRP B CZ2 1 
ATOM   5110 C CZ3 . TRP B 1 117 ? 1.842   7.347   -41.601 1.00 41.56 ? 117  TRP B CZ3 1 
ATOM   5111 C CH2 . TRP B 1 117 ? 2.062   6.040   -41.142 1.00 41.52 ? 117  TRP B CH2 1 
ATOM   5112 N N   . ILE B 1 118 ? 4.711   7.509   -45.811 1.00 42.10 ? 118  ILE B N   1 
ATOM   5113 C CA  . ILE B 1 118 ? 5.891   6.644   -45.946 1.00 41.80 ? 118  ILE B CA  1 
ATOM   5114 C C   . ILE B 1 118 ? 5.798   5.576   -44.843 1.00 42.66 ? 118  ILE B C   1 
ATOM   5115 O O   . ILE B 1 118 ? 5.936   5.872   -43.651 1.00 43.04 ? 118  ILE B O   1 
ATOM   5116 C CB  . ILE B 1 118 ? 7.239   7.442   -45.817 1.00 41.67 ? 118  ILE B CB  1 
ATOM   5117 C CG1 . ILE B 1 118 ? 7.283   8.605   -46.806 1.00 41.04 ? 118  ILE B CG1 1 
ATOM   5118 C CG2 . ILE B 1 118 ? 8.456   6.543   -46.092 1.00 40.65 ? 118  ILE B CG2 1 
ATOM   5119 C CD1 . ILE B 1 118 ? 8.499   9.474   -46.677 1.00 40.13 ? 118  ILE B CD1 1 
ATOM   5120 N N   . TYR B 1 119 ? 5.551   4.338   -45.237 1.00 43.42 ? 119  TYR B N   1 
ATOM   5121 C CA  . TYR B 1 119 ? 5.389   3.243   -44.284 1.00 43.30 ? 119  TYR B CA  1 
ATOM   5122 C C   . TYR B 1 119 ? 6.671   2.876   -43.543 1.00 43.63 ? 119  TYR B C   1 
ATOM   5123 O O   . TYR B 1 119 ? 7.782   3.139   -44.031 1.00 42.98 ? 119  TYR B O   1 
ATOM   5124 C CB  . TYR B 1 119 ? 4.841   1.985   -44.978 1.00 43.46 ? 119  TYR B CB  1 
ATOM   5125 C CG  . TYR B 1 119 ? 5.650   1.417   -46.145 1.00 42.66 ? 119  TYR B CG  1 
ATOM   5126 C CD1 . TYR B 1 119 ? 6.811   0.695   -45.929 1.00 42.42 ? 119  TYR B CD1 1 
ATOM   5127 C CD2 . TYR B 1 119 ? 5.197   1.535   -47.463 1.00 42.76 ? 119  TYR B CD2 1 
ATOM   5128 C CE1 . TYR B 1 119 ? 7.535   0.153   -46.979 1.00 41.05 ? 119  TYR B CE1 1 
ATOM   5129 C CE2 . TYR B 1 119 ? 5.919   0.992   -48.527 1.00 41.81 ? 119  TYR B CE2 1 
ATOM   5130 C CZ  . TYR B 1 119 ? 7.090   0.299   -48.273 1.00 41.90 ? 119  TYR B CZ  1 
ATOM   5131 O OH  . TYR B 1 119 ? 7.822   -0.264  -49.289 1.00 40.37 ? 119  TYR B OH  1 
ATOM   5132 N N   . GLY B 1 120 ? 6.482   2.250   -42.373 1.00 43.70 ? 120  GLY B N   1 
ATOM   5133 C CA  . GLY B 1 120 ? 7.558   1.626   -41.597 1.00 43.54 ? 120  GLY B CA  1 
ATOM   5134 C C   . GLY B 1 120 ? 7.614   0.125   -41.791 1.00 44.02 ? 120  GLY B C   1 
ATOM   5135 O O   . GLY B 1 120 ? 6.989   -0.407  -42.711 1.00 45.05 ? 120  GLY B O   1 
ATOM   5136 N N   . GLY B 1 121 ? 8.350   -0.554  -40.912 1.00 43.83 ? 121  GLY B N   1 
ATOM   5137 C CA  . GLY B 1 121 ? 8.790   -1.938  -41.128 1.00 44.51 ? 121  GLY B CA  1 
ATOM   5138 C C   . GLY B 1 121 ? 10.301  -2.161  -41.022 1.00 44.75 ? 121  GLY B C   1 
ATOM   5139 O O   . GLY B 1 121 ? 10.850  -3.029  -41.699 1.00 45.16 ? 121  GLY B O   1 
ATOM   5140 N N   . GLY B 1 122 ? 10.981  -1.371  -40.185 1.00 44.93 ? 122  GLY B N   1 
ATOM   5141 C CA  . GLY B 1 122 ? 12.408  -1.545  -39.907 1.00 45.06 ? 122  GLY B CA  1 
ATOM   5142 C C   . GLY B 1 122 ? 13.327  -1.475  -41.114 1.00 45.52 ? 122  GLY B C   1 
ATOM   5143 O O   . GLY B 1 122 ? 14.438  -2.013  -41.081 1.00 46.07 ? 122  GLY B O   1 
ATOM   5144 N N   . PHE B 1 123 ? 12.860  -0.825  -42.181 1.00 45.20 ? 123  PHE B N   1 
ATOM   5145 C CA  . PHE B 1 123 ? 13.560  -0.782  -43.469 1.00 45.30 ? 123  PHE B CA  1 
ATOM   5146 C C   . PHE B 1 123 ? 13.757  -2.146  -44.128 1.00 46.07 ? 123  PHE B C   1 
ATOM   5147 O O   . PHE B 1 123 ? 14.497  -2.229  -45.119 1.00 47.25 ? 123  PHE B O   1 
ATOM   5148 C CB  . PHE B 1 123 ? 14.931  -0.089  -43.348 1.00 45.44 ? 123  PHE B CB  1 
ATOM   5149 C CG  . PHE B 1 123 ? 14.857  1.350   -42.986 1.00 44.39 ? 123  PHE B CG  1 
ATOM   5150 C CD1 . PHE B 1 123 ? 14.427  2.282   -43.917 1.00 45.04 ? 123  PHE B CD1 1 
ATOM   5151 C CD2 . PHE B 1 123 ? 15.255  1.791   -41.724 1.00 45.41 ? 123  PHE B CD2 1 
ATOM   5152 C CE1 . PHE B 1 123 ? 14.352  3.625   -43.590 1.00 43.46 ? 123  PHE B CE1 1 
ATOM   5153 C CE2 . PHE B 1 123 ? 15.200  3.133   -41.385 1.00 43.05 ? 123  PHE B CE2 1 
ATOM   5154 C CZ  . PHE B 1 123 ? 14.743  4.056   -42.327 1.00 44.42 ? 123  PHE B CZ  1 
ATOM   5155 N N   . TYR B 1 124 ? 13.112  -3.194  -43.593 1.00 45.90 ? 124  TYR B N   1 
ATOM   5156 C CA  . TYR B 1 124 ? 13.196  -4.551  -44.128 1.00 46.16 ? 124  TYR B CA  1 
ATOM   5157 C C   . TYR B 1 124 ? 11.835  -5.067  -44.614 1.00 46.04 ? 124  TYR B C   1 
ATOM   5158 O O   . TYR B 1 124 ? 11.754  -6.162  -45.176 1.00 45.57 ? 124  TYR B O   1 
ATOM   5159 C CB  . TYR B 1 124 ? 13.779  -5.529  -43.078 1.00 47.25 ? 124  TYR B CB  1 
ATOM   5160 C CG  . TYR B 1 124 ? 12.823  -5.916  -41.963 1.00 47.54 ? 124  TYR B CG  1 
ATOM   5161 C CD1 . TYR B 1 124 ? 11.927  -6.969  -42.124 1.00 48.42 ? 124  TYR B CD1 1 
ATOM   5162 C CD2 . TYR B 1 124 ? 12.801  -5.215  -40.759 1.00 48.54 ? 124  TYR B CD2 1 
ATOM   5163 C CE1 . TYR B 1 124 ? 11.034  -7.309  -41.126 1.00 48.28 ? 124  TYR B CE1 1 
ATOM   5164 C CE2 . TYR B 1 124 ? 11.910  -5.552  -39.745 1.00 47.92 ? 124  TYR B CE2 1 
ATOM   5165 C CZ  . TYR B 1 124 ? 11.030  -6.602  -39.938 1.00 48.70 ? 124  TYR B CZ  1 
ATOM   5166 O OH  . TYR B 1 124 ? 10.143  -6.954  -38.944 1.00 49.07 ? 124  TYR B OH  1 
ATOM   5167 N N   . SER B 1 125 ? 10.776  -4.281  -44.408 1.00 45.20 ? 125  SER B N   1 
ATOM   5168 C CA  . SER B 1 125 ? 9.424   -4.734  -44.691 1.00 45.18 ? 125  SER B CA  1 
ATOM   5169 C C   . SER B 1 125 ? 8.471   -3.563  -44.873 1.00 44.47 ? 125  SER B C   1 
ATOM   5170 O O   . SER B 1 125 ? 8.856   -2.412  -44.701 1.00 43.84 ? 125  SER B O   1 
ATOM   5171 C CB  . SER B 1 125 ? 8.936   -5.617  -43.543 1.00 45.70 ? 125  SER B CB  1 
ATOM   5172 O OG  . SER B 1 125 ? 8.831   -4.864  -42.346 1.00 45.31 ? 125  SER B OG  1 
ATOM   5173 N N   . GLY B 1 126 ? 7.233   -3.879  -45.255 1.00 44.72 ? 126  GLY B N   1 
ATOM   5174 C CA  . GLY B 1 126 ? 6.163   -2.896  -45.425 1.00 44.14 ? 126  GLY B CA  1 
ATOM   5175 C C   . GLY B 1 126 ? 5.645   -2.775  -46.841 1.00 44.03 ? 126  GLY B C   1 
ATOM   5176 O O   . GLY B 1 126 ? 6.300   -3.194  -47.796 1.00 43.40 ? 126  GLY B O   1 
ATOM   5177 N N   . ALA B 1 127 ? 4.457   -2.181  -46.962 1.00 43.85 ? 127  ALA B N   1 
ATOM   5178 C CA  . ALA B 1 127 ? 3.820   -1.940  -48.256 1.00 44.22 ? 127  ALA B CA  1 
ATOM   5179 C C   . ALA B 1 127 ? 2.804   -0.827  -48.134 1.00 44.50 ? 127  ALA B C   1 
ATOM   5180 O O   . ALA B 1 127 ? 2.154   -0.694  -47.102 1.00 44.57 ? 127  ALA B O   1 
ATOM   5181 C CB  . ALA B 1 127 ? 3.139   -3.221  -48.772 1.00 45.09 ? 127  ALA B CB  1 
ATOM   5182 N N   . ALA B 1 128 ? 2.652   -0.038  -49.191 1.00 44.73 ? 128  ALA B N   1 
ATOM   5183 C CA  . ALA B 1 128 ? 1.629   1.013   -49.226 1.00 45.34 ? 128  ALA B CA  1 
ATOM   5184 C C   . ALA B 1 128 ? 0.199   0.447   -49.362 1.00 46.35 ? 128  ALA B C   1 
ATOM   5185 O O   . ALA B 1 128 ? -0.775  1.189   -49.207 1.00 46.68 ? 128  ALA B O   1 
ATOM   5186 C CB  . ALA B 1 128 ? 1.917   1.987   -50.360 1.00 44.71 ? 128  ALA B CB  1 
ATOM   5187 N N   . SER B 1 129 ? 0.084   -0.857  -49.628 1.00 47.20 ? 129  SER B N   1 
ATOM   5188 C CA  . SER B 1 129 ? -1.203  -1.515  -49.886 1.00 48.37 ? 129  SER B CA  1 
ATOM   5189 C C   . SER B 1 129 ? -1.883  -2.135  -48.650 1.00 49.26 ? 129  SER B C   1 
ATOM   5190 O O   . SER B 1 129 ? -2.986  -2.650  -48.753 1.00 50.75 ? 129  SER B O   1 
ATOM   5191 C CB  . SER B 1 129 ? -1.021  -2.581  -50.962 1.00 48.67 ? 129  SER B CB  1 
ATOM   5192 O OG  . SER B 1 129 ? -0.075  -3.550  -50.558 1.00 49.89 ? 129  SER B OG  1 
ATOM   5193 N N   . LEU B 1 130 ? -1.252  -2.063  -47.485 1.00 49.67 ? 130  LEU B N   1 
ATOM   5194 C CA  . LEU B 1 130 ? -1.854  -2.588  -46.258 1.00 50.20 ? 130  LEU B CA  1 
ATOM   5195 C C   . LEU B 1 130 ? -3.162  -1.859  -45.954 1.00 51.05 ? 130  LEU B C   1 
ATOM   5196 O O   . LEU B 1 130 ? -3.325  -0.686  -46.301 1.00 50.76 ? 130  LEU B O   1 
ATOM   5197 C CB  . LEU B 1 130 ? -0.885  -2.454  -45.079 1.00 49.56 ? 130  LEU B CB  1 
ATOM   5198 C CG  . LEU B 1 130 ? 0.477   -3.155  -45.225 1.00 49.01 ? 130  LEU B CG  1 
ATOM   5199 C CD1 . LEU B 1 130 ? 1.325   -2.984  -43.953 1.00 44.77 ? 130  LEU B CD1 1 
ATOM   5200 C CD2 . LEU B 1 130 ? 0.312   -4.642  -45.617 1.00 48.65 ? 130  LEU B CD2 1 
ATOM   5201 N N   . ASP B 1 131 ? -4.106  -2.566  -45.336 1.00 52.31 ? 131  ASP B N   1 
ATOM   5202 C CA  . ASP B 1 131 ? -5.428  -1.994  -45.069 1.00 53.27 ? 131  ASP B CA  1 
ATOM   5203 C C   . ASP B 1 131 ? -5.366  -0.764  -44.176 1.00 52.28 ? 131  ASP B C   1 
ATOM   5204 O O   . ASP B 1 131 ? -6.176  0.136   -44.340 1.00 52.70 ? 131  ASP B O   1 
ATOM   5205 C CB  . ASP B 1 131 ? -6.352  -3.000  -44.386 1.00 54.80 ? 131  ASP B CB  1 
ATOM   5206 C CG  . ASP B 1 131 ? -6.728  -4.176  -45.273 1.00 57.83 ? 131  ASP B CG  1 
ATOM   5207 O OD1 . ASP B 1 131 ? -6.544  -4.122  -46.516 1.00 59.33 ? 131  ASP B OD1 1 
ATOM   5208 O OD2 . ASP B 1 131 ? -7.223  -5.167  -44.691 1.00 61.46 ? 131  ASP B OD2 1 
ATOM   5209 N N   . VAL B 1 132 ? -4.442  -0.746  -43.213 1.00 51.38 ? 132  VAL B N   1 
ATOM   5210 C CA  . VAL B 1 132 ? -4.330  0.373   -42.256 1.00 50.87 ? 132  VAL B CA  1 
ATOM   5211 C C   . VAL B 1 132 ? -3.835  1.669   -42.873 1.00 49.61 ? 132  VAL B C   1 
ATOM   5212 O O   . VAL B 1 132 ? -3.944  2.718   -42.239 1.00 49.86 ? 132  VAL B O   1 
ATOM   5213 C CB  . VAL B 1 132 ? -3.370  0.070   -41.055 1.00 50.75 ? 132  VAL B CB  1 
ATOM   5214 C CG1 . VAL B 1 132 ? -4.095  -0.693  -39.967 1.00 53.17 ? 132  VAL B CG1 1 
ATOM   5215 C CG2 . VAL B 1 132 ? -2.115  -0.665  -41.521 1.00 50.73 ? 132  VAL B CG2 1 
ATOM   5216 N N   . TYR B 1 133 ? -3.257  1.596   -44.073 1.00 48.54 ? 133  TYR B N   1 
ATOM   5217 C CA  . TYR B 1 133 ? -2.780  2.777   -44.785 1.00 47.98 ? 133  TYR B CA  1 
ATOM   5218 C C   . TYR B 1 133 ? -3.780  3.253   -45.849 1.00 48.77 ? 133  TYR B C   1 
ATOM   5219 O O   . TYR B 1 133 ? -3.440  4.055   -46.720 1.00 48.37 ? 133  TYR B O   1 
ATOM   5220 C CB  . TYR B 1 133 ? -1.429  2.495   -45.436 1.00 46.79 ? 133  TYR B CB  1 
ATOM   5221 C CG  . TYR B 1 133 ? -0.362  1.929   -44.515 1.00 45.40 ? 133  TYR B CG  1 
ATOM   5222 C CD1 . TYR B 1 133 ? -0.336  2.236   -43.160 1.00 43.66 ? 133  TYR B CD1 1 
ATOM   5223 C CD2 . TYR B 1 133 ? 0.639   1.096   -45.020 1.00 44.16 ? 133  TYR B CD2 1 
ATOM   5224 C CE1 . TYR B 1 133 ? 0.634   1.706   -42.319 1.00 44.15 ? 133  TYR B CE1 1 
ATOM   5225 C CE2 . TYR B 1 133 ? 1.634   0.568   -44.188 1.00 44.77 ? 133  TYR B CE2 1 
ATOM   5226 C CZ  . TYR B 1 133 ? 1.627   0.877   -42.839 1.00 45.02 ? 133  TYR B CZ  1 
ATOM   5227 O OH  . TYR B 1 133 ? 2.593   0.372   -42.003 1.00 43.29 ? 133  TYR B OH  1 
ATOM   5228 N N   . ASP B 1 134 ? -5.010  2.755   -45.762 1.00 49.64 ? 134  ASP B N   1 
ATOM   5229 C CA  . ASP B 1 134 ? -6.073  3.093   -46.698 1.00 50.48 ? 134  ASP B CA  1 
ATOM   5230 C C   . ASP B 1 134 ? -6.405  4.575   -46.611 1.00 50.68 ? 134  ASP B C   1 
ATOM   5231 O O   . ASP B 1 134 ? -6.809  5.063   -45.559 1.00 51.38 ? 134  ASP B O   1 
ATOM   5232 C CB  . ASP B 1 134 ? -7.304  2.249   -46.362 1.00 51.37 ? 134  ASP B CB  1 
ATOM   5233 C CG  . ASP B 1 134 ? -8.417  2.386   -47.370 1.00 52.77 ? 134  ASP B CG  1 
ATOM   5234 O OD1 . ASP B 1 134 ? -8.371  3.272   -48.237 1.00 53.69 ? 134  ASP B OD1 1 
ATOM   5235 O OD2 . ASP B 1 134 ? -9.357  1.576   -47.294 1.00 56.84 ? 134  ASP B OD2 1 
ATOM   5236 N N   . GLY B 1 135 ? -6.253  5.279   -47.728 1.00 50.95 ? 135  GLY B N   1 
ATOM   5237 C CA  . GLY B 1 135 ? -6.412  6.734   -47.780 1.00 51.06 ? 135  GLY B CA  1 
ATOM   5238 C C   . GLY B 1 135 ? -7.811  7.269   -48.066 1.00 52.34 ? 135  GLY B C   1 
ATOM   5239 O O   . GLY B 1 135 ? -8.003  8.483   -48.169 1.00 52.24 ? 135  GLY B O   1 
ATOM   5240 N N   . ARG B 1 136 ? -8.797  6.390   -48.198 1.00 53.52 ? 136  ARG B N   1 
ATOM   5241 C CA  . ARG B 1 136 ? -10.120 6.841   -48.626 1.00 54.97 ? 136  ARG B CA  1 
ATOM   5242 C C   . ARG B 1 136 ? -10.820 7.719   -47.580 1.00 54.96 ? 136  ARG B C   1 
ATOM   5243 O O   . ARG B 1 136 ? -11.584 8.625   -47.936 1.00 55.48 ? 136  ARG B O   1 
ATOM   5244 C CB  . ARG B 1 136 ? -11.002 5.652   -49.033 1.00 56.05 ? 136  ARG B CB  1 
ATOM   5245 C CG  . ARG B 1 136 ? -11.588 4.848   -47.884 1.00 58.27 ? 136  ARG B CG  1 
ATOM   5246 C CD  . ARG B 1 136 ? -11.528 3.350   -48.183 1.00 61.39 ? 136  ARG B CD  1 
ATOM   5247 N NE  . ARG B 1 136 ? -12.563 2.872   -49.075 1.00 63.51 ? 136  ARG B NE  1 
ATOM   5248 C CZ  . ARG B 1 136 ? -12.463 1.794   -49.865 1.00 64.65 ? 136  ARG B CZ  1 
ATOM   5249 N NH1 . ARG B 1 136 ? -11.353 1.049   -49.932 1.00 63.64 ? 136  ARG B NH1 1 
ATOM   5250 N NH2 . ARG B 1 136 ? -13.497 1.454   -50.617 1.00 64.90 ? 136  ARG B NH2 1 
ATOM   5251 N N   . PHE B 1 137 ? -10.551 7.473   -46.300 1.00 54.00 ? 137  PHE B N   1 
ATOM   5252 C CA  . PHE B 1 137 ? -11.236 8.224   -45.241 1.00 54.22 ? 137  PHE B CA  1 
ATOM   5253 C C   . PHE B 1 137 ? -10.716 9.652   -45.146 1.00 53.09 ? 137  PHE B C   1 
ATOM   5254 O O   . PHE B 1 137 ? -11.497 10.581  -45.071 1.00 53.48 ? 137  PHE B O   1 
ATOM   5255 C CB  . PHE B 1 137 ? -11.121 7.519   -43.885 1.00 54.46 ? 137  PHE B CB  1 
ATOM   5256 C CG  . PHE B 1 137 ? -11.482 6.072   -43.938 1.00 54.29 ? 137  PHE B CG  1 
ATOM   5257 C CD1 . PHE B 1 137 ? -12.808 5.681   -43.962 1.00 56.51 ? 137  PHE B CD1 1 
ATOM   5258 C CD2 . PHE B 1 137 ? -10.495 5.100   -43.983 1.00 54.01 ? 137  PHE B CD2 1 
ATOM   5259 C CE1 . PHE B 1 137 ? -13.150 4.327   -44.037 1.00 57.63 ? 137  PHE B CE1 1 
ATOM   5260 C CE2 . PHE B 1 137 ? -10.820 3.750   -44.049 1.00 54.92 ? 137  PHE B CE2 1 
ATOM   5261 C CZ  . PHE B 1 137 ? -12.153 3.361   -44.078 1.00 55.90 ? 137  PHE B CZ  1 
ATOM   5262 N N   . LEU B 1 138 ? -9.400  9.833   -45.152 1.00 51.53 ? 138  LEU B N   1 
ATOM   5263 C CA  . LEU B 1 138 ? -8.840  11.197  -45.143 1.00 50.75 ? 138  LEU B CA  1 
ATOM   5264 C C   . LEU B 1 138 ? -9.287  11.973  -46.380 1.00 51.39 ? 138  LEU B C   1 
ATOM   5265 O O   . LEU B 1 138 ? -9.591  13.169  -46.297 1.00 51.49 ? 138  LEU B O   1 
ATOM   5266 C CB  . LEU B 1 138 ? -7.316  11.171  -45.053 1.00 49.32 ? 138  LEU B CB  1 
ATOM   5267 C CG  . LEU B 1 138 ? -6.773  10.778  -43.676 1.00 47.85 ? 138  LEU B CG  1 
ATOM   5268 C CD1 . LEU B 1 138 ? -5.337  10.279  -43.787 1.00 45.96 ? 138  LEU B CD1 1 
ATOM   5269 C CD2 . LEU B 1 138 ? -6.876  11.938  -42.694 1.00 45.92 ? 138  LEU B CD2 1 
ATOM   5270 N N   . ALA B 1 139 ? -9.349  11.273  -47.514 1.00 51.54 ? 139  ALA B N   1 
ATOM   5271 C CA  . ALA B 1 139 ? -9.781  11.859  -48.781 1.00 52.43 ? 139  ALA B CA  1 
ATOM   5272 C C   . ALA B 1 139 ? -11.225 12.339  -48.702 1.00 53.88 ? 139  ALA B C   1 
ATOM   5273 O O   . ALA B 1 139 ? -11.514 13.497  -48.990 1.00 54.55 ? 139  ALA B O   1 
ATOM   5274 C CB  . ALA B 1 139 ? -9.625  10.846  -49.920 1.00 51.71 ? 139  ALA B CB  1 
ATOM   5275 N N   . GLN B 1 140 ? -12.123 11.443  -48.300 1.00 54.84 ? 140  GLN B N   1 
ATOM   5276 C CA  . GLN B 1 140 ? -13.545 11.730  -48.309 1.00 56.06 ? 140  GLN B CA  1 
ATOM   5277 C C   . GLN B 1 140 ? -13.925 12.732  -47.227 1.00 56.87 ? 140  GLN B C   1 
ATOM   5278 O O   . GLN B 1 140 ? -14.638 13.695  -47.493 1.00 57.73 ? 140  GLN B O   1 
ATOM   5279 C CB  . GLN B 1 140 ? -14.353 10.436  -48.139 1.00 56.84 ? 140  GLN B CB  1 
ATOM   5280 C CG  . GLN B 1 140 ? -15.800 10.529  -48.650 1.00 57.50 ? 140  GLN B CG  1 
ATOM   5281 C CD  . GLN B 1 140 ? -16.703 11.296  -47.713 1.00 58.56 ? 140  GLN B CD  1 
ATOM   5282 O OE1 . GLN B 1 140 ? -16.654 11.115  -46.501 1.00 59.31 ? 140  GLN B OE1 1 
ATOM   5283 N NE2 . GLN B 1 140 ? -17.534 12.159  -48.269 1.00 60.31 ? 140  GLN B NE2 1 
ATOM   5284 N N   . VAL B 1 141 ? -13.447 12.501  -46.011 1.00 56.69 ? 141  VAL B N   1 
ATOM   5285 C CA  . VAL B 1 141 ? -13.911 13.258  -44.845 1.00 57.48 ? 141  VAL B CA  1 
ATOM   5286 C C   . VAL B 1 141 ? -13.222 14.611  -44.724 1.00 57.38 ? 141  VAL B C   1 
ATOM   5287 O O   . VAL B 1 141 ? -13.868 15.604  -44.402 1.00 58.08 ? 141  VAL B O   1 
ATOM   5288 C CB  . VAL B 1 141 ? -13.698 12.463  -43.542 1.00 57.26 ? 141  VAL B CB  1 
ATOM   5289 C CG1 . VAL B 1 141 ? -14.226 13.236  -42.345 1.00 57.34 ? 141  VAL B CG1 1 
ATOM   5290 C CG2 . VAL B 1 141 ? -14.380 11.096  -43.641 1.00 57.45 ? 141  VAL B CG2 1 
ATOM   5291 N N   . GLU B 1 142 ? -11.918 14.654  -44.992 1.00 56.29 ? 142  GLU B N   1 
ATOM   5292 C CA  . GLU B 1 142 ? -11.155 15.893  -44.849 1.00 56.16 ? 142  GLU B CA  1 
ATOM   5293 C C   . GLU B 1 142 ? -10.817 16.567  -46.175 1.00 56.14 ? 142  GLU B C   1 
ATOM   5294 O O   . GLU B 1 142 ? -10.227 17.647  -46.185 1.00 56.42 ? 142  GLU B O   1 
ATOM   5295 C CB  . GLU B 1 142 ? -9.879  15.641  -44.040 1.00 55.22 ? 142  GLU B CB  1 
ATOM   5296 C CG  . GLU B 1 142 ? -10.122 15.310  -42.575 1.00 55.89 ? 142  GLU B CG  1 
ATOM   5297 C CD  . GLU B 1 142 ? -10.773 16.449  -41.802 1.00 58.66 ? 142  GLU B CD  1 
ATOM   5298 O OE1 . GLU B 1 142 ? -10.660 17.624  -42.217 1.00 58.96 ? 142  GLU B OE1 1 
ATOM   5299 O OE2 . GLU B 1 142 ? -11.405 16.162  -40.765 1.00 61.31 ? 142  GLU B OE2 1 
ATOM   5300 N N   . GLY B 1 143 ? -11.201 15.953  -47.287 1.00 56.53 ? 143  GLY B N   1 
ATOM   5301 C CA  . GLY B 1 143 ? -10.964 16.540  -48.602 1.00 56.86 ? 143  GLY B CA  1 
ATOM   5302 C C   . GLY B 1 143 ? -9.501  16.523  -49.009 1.00 56.11 ? 143  GLY B C   1 
ATOM   5303 O O   . GLY B 1 143 ? -9.078  17.312  -49.856 1.00 56.94 ? 143  GLY B O   1 
ATOM   5304 N N   . ALA B 1 144 ? -8.720  15.623  -48.414 1.00 55.02 ? 144  ALA B N   1 
ATOM   5305 C CA  . ALA B 1 144 ? -7.278  15.579  -48.645 1.00 53.53 ? 144  ALA B CA  1 
ATOM   5306 C C   . ALA B 1 144 ? -6.917  14.782  -49.895 1.00 52.91 ? 144  ALA B C   1 
ATOM   5307 O O   . ALA B 1 144 ? -7.631  13.862  -50.279 1.00 53.68 ? 144  ALA B O   1 
ATOM   5308 C CB  . ALA B 1 144 ? -6.586  14.976  -47.438 1.00 52.63 ? 144  ALA B CB  1 
ATOM   5309 N N   . VAL B 1 145 ? -5.801  15.151  -50.517 1.00 51.95 ? 145  VAL B N   1 
ATOM   5310 C CA  . VAL B 1 145 ? -5.140  14.320  -51.508 1.00 50.89 ? 145  VAL B CA  1 
ATOM   5311 C C   . VAL B 1 145 ? -4.047  13.512  -50.798 1.00 49.89 ? 145  VAL B C   1 
ATOM   5312 O O   . VAL B 1 145 ? -3.086  14.076  -50.258 1.00 49.76 ? 145  VAL B O   1 
ATOM   5313 C CB  . VAL B 1 145 ? -4.551  15.158  -52.667 1.00 51.00 ? 145  VAL B CB  1 
ATOM   5314 C CG1 . VAL B 1 145 ? -3.717  14.271  -53.613 1.00 49.85 ? 145  VAL B CG1 1 
ATOM   5315 C CG2 . VAL B 1 145 ? -5.669  15.844  -53.435 1.00 50.60 ? 145  VAL B CG2 1 
ATOM   5316 N N   . LEU B 1 146 ? -4.212  12.195  -50.771 1.00 49.29 ? 146  LEU B N   1 
ATOM   5317 C CA  . LEU B 1 146 ? -3.271  11.327  -50.078 1.00 48.55 ? 146  LEU B CA  1 
ATOM   5318 C C   . LEU B 1 146 ? -2.428  10.508  -51.056 1.00 47.58 ? 146  LEU B C   1 
ATOM   5319 O O   . LEU B 1 146 ? -2.953  9.863   -51.963 1.00 47.96 ? 146  LEU B O   1 
ATOM   5320 C CB  . LEU B 1 146 ? -3.993  10.413  -49.085 1.00 48.99 ? 146  LEU B CB  1 
ATOM   5321 C CG  . LEU B 1 146 ? -3.001  9.762   -48.105 1.00 50.14 ? 146  LEU B CG  1 
ATOM   5322 C CD1 . LEU B 1 146 ? -3.500  9.844   -46.689 1.00 49.67 ? 146  LEU B CD1 1 
ATOM   5323 C CD2 . LEU B 1 146 ? -2.642  8.292   -48.533 1.00 50.15 ? 146  LEU B CD2 1 
ATOM   5324 N N   . VAL B 1 147 ? -1.109  10.565  -50.885 1.00 46.16 ? 147  VAL B N   1 
ATOM   5325 C CA  . VAL B 1 147 ? -0.201  9.775   -51.714 1.00 45.02 ? 147  VAL B CA  1 
ATOM   5326 C C   . VAL B 1 147 ? 0.572   8.801   -50.830 1.00 44.51 ? 147  VAL B C   1 
ATOM   5327 O O   . VAL B 1 147 ? 0.920   9.122   -49.687 1.00 43.91 ? 147  VAL B O   1 
ATOM   5328 C CB  . VAL B 1 147 ? 0.773   10.679  -52.486 1.00 45.04 ? 147  VAL B CB  1 
ATOM   5329 C CG1 . VAL B 1 147 ? 1.643   9.872   -53.446 1.00 42.61 ? 147  VAL B CG1 1 
ATOM   5330 C CG2 . VAL B 1 147 ? 0.005   11.785  -53.217 1.00 45.23 ? 147  VAL B CG2 1 
ATOM   5331 N N   . SER B 1 148 ? 0.803   7.594   -51.347 1.00 44.24 ? 148  SER B N   1 
ATOM   5332 C CA  . SER B 1 148 ? 1.730   6.650   -50.713 1.00 43.52 ? 148  SER B CA  1 
ATOM   5333 C C   . SER B 1 148 ? 2.513   5.901   -51.778 1.00 43.21 ? 148  SER B C   1 
ATOM   5334 O O   . SER B 1 148 ? 1.970   5.567   -52.815 1.00 44.12 ? 148  SER B O   1 
ATOM   5335 C CB  . SER B 1 148 ? 0.978   5.661   -49.819 1.00 43.29 ? 148  SER B CB  1 
ATOM   5336 O OG  . SER B 1 148 ? 0.041   4.922   -50.569 1.00 44.70 ? 148  SER B OG  1 
ATOM   5337 N N   . MET B 1 149 ? 3.787   5.636   -51.515 1.00 42.98 ? 149  MET B N   1 
ATOM   5338 C CA  . MET B 1 149 ? 4.639   4.911   -52.458 1.00 43.47 ? 149  MET B CA  1 
ATOM   5339 C C   . MET B 1 149 ? 5.198   3.655   -51.838 1.00 43.61 ? 149  MET B C   1 
ATOM   5340 O O   . MET B 1 149 ? 5.349   3.568   -50.621 1.00 44.03 ? 149  MET B O   1 
ATOM   5341 C CB  . MET B 1 149 ? 5.803   5.802   -52.938 1.00 43.41 ? 149  MET B CB  1 
ATOM   5342 C CG  . MET B 1 149 ? 7.040   5.880   -52.018 1.00 42.90 ? 149  MET B CG  1 
ATOM   5343 S SD  . MET B 1 149 ? 6.808   6.597   -50.375 1.00 44.12 ? 149  MET B SD  1 
ATOM   5344 C CE  . MET B 1 149 ? 6.725   8.335   -50.777 1.00 41.57 ? 149  MET B CE  1 
ATOM   5345 N N   . ASN B 1 150 ? 5.509   2.684   -52.686 1.00 44.22 ? 150  ASN B N   1 
ATOM   5346 C CA  . ASN B 1 150 ? 6.368   1.583   -52.311 1.00 44.03 ? 150  ASN B CA  1 
ATOM   5347 C C   . ASN B 1 150 ? 7.804   2.036   -52.494 1.00 44.10 ? 150  ASN B C   1 
ATOM   5348 O O   . ASN B 1 150 ? 8.121   2.775   -53.433 1.00 44.37 ? 150  ASN B O   1 
ATOM   5349 C CB  . ASN B 1 150 ? 6.110   0.355   -53.183 1.00 44.81 ? 150  ASN B CB  1 
ATOM   5350 C CG  . ASN B 1 150 ? 4.888   -0.439  -52.744 1.00 45.99 ? 150  ASN B CG  1 
ATOM   5351 O OD1 . ASN B 1 150 ? 4.241   -0.130  -51.732 1.00 47.68 ? 150  ASN B OD1 1 
ATOM   5352 N ND2 . ASN B 1 150 ? 4.566   -1.474  -53.508 1.00 46.03 ? 150  ASN B ND2 1 
ATOM   5353 N N   . TYR B 1 151 ? 8.670   1.614   -51.583 1.00 43.57 ? 151  TYR B N   1 
ATOM   5354 C CA  . TYR B 1 151 ? 10.088  1.828   -51.739 1.00 43.43 ? 151  TYR B CA  1 
ATOM   5355 C C   . TYR B 1 151 ? 10.806  0.538   -51.367 1.00 43.32 ? 151  TYR B C   1 
ATOM   5356 O O   . TYR B 1 151 ? 10.312  -0.233  -50.546 1.00 43.25 ? 151  TYR B O   1 
ATOM   5357 C CB  . TYR B 1 151 ? 10.562  2.996   -50.875 1.00 43.44 ? 151  TYR B CB  1 
ATOM   5358 C CG  . TYR B 1 151 ? 10.385  2.790   -49.390 1.00 42.83 ? 151  TYR B CG  1 
ATOM   5359 C CD1 . TYR B 1 151 ? 9.213   3.160   -48.750 1.00 43.94 ? 151  TYR B CD1 1 
ATOM   5360 C CD2 . TYR B 1 151 ? 11.404  2.248   -48.624 1.00 43.34 ? 151  TYR B CD2 1 
ATOM   5361 C CE1 . TYR B 1 151 ? 9.053   2.980   -47.374 1.00 42.77 ? 151  TYR B CE1 1 
ATOM   5362 C CE2 . TYR B 1 151 ? 11.257  2.060   -47.262 1.00 42.71 ? 151  TYR B CE2 1 
ATOM   5363 C CZ  . TYR B 1 151 ? 10.082  2.425   -46.649 1.00 42.99 ? 151  TYR B CZ  1 
ATOM   5364 O OH  . TYR B 1 151 ? 9.951   2.226   -45.304 1.00 44.28 ? 151  TYR B OH  1 
ATOM   5365 N N   . ARG B 1 152 ? 11.952  0.304   -51.994 1.00 43.16 ? 152  ARG B N   1 
ATOM   5366 C CA  . ARG B 1 152 ? 12.724  -0.909  -51.761 1.00 43.80 ? 152  ARG B CA  1 
ATOM   5367 C C   . ARG B 1 152 ? 13.233  -1.033  -50.321 1.00 43.67 ? 152  ARG B C   1 
ATOM   5368 O O   . ARG B 1 152 ? 13.719  -0.076  -49.734 1.00 44.02 ? 152  ARG B O   1 
ATOM   5369 C CB  . ARG B 1 152 ? 13.895  -0.959  -52.725 1.00 44.00 ? 152  ARG B CB  1 
ATOM   5370 C CG  . ARG B 1 152 ? 13.498  -1.380  -54.127 1.00 44.71 ? 152  ARG B CG  1 
ATOM   5371 C CD  . ARG B 1 152 ? 14.683  -1.301  -55.064 1.00 44.82 ? 152  ARG B CD  1 
ATOM   5372 N NE  . ARG B 1 152 ? 14.950  0.083   -55.443 1.00 44.65 ? 152  ARG B NE  1 
ATOM   5373 C CZ  . ARG B 1 152 ? 16.037  0.486   -56.092 1.00 45.22 ? 152  ARG B CZ  1 
ATOM   5374 N NH1 . ARG B 1 152 ? 16.981  -0.392  -56.448 1.00 45.15 ? 152  ARG B NH1 1 
ATOM   5375 N NH2 . ARG B 1 152 ? 16.171  1.778   -56.398 1.00 44.27 ? 152  ARG B NH2 1 
ATOM   5376 N N   . VAL B 1 153 ? 13.113  -2.234  -49.772 1.00 43.98 ? 153  VAL B N   1 
ATOM   5377 C CA  . VAL B 1 153 ? 13.504  -2.538  -48.400 1.00 43.62 ? 153  VAL B CA  1 
ATOM   5378 C C   . VAL B 1 153 ? 14.521  -3.672  -48.390 1.00 44.65 ? 153  VAL B C   1 
ATOM   5379 O O   . VAL B 1 153 ? 14.800  -4.286  -49.430 1.00 45.29 ? 153  VAL B O   1 
ATOM   5380 C CB  . VAL B 1 153 ? 12.265  -2.944  -47.549 1.00 43.71 ? 153  VAL B CB  1 
ATOM   5381 C CG1 . VAL B 1 153 ? 11.319  -1.778  -47.408 1.00 42.22 ? 153  VAL B CG1 1 
ATOM   5382 C CG2 . VAL B 1 153 ? 11.539  -4.158  -48.170 1.00 42.97 ? 153  VAL B CG2 1 
ATOM   5383 N N   . GLY B 1 154 ? 15.090  -3.943  -47.216 1.00 45.03 ? 154  GLY B N   1 
ATOM   5384 C CA  . GLY B 1 154 ? 16.087  -5.008  -47.067 1.00 45.85 ? 154  GLY B CA  1 
ATOM   5385 C C   . GLY B 1 154 ? 17.355  -4.757  -47.871 1.00 46.06 ? 154  GLY B C   1 
ATOM   5386 O O   . GLY B 1 154 ? 17.738  -3.621  -48.100 1.00 45.59 ? 154  GLY B O   1 
ATOM   5387 N N   . THR B 1 155 ? 17.997  -5.834  -48.306 1.00 46.90 ? 155  THR B N   1 
ATOM   5388 C CA  . THR B 1 155 ? 19.165  -5.745  -49.185 1.00 47.10 ? 155  THR B CA  1 
ATOM   5389 C C   . THR B 1 155 ? 18.864  -4.943  -50.459 1.00 46.87 ? 155  THR B C   1 
ATOM   5390 O O   . THR B 1 155 ? 19.689  -4.168  -50.931 1.00 47.03 ? 155  THR B O   1 
ATOM   5391 C CB  . THR B 1 155 ? 19.610  -7.132  -49.608 1.00 47.80 ? 155  THR B CB  1 
ATOM   5392 O OG1 . THR B 1 155 ? 18.500  -7.796  -50.209 1.00 47.90 ? 155  THR B OG1 1 
ATOM   5393 C CG2 . THR B 1 155 ? 20.104  -7.945  -48.400 1.00 47.51 ? 155  THR B CG2 1 
ATOM   5394 N N   . PHE B 1 156 ? 17.664  -5.110  -50.997 1.00 46.43 ? 156  PHE B N   1 
ATOM   5395 C CA  . PHE B 1 156 ? 17.321  -4.497  -52.272 1.00 46.27 ? 156  PHE B CA  1 
ATOM   5396 C C   . PHE B 1 156 ? 17.288  -2.976  -52.164 1.00 45.89 ? 156  PHE B C   1 
ATOM   5397 O O   . PHE B 1 156 ? 17.685  -2.271  -53.094 1.00 46.40 ? 156  PHE B O   1 
ATOM   5398 C CB  . PHE B 1 156 ? 15.987  -5.045  -52.778 1.00 46.37 ? 156  PHE B CB  1 
ATOM   5399 C CG  . PHE B 1 156 ? 15.908  -6.530  -52.719 1.00 47.30 ? 156  PHE B CG  1 
ATOM   5400 C CD1 . PHE B 1 156 ? 16.450  -7.304  -53.738 1.00 47.31 ? 156  PHE B CD1 1 
ATOM   5401 C CD2 . PHE B 1 156 ? 15.350  -7.164  -51.614 1.00 46.57 ? 156  PHE B CD2 1 
ATOM   5402 C CE1 . PHE B 1 156 ? 16.402  -8.672  -53.665 1.00 48.70 ? 156  PHE B CE1 1 
ATOM   5403 C CE2 . PHE B 1 156 ? 15.305  -8.538  -51.540 1.00 47.53 ? 156  PHE B CE2 1 
ATOM   5404 C CZ  . PHE B 1 156 ? 15.833  -9.294  -52.563 1.00 48.27 ? 156  PHE B CZ  1 
ATOM   5405 N N   . GLY B 1 157 ? 16.845  -2.482  -51.011 1.00 45.19 ? 157  GLY B N   1 
ATOM   5406 C CA  . GLY B 1 157 ? 16.789  -1.062  -50.745 1.00 44.71 ? 157  GLY B CA  1 
ATOM   5407 C C   . GLY B 1 157 ? 18.017  -0.466  -50.086 1.00 44.84 ? 157  GLY B C   1 
ATOM   5408 O O   . GLY B 1 157 ? 18.351  0.676   -50.352 1.00 44.71 ? 157  GLY B O   1 
ATOM   5409 N N   . PHE B 1 158 ? 18.691  -1.219  -49.220 1.00 45.73 ? 158  PHE B N   1 
ATOM   5410 C CA  . PHE B 1 158 ? 19.753  -0.640  -48.385 1.00 46.31 ? 158  PHE B CA  1 
ATOM   5411 C C   . PHE B 1 158 ? 21.094  -1.396  -48.316 1.00 47.60 ? 158  PHE B C   1 
ATOM   5412 O O   . PHE B 1 158 ? 21.996  -0.956  -47.601 1.00 48.48 ? 158  PHE B O   1 
ATOM   5413 C CB  . PHE B 1 158 ? 19.185  -0.346  -46.979 1.00 46.02 ? 158  PHE B CB  1 
ATOM   5414 C CG  . PHE B 1 158 ? 18.011  0.602   -47.013 1.00 44.75 ? 158  PHE B CG  1 
ATOM   5415 C CD1 . PHE B 1 158 ? 18.218  1.963   -47.150 1.00 44.47 ? 158  PHE B CD1 1 
ATOM   5416 C CD2 . PHE B 1 158 ? 16.711  0.119   -47.034 1.00 44.22 ? 158  PHE B CD2 1 
ATOM   5417 C CE1 . PHE B 1 158 ? 17.144  2.846   -47.256 1.00 44.00 ? 158  PHE B CE1 1 
ATOM   5418 C CE2 . PHE B 1 158 ? 15.630  0.990   -47.148 1.00 44.35 ? 158  PHE B CE2 1 
ATOM   5419 C CZ  . PHE B 1 158 ? 15.850  2.360   -47.248 1.00 43.89 ? 158  PHE B CZ  1 
ATOM   5420 N N   . LEU B 1 159 ? 21.268  -2.481  -49.070 1.00 48.35 ? 159  LEU B N   1 
ATOM   5421 C CA  . LEU B 1 159 ? 22.602  -3.092  -49.162 1.00 49.24 ? 159  LEU B CA  1 
ATOM   5422 C C   . LEU B 1 159 ? 23.534  -2.099  -49.840 1.00 50.03 ? 159  LEU B C   1 
ATOM   5423 O O   . LEU B 1 159 ? 23.210  -1.526  -50.896 1.00 50.05 ? 159  LEU B O   1 
ATOM   5424 C CB  . LEU B 1 159 ? 22.600  -4.427  -49.898 1.00 49.66 ? 159  LEU B CB  1 
ATOM   5425 C CG  . LEU B 1 159 ? 23.951  -5.185  -50.003 1.00 50.76 ? 159  LEU B CG  1 
ATOM   5426 C CD1 . LEU B 1 159 ? 23.754  -6.697  -49.969 1.00 51.21 ? 159  LEU B CD1 1 
ATOM   5427 C CD2 . LEU B 1 159 ? 24.724  -4.819  -51.258 1.00 49.39 ? 159  LEU B CD2 1 
ATOM   5428 N N   . ALA B 1 160 ? 24.687  -1.879  -49.209 1.00 50.83 ? 160  ALA B N   1 
ATOM   5429 C CA  . ALA B 1 160 ? 25.604  -0.819  -49.615 1.00 50.94 ? 160  ALA B CA  1 
ATOM   5430 C C   . ALA B 1 160 ? 27.039  -1.305  -49.551 1.00 52.05 ? 160  ALA B C   1 
ATOM   5431 O O   . ALA B 1 160 ? 27.431  -1.998  -48.602 1.00 52.40 ? 160  ALA B O   1 
ATOM   5432 C CB  . ALA B 1 160 ? 25.421  0.401   -48.727 1.00 50.05 ? 160  ALA B CB  1 
ATOM   5433 N N   . LEU B 1 161 ? 27.804  -0.958  -50.583 1.00 52.83 ? 161  LEU B N   1 
ATOM   5434 C CA  . LEU B 1 161 ? 29.263  -1.032  -50.550 1.00 54.43 ? 161  LEU B CA  1 
ATOM   5435 C C   . LEU B 1 161 ? 29.718  0.403   -50.767 1.00 54.79 ? 161  LEU B C   1 
ATOM   5436 O O   . LEU B 1 161 ? 29.905  0.839   -51.899 1.00 55.18 ? 161  LEU B O   1 
ATOM   5437 C CB  . LEU B 1 161 ? 29.801  -2.007  -51.605 1.00 55.22 ? 161  LEU B CB  1 
ATOM   5438 C CG  . LEU B 1 161 ? 29.438  -3.449  -51.199 1.00 55.63 ? 161  LEU B CG  1 
ATOM   5439 C CD1 . LEU B 1 161 ? 29.190  -4.277  -52.381 1.00 57.47 ? 161  LEU B CD1 1 
ATOM   5440 C CD2 . LEU B 1 161 ? 30.492  -4.105  -50.300 1.00 57.65 ? 161  LEU B CD2 1 
ATOM   5441 N N   . PRO B 1 162 ? 29.832  1.161   -49.666 1.00 55.10 ? 162  PRO B N   1 
ATOM   5442 C CA  . PRO B 1 162 ? 30.037  2.599   -49.729 1.00 55.53 ? 162  PRO B CA  1 
ATOM   5443 C C   . PRO B 1 162 ? 31.238  2.988   -50.579 1.00 57.26 ? 162  PRO B C   1 
ATOM   5444 O O   . PRO B 1 162 ? 32.311  2.403   -50.437 1.00 57.80 ? 162  PRO B O   1 
ATOM   5445 C CB  . PRO B 1 162 ? 30.265  2.971   -48.269 1.00 55.69 ? 162  PRO B CB  1 
ATOM   5446 C CG  . PRO B 1 162 ? 29.519  1.932   -47.509 1.00 54.68 ? 162  PRO B CG  1 
ATOM   5447 C CD  . PRO B 1 162 ? 29.756  0.690   -48.272 1.00 54.72 ? 162  PRO B CD  1 
ATOM   5448 N N   . GLY B 1 163 ? 31.039  3.955   -51.467 1.00 57.82 ? 163  GLY B N   1 
ATOM   5449 C CA  . GLY B 1 163 ? 32.075  4.381   -52.382 1.00 59.56 ? 163  GLY B CA  1 
ATOM   5450 C C   . GLY B 1 163 ? 31.986  3.691   -53.722 1.00 60.55 ? 163  GLY B C   1 
ATOM   5451 O O   . GLY B 1 163 ? 32.567  4.170   -54.695 1.00 61.15 ? 163  GLY B O   1 
ATOM   5452 N N   . SER B 1 164 ? 31.257  2.573   -53.782 1.00 61.01 ? 164  SER B N   1 
ATOM   5453 C CA  . SER B 1 164 ? 31.058  1.845   -55.042 1.00 61.91 ? 164  SER B CA  1 
ATOM   5454 C C   . SER B 1 164 ? 30.036  2.540   -55.929 1.00 62.17 ? 164  SER B C   1 
ATOM   5455 O O   . SER B 1 164 ? 29.139  3.235   -55.451 1.00 60.82 ? 164  SER B O   1 
ATOM   5456 C CB  . SER B 1 164 ? 30.603  0.397   -54.792 1.00 61.60 ? 164  SER B CB  1 
ATOM   5457 O OG  . SER B 1 164 ? 29.232  0.332   -54.425 1.00 59.07 ? 164  SER B OG  1 
ATOM   5458 N N   . ARG B 1 165 ? 30.175  2.314   -57.229 1.00 63.78 ? 165  ARG B N   1 
ATOM   5459 C CA  . ARG B 1 165 ? 29.257  2.860   -58.220 1.00 64.49 ? 165  ARG B CA  1 
ATOM   5460 C C   . ARG B 1 165 ? 27.969  2.042   -58.208 1.00 62.14 ? 165  ARG B C   1 
ATOM   5461 O O   . ARG B 1 165 ? 26.873  2.579   -58.339 1.00 61.59 ? 165  ARG B O   1 
ATOM   5462 C CB  . ARG B 1 165 ? 29.914  2.782   -59.605 1.00 65.79 ? 165  ARG B CB  1 
ATOM   5463 C CG  . ARG B 1 165 ? 29.406  3.784   -60.641 1.00 68.18 ? 165  ARG B CG  1 
ATOM   5464 C CD  . ARG B 1 165 ? 29.398  3.169   -62.082 1.00 70.47 ? 165  ARG B CD  1 
ATOM   5465 N NE  . ARG B 1 165 ? 28.037  2.721   -62.445 1.00 74.32 ? 165  ARG B NE  1 
ATOM   5466 C CZ  . ARG B 1 165 ? 27.732  1.727   -63.290 1.00 75.98 ? 165  ARG B CZ  1 
ATOM   5467 N NH1 . ARG B 1 165 ? 28.679  1.015   -63.914 1.00 77.41 ? 165  ARG B NH1 1 
ATOM   5468 N NH2 . ARG B 1 165 ? 26.447  1.444   -63.512 1.00 75.04 ? 165  ARG B NH2 1 
ATOM   5469 N N   . GLU B 1 166 ? 28.119  0.733   -58.022 1.00 61.19 ? 166  GLU B N   1 
ATOM   5470 C CA  . GLU B 1 166 ? 27.046  -0.224  -58.292 1.00 59.38 ? 166  GLU B CA  1 
ATOM   5471 C C   . GLU B 1 166 ? 26.101  -0.501  -57.106 1.00 57.39 ? 166  GLU B C   1 
ATOM   5472 O O   . GLU B 1 166 ? 24.972  -0.930  -57.315 1.00 55.99 ? 166  GLU B O   1 
ATOM   5473 C CB  . GLU B 1 166 ? 27.655  -1.535  -58.814 1.00 60.81 ? 166  GLU B CB  1 
ATOM   5474 C CG  . GLU B 1 166 ? 28.585  -1.366  -60.052 1.00 62.95 ? 166  GLU B CG  1 
ATOM   5475 C CD  . GLU B 1 166 ? 30.075  -1.127  -59.700 1.00 66.13 ? 166  GLU B CD  1 
ATOM   5476 O OE1 . GLU B 1 166 ? 30.417  -0.888  -58.513 1.00 65.16 ? 166  GLU B OE1 1 
ATOM   5477 O OE2 . GLU B 1 166 ? 30.913  -1.180  -60.634 1.00 70.28 ? 166  GLU B OE2 1 
ATOM   5478 N N   . ALA B 1 167 ? 26.567  -0.268  -55.878 1.00 56.24 ? 167  ALA B N   1 
ATOM   5479 C CA  . ALA B 1 167 ? 25.748  -0.436  -54.668 1.00 55.17 ? 167  ALA B CA  1 
ATOM   5480 C C   . ALA B 1 167 ? 26.085  0.680   -53.679 1.00 54.07 ? 167  ALA B C   1 
ATOM   5481 O O   . ALA B 1 167 ? 26.675  0.440   -52.635 1.00 53.82 ? 167  ALA B O   1 
ATOM   5482 C CB  . ALA B 1 167 ? 25.990  -1.794  -54.040 1.00 55.00 ? 167  ALA B CB  1 
ATOM   5483 N N   . PRO B 1 168 ? 25.727  1.919   -54.025 1.00 53.30 ? 168  PRO B N   1 
ATOM   5484 C CA  . PRO B 1 168 ? 26.138  3.073   -53.222 1.00 53.01 ? 168  PRO B CA  1 
ATOM   5485 C C   . PRO B 1 168 ? 25.405  3.238   -51.875 1.00 51.50 ? 168  PRO B C   1 
ATOM   5486 O O   . PRO B 1 168 ? 25.816  4.052   -51.064 1.00 51.75 ? 168  PRO B O   1 
ATOM   5487 C CB  . PRO B 1 168 ? 25.813  4.256   -54.144 1.00 53.17 ? 168  PRO B CB  1 
ATOM   5488 C CG  . PRO B 1 168 ? 24.637  3.771   -54.946 1.00 52.82 ? 168  PRO B CG  1 
ATOM   5489 C CD  . PRO B 1 168 ? 24.934  2.319   -55.204 1.00 53.07 ? 168  PRO B CD  1 
ATOM   5490 N N   . GLY B 1 169 ? 24.344  2.473   -51.647 1.00 50.05 ? 169  GLY B N   1 
ATOM   5491 C CA  . GLY B 1 169 ? 23.519  2.631   -50.453 1.00 48.80 ? 169  GLY B CA  1 
ATOM   5492 C C   . GLY B 1 169 ? 22.397  3.654   -50.598 1.00 47.47 ? 169  GLY B C   1 
ATOM   5493 O O   . GLY B 1 169 ? 22.402  4.487   -51.515 1.00 46.99 ? 169  GLY B O   1 
ATOM   5494 N N   . ASN B 1 170 ? 21.435  3.561   -49.681 1.00 46.19 ? 170  ASN B N   1 
ATOM   5495 C CA  . ASN B 1 170 ? 20.317  4.502   -49.552 1.00 45.41 ? 170  ASN B CA  1 
ATOM   5496 C C   . ASN B 1 170 ? 19.347  4.556   -50.747 1.00 45.10 ? 170  ASN B C   1 
ATOM   5497 O O   . ASN B 1 170 ? 18.576  5.498   -50.871 1.00 44.64 ? 170  ASN B O   1 
ATOM   5498 C CB  . ASN B 1 170 ? 20.835  5.906   -49.198 1.00 44.94 ? 170  ASN B CB  1 
ATOM   5499 C CG  . ASN B 1 170 ? 21.571  5.939   -47.871 1.00 45.30 ? 170  ASN B CG  1 
ATOM   5500 O OD1 . ASN B 1 170 ? 21.136  5.334   -46.888 1.00 43.92 ? 170  ASN B OD1 1 
ATOM   5501 N ND2 . ASN B 1 170 ? 22.694  6.652   -47.831 1.00 45.48 ? 170  ASN B ND2 1 
ATOM   5502 N N   . VAL B 1 171 ? 19.336  3.521   -51.583 1.00 45.48 ? 171  VAL B N   1 
ATOM   5503 C CA  . VAL B 1 171 ? 18.532  3.551   -52.809 1.00 45.19 ? 171  VAL B CA  1 
ATOM   5504 C C   . VAL B 1 171 ? 17.042  3.515   -52.498 1.00 44.63 ? 171  VAL B C   1 
ATOM   5505 O O   . VAL B 1 171 ? 16.249  4.139   -53.200 1.00 44.42 ? 171  VAL B O   1 
ATOM   5506 C CB  . VAL B 1 171 ? 18.954  2.452   -53.842 1.00 46.29 ? 171  VAL B CB  1 
ATOM   5507 C CG1 . VAL B 1 171 ? 20.469  2.562   -54.148 1.00 46.10 ? 171  VAL B CG1 1 
ATOM   5508 C CG2 . VAL B 1 171 ? 18.577  1.028   -53.378 1.00 45.50 ? 171  VAL B CG2 1 
ATOM   5509 N N   . GLY B 1 172 ? 16.654  2.810   -51.441 1.00 44.30 ? 172  GLY B N   1 
ATOM   5510 C CA  . GLY B 1 172 ? 15.262  2.850   -50.978 1.00 43.83 ? 172  GLY B CA  1 
ATOM   5511 C C   . GLY B 1 172 ? 14.808  4.257   -50.594 1.00 43.39 ? 172  GLY B C   1 
ATOM   5512 O O   . GLY B 1 172 ? 13.647  4.617   -50.766 1.00 43.15 ? 172  GLY B O   1 
ATOM   5513 N N   . LEU B 1 173 ? 15.722  5.064   -50.062 1.00 43.62 ? 173  LEU B N   1 
ATOM   5514 C CA  . LEU B 1 173 ? 15.411  6.460   -49.753 1.00 43.05 ? 173  LEU B CA  1 
ATOM   5515 C C   . LEU B 1 173 ? 15.342  7.290   -51.032 1.00 43.04 ? 173  LEU B C   1 
ATOM   5516 O O   . LEU B 1 173 ? 14.578  8.249   -51.116 1.00 43.23 ? 173  LEU B O   1 
ATOM   5517 C CB  . LEU B 1 173 ? 16.467  7.070   -48.813 1.00 43.90 ? 173  LEU B CB  1 
ATOM   5518 C CG  . LEU B 1 173 ? 16.569  6.663   -47.331 1.00 43.30 ? 173  LEU B CG  1 
ATOM   5519 C CD1 . LEU B 1 173 ? 17.699  7.432   -46.713 1.00 42.32 ? 173  LEU B CD1 1 
ATOM   5520 C CD2 . LEU B 1 173 ? 15.287  6.926   -46.564 1.00 42.77 ? 173  LEU B CD2 1 
ATOM   5521 N N   . LEU B 1 174 ? 16.162  6.942   -52.016 1.00 42.86 ? 174  LEU B N   1 
ATOM   5522 C CA  . LEU B 1 174 ? 16.096  7.586   -53.326 1.00 43.28 ? 174  LEU B CA  1 
ATOM   5523 C C   . LEU B 1 174 ? 14.791  7.229   -54.047 1.00 42.86 ? 174  LEU B C   1 
ATOM   5524 O O   . LEU B 1 174 ? 14.267  8.036   -54.829 1.00 42.93 ? 174  LEU B O   1 
ATOM   5525 C CB  . LEU B 1 174 ? 17.318  7.210   -54.185 1.00 43.92 ? 174  LEU B CB  1 
ATOM   5526 C CG  . LEU B 1 174 ? 18.684  7.793   -53.749 1.00 44.48 ? 174  LEU B CG  1 
ATOM   5527 C CD1 . LEU B 1 174 ? 19.821  7.284   -54.638 1.00 41.07 ? 174  LEU B CD1 1 
ATOM   5528 C CD2 . LEU B 1 174 ? 18.649  9.316   -53.757 1.00 43.40 ? 174  LEU B CD2 1 
ATOM   5529 N N   . ASP B 1 175 ? 14.267  6.034   -53.779 1.00 42.06 ? 175  ASP B N   1 
ATOM   5530 C CA  . ASP B 1 175 ? 12.940  5.649   -54.287 1.00 42.28 ? 175  ASP B CA  1 
ATOM   5531 C C   . ASP B 1 175 ? 11.884  6.610   -53.757 1.00 42.45 ? 175  ASP B C   1 
ATOM   5532 O O   . ASP B 1 175 ? 11.055  7.138   -54.516 1.00 42.63 ? 175  ASP B O   1 
ATOM   5533 C CB  . ASP B 1 175 ? 12.575  4.214   -53.874 1.00 41.70 ? 175  ASP B CB  1 
ATOM   5534 C CG  . ASP B 1 175 ? 13.449  3.175   -54.535 1.00 42.10 ? 175  ASP B CG  1 
ATOM   5535 O OD1 . ASP B 1 175 ? 14.102  3.506   -55.547 1.00 42.26 ? 175  ASP B OD1 1 
ATOM   5536 O OD2 . ASP B 1 175 ? 13.482  2.025   -54.054 1.00 41.83 ? 175  ASP B OD2 1 
ATOM   5537 N N   . GLN B 1 176 ? 11.920  6.845   -52.450 1.00 42.55 ? 176  GLN B N   1 
ATOM   5538 C CA  . GLN B 1 176 ? 10.976  7.772   -51.817 1.00 42.59 ? 176  GLN B CA  1 
ATOM   5539 C C   . GLN B 1 176 ? 11.114  9.142   -52.440 1.00 42.85 ? 176  GLN B C   1 
ATOM   5540 O O   . GLN B 1 176 ? 10.128  9.763   -52.809 1.00 43.53 ? 176  GLN B O   1 
ATOM   5541 C CB  . GLN B 1 176 ? 11.229  7.862   -50.305 1.00 42.54 ? 176  GLN B CB  1 
ATOM   5542 C CG  . GLN B 1 176 ? 11.060  6.532   -49.532 1.00 42.33 ? 176  GLN B CG  1 
ATOM   5543 C CD  . GLN B 1 176 ? 11.555  6.627   -48.100 1.00 42.11 ? 176  GLN B CD  1 
ATOM   5544 O OE1 . GLN B 1 176 ? 11.900  7.701   -47.630 1.00 43.48 ? 176  GLN B OE1 1 
ATOM   5545 N NE2 . GLN B 1 176 ? 11.579  5.501   -47.398 1.00 42.55 ? 176  GLN B NE2 1 
ATOM   5546 N N   . ARG B 1 177 ? 12.345  9.615   -52.573 1.00 43.10 ? 177  ARG B N   1 
ATOM   5547 C CA  . ARG B 1 177 ? 12.580  10.939  -53.143 1.00 43.78 ? 177  ARG B CA  1 
ATOM   5548 C C   . ARG B 1 177 ? 12.012  11.093  -54.554 1.00 43.83 ? 177  ARG B C   1 
ATOM   5549 O O   . ARG B 1 177 ? 11.454  12.140  -54.904 1.00 44.02 ? 177  ARG B O   1 
ATOM   5550 C CB  . ARG B 1 177 ? 14.075  11.257  -53.165 1.00 43.92 ? 177  ARG B CB  1 
ATOM   5551 C CG  . ARG B 1 177 ? 14.386  12.620  -53.758 1.00 45.32 ? 177  ARG B CG  1 
ATOM   5552 C CD  . ARG B 1 177 ? 15.860  12.889  -53.727 1.00 46.20 ? 177  ARG B CD  1 
ATOM   5553 N NE  . ARG B 1 177 ? 16.289  13.210  -52.369 1.00 47.83 ? 177  ARG B NE  1 
ATOM   5554 C CZ  . ARG B 1 177 ? 17.564  13.253  -51.974 1.00 48.44 ? 177  ARG B CZ  1 
ATOM   5555 N NH1 . ARG B 1 177 ? 18.546  12.989  -52.829 1.00 49.54 ? 177  ARG B NH1 1 
ATOM   5556 N NH2 . ARG B 1 177 ? 17.861  13.562  -50.723 1.00 48.36 ? 177  ARG B NH2 1 
ATOM   5557 N N   . LEU B 1 178 ? 12.184  10.058  -55.367 1.00 43.77 ? 178  LEU B N   1 
ATOM   5558 C CA  . LEU B 1 178 ? 11.677  10.067  -56.723 1.00 44.07 ? 178  LEU B CA  1 
ATOM   5559 C C   . LEU B 1 178 ? 10.149  10.137  -56.717 1.00 43.90 ? 178  LEU B C   1 
ATOM   5560 O O   . LEU B 1 178 ? 9.569   10.865  -57.511 1.00 44.10 ? 178  LEU B O   1 
ATOM   5561 C CB  . LEU B 1 178 ? 12.196  8.858   -57.505 1.00 43.94 ? 178  LEU B CB  1 
ATOM   5562 C CG  . LEU B 1 178 ? 11.837  8.755   -58.991 1.00 45.10 ? 178  LEU B CG  1 
ATOM   5563 C CD1 . LEU B 1 178 ? 12.310  9.975   -59.786 1.00 44.26 ? 178  LEU B CD1 1 
ATOM   5564 C CD2 . LEU B 1 178 ? 12.422  7.450   -59.591 1.00 44.30 ? 178  LEU B CD2 1 
ATOM   5565 N N   . ALA B 1 179 ? 9.510   9.402   -55.807 1.00 43.66 ? 179  ALA B N   1 
ATOM   5566 C CA  . ALA B 1 179 ? 8.055   9.489   -55.609 1.00 43.90 ? 179  ALA B CA  1 
ATOM   5567 C C   . ALA B 1 179 ? 7.630   10.916  -55.215 1.00 44.29 ? 179  ALA B C   1 
ATOM   5568 O O   . ALA B 1 179 ? 6.565   11.405  -55.617 1.00 45.24 ? 179  ALA B O   1 
ATOM   5569 C CB  . ALA B 1 179 ? 7.593   8.484   -54.555 1.00 42.75 ? 179  ALA B CB  1 
ATOM   5570 N N   . LEU B 1 180 ? 8.469   11.577  -54.427 1.00 44.31 ? 180  LEU B N   1 
ATOM   5571 C CA  . LEU B 1 180 ? 8.236   12.961  -54.015 1.00 44.51 ? 180  LEU B CA  1 
ATOM   5572 C C   . LEU B 1 180 ? 8.371   13.928  -55.213 1.00 45.61 ? 180  LEU B C   1 
ATOM   5573 O O   . LEU B 1 180 ? 7.574   14.878  -55.353 1.00 45.68 ? 180  LEU B O   1 
ATOM   5574 C CB  . LEU B 1 180 ? 9.220   13.350  -52.902 1.00 44.18 ? 180  LEU B CB  1 
ATOM   5575 C CG  . LEU B 1 180 ? 8.843   13.166  -51.423 1.00 44.54 ? 180  LEU B CG  1 
ATOM   5576 C CD1 . LEU B 1 180 ? 8.007   11.910  -51.123 1.00 44.22 ? 180  LEU B CD1 1 
ATOM   5577 C CD2 . LEU B 1 180 ? 10.096  13.223  -50.547 1.00 43.82 ? 180  LEU B CD2 1 
ATOM   5578 N N   . GLN B 1 181 ? 9.387   13.699  -56.057 1.00 45.47 ? 181  GLN B N   1 
ATOM   5579 C CA  . GLN B 1 181 ? 9.573   14.506  -57.278 1.00 46.20 ? 181  GLN B CA  1 
ATOM   5580 C C   . GLN B 1 181 ? 8.384   14.318  -58.210 1.00 46.30 ? 181  GLN B C   1 
ATOM   5581 O O   . GLN B 1 181 ? 7.946   15.266  -58.854 1.00 46.15 ? 181  GLN B O   1 
ATOM   5582 C CB  A GLN B 1 181 ? 10.894  14.154  -57.991 0.50 46.24 ? 181  GLN B CB  1 
ATOM   5583 C CB  B GLN B 1 181 ? 10.890  14.154  -57.996 0.50 46.29 ? 181  GLN B CB  1 
ATOM   5584 C CG  A GLN B 1 181 ? 12.120  14.870  -57.395 0.50 46.69 ? 181  GLN B CG  1 
ATOM   5585 C CG  B GLN B 1 181 ? 11.207  14.979  -59.260 0.50 47.25 ? 181  GLN B CG  1 
ATOM   5586 C CD  A GLN B 1 181 ? 13.457  14.165  -57.646 0.50 47.06 ? 181  GLN B CD  1 
ATOM   5587 C CD  B GLN B 1 181 ? 11.314  16.489  -59.001 0.50 49.15 ? 181  GLN B CD  1 
ATOM   5588 O OE1 A GLN B 1 181 ? 13.517  13.067  -58.218 0.50 48.74 ? 181  GLN B OE1 1 
ATOM   5589 O OE1 B GLN B 1 181 ? 10.538  17.281  -59.547 0.50 49.57 ? 181  GLN B OE1 1 
ATOM   5590 N NE2 A GLN B 1 181 ? 14.537  14.795  -57.201 0.50 45.97 ? 181  GLN B NE2 1 
ATOM   5591 N NE2 B GLN B 1 181 ? 12.274  16.886  -58.166 0.50 48.82 ? 181  GLN B NE2 1 
ATOM   5592 N N   . TRP B 1 182 ? 7.861   13.094  -58.259 1.00 46.26 ? 182  TRP B N   1 
ATOM   5593 C CA  . TRP B 1 182 ? 6.701   12.773  -59.081 1.00 46.82 ? 182  TRP B CA  1 
ATOM   5594 C C   . TRP B 1 182 ? 5.505   13.613  -58.638 1.00 47.43 ? 182  TRP B C   1 
ATOM   5595 O O   . TRP B 1 182 ? 4.799   14.195  -59.471 1.00 47.89 ? 182  TRP B O   1 
ATOM   5596 C CB  . TRP B 1 182 ? 6.381   11.275  -58.979 1.00 47.15 ? 182  TRP B CB  1 
ATOM   5597 C CG  . TRP B 1 182 ? 5.290   10.809  -59.915 1.00 47.83 ? 182  TRP B CG  1 
ATOM   5598 C CD1 . TRP B 1 182 ? 5.456   10.257  -61.147 1.00 48.24 ? 182  TRP B CD1 1 
ATOM   5599 C CD2 . TRP B 1 182 ? 3.874   10.878  -59.692 1.00 48.59 ? 182  TRP B CD2 1 
ATOM   5600 N NE1 . TRP B 1 182 ? 4.238   9.982   -61.708 1.00 49.28 ? 182  TRP B NE1 1 
ATOM   5601 C CE2 . TRP B 1 182 ? 3.249   10.347  -60.837 1.00 48.56 ? 182  TRP B CE2 1 
ATOM   5602 C CE3 . TRP B 1 182 ? 3.075   11.340  -58.636 1.00 48.34 ? 182  TRP B CE3 1 
ATOM   5603 C CZ2 . TRP B 1 182 ? 1.873   10.255  -60.959 1.00 48.97 ? 182  TRP B CZ2 1 
ATOM   5604 C CZ3 . TRP B 1 182 ? 1.702   11.249  -58.756 1.00 48.27 ? 182  TRP B CZ3 1 
ATOM   5605 C CH2 . TRP B 1 182 ? 1.113   10.709  -59.910 1.00 49.02 ? 182  TRP B CH2 1 
ATOM   5606 N N   . VAL B 1 183 ? 5.284   13.686  -57.327 1.00 47.17 ? 183  VAL B N   1 
ATOM   5607 C CA  . VAL B 1 183 ? 4.191   14.501  -56.787 1.00 47.84 ? 183  VAL B CA  1 
ATOM   5608 C C   . VAL B 1 183 ? 4.338   15.962  -57.246 1.00 48.90 ? 183  VAL B C   1 
ATOM   5609 O O   . VAL B 1 183 ? 3.374   16.572  -57.679 1.00 48.96 ? 183  VAL B O   1 
ATOM   5610 C CB  . VAL B 1 183 ? 4.093   14.390  -55.227 1.00 47.24 ? 183  VAL B CB  1 
ATOM   5611 C CG1 . VAL B 1 183 ? 3.146   15.455  -54.639 1.00 46.97 ? 183  VAL B CG1 1 
ATOM   5612 C CG2 . VAL B 1 183 ? 3.652   12.983  -54.821 1.00 46.28 ? 183  VAL B CG2 1 
ATOM   5613 N N   . GLN B 1 184 ? 5.546   16.514  -57.185 1.00 49.47 ? 184  GLN B N   1 
ATOM   5614 C CA  . GLN B 1 184 ? 5.759   17.908  -57.608 1.00 50.60 ? 184  GLN B CA  1 
ATOM   5615 C C   . GLN B 1 184 ? 5.333   18.138  -59.047 1.00 51.93 ? 184  GLN B C   1 
ATOM   5616 O O   . GLN B 1 184 ? 4.628   19.113  -59.360 1.00 51.99 ? 184  GLN B O   1 
ATOM   5617 C CB  . GLN B 1 184 ? 7.232   18.303  -57.451 1.00 50.50 ? 184  GLN B CB  1 
ATOM   5618 C CG  . GLN B 1 184 ? 7.642   18.458  -56.020 1.00 51.36 ? 184  GLN B CG  1 
ATOM   5619 C CD  . GLN B 1 184 ? 6.887   19.602  -55.343 1.00 53.65 ? 184  GLN B CD  1 
ATOM   5620 O OE1 . GLN B 1 184 ? 7.043   20.762  -55.725 1.00 54.22 ? 184  GLN B OE1 1 
ATOM   5621 N NE2 . GLN B 1 184 ? 6.073   19.275  -54.342 1.00 51.45 ? 184  GLN B NE2 1 
ATOM   5622 N N   . GLU B 1 185 ? 5.784   17.233  -59.911 1.00 52.63 ? 185  GLU B N   1 
ATOM   5623 C CA  . GLU B 1 185 ? 5.524   17.309  -61.346 1.00 54.54 ? 185  GLU B CA  1 
ATOM   5624 C C   . GLU B 1 185 ? 4.083   17.004  -61.755 1.00 53.83 ? 185  GLU B C   1 
ATOM   5625 O O   . GLU B 1 185 ? 3.650   17.480  -62.808 1.00 54.84 ? 185  GLU B O   1 
ATOM   5626 C CB  . GLU B 1 185 ? 6.450   16.343  -62.098 1.00 54.13 ? 185  GLU B CB  1 
ATOM   5627 C CG  . GLU B 1 185 ? 7.927   16.706  -61.993 1.00 57.02 ? 185  GLU B CG  1 
ATOM   5628 C CD  . GLU B 1 185 ? 8.878   15.603  -62.493 1.00 58.49 ? 185  GLU B CD  1 
ATOM   5629 O OE1 . GLU B 1 185 ? 8.424   14.445  -62.741 1.00 63.50 ? 185  GLU B OE1 1 
ATOM   5630 O OE2 . GLU B 1 185 ? 10.098  15.900  -62.615 1.00 64.43 ? 185  GLU B OE2 1 
ATOM   5631 N N   . ASN B 1 186 ? 3.362   16.211  -60.952 1.00 52.80 ? 186  ASN B N   1 
ATOM   5632 C CA  . ASN B 1 186 ? 2.110   15.560  -61.401 1.00 52.78 ? 186  ASN B CA  1 
ATOM   5633 C C   . ASN B 1 186 ? 0.853   15.729  -60.540 1.00 52.51 ? 186  ASN B C   1 
ATOM   5634 O O   . ASN B 1 186 ? -0.252  15.459  -61.015 1.00 53.06 ? 186  ASN B O   1 
ATOM   5635 C CB  . ASN B 1 186 ? 2.346   14.049  -61.565 1.00 52.41 ? 186  ASN B CB  1 
ATOM   5636 C CG  . ASN B 1 186 ? 3.319   13.728  -62.666 1.00 53.15 ? 186  ASN B CG  1 
ATOM   5637 O OD1 . ASN B 1 186 ? 3.061   14.023  -63.826 1.00 56.40 ? 186  ASN B OD1 1 
ATOM   5638 N ND2 . ASN B 1 186 ? 4.444   13.114  -62.313 1.00 53.05 ? 186  ASN B ND2 1 
ATOM   5639 N N   . ILE B 1 187 ? 0.995   16.146  -59.285 1.00 51.72 ? 187  ILE B N   1 
ATOM   5640 C CA  . ILE B 1 187 ? -0.139  16.116  -58.361 1.00 51.27 ? 187  ILE B CA  1 
ATOM   5641 C C   . ILE B 1 187 ? -1.238  17.149  -58.695 1.00 52.33 ? 187  ILE B C   1 
ATOM   5642 O O   . ILE B 1 187 ? -2.418  16.935  -58.379 1.00 52.13 ? 187  ILE B O   1 
ATOM   5643 C CB  . ILE B 1 187 ? 0.325   16.236  -56.878 1.00 50.55 ? 187  ILE B CB  1 
ATOM   5644 C CG1 . ILE B 1 187 ? -0.650  15.497  -55.958 1.00 50.24 ? 187  ILE B CG1 1 
ATOM   5645 C CG2 . ILE B 1 187 ? 0.524   17.692  -56.457 1.00 50.72 ? 187  ILE B CG2 1 
ATOM   5646 C CD1 . ILE B 1 187 ? -0.730  14.001  -56.240 1.00 48.76 ? 187  ILE B CD1 1 
ATOM   5647 N N   . ALA B 1 188 ? -0.846  18.255  -59.327 1.00 52.96 ? 188  ALA B N   1 
ATOM   5648 C CA  . ALA B 1 188 ? -1.794  19.255  -59.818 1.00 54.02 ? 188  ALA B CA  1 
ATOM   5649 C C   . ALA B 1 188 ? -2.872  18.636  -60.719 1.00 54.70 ? 188  ALA B C   1 
ATOM   5650 O O   . ALA B 1 188 ? -4.021  19.058  -60.694 1.00 56.12 ? 188  ALA B O   1 
ATOM   5651 C CB  . ALA B 1 188 ? -1.058  20.348  -60.564 1.00 54.60 ? 188  ALA B CB  1 
ATOM   5652 N N   . ALA B 1 189 ? -2.505  17.623  -61.494 1.00 54.23 ? 189  ALA B N   1 
ATOM   5653 C CA  . ALA B 1 189 ? -3.441  16.960  -62.393 1.00 54.71 ? 189  ALA B CA  1 
ATOM   5654 C C   . ALA B 1 189 ? -4.572  16.287  -61.622 1.00 54.78 ? 189  ALA B C   1 
ATOM   5655 O O   . ALA B 1 189 ? -5.654  16.098  -62.155 1.00 55.37 ? 189  ALA B O   1 
ATOM   5656 C CB  . ALA B 1 189 ? -2.706  15.938  -63.251 1.00 53.79 ? 189  ALA B CB  1 
ATOM   5657 N N   . PHE B 1 190 ? -4.313  15.925  -60.370 1.00 54.54 ? 190  PHE B N   1 
ATOM   5658 C CA  . PHE B 1 190 ? -5.312  15.295  -59.515 1.00 54.88 ? 190  PHE B CA  1 
ATOM   5659 C C   . PHE B 1 190 ? -6.029  16.310  -58.639 1.00 56.01 ? 190  PHE B C   1 
ATOM   5660 O O   . PHE B 1 190 ? -6.938  15.939  -57.892 1.00 56.72 ? 190  PHE B O   1 
ATOM   5661 C CB  . PHE B 1 190 ? -4.648  14.261  -58.612 1.00 53.82 ? 190  PHE B CB  1 
ATOM   5662 C CG  . PHE B 1 190 ? -3.925  13.194  -59.356 1.00 53.26 ? 190  PHE B CG  1 
ATOM   5663 C CD1 . PHE B 1 190 ? -2.628  13.400  -59.801 1.00 53.48 ? 190  PHE B CD1 1 
ATOM   5664 C CD2 . PHE B 1 190 ? -4.530  11.979  -59.615 1.00 53.88 ? 190  PHE B CD2 1 
ATOM   5665 C CE1 . PHE B 1 190 ? -1.950  12.422  -60.486 1.00 53.26 ? 190  PHE B CE1 1 
ATOM   5666 C CE2 . PHE B 1 190 ? -3.854  10.988  -60.311 1.00 53.13 ? 190  PHE B CE2 1 
ATOM   5667 C CZ  . PHE B 1 190 ? -2.567  11.212  -60.752 1.00 53.43 ? 190  PHE B CZ  1 
ATOM   5668 N N   . GLY B 1 191 ? -5.608  17.575  -58.704 1.00 56.56 ? 191  GLY B N   1 
ATOM   5669 C CA  . GLY B 1 191 ? -6.152  18.623  -57.850 1.00 57.42 ? 191  GLY B CA  1 
ATOM   5670 C C   . GLY B 1 191 ? -5.385  18.858  -56.557 1.00 56.96 ? 191  GLY B C   1 
ATOM   5671 O O   . GLY B 1 191 ? -5.864  19.559  -55.658 1.00 57.44 ? 191  GLY B O   1 
ATOM   5672 N N   . GLY B 1 192 ? -4.195  18.277  -56.459 1.00 56.30 ? 192  GLY B N   1 
ATOM   5673 C CA  . GLY B 1 192 ? -3.337  18.469  -55.298 1.00 55.43 ? 192  GLY B CA  1 
ATOM   5674 C C   . GLY B 1 192 ? -2.471  19.701  -55.461 1.00 55.57 ? 192  GLY B C   1 
ATOM   5675 O O   . GLY B 1 192 ? -2.121  20.074  -56.571 1.00 56.56 ? 192  GLY B O   1 
ATOM   5676 N N   . ASP B 1 193 ? -2.108  20.320  -54.345 1.00 55.05 ? 193  ASP B N   1 
ATOM   5677 C CA  . ASP B 1 193 ? -1.247  21.500  -54.347 1.00 55.10 ? 193  ASP B CA  1 
ATOM   5678 C C   . ASP B 1 193 ? 0.220   21.101  -54.154 1.00 53.72 ? 193  ASP B C   1 
ATOM   5679 O O   . ASP B 1 193 ? 0.603   20.718  -53.052 1.00 53.06 ? 193  ASP B O   1 
ATOM   5680 C CB  . ASP B 1 193 ? -1.675  22.417  -53.206 1.00 55.62 ? 193  ASP B CB  1 
ATOM   5681 C CG  . ASP B 1 193 ? -1.043  23.788  -53.286 1.00 57.06 ? 193  ASP B CG  1 
ATOM   5682 O OD1 . ASP B 1 193 ? -0.165  23.996  -54.158 1.00 56.10 ? 193  ASP B OD1 1 
ATOM   5683 O OD2 . ASP B 1 193 ? -1.444  24.655  -52.470 1.00 57.17 ? 193  ASP B OD2 1 
ATOM   5684 N N   . PRO B 1 194 ? 1.054   21.191  -55.215 1.00 53.25 ? 194  PRO B N   1 
ATOM   5685 C CA  . PRO B 1 194 ? 2.467   20.866  -55.025 1.00 52.51 ? 194  PRO B CA  1 
ATOM   5686 C C   . PRO B 1 194 ? 3.198   21.839  -54.089 1.00 52.81 ? 194  PRO B C   1 
ATOM   5687 O O   . PRO B 1 194 ? 4.284   21.520  -53.597 1.00 51.90 ? 194  PRO B O   1 
ATOM   5688 C CB  . PRO B 1 194 ? 3.045   20.919  -56.445 1.00 52.51 ? 194  PRO B CB  1 
ATOM   5689 C CG  . PRO B 1 194 ? 2.118   21.749  -57.216 1.00 53.85 ? 194  PRO B CG  1 
ATOM   5690 C CD  . PRO B 1 194 ? 0.765   21.580  -56.605 1.00 54.09 ? 194  PRO B CD  1 
ATOM   5691 N N   . MET B 1 195 ? 2.597   22.998  -53.834 1.00 54.10 ? 195  MET B N   1 
ATOM   5692 C CA  . MET B 1 195 ? 3.156   23.966  -52.887 1.00 55.76 ? 195  MET B CA  1 
ATOM   5693 C C   . MET B 1 195 ? 2.708   23.722  -51.451 1.00 53.80 ? 195  MET B C   1 
ATOM   5694 O O   . MET B 1 195 ? 3.031   24.519  -50.578 1.00 54.45 ? 195  MET B O   1 
ATOM   5695 C CB  . MET B 1 195 ? 2.797   25.402  -53.294 1.00 56.84 ? 195  MET B CB  1 
ATOM   5696 C CG  . MET B 1 195 ? 3.202   25.749  -54.709 1.00 59.15 ? 195  MET B CG  1 
ATOM   5697 S SD  . MET B 1 195 ? 3.307   27.521  -54.976 1.00 64.84 ? 195  MET B SD  1 
ATOM   5698 C CE  . MET B 1 195 ? 1.685   28.127  -54.449 1.00 68.40 ? 195  MET B CE  1 
ATOM   5699 N N   . SER B 1 196 ? 1.969   22.639  -51.203 1.00 52.50 ? 196  SER B N   1 
ATOM   5700 C CA  . SER B 1 196 ? 1.613   22.237  -49.836 1.00 51.26 ? 196  SER B CA  1 
ATOM   5701 C C   . SER B 1 196 ? 1.624   20.717  -49.666 1.00 49.70 ? 196  SER B C   1 
ATOM   5702 O O   . SER B 1 196 ? 0.595   20.059  -49.797 1.00 49.66 ? 196  SER B O   1 
ATOM   5703 C CB  . SER B 1 196 ? 0.247   22.804  -49.451 1.00 52.09 ? 196  SER B CB  1 
ATOM   5704 O OG  . SER B 1 196 ? -0.101  22.399  -48.146 1.00 51.38 ? 196  SER B OG  1 
ATOM   5705 N N   . VAL B 1 197 ? 2.801   20.182  -49.361 1.00 47.97 ? 197  VAL B N   1 
ATOM   5706 C CA  . VAL B 1 197 ? 3.036   18.747  -49.263 1.00 46.57 ? 197  VAL B CA  1 
ATOM   5707 C C   . VAL B 1 197 ? 3.540   18.454  -47.870 1.00 45.70 ? 197  VAL B C   1 
ATOM   5708 O O   . VAL B 1 197 ? 4.545   19.012  -47.444 1.00 46.04 ? 197  VAL B O   1 
ATOM   5709 C CB  . VAL B 1 197 ? 4.081   18.261  -50.287 1.00 46.22 ? 197  VAL B CB  1 
ATOM   5710 C CG1 . VAL B 1 197 ? 4.499   16.788  -50.007 1.00 45.13 ? 197  VAL B CG1 1 
ATOM   5711 C CG2 . VAL B 1 197 ? 3.552   18.437  -51.701 1.00 45.42 ? 197  VAL B CG2 1 
ATOM   5712 N N   . THR B 1 198 ? 2.825   17.593  -47.164 1.00 44.82 ? 198  THR B N   1 
ATOM   5713 C CA  . THR B 1 198 ? 3.209   17.172  -45.833 1.00 44.64 ? 198  THR B CA  1 
ATOM   5714 C C   . THR B 1 198 ? 3.600   15.704  -45.866 1.00 44.02 ? 198  THR B C   1 
ATOM   5715 O O   . THR B 1 198 ? 2.810   14.871  -46.297 1.00 44.33 ? 198  THR B O   1 
ATOM   5716 C CB  . THR B 1 198 ? 2.050   17.371  -44.851 1.00 44.62 ? 198  THR B CB  1 
ATOM   5717 O OG1 . THR B 1 198 ? 1.634   18.736  -44.902 1.00 45.76 ? 198  THR B OG1 1 
ATOM   5718 C CG2 . THR B 1 198 ? 2.456   17.035  -43.444 1.00 43.81 ? 198  THR B CG2 1 
ATOM   5719 N N   . LEU B 1 199 ? 4.820   15.388  -45.438 1.00 43.87 ? 199  LEU B N   1 
ATOM   5720 C CA  . LEU B 1 199 ? 5.225   13.989  -45.311 1.00 43.83 ? 199  LEU B CA  1 
ATOM   5721 C C   . LEU B 1 199 ? 4.746   13.503  -43.967 1.00 44.25 ? 199  LEU B C   1 
ATOM   5722 O O   . LEU B 1 199 ? 4.820   14.235  -42.988 1.00 44.83 ? 199  LEU B O   1 
ATOM   5723 C CB  . LEU B 1 199 ? 6.742   13.822  -45.379 1.00 43.40 ? 199  LEU B CB  1 
ATOM   5724 C CG  . LEU B 1 199 ? 7.491   14.415  -46.581 1.00 44.40 ? 199  LEU B CG  1 
ATOM   5725 C CD1 . LEU B 1 199 ? 8.976   14.001  -46.528 1.00 42.19 ? 199  LEU B CD1 1 
ATOM   5726 C CD2 . LEU B 1 199 ? 6.837   14.033  -47.924 1.00 41.81 ? 199  LEU B CD2 1 
ATOM   5727 N N   . PHE B 1 200 ? 4.245   12.280  -43.916 1.00 44.54 ? 200  PHE B N   1 
ATOM   5728 C CA  . PHE B 1 200 ? 4.037   11.598  -42.643 1.00 44.73 ? 200  PHE B CA  1 
ATOM   5729 C C   . PHE B 1 200 ? 4.402   10.126  -42.758 1.00 44.67 ? 200  PHE B C   1 
ATOM   5730 O O   . PHE B 1 200 ? 4.321   9.535   -43.836 1.00 45.11 ? 200  PHE B O   1 
ATOM   5731 C CB  . PHE B 1 200 ? 2.638   11.868  -42.031 1.00 45.06 ? 200  PHE B CB  1 
ATOM   5732 C CG  . PHE B 1 200 ? 1.463   11.187  -42.711 1.00 46.21 ? 200  PHE B CG  1 
ATOM   5733 C CD1 . PHE B 1 200 ? 1.282   11.216  -44.085 1.00 46.17 ? 200  PHE B CD1 1 
ATOM   5734 C CD2 . PHE B 1 200 ? 0.465   10.595  -41.926 1.00 46.44 ? 200  PHE B CD2 1 
ATOM   5735 C CE1 . PHE B 1 200 ? 0.173   10.621  -44.666 1.00 46.37 ? 200  PHE B CE1 1 
ATOM   5736 C CE2 . PHE B 1 200 ? -0.646  10.000  -42.502 1.00 46.34 ? 200  PHE B CE2 1 
ATOM   5737 C CZ  . PHE B 1 200 ? -0.792  10.015  -43.873 1.00 47.10 ? 200  PHE B CZ  1 
ATOM   5738 N N   . GLY B 1 201 ? 4.888   9.568   -41.655 1.00 44.36 ? 201  GLY B N   1 
ATOM   5739 C CA  . GLY B 1 201 ? 5.318   8.178   -41.611 1.00 44.04 ? 201  GLY B CA  1 
ATOM   5740 C C   . GLY B 1 201 ? 5.426   7.691   -40.188 1.00 44.06 ? 201  GLY B C   1 
ATOM   5741 O O   . GLY B 1 201 ? 5.467   8.504   -39.264 1.00 43.68 ? 201  GLY B O   1 
ATOM   5742 N N   . GLU B 1 202 ? 5.448   6.369   -40.012 1.00 43.94 ? 202  GLU B N   1 
ATOM   5743 C CA  . GLU B 1 202 ? 5.627   5.768   -38.699 1.00 44.07 ? 202  GLU B CA  1 
ATOM   5744 C C   . GLU B 1 202 ? 6.817   4.804   -38.680 1.00 44.24 ? 202  GLU B C   1 
ATOM   5745 O O   . GLU B 1 202 ? 7.081   4.122   -39.664 1.00 43.80 ? 202  GLU B O   1 
ATOM   5746 C CB  . GLU B 1 202 ? 4.346   5.058   -38.262 1.00 44.39 ? 202  GLU B CB  1 
ATOM   5747 C CG  . GLU B 1 202 ? 4.381   4.496   -36.839 1.00 45.23 ? 202  GLU B CG  1 
ATOM   5748 C CD  . GLU B 1 202 ? 4.735   3.017   -36.771 1.00 46.15 ? 202  GLU B CD  1 
ATOM   5749 O OE1 . GLU B 1 202 ? 4.895   2.387   -37.835 1.00 44.58 ? 202  GLU B OE1 1 
ATOM   5750 O OE2 . GLU B 1 202 ? 4.846   2.486   -35.643 1.00 47.51 ? 202  GLU B OE2 1 
ATOM   5751 N N   . SER B 1 203 ? 7.520   4.767   -37.544 1.00 44.31 ? 203  SER B N   1 
ATOM   5752 C CA  . SER B 1 203 ? 8.653   3.880   -37.332 1.00 44.70 ? 203  SER B CA  1 
ATOM   5753 C C   . SER B 1 203 ? 9.753   4.187   -38.367 1.00 44.44 ? 203  SER B C   1 
ATOM   5754 O O   . SER B 1 203 ? 10.185  5.342   -38.448 1.00 45.07 ? 203  SER B O   1 
ATOM   5755 C CB  . SER B 1 203 ? 8.173   2.434   -37.343 1.00 45.39 ? 203  SER B CB  1 
ATOM   5756 O OG  . SER B 1 203 ? 9.073   1.604   -36.654 1.00 47.52 ? 203  SER B OG  1 
ATOM   5757 N N   . ALA B 1 204 ? 10.209  3.203   -39.143 1.00 44.34 ? 204  ALA B N   1 
ATOM   5758 C CA  . ALA B 1 204 ? 11.178  3.454   -40.221 1.00 44.11 ? 204  ALA B CA  1 
ATOM   5759 C C   . ALA B 1 204 ? 10.672  4.525   -41.201 1.00 43.53 ? 204  ALA B C   1 
ATOM   5760 O O   . ALA B 1 204 ? 11.467  5.298   -41.753 1.00 43.82 ? 204  ALA B O   1 
ATOM   5761 C CB  . ALA B 1 204 ? 11.508  2.169   -40.960 1.00 44.23 ? 204  ALA B CB  1 
ATOM   5762 N N   . GLY B 1 205 ? 9.356   4.601   -41.388 1.00 42.71 ? 205  GLY B N   1 
ATOM   5763 C CA  . GLY B 1 205 ? 8.757   5.667   -42.200 1.00 42.37 ? 205  GLY B CA  1 
ATOM   5764 C C   . GLY B 1 205 ? 9.008   7.065   -41.622 1.00 41.91 ? 205  GLY B C   1 
ATOM   5765 O O   . GLY B 1 205 ? 9.180   8.034   -42.359 1.00 41.90 ? 205  GLY B O   1 
ATOM   5766 N N   . ALA B 1 206 ? 8.994   7.159   -40.295 1.00 41.37 ? 206  ALA B N   1 
ATOM   5767 C CA  . ALA B 1 206 ? 9.268   8.398   -39.593 1.00 41.05 ? 206  ALA B CA  1 
ATOM   5768 C C   . ALA B 1 206 ? 10.764  8.732   -39.671 1.00 40.86 ? 206  ALA B C   1 
ATOM   5769 O O   . ALA B 1 206 ? 11.124  9.870   -39.925 1.00 41.17 ? 206  ALA B O   1 
ATOM   5770 C CB  . ALA B 1 206 ? 8.784   8.301   -38.136 1.00 40.64 ? 206  ALA B CB  1 
ATOM   5771 N N   . ALA B 1 207 ? 11.632  7.740   -39.470 1.00 40.67 ? 207  ALA B N   1 
ATOM   5772 C CA  . ALA B 1 207 ? 13.063  7.935   -39.678 1.00 40.90 ? 207  ALA B CA  1 
ATOM   5773 C C   . ALA B 1 207 ? 13.346  8.425   -41.100 1.00 41.22 ? 207  ALA B C   1 
ATOM   5774 O O   . ALA B 1 207 ? 14.159  9.344   -41.306 1.00 41.84 ? 207  ALA B O   1 
ATOM   5775 C CB  . ALA B 1 207 ? 13.830  6.648   -39.385 1.00 40.82 ? 207  ALA B CB  1 
ATOM   5776 N N   . SER B 1 208 ? 12.658  7.822   -42.076 1.00 41.29 ? 208  SER B N   1 
ATOM   5777 C CA  . SER B 1 208 ? 12.732  8.243   -43.496 1.00 41.28 ? 208  SER B CA  1 
ATOM   5778 C C   . SER B 1 208 ? 12.349  9.708   -43.668 1.00 41.57 ? 208  SER B C   1 
ATOM   5779 O O   . SER B 1 208 ? 13.100  10.467  -44.266 1.00 42.82 ? 208  SER B O   1 
ATOM   5780 C CB  . SER B 1 208 ? 11.823  7.376   -44.379 1.00 41.52 ? 208  SER B CB  1 
ATOM   5781 O OG  . SER B 1 208 ? 12.273  6.032   -44.439 1.00 40.86 ? 208  SER B OG  1 
ATOM   5782 N N   . VAL B 1 209 ? 11.191  10.110  -43.143 1.00 41.19 ? 209  VAL B N   1 
ATOM   5783 C CA  . VAL B 1 209 ? 10.807  11.539  -43.111 1.00 41.08 ? 209  VAL B CA  1 
ATOM   5784 C C   . VAL B 1 209 ? 11.927  12.416  -42.545 1.00 41.88 ? 209  VAL B C   1 
ATOM   5785 O O   . VAL B 1 209 ? 12.276  13.444  -43.142 1.00 42.31 ? 209  VAL B O   1 
ATOM   5786 C CB  . VAL B 1 209 ? 9.507   11.777  -42.301 1.00 41.24 ? 209  VAL B CB  1 
ATOM   5787 C CG1 . VAL B 1 209 ? 9.233   13.288  -42.118 1.00 40.84 ? 209  VAL B CG1 1 
ATOM   5788 C CG2 . VAL B 1 209 ? 8.320   11.087  -42.996 1.00 39.09 ? 209  VAL B CG2 1 
ATOM   5789 N N   . GLY B 1 210 ? 12.496  12.006  -41.409 1.00 42.15 ? 210  GLY B N   1 
ATOM   5790 C CA  . GLY B 1 210 ? 13.628  12.709  -40.805 1.00 42.83 ? 210  GLY B CA  1 
ATOM   5791 C C   . GLY B 1 210 ? 14.844  12.838  -41.717 1.00 43.71 ? 210  GLY B C   1 
ATOM   5792 O O   . GLY B 1 210 ? 15.486  13.896  -41.789 1.00 43.44 ? 210  GLY B O   1 
ATOM   5793 N N   . MET B 1 211 ? 15.165  11.765  -42.423 1.00 44.58 ? 211  MET B N   1 
ATOM   5794 C CA  . MET B 1 211 ? 16.271  11.817  -43.367 1.00 46.66 ? 211  MET B CA  1 
ATOM   5795 C C   . MET B 1 211 ? 16.007  12.754  -44.554 1.00 46.20 ? 211  MET B C   1 
ATOM   5796 O O   . MET B 1 211 ? 16.921  13.445  -44.997 1.00 46.73 ? 211  MET B O   1 
ATOM   5797 C CB  . MET B 1 211 ? 16.683  10.416  -43.796 1.00 46.80 ? 211  MET B CB  1 
ATOM   5798 C CG  . MET B 1 211 ? 17.618  9.787   -42.736 1.00 47.58 ? 211  MET B CG  1 
ATOM   5799 S SD  . MET B 1 211 ? 17.518  8.026   -42.796 1.00 52.32 ? 211  MET B SD  1 
ATOM   5800 C CE  . MET B 1 211 ? 17.712  7.654   -41.049 1.00 47.87 ? 211  MET B CE  1 
ATOM   5801 N N   . HIS B 1 212 ? 14.769  12.823  -45.031 1.00 45.46 ? 212  HIS B N   1 
ATOM   5802 C CA  . HIS B 1 212 ? 14.426  13.845  -46.026 1.00 45.70 ? 212  HIS B CA  1 
ATOM   5803 C C   . HIS B 1 212 ? 14.573  15.244  -45.442 1.00 45.95 ? 212  HIS B C   1 
ATOM   5804 O O   . HIS B 1 212 ? 15.030  16.148  -46.132 1.00 46.45 ? 212  HIS B O   1 
ATOM   5805 C CB  . HIS B 1 212 ? 13.028  13.632  -46.613 1.00 44.95 ? 212  HIS B CB  1 
ATOM   5806 C CG  . HIS B 1 212 ? 12.911  12.373  -47.410 1.00 45.19 ? 212  HIS B CG  1 
ATOM   5807 N ND1 . HIS B 1 212 ? 13.568  12.186  -48.607 1.00 43.93 ? 212  HIS B ND1 1 
ATOM   5808 C CD2 . HIS B 1 212 ? 12.229  11.229  -47.171 1.00 44.78 ? 212  HIS B CD2 1 
ATOM   5809 C CE1 . HIS B 1 212 ? 13.296  10.979  -49.065 1.00 44.87 ? 212  HIS B CE1 1 
ATOM   5810 N NE2 . HIS B 1 212 ? 12.482  10.380  -48.216 1.00 43.44 ? 212  HIS B NE2 1 
ATOM   5811 N N   . ILE B 1 213 ? 14.216  15.429  -44.175 1.00 45.69 ? 213  ILE B N   1 
ATOM   5812 C CA  . ILE B 1 213 ? 14.482  16.715  -43.515 1.00 46.09 ? 213  ILE B CA  1 
ATOM   5813 C C   . ILE B 1 213 ? 15.982  17.045  -43.513 1.00 46.66 ? 213  ILE B C   1 
ATOM   5814 O O   . ILE B 1 213 ? 16.371  18.201  -43.685 1.00 47.46 ? 213  ILE B O   1 
ATOM   5815 C CB  . ILE B 1 213 ? 13.950  16.764  -42.065 1.00 45.62 ? 213  ILE B CB  1 
ATOM   5816 C CG1 . ILE B 1 213 ? 12.414  16.801  -42.045 1.00 46.01 ? 213  ILE B CG1 1 
ATOM   5817 C CG2 . ILE B 1 213 ? 14.516  17.995  -41.328 1.00 45.64 ? 213  ILE B CG2 1 
ATOM   5818 C CD1 . ILE B 1 213 ? 11.777  16.509  -40.646 1.00 45.38 ? 213  ILE B CD1 1 
ATOM   5819 N N   . LEU B 1 214 ? 16.823  16.031  -43.323 1.00 46.91 ? 214  LEU B N   1 
ATOM   5820 C CA  . LEU B 1 214 ? 18.263  16.249  -43.212 1.00 47.57 ? 214  LEU B CA  1 
ATOM   5821 C C   . LEU B 1 214 ? 19.038  16.119  -44.526 1.00 48.43 ? 214  LEU B C   1 
ATOM   5822 O O   . LEU B 1 214 ? 20.263  16.246  -44.517 1.00 49.78 ? 214  LEU B O   1 
ATOM   5823 C CB  . LEU B 1 214 ? 18.858  15.303  -42.174 1.00 47.06 ? 214  LEU B CB  1 
ATOM   5824 C CG  . LEU B 1 214 ? 18.258  15.361  -40.778 1.00 46.58 ? 214  LEU B CG  1 
ATOM   5825 C CD1 . LEU B 1 214 ? 18.764  14.169  -39.988 1.00 46.96 ? 214  LEU B CD1 1 
ATOM   5826 C CD2 . LEU B 1 214 ? 18.589  16.674  -40.083 1.00 47.35 ? 214  LEU B CD2 1 
ATOM   5827 N N   . SER B 1 215 ? 18.352  15.878  -45.645 1.00 48.87 ? 215  SER B N   1 
ATOM   5828 C CA  . SER B 1 215 ? 19.019  15.787  -46.954 1.00 49.47 ? 215  SER B CA  1 
ATOM   5829 C C   . SER B 1 215 ? 18.527  16.891  -47.896 1.00 50.51 ? 215  SER B C   1 
ATOM   5830 O O   . SER B 1 215 ? 17.374  16.904  -48.319 1.00 49.78 ? 215  SER B O   1 
ATOM   5831 C CB  . SER B 1 215 ? 18.796  14.411  -47.582 1.00 49.63 ? 215  SER B CB  1 
ATOM   5832 O OG  . SER B 1 215 ? 19.670  14.180  -48.682 1.00 49.88 ? 215  SER B OG  1 
ATOM   5833 N N   . LEU B 1 216 ? 19.428  17.809  -48.230 1.00 52.10 ? 216  LEU B N   1 
ATOM   5834 C CA  . LEU B 1 216 ? 19.074  19.020  -48.981 1.00 53.54 ? 216  LEU B CA  1 
ATOM   5835 C C   . LEU B 1 216 ? 18.242  18.805  -50.235 1.00 52.76 ? 216  LEU B C   1 
ATOM   5836 O O   . LEU B 1 216 ? 17.258  19.499  -50.421 1.00 52.99 ? 216  LEU B O   1 
ATOM   5837 C CB  . LEU B 1 216 ? 20.327  19.822  -49.363 1.00 55.31 ? 216  LEU B CB  1 
ATOM   5838 C CG  . LEU B 1 216 ? 20.626  21.035  -48.490 1.00 58.85 ? 216  LEU B CG  1 
ATOM   5839 C CD1 . LEU B 1 216 ? 21.957  21.663  -48.948 1.00 62.39 ? 216  LEU B CD1 1 
ATOM   5840 C CD2 . LEU B 1 216 ? 19.464  22.048  -48.572 1.00 60.47 ? 216  LEU B CD2 1 
ATOM   5841 N N   . PRO B 1 217 ? 18.657  17.884  -51.123 1.00 52.55 ? 217  PRO B N   1 
ATOM   5842 C CA  . PRO B 1 217 ? 17.855  17.696  -52.336 1.00 52.47 ? 217  PRO B CA  1 
ATOM   5843 C C   . PRO B 1 217 ? 16.391  17.277  -52.092 1.00 52.02 ? 217  PRO B C   1 
ATOM   5844 O O   . PRO B 1 217 ? 15.567  17.422  -52.997 1.00 52.85 ? 217  PRO B O   1 
ATOM   5845 C CB  . PRO B 1 217 ? 18.625  16.610  -53.109 1.00 52.54 ? 217  PRO B CB  1 
ATOM   5846 C CG  . PRO B 1 217 ? 20.009  16.633  -52.542 1.00 52.45 ? 217  PRO B CG  1 
ATOM   5847 C CD  . PRO B 1 217 ? 19.847  17.013  -51.110 1.00 52.39 ? 217  PRO B CD  1 
ATOM   5848 N N   . SER B 1 218 ? 16.067  16.766  -50.903 1.00 51.32 ? 218  SER B N   1 
ATOM   5849 C CA  . SER B 1 218 ? 14.666  16.443  -50.562 1.00 50.65 ? 218  SER B CA  1 
ATOM   5850 C C   . SER B 1 218 ? 13.864  17.651  -50.096 1.00 50.85 ? 218  SER B C   1 
ATOM   5851 O O   . SER B 1 218 ? 12.658  17.673  -50.260 1.00 49.88 ? 218  SER B O   1 
ATOM   5852 C CB  . SER B 1 218 ? 14.582  15.364  -49.483 1.00 49.79 ? 218  SER B CB  1 
ATOM   5853 O OG  . SER B 1 218 ? 14.903  14.091  -49.990 1.00 47.25 ? 218  SER B OG  1 
ATOM   5854 N N   . ARG B 1 219 ? 14.539  18.636  -49.500 1.00 52.10 ? 219  ARG B N   1 
ATOM   5855 C CA  . ARG B 1 219 ? 13.859  19.764  -48.845 1.00 52.98 ? 219  ARG B CA  1 
ATOM   5856 C C   . ARG B 1 219 ? 13.020  20.628  -49.771 1.00 53.19 ? 219  ARG B C   1 
ATOM   5857 O O   . ARG B 1 219 ? 12.033  21.212  -49.334 1.00 54.23 ? 219  ARG B O   1 
ATOM   5858 C CB  . ARG B 1 219 ? 14.859  20.648  -48.079 1.00 54.03 ? 219  ARG B CB  1 
ATOM   5859 C CG  . ARG B 1 219 ? 15.367  20.015  -46.791 1.00 55.22 ? 219  ARG B CG  1 
ATOM   5860 C CD  . ARG B 1 219 ? 14.279  19.940  -45.718 1.00 57.76 ? 219  ARG B CD  1 
ATOM   5861 N NE  . ARG B 1 219 ? 13.984  21.243  -45.130 1.00 59.80 ? 219  ARG B NE  1 
ATOM   5862 C CZ  . ARG B 1 219 ? 14.752  21.861  -44.234 1.00 61.73 ? 219  ARG B CZ  1 
ATOM   5863 N NH1 . ARG B 1 219 ? 15.873  21.297  -43.795 1.00 62.29 ? 219  ARG B NH1 1 
ATOM   5864 N NH2 . ARG B 1 219 ? 14.398  23.059  -43.767 1.00 63.54 ? 219  ARG B NH2 1 
ATOM   5865 N N   . SER B 1 220 ? 13.381  20.693  -51.044 1.00 53.03 ? 220  SER B N   1 
ATOM   5866 C CA  . SER B 1 220 ? 12.579  21.413  -52.011 1.00 53.40 ? 220  SER B CA  1 
ATOM   5867 C C   . SER B 1 220 ? 11.297  20.663  -52.409 1.00 52.64 ? 220  SER B C   1 
ATOM   5868 O O   . SER B 1 220 ? 10.480  21.198  -53.154 1.00 53.31 ? 220  SER B O   1 
ATOM   5869 C CB  . SER B 1 220 ? 13.417  21.706  -53.253 1.00 54.49 ? 220  SER B CB  1 
ATOM   5870 O OG  . SER B 1 220 ? 13.933  20.497  -53.817 1.00 57.01 ? 220  SER B OG  1 
ATOM   5871 N N   . LEU B 1 221 ? 11.108  19.442  -51.916 1.00 50.98 ? 221  LEU B N   1 
ATOM   5872 C CA  . LEU B 1 221 ? 9.981   18.596  -52.341 1.00 50.11 ? 221  LEU B CA  1 
ATOM   5873 C C   . LEU B 1 221 ? 8.845   18.485  -51.322 1.00 49.28 ? 221  LEU B C   1 
ATOM   5874 O O   . LEU B 1 221 ? 7.889   17.760  -51.560 1.00 48.86 ? 221  LEU B O   1 
ATOM   5875 C CB  . LEU B 1 221 ? 10.486  17.188  -52.663 1.00 49.04 ? 221  LEU B CB  1 
ATOM   5876 C CG  . LEU B 1 221 ? 11.660  17.068  -53.631 1.00 49.04 ? 221  LEU B CG  1 
ATOM   5877 C CD1 . LEU B 1 221 ? 12.101  15.623  -53.749 1.00 46.47 ? 221  LEU B CD1 1 
ATOM   5878 C CD2 . LEU B 1 221 ? 11.294  17.646  -55.002 1.00 49.16 ? 221  LEU B CD2 1 
ATOM   5879 N N   . PHE B 1 222 ? 8.964   19.168  -50.184 1.00 49.16 ? 222  PHE B N   1 
ATOM   5880 C CA  . PHE B 1 222 ? 7.929   19.174  -49.162 1.00 48.61 ? 222  PHE B CA  1 
ATOM   5881 C C   . PHE B 1 222 ? 8.095   20.370  -48.239 1.00 49.44 ? 222  PHE B C   1 
ATOM   5882 O O   . PHE B 1 222 ? 9.124   21.045  -48.278 1.00 50.11 ? 222  PHE B O   1 
ATOM   5883 C CB  . PHE B 1 222 ? 7.931   17.854  -48.367 1.00 47.84 ? 222  PHE B CB  1 
ATOM   5884 C CG  . PHE B 1 222 ? 9.137   17.656  -47.482 1.00 47.12 ? 222  PHE B CG  1 
ATOM   5885 C CD1 . PHE B 1 222 ? 10.341  17.198  -48.013 1.00 46.04 ? 222  PHE B CD1 1 
ATOM   5886 C CD2 . PHE B 1 222 ? 9.063   17.922  -46.109 1.00 47.00 ? 222  PHE B CD2 1 
ATOM   5887 C CE1 . PHE B 1 222 ? 11.439  17.023  -47.208 1.00 45.41 ? 222  PHE B CE1 1 
ATOM   5888 C CE2 . PHE B 1 222 ? 10.164  17.744  -45.291 1.00 45.20 ? 222  PHE B CE2 1 
ATOM   5889 C CZ  . PHE B 1 222 ? 11.352  17.289  -45.838 1.00 46.41 ? 222  PHE B CZ  1 
ATOM   5890 N N   . HIS B 1 223 ? 7.082   20.620  -47.409 1.00 49.53 ? 223  HIS B N   1 
ATOM   5891 C CA  . HIS B 1 223 ? 7.012   21.821  -46.570 1.00 49.91 ? 223  HIS B CA  1 
ATOM   5892 C C   . HIS B 1 223 ? 6.850   21.555  -45.079 1.00 49.59 ? 223  HIS B C   1 
ATOM   5893 O O   . HIS B 1 223 ? 7.214   22.396  -44.252 1.00 50.28 ? 223  HIS B O   1 
ATOM   5894 C CB  . HIS B 1 223 ? 5.858   22.694  -47.063 1.00 50.70 ? 223  HIS B CB  1 
ATOM   5895 C CG  . HIS B 1 223 ? 5.834   22.836  -48.551 1.00 51.53 ? 223  HIS B CG  1 
ATOM   5896 N ND1 . HIS B 1 223 ? 6.409   23.900  -49.205 1.00 52.79 ? 223  HIS B ND1 1 
ATOM   5897 C CD2 . HIS B 1 223 ? 5.373   22.008  -49.516 1.00 50.32 ? 223  HIS B CD2 1 
ATOM   5898 C CE1 . HIS B 1 223 ? 6.269   23.736  -50.508 1.00 53.07 ? 223  HIS B CE1 1 
ATOM   5899 N NE2 . HIS B 1 223 ? 5.657   22.588  -50.723 1.00 50.95 ? 223  HIS B NE2 1 
ATOM   5900 N N   . ARG B 1 224 ? 6.313   20.388  -44.736 1.00 48.96 ? 224  ARG B N   1 
ATOM   5901 C CA  . ARG B 1 224 ? 6.009   20.024  -43.360 1.00 48.46 ? 224  ARG B CA  1 
ATOM   5902 C C   . ARG B 1 224 ? 6.184   18.528  -43.223 1.00 46.74 ? 224  ARG B C   1 
ATOM   5903 O O   . ARG B 1 224 ? 6.088   17.803  -44.215 1.00 46.75 ? 224  ARG B O   1 
ATOM   5904 C CB  . ARG B 1 224 ? 4.551   20.382  -43.050 1.00 49.03 ? 224  ARG B CB  1 
ATOM   5905 C CG  . ARG B 1 224 ? 4.373   21.817  -42.698 1.00 52.29 ? 224  ARG B CG  1 
ATOM   5906 C CD  . ARG B 1 224 ? 2.917   22.228  -42.565 1.00 52.57 ? 224  ARG B CD  1 
ATOM   5907 N NE  . ARG B 1 224 ? 2.277   22.317  -43.859 1.00 54.91 ? 224  ARG B NE  1 
ATOM   5908 C CZ  . ARG B 1 224 ? 2.475   23.282  -44.753 1.00 56.29 ? 224  ARG B CZ  1 
ATOM   5909 N NH1 . ARG B 1 224 ? 3.312   24.285  -44.534 1.00 57.09 ? 224  ARG B NH1 1 
ATOM   5910 N NH2 . ARG B 1 224 ? 1.821   23.230  -45.900 1.00 58.50 ? 224  ARG B NH2 1 
ATOM   5911 N N   . ALA B 1 225 ? 6.366   18.073  -41.985 1.00 45.38 ? 225  ALA B N   1 
ATOM   5912 C CA  . ALA B 1 225 ? 6.710   16.691  -41.692 1.00 44.01 ? 225  ALA B CA  1 
ATOM   5913 C C   . ALA B 1 225 ? 6.043   16.203  -40.409 1.00 43.30 ? 225  ALA B C   1 
ATOM   5914 O O   . ALA B 1 225 ? 5.919   16.952  -39.433 1.00 42.88 ? 225  ALA B O   1 
ATOM   5915 C CB  . ALA B 1 225 ? 8.228   16.565  -41.578 1.00 43.67 ? 225  ALA B CB  1 
ATOM   5916 N N   . VAL B 1 226 ? 5.624   14.941  -40.420 1.00 42.62 ? 226  VAL B N   1 
ATOM   5917 C CA  . VAL B 1 226 ? 5.121   14.258  -39.230 1.00 42.05 ? 226  VAL B CA  1 
ATOM   5918 C C   . VAL B 1 226 ? 5.938   12.991  -39.025 1.00 41.99 ? 226  VAL B C   1 
ATOM   5919 O O   . VAL B 1 226 ? 6.015   12.164  -39.928 1.00 41.35 ? 226  VAL B O   1 
ATOM   5920 C CB  . VAL B 1 226 ? 3.641   13.855  -39.387 1.00 42.35 ? 226  VAL B CB  1 
ATOM   5921 C CG1 . VAL B 1 226 ? 3.111   13.210  -38.105 1.00 40.70 ? 226  VAL B CG1 1 
ATOM   5922 C CG2 . VAL B 1 226 ? 2.793   15.070  -39.803 1.00 42.46 ? 226  VAL B CG2 1 
ATOM   5923 N N   . LEU B 1 227 ? 6.556   12.853  -37.845 1.00 42.27 ? 227  LEU B N   1 
ATOM   5924 C CA  . LEU B 1 227 ? 7.330   11.653  -37.483 1.00 41.86 ? 227  LEU B CA  1 
ATOM   5925 C C   . LEU B 1 227 ? 6.652   10.953  -36.323 1.00 41.91 ? 227  LEU B C   1 
ATOM   5926 O O   . LEU B 1 227 ? 6.683   11.446  -35.188 1.00 41.65 ? 227  LEU B O   1 
ATOM   5927 C CB  . LEU B 1 227 ? 8.778   11.995  -37.087 1.00 41.97 ? 227  LEU B CB  1 
ATOM   5928 C CG  . LEU B 1 227 ? 9.664   12.635  -38.177 1.00 42.76 ? 227  LEU B CG  1 
ATOM   5929 C CD1 . LEU B 1 227 ? 9.326   14.118  -38.344 1.00 40.85 ? 227  LEU B CD1 1 
ATOM   5930 C CD2 . LEU B 1 227 ? 11.148  12.461  -37.845 1.00 41.81 ? 227  LEU B CD2 1 
ATOM   5931 N N   . GLN B 1 228 ? 6.052   9.800   -36.612 1.00 41.31 ? 228  GLN B N   1 
ATOM   5932 C CA  . GLN B 1 228 ? 5.319   9.026   -35.616 1.00 41.64 ? 228  GLN B CA  1 
ATOM   5933 C C   . GLN B 1 228 ? 6.196   7.869   -35.163 1.00 41.67 ? 228  GLN B C   1 
ATOM   5934 O O   . GLN B 1 228 ? 6.488   6.985   -35.949 1.00 40.92 ? 228  GLN B O   1 
ATOM   5935 C CB  . GLN B 1 228 ? 4.019   8.479   -36.219 1.00 41.96 ? 228  GLN B CB  1 
ATOM   5936 C CG  . GLN B 1 228 ? 3.094   9.545   -36.762 1.00 41.59 ? 228  GLN B CG  1 
ATOM   5937 C CD  . GLN B 1 228 ? 1.885   9.007   -37.519 1.00 43.11 ? 228  GLN B CD  1 
ATOM   5938 O OE1 . GLN B 1 228 ? 1.363   9.703   -38.388 1.00 44.79 ? 228  GLN B OE1 1 
ATOM   5939 N NE2 . GLN B 1 228 ? 1.435   7.770   -37.208 1.00 42.57 ? 228  GLN B NE2 1 
ATOM   5940 N N   . SER B 1 229 ? 6.640   7.891   -33.903 1.00 41.90 ? 229  SER B N   1 
ATOM   5941 C CA  . SER B 1 229 ? 7.403   6.774   -33.316 1.00 41.74 ? 229  SER B CA  1 
ATOM   5942 C C   . SER B 1 229 ? 8.644   6.381   -34.110 1.00 41.85 ? 229  SER B C   1 
ATOM   5943 O O   . SER B 1 229 ? 8.871   5.203   -34.356 1.00 42.25 ? 229  SER B O   1 
ATOM   5944 C CB  . SER B 1 229 ? 6.511   5.539   -33.141 1.00 42.12 ? 229  SER B CB  1 
ATOM   5945 O OG  . SER B 1 229 ? 5.375   5.834   -32.357 1.00 41.61 ? 229  SER B OG  1 
ATOM   5946 N N   . GLY B 1 230 ? 9.466   7.362   -34.473 1.00 41.70 ? 230  GLY B N   1 
ATOM   5947 C CA  . GLY B 1 230 ? 10.657  7.100   -35.255 1.00 41.58 ? 230  GLY B CA  1 
ATOM   5948 C C   . GLY B 1 230 ? 11.402  8.367   -35.592 1.00 41.62 ? 230  GLY B C   1 
ATOM   5949 O O   . GLY B 1 230 ? 10.795  9.426   -35.743 1.00 41.94 ? 230  GLY B O   1 
ATOM   5950 N N   . THR B 1 231 ? 12.725  8.250   -35.698 1.00 41.63 ? 231  THR B N   1 
ATOM   5951 C CA  . THR B 1 231 ? 13.622  9.395   -35.828 1.00 42.28 ? 231  THR B CA  1 
ATOM   5952 C C   . THR B 1 231 ? 14.824  8.959   -36.660 1.00 42.25 ? 231  THR B C   1 
ATOM   5953 O O   . THR B 1 231 ? 15.166  7.793   -36.654 1.00 42.56 ? 231  THR B O   1 
ATOM   5954 C CB  . THR B 1 231 ? 14.138  9.865   -34.427 1.00 42.28 ? 231  THR B CB  1 
ATOM   5955 O OG1 . THR B 1 231 ? 14.782  8.772   -33.763 1.00 44.40 ? 231  THR B OG1 1 
ATOM   5956 C CG2 . THR B 1 231 ? 13.008  10.360  -33.538 1.00 42.27 ? 231  THR B CG2 1 
ATOM   5957 N N   . PRO B 1 232 ? 15.473  9.891   -37.363 1.00 42.59 ? 232  PRO B N   1 
ATOM   5958 C CA  . PRO B 1 232 ? 16.698  9.543   -38.092 1.00 43.32 ? 232  PRO B CA  1 
ATOM   5959 C C   . PRO B 1 232 ? 17.894  9.347   -37.169 1.00 44.10 ? 232  PRO B C   1 
ATOM   5960 O O   . PRO B 1 232 ? 18.777  8.524   -37.450 1.00 44.80 ? 232  PRO B O   1 
ATOM   5961 C CB  . PRO B 1 232 ? 16.920  10.752  -39.010 1.00 43.05 ? 232  PRO B CB  1 
ATOM   5962 C CG  . PRO B 1 232 ? 16.249  11.886  -38.294 1.00 43.40 ? 232  PRO B CG  1 
ATOM   5963 C CD  . PRO B 1 232 ? 15.091  11.303  -37.543 1.00 42.33 ? 232  PRO B CD  1 
ATOM   5964 N N   . ASN B 1 233 ? 17.943  10.135  -36.103 1.00 44.26 ? 233  ASN B N   1 
ATOM   5965 C CA  . ASN B 1 233 ? 18.898  9.917   -35.036 1.00 44.92 ? 233  ASN B CA  1 
ATOM   5966 C C   . ASN B 1 233 ? 18.532  8.662   -34.270 1.00 45.48 ? 233  ASN B C   1 
ATOM   5967 O O   . ASN B 1 233 ? 17.478  8.039   -34.509 1.00 46.10 ? 233  ASN B O   1 
ATOM   5968 C CB  . ASN B 1 233 ? 18.946  11.127  -34.089 1.00 45.06 ? 233  ASN B CB  1 
ATOM   5969 C CG  . ASN B 1 233 ? 17.555  11.571  -33.615 1.00 44.72 ? 233  ASN B CG  1 
ATOM   5970 O OD1 . ASN B 1 233 ? 16.692  11.947  -34.427 1.00 42.92 ? 233  ASN B OD1 1 
ATOM   5971 N ND2 . ASN B 1 233 ? 17.344  11.554  -32.301 1.00 42.02 ? 233  ASN B ND2 1 
ATOM   5972 N N   . GLY B 1 234 ? 19.395  8.276   -33.342 1.00 46.18 ? 234  GLY B N   1 
ATOM   5973 C CA  . GLY B 1 234 ? 19.124  7.097   -32.526 1.00 46.30 ? 234  GLY B CA  1 
ATOM   5974 C C   . GLY B 1 234 ? 19.847  5.855   -32.997 1.00 46.48 ? 234  GLY B C   1 
ATOM   5975 O O   . GLY B 1 234 ? 20.566  5.887   -33.995 1.00 45.86 ? 234  GLY B O   1 
ATOM   5976 N N   . PRO B 1 235 ? 19.646  4.747   -32.272 1.00 46.62 ? 235  PRO B N   1 
ATOM   5977 C CA  . PRO B 1 235 ? 20.509  3.558   -32.365 1.00 47.00 ? 235  PRO B CA  1 
ATOM   5978 C C   . PRO B 1 235 ? 20.308  2.593   -33.539 1.00 46.94 ? 235  PRO B C   1 
ATOM   5979 O O   . PRO B 1 235 ? 21.212  1.794   -33.814 1.00 47.22 ? 235  PRO B O   1 
ATOM   5980 C CB  . PRO B 1 235 ? 20.240  2.838   -31.041 1.00 47.43 ? 235  PRO B CB  1 
ATOM   5981 C CG  . PRO B 1 235 ? 18.864  3.259   -30.639 1.00 47.28 ? 235  PRO B CG  1 
ATOM   5982 C CD  . PRO B 1 235 ? 18.602  4.610   -31.240 1.00 46.07 ? 235  PRO B CD  1 
ATOM   5983 N N   . TRP B 1 236 ? 19.165  2.666   -34.225 1.00 46.08 ? 236  TRP B N   1 
ATOM   5984 C CA  . TRP B 1 236 ? 18.785  1.643   -35.214 1.00 45.58 ? 236  TRP B CA  1 
ATOM   5985 C C   . TRP B 1 236 ? 18.572  2.121   -36.657 1.00 45.07 ? 236  TRP B C   1 
ATOM   5986 O O   . TRP B 1 236 ? 18.553  1.300   -37.575 1.00 44.97 ? 236  TRP B O   1 
ATOM   5987 C CB  . TRP B 1 236 ? 17.510  0.933   -34.752 1.00 45.19 ? 236  TRP B CB  1 
ATOM   5988 C CG  . TRP B 1 236 ? 16.371  1.843   -34.519 1.00 44.73 ? 236  TRP B CG  1 
ATOM   5989 C CD1 . TRP B 1 236 ? 16.023  2.425   -33.334 1.00 44.76 ? 236  TRP B CD1 1 
ATOM   5990 C CD2 . TRP B 1 236 ? 15.410  2.296   -35.484 1.00 45.00 ? 236  TRP B CD2 1 
ATOM   5991 N NE1 . TRP B 1 236 ? 14.910  3.214   -33.498 1.00 44.18 ? 236  TRP B NE1 1 
ATOM   5992 C CE2 . TRP B 1 236 ? 14.509  3.155   -34.805 1.00 45.08 ? 236  TRP B CE2 1 
ATOM   5993 C CE3 . TRP B 1 236 ? 15.212  2.056   -36.850 1.00 44.42 ? 236  TRP B CE3 1 
ATOM   5994 C CZ2 . TRP B 1 236 ? 13.435  3.782   -35.451 1.00 44.10 ? 236  TRP B CZ2 1 
ATOM   5995 C CZ3 . TRP B 1 236 ? 14.136  2.689   -37.497 1.00 43.71 ? 236  TRP B CZ3 1 
ATOM   5996 C CH2 . TRP B 1 236 ? 13.269  3.536   -36.794 1.00 43.62 ? 236  TRP B CH2 1 
ATOM   5997 N N   . ALA B 1 237 ? 18.371  3.421   -36.855 1.00 44.64 ? 237  ALA B N   1 
ATOM   5998 C CA  . ALA B 1 237 ? 17.896  3.952   -38.149 1.00 44.32 ? 237  ALA B CA  1 
ATOM   5999 C C   . ALA B 1 237 ? 19.022  4.151   -39.148 1.00 44.57 ? 237  ALA B C   1 
ATOM   6000 O O   . ALA B 1 237 ? 18.753  4.284   -40.349 1.00 44.44 ? 237  ALA B O   1 
ATOM   6001 C CB  . ALA B 1 237 ? 17.128  5.259   -37.960 1.00 43.67 ? 237  ALA B CB  1 
ATOM   6002 N N   . THR B 1 238 ? 20.268  4.181   -38.661 1.00 44.64 ? 238  THR B N   1 
ATOM   6003 C CA  . THR B 1 238 ? 21.440  4.288   -39.532 1.00 44.95 ? 238  THR B CA  1 
ATOM   6004 C C   . THR B 1 238 ? 22.599  3.405   -39.090 1.00 46.05 ? 238  THR B C   1 
ATOM   6005 O O   . THR B 1 238 ? 22.655  2.916   -37.946 1.00 46.04 ? 238  THR B O   1 
ATOM   6006 C CB  . THR B 1 238 ? 21.978  5.746   -39.651 1.00 45.13 ? 238  THR B CB  1 
ATOM   6007 O OG1 . THR B 1 238 ? 22.468  6.191   -38.379 1.00 44.03 ? 238  THR B OG1 1 
ATOM   6008 C CG2 . THR B 1 238 ? 20.900  6.688   -40.178 1.00 43.58 ? 238  THR B CG2 1 
ATOM   6009 N N   . VAL B 1 239 ? 23.512  3.196   -40.030 1.00 46.79 ? 239  VAL B N   1 
ATOM   6010 C CA  . VAL B 1 239 ? 24.790  2.547   -39.757 1.00 48.16 ? 239  VAL B CA  1 
ATOM   6011 C C   . VAL B 1 239 ? 25.882  3.365   -40.405 1.00 48.75 ? 239  VAL B C   1 
ATOM   6012 O O   . VAL B 1 239 ? 25.623  4.129   -41.338 1.00 48.59 ? 239  VAL B O   1 
ATOM   6013 C CB  . VAL B 1 239 ? 24.834  1.097   -40.309 1.00 48.73 ? 239  VAL B CB  1 
ATOM   6014 C CG1 . VAL B 1 239 ? 23.879  0.210   -39.522 1.00 48.85 ? 239  VAL B CG1 1 
ATOM   6015 C CG2 . VAL B 1 239 ? 24.504  1.067   -41.806 1.00 47.74 ? 239  VAL B CG2 1 
ATOM   6016 N N   . SER B 1 240 ? 27.099  3.207   -39.904 1.00 49.96 ? 240  SER B N   1 
ATOM   6017 C CA  . SER B 1 240 ? 28.268  3.799   -40.539 1.00 50.81 ? 240  SER B CA  1 
ATOM   6018 C C   . SER B 1 240 ? 28.584  3.035   -41.815 1.00 51.31 ? 240  SER B C   1 
ATOM   6019 O O   . SER B 1 240 ? 28.146  1.894   -41.996 1.00 50.91 ? 240  SER B O   1 
ATOM   6020 C CB  . SER B 1 240 ? 29.466  3.736   -39.607 1.00 51.76 ? 240  SER B CB  1 
ATOM   6021 O OG  . SER B 1 240 ? 29.896  2.394   -39.476 1.00 52.66 ? 240  SER B OG  1 
ATOM   6022 N N   . ALA B 1 241 ? 29.357  3.670   -42.692 1.00 52.00 ? 241  ALA B N   1 
ATOM   6023 C CA  . ALA B 1 241 ? 29.787  3.054   -43.943 1.00 52.56 ? 241  ALA B CA  1 
ATOM   6024 C C   . ALA B 1 241 ? 30.543  1.755   -43.670 1.00 53.79 ? 241  ALA B C   1 
ATOM   6025 O O   . ALA B 1 241 ? 30.366  0.756   -44.381 1.00 53.71 ? 241  ALA B O   1 
ATOM   6026 C CB  . ALA B 1 241 ? 30.671  4.021   -44.731 1.00 52.89 ? 241  ALA B CB  1 
ATOM   6027 N N   . GLY B 1 242 ? 31.389  1.780   -42.641 1.00 54.42 ? 242  GLY B N   1 
ATOM   6028 C CA  . GLY B 1 242 ? 32.163  0.613   -42.251 1.00 55.42 ? 242  GLY B CA  1 
ATOM   6029 C C   . GLY B 1 242 ? 31.270  -0.559  -41.908 1.00 54.80 ? 242  GLY B C   1 
ATOM   6030 O O   . GLY B 1 242 ? 31.499  -1.665  -42.361 1.00 55.63 ? 242  GLY B O   1 
ATOM   6031 N N   . GLU B 1 243 ? 30.240  -0.311  -41.116 1.00 53.74 ? 243  GLU B N   1 
ATOM   6032 C CA  . GLU B 1 243 ? 29.356  -1.379  -40.661 1.00 53.36 ? 243  GLU B CA  1 
ATOM   6033 C C   . GLU B 1 243 ? 28.464  -1.906  -41.803 1.00 52.99 ? 243  GLU B C   1 
ATOM   6034 O O   . GLU B 1 243 ? 28.163  -3.105  -41.852 1.00 53.05 ? 243  GLU B O   1 
ATOM   6035 C CB  . GLU B 1 243 ? 28.517  -0.884  -39.476 1.00 52.74 ? 243  GLU B CB  1 
ATOM   6036 C CG  . GLU B 1 243 ? 27.478  -1.867  -38.934 1.00 52.54 ? 243  GLU B CG  1 
ATOM   6037 C CD  . GLU B 1 243 ? 28.079  -3.123  -38.340 1.00 53.61 ? 243  GLU B CD  1 
ATOM   6038 O OE1 . GLU B 1 243 ? 27.294  -3.999  -37.922 1.00 52.52 ? 243  GLU B OE1 1 
ATOM   6039 O OE2 . GLU B 1 243 ? 29.321  -3.247  -38.284 1.00 55.63 ? 243  GLU B OE2 1 
ATOM   6040 N N   . ALA B 1 244 ? 28.065  -1.011  -42.712 1.00 51.94 ? 244  ALA B N   1 
ATOM   6041 C CA  . ALA B 1 244 ? 27.300  -1.384  -43.916 1.00 51.59 ? 244  ALA B CA  1 
ATOM   6042 C C   . ALA B 1 244 ? 28.127  -2.302  -44.820 1.00 52.40 ? 244  ALA B C   1 
ATOM   6043 O O   . ALA B 1 244 ? 27.642  -3.326  -45.299 1.00 52.11 ? 244  ALA B O   1 
ATOM   6044 C CB  . ALA B 1 244 ? 26.853  -0.133  -44.685 1.00 50.05 ? 244  ALA B CB  1 
ATOM   6045 N N   . ARG B 1 245 ? 29.379  -1.932  -45.037 1.00 53.71 ? 245  ARG B N   1 
ATOM   6046 C CA  . ARG B 1 245 ? 30.313  -2.749  -45.812 1.00 55.21 ? 245  ARG B CA  1 
ATOM   6047 C C   . ARG B 1 245 ? 30.503  -4.141  -45.204 1.00 55.93 ? 245  ARG B C   1 
ATOM   6048 O O   . ARG B 1 245 ? 30.472  -5.149  -45.910 1.00 56.51 ? 245  ARG B O   1 
ATOM   6049 C CB  . ARG B 1 245 ? 31.660  -2.035  -45.904 1.00 56.41 ? 245  ARG B CB  1 
ATOM   6050 C CG  . ARG B 1 245 ? 32.734  -2.792  -46.687 1.00 57.54 ? 245  ARG B CG  1 
ATOM   6051 C CD  . ARG B 1 245 ? 33.877  -1.868  -47.046 1.00 58.63 ? 245  ARG B CD  1 
ATOM   6052 N NE  . ARG B 1 245 ? 33.520  -0.998  -48.164 1.00 58.81 ? 245  ARG B NE  1 
ATOM   6053 C CZ  . ARG B 1 245 ? 33.543  -1.372  -49.441 1.00 59.55 ? 245  ARG B CZ  1 
ATOM   6054 N NH1 . ARG B 1 245 ? 33.200  -0.505  -50.380 1.00 59.73 ? 245  ARG B NH1 1 
ATOM   6055 N NH2 . ARG B 1 245 ? 33.898  -2.606  -49.788 1.00 60.67 ? 245  ARG B NH2 1 
ATOM   6056 N N   . ARG B 1 246 ? 30.710  -4.171  -43.894 1.00 56.23 ? 246  ARG B N   1 
ATOM   6057 C CA  . ARG B 1 246 ? 30.873  -5.411  -43.123 1.00 56.92 ? 246  ARG B CA  1 
ATOM   6058 C C   . ARG B 1 246 ? 29.696  -6.349  -43.368 1.00 55.71 ? 246  ARG B C   1 
ATOM   6059 O O   . ARG B 1 246 ? 29.879  -7.530  -43.682 1.00 55.99 ? 246  ARG B O   1 
ATOM   6060 C CB  . ARG B 1 246 ? 30.944  -5.070  -41.620 1.00 57.21 ? 246  ARG B CB  1 
ATOM   6061 C CG  . ARG B 1 246 ? 31.977  -5.833  -40.776 1.00 60.04 ? 246  ARG B CG  1 
ATOM   6062 C CD  . ARG B 1 246 ? 31.377  -6.818  -39.756 1.00 61.55 ? 246  ARG B CD  1 
ATOM   6063 N NE  . ARG B 1 246 ? 30.124  -6.383  -39.127 1.00 60.55 ? 246  ARG B NE  1 
ATOM   6064 C CZ  . ARG B 1 246 ? 29.135  -7.215  -38.784 1.00 60.89 ? 246  ARG B CZ  1 
ATOM   6065 N NH1 . ARG B 1 246 ? 29.243  -8.525  -38.980 1.00 62.08 ? 246  ARG B NH1 1 
ATOM   6066 N NH2 . ARG B 1 246 ? 28.021  -6.747  -38.235 1.00 59.84 ? 246  ARG B NH2 1 
ATOM   6067 N N   . ARG B 1 247 ? 28.487  -5.809  -43.222 1.00 53.96 ? 247  ARG B N   1 
ATOM   6068 C CA  . ARG B 1 247 ? 27.258  -6.607  -43.369 1.00 53.34 ? 247  ARG B CA  1 
ATOM   6069 C C   . ARG B 1 247 ? 27.024  -7.091  -44.799 1.00 53.26 ? 247  ARG B C   1 
ATOM   6070 O O   . ARG B 1 247 ? 26.575  -8.221  -45.007 1.00 53.71 ? 247  ARG B O   1 
ATOM   6071 C CB  . ARG B 1 247 ? 26.039  -5.825  -42.872 1.00 51.91 ? 247  ARG B CB  1 
ATOM   6072 C CG  . ARG B 1 247 ? 26.050  -5.553  -41.373 1.00 51.63 ? 247  ARG B CG  1 
ATOM   6073 C CD  . ARG B 1 247 ? 24.890  -4.667  -40.950 1.00 51.27 ? 247  ARG B CD  1 
ATOM   6074 N NE  . ARG B 1 247 ? 24.955  -4.319  -39.535 1.00 51.16 ? 247  ARG B NE  1 
ATOM   6075 C CZ  . ARG B 1 247 ? 24.003  -3.665  -38.869 1.00 50.27 ? 247  ARG B CZ  1 
ATOM   6076 N NH1 . ARG B 1 247 ? 22.879  -3.301  -39.462 1.00 50.54 ? 247  ARG B NH1 1 
ATOM   6077 N NH2 . ARG B 1 247 ? 24.168  -3.390  -37.583 1.00 50.48 ? 247  ARG B NH2 1 
ATOM   6078 N N   . ALA B 1 248 ? 27.326  -6.242  -45.777 1.00 53.12 ? 248  ALA B N   1 
ATOM   6079 C CA  . ALA B 1 248 ? 27.167  -6.602  -47.190 1.00 53.62 ? 248  ALA B CA  1 
ATOM   6080 C C   . ALA B 1 248 ? 28.182  -7.679  -47.572 1.00 55.47 ? 248  ALA B C   1 
ATOM   6081 O O   . ALA B 1 248 ? 27.848  -8.663  -48.229 1.00 55.81 ? 248  ALA B O   1 
ATOM   6082 C CB  . ALA B 1 248 ? 27.334  -5.373  -48.074 1.00 52.71 ? 248  ALA B CB  1 
ATOM   6083 N N   . THR B 1 249 ? 29.423  -7.488  -47.138 1.00 57.15 ? 249  THR B N   1 
ATOM   6084 C CA  . THR B 1 249 ? 30.493  -8.460  -47.359 1.00 59.08 ? 249  THR B CA  1 
ATOM   6085 C C   . THR B 1 249 ? 30.159  -9.823  -46.742 1.00 60.01 ? 249  THR B C   1 
ATOM   6086 O O   . THR B 1 249 ? 30.449  -10.863 -47.329 1.00 60.90 ? 249  THR B O   1 
ATOM   6087 C CB  . THR B 1 249 ? 31.805  -7.934  -46.774 1.00 59.99 ? 249  THR B CB  1 
ATOM   6088 O OG1 . THR B 1 249 ? 32.073  -6.644  -47.327 1.00 59.73 ? 249  THR B OG1 1 
ATOM   6089 C CG2 . THR B 1 249 ? 32.977  -8.880  -47.070 1.00 61.42 ? 249  THR B CG2 1 
ATOM   6090 N N   . LEU B 1 250 ? 29.540  -9.809  -45.564 1.00 59.97 ? 250  LEU B N   1 
ATOM   6091 C CA  . LEU B 1 250 ? 29.173  -11.050 -44.880 1.00 60.82 ? 250  LEU B CA  1 
ATOM   6092 C C   . LEU B 1 250 ? 28.010  -11.769 -45.577 1.00 61.07 ? 250  LEU B C   1 
ATOM   6093 O O   . LEU B 1 250 ? 28.039  -12.993 -45.734 1.00 61.78 ? 250  LEU B O   1 
ATOM   6094 C CB  . LEU B 1 250 ? 28.827  -10.767 -43.416 1.00 60.38 ? 250  LEU B CB  1 
ATOM   6095 C CG  . LEU B 1 250 ? 28.382  -11.935 -42.538 1.00 60.39 ? 250  LEU B CG  1 
ATOM   6096 C CD1 . LEU B 1 250 ? 29.393  -13.068 -42.561 1.00 61.49 ? 250  LEU B CD1 1 
ATOM   6097 C CD2 . LEU B 1 250 ? 28.151  -11.429 -41.115 1.00 59.66 ? 250  LEU B CD2 1 
ATOM   6098 N N   . LEU B 1 251 ? 26.986  -11.020 -45.982 1.00 60.58 ? 251  LEU B N   1 
ATOM   6099 C CA  . LEU B 1 251 ? 25.861  -11.620 -46.713 1.00 60.69 ? 251  LEU B CA  1 
ATOM   6100 C C   . LEU B 1 251 ? 26.351  -12.270 -48.006 1.00 61.62 ? 251  LEU B C   1 
ATOM   6101 O O   . LEU B 1 251 ? 25.947  -13.376 -48.335 1.00 61.91 ? 251  LEU B O   1 
ATOM   6102 C CB  . LEU B 1 251 ? 24.785  -10.582 -47.025 1.00 59.43 ? 251  LEU B CB  1 
ATOM   6103 C CG  . LEU B 1 251 ? 23.535  -11.111 -47.754 1.00 59.52 ? 251  LEU B CG  1 
ATOM   6104 C CD1 . LEU B 1 251 ? 22.521  -11.673 -46.769 1.00 59.74 ? 251  LEU B CD1 1 
ATOM   6105 C CD2 . LEU B 1 251 ? 22.910  -10.016 -48.579 1.00 58.72 ? 251  LEU B CD2 1 
ATOM   6106 N N   . ALA B 1 252 ? 27.224  -11.566 -48.721 1.00 62.56 ? 252  ALA B N   1 
ATOM   6107 C CA  . ALA B 1 252 ? 27.861  -12.075 -49.937 1.00 63.97 ? 252  ALA B CA  1 
ATOM   6108 C C   . ALA B 1 252 ? 28.565  -13.396 -49.668 1.00 66.07 ? 252  ALA B C   1 
ATOM   6109 O O   . ALA B 1 252 ? 28.411  -14.355 -50.421 1.00 66.94 ? 252  ALA B O   1 
ATOM   6110 C CB  . ALA B 1 252 ? 28.858  -11.054 -50.484 1.00 63.74 ? 252  ALA B CB  1 
ATOM   6111 N N   . ARG B 1 253 ? 29.335  -13.445 -48.590 1.00 67.45 ? 253  ARG B N   1 
ATOM   6112 C CA  . ARG B 1 253 ? 30.016  -14.671 -48.197 1.00 69.86 ? 253  ARG B CA  1 
ATOM   6113 C C   . ARG B 1 253 ? 29.006  -15.791 -47.955 1.00 69.48 ? 253  ARG B C   1 
ATOM   6114 O O   . ARG B 1 253 ? 29.153  -16.895 -48.477 1.00 70.40 ? 253  ARG B O   1 
ATOM   6115 C CB  . ARG B 1 253 ? 30.852  -14.427 -46.947 1.00 70.22 ? 253  ARG B CB  1 
ATOM   6116 C CG  . ARG B 1 253 ? 31.615  -15.645 -46.463 1.00 73.89 ? 253  ARG B CG  1 
ATOM   6117 C CD  . ARG B 1 253 ? 32.434  -15.316 -45.243 1.00 75.37 ? 253  ARG B CD  1 
ATOM   6118 N NE  . ARG B 1 253 ? 32.817  -16.518 -44.505 1.00 80.40 ? 253  ARG B NE  1 
ATOM   6119 C CZ  . ARG B 1 253 ? 32.166  -17.018 -43.448 1.00 81.93 ? 253  ARG B CZ  1 
ATOM   6120 N NH1 . ARG B 1 253 ? 31.063  -16.439 -42.964 1.00 80.50 ? 253  ARG B NH1 1 
ATOM   6121 N NH2 . ARG B 1 253 ? 32.641  -18.120 -42.859 1.00 83.64 ? 253  ARG B NH2 1 
ATOM   6122 N N   . LEU B 1 254 ? 27.963  -15.488 -47.193 1.00 68.38 ? 254  LEU B N   1 
ATOM   6123 C CA  . LEU B 1 254 ? 26.917  -16.465 -46.884 1.00 68.38 ? 254  LEU B CA  1 
ATOM   6124 C C   . LEU B 1 254 ? 26.174  -17.019 -48.107 1.00 68.61 ? 254  LEU B C   1 
ATOM   6125 O O   . LEU B 1 254 ? 25.697  -18.150 -48.066 1.00 69.25 ? 254  LEU B O   1 
ATOM   6126 C CB  . LEU B 1 254 ? 25.907  -15.869 -45.899 1.00 66.98 ? 254  LEU B CB  1 
ATOM   6127 C CG  . LEU B 1 254 ? 26.433  -15.610 -44.482 1.00 66.61 ? 254  LEU B CG  1 
ATOM   6128 C CD1 . LEU B 1 254 ? 25.405  -14.858 -43.682 1.00 64.30 ? 254  LEU B CD1 1 
ATOM   6129 C CD2 . LEU B 1 254 ? 26.807  -16.925 -43.795 1.00 67.77 ? 254  LEU B CD2 1 
ATOM   6130 N N   . VAL B 1 255 ? 26.065  -16.237 -49.178 1.00 68.25 ? 255  VAL B N   1 
ATOM   6131 C CA  . VAL B 1 255 ? 25.399  -16.717 -50.398 1.00 68.89 ? 255  VAL B CA  1 
ATOM   6132 C C   . VAL B 1 255 ? 26.405  -17.204 -51.440 1.00 70.53 ? 255  VAL B C   1 
ATOM   6133 O O   . VAL B 1 255 ? 26.049  -17.437 -52.588 1.00 71.16 ? 255  VAL B O   1 
ATOM   6134 C CB  . VAL B 1 255 ? 24.438  -15.664 -51.021 1.00 67.42 ? 255  VAL B CB  1 
ATOM   6135 C CG1 . VAL B 1 255 ? 23.334  -15.326 -50.034 1.00 66.42 ? 255  VAL B CG1 1 
ATOM   6136 C CG2 . VAL B 1 255 ? 25.189  -14.404 -51.457 1.00 66.64 ? 255  VAL B CG2 1 
ATOM   6137 N N   . GLY B 1 256 ? 27.657  -17.359 -51.035 1.00 71.98 ? 256  GLY B N   1 
ATOM   6138 C CA  . GLY B 1 256 ? 28.674  -17.922 -51.902 1.00 73.87 ? 256  GLY B CA  1 
ATOM   6139 C C   . GLY B 1 256 ? 29.210  -16.951 -52.930 1.00 74.09 ? 256  GLY B C   1 
ATOM   6140 O O   . GLY B 1 256 ? 29.679  -17.375 -53.980 1.00 74.94 ? 256  GLY B O   1 
ATOM   6141 N N   . CYS B 1 257 ? 29.162  -15.656 -52.632 1.00 73.75 ? 257  CYS B N   1 
ATOM   6142 C CA  . CYS B 1 257 ? 29.639  -14.647 -53.573 1.00 74.44 ? 257  CYS B CA  1 
ATOM   6143 C C   . CYS B 1 257 ? 31.017  -14.134 -53.192 1.00 76.31 ? 257  CYS B C   1 
ATOM   6144 O O   . CYS B 1 257 ? 31.178  -13.434 -52.189 1.00 76.20 ? 257  CYS B O   1 
ATOM   6145 C CB  . CYS B 1 257 ? 28.647  -13.494 -53.709 1.00 72.50 ? 257  CYS B CB  1 
ATOM   6146 S SG  . CYS B 1 257 ? 27.328  -13.911 -54.830 1.00 71.85 ? 257  CYS B SG  1 
ATOM   6147 N N   . PRO B 1 258 ? 32.024  -14.481 -54.004 1.00 78.95 ? 258  PRO B N   1 
ATOM   6148 C CA  . PRO B 1 258 ? 33.370  -14.035 -53.699 1.00 80.24 ? 258  PRO B CA  1 
ATOM   6149 C C   . PRO B 1 258 ? 33.617  -12.626 -54.246 1.00 79.93 ? 258  PRO B C   1 
ATOM   6150 O O   . PRO B 1 258 ? 33.121  -12.291 -55.334 1.00 79.91 ? 258  PRO B O   1 
ATOM   6151 C CB  . PRO B 1 258 ? 34.233  -15.081 -54.412 1.00 82.08 ? 258  PRO B CB  1 
ATOM   6152 C CG  . PRO B 1 258 ? 33.393  -15.530 -55.603 1.00 81.67 ? 258  PRO B CG  1 
ATOM   6153 C CD  . PRO B 1 258 ? 31.966  -15.292 -55.246 1.00 79.89 ? 258  PRO B CD  1 
ATOM   6154 N N   . ASN B 1 265 ? 37.487  -6.795  -54.876 1.00 77.20 ? 265  ASN B N   1 
ATOM   6155 C CA  . ASN B 1 265 ? 36.827  -5.881  -55.822 1.00 76.14 ? 265  ASN B CA  1 
ATOM   6156 C C   . ASN B 1 265 ? 35.292  -5.794  -55.651 1.00 73.95 ? 265  ASN B C   1 
ATOM   6157 O O   . ASN B 1 265 ? 34.599  -6.814  -55.722 1.00 73.64 ? 265  ASN B O   1 
ATOM   6158 C CB  . ASN B 1 265 ? 37.171  -6.300  -57.253 1.00 77.62 ? 265  ASN B CB  1 
ATOM   6159 C CG  . ASN B 1 265 ? 36.292  -5.628  -58.283 1.00 78.22 ? 265  ASN B CG  1 
ATOM   6160 O OD1 . ASN B 1 265 ? 35.672  -6.292  -59.110 1.00 80.87 ? 265  ASN B OD1 1 
ATOM   6161 N ND2 . ASN B 1 265 ? 36.219  -4.303  -58.228 1.00 80.68 ? 265  ASN B ND2 1 
ATOM   6162 N N   . ASP B 1 266 ? 34.774  -4.577  -55.460 1.00 72.12 ? 266  ASP B N   1 
ATOM   6163 C CA  . ASP B 1 266 ? 33.328  -4.359  -55.239 1.00 70.24 ? 266  ASP B CA  1 
ATOM   6164 C C   . ASP B 1 266 ? 32.478  -4.811  -56.425 1.00 69.29 ? 266  ASP B C   1 
ATOM   6165 O O   . ASP B 1 266 ? 31.432  -5.431  -56.248 1.00 68.37 ? 266  ASP B O   1 
ATOM   6166 C CB  . ASP B 1 266 ? 33.011  -2.875  -54.961 1.00 69.02 ? 266  ASP B CB  1 
ATOM   6167 C CG  . ASP B 1 266 ? 33.385  -2.429  -53.550 1.00 68.54 ? 266  ASP B CG  1 
ATOM   6168 O OD1 . ASP B 1 266 ? 33.618  -3.289  -52.674 1.00 67.92 ? 266  ASP B OD1 1 
ATOM   6169 O OD2 . ASP B 1 266 ? 33.446  -1.200  -53.322 1.00 66.68 ? 266  ASP B OD2 1 
ATOM   6170 N N   . THR B 1 267 ? 32.926  -4.467  -57.627 1.00 69.42 ? 267  THR B N   1 
ATOM   6171 C CA  . THR B 1 267 ? 32.194  -4.758  -58.852 1.00 68.82 ? 267  THR B CA  1 
ATOM   6172 C C   . THR B 1 267 ? 31.891  -6.249  -58.979 1.00 68.81 ? 267  THR B C   1 
ATOM   6173 O O   . THR B 1 267 ? 30.747  -6.625  -59.231 1.00 67.77 ? 267  THR B O   1 
ATOM   6174 C CB  . THR B 1 267 ? 32.971  -4.228  -60.086 1.00 70.05 ? 267  THR B CB  1 
ATOM   6175 O OG1 . THR B 1 267 ? 33.023  -2.797  -60.021 1.00 69.23 ? 267  THR B OG1 1 
ATOM   6176 C CG2 . THR B 1 267 ? 32.308  -4.656  -61.413 1.00 69.90 ? 267  THR B CG2 1 
ATOM   6177 N N   . GLU B 1 268 ? 32.915  -7.083  -58.788 1.00 69.94 ? 268  GLU B N   1 
ATOM   6178 C CA  . GLU B 1 268 ? 32.772  -8.546  -58.825 1.00 70.52 ? 268  GLU B CA  1 
ATOM   6179 C C   . GLU B 1 268 ? 31.759  -9.020  -57.789 1.00 68.41 ? 268  GLU B C   1 
ATOM   6180 O O   . GLU B 1 268 ? 30.847  -9.789  -58.095 1.00 67.83 ? 268  GLU B O   1 
ATOM   6181 C CB  . GLU B 1 268 ? 34.117  -9.244  -58.555 1.00 72.06 ? 268  GLU B CB  1 
ATOM   6182 C CG  . GLU B 1 268 ? 34.989  -9.467  -59.791 1.00 75.08 ? 268  GLU B CG  1 
ATOM   6183 C CD  . GLU B 1 268 ? 36.351  -10.133 -59.474 1.00 77.44 ? 268  GLU B CD  1 
ATOM   6184 O OE1 . GLU B 1 268 ? 36.941  -10.735 -60.409 1.00 80.46 ? 268  GLU B OE1 1 
ATOM   6185 O OE2 . GLU B 1 268 ? 36.835  -10.047 -58.306 1.00 81.08 ? 268  GLU B OE2 1 
ATOM   6186 N N   . LEU B 1 269 ? 31.939  -8.556  -56.560 1.00 66.91 ? 269  LEU B N   1 
ATOM   6187 C CA  . LEU B 1 269 ? 31.071  -8.938  -55.454 1.00 65.57 ? 269  LEU B CA  1 
ATOM   6188 C C   . LEU B 1 269 ? 29.613  -8.612  -55.766 1.00 63.54 ? 269  LEU B C   1 
ATOM   6189 O O   . LEU B 1 269 ? 28.740  -9.463  -55.618 1.00 63.22 ? 269  LEU B O   1 
ATOM   6190 C CB  . LEU B 1 269 ? 31.544  -8.246  -54.167 1.00 65.37 ? 269  LEU B CB  1 
ATOM   6191 C CG  . LEU B 1 269 ? 30.798  -8.491  -52.857 1.00 64.90 ? 269  LEU B CG  1 
ATOM   6192 C CD1 . LEU B 1 269 ? 31.736  -8.340  -51.675 1.00 64.95 ? 269  LEU B CD1 1 
ATOM   6193 C CD2 . LEU B 1 269 ? 29.635  -7.531  -52.720 1.00 63.66 ? 269  LEU B CD2 1 
ATOM   6194 N N   . ILE B 1 270 ? 29.362  -7.397  -56.237 1.00 62.15 ? 270  ILE B N   1 
ATOM   6195 C CA  . ILE B 1 270 ? 27.996  -6.941  -56.499 1.00 60.85 ? 270  ILE B CA  1 
ATOM   6196 C C   . ILE B 1 270 ? 27.396  -7.623  -57.735 1.00 60.80 ? 270  ILE B C   1 
ATOM   6197 O O   . ILE B 1 270 ? 26.181  -7.876  -57.784 1.00 59.50 ? 270  ILE B O   1 
ATOM   6198 C CB  . ILE B 1 270 ? 27.934  -5.402  -56.667 1.00 60.24 ? 270  ILE B CB  1 
ATOM   6199 C CG1 . ILE B 1 270 ? 28.349  -4.701  -55.365 1.00 59.90 ? 270  ILE B CG1 1 
ATOM   6200 C CG2 . ILE B 1 270 ? 26.559  -4.976  -57.053 1.00 58.35 ? 270  ILE B CG2 1 
ATOM   6201 C CD1 . ILE B 1 270 ? 28.817  -3.256  -55.555 1.00 59.84 ? 270  ILE B CD1 1 
ATOM   6202 N N   . ALA B 1 271 ? 28.243  -7.924  -58.723 1.00 61.48 ? 271  ALA B N   1 
ATOM   6203 C CA  . ALA B 1 271 ? 27.793  -8.655  -59.908 1.00 61.97 ? 271  ALA B CA  1 
ATOM   6204 C C   . ALA B 1 271 ? 27.249  -10.032 -59.523 1.00 62.23 ? 271  ALA B C   1 
ATOM   6205 O O   . ALA B 1 271 ? 26.225  -10.464 -60.043 1.00 62.21 ? 271  ALA B O   1 
ATOM   6206 C CB  . ALA B 1 271 ? 28.916  -8.786  -60.927 1.00 62.80 ? 271  ALA B CB  1 
ATOM   6207 N N   . CYS B 1 272 ? 27.925  -10.702 -58.597 1.00 63.30 ? 272  CYS B N   1 
ATOM   6208 C CA  . CYS B 1 272 ? 27.508  -12.024 -58.136 1.00 63.50 ? 272  CYS B CA  1 
ATOM   6209 C C   . CYS B 1 272 ? 26.255  -11.928 -57.270 1.00 61.51 ? 272  CYS B C   1 
ATOM   6210 O O   . CYS B 1 272 ? 25.381  -12.786 -57.352 1.00 61.60 ? 272  CYS B O   1 
ATOM   6211 C CB  . CYS B 1 272 ? 28.654  -12.727 -57.389 1.00 64.80 ? 272  CYS B CB  1 
ATOM   6212 S SG  . CYS B 1 272 ? 28.248  -14.368 -56.679 1.00 67.44 ? 272  CYS B SG  1 
ATOM   6213 N N   . LEU B 1 273 ? 26.156  -10.890 -56.444 1.00 59.76 ? 273  LEU B N   1 
ATOM   6214 C CA  . LEU B 1 273 ? 24.934  -10.679 -55.669 1.00 57.89 ? 273  LEU B CA  1 
ATOM   6215 C C   . LEU B 1 273 ? 23.730  -10.486 -56.597 1.00 56.96 ? 273  LEU B C   1 
ATOM   6216 O O   . LEU B 1 273 ? 22.645  -11.001 -56.322 1.00 56.79 ? 273  LEU B O   1 
ATOM   6217 C CB  . LEU B 1 273 ? 25.066  -9.498  -54.706 1.00 56.94 ? 273  LEU B CB  1 
ATOM   6218 C CG  . LEU B 1 273 ? 25.836  -9.739  -53.406 1.00 56.16 ? 273  LEU B CG  1 
ATOM   6219 C CD1 . LEU B 1 273 ? 25.986  -8.435  -52.650 1.00 53.69 ? 273  LEU B CD1 1 
ATOM   6220 C CD2 . LEU B 1 273 ? 25.168  -10.794 -52.531 1.00 54.34 ? 273  LEU B CD2 1 
ATOM   6221 N N   . ARG B 1 274 ? 23.937  -9.789  -57.711 1.00 56.23 ? 274  ARG B N   1 
ATOM   6222 C CA  . ARG B 1 274 ? 22.869  -9.585  -58.702 1.00 55.37 ? 274  ARG B CA  1 
ATOM   6223 C C   . ARG B 1 274 ? 22.377  -10.856 -59.398 1.00 55.32 ? 274  ARG B C   1 
ATOM   6224 O O   . ARG B 1 274 ? 21.284  -10.850 -59.945 1.00 54.68 ? 274  ARG B O   1 
ATOM   6225 C CB  . ARG B 1 274 ? 23.287  -8.553  -59.754 1.00 55.13 ? 274  ARG B CB  1 
ATOM   6226 C CG  . ARG B 1 274 ? 23.357  -7.126  -59.202 1.00 54.55 ? 274  ARG B CG  1 
ATOM   6227 C CD  . ARG B 1 274 ? 23.249  -6.088  -60.288 1.00 55.04 ? 274  ARG B CD  1 
ATOM   6228 N NE  . ARG B 1 274 ? 24.274  -6.277  -61.307 1.00 56.09 ? 274  ARG B NE  1 
ATOM   6229 C CZ  . ARG B 1 274 ? 25.431  -5.626  -61.353 1.00 58.07 ? 274  ARG B CZ  1 
ATOM   6230 N NH1 . ARG B 1 274 ? 25.740  -4.724  -60.430 1.00 59.11 ? 274  ARG B NH1 1 
ATOM   6231 N NH2 . ARG B 1 274 ? 26.300  -5.896  -62.327 1.00 59.08 ? 274  ARG B NH2 1 
ATOM   6232 N N   . THR B 1 275 ? 23.170  -11.925 -59.385 1.00 55.97 ? 275  THR B N   1 
ATOM   6233 C CA  . THR B 1 275 ? 22.770  -13.195 -59.995 1.00 56.68 ? 275  THR B CA  1 
ATOM   6234 C C   . THR B 1 275 ? 21.852  -14.034 -59.113 1.00 56.97 ? 275  THR B C   1 
ATOM   6235 O O   . THR B 1 275 ? 21.229  -14.979 -59.591 1.00 57.89 ? 275  THR B O   1 
ATOM   6236 C CB  . THR B 1 275 ? 23.990  -14.096 -60.330 1.00 58.04 ? 275  THR B CB  1 
ATOM   6237 O OG1 . THR B 1 275 ? 24.629  -14.512 -59.117 1.00 57.21 ? 275  THR B OG1 1 
ATOM   6238 C CG2 . THR B 1 275 ? 24.999  -13.369 -61.225 1.00 57.77 ? 275  THR B CG2 1 
ATOM   6239 N N   . ARG B 1 276 ? 21.786  -13.720 -57.826 1.00 56.86 ? 276  ARG B N   1 
ATOM   6240 C CA  . ARG B 1 276 ? 21.130  -14.595 -56.869 1.00 57.20 ? 276  ARG B CA  1 
ATOM   6241 C C   . ARG B 1 276 ? 19.619  -14.348 -56.826 1.00 56.36 ? 276  ARG B C   1 
ATOM   6242 O O   . ARG B 1 276 ? 19.180  -13.210 -56.829 1.00 54.77 ? 276  ARG B O   1 
ATOM   6243 C CB  . ARG B 1 276 ? 21.739  -14.394 -55.475 1.00 57.66 ? 276  ARG B CB  1 
ATOM   6244 C CG  . ARG B 1 276 ? 23.212  -14.800 -55.372 1.00 59.34 ? 276  ARG B CG  1 
ATOM   6245 C CD  . ARG B 1 276 ? 23.376  -16.303 -55.269 1.00 62.94 ? 276  ARG B CD  1 
ATOM   6246 N NE  . ARG B 1 276 ? 24.768  -16.676 -55.003 1.00 65.06 ? 276  ARG B NE  1 
ATOM   6247 C CZ  . ARG B 1 276 ? 25.677  -16.945 -55.940 1.00 66.10 ? 276  ARG B CZ  1 
ATOM   6248 N NH1 . ARG B 1 276 ? 25.371  -16.874 -57.233 1.00 67.45 ? 276  ARG B NH1 1 
ATOM   6249 N NH2 . ARG B 1 276 ? 26.914  -17.267 -55.582 1.00 66.18 ? 276  ARG B NH2 1 
ATOM   6250 N N   . PRO B 1 277 ? 18.814  -15.426 -56.780 1.00 56.87 ? 277  PRO B N   1 
ATOM   6251 C CA  . PRO B 1 277 ? 17.383  -15.227 -56.564 1.00 55.98 ? 277  PRO B CA  1 
ATOM   6252 C C   . PRO B 1 277 ? 17.105  -14.412 -55.297 1.00 54.96 ? 277  PRO B C   1 
ATOM   6253 O O   . PRO B 1 277 ? 17.842  -14.498 -54.311 1.00 54.93 ? 277  PRO B O   1 
ATOM   6254 C CB  . PRO B 1 277 ? 16.833  -16.656 -56.450 1.00 57.13 ? 277  PRO B CB  1 
ATOM   6255 C CG  . PRO B 1 277 ? 17.828  -17.507 -57.160 1.00 58.32 ? 277  PRO B CG  1 
ATOM   6256 C CD  . PRO B 1 277 ? 19.160  -16.851 -56.925 1.00 57.87 ? 277  PRO B CD  1 
ATOM   6257 N N   . ALA B 1 278 ? 16.056  -13.603 -55.354 1.00 54.29 ? 278  ALA B N   1 
ATOM   6258 C CA  . ALA B 1 278 ? 15.717  -12.669 -54.281 1.00 53.33 ? 278  ALA B CA  1 
ATOM   6259 C C   . ALA B 1 278 ? 15.609  -13.360 -52.922 1.00 53.89 ? 278  ALA B C   1 
ATOM   6260 O O   . ALA B 1 278 ? 16.088  -12.831 -51.926 1.00 53.61 ? 278  ALA B O   1 
ATOM   6261 C CB  . ALA B 1 278 ? 14.409  -11.933 -54.618 1.00 52.23 ? 278  ALA B CB  1 
ATOM   6262 N N   . GLN B 1 279 ? 14.993  -14.540 -52.876 1.00 55.02 ? 279  GLN B N   1 
ATOM   6263 C CA  . GLN B 1 279 ? 14.798  -15.243 -51.600 1.00 55.81 ? 279  GLN B CA  1 
ATOM   6264 C C   . GLN B 1 279 ? 16.118  -15.686 -50.959 1.00 56.88 ? 279  GLN B C   1 
ATOM   6265 O O   . GLN B 1 279 ? 16.215  -15.728 -49.733 1.00 56.75 ? 279  GLN B O   1 
ATOM   6266 C CB  . GLN B 1 279 ? 13.856  -16.442 -51.752 1.00 56.10 ? 279  GLN B CB  1 
ATOM   6267 C CG  . GLN B 1 279 ? 13.378  -17.036 -50.418 1.00 56.12 ? 279  GLN B CG  1 
ATOM   6268 C CD  . GLN B 1 279 ? 12.713  -16.010 -49.498 1.00 54.95 ? 279  GLN B CD  1 
ATOM   6269 O OE1 . GLN B 1 279 ? 11.924  -15.177 -49.947 1.00 53.71 ? 279  GLN B OE1 1 
ATOM   6270 N NE2 . GLN B 1 279 ? 13.034  -16.070 -48.208 1.00 52.38 ? 279  GLN B NE2 1 
ATOM   6271 N N   . ASP B 1 280 ? 17.113  -16.022 -51.787 1.00 57.98 ? 280  ASP B N   1 
ATOM   6272 C CA  . ASP B 1 280 ? 18.439  -16.413 -51.291 1.00 59.19 ? 280  ASP B CA  1 
ATOM   6273 C C   . ASP B 1 280 ? 19.074  -15.312 -50.430 1.00 58.50 ? 280  ASP B C   1 
ATOM   6274 O O   . ASP B 1 280 ? 19.740  -15.606 -49.443 1.00 59.52 ? 280  ASP B O   1 
ATOM   6275 C CB  . ASP B 1 280 ? 19.378  -16.782 -52.442 1.00 59.87 ? 280  ASP B CB  1 
ATOM   6276 C CG  . ASP B 1 280 ? 18.990  -18.091 -53.124 1.00 63.28 ? 280  ASP B CG  1 
ATOM   6277 O OD1 . ASP B 1 280 ? 17.920  -18.651 -52.785 1.00 66.93 ? 280  ASP B OD1 1 
ATOM   6278 O OD2 . ASP B 1 280 ? 19.746  -18.561 -54.008 1.00 63.61 ? 280  ASP B OD2 1 
ATOM   6279 N N   . LEU B 1 281 ? 18.859  -14.057 -50.813 1.00 57.35 ? 281  LEU B N   1 
ATOM   6280 C CA  . LEU B 1 281 ? 19.343  -12.898 -50.061 1.00 56.49 ? 281  LEU B CA  1 
ATOM   6281 C C   . LEU B 1 281 ? 18.565  -12.722 -48.756 1.00 56.13 ? 281  LEU B C   1 
ATOM   6282 O O   . LEU B 1 281 ? 19.152  -12.547 -47.686 1.00 56.31 ? 281  LEU B O   1 
ATOM   6283 C CB  . LEU B 1 281 ? 19.226  -11.637 -50.920 1.00 55.61 ? 281  LEU B CB  1 
ATOM   6284 C CG  . LEU B 1 281 ? 20.422  -11.277 -51.811 1.00 56.13 ? 281  LEU B CG  1 
ATOM   6285 C CD1 . LEU B 1 281 ? 21.206  -12.498 -52.283 1.00 56.22 ? 281  LEU B CD1 1 
ATOM   6286 C CD2 . LEU B 1 281 ? 19.985  -10.389 -52.975 1.00 54.91 ? 281  LEU B CD2 1 
ATOM   6287 N N   . VAL B 1 282 ? 17.242  -12.790 -48.856 1.00 55.60 ? 282  VAL B N   1 
ATOM   6288 C CA  . VAL B 1 282 ? 16.370  -12.716 -47.695 1.00 55.17 ? 282  VAL B CA  1 
ATOM   6289 C C   . VAL B 1 282 ? 16.613  -13.855 -46.685 1.00 56.29 ? 282  VAL B C   1 
ATOM   6290 O O   . VAL B 1 282 ? 16.514  -13.645 -45.477 1.00 55.75 ? 282  VAL B O   1 
ATOM   6291 C CB  . VAL B 1 282 ? 14.897  -12.702 -48.124 1.00 54.73 ? 282  VAL B CB  1 
ATOM   6292 C CG1 . VAL B 1 282 ? 13.988  -12.754 -46.904 1.00 54.48 ? 282  VAL B CG1 1 
ATOM   6293 C CG2 . VAL B 1 282 ? 14.611  -11.459 -48.966 1.00 53.11 ? 282  VAL B CG2 1 
ATOM   6294 N N   . ASP B 1 283 ? 16.941  -15.050 -47.182 1.00 57.41 ? 283  ASP B N   1 
ATOM   6295 C CA  . ASP B 1 283 ? 17.256  -16.183 -46.316 1.00 58.83 ? 283  ASP B CA  1 
ATOM   6296 C C   . ASP B 1 283 ? 18.408  -15.912 -45.336 1.00 59.08 ? 283  ASP B C   1 
ATOM   6297 O O   . ASP B 1 283 ? 18.493  -16.573 -44.297 1.00 59.51 ? 283  ASP B O   1 
ATOM   6298 C CB  . ASP B 1 283 ? 17.596  -17.429 -47.150 1.00 60.20 ? 283  ASP B CB  1 
ATOM   6299 C CG  . ASP B 1 283 ? 16.359  -18.179 -47.637 1.00 61.36 ? 283  ASP B CG  1 
ATOM   6300 O OD1 . ASP B 1 283 ? 15.238  -17.906 -47.145 1.00 61.97 ? 283  ASP B OD1 1 
ATOM   6301 O OD2 . ASP B 1 283 ? 16.518  -19.065 -48.504 1.00 63.03 ? 283  ASP B OD2 1 
ATOM   6302 N N   . HIS B 1 284 ? 19.277  -14.953 -45.667 1.00 58.86 ? 284  HIS B N   1 
ATOM   6303 C CA  . HIS B 1 284 ? 20.474  -14.656 -44.878 1.00 59.22 ? 284  HIS B CA  1 
ATOM   6304 C C   . HIS B 1 284 ? 20.532  -13.243 -44.309 1.00 58.77 ? 284  HIS B C   1 
ATOM   6305 O O   . HIS B 1 284 ? 21.514  -12.876 -43.654 1.00 58.58 ? 284  HIS B O   1 
ATOM   6306 C CB  . HIS B 1 284 ? 21.713  -14.886 -45.738 1.00 60.07 ? 284  HIS B CB  1 
ATOM   6307 C CG  . HIS B 1 284 ? 22.044  -16.330 -45.938 1.00 61.67 ? 284  HIS B CG  1 
ATOM   6308 N ND1 . HIS B 1 284 ? 22.455  -17.146 -44.906 1.00 62.69 ? 284  HIS B ND1 1 
ATOM   6309 C CD2 . HIS B 1 284 ? 22.038  -17.100 -47.049 1.00 63.08 ? 284  HIS B CD2 1 
ATOM   6310 C CE1 . HIS B 1 284 ? 22.680  -18.360 -45.373 1.00 64.65 ? 284  HIS B CE1 1 
ATOM   6311 N NE2 . HIS B 1 284 ? 22.438  -18.359 -46.671 1.00 64.86 ? 284  HIS B NE2 1 
ATOM   6312 N N   . GLU B 1 285 ? 19.499  -12.439 -44.539 1.00 58.39 ? 285  GLU B N   1 
ATOM   6313 C CA  . GLU B 1 285 ? 19.573  -11.042 -44.126 1.00 58.02 ? 285  GLU B CA  1 
ATOM   6314 C C   . GLU B 1 285 ? 19.610  -10.876 -42.603 1.00 57.74 ? 285  GLU B C   1 
ATOM   6315 O O   . GLU B 1 285 ? 20.190  -9.913  -42.115 1.00 56.82 ? 285  GLU B O   1 
ATOM   6316 C CB  . GLU B 1 285 ? 18.494  -10.174 -44.807 1.00 56.96 ? 285  GLU B CB  1 
ATOM   6317 C CG  . GLU B 1 285 ? 17.104  -10.164 -44.207 1.00 57.59 ? 285  GLU B CG  1 
ATOM   6318 C CD  . GLU B 1 285 ? 16.235  -9.057  -44.826 1.00 56.76 ? 285  GLU B CD  1 
ATOM   6319 O OE1 . GLU B 1 285 ? 15.741  -9.250  -45.940 1.00 58.13 ? 285  GLU B OE1 1 
ATOM   6320 O OE2 . GLU B 1 285 ? 16.070  -7.980  -44.210 1.00 60.85 ? 285  GLU B OE2 1 
ATOM   6321 N N   . TRP B 1 286 ? 19.039  -11.824 -41.860 1.00 58.78 ? 286  TRP B N   1 
ATOM   6322 C CA  . TRP B 1 286 ? 19.087  -11.785 -40.388 1.00 59.36 ? 286  TRP B CA  1 
ATOM   6323 C C   . TRP B 1 286 ? 20.344  -12.420 -39.791 1.00 60.09 ? 286  TRP B C   1 
ATOM   6324 O O   . TRP B 1 286 ? 20.514  -12.424 -38.586 1.00 61.10 ? 286  TRP B O   1 
ATOM   6325 C CB  . TRP B 1 286 ? 17.823  -12.406 -39.781 1.00 60.42 ? 286  TRP B CB  1 
ATOM   6326 C CG  . TRP B 1 286 ? 16.635  -11.621 -40.197 1.00 60.40 ? 286  TRP B CG  1 
ATOM   6327 C CD1 . TRP B 1 286 ? 15.676  -11.989 -41.091 1.00 61.09 ? 286  TRP B CD1 1 
ATOM   6328 C CD2 . TRP B 1 286 ? 16.331  -10.285 -39.807 1.00 60.49 ? 286  TRP B CD2 1 
ATOM   6329 N NE1 . TRP B 1 286 ? 14.776  -10.974 -41.265 1.00 60.35 ? 286  TRP B NE1 1 
ATOM   6330 C CE2 . TRP B 1 286 ? 15.154  -9.912  -40.488 1.00 60.36 ? 286  TRP B CE2 1 
ATOM   6331 C CE3 . TRP B 1 286 ? 16.932  -9.368  -38.931 1.00 60.19 ? 286  TRP B CE3 1 
ATOM   6332 C CZ2 . TRP B 1 286 ? 14.560  -8.661  -40.321 1.00 59.55 ? 286  TRP B CZ2 1 
ATOM   6333 C CZ3 . TRP B 1 286 ? 16.352  -8.121  -38.771 1.00 59.33 ? 286  TRP B CZ3 1 
ATOM   6334 C CH2 . TRP B 1 286 ? 15.176  -7.777  -39.461 1.00 58.96 ? 286  TRP B CH2 1 
ATOM   6335 N N   . HIS B 1 287 ? 21.244  -12.906 -40.630 1.00 60.16 ? 287  HIS B N   1 
ATOM   6336 C CA  . HIS B 1 287 ? 22.469  -13.528 -40.149 1.00 60.94 ? 287  HIS B CA  1 
ATOM   6337 C C   . HIS B 1 287 ? 23.666  -12.574 -40.096 1.00 60.38 ? 287  HIS B C   1 
ATOM   6338 O O   . HIS B 1 287 ? 24.774  -13.020 -39.800 1.00 61.01 ? 287  HIS B O   1 
ATOM   6339 C CB  . HIS B 1 287 ? 22.809  -14.739 -41.021 1.00 62.53 ? 287  HIS B CB  1 
ATOM   6340 C CG  . HIS B 1 287 ? 21.792  -15.835 -40.945 1.00 64.64 ? 287  HIS B CG  1 
ATOM   6341 N ND1 . HIS B 1 287 ? 21.696  -16.833 -41.895 1.00 67.73 ? 287  HIS B ND1 1 
ATOM   6342 C CD2 . HIS B 1 287 ? 20.818  -16.085 -40.037 1.00 66.28 ? 287  HIS B CD2 1 
ATOM   6343 C CE1 . HIS B 1 287 ? 20.714  -17.655 -41.568 1.00 68.41 ? 287  HIS B CE1 1 
ATOM   6344 N NE2 . HIS B 1 287 ? 20.165  -17.224 -40.445 1.00 67.86 ? 287  HIS B NE2 1 
ATOM   6345 N N   . VAL B 1 288 ? 23.452  -11.277 -40.367 1.00 58.54 ? 288  VAL B N   1 
ATOM   6346 C CA  . VAL B 1 288 ? 24.562  -10.321 -40.427 1.00 58.15 ? 288  VAL B CA  1 
ATOM   6347 C C   . VAL B 1 288 ? 24.623  -9.296  -39.284 1.00 57.33 ? 288  VAL B C   1 
ATOM   6348 O O   . VAL B 1 288 ? 25.572  -8.514  -39.225 1.00 57.48 ? 288  VAL B O   1 
ATOM   6349 C CB  . VAL B 1 288 ? 24.604  -9.554  -41.776 1.00 57.67 ? 288  VAL B CB  1 
ATOM   6350 C CG1 . VAL B 1 288 ? 24.625  -10.527 -42.958 1.00 57.22 ? 288  VAL B CG1 1 
ATOM   6351 C CG2 . VAL B 1 288 ? 23.439  -8.540  -41.880 1.00 55.66 ? 288  VAL B CG2 1 
ATOM   6352 N N   . LEU B 1 289 ? 23.632  -9.284  -38.394 1.00 56.53 ? 289  LEU B N   1 
ATOM   6353 C CA  . LEU B 1 289 ? 23.673  -8.409  -37.228 1.00 56.05 ? 289  LEU B CA  1 
ATOM   6354 C C   . LEU B 1 289 ? 24.811  -8.821  -36.292 1.00 57.76 ? 289  LEU B C   1 
ATOM   6355 O O   . LEU B 1 289 ? 25.054  -10.004 -36.092 1.00 58.68 ? 289  LEU B O   1 
ATOM   6356 C CB  . LEU B 1 289 ? 22.339  -8.407  -36.468 1.00 55.02 ? 289  LEU B CB  1 
ATOM   6357 C CG  . LEU B 1 289 ? 21.179  -7.670  -37.142 1.00 52.90 ? 289  LEU B CG  1 
ATOM   6358 C CD1 . LEU B 1 289 ? 19.861  -8.007  -36.449 1.00 50.89 ? 289  LEU B CD1 1 
ATOM   6359 C CD2 . LEU B 1 289 ? 21.434  -6.145  -37.181 1.00 49.03 ? 289  LEU B CD2 1 
ATOM   6360 N N   . PRO B 1 290 ? 25.517  -7.837  -35.715 1.00 58.50 ? 290  PRO B N   1 
ATOM   6361 C CA  . PRO B 1 290 ? 26.664  -8.132  -34.878 1.00 60.07 ? 290  PRO B CA  1 
ATOM   6362 C C   . PRO B 1 290 ? 26.329  -8.746  -33.516 1.00 60.72 ? 290  PRO B C   1 
ATOM   6363 O O   . PRO B 1 290 ? 27.201  -9.353  -32.902 1.00 61.86 ? 290  PRO B O   1 
ATOM   6364 C CB  . PRO B 1 290 ? 27.334  -6.764  -34.717 1.00 59.63 ? 290  PRO B CB  1 
ATOM   6365 C CG  . PRO B 1 290 ? 26.256  -5.789  -34.883 1.00 58.26 ? 290  PRO B CG  1 
ATOM   6366 C CD  . PRO B 1 290 ? 25.278  -6.389  -35.837 1.00 57.61 ? 290  PRO B CD  1 
ATOM   6367 N N   . GLN B 1 291 ? 25.083  -8.595  -33.068 1.00 60.68 ? 291  GLN B N   1 
ATOM   6368 C CA  . GLN B 1 291 ? 24.640  -9.031  -31.732 1.00 61.10 ? 291  GLN B CA  1 
ATOM   6369 C C   . GLN B 1 291 ? 23.294  -9.735  -31.779 1.00 60.82 ? 291  GLN B C   1 
ATOM   6370 O O   . GLN B 1 291 ? 22.520  -9.536  -32.707 1.00 59.48 ? 291  GLN B O   1 
ATOM   6371 C CB  . GLN B 1 291 ? 24.472  -7.823  -30.810 1.00 60.52 ? 291  GLN B CB  1 
ATOM   6372 C CG  . GLN B 1 291 ? 25.608  -7.587  -29.858 1.00 63.88 ? 291  GLN B CG  1 
ATOM   6373 C CD  . GLN B 1 291 ? 26.725  -6.779  -30.451 1.00 66.43 ? 291  GLN B CD  1 
ATOM   6374 O OE1 . GLN B 1 291 ? 27.903  -7.037  -30.174 1.00 69.02 ? 291  GLN B OE1 1 
ATOM   6375 N NE2 . GLN B 1 291 ? 26.374  -5.787  -31.264 1.00 65.54 ? 291  GLN B NE2 1 
ATOM   6376 N N   . GLU B 1 292 ? 23.029  -10.543 -30.753 1.00 61.96 ? 292  GLU B N   1 
ATOM   6377 C CA  . GLU B 1 292 ? 21.686  -11.045 -30.460 1.00 62.03 ? 292  GLU B CA  1 
ATOM   6378 C C   . GLU B 1 292 ? 20.927  -9.842  -29.936 1.00 59.87 ? 292  GLU B C   1 
ATOM   6379 O O   . GLU B 1 292 ? 21.329  -9.245  -28.944 1.00 59.73 ? 292  GLU B O   1 
ATOM   6380 C CB  . GLU B 1 292 ? 21.747  -12.145 -29.388 1.00 63.45 ? 292  GLU B CB  1 
ATOM   6381 C CG  . GLU B 1 292 ? 20.390  -12.779 -29.006 1.00 64.55 ? 292  GLU B CG  1 
ATOM   6382 C CD  . GLU B 1 292 ? 20.503  -13.762 -27.823 1.00 67.26 ? 292  GLU B CD  1 
ATOM   6383 O OE1 . GLU B 1 292 ? 21.291  -13.504 -26.871 1.00 70.58 ? 292  GLU B OE1 1 
ATOM   6384 O OE2 . GLU B 1 292 ? 19.799  -14.800 -27.846 1.00 72.19 ? 292  GLU B OE2 1 
ATOM   6385 N N   . SER B 1 293 ? 19.853  -9.460  -30.613 1.00 58.18 ? 293  SER B N   1 
ATOM   6386 C CA  . SER B 1 293 ? 19.250  -8.161  -30.367 1.00 56.17 ? 293  SER B CA  1 
ATOM   6387 C C   . SER B 1 293 ? 17.801  -8.071  -30.804 1.00 55.12 ? 293  SER B C   1 
ATOM   6388 O O   . SER B 1 293 ? 17.307  -8.888  -31.585 1.00 55.41 ? 293  SER B O   1 
ATOM   6389 C CB  . SER B 1 293 ? 20.050  -7.087  -31.098 1.00 55.62 ? 293  SER B CB  1 
ATOM   6390 O OG  . SER B 1 293 ? 20.090  -7.338  -32.493 1.00 55.20 ? 293  SER B OG  1 
ATOM   6391 N N   . ILE B 1 294 ? 17.115  -7.067  -30.278 1.00 53.53 ? 294  ILE B N   1 
ATOM   6392 C CA  . ILE B 1 294 ? 15.804  -6.698  -30.788 1.00 52.20 ? 294  ILE B CA  1 
ATOM   6393 C C   . ILE B 1 294 ? 15.880  -5.225  -31.188 1.00 50.34 ? 294  ILE B C   1 
ATOM   6394 O O   . ILE B 1 294 ? 16.802  -4.520  -30.780 1.00 50.43 ? 294  ILE B O   1 
ATOM   6395 C CB  . ILE B 1 294 ? 14.661  -7.011  -29.783 1.00 52.30 ? 294  ILE B CB  1 
ATOM   6396 C CG1 . ILE B 1 294 ? 14.933  -6.389  -28.410 1.00 52.07 ? 294  ILE B CG1 1 
ATOM   6397 C CG2 . ILE B 1 294 ? 14.477  -8.511  -29.647 1.00 53.28 ? 294  ILE B CG2 1 
ATOM   6398 C CD1 . ILE B 1 294 ? 13.673  -6.206  -27.559 1.00 52.10 ? 294  ILE B CD1 1 
ATOM   6399 N N   . PHE B 1 295 ? 14.939  -4.794  -32.023 1.00 49.29 ? 295  PHE B N   1 
ATOM   6400 C CA  . PHE B 1 295 ? 14.876  -3.422  -32.551 1.00 48.10 ? 295  PHE B CA  1 
ATOM   6401 C C   . PHE B 1 295 ? 16.149  -3.075  -33.315 1.00 47.81 ? 295  PHE B C   1 
ATOM   6402 O O   . PHE B 1 295 ? 16.681  -1.971  -33.206 1.00 47.19 ? 295  PHE B O   1 
ATOM   6403 C CB  . PHE B 1 295 ? 14.601  -2.400  -31.424 1.00 47.55 ? 295  PHE B CB  1 
ATOM   6404 C CG  . PHE B 1 295 ? 13.643  -1.283  -31.818 1.00 46.95 ? 295  PHE B CG  1 
ATOM   6405 C CD1 . PHE B 1 295 ? 13.807  -0.578  -33.009 1.00 46.32 ? 295  PHE B CD1 1 
ATOM   6406 C CD2 . PHE B 1 295 ? 12.581  -0.938  -30.989 1.00 46.81 ? 295  PHE B CD2 1 
ATOM   6407 C CE1 . PHE B 1 295 ? 12.928  0.440   -33.370 1.00 44.92 ? 295  PHE B CE1 1 
ATOM   6408 C CE2 . PHE B 1 295 ? 11.707  0.087   -31.333 1.00 46.13 ? 295  PHE B CE2 1 
ATOM   6409 C CZ  . PHE B 1 295 ? 11.888  0.776   -32.536 1.00 45.81 ? 295  PHE B CZ  1 
ATOM   6410 N N   . ARG B 1 296 ? 16.639  -4.043  -34.078 1.00 48.38 ? 296  ARG B N   1 
ATOM   6411 C CA  . ARG B 1 296 ? 17.811  -3.862  -34.932 1.00 48.46 ? 296  ARG B CA  1 
ATOM   6412 C C   . ARG B 1 296 ? 17.548  -4.544  -36.247 1.00 48.51 ? 296  ARG B C   1 
ATOM   6413 O O   . ARG B 1 296 ? 16.960  -5.628  -36.285 1.00 49.22 ? 296  ARG B O   1 
ATOM   6414 C CB  . ARG B 1 296 ? 19.064  -4.442  -34.293 1.00 49.07 ? 296  ARG B CB  1 
ATOM   6415 C CG  . ARG B 1 296 ? 19.526  -3.690  -33.050 1.00 49.09 ? 296  ARG B CG  1 
ATOM   6416 C CD  . ARG B 1 296 ? 19.987  -2.284  -33.366 1.00 48.29 ? 296  ARG B CD  1 
ATOM   6417 N NE  . ARG B 1 296 ? 20.561  -1.677  -32.179 1.00 49.08 ? 296  ARG B NE  1 
ATOM   6418 C CZ  . ARG B 1 296 ? 19.880  -1.019  -31.243 1.00 48.75 ? 296  ARG B CZ  1 
ATOM   6419 N NH1 . ARG B 1 296 ? 18.582  -0.846  -31.344 1.00 48.77 ? 296  ARG B NH1 1 
ATOM   6420 N NH2 . ARG B 1 296 ? 20.513  -0.513  -30.189 1.00 49.29 ? 296  ARG B NH2 1 
ATOM   6421 N N   . PHE B 1 297 ? 17.975  -3.889  -37.319 1.00 47.70 ? 297  PHE B N   1 
ATOM   6422 C CA  . PHE B 1 297 ? 17.624  -4.290  -38.681 1.00 47.31 ? 297  PHE B CA  1 
ATOM   6423 C C   . PHE B 1 297 ? 18.895  -4.226  -39.510 1.00 47.68 ? 297  PHE B C   1 
ATOM   6424 O O   . PHE B 1 297 ? 19.697  -3.287  -39.353 1.00 47.41 ? 297  PHE B O   1 
ATOM   6425 C CB  . PHE B 1 297 ? 16.548  -3.352  -39.227 1.00 46.21 ? 297  PHE B CB  1 
ATOM   6426 C CG  . PHE B 1 297 ? 15.481  -3.017  -38.216 1.00 45.53 ? 297  PHE B CG  1 
ATOM   6427 C CD1 . PHE B 1 297 ? 14.561  -3.979  -37.818 1.00 46.39 ? 297  PHE B CD1 1 
ATOM   6428 C CD2 . PHE B 1 297 ? 15.412  -1.758  -37.644 1.00 44.58 ? 297  PHE B CD2 1 
ATOM   6429 C CE1 . PHE B 1 297 ? 13.584  -3.678  -36.879 1.00 45.52 ? 297  PHE B CE1 1 
ATOM   6430 C CE2 . PHE B 1 297 ? 14.443  -1.453  -36.702 1.00 43.36 ? 297  PHE B CE2 1 
ATOM   6431 C CZ  . PHE B 1 297 ? 13.526  -2.407  -36.327 1.00 44.93 ? 297  PHE B CZ  1 
ATOM   6432 N N   . SER B 1 298 ? 19.086  -5.237  -40.355 1.00 47.68 ? 298  SER B N   1 
ATOM   6433 C CA  . SER B 1 298 ? 20.375  -5.488  -40.987 1.00 48.63 ? 298  SER B CA  1 
ATOM   6434 C C   . SER B 1 298 ? 20.749  -4.463  -42.041 1.00 47.99 ? 298  SER B C   1 
ATOM   6435 O O   . SER B 1 298 ? 21.896  -4.034  -42.110 1.00 48.92 ? 298  SER B O   1 
ATOM   6436 C CB  . SER B 1 298 ? 20.384  -6.862  -41.642 1.00 49.43 ? 298  SER B CB  1 
ATOM   6437 O OG  . SER B 1 298 ? 20.081  -7.878  -40.716 1.00 50.99 ? 298  SER B OG  1 
ATOM   6438 N N   . PHE B 1 299 ? 19.792  -4.094  -42.881 1.00 47.28 ? 299  PHE B N   1 
ATOM   6439 C CA  . PHE B 1 299 ? 20.069  -3.174  -43.986 1.00 46.63 ? 299  PHE B CA  1 
ATOM   6440 C C   . PHE B 1 299 ? 19.181  -1.945  -43.875 1.00 45.47 ? 299  PHE B C   1 
ATOM   6441 O O   . PHE B 1 299 ? 18.003  -2.008  -44.162 1.00 44.82 ? 299  PHE B O   1 
ATOM   6442 C CB  . PHE B 1 299 ? 19.925  -3.911  -45.323 1.00 46.70 ? 299  PHE B CB  1 
ATOM   6443 C CG  . PHE B 1 299 ? 20.900  -5.041  -45.456 1.00 47.87 ? 299  PHE B CG  1 
ATOM   6444 C CD1 . PHE B 1 299 ? 22.199  -4.797  -45.874 1.00 47.37 ? 299  PHE B CD1 1 
ATOM   6445 C CD2 . PHE B 1 299 ? 20.549  -6.332  -45.062 1.00 48.27 ? 299  PHE B CD2 1 
ATOM   6446 C CE1 . PHE B 1 299 ? 23.129  -5.827  -45.939 1.00 49.69 ? 299  PHE B CE1 1 
ATOM   6447 C CE2 . PHE B 1 299 ? 21.462  -7.360  -45.120 1.00 49.09 ? 299  PHE B CE2 1 
ATOM   6448 C CZ  . PHE B 1 299 ? 22.764  -7.113  -45.563 1.00 49.33 ? 299  PHE B CZ  1 
ATOM   6449 N N   . VAL B 1 300 ? 19.796  -0.840  -43.451 1.00 45.06 ? 300  VAL B N   1 
ATOM   6450 C CA  . VAL B 1 300 ? 19.138  0.423   -43.165 1.00 44.26 ? 300  VAL B CA  1 
ATOM   6451 C C   . VAL B 1 300 ? 19.956  1.553   -43.815 1.00 44.43 ? 300  VAL B C   1 
ATOM   6452 O O   . VAL B 1 300 ? 21.053  1.311   -44.340 1.00 44.69 ? 300  VAL B O   1 
ATOM   6453 C CB  . VAL B 1 300 ? 19.054  0.659   -41.618 1.00 44.61 ? 300  VAL B CB  1 
ATOM   6454 C CG1 . VAL B 1 300 ? 18.345  -0.484  -40.911 1.00 43.55 ? 300  VAL B CG1 1 
ATOM   6455 C CG2 . VAL B 1 300 ? 20.445  0.864   -41.024 1.00 44.15 ? 300  VAL B CG2 1 
ATOM   6456 N N   . PRO B 1 301 ? 19.423  2.787   -43.822 1.00 44.11 ? 301  PRO B N   1 
ATOM   6457 C CA  . PRO B 1 301 ? 20.207  3.907   -44.344 1.00 44.45 ? 301  PRO B CA  1 
ATOM   6458 C C   . PRO B 1 301 ? 21.641  3.951   -43.810 1.00 45.15 ? 301  PRO B C   1 
ATOM   6459 O O   . PRO B 1 301 ? 21.885  3.606   -42.653 1.00 44.72 ? 301  PRO B O   1 
ATOM   6460 C CB  . PRO B 1 301 ? 19.419  5.116   -43.870 1.00 44.25 ? 301  PRO B CB  1 
ATOM   6461 C CG  . PRO B 1 301 ? 18.009  4.637   -43.914 1.00 43.71 ? 301  PRO B CG  1 
ATOM   6462 C CD  . PRO B 1 301 ? 18.069  3.219   -43.432 1.00 43.67 ? 301  PRO B CD  1 
ATOM   6463 N N   . VAL B 1 302 ? 22.571  4.355   -44.672 1.00 45.57 ? 302  VAL B N   1 
ATOM   6464 C CA  . VAL B 1 302 ? 23.986  4.400   -44.338 1.00 45.65 ? 302  VAL B CA  1 
ATOM   6465 C C   . VAL B 1 302 ? 24.463  5.834   -44.379 1.00 46.17 ? 302  VAL B C   1 
ATOM   6466 O O   . VAL B 1 302 ? 24.050  6.607   -45.248 1.00 46.34 ? 302  VAL B O   1 
ATOM   6467 C CB  . VAL B 1 302 ? 24.835  3.515   -45.306 1.00 46.36 ? 302  VAL B CB  1 
ATOM   6468 C CG1 . VAL B 1 302 ? 24.643  3.934   -46.773 1.00 45.20 ? 302  VAL B CG1 1 
ATOM   6469 C CG2 . VAL B 1 302 ? 26.303  3.549   -44.908 1.00 46.31 ? 302  VAL B CG2 1 
ATOM   6470 N N   . VAL B 1 303 ? 25.316  6.200   -43.427 1.00 46.87 ? 303  VAL B N   1 
ATOM   6471 C CA  . VAL B 1 303 ? 25.951  7.505   -43.455 1.00 47.57 ? 303  VAL B CA  1 
ATOM   6472 C C   . VAL B 1 303 ? 27.034  7.463   -44.539 1.00 49.29 ? 303  VAL B C   1 
ATOM   6473 O O   . VAL B 1 303 ? 28.189  7.034   -44.304 1.00 49.79 ? 303  VAL B O   1 
ATOM   6474 C CB  . VAL B 1 303 ? 26.507  7.916   -42.062 1.00 48.00 ? 303  VAL B CB  1 
ATOM   6475 C CG1 . VAL B 1 303 ? 27.136  9.281   -42.122 1.00 47.07 ? 303  VAL B CG1 1 
ATOM   6476 C CG2 . VAL B 1 303 ? 25.383  7.886   -41.006 1.00 45.78 ? 303  VAL B CG2 1 
ATOM   6477 N N   . ASP B 1 304 ? 26.626  7.899   -45.735 1.00 49.72 ? 304  ASP B N   1 
ATOM   6478 C CA  . ASP B 1 304 ? 27.429  7.765   -46.964 1.00 50.82 ? 304  ASP B CA  1 
ATOM   6479 C C   . ASP B 1 304 ? 28.234  9.015   -47.333 1.00 52.20 ? 304  ASP B C   1 
ATOM   6480 O O   . ASP B 1 304 ? 29.107  8.968   -48.213 1.00 52.72 ? 304  ASP B O   1 
ATOM   6481 C CB  . ASP B 1 304 ? 26.516  7.399   -48.135 1.00 50.35 ? 304  ASP B CB  1 
ATOM   6482 C CG  . ASP B 1 304 ? 25.368  8.377   -48.320 1.00 49.61 ? 304  ASP B CG  1 
ATOM   6483 O OD1 . ASP B 1 304 ? 25.154  9.228   -47.439 1.00 50.31 ? 304  ASP B OD1 1 
ATOM   6484 O OD2 . ASP B 1 304 ? 24.661  8.296   -49.346 1.00 49.99 ? 304  ASP B OD2 1 
ATOM   6485 N N   . GLY B 1 305 ? 27.940  10.127  -46.661 1.00 52.62 ? 305  GLY B N   1 
ATOM   6486 C CA  . GLY B 1 305 ? 28.536  11.415  -46.996 1.00 53.47 ? 305  GLY B CA  1 
ATOM   6487 C C   . GLY B 1 305 ? 27.955  11.962  -48.288 1.00 54.09 ? 305  GLY B C   1 
ATOM   6488 O O   . GLY B 1 305 ? 28.541  12.840  -48.909 1.00 55.11 ? 305  GLY B O   1 
ATOM   6489 N N   . ASP B 1 306 ? 26.798  11.447  -48.697 1.00 53.61 ? 306  ASP B N   1 
ATOM   6490 C CA  . ASP B 1 306 ? 26.142  11.896  -49.924 1.00 53.94 ? 306  ASP B CA  1 
ATOM   6491 C C   . ASP B 1 306 ? 24.679  12.214  -49.600 1.00 52.76 ? 306  ASP B C   1 
ATOM   6492 O O   . ASP B 1 306 ? 24.350  13.379  -49.363 1.00 52.69 ? 306  ASP B O   1 
ATOM   6493 C CB  . ASP B 1 306 ? 26.311  10.841  -51.027 1.00 54.38 ? 306  ASP B CB  1 
ATOM   6494 C CG  . ASP B 1 306 ? 25.628  11.218  -52.324 1.00 56.09 ? 306  ASP B CG  1 
ATOM   6495 O OD1 . ASP B 1 306 ? 25.224  12.391  -52.488 1.00 58.45 ? 306  ASP B OD1 1 
ATOM   6496 O OD2 . ASP B 1 306 ? 25.495  10.325  -53.193 1.00 57.18 ? 306  ASP B OD2 1 
ATOM   6497 N N   . PHE B 1 307 ? 23.810  11.204  -49.553 1.00 51.59 ? 307  PHE B N   1 
ATOM   6498 C CA  . PHE B 1 307 ? 22.422  11.430  -49.129 1.00 50.58 ? 307  PHE B CA  1 
ATOM   6499 C C   . PHE B 1 307 ? 22.435  12.044  -47.729 1.00 50.66 ? 307  PHE B C   1 
ATOM   6500 O O   . PHE B 1 307 ? 21.791  13.069  -47.471 1.00 50.32 ? 307  PHE B O   1 
ATOM   6501 C CB  . PHE B 1 307 ? 21.610  10.126  -49.123 1.00 49.71 ? 307  PHE B CB  1 
ATOM   6502 C CG  . PHE B 1 307 ? 20.117  10.341  -49.012 1.00 48.91 ? 307  PHE B CG  1 
ATOM   6503 C CD1 . PHE B 1 307 ? 19.528  10.652  -47.789 1.00 49.03 ? 307  PHE B CD1 1 
ATOM   6504 C CD2 . PHE B 1 307 ? 19.304  10.241  -50.123 1.00 48.73 ? 307  PHE B CD2 1 
ATOM   6505 C CE1 . PHE B 1 307 ? 18.153  10.880  -47.684 1.00 47.12 ? 307  PHE B CE1 1 
ATOM   6506 C CE2 . PHE B 1 307 ? 17.934  10.454  -50.022 1.00 49.05 ? 307  PHE B CE2 1 
ATOM   6507 C CZ  . PHE B 1 307 ? 17.365  10.781  -48.785 1.00 48.08 ? 307  PHE B CZ  1 
ATOM   6508 N N   . LEU B 1 308 ? 23.176  11.389  -46.837 1.00 50.90 ? 308  LEU B N   1 
ATOM   6509 C CA  . LEU B 1 308 ? 23.468  11.906  -45.507 1.00 51.06 ? 308  LEU B CA  1 
ATOM   6510 C C   . LEU B 1 308 ? 24.904  12.418  -45.495 1.00 52.19 ? 308  LEU B C   1 
ATOM   6511 O O   . LEU B 1 308 ? 25.845  11.622  -45.479 1.00 52.17 ? 308  LEU B O   1 
ATOM   6512 C CB  . LEU B 1 308 ? 23.282  10.809  -44.453 1.00 50.39 ? 308  LEU B CB  1 
ATOM   6513 C CG  . LEU B 1 308 ? 21.852  10.261  -44.299 1.00 49.76 ? 308  LEU B CG  1 
ATOM   6514 C CD1 . LEU B 1 308 ? 21.808  9.155   -43.250 1.00 48.96 ? 308  LEU B CD1 1 
ATOM   6515 C CD2 . LEU B 1 308 ? 20.847  11.381  -43.945 1.00 47.56 ? 308  LEU B CD2 1 
ATOM   6516 N N   . SER B 1 309 ? 25.054  13.742  -45.514 1.00 52.81 ? 309  SER B N   1 
ATOM   6517 C CA  . SER B 1 309 ? 26.371  14.401  -45.545 1.00 54.61 ? 309  SER B CA  1 
ATOM   6518 C C   . SER B 1 309 ? 27.200  14.174  -44.276 1.00 55.05 ? 309  SER B C   1 
ATOM   6519 O O   . SER B 1 309 ? 28.425  14.292  -44.291 1.00 55.61 ? 309  SER B O   1 
ATOM   6520 C CB  . SER B 1 309 ? 26.194  15.907  -45.763 1.00 55.07 ? 309  SER B CB  1 
ATOM   6521 O OG  . SER B 1 309 ? 25.379  16.484  -44.738 1.00 56.17 ? 309  SER B OG  1 
ATOM   6522 N N   . ASP B 1 310 ? 26.511  13.869  -43.177 1.00 54.79 ? 310  ASP B N   1 
ATOM   6523 C CA  . ASP B 1 310 ? 27.139  13.541  -41.897 1.00 55.02 ? 310  ASP B CA  1 
ATOM   6524 C C   . ASP B 1 310 ? 26.149  12.638  -41.153 1.00 54.05 ? 310  ASP B C   1 
ATOM   6525 O O   . ASP B 1 310 ? 25.079  12.328  -41.673 1.00 53.22 ? 310  ASP B O   1 
ATOM   6526 C CB  . ASP B 1 310 ? 27.406  14.829  -41.108 1.00 55.56 ? 310  ASP B CB  1 
ATOM   6527 C CG  . ASP B 1 310 ? 28.660  14.756  -40.225 1.00 57.66 ? 310  ASP B CG  1 
ATOM   6528 O OD1 . ASP B 1 310 ? 29.040  13.653  -39.757 1.00 59.20 ? 310  ASP B OD1 1 
ATOM   6529 O OD2 . ASP B 1 310 ? 29.267  15.826  -40.002 1.00 58.56 ? 310  ASP B OD2 1 
ATOM   6530 N N   . THR B 1 311 ? 26.497  12.217  -39.944 1.00 54.23 ? 311  THR B N   1 
ATOM   6531 C CA  . THR B 1 311 ? 25.567  11.483  -39.100 1.00 53.39 ? 311  THR B CA  1 
ATOM   6532 C C   . THR B 1 311 ? 24.339  12.353  -38.814 1.00 53.23 ? 311  THR B C   1 
ATOM   6533 O O   . THR B 1 311 ? 24.441  13.577  -38.779 1.00 52.77 ? 311  THR B O   1 
ATOM   6534 C CB  . THR B 1 311 ? 26.206  11.100  -37.751 1.00 53.91 ? 311  THR B CB  1 
ATOM   6535 O OG1 . THR B 1 311 ? 26.471  12.287  -37.000 1.00 52.75 ? 311  THR B OG1 1 
ATOM   6536 C CG2 . THR B 1 311 ? 27.515  10.310  -37.959 1.00 53.81 ? 311  THR B CG2 1 
ATOM   6537 N N   . PRO B 1 312 ? 23.167  11.724  -38.651 1.00 53.24 ? 312  PRO B N   1 
ATOM   6538 C CA  . PRO B 1 312 ? 21.979  12.416  -38.172 1.00 53.53 ? 312  PRO B CA  1 
ATOM   6539 C C   . PRO B 1 312 ? 22.230  13.248  -36.932 1.00 54.49 ? 312  PRO B C   1 
ATOM   6540 O O   . PRO B 1 312 ? 21.753  14.374  -36.867 1.00 54.88 ? 312  PRO B O   1 
ATOM   6541 C CB  . PRO B 1 312 ? 21.006  11.273  -37.868 1.00 52.85 ? 312  PRO B CB  1 
ATOM   6542 C CG  . PRO B 1 312 ? 21.370  10.237  -38.828 1.00 52.65 ? 312  PRO B CG  1 
ATOM   6543 C CD  . PRO B 1 312 ? 22.873  10.315  -38.965 1.00 53.09 ? 312  PRO B CD  1 
ATOM   6544 N N   . GLU B 1 313 ? 22.987  12.717  -35.974 1.00 56.19 ? 313  GLU B N   1 
ATOM   6545 C CA  . GLU B 1 313 ? 23.350  13.488  -34.784 1.00 57.28 ? 313  GLU B CA  1 
ATOM   6546 C C   . GLU B 1 313 ? 23.986  14.819  -35.145 1.00 57.16 ? 313  GLU B C   1 
ATOM   6547 O O   . GLU B 1 313 ? 23.517  15.866  -34.709 1.00 57.36 ? 313  GLU B O   1 
ATOM   6548 C CB  . GLU B 1 313 ? 24.314  12.716  -33.884 1.00 58.20 ? 313  GLU B CB  1 
ATOM   6549 C CG  . GLU B 1 313 ? 24.581  13.428  -32.554 1.00 59.25 ? 313  GLU B CG  1 
ATOM   6550 C CD  . GLU B 1 313 ? 25.561  12.681  -31.661 1.00 61.79 ? 313  GLU B CD  1 
ATOM   6551 O OE1 . GLU B 1 313 ? 25.130  12.169  -30.593 1.00 67.06 ? 313  GLU B OE1 1 
ATOM   6552 O OE2 . GLU B 1 313 ? 26.764  12.616  -32.023 1.00 67.79 ? 313  GLU B OE2 1 
ATOM   6553 N N   . ALA B 1 314 ? 25.048  14.780  -35.941 1.00 57.21 ? 314  ALA B N   1 
ATOM   6554 C CA  . ALA B 1 314 ? 25.720  16.007  -36.367 1.00 57.72 ? 314  ALA B CA  1 
ATOM   6555 C C   . ALA B 1 314 ? 24.761  16.948  -37.110 1.00 57.46 ? 314  ALA B C   1 
ATOM   6556 O O   . ALA B 1 314 ? 24.752  18.157  -36.860 1.00 57.33 ? 314  ALA B O   1 
ATOM   6557 C CB  . ALA B 1 314 ? 26.955  15.689  -37.234 1.00 58.06 ? 314  ALA B CB  1 
ATOM   6558 N N   . LEU B 1 315 ? 23.945  16.384  -38.002 1.00 57.00 ? 315  LEU B N   1 
ATOM   6559 C CA  . LEU B 1 315 ? 23.058  17.180  -38.851 1.00 56.99 ? 315  LEU B CA  1 
ATOM   6560 C C   . LEU B 1 315 ? 21.926  17.840  -38.065 1.00 57.14 ? 315  LEU B C   1 
ATOM   6561 O O   . LEU B 1 315 ? 21.544  18.961  -38.387 1.00 57.11 ? 315  LEU B O   1 
ATOM   6562 C CB  . LEU B 1 315 ? 22.488  16.339  -40.014 1.00 56.36 ? 315  LEU B CB  1 
ATOM   6563 C CG  . LEU B 1 315 ? 23.495  15.823  -41.049 1.00 56.16 ? 315  LEU B CG  1 
ATOM   6564 C CD1 . LEU B 1 315 ? 22.805  15.044  -42.170 1.00 53.00 ? 315  LEU B CD1 1 
ATOM   6565 C CD2 . LEU B 1 315 ? 24.329  16.980  -41.611 1.00 56.49 ? 315  LEU B CD2 1 
ATOM   6566 N N   . ILE B 1 316 ? 21.389  17.166  -37.049 1.00 57.78 ? 316  ILE B N   1 
ATOM   6567 C CA  . ILE B 1 316 ? 20.348  17.791  -36.226 1.00 58.90 ? 316  ILE B CA  1 
ATOM   6568 C C   . ILE B 1 316 ? 20.954  18.850  -35.296 1.00 60.25 ? 316  ILE B C   1 
ATOM   6569 O O   . ILE B 1 316 ? 20.305  19.847  -35.008 1.00 60.67 ? 316  ILE B O   1 
ATOM   6570 C CB  . ILE B 1 316 ? 19.448  16.783  -35.431 1.00 58.20 ? 316  ILE B CB  1 
ATOM   6571 C CG1 . ILE B 1 316 ? 20.189  16.151  -34.247 1.00 58.98 ? 316  ILE B CG1 1 
ATOM   6572 C CG2 . ILE B 1 316 ? 18.897  15.680  -36.349 1.00 57.27 ? 316  ILE B CG2 1 
ATOM   6573 C CD1 . ILE B 1 316 ? 19.289  15.280  -33.349 1.00 57.66 ? 316  ILE B CD1 1 
ATOM   6574 N N   . ASN B 1 317 ? 22.195  18.653  -34.849 1.00 61.67 ? 317  ASN B N   1 
ATOM   6575 C CA  . ASN B 1 317 ? 22.859  19.635  -33.976 1.00 62.64 ? 317  ASN B CA  1 
ATOM   6576 C C   . ASN B 1 317 ? 23.176  20.953  -34.684 1.00 64.05 ? 317  ASN B C   1 
ATOM   6577 O O   . ASN B 1 317 ? 23.064  22.007  -34.082 1.00 64.78 ? 317  ASN B O   1 
ATOM   6578 C CB  . ASN B 1 317 ? 24.148  19.065  -33.374 1.00 63.28 ? 317  ASN B CB  1 
ATOM   6579 C CG  . ASN B 1 317 ? 23.893  18.026  -32.297 1.00 63.28 ? 317  ASN B CG  1 
ATOM   6580 O OD1 . ASN B 1 317 ? 22.756  17.778  -31.909 1.00 65.17 ? 317  ASN B OD1 1 
ATOM   6581 N ND2 . ASN B 1 317 ? 24.964  17.408  -31.808 1.00 64.05 ? 317  ASN B ND2 1 
ATOM   6582 N N   . THR B 1 318 ? 23.559  20.893  -35.956 1.00 64.89 ? 318  THR B N   1 
ATOM   6583 C CA  . THR B 1 318 ? 24.017  22.078  -36.683 1.00 66.35 ? 318  THR B CA  1 
ATOM   6584 C C   . THR B 1 318 ? 23.017  22.619  -37.700 1.00 66.53 ? 318  THR B C   1 
ATOM   6585 O O   . THR B 1 318 ? 23.271  23.640  -38.346 1.00 67.30 ? 318  THR B O   1 
ATOM   6586 C CB  . THR B 1 318 ? 25.321  21.779  -37.452 1.00 67.11 ? 318  THR B CB  1 
ATOM   6587 O OG1 . THR B 1 318 ? 25.072  20.772  -38.446 1.00 66.90 ? 318  THR B OG1 1 
ATOM   6588 C CG2 . THR B 1 318 ? 26.405  21.311  -36.494 1.00 67.82 ? 318  THR B CG2 1 
ATOM   6589 N N   . GLY B 1 319 ? 21.896  21.937  -37.866 1.00 65.94 ? 319  GLY B N   1 
ATOM   6590 C CA  . GLY B 1 319 ? 20.955  22.312  -38.901 1.00 66.22 ? 319  GLY B CA  1 
ATOM   6591 C C   . GLY B 1 319 ? 20.240  23.626  -38.639 1.00 66.97 ? 319  GLY B C   1 
ATOM   6592 O O   . GLY B 1 319 ? 20.134  24.090  -37.497 1.00 66.73 ? 319  GLY B O   1 
ATOM   6593 N N   . ASP B 1 320 ? 19.761  24.222  -39.726 1.00 67.77 ? 320  ASP B N   1 
ATOM   6594 C CA  . ASP B 1 320 ? 18.873  25.365  -39.668 1.00 68.49 ? 320  ASP B CA  1 
ATOM   6595 C C   . ASP B 1 320 ? 17.507  24.899  -40.151 1.00 67.21 ? 320  ASP B C   1 
ATOM   6596 O O   . ASP B 1 320 ? 17.366  24.441  -41.293 1.00 66.60 ? 320  ASP B O   1 
ATOM   6597 C CB  . ASP B 1 320 ? 19.377  26.508  -40.554 1.00 70.14 ? 320  ASP B CB  1 
ATOM   6598 C CG  . ASP B 1 320 ? 18.559  27.782  -40.375 1.00 72.65 ? 320  ASP B CG  1 
ATOM   6599 O OD1 . ASP B 1 320 ? 17.942  27.919  -39.297 1.00 74.98 ? 320  ASP B OD1 1 
ATOM   6600 O OD2 . ASP B 1 320 ? 18.534  28.636  -41.294 1.00 74.93 ? 320  ASP B OD2 1 
ATOM   6601 N N   . PHE B 1 321 ? 16.514  25.006  -39.267 1.00 66.29 ? 321  PHE B N   1 
ATOM   6602 C CA  . PHE B 1 321 ? 15.176  24.483  -39.533 1.00 65.01 ? 321  PHE B CA  1 
ATOM   6603 C C   . PHE B 1 321 ? 14.093  25.561  -39.406 1.00 65.30 ? 321  PHE B C   1 
ATOM   6604 O O   . PHE B 1 321 ? 12.955  25.259  -39.061 1.00 64.56 ? 321  PHE B O   1 
ATOM   6605 C CB  . PHE B 1 321 ? 14.891  23.322  -38.575 1.00 63.84 ? 321  PHE B CB  1 
ATOM   6606 C CG  . PHE B 1 321 ? 15.918  22.224  -38.625 1.00 62.75 ? 321  PHE B CG  1 
ATOM   6607 C CD1 . PHE B 1 321 ? 16.010  21.392  -39.734 1.00 62.41 ? 321  PHE B CD1 1 
ATOM   6608 C CD2 . PHE B 1 321 ? 16.780  22.006  -37.561 1.00 62.52 ? 321  PHE B CD2 1 
ATOM   6609 C CE1 . PHE B 1 321 ? 16.946  20.365  -39.786 1.00 61.27 ? 321  PHE B CE1 1 
ATOM   6610 C CE2 . PHE B 1 321 ? 17.714  20.981  -37.605 1.00 62.43 ? 321  PHE B CE2 1 
ATOM   6611 C CZ  . PHE B 1 321 ? 17.795  20.159  -38.726 1.00 61.71 ? 321  PHE B CZ  1 
ATOM   6612 N N   . GLN B 1 322 ? 14.436  26.808  -39.730 1.00 66.27 ? 322  GLN B N   1 
ATOM   6613 C CA  . GLN B 1 322 ? 13.540  27.940  -39.490 1.00 67.17 ? 322  GLN B CA  1 
ATOM   6614 C C   . GLN B 1 322 ? 12.216  27.861  -40.246 1.00 66.64 ? 322  GLN B C   1 
ATOM   6615 O O   . GLN B 1 322 ? 11.153  28.148  -39.681 1.00 67.25 ? 322  GLN B O   1 
ATOM   6616 C CB  . GLN B 1 322 ? 14.238  29.269  -39.790 1.00 68.81 ? 322  GLN B CB  1 
ATOM   6617 C CG  . GLN B 1 322 ? 15.464  29.507  -38.916 1.00 71.13 ? 322  GLN B CG  1 
ATOM   6618 C CD  . GLN B 1 322 ? 15.633  30.950  -38.482 1.00 75.99 ? 322  GLN B CD  1 
ATOM   6619 O OE1 . GLN B 1 322 ? 15.661  31.251  -37.279 1.00 77.65 ? 322  GLN B OE1 1 
ATOM   6620 N NE2 . GLN B 1 322 ? 15.752  31.855  -39.459 1.00 77.57 ? 322  GLN B NE2 1 
ATOM   6621 N N   . ASP B 1 323 ? 12.250  27.447  -41.503 1.00 65.80 ? 323  ASP B N   1 
ATOM   6622 C CA  . ASP B 1 323 ? 11.027  27.483  -42.308 1.00 65.49 ? 323  ASP B CA  1 
ATOM   6623 C C   . ASP B 1 323 ? 10.317  26.123  -42.341 1.00 62.86 ? 323  ASP B C   1 
ATOM   6624 O O   . ASP B 1 323 ? 9.694   25.759  -43.331 1.00 62.97 ? 323  ASP B O   1 
ATOM   6625 C CB  . ASP B 1 323 ? 11.344  28.018  -43.707 1.00 66.82 ? 323  ASP B CB  1 
ATOM   6626 C CG  . ASP B 1 323 ? 11.844  29.490  -43.677 1.00 70.54 ? 323  ASP B CG  1 
ATOM   6627 O OD1 . ASP B 1 323 ? 11.110  30.384  -43.160 1.00 72.61 ? 323  ASP B OD1 1 
ATOM   6628 O OD2 . ASP B 1 323 ? 12.979  29.741  -44.171 1.00 74.15 ? 323  ASP B OD2 1 
ATOM   6629 N N   . LEU B 1 324 ? 10.382  25.406  -41.221 1.00 59.99 ? 324  LEU B N   1 
ATOM   6630 C CA  . LEU B 1 324 ? 9.877   24.050  -41.124 1.00 57.46 ? 324  LEU B CA  1 
ATOM   6631 C C   . LEU B 1 324 ? 8.919   23.913  -39.956 1.00 55.01 ? 324  LEU B C   1 
ATOM   6632 O O   . LEU B 1 324 ? 9.226   24.356  -38.860 1.00 54.27 ? 324  LEU B O   1 
ATOM   6633 C CB  . LEU B 1 324 ? 11.055  23.091  -40.906 1.00 57.25 ? 324  LEU B CB  1 
ATOM   6634 C CG  . LEU B 1 324 ? 10.742  21.597  -41.008 1.00 57.04 ? 324  LEU B CG  1 
ATOM   6635 C CD1 . LEU B 1 324 ? 10.373  21.233  -42.447 1.00 57.62 ? 324  LEU B CD1 1 
ATOM   6636 C CD2 . LEU B 1 324 ? 11.920  20.763  -40.494 1.00 56.51 ? 324  LEU B CD2 1 
ATOM   6637 N N   . GLN B 1 325 ? 7.766   23.289  -40.195 1.00 52.98 ? 325  GLN B N   1 
ATOM   6638 C CA  . GLN B 1 325 ? 6.901   22.821  -39.109 1.00 51.42 ? 325  GLN B CA  1 
ATOM   6639 C C   . GLN B 1 325 ? 6.966   21.289  -39.014 1.00 49.93 ? 325  GLN B C   1 
ATOM   6640 O O   . GLN B 1 325 ? 6.948   20.598  -40.035 1.00 49.03 ? 325  GLN B O   1 
ATOM   6641 C CB  . GLN B 1 325 ? 5.457   23.279  -39.287 1.00 51.62 ? 325  GLN B CB  1 
ATOM   6642 C CG  . GLN B 1 325 ? 5.264   24.790  -39.536 1.00 52.37 ? 325  GLN B CG  1 
ATOM   6643 C CD  . GLN B 1 325 ? 5.391   25.172  -41.001 1.00 52.21 ? 325  GLN B CD  1 
ATOM   6644 O OE1 . GLN B 1 325 ? 4.833   24.513  -41.884 1.00 50.76 ? 325  GLN B OE1 1 
ATOM   6645 N NE2 . GLN B 1 325 ? 6.140   26.222  -41.268 1.00 51.77 ? 325  GLN B NE2 1 
ATOM   6646 N N   . VAL B 1 326 ? 7.051   20.775  -37.783 1.00 49.00 ? 326  VAL B N   1 
ATOM   6647 C CA  . VAL B 1 326 ? 7.122   19.336  -37.523 1.00 47.69 ? 326  VAL B CA  1 
ATOM   6648 C C   . VAL B 1 326 ? 6.148   18.907  -36.422 1.00 47.10 ? 326  VAL B C   1 
ATOM   6649 O O   . VAL B 1 326 ? 6.049   19.548  -35.390 1.00 46.88 ? 326  VAL B O   1 
ATOM   6650 C CB  . VAL B 1 326 ? 8.573   18.898  -37.125 1.00 47.87 ? 326  VAL B CB  1 
ATOM   6651 C CG1 . VAL B 1 326 ? 8.643   17.393  -36.903 1.00 47.73 ? 326  VAL B CG1 1 
ATOM   6652 C CG2 . VAL B 1 326 ? 9.599   19.292  -38.204 1.00 47.61 ? 326  VAL B CG2 1 
ATOM   6653 N N   . LEU B 1 327 ? 5.420   17.815  -36.661 1.00 46.89 ? 327  LEU B N   1 
ATOM   6654 C CA  . LEU B 1 327 ? 4.623   17.139  -35.630 1.00 46.30 ? 327  LEU B CA  1 
ATOM   6655 C C   . LEU B 1 327 ? 5.323   15.818  -35.300 1.00 45.45 ? 327  LEU B C   1 
ATOM   6656 O O   . LEU B 1 327 ? 5.611   15.039  -36.191 1.00 45.08 ? 327  LEU B O   1 
ATOM   6657 C CB  . LEU B 1 327 ? 3.191   16.901  -36.120 1.00 46.61 ? 327  LEU B CB  1 
ATOM   6658 C CG  . LEU B 1 327 ? 2.183   16.073  -35.285 1.00 47.04 ? 327  LEU B CG  1 
ATOM   6659 C CD1 . LEU B 1 327 ? 1.886   16.726  -33.951 1.00 46.41 ? 327  LEU B CD1 1 
ATOM   6660 C CD2 . LEU B 1 327 ? 0.858   15.842  -36.063 1.00 47.00 ? 327  LEU B CD2 1 
ATOM   6661 N N   . VAL B 1 328 ? 5.623   15.584  -34.023 1.00 45.15 ? 328  VAL B N   1 
ATOM   6662 C CA  . VAL B 1 328 ? 6.293   14.354  -33.604 1.00 45.13 ? 328  VAL B CA  1 
ATOM   6663 C C   . VAL B 1 328 ? 5.592   13.745  -32.392 1.00 45.01 ? 328  VAL B C   1 
ATOM   6664 O O   . VAL B 1 328 ? 5.010   14.452  -31.569 1.00 45.41 ? 328  VAL B O   1 
ATOM   6665 C CB  . VAL B 1 328 ? 7.800   14.578  -33.226 1.00 44.94 ? 328  VAL B CB  1 
ATOM   6666 C CG1 . VAL B 1 328 ? 8.589   15.058  -34.400 1.00 45.66 ? 328  VAL B CG1 1 
ATOM   6667 C CG2 . VAL B 1 328 ? 7.919   15.575  -32.084 1.00 45.12 ? 328  VAL B CG2 1 
ATOM   6668 N N   . GLY B 1 329 ? 5.679   12.433  -32.262 1.00 44.74 ? 329  GLY B N   1 
ATOM   6669 C CA  . GLY B 1 329 ? 5.195   11.800  -31.049 1.00 45.21 ? 329  GLY B CA  1 
ATOM   6670 C C   . GLY B 1 329 ? 5.448   10.322  -30.964 1.00 44.65 ? 329  GLY B C   1 
ATOM   6671 O O   . GLY B 1 329 ? 6.079   9.740   -31.835 1.00 44.31 ? 329  GLY B O   1 
ATOM   6672 N N   . VAL B 1 330 ? 4.923   9.746   -29.888 1.00 45.02 ? 330  VAL B N   1 
ATOM   6673 C CA  . VAL B 1 330 ? 5.157   8.368   -29.469 1.00 44.61 ? 330  VAL B CA  1 
ATOM   6674 C C   . VAL B 1 330 ? 3.837   7.742   -28.997 1.00 45.31 ? 330  VAL B C   1 
ATOM   6675 O O   . VAL B 1 330 ? 2.877   8.459   -28.732 1.00 45.45 ? 330  VAL B O   1 
ATOM   6676 C CB  . VAL B 1 330 ? 6.193   8.318   -28.309 1.00 44.79 ? 330  VAL B CB  1 
ATOM   6677 C CG1 . VAL B 1 330 ? 7.594   8.740   -28.802 1.00 43.50 ? 330  VAL B CG1 1 
ATOM   6678 C CG2 . VAL B 1 330 ? 5.759   9.179   -27.124 1.00 42.44 ? 330  VAL B CG2 1 
ATOM   6679 N N   . VAL B 1 331 ? 3.779   6.409   -28.949 1.00 45.75 ? 331  VAL B N   1 
ATOM   6680 C CA  . VAL B 1 331 ? 2.662   5.689   -28.315 1.00 46.23 ? 331  VAL B CA  1 
ATOM   6681 C C   . VAL B 1 331 ? 3.043   5.386   -26.873 1.00 46.98 ? 331  VAL B C   1 
ATOM   6682 O O   . VAL B 1 331 ? 4.207   5.512   -26.501 1.00 46.81 ? 331  VAL B O   1 
ATOM   6683 C CB  . VAL B 1 331 ? 2.251   4.366   -29.070 1.00 46.70 ? 331  VAL B CB  1 
ATOM   6684 C CG1 . VAL B 1 331 ? 1.739   4.689   -30.458 1.00 45.63 ? 331  VAL B CG1 1 
ATOM   6685 C CG2 . VAL B 1 331 ? 3.402   3.324   -29.130 1.00 45.14 ? 331  VAL B CG2 1 
ATOM   6686 N N   . LYS B 1 332 ? 2.060   4.996   -26.066 1.00 48.10 ? 332  LYS B N   1 
ATOM   6687 C CA  . LYS B 1 332 ? 2.273   4.766   -24.638 1.00 49.09 ? 332  LYS B CA  1 
ATOM   6688 C C   . LYS B 1 332 ? 3.250   3.616   -24.346 1.00 48.52 ? 332  LYS B C   1 
ATOM   6689 O O   . LYS B 1 332 ? 3.970   3.673   -23.369 1.00 48.58 ? 332  LYS B O   1 
ATOM   6690 C CB  . LYS B 1 332 ? 0.926   4.517   -23.925 1.00 50.07 ? 332  LYS B CB  1 
ATOM   6691 C CG  . LYS B 1 332 ? 0.972   4.633   -22.400 1.00 51.35 ? 332  LYS B CG  1 
ATOM   6692 C CD  . LYS B 1 332 ? -0.415  4.348   -21.750 1.00 54.15 ? 332  LYS B CD  1 
ATOM   6693 C CE  . LYS B 1 332 ? -0.484  3.029   -20.895 1.00 58.17 ? 332  LYS B CE  1 
ATOM   6694 N NZ  . LYS B 1 332 ? -0.768  1.707   -21.630 1.00 56.55 ? 332  LYS B NZ  1 
ATOM   6695 N N   . ASP B 1 333 ? 3.286   2.588   -25.188 1.00 48.43 ? 333  ASP B N   1 
ATOM   6696 C CA  . ASP B 1 333 ? 4.151   1.416   -24.931 1.00 48.61 ? 333  ASP B CA  1 
ATOM   6697 C C   . ASP B 1 333 ? 4.993   1.024   -26.147 1.00 48.03 ? 333  ASP B C   1 
ATOM   6698 O O   . ASP B 1 333 ? 4.755   0.014   -26.784 1.00 49.00 ? 333  ASP B O   1 
ATOM   6699 C CB  . ASP B 1 333 ? 3.291   0.249   -24.464 1.00 49.35 ? 333  ASP B CB  1 
ATOM   6700 C CG  . ASP B 1 333 ? 2.489   0.590   -23.230 1.00 50.05 ? 333  ASP B CG  1 
ATOM   6701 O OD1 . ASP B 1 333 ? 1.287   0.879   -23.359 1.00 49.97 ? 333  ASP B OD1 1 
ATOM   6702 O OD2 . ASP B 1 333 ? 3.064   0.593   -22.132 1.00 51.57 ? 333  ASP B OD2 1 
ATOM   6703 N N   . GLU B 1 334 ? 5.993   1.835   -26.450 1.00 47.79 ? 334  GLU B N   1 
ATOM   6704 C CA  . GLU B 1 334 ? 6.821   1.656   -27.651 1.00 47.76 ? 334  GLU B CA  1 
ATOM   6705 C C   . GLU B 1 334 ? 7.599   0.342   -27.664 1.00 48.51 ? 334  GLU B C   1 
ATOM   6706 O O   . GLU B 1 334 ? 7.757   -0.262  -28.713 1.00 49.01 ? 334  GLU B O   1 
ATOM   6707 C CB  . GLU B 1 334 ? 7.809   2.829   -27.800 1.00 47.03 ? 334  GLU B CB  1 
ATOM   6708 C CG  . GLU B 1 334 ? 7.154   4.160   -28.137 1.00 45.71 ? 334  GLU B CG  1 
ATOM   6709 C CD  . GLU B 1 334 ? 6.678   4.248   -29.583 1.00 47.29 ? 334  GLU B CD  1 
ATOM   6710 O OE1 . GLU B 1 334 ? 6.954   3.324   -30.382 1.00 48.00 ? 334  GLU B OE1 1 
ATOM   6711 O OE2 . GLU B 1 334 ? 6.027   5.254   -29.936 1.00 46.59 ? 334  GLU B OE2 1 
ATOM   6712 N N   . GLY B 1 335 ? 8.063   -0.108  -26.506 1.00 49.28 ? 335  GLY B N   1 
ATOM   6713 C CA  . GLY B 1 335 ? 8.944   -1.261  -26.444 1.00 50.56 ? 335  GLY B CA  1 
ATOM   6714 C C   . GLY B 1 335 ? 8.324   -2.654  -26.462 1.00 51.23 ? 335  GLY B C   1 
ATOM   6715 O O   . GLY B 1 335 ? 9.004   -3.601  -26.817 1.00 51.16 ? 335  GLY B O   1 
ATOM   6716 N N   . SER B 1 336 ? 7.052   -2.774  -26.080 1.00 52.21 ? 336  SER B N   1 
ATOM   6717 C CA  . SER B 1 336 ? 6.404   -4.079  -25.846 1.00 53.71 ? 336  SER B CA  1 
ATOM   6718 C C   . SER B 1 336 ? 6.381   -5.016  -27.070 1.00 54.48 ? 336  SER B C   1 
ATOM   6719 O O   . SER B 1 336 ? 6.696   -6.198  -26.948 1.00 54.88 ? 336  SER B O   1 
ATOM   6720 C CB  . SER B 1 336 ? 4.973   -3.892  -25.310 1.00 53.84 ? 336  SER B CB  1 
ATOM   6721 O OG  . SER B 1 336 ? 4.132   -3.259  -26.263 1.00 53.41 ? 336  SER B OG  1 
ATOM   6722 N N   . TYR B 1 337 ? 6.008   -4.478  -28.232 1.00 54.79 ? 337  TYR B N   1 
ATOM   6723 C CA  . TYR B 1 337 ? 5.965   -5.240  -29.505 1.00 55.15 ? 337  TYR B CA  1 
ATOM   6724 C C   . TYR B 1 337 ? 7.208   -6.106  -29.729 1.00 55.06 ? 337  TYR B C   1 
ATOM   6725 O O   . TYR B 1 337 ? 7.100   -7.260  -30.142 1.00 55.59 ? 337  TYR B O   1 
ATOM   6726 C CB  . TYR B 1 337 ? 5.809   -4.264  -30.696 1.00 55.73 ? 337  TYR B CB  1 
ATOM   6727 C CG  . TYR B 1 337 ? 5.407   -4.923  -31.991 1.00 56.85 ? 337  TYR B CG  1 
ATOM   6728 C CD1 . TYR B 1 337 ? 4.068   -5.145  -32.279 1.00 59.36 ? 337  TYR B CD1 1 
ATOM   6729 C CD2 . TYR B 1 337 ? 6.356   -5.334  -32.926 1.00 58.83 ? 337  TYR B CD2 1 
ATOM   6730 C CE1 . TYR B 1 337 ? 3.669   -5.764  -33.463 1.00 59.56 ? 337  TYR B CE1 1 
ATOM   6731 C CE2 . TYR B 1 337 ? 5.965   -5.971  -34.127 1.00 59.27 ? 337  TYR B CE2 1 
ATOM   6732 C CZ  . TYR B 1 337 ? 4.612   -6.175  -34.383 1.00 58.95 ? 337  TYR B CZ  1 
ATOM   6733 O OH  . TYR B 1 337 ? 4.171   -6.792  -35.547 1.00 59.44 ? 337  TYR B OH  1 
ATOM   6734 N N   . PHE B 1 338 ? 8.375   -5.536  -29.436 1.00 54.20 ? 338  PHE B N   1 
ATOM   6735 C CA  . PHE B 1 338 ? 9.670   -6.112  -29.805 1.00 54.18 ? 338  PHE B CA  1 
ATOM   6736 C C   . PHE B 1 338 ? 10.163  -7.186  -28.848 1.00 54.82 ? 338  PHE B C   1 
ATOM   6737 O O   . PHE B 1 338 ? 11.012  -7.994  -29.203 1.00 55.04 ? 338  PHE B O   1 
ATOM   6738 C CB  . PHE B 1 338 ? 10.718  -4.989  -29.911 1.00 53.73 ? 338  PHE B CB  1 
ATOM   6739 C CG  . PHE B 1 338 ? 10.392  -3.975  -30.971 1.00 53.02 ? 338  PHE B CG  1 
ATOM   6740 C CD1 . PHE B 1 338 ? 9.611   -2.864  -30.666 1.00 51.69 ? 338  PHE B CD1 1 
ATOM   6741 C CD2 . PHE B 1 338 ? 10.824  -4.162  -32.283 1.00 51.82 ? 338  PHE B CD2 1 
ATOM   6742 C CE1 . PHE B 1 338 ? 9.277   -1.949  -31.640 1.00 51.88 ? 338  PHE B CE1 1 
ATOM   6743 C CE2 . PHE B 1 338 ? 10.499  -3.247  -33.277 1.00 51.45 ? 338  PHE B CE2 1 
ATOM   6744 C CZ  . PHE B 1 338 ? 9.724   -2.135  -32.956 1.00 52.11 ? 338  PHE B CZ  1 
ATOM   6745 N N   . LEU B 1 339 ? 9.622   -7.205  -27.640 1.00 55.42 ? 339  LEU B N   1 
ATOM   6746 C CA  . LEU B 1 339 ? 10.087  -8.136  -26.614 1.00 56.46 ? 339  LEU B CA  1 
ATOM   6747 C C   . LEU B 1 339 ? 9.795   -9.588  -26.996 1.00 58.18 ? 339  LEU B C   1 
ATOM   6748 O O   . LEU B 1 339 ? 10.601  -10.476 -26.717 1.00 59.02 ? 339  LEU B O   1 
ATOM   6749 C CB  . LEU B 1 339 ? 9.456   -7.798  -25.257 1.00 56.49 ? 339  LEU B CB  1 
ATOM   6750 C CG  . LEU B 1 339 ? 9.752   -6.396  -24.698 1.00 54.79 ? 339  LEU B CG  1 
ATOM   6751 C CD1 . LEU B 1 339 ? 9.115   -6.219  -23.340 1.00 53.42 ? 339  LEU B CD1 1 
ATOM   6752 C CD2 . LEU B 1 339 ? 11.245  -6.118  -24.628 1.00 52.58 ? 339  LEU B CD2 1 
ATOM   6753 N N   . VAL B 1 340 ? 8.657   -9.811  -27.653 1.00 58.89 ? 340  VAL B N   1 
ATOM   6754 C CA  . VAL B 1 340 ? 8.231   -11.151 -28.060 1.00 60.45 ? 340  VAL B CA  1 
ATOM   6755 C C   . VAL B 1 340 ? 9.057   -11.713 -29.234 1.00 61.16 ? 340  VAL B C   1 
ATOM   6756 O O   . VAL B 1 340 ? 8.965   -12.892 -29.546 1.00 61.92 ? 340  VAL B O   1 
ATOM   6757 C CB  . VAL B 1 340 ? 6.710   -11.184 -28.411 1.00 60.57 ? 340  VAL B CB  1 
ATOM   6758 C CG1 . VAL B 1 340 ? 5.860   -10.683 -27.219 1.00 60.61 ? 340  VAL B CG1 1 
ATOM   6759 C CG2 . VAL B 1 340 ? 6.421   -10.368 -29.651 1.00 59.23 ? 340  VAL B CG2 1 
ATOM   6760 N N   . TYR B 1 341 ? 9.878   -10.870 -29.856 1.00 61.32 ? 341  TYR B N   1 
ATOM   6761 C CA  . TYR B 1 341 ? 10.731  -11.281 -30.971 1.00 61.85 ? 341  TYR B CA  1 
ATOM   6762 C C   . TYR B 1 341 ? 12.153  -11.677 -30.557 1.00 62.58 ? 341  TYR B C   1 
ATOM   6763 O O   . TYR B 1 341 ? 13.064  -11.685 -31.391 1.00 63.15 ? 341  TYR B O   1 
ATOM   6764 C CB  . TYR B 1 341 ? 10.794  -10.157 -32.011 1.00 61.22 ? 341  TYR B CB  1 
ATOM   6765 C CG  . TYR B 1 341 ? 9.593   -10.116 -32.926 1.00 61.63 ? 341  TYR B CG  1 
ATOM   6766 C CD1 . TYR B 1 341 ? 8.482   -9.324  -32.629 1.00 61.85 ? 341  TYR B CD1 1 
ATOM   6767 C CD2 . TYR B 1 341 ? 9.568   -10.874 -34.088 1.00 62.08 ? 341  TYR B CD2 1 
ATOM   6768 C CE1 . TYR B 1 341 ? 7.375   -9.292  -33.474 1.00 62.06 ? 341  TYR B CE1 1 
ATOM   6769 C CE2 . TYR B 1 341 ? 8.482   -10.847 -34.936 1.00 62.81 ? 341  TYR B CE2 1 
ATOM   6770 C CZ  . TYR B 1 341 ? 7.384   -10.057 -34.633 1.00 62.74 ? 341  TYR B CZ  1 
ATOM   6771 O OH  . TYR B 1 341 ? 6.298   -10.047 -35.490 1.00 63.15 ? 341  TYR B OH  1 
ATOM   6772 N N   . GLY B 1 342 ? 12.372  -12.012 -29.292 1.00 63.23 ? 342  GLY B N   1 
ATOM   6773 C CA  . GLY B 1 342 ? 13.715  -12.454 -28.891 1.00 63.88 ? 342  GLY B CA  1 
ATOM   6774 C C   . GLY B 1 342 ? 14.163  -12.270 -27.455 1.00 63.97 ? 342  GLY B C   1 
ATOM   6775 O O   . GLY B 1 342 ? 15.270  -12.671 -27.117 1.00 64.81 ? 342  GLY B O   1 
ATOM   6776 N N   . VAL B 1 343 ? 13.343  -11.649 -26.611 1.00 63.57 ? 343  VAL B N   1 
ATOM   6777 C CA  . VAL B 1 343 ? 13.660  -11.583 -25.189 1.00 63.55 ? 343  VAL B CA  1 
ATOM   6778 C C   . VAL B 1 343 ? 12.985  -12.751 -24.466 1.00 64.70 ? 343  VAL B C   1 
ATOM   6779 O O   . VAL B 1 343 ? 11.760  -12.812 -24.408 1.00 64.66 ? 343  VAL B O   1 
ATOM   6780 C CB  . VAL B 1 343 ? 13.237  -10.263 -24.559 1.00 62.63 ? 343  VAL B CB  1 
ATOM   6781 C CG1 . VAL B 1 343 ? 13.673  -10.230 -23.092 1.00 61.78 ? 343  VAL B CG1 1 
ATOM   6782 C CG2 . VAL B 1 343 ? 13.854  -9.109  -25.326 1.00 61.45 ? 343  VAL B CG2 1 
ATOM   6783 N N   . PRO B 1 344 ? 13.783  -13.689 -23.923 1.00 65.60 ? 344  PRO B N   1 
ATOM   6784 C CA  . PRO B 1 344 ? 13.183  -14.824 -23.231 1.00 66.95 ? 344  PRO B CA  1 
ATOM   6785 C C   . PRO B 1 344 ? 12.296  -14.419 -22.049 1.00 66.93 ? 344  PRO B C   1 
ATOM   6786 O O   . PRO B 1 344 ? 12.612  -13.470 -21.320 1.00 66.01 ? 344  PRO B O   1 
ATOM   6787 C CB  . PRO B 1 344 ? 14.401  -15.625 -22.740 1.00 68.17 ? 344  PRO B CB  1 
ATOM   6788 C CG  . PRO B 1 344 ? 15.515  -15.198 -23.612 1.00 67.55 ? 344  PRO B CG  1 
ATOM   6789 C CD  . PRO B 1 344 ? 15.253  -13.765 -23.918 1.00 65.75 ? 344  PRO B CD  1 
ATOM   6790 N N   . GLY B 1 345 ? 11.198  -15.151 -21.879 1.00 67.51 ? 345  GLY B N   1 
ATOM   6791 C CA  . GLY B 1 345 ? 10.212  -14.864 -20.846 1.00 67.62 ? 345  GLY B CA  1 
ATOM   6792 C C   . GLY B 1 345 ? 9.011   -14.132 -21.410 1.00 66.68 ? 345  GLY B C   1 
ATOM   6793 O O   . GLY B 1 345 ? 7.961   -14.065 -20.764 1.00 67.15 ? 345  GLY B O   1 
ATOM   6794 N N   . PHE B 1 346 ? 9.152   -13.603 -22.624 1.00 65.52 ? 346  PHE B N   1 
ATOM   6795 C CA  . PHE B 1 346 ? 8.115   -12.767 -23.219 1.00 64.71 ? 346  PHE B CA  1 
ATOM   6796 C C   . PHE B 1 346 ? 7.341   -13.491 -24.314 1.00 65.53 ? 346  PHE B C   1 
ATOM   6797 O O   . PHE B 1 346 ? 7.932   -14.110 -25.209 1.00 66.09 ? 346  PHE B O   1 
ATOM   6798 C CB  . PHE B 1 346 ? 8.723   -11.463 -23.737 1.00 62.86 ? 346  PHE B CB  1 
ATOM   6799 C CG  . PHE B 1 346 ? 9.156   -10.531 -22.636 1.00 61.80 ? 346  PHE B CG  1 
ATOM   6800 C CD1 . PHE B 1 346 ? 10.394  -10.673 -22.033 1.00 61.06 ? 346  PHE B CD1 1 
ATOM   6801 C CD2 . PHE B 1 346 ? 8.310   -9.535  -22.183 1.00 61.13 ? 346  PHE B CD2 1 
ATOM   6802 C CE1 . PHE B 1 346 ? 10.784  -9.834  -21.013 1.00 60.49 ? 346  PHE B CE1 1 
ATOM   6803 C CE2 . PHE B 1 346 ? 8.697   -8.690  -21.160 1.00 60.09 ? 346  PHE B CE2 1 
ATOM   6804 C CZ  . PHE B 1 346 ? 9.937   -8.839  -20.580 1.00 60.51 ? 346  PHE B CZ  1 
ATOM   6805 N N   . SER B 1 347 ? 6.013   -13.412 -24.218 1.00 66.05 ? 347  SER B N   1 
ATOM   6806 C CA  . SER B 1 347 ? 5.108   -14.056 -25.157 1.00 66.62 ? 347  SER B CA  1 
ATOM   6807 C C   . SER B 1 347 ? 3.785   -13.317 -25.189 1.00 66.40 ? 347  SER B C   1 
ATOM   6808 O O   . SER B 1 347 ? 3.347   -12.782 -24.178 1.00 66.39 ? 347  SER B O   1 
ATOM   6809 C CB  . SER B 1 347 ? 4.867   -15.507 -24.734 1.00 68.56 ? 347  SER B CB  1 
ATOM   6810 O OG  . SER B 1 347 ? 3.843   -16.129 -25.504 1.00 69.62 ? 347  SER B OG  1 
ATOM   6811 N N   . LYS B 1 348 ? 3.141   -13.307 -26.354 1.00 66.59 ? 348  LYS B N   1 
ATOM   6812 C CA  . LYS B 1 348 ? 1.777   -12.787 -26.481 1.00 66.71 ? 348  LYS B CA  1 
ATOM   6813 C C   . LYS B 1 348 ? 0.749   -13.680 -25.771 1.00 68.13 ? 348  LYS B C   1 
ATOM   6814 O O   . LYS B 1 348 ? -0.381  -13.263 -25.539 1.00 68.11 ? 348  LYS B O   1 
ATOM   6815 C CB  . LYS B 1 348 ? 1.383   -12.642 -27.960 1.00 66.25 ? 348  LYS B CB  1 
ATOM   6816 C CG  . LYS B 1 348 ? 0.919   -13.919 -28.641 1.00 67.19 ? 348  LYS B CG  1 
ATOM   6817 C CD  . LYS B 1 348 ? 0.142   -13.627 -29.913 1.00 67.19 ? 348  LYS B CD  1 
ATOM   6818 C CE  . LYS B 1 348 ? -0.380  -14.902 -30.572 1.00 68.50 ? 348  LYS B CE  1 
ATOM   6819 N NZ  . LYS B 1 348 ? -1.489  -15.541 -29.786 1.00 70.56 ? 348  LYS B NZ  1 
ATOM   6820 N N   . ASP B 1 349 ? 1.145   -14.910 -25.455 1.00 69.45 ? 349  ASP B N   1 
ATOM   6821 C CA  . ASP B 1 349 ? 0.213   -15.940 -24.971 1.00 71.51 ? 349  ASP B CA  1 
ATOM   6822 C C   . ASP B 1 349 ? 0.115   -16.055 -23.448 1.00 72.60 ? 349  ASP B C   1 
ATOM   6823 O O   . ASP B 1 349 ? -0.698  -16.821 -22.947 1.00 73.88 ? 349  ASP B O   1 
ATOM   6824 C CB  . ASP B 1 349 ? 0.593   -17.298 -25.577 1.00 72.31 ? 349  ASP B CB  1 
ATOM   6825 C CG  . ASP B 1 349 ? 0.357   -17.351 -27.076 1.00 72.39 ? 349  ASP B CG  1 
ATOM   6826 O OD1 . ASP B 1 349 ? -0.711  -16.878 -27.517 1.00 73.15 ? 349  ASP B OD1 1 
ATOM   6827 O OD2 . ASP B 1 349 ? 1.231   -17.863 -27.814 1.00 73.16 ? 349  ASP B OD2 1 
ATOM   6828 N N   . ASN B 1 350 ? 0.938   -15.304 -22.719 1.00 72.45 ? 350  ASN B N   1 
ATOM   6829 C CA  . ASN B 1 350 ? 0.818   -15.207 -21.255 1.00 73.56 ? 350  ASN B CA  1 
ATOM   6830 C C   . ASN B 1 350 ? 1.100   -13.769 -20.793 1.00 71.42 ? 350  ASN B C   1 
ATOM   6831 O O   . ASN B 1 350 ? 1.348   -12.891 -21.618 1.00 70.17 ? 350  ASN B O   1 
ATOM   6832 C CB  . ASN B 1 350 ? 1.727   -16.242 -20.549 1.00 75.10 ? 350  ASN B CB  1 
ATOM   6833 C CG  . ASN B 1 350 ? 3.180   -16.187 -21.024 1.00 78.13 ? 350  ASN B CG  1 
ATOM   6834 O OD1 . ASN B 1 350 ? 3.853   -15.165 -20.875 1.00 76.77 ? 350  ASN B OD1 1 
ATOM   6835 N ND2 . ASN B 1 350 ? 3.655   -17.293 -21.629 1.00 85.62 ? 350  ASN B ND2 1 
ATOM   6836 N N   . GLU B 1 351 ? 1.043   -13.536 -19.484 1.00 70.80 ? 351  GLU B N   1 
ATOM   6837 C CA  . GLU B 1 351 ? 1.299   -12.218 -18.909 1.00 69.22 ? 351  GLU B CA  1 
ATOM   6838 C C   . GLU B 1 351 ? 2.781   -11.789 -18.904 1.00 67.46 ? 351  GLU B C   1 
ATOM   6839 O O   . GLU B 1 351 ? 3.087   -10.667 -18.512 1.00 66.33 ? 351  GLU B O   1 
ATOM   6840 C CB  . GLU B 1 351 ? 0.769   -12.155 -17.478 1.00 70.02 ? 351  GLU B CB  1 
ATOM   6841 C CG  . GLU B 1 351 ? -0.729  -12.098 -17.356 1.00 71.72 ? 351  GLU B CG  1 
ATOM   6842 C CD  . GLU B 1 351 ? -1.178  -12.235 -15.900 1.00 73.86 ? 351  GLU B CD  1 
ATOM   6843 O OE1 . GLU B 1 351 ? -0.688  -11.462 -15.039 1.00 76.89 ? 351  GLU B OE1 1 
ATOM   6844 O OE2 . GLU B 1 351 ? -2.014  -13.114 -15.612 1.00 77.48 ? 351  GLU B OE2 1 
ATOM   6845 N N   . SER B 1 352 ? 3.680   -12.686 -19.301 1.00 67.03 ? 352  SER B N   1 
ATOM   6846 C CA  . SER B 1 352 ? 5.107   -12.398 -19.450 1.00 66.06 ? 352  SER B CA  1 
ATOM   6847 C C   . SER B 1 352 ? 5.754   -11.846 -18.176 1.00 65.85 ? 352  SER B C   1 
ATOM   6848 O O   . SER B 1 352 ? 6.618   -10.958 -18.229 1.00 64.82 ? 352  SER B O   1 
ATOM   6849 C CB  . SER B 1 352 ? 5.341   -11.450 -20.633 1.00 64.50 ? 352  SER B CB  1 
ATOM   6850 O OG  . SER B 1 352 ? 4.934   -12.044 -21.844 1.00 63.20 ? 352  SER B OG  1 
ATOM   6851 N N   . LEU B 1 353 ? 5.331   -12.378 -17.034 1.00 66.67 ? 353  LEU B N   1 
ATOM   6852 C CA  . LEU B 1 353 ? 5.881   -11.982 -15.746 1.00 66.89 ? 353  LEU B CA  1 
ATOM   6853 C C   . LEU B 1 353 ? 7.257   -12.630 -15.613 1.00 67.10 ? 353  LEU B C   1 
ATOM   6854 O O   . LEU B 1 353 ? 7.373   -13.846 -15.610 1.00 68.92 ? 353  LEU B O   1 
ATOM   6855 C CB  . LEU B 1 353 ? 4.945   -12.405 -14.600 1.00 68.05 ? 353  LEU B CB  1 
ATOM   6856 C CG  . LEU B 1 353 ? 3.543   -11.771 -14.580 1.00 67.55 ? 353  LEU B CG  1 
ATOM   6857 C CD1 . LEU B 1 353 ? 2.667   -12.440 -13.519 1.00 69.27 ? 353  LEU B CD1 1 
ATOM   6858 C CD2 . LEU B 1 353 ? 3.573   -10.269 -14.357 1.00 65.16 ? 353  LEU B CD2 1 
ATOM   6859 N N   . ILE B 1 354 ? 8.292   -11.810 -15.502 1.00 65.93 ? 354  ILE B N   1 
ATOM   6860 C CA  . ILE B 1 354 ? 9.672   -12.274 -15.620 1.00 65.62 ? 354  ILE B CA  1 
ATOM   6861 C C   . ILE B 1 354 ? 10.482  -12.137 -14.319 1.00 66.16 ? 354  ILE B C   1 
ATOM   6862 O O   . ILE B 1 354 ? 10.175  -11.315 -13.455 1.00 65.74 ? 354  ILE B O   1 
ATOM   6863 C CB  . ILE B 1 354 ? 10.386  -11.533 -16.781 1.00 64.27 ? 354  ILE B CB  1 
ATOM   6864 C CG1 . ILE B 1 354 ? 10.372  -10.006 -16.573 1.00 63.18 ? 354  ILE B CG1 1 
ATOM   6865 C CG2 . ILE B 1 354 ? 9.705   -11.887 -18.106 1.00 63.28 ? 354  ILE B CG2 1 
ATOM   6866 C CD1 . ILE B 1 354 ? 11.490  -9.279  -17.275 1.00 61.58 ? 354  ILE B CD1 1 
ATOM   6867 N N   . SER B 1 355 ? 11.520  -12.958 -14.197 1.00 66.90 ? 355  SER B N   1 
ATOM   6868 C CA  . SER B 1 355 ? 12.433  -12.896 -13.055 1.00 67.66 ? 355  SER B CA  1 
ATOM   6869 C C   . SER B 1 355 ? 13.474  -11.807 -13.258 1.00 66.42 ? 355  SER B C   1 
ATOM   6870 O O   . SER B 1 355 ? 13.696  -11.342 -14.383 1.00 65.40 ? 355  SER B O   1 
ATOM   6871 C CB  . SER B 1 355 ? 13.166  -14.221 -12.890 1.00 69.12 ? 355  SER B CB  1 
ATOM   6872 O OG  . SER B 1 355 ? 13.959  -14.486 -14.043 1.00 69.70 ? 355  SER B OG  1 
ATOM   6873 N N   . ARG B 1 356 ? 14.139  -11.432 -12.169 1.00 66.67 ? 356  ARG B N   1 
ATOM   6874 C CA  . ARG B 1 356 ? 15.243  -10.487 -12.247 1.00 65.84 ? 356  ARG B CA  1 
ATOM   6875 C C   . ARG B 1 356 ? 16.332  -10.977 -13.201 1.00 65.82 ? 356  ARG B C   1 
ATOM   6876 O O   . ARG B 1 356 ? 16.868  -10.190 -13.985 1.00 65.13 ? 356  ARG B O   1 
ATOM   6877 C CB  . ARG B 1 356 ? 15.842  -10.201 -10.868 1.00 66.37 ? 356  ARG B CB  1 
ATOM   6878 C CG  . ARG B 1 356 ? 16.859  -9.070  -10.914 1.00 65.44 ? 356  ARG B CG  1 
ATOM   6879 C CD  . ARG B 1 356 ? 17.017  -8.356  -9.588  1.00 66.45 ? 356  ARG B CD  1 
ATOM   6880 N NE  . ARG B 1 356 ? 17.899  -7.198  -9.709  1.00 65.70 ? 356  ARG B NE  1 
ATOM   6881 C CZ  . ARG B 1 356 ? 17.526  -6.005  -10.174 1.00 65.08 ? 356  ARG B CZ  1 
ATOM   6882 N NH1 . ARG B 1 356 ? 16.274  -5.787  -10.563 1.00 65.16 ? 356  ARG B NH1 1 
ATOM   6883 N NH2 . ARG B 1 356 ? 18.410  -5.018  -10.246 1.00 64.83 ? 356  ARG B NH2 1 
ATOM   6884 N N   . ALA B 1 357 ? 16.638  -12.273 -13.158 1.00 66.74 ? 357  ALA B N   1 
ATOM   6885 C CA  . ALA B 1 357 ? 17.654  -12.843 -14.042 1.00 66.88 ? 357  ALA B CA  1 
ATOM   6886 C C   . ALA B 1 357 ? 17.284  -12.586 -15.501 1.00 65.63 ? 357  ALA B C   1 
ATOM   6887 O O   . ALA B 1 357 ? 18.127  -12.196 -16.310 1.00 64.50 ? 357  ALA B O   1 
ATOM   6888 C CB  . ALA B 1 357 ? 17.812  -14.343 -13.785 1.00 68.17 ? 357  ALA B CB  1 
ATOM   6889 N N   . GLN B 1 358 ? 16.009  -12.802 -15.812 1.00 65.55 ? 358  GLN B N   1 
ATOM   6890 C CA  . GLN B 1 358 ? 15.477  -12.594 -17.156 1.00 64.71 ? 358  GLN B CA  1 
ATOM   6891 C C   . GLN B 1 358 ? 15.507  -11.118 -17.567 1.00 62.99 ? 358  GLN B C   1 
ATOM   6892 O O   . GLN B 1 358 ? 15.617  -10.800 -18.756 1.00 62.11 ? 358  GLN B O   1 
ATOM   6893 C CB  . GLN B 1 358 ? 14.051  -13.145 -17.242 1.00 65.05 ? 358  GLN B CB  1 
ATOM   6894 C CG  . GLN B 1 358 ? 13.978  -14.667 -17.203 1.00 66.92 ? 358  GLN B CG  1 
ATOM   6895 C CD  . GLN B 1 358 ? 12.545  -15.197 -17.246 1.00 67.84 ? 358  GLN B CD  1 
ATOM   6896 O OE1 . GLN B 1 358 ? 11.690  -14.767 -16.465 1.00 70.10 ? 358  GLN B OE1 1 
ATOM   6897 N NE2 . GLN B 1 358 ? 12.281  -16.144 -18.153 1.00 68.51 ? 358  GLN B NE2 1 
ATOM   6898 N N   . PHE B 1 359 ? 15.420  -10.227 -16.580 1.00 62.31 ? 359  PHE B N   1 
ATOM   6899 C CA  . PHE B 1 359 ? 15.493  -8.788  -16.825 1.00 60.66 ? 359  PHE B CA  1 
ATOM   6900 C C   . PHE B 1 359 ? 16.908  -8.336  -17.187 1.00 59.84 ? 359  PHE B C   1 
ATOM   6901 O O   . PHE B 1 359 ? 17.080  -7.542  -18.107 1.00 58.20 ? 359  PHE B O   1 
ATOM   6902 C CB  . PHE B 1 359 ? 14.955  -8.012  -15.614 1.00 60.72 ? 359  PHE B CB  1 
ATOM   6903 C CG  . PHE B 1 359 ? 15.105  -6.529  -15.726 1.00 59.24 ? 359  PHE B CG  1 
ATOM   6904 C CD1 . PHE B 1 359 ? 15.928  -5.833  -14.853 1.00 59.61 ? 359  PHE B CD1 1 
ATOM   6905 C CD2 . PHE B 1 359 ? 14.431  -5.826  -16.706 1.00 59.58 ? 359  PHE B CD2 1 
ATOM   6906 C CE1 . PHE B 1 359 ? 16.078  -4.456  -14.951 1.00 58.84 ? 359  PHE B CE1 1 
ATOM   6907 C CE2 . PHE B 1 359 ? 14.579  -4.441  -16.822 1.00 58.85 ? 359  PHE B CE2 1 
ATOM   6908 C CZ  . PHE B 1 359 ? 15.402  -3.758  -15.941 1.00 58.26 ? 359  PHE B CZ  1 
ATOM   6909 N N   . LEU B 1 360 ? 17.910  -8.842  -16.473 1.00 60.44 ? 360  LEU B N   1 
ATOM   6910 C CA  . LEU B 1 360 ? 19.304  -8.487  -16.748 1.00 60.50 ? 360  LEU B CA  1 
ATOM   6911 C C   . LEU B 1 360 ? 19.749  -9.025  -18.109 1.00 60.12 ? 360  LEU B C   1 
ATOM   6912 O O   . LEU B 1 360 ? 20.486  -8.370  -18.848 1.00 59.06 ? 360  LEU B O   1 
ATOM   6913 C CB  . LEU B 1 360 ? 20.241  -9.022  -15.663 1.00 61.90 ? 360  LEU B CB  1 
ATOM   6914 C CG  . LEU B 1 360 ? 19.969  -8.723  -14.176 1.00 63.22 ? 360  LEU B CG  1 
ATOM   6915 C CD1 . LEU B 1 360 ? 21.218  -9.023  -13.334 1.00 65.01 ? 360  LEU B CD1 1 
ATOM   6916 C CD2 . LEU B 1 360 ? 19.515  -7.297  -13.923 1.00 61.42 ? 360  LEU B CD2 1 
ATOM   6917 N N   . ALA B 1 361 ? 19.297  -10.232 -18.431 1.00 60.65 ? 361  ALA B N   1 
ATOM   6918 C CA  . ALA B 1 361 ? 19.611  -10.851 -19.717 1.00 60.34 ? 361  ALA B CA  1 
ATOM   6919 C C   . ALA B 1 361 ? 18.917  -10.092 -20.830 1.00 58.60 ? 361  ALA B C   1 
ATOM   6920 O O   . ALA B 1 361 ? 19.483  -9.906  -21.904 1.00 58.01 ? 361  ALA B O   1 
ATOM   6921 C CB  . ALA B 1 361 ? 19.179  -12.328 -19.726 1.00 61.30 ? 361  ALA B CB  1 
ATOM   6922 N N   . GLY B 1 362 ? 17.680  -9.680  -20.556 1.00 57.59 ? 362  GLY B N   1 
ATOM   6923 C CA  . GLY B 1 362 ? 16.861  -8.937  -21.501 1.00 56.36 ? 362  GLY B CA  1 
ATOM   6924 C C   . GLY B 1 362 ? 17.472  -7.607  -21.864 1.00 55.42 ? 362  GLY B C   1 
ATOM   6925 O O   . GLY B 1 362 ? 17.423  -7.196  -23.025 1.00 54.28 ? 362  GLY B O   1 
ATOM   6926 N N   . VAL B 1 363 ? 18.064  -6.943  -20.871 1.00 55.50 ? 363  VAL B N   1 
ATOM   6927 C CA  . VAL B 1 363 ? 18.712  -5.647  -21.088 1.00 55.16 ? 363  VAL B CA  1 
ATOM   6928 C C   . VAL B 1 363 ? 19.866  -5.744  -22.096 1.00 55.60 ? 363  VAL B C   1 
ATOM   6929 O O   . VAL B 1 363 ? 20.047  -4.837  -22.894 1.00 54.38 ? 363  VAL B O   1 
ATOM   6930 C CB  . VAL B 1 363 ? 19.171  -4.997  -19.744 1.00 55.26 ? 363  VAL B CB  1 
ATOM   6931 C CG1 . VAL B 1 363 ? 20.165  -3.863  -19.978 1.00 54.86 ? 363  VAL B CG1 1 
ATOM   6932 C CG2 . VAL B 1 363 ? 17.962  -4.477  -18.984 1.00 54.08 ? 363  VAL B CG2 1 
ATOM   6933 N N   . ARG B 1 364 ? 20.614  -6.854  -22.074 1.00 57.16 ? 364  ARG B N   1 
ATOM   6934 C CA  . ARG B 1 364 ? 21.727  -7.044  -23.001 1.00 57.74 ? 364  ARG B CA  1 
ATOM   6935 C C   . ARG B 1 364 ? 21.241  -7.195  -24.432 1.00 57.12 ? 364  ARG B C   1 
ATOM   6936 O O   . ARG B 1 364 ? 21.915  -6.751  -25.353 1.00 57.34 ? 364  ARG B O   1 
ATOM   6937 C CB  . ARG B 1 364 ? 22.563  -8.275  -22.649 1.00 59.32 ? 364  ARG B CB  1 
ATOM   6938 C CG  . ARG B 1 364 ? 23.074  -8.370  -21.212 1.00 62.10 ? 364  ARG B CG  1 
ATOM   6939 C CD  . ARG B 1 364 ? 23.619  -7.067  -20.649 1.00 63.63 ? 364  ARG B CD  1 
ATOM   6940 N NE  . ARG B 1 364 ? 24.671  -6.472  -21.478 1.00 64.37 ? 364  ARG B NE  1 
ATOM   6941 C CZ  . ARG B 1 364 ? 25.985  -6.650  -21.306 1.00 66.91 ? 364  ARG B CZ  1 
ATOM   6942 N NH1 . ARG B 1 364 ? 26.463  -7.436  -20.335 1.00 68.69 ? 364  ARG B NH1 1 
ATOM   6943 N NH2 . ARG B 1 364 ? 26.838  -6.027  -22.117 1.00 66.03 ? 364  ARG B NH2 1 
ATOM   6944 N N   . ILE B 1 365 ? 20.093  -7.849  -24.615 1.00 56.72 ? 365  ILE B N   1 
ATOM   6945 C CA  . ILE B 1 365 ? 19.475  -8.015  -25.935 1.00 56.05 ? 365  ILE B CA  1 
ATOM   6946 C C   . ILE B 1 365 ? 18.786  -6.727  -26.398 1.00 54.72 ? 365  ILE B C   1 
ATOM   6947 O O   . ILE B 1 365 ? 18.850  -6.365  -27.575 1.00 53.95 ? 365  ILE B O   1 
ATOM   6948 C CB  . ILE B 1 365 ? 18.439  -9.186  -25.935 1.00 56.75 ? 365  ILE B CB  1 
ATOM   6949 C CG1 . ILE B 1 365 ? 19.138  -10.522 -25.647 1.00 57.73 ? 365  ILE B CG1 1 
ATOM   6950 C CG2 . ILE B 1 365 ? 17.692  -9.276  -27.278 1.00 55.44 ? 365  ILE B CG2 1 
ATOM   6951 C CD1 . ILE B 1 365 ? 18.192  -11.610 -25.217 1.00 58.82 ? 365  ILE B CD1 1 
ATOM   6952 N N   . GLY B 1 366 ? 18.127  -6.050  -25.458 1.00 54.43 ? 366  GLY B N   1 
ATOM   6953 C CA  . GLY B 1 366 ? 17.396  -4.811  -25.725 1.00 53.46 ? 366  GLY B CA  1 
ATOM   6954 C C   . GLY B 1 366 ? 18.278  -3.586  -25.907 1.00 52.87 ? 366  GLY B C   1 
ATOM   6955 O O   . GLY B 1 366 ? 17.863  -2.612  -26.539 1.00 52.21 ? 366  GLY B O   1 
ATOM   6956 N N   . VAL B 1 367 ? 19.485  -3.620  -25.347 1.00 53.33 ? 367  VAL B N   1 
ATOM   6957 C CA  . VAL B 1 367 ? 20.458  -2.538  -25.514 1.00 52.86 ? 367  VAL B CA  1 
ATOM   6958 C C   . VAL B 1 367 ? 21.792  -3.159  -25.951 1.00 54.18 ? 367  VAL B C   1 
ATOM   6959 O O   . VAL B 1 367 ? 22.774  -3.120  -25.221 1.00 54.55 ? 367  VAL B O   1 
ATOM   6960 C CB  . VAL B 1 367 ? 20.610  -1.698  -24.202 1.00 53.17 ? 367  VAL B CB  1 
ATOM   6961 C CG1 . VAL B 1 367 ? 21.329  -0.367  -24.486 1.00 50.86 ? 367  VAL B CG1 1 
ATOM   6962 C CG2 . VAL B 1 367 ? 19.232  -1.433  -23.568 1.00 51.32 ? 367  VAL B CG2 1 
ATOM   6963 N N   . PRO B 1 368 ? 21.826  -3.728  -27.171 1.00 54.91 ? 368  PRO B N   1 
ATOM   6964 C CA  . PRO B 1 368 ? 22.894  -4.624  -27.621 1.00 55.97 ? 368  PRO B CA  1 
ATOM   6965 C C   . PRO B 1 368 ? 24.266  -3.987  -27.833 1.00 56.39 ? 368  PRO B C   1 
ATOM   6966 O O   . PRO B 1 368 ? 25.267  -4.695  -27.809 1.00 57.01 ? 368  PRO B O   1 
ATOM   6967 C CB  . PRO B 1 368 ? 22.348  -5.174  -28.944 1.00 55.69 ? 368  PRO B CB  1 
ATOM   6968 C CG  . PRO B 1 368 ? 21.467  -4.137  -29.434 1.00 54.69 ? 368  PRO B CG  1 
ATOM   6969 C CD  . PRO B 1 368 ? 20.815  -3.544  -28.222 1.00 54.38 ? 368  PRO B CD  1 
ATOM   6970 N N   . GLN B 1 369 ? 24.323  -2.675  -28.043 1.00 56.12 ? 369  GLN B N   1 
ATOM   6971 C CA  . GLN B 1 369 ? 25.624  -2.011  -28.186 1.00 56.33 ? 369  GLN B CA  1 
ATOM   6972 C C   . GLN B 1 369 ? 26.200  -1.573  -26.847 1.00 56.96 ? 369  GLN B C   1 
ATOM   6973 O O   . GLN B 1 369 ? 27.322  -1.067  -26.799 1.00 58.06 ? 369  GLN B O   1 
ATOM   6974 C CB  . GLN B 1 369 ? 25.540  -0.841  -29.166 1.00 55.74 ? 369  GLN B CB  1 
ATOM   6975 C CG  . GLN B 1 369 ? 25.581  -1.276  -30.662 1.00 55.76 ? 369  GLN B CG  1 
ATOM   6976 C CD  . GLN B 1 369 ? 24.325  -2.024  -31.114 1.00 55.18 ? 369  GLN B CD  1 
ATOM   6977 O OE1 . GLN B 1 369 ? 23.256  -1.433  -31.240 1.00 52.69 ? 369  GLN B OE1 1 
ATOM   6978 N NE2 . GLN B 1 369 ? 24.462  -3.322  -31.377 1.00 54.84 ? 369  GLN B NE2 1 
ATOM   6979 N N   . ALA B 1 370 ? 25.458  -1.800  -25.760 1.00 56.73 ? 370  ALA B N   1 
ATOM   6980 C CA  . ALA B 1 370 ? 25.875  -1.368  -24.424 1.00 56.83 ? 370  ALA B CA  1 
ATOM   6981 C C   . ALA B 1 370 ? 26.987  -2.248  -23.861 1.00 57.82 ? 370  ALA B C   1 
ATOM   6982 O O   . ALA B 1 370 ? 26.934  -3.478  -23.956 1.00 58.15 ? 370  ALA B O   1 
ATOM   6983 C CB  . ALA B 1 370 ? 24.668  -1.355  -23.451 1.00 56.17 ? 370  ALA B CB  1 
ATOM   6984 N N   . SER B 1 371 ? 27.984  -1.600  -23.264 1.00 58.02 ? 371  SER B N   1 
ATOM   6985 C CA  . SER B 1 371 ? 29.021  -2.287  -22.507 1.00 59.15 ? 371  SER B CA  1 
ATOM   6986 C C   . SER B 1 371 ? 28.434  -2.888  -21.240 1.00 59.14 ? 371  SER B C   1 
ATOM   6987 O O   . SER B 1 371 ? 27.296  -2.607  -20.885 1.00 58.14 ? 371  SER B O   1 
ATOM   6988 C CB  . SER B 1 371 ? 30.138  -1.312  -22.129 1.00 59.43 ? 371  SER B CB  1 
ATOM   6989 O OG  . SER B 1 371 ? 29.656  -0.310  -21.249 1.00 59.47 ? 371  SER B OG  1 
ATOM   6990 N N   . ASP B 1 372 ? 29.221  -3.714  -20.561 1.00 60.35 ? 372  ASP B N   1 
ATOM   6991 C CA  . ASP B 1 372 ? 28.807  -4.286  -19.289 1.00 60.96 ? 372  ASP B CA  1 
ATOM   6992 C C   . ASP B 1 372 ? 28.394  -3.168  -18.336 1.00 60.06 ? 372  ASP B C   1 
ATOM   6993 O O   . ASP B 1 372 ? 27.304  -3.223  -17.759 1.00 60.01 ? 372  ASP B O   1 
ATOM   6994 C CB  . ASP B 1 372 ? 29.941  -5.106  -18.660 1.00 62.76 ? 372  ASP B CB  1 
ATOM   6995 C CG  . ASP B 1 372 ? 30.222  -6.410  -19.409 1.00 64.94 ? 372  ASP B CG  1 
ATOM   6996 O OD1 . ASP B 1 372 ? 29.612  -6.660  -20.476 1.00 65.99 ? 372  ASP B OD1 1 
ATOM   6997 O OD2 . ASP B 1 372 ? 31.062  -7.193  -18.914 1.00 68.46 ? 372  ASP B OD2 1 
ATOM   6998 N N   . LEU B 1 373 ? 29.248  -2.152  -18.192 1.00 59.30 ? 373  LEU B N   1 
ATOM   6999 C CA  . LEU B 1 373 ? 28.977  -1.038  -17.271 1.00 58.67 ? 373  LEU B CA  1 
ATOM   7000 C C   . LEU B 1 373 ? 27.726  -0.244  -17.649 1.00 57.24 ? 373  LEU B C   1 
ATOM   7001 O O   . LEU B 1 373 ? 26.921  0.098   -16.781 1.00 56.65 ? 373  LEU B O   1 
ATOM   7002 C CB  . LEU B 1 373 ? 30.182  -0.097  -17.194 1.00 59.20 ? 373  LEU B CB  1 
ATOM   7003 C CG  . LEU B 1 373 ? 30.141  1.062   -16.182 1.00 59.15 ? 373  LEU B CG  1 
ATOM   7004 C CD1 . LEU B 1 373 ? 29.867  0.598   -14.743 1.00 59.23 ? 373  LEU B CD1 1 
ATOM   7005 C CD2 . LEU B 1 373 ? 31.447  1.855   -16.250 1.00 59.47 ? 373  LEU B CD2 1 
ATOM   7006 N N   . ALA B 1 374 ? 27.566  0.048   -18.940 1.00 56.43 ? 374  ALA B N   1 
ATOM   7007 C CA  . ALA B 1 374 ? 26.385  0.769   -19.421 1.00 55.42 ? 374  ALA B CA  1 
ATOM   7008 C C   . ALA B 1 374 ? 25.119  -0.023  -19.133 1.00 55.03 ? 374  ALA B C   1 
ATOM   7009 O O   . ALA B 1 374 ? 24.100  0.547   -18.746 1.00 54.15 ? 374  ALA B O   1 
ATOM   7010 C CB  . ALA B 1 374 ? 26.487  1.063   -20.915 1.00 54.70 ? 374  ALA B CB  1 
ATOM   7011 N N   . ALA B 1 375 ? 25.188  -1.334  -19.338 1.00 55.58 ? 375  ALA B N   1 
ATOM   7012 C CA  . ALA B 1 375 ? 24.049  -2.206  -19.086 1.00 55.82 ? 375  ALA B CA  1 
ATOM   7013 C C   . ALA B 1 375 ? 23.718  -2.210  -17.596 1.00 56.64 ? 375  ALA B C   1 
ATOM   7014 O O   . ALA B 1 375 ? 22.554  -2.139  -17.224 1.00 56.24 ? 375  ALA B O   1 
ATOM   7015 C CB  . ALA B 1 375 ? 24.327  -3.616  -19.595 1.00 56.38 ? 375  ALA B CB  1 
ATOM   7016 N N   . GLU B 1 376 ? 24.743  -2.268  -16.746 1.00 58.15 ? 376  GLU B N   1 
ATOM   7017 C CA  . GLU B 1 376 ? 24.548  -2.139  -15.295 1.00 59.46 ? 376  GLU B CA  1 
ATOM   7018 C C   . GLU B 1 376 ? 23.874  -0.814  -14.940 1.00 57.45 ? 376  GLU B C   1 
ATOM   7019 O O   . GLU B 1 376 ? 22.974  -0.782  -14.112 1.00 57.58 ? 376  GLU B O   1 
ATOM   7020 C CB  . GLU B 1 376 ? 25.875  -2.289  -14.531 1.00 60.30 ? 376  GLU B CB  1 
ATOM   7021 C CG  . GLU B 1 376 ? 26.327  -3.739  -14.413 1.00 64.20 ? 376  GLU B CG  1 
ATOM   7022 C CD  . GLU B 1 376 ? 27.718  -3.893  -13.808 1.00 66.72 ? 376  GLU B CD  1 
ATOM   7023 O OE1 . GLU B 1 376 ? 28.713  -3.499  -14.466 1.00 73.26 ? 376  GLU B OE1 1 
ATOM   7024 O OE2 . GLU B 1 376 ? 27.823  -4.436  -12.682 1.00 73.24 ? 376  GLU B OE2 1 
ATOM   7025 N N   . ALA B 1 377 ? 24.300  0.275   -15.577 1.00 55.91 ? 377  ALA B N   1 
ATOM   7026 C CA  . ALA B 1 377 ? 23.654  1.569   -15.365 1.00 54.11 ? 377  ALA B CA  1 
ATOM   7027 C C   . ALA B 1 377 ? 22.178  1.508   -15.763 1.00 52.76 ? 377  ALA B C   1 
ATOM   7028 O O   . ALA B 1 377 ? 21.324  2.089   -15.086 1.00 52.49 ? 377  ALA B O   1 
ATOM   7029 C CB  . ALA B 1 377 ? 24.368  2.645   -16.124 1.00 53.21 ? 377  ALA B CB  1 
ATOM   7030 N N   . VAL B 1 378 ? 21.876  0.813   -16.857 1.00 51.69 ? 378  VAL B N   1 
ATOM   7031 C CA  . VAL B 1 378 ? 20.491  0.681   -17.314 1.00 50.78 ? 378  VAL B CA  1 
ATOM   7032 C C   . VAL B 1 378 ? 19.664  -0.093  -16.288 1.00 51.20 ? 378  VAL B C   1 
ATOM   7033 O O   . VAL B 1 378 ? 18.585  0.360   -15.900 1.00 50.91 ? 378  VAL B O   1 
ATOM   7034 C CB  . VAL B 1 378 ? 20.374  0.006   -18.725 1.00 50.42 ? 378  VAL B CB  1 
ATOM   7035 C CG1 . VAL B 1 378 ? 18.909  -0.280  -19.080 1.00 48.43 ? 378  VAL B CG1 1 
ATOM   7036 C CG2 . VAL B 1 378 ? 21.007  0.890   -19.792 1.00 49.08 ? 378  VAL B CG2 1 
ATOM   7037 N N   . VAL B 1 379 ? 20.187  -1.230  -15.833 1.00 52.08 ? 379  VAL B N   1 
ATOM   7038 C CA  . VAL B 1 379 ? 19.483  -2.076  -14.879 1.00 53.01 ? 379  VAL B CA  1 
ATOM   7039 C C   . VAL B 1 379 ? 19.214  -1.320  -13.587 1.00 53.98 ? 379  VAL B C   1 
ATOM   7040 O O   . VAL B 1 379 ? 18.124  -1.415  -13.016 1.00 54.12 ? 379  VAL B O   1 
ATOM   7041 C CB  . VAL B 1 379 ? 20.278  -3.378  -14.576 1.00 54.38 ? 379  VAL B CB  1 
ATOM   7042 C CG1 . VAL B 1 379 ? 19.748  -4.095  -13.336 1.00 52.94 ? 379  VAL B CG1 1 
ATOM   7043 C CG2 . VAL B 1 379 ? 20.246  -4.293  -15.786 1.00 54.19 ? 379  VAL B CG2 1 
ATOM   7044 N N   . LEU B 1 380 ? 20.196  -0.550  -13.139 1.00 54.83 ? 380  LEU B N   1 
ATOM   7045 C CA  . LEU B 1 380 ? 20.078  0.144   -11.872 1.00 55.74 ? 380  LEU B CA  1 
ATOM   7046 C C   . LEU B 1 380 ? 19.103  1.322   -11.965 1.00 55.28 ? 380  LEU B C   1 
ATOM   7047 O O   . LEU B 1 380 ? 18.404  1.634   -11.000 1.00 56.25 ? 380  LEU B O   1 
ATOM   7048 C CB  . LEU B 1 380 ? 21.465  0.578   -11.367 1.00 56.79 ? 380  LEU B CB  1 
ATOM   7049 C CG  . LEU B 1 380 ? 22.426  -0.567  -10.991 1.00 58.25 ? 380  LEU B CG  1 
ATOM   7050 C CD1 . LEU B 1 380 ? 23.772  -0.066  -10.467 1.00 59.64 ? 380  LEU B CD1 1 
ATOM   7051 C CD2 . LEU B 1 380 ? 21.803  -1.501  -9.967  1.00 60.67 ? 380  LEU B CD2 1 
ATOM   7052 N N   . HIS B 1 381 ? 19.045  1.964   -13.126 1.00 54.34 ? 381  HIS B N   1 
ATOM   7053 C CA  . HIS B 1 381 ? 18.115  3.069   -13.365 1.00 53.27 ? 381  HIS B CA  1 
ATOM   7054 C C   . HIS B 1 381 ? 16.660  2.621   -13.427 1.00 52.69 ? 381  HIS B C   1 
ATOM   7055 O O   . HIS B 1 381 ? 15.784  3.294   -12.893 1.00 52.37 ? 381  HIS B O   1 
ATOM   7056 C CB  . HIS B 1 381 ? 18.479  3.781   -14.678 1.00 52.67 ? 381  HIS B CB  1 
ATOM   7057 C CG  . HIS B 1 381 ? 17.583  4.933   -15.015 1.00 53.19 ? 381  HIS B CG  1 
ATOM   7058 N ND1 . HIS B 1 381 ? 17.833  6.224   -14.586 1.00 55.12 ? 381  HIS B ND1 1 
ATOM   7059 C CD2 . HIS B 1 381 ? 16.437  4.991   -15.738 1.00 52.49 ? 381  HIS B CD2 1 
ATOM   7060 C CE1 . HIS B 1 381 ? 16.873  7.021   -15.025 1.00 54.58 ? 381  HIS B CE1 1 
ATOM   7061 N NE2 . HIS B 1 381 ? 16.017  6.299   -15.731 1.00 53.08 ? 381  HIS B NE2 1 
ATOM   7062 N N   . TYR B 1 382 ? 16.410  1.500   -14.104 1.00 52.77 ? 382  TYR B N   1 
ATOM   7063 C CA  . TYR B 1 382 ? 15.049  1.019   -14.363 1.00 52.71 ? 382  TYR B CA  1 
ATOM   7064 C C   . TYR B 1 382 ? 14.494  0.063   -13.316 1.00 54.05 ? 382  TYR B C   1 
ATOM   7065 O O   . TYR B 1 382 ? 13.281  -0.179  -13.283 1.00 54.70 ? 382  TYR B O   1 
ATOM   7066 C CB  . TYR B 1 382 ? 14.968  0.355   -15.740 1.00 52.49 ? 382  TYR B CB  1 
ATOM   7067 C CG  . TYR B 1 382 ? 14.824  1.344   -16.876 1.00 51.06 ? 382  TYR B CG  1 
ATOM   7068 C CD1 . TYR B 1 382 ? 15.938  1.880   -17.501 1.00 50.35 ? 382  TYR B CD1 1 
ATOM   7069 C CD2 . TYR B 1 382 ? 13.573  1.750   -17.308 1.00 50.31 ? 382  TYR B CD2 1 
ATOM   7070 C CE1 . TYR B 1 382 ? 15.812  2.779   -18.544 1.00 49.76 ? 382  TYR B CE1 1 
ATOM   7071 C CE2 . TYR B 1 382 ? 13.434  2.651   -18.342 1.00 50.00 ? 382  TYR B CE2 1 
ATOM   7072 C CZ  . TYR B 1 382 ? 14.559  3.164   -18.961 1.00 50.02 ? 382  TYR B CZ  1 
ATOM   7073 O OH  . TYR B 1 382 ? 14.429  4.067   -19.999 1.00 49.31 ? 382  TYR B OH  1 
ATOM   7074 N N   . THR B 1 383 ? 15.361  -0.494  -12.477 1.00 54.93 ? 383  THR B N   1 
ATOM   7075 C CA  . THR B 1 383 ? 14.913  -1.212  -11.300 1.00 55.83 ? 383  THR B CA  1 
ATOM   7076 C C   . THR B 1 383 ? 14.169  -0.266  -10.359 1.00 56.51 ? 383  THR B C   1 
ATOM   7077 O O   . THR B 1 383 ? 14.637  0.836   -10.076 1.00 56.34 ? 383  THR B O   1 
ATOM   7078 C CB  . THR B 1 383 ? 16.098  -1.841  -10.563 1.00 56.64 ? 383  THR B CB  1 
ATOM   7079 O OG1 . THR B 1 383 ? 16.719  -2.801  -11.424 1.00 56.28 ? 383  THR B OG1 1 
ATOM   7080 C CG2 . THR B 1 383 ? 15.657  -2.511  -9.254  1.00 56.79 ? 383  THR B CG2 1 
ATOM   7081 N N   . ASP B 1 384 ? 12.992  -0.695  -9.914  1.00 57.87 ? 384  ASP B N   1 
ATOM   7082 C CA  . ASP B 1 384 ? 12.291  -0.062  -8.802  1.00 59.15 ? 384  ASP B CA  1 
ATOM   7083 C C   . ASP B 1 384 ? 12.844  -0.674  -7.527  1.00 60.29 ? 384  ASP B C   1 
ATOM   7084 O O   . ASP B 1 384 ? 12.517  -1.807  -7.187  1.00 60.73 ? 384  ASP B O   1 
ATOM   7085 C CB  . ASP B 1 384 ? 10.776  -0.295  -8.880  1.00 59.55 ? 384  ASP B CB  1 
ATOM   7086 C CG  . ASP B 1 384 ? 10.012  0.437   -7.776  1.00 61.75 ? 384  ASP B CG  1 
ATOM   7087 O OD1 . ASP B 1 384 ? 10.515  0.505   -6.637  1.00 63.19 ? 384  ASP B OD1 1 
ATOM   7088 O OD2 . ASP B 1 384 ? 8.907   0.955   -8.051  1.00 65.24 ? 384  ASP B OD2 1 
ATOM   7089 N N   . TRP B 1 385 ? 13.673  0.084   -6.818  1.00 60.49 ? 385  TRP B N   1 
ATOM   7090 C CA  . TRP B 1 385 ? 14.382  -0.458  -5.657  1.00 62.12 ? 385  TRP B CA  1 
ATOM   7091 C C   . TRP B 1 385 ? 13.493  -0.670  -4.425  1.00 63.77 ? 385  TRP B C   1 
ATOM   7092 O O   . TRP B 1 385 ? 13.926  -1.262  -3.434  1.00 65.05 ? 385  TRP B O   1 
ATOM   7093 C CB  . TRP B 1 385 ? 15.638  0.380   -5.361  1.00 61.44 ? 385  TRP B CB  1 
ATOM   7094 C CG  . TRP B 1 385 ? 16.642  0.143   -6.426  1.00 60.38 ? 385  TRP B CG  1 
ATOM   7095 C CD1 . TRP B 1 385 ? 16.953  0.967   -7.471  1.00 58.99 ? 385  TRP B CD1 1 
ATOM   7096 C CD2 . TRP B 1 385 ? 17.402  -1.052  -6.617  1.00 60.66 ? 385  TRP B CD2 1 
ATOM   7097 N NE1 . TRP B 1 385 ? 17.886  0.368   -8.284  1.00 58.49 ? 385  TRP B NE1 1 
ATOM   7098 C CE2 . TRP B 1 385 ? 18.186  -0.869  -7.776  1.00 59.85 ? 385  TRP B CE2 1 
ATOM   7099 C CE3 . TRP B 1 385 ? 17.511  -2.254  -5.910  1.00 61.88 ? 385  TRP B CE3 1 
ATOM   7100 C CZ2 . TRP B 1 385 ? 19.064  -1.845  -8.245  1.00 60.48 ? 385  TRP B CZ2 1 
ATOM   7101 C CZ3 . TRP B 1 385 ? 18.386  -3.220  -6.373  1.00 62.18 ? 385  TRP B CZ3 1 
ATOM   7102 C CH2 . TRP B 1 385 ? 19.150  -3.010  -7.526  1.00 61.87 ? 385  TRP B CH2 1 
ATOM   7103 N N   . LEU B 1 386 ? 12.244  -0.223  -4.501  1.00 64.51 ? 386  LEU B N   1 
ATOM   7104 C CA  . LEU B 1 386 ? 11.226  -0.667  -3.545  1.00 66.39 ? 386  LEU B CA  1 
ATOM   7105 C C   . LEU B 1 386 ? 10.685  -2.060  -3.869  1.00 67.07 ? 386  LEU B C   1 
ATOM   7106 O O   . LEU B 1 386 ? 10.326  -2.802  -2.971  1.00 68.49 ? 386  LEU B O   1 
ATOM   7107 C CB  . LEU B 1 386 ? 10.079  0.344   -3.470  1.00 66.35 ? 386  LEU B CB  1 
ATOM   7108 C CG  . LEU B 1 386 ? 10.376  1.455   -2.470  1.00 67.39 ? 386  LEU B CG  1 
ATOM   7109 C CD1 . LEU B 1 386 ? 9.555   2.706   -2.779  1.00 68.27 ? 386  LEU B CD1 1 
ATOM   7110 C CD2 . LEU B 1 386 ? 10.132  0.925   -1.059  1.00 69.26 ? 386  LEU B CD2 1 
ATOM   7111 N N   . HIS B 1 387 ? 10.629  -2.409  -5.152  1.00 66.99 ? 387  HIS B N   1 
ATOM   7112 C CA  . HIS B 1 387 ? 10.148  -3.719  -5.586  1.00 67.76 ? 387  HIS B CA  1 
ATOM   7113 C C   . HIS B 1 387 ? 11.103  -4.311  -6.631  1.00 67.18 ? 387  HIS B C   1 
ATOM   7114 O O   . HIS B 1 387 ? 10.710  -4.526  -7.778  1.00 66.55 ? 387  HIS B O   1 
ATOM   7115 C CB  . HIS B 1 387 ? 8.730   -3.598  -6.169  1.00 67.92 ? 387  HIS B CB  1 
ATOM   7116 C CG  . HIS B 1 387 ? 7.798   -2.775  -5.334  1.00 69.01 ? 387  HIS B CG  1 
ATOM   7117 N ND1 . HIS B 1 387 ? 7.485   -1.466  -5.641  1.00 69.66 ? 387  HIS B ND1 1 
ATOM   7118 C CD2 . HIS B 1 387 ? 7.120   -3.069  -4.198  1.00 71.35 ? 387  HIS B CD2 1 
ATOM   7119 C CE1 . HIS B 1 387 ? 6.653   -0.989  -4.730  1.00 70.20 ? 387  HIS B CE1 1 
ATOM   7120 N NE2 . HIS B 1 387 ? 6.414   -1.941  -3.845  1.00 71.42 ? 387  HIS B NE2 1 
ATOM   7121 N N   . PRO B 1 388 ? 12.365  -4.572  -6.237  1.00 67.36 ? 388  PRO B N   1 
ATOM   7122 C CA  . PRO B 1 388 ? 13.415  -4.978  -7.175  1.00 67.05 ? 388  PRO B CA  1 
ATOM   7123 C C   . PRO B 1 388 ? 13.218  -6.328  -7.862  1.00 67.52 ? 388  PRO B C   1 
ATOM   7124 O O   . PRO B 1 388 ? 13.764  -6.550  -8.945  1.00 66.48 ? 388  PRO B O   1 
ATOM   7125 C CB  . PRO B 1 388 ? 14.677  -5.002  -6.300  1.00 67.79 ? 388  PRO B CB  1 
ATOM   7126 C CG  . PRO B 1 388 ? 14.191  -5.170  -4.922  1.00 68.48 ? 388  PRO B CG  1 
ATOM   7127 C CD  . PRO B 1 388 ? 12.879  -4.468  -4.859  1.00 68.24 ? 388  PRO B CD  1 
ATOM   7128 N N   . GLU B 1 389 ? 12.455  -7.224  -7.250  1.00 68.84 ? 389  GLU B N   1 
ATOM   7129 C CA  . GLU B 1 389 ? 12.243  -8.548  -7.843  1.00 69.83 ? 389  GLU B CA  1 
ATOM   7130 C C   . GLU B 1 389 ? 10.788  -8.812  -8.229  1.00 69.31 ? 389  GLU B C   1 
ATOM   7131 O O   . GLU B 1 389 ? 10.443  -9.942  -8.566  1.00 69.77 ? 389  GLU B O   1 
ATOM   7132 C CB  . GLU B 1 389 ? 12.780  -9.635  -6.907  1.00 71.25 ? 389  GLU B CB  1 
ATOM   7133 C CG  . GLU B 1 389 ? 14.219  -9.366  -6.444  1.00 72.38 ? 389  GLU B CG  1 
ATOM   7134 C CD  . GLU B 1 389 ? 14.953  -10.620 -5.995  1.00 74.70 ? 389  GLU B CD  1 
ATOM   7135 O OE1 . GLU B 1 389 ? 15.239  -11.494 -6.862  1.00 77.72 ? 389  GLU B OE1 1 
ATOM   7136 O OE2 . GLU B 1 389 ? 15.251  -10.725 -4.778  1.00 77.61 ? 389  GLU B OE2 1 
ATOM   7137 N N   . ASP B 1 390 ? 9.945   -7.776  -8.210  1.00 68.24 ? 390  ASP B N   1 
ATOM   7138 C CA  . ASP B 1 390 ? 8.552   -7.924  -8.632  1.00 68.20 ? 390  ASP B CA  1 
ATOM   7139 C C   . ASP B 1 390 ? 8.458   -8.136  -10.154 1.00 67.29 ? 390  ASP B C   1 
ATOM   7140 O O   . ASP B 1 390 ? 8.889   -7.281  -10.930 1.00 66.00 ? 390  ASP B O   1 
ATOM   7141 C CB  . ASP B 1 390 ? 7.715   -6.715  -8.235  1.00 67.87 ? 390  ASP B CB  1 
ATOM   7142 C CG  . ASP B 1 390 ? 6.288   -6.809  -8.756  1.00 69.03 ? 390  ASP B CG  1 
ATOM   7143 O OD1 . ASP B 1 390 ? 5.539   -7.686  -8.275  1.00 71.82 ? 390  ASP B OD1 1 
ATOM   7144 O OD2 . ASP B 1 390 ? 5.926   -6.023  -9.662  1.00 68.57 ? 390  ASP B OD2 1 
ATOM   7145 N N   . PRO B 1 391 ? 7.895   -9.278  -10.584 1.00 67.90 ? 391  PRO B N   1 
ATOM   7146 C CA  . PRO B 1 391 ? 7.850   -9.603  -12.015 1.00 67.01 ? 391  PRO B CA  1 
ATOM   7147 C C   . PRO B 1 391 ? 7.067   -8.625  -12.896 1.00 65.37 ? 391  PRO B C   1 
ATOM   7148 O O   . PRO B 1 391 ? 7.474   -8.380  -14.030 1.00 64.37 ? 391  PRO B O   1 
ATOM   7149 C CB  . PRO B 1 391 ? 7.193   -10.987 -12.037 1.00 68.28 ? 391  PRO B CB  1 
ATOM   7150 C CG  . PRO B 1 391 ? 7.403   -11.534 -10.673 1.00 69.81 ? 391  PRO B CG  1 
ATOM   7151 C CD  . PRO B 1 391 ? 7.295   -10.354 -9.773  1.00 69.33 ? 391  PRO B CD  1 
ATOM   7152 N N   . THR B 1 392 ? 5.955   -8.092  -12.395 1.00 65.03 ? 392  THR B N   1 
ATOM   7153 C CA  . THR B 1 392 ? 5.183   -7.081  -13.129 1.00 63.95 ? 392  THR B CA  1 
ATOM   7154 C C   . THR B 1 392 ? 6.034   -5.831  -13.386 1.00 62.66 ? 392  THR B C   1 
ATOM   7155 O O   . THR B 1 392 ? 6.067   -5.319  -14.504 1.00 61.68 ? 392  THR B O   1 
ATOM   7156 C CB  . THR B 1 392 ? 3.885   -6.674  -12.368 1.00 64.44 ? 392  THR B CB  1 
ATOM   7157 O OG1 . THR B 1 392 ? 3.110   -7.846  -12.064 1.00 66.29 ? 392  THR B OG1 1 
ATOM   7158 C CG2 . THR B 1 392 ? 3.039   -5.719  -13.197 1.00 63.24 ? 392  THR B CG2 1 
ATOM   7159 N N   . HIS B 1 393 ? 6.712   -5.346  -12.345 1.00 62.68 ? 393  HIS B N   1 
ATOM   7160 C CA  . HIS B 1 393 ? 7.592   -4.177  -12.467 1.00 61.73 ? 393  HIS B CA  1 
ATOM   7161 C C   . HIS B 1 393 ? 8.705   -4.479  -13.469 1.00 60.25 ? 393  HIS B C   1 
ATOM   7162 O O   . HIS B 1 393 ? 9.012   -3.651  -14.324 1.00 58.60 ? 393  HIS B O   1 
ATOM   7163 C CB  . HIS B 1 393 ? 8.224   -3.791  -11.120 1.00 62.45 ? 393  HIS B CB  1 
ATOM   7164 C CG  . HIS B 1 393 ? 7.355   -2.937  -10.242 1.00 64.73 ? 393  HIS B CG  1 
ATOM   7165 N ND1 . HIS B 1 393 ? 6.382   -3.463  -9.415  1.00 67.87 ? 393  HIS B ND1 1 
ATOM   7166 C CD2 . HIS B 1 393 ? 7.362   -1.600  -10.005 1.00 66.24 ? 393  HIS B CD2 1 
ATOM   7167 C CE1 . HIS B 1 393 ? 5.809   -2.487  -8.728  1.00 67.26 ? 393  HIS B CE1 1 
ATOM   7168 N NE2 . HIS B 1 393 ? 6.386   -1.347  -9.065  1.00 66.82 ? 393  HIS B NE2 1 
ATOM   7169 N N   . LEU B 1 394 ? 9.293   -5.670  -13.357 1.00 60.03 ? 394  LEU B N   1 
ATOM   7170 C CA  . LEU B 1 394 ? 10.412  -6.056  -14.219 1.00 59.40 ? 394  LEU B CA  1 
ATOM   7171 C C   . LEU B 1 394 ? 9.984   -6.193  -15.689 1.00 58.42 ? 394  LEU B C   1 
ATOM   7172 O O   . LEU B 1 394 ? 10.694  -5.757  -16.596 1.00 57.30 ? 394  LEU B O   1 
ATOM   7173 C CB  . LEU B 1 394 ? 11.057  -7.348  -13.713 1.00 60.21 ? 394  LEU B CB  1 
ATOM   7174 C CG  . LEU B 1 394 ? 11.771  -7.236  -12.359 1.00 60.82 ? 394  LEU B CG  1 
ATOM   7175 C CD1 . LEU B 1 394 ? 12.123  -8.622  -11.803 1.00 60.69 ? 394  LEU B CD1 1 
ATOM   7176 C CD2 . LEU B 1 394 ? 13.016  -6.329  -12.444 1.00 58.73 ? 394  LEU B CD2 1 
ATOM   7177 N N   . ARG B 1 395 ? 8.812   -6.775  -15.911 1.00 58.60 ? 395  ARG B N   1 
ATOM   7178 C CA  . ARG B 1 395 ? 8.241   -6.869  -17.259 1.00 57.93 ? 395  ARG B CA  1 
ATOM   7179 C C   . ARG B 1 395 ? 7.997   -5.477  -17.878 1.00 56.37 ? 395  ARG B C   1 
ATOM   7180 O O   . ARG B 1 395 ? 8.365   -5.235  -19.029 1.00 55.52 ? 395  ARG B O   1 
ATOM   7181 C CB  . ARG B 1 395 ? 6.955   -7.711  -17.225 1.00 58.68 ? 395  ARG B CB  1 
ATOM   7182 C CG  . ARG B 1 395 ? 6.136   -7.712  -18.525 1.00 58.82 ? 395  ARG B CG  1 
ATOM   7183 C CD  . ARG B 1 395 ? 4.842   -6.943  -18.340 1.00 60.34 ? 395  ARG B CD  1 
ATOM   7184 N NE  . ARG B 1 395 ? 3.782   -7.805  -17.849 1.00 61.79 ? 395  ARG B NE  1 
ATOM   7185 C CZ  . ARG B 1 395 ? 2.666   -7.390  -17.251 1.00 62.66 ? 395  ARG B CZ  1 
ATOM   7186 N NH1 . ARG B 1 395 ? 2.423   -6.103  -17.022 1.00 61.13 ? 395  ARG B NH1 1 
ATOM   7187 N NH2 . ARG B 1 395 ? 1.780   -8.295  -16.855 1.00 65.56 ? 395  ARG B NH2 1 
ATOM   7188 N N   . ASP B 1 396 ? 7.396   -4.574  -17.109 1.00 55.85 ? 396  ASP B N   1 
ATOM   7189 C CA  . ASP B 1 396 ? 7.113   -3.216  -17.593 1.00 55.24 ? 396  ASP B CA  1 
ATOM   7190 C C   . ASP B 1 396 ? 8.378   -2.351  -17.740 1.00 53.73 ? 396  ASP B C   1 
ATOM   7191 O O   . ASP B 1 396 ? 8.429   -1.468  -18.597 1.00 52.74 ? 396  ASP B O   1 
ATOM   7192 C CB  . ASP B 1 396 ? 6.083   -2.528  -16.690 1.00 55.63 ? 396  ASP B CB  1 
ATOM   7193 C CG  . ASP B 1 396 ? 4.725   -3.216  -16.726 1.00 58.53 ? 396  ASP B CG  1 
ATOM   7194 O OD1 . ASP B 1 396 ? 4.407   -3.846  -17.757 1.00 61.52 ? 396  ASP B OD1 1 
ATOM   7195 O OD2 . ASP B 1 396 ? 3.968   -3.118  -15.733 1.00 62.21 ? 396  ASP B OD2 1 
ATOM   7196 N N   . ALA B 1 397 ? 9.388   -2.617  -16.915 1.00 53.50 ? 397  ALA B N   1 
ATOM   7197 C CA  . ALA B 1 397 ? 10.681  -1.954  -17.037 1.00 53.11 ? 397  ALA B CA  1 
ATOM   7198 C C   . ALA B 1 397 ? 11.424  -2.384  -18.316 1.00 52.62 ? 397  ALA B C   1 
ATOM   7199 O O   . ALA B 1 397 ? 12.061  -1.564  -18.980 1.00 51.95 ? 397  ALA B O   1 
ATOM   7200 C CB  . ALA B 1 397 ? 11.544  -2.213  -15.789 1.00 53.17 ? 397  ALA B CB  1 
ATOM   7201 N N   . MET B 1 398 ? 11.337  -3.666  -18.654 1.00 53.33 ? 398  MET B N   1 
ATOM   7202 C CA  . MET B 1 398 ? 11.966  -4.193  -19.867 1.00 53.00 ? 398  MET B CA  1 
ATOM   7203 C C   . MET B 1 398 ? 11.394  -3.513  -21.112 1.00 51.83 ? 398  MET B C   1 
ATOM   7204 O O   . MET B 1 398 ? 12.137  -3.078  -21.986 1.00 51.17 ? 398  MET B O   1 
ATOM   7205 C CB  . MET B 1 398 ? 11.748  -5.705  -19.957 1.00 54.23 ? 398  MET B CB  1 
ATOM   7206 C CG  . MET B 1 398 ? 12.596  -6.427  -21.019 1.00 54.94 ? 398  MET B CG  1 
ATOM   7207 S SD  . MET B 1 398 ? 14.366  -6.275  -20.729 1.00 58.02 ? 398  MET B SD  1 
ATOM   7208 C CE  . MET B 1 398 ? 14.773  -4.908  -21.815 1.00 54.58 ? 398  MET B CE  1 
ATOM   7209 N N   . SER B 1 399 ? 10.068  -3.437  -21.181 1.00 51.56 ? 399  SER B N   1 
ATOM   7210 C CA  . SER B 1 399 ? 9.383   -2.691  -22.227 1.00 50.56 ? 399  SER B CA  1 
ATOM   7211 C C   . SER B 1 399 ? 9.871   -1.254  -22.289 1.00 49.40 ? 399  SER B C   1 
ATOM   7212 O O   . SER B 1 399 ? 10.256  -0.772  -23.355 1.00 48.67 ? 399  SER B O   1 
ATOM   7213 C CB  . SER B 1 399 ? 7.886   -2.680  -21.980 1.00 50.83 ? 399  SER B CB  1 
ATOM   7214 O OG  . SER B 1 399 ? 7.247   -1.843  -22.922 1.00 51.06 ? 399  SER B OG  1 
ATOM   7215 N N   . ALA B 1 400 ? 9.852   -0.590  -21.135 1.00 48.98 ? 400  ALA B N   1 
ATOM   7216 C CA  . ALA B 1 400 ? 10.309  0.799   -21.002 1.00 47.89 ? 400  ALA B CA  1 
ATOM   7217 C C   . ALA B 1 400 ? 11.719  1.011   -21.525 1.00 47.17 ? 400  ALA B C   1 
ATOM   7218 O O   . ALA B 1 400 ? 11.968  1.958   -22.272 1.00 47.14 ? 400  ALA B O   1 
ATOM   7219 C CB  . ALA B 1 400 ? 10.222  1.255   -19.541 1.00 47.88 ? 400  ALA B CB  1 
ATOM   7220 N N   . VAL B 1 401 ? 12.644  0.145   -21.136 1.00 47.43 ? 401  VAL B N   1 
ATOM   7221 C CA  . VAL B 1 401 ? 14.028  0.241   -21.613 1.00 47.37 ? 401  VAL B CA  1 
ATOM   7222 C C   . VAL B 1 401 ? 14.106  0.250   -23.154 1.00 47.24 ? 401  VAL B C   1 
ATOM   7223 O O   . VAL B 1 401 ? 14.828  1.061   -23.759 1.00 46.49 ? 401  VAL B O   1 
ATOM   7224 C CB  . VAL B 1 401 ? 14.888  -0.945  -21.075 1.00 48.26 ? 401  VAL B CB  1 
ATOM   7225 C CG1 . VAL B 1 401 ? 16.173  -1.092  -21.883 1.00 47.34 ? 401  VAL B CG1 1 
ATOM   7226 C CG2 . VAL B 1 401 ? 15.202  -0.762  -19.583 1.00 47.63 ? 401  VAL B CG2 1 
ATOM   7227 N N   . VAL B 1 402 ? 13.368  -0.667  -23.780 1.00 47.50 ? 402  VAL B N   1 
ATOM   7228 C CA  . VAL B 1 402 ? 13.417  -0.836  -25.234 1.00 47.27 ? 402  VAL B CA  1 
ATOM   7229 C C   . VAL B 1 402 ? 12.746  0.359   -25.933 1.00 46.80 ? 402  VAL B C   1 
ATOM   7230 O O   . VAL B 1 402 ? 13.286  0.888   -26.908 1.00 46.31 ? 402  VAL B O   1 
ATOM   7231 C CB  . VAL B 1 402 ? 12.809  -2.220  -25.653 1.00 48.18 ? 402  VAL B CB  1 
ATOM   7232 C CG1 . VAL B 1 402 ? 12.583  -2.328  -27.189 1.00 47.21 ? 402  VAL B CG1 1 
ATOM   7233 C CG2 . VAL B 1 402 ? 13.710  -3.356  -25.138 1.00 47.67 ? 402  VAL B CG2 1 
ATOM   7234 N N   . GLY B 1 403 ? 11.609  0.815   -25.404 1.00 46.53 ? 403  GLY B N   1 
ATOM   7235 C CA  . GLY B 1 403 ? 10.916  1.980   -25.962 1.00 45.97 ? 403  GLY B CA  1 
ATOM   7236 C C   . GLY B 1 403 ? 11.659  3.308   -25.818 1.00 45.68 ? 403  GLY B C   1 
ATOM   7237 O O   . GLY B 1 403 ? 11.696  4.122   -26.748 1.00 45.09 ? 403  GLY B O   1 
ATOM   7238 N N   . ASP B 1 404 ? 12.247  3.532   -24.649 1.00 45.74 ? 404  ASP B N   1 
ATOM   7239 C CA  . ASP B 1 404 ? 12.959  4.761   -24.376 1.00 45.34 ? 404  ASP B CA  1 
ATOM   7240 C C   . ASP B 1 404 ? 14.228  4.856   -25.215 1.00 44.78 ? 404  ASP B C   1 
ATOM   7241 O O   . ASP B 1 404 ? 14.488  5.869   -25.839 1.00 44.30 ? 404  ASP B O   1 
ATOM   7242 C CB  . ASP B 1 404 ? 13.318  4.831   -22.888 1.00 46.18 ? 404  ASP B CB  1 
ATOM   7243 C CG  . ASP B 1 404 ? 12.097  4.950   -21.998 1.00 46.72 ? 404  ASP B CG  1 
ATOM   7244 O OD1 . ASP B 1 404 ? 11.016  5.247   -22.536 1.00 46.26 ? 404  ASP B OD1 1 
ATOM   7245 O OD2 . ASP B 1 404 ? 12.225  4.764   -20.764 1.00 47.58 ? 404  ASP B OD2 1 
ATOM   7246 N N   . HIS B 1 405 ? 15.028  3.797   -25.178 1.00 44.84 ? 405  HIS B N   1 
ATOM   7247 C CA  . HIS B 1 405 ? 16.286  3.706   -25.922 1.00 44.73 ? 405  HIS B CA  1 
ATOM   7248 C C   . HIS B 1 405 ? 16.088  3.916   -27.428 1.00 44.07 ? 405  HIS B C   1 
ATOM   7249 O O   . HIS B 1 405 ? 16.834  4.663   -28.057 1.00 44.07 ? 405  HIS B O   1 
ATOM   7250 C CB  . HIS B 1 405 ? 16.908  2.330   -25.641 1.00 45.39 ? 405  HIS B CB  1 
ATOM   7251 C CG  . HIS B 1 405 ? 18.131  2.008   -26.449 1.00 46.07 ? 405  HIS B CG  1 
ATOM   7252 N ND1 . HIS B 1 405 ? 19.213  2.856   -26.551 1.00 46.19 ? 405  HIS B ND1 1 
ATOM   7253 C CD2 . HIS B 1 405 ? 18.461  0.889   -27.145 1.00 47.04 ? 405  HIS B CD2 1 
ATOM   7254 C CE1 . HIS B 1 405 ? 20.145  2.284   -27.297 1.00 47.87 ? 405  HIS B CE1 1 
ATOM   7255 N NE2 . HIS B 1 405 ? 19.717  1.087   -27.663 1.00 47.54 ? 405  HIS B NE2 1 
ATOM   7256 N N   . ASN B 1 406 ? 15.071  3.273   -27.990 1.00 43.43 ? 406  ASN B N   1 
ATOM   7257 C CA  . ASN B 1 406 ? 14.886  3.238   -29.426 1.00 43.60 ? 406  ASN B CA  1 
ATOM   7258 C C   . ASN B 1 406 ? 13.952  4.320   -29.982 1.00 43.20 ? 406  ASN B C   1 
ATOM   7259 O O   . ASN B 1 406 ? 14.124  4.727   -31.128 1.00 42.46 ? 406  ASN B O   1 
ATOM   7260 C CB  . ASN B 1 406 ? 14.386  1.859   -29.854 1.00 43.86 ? 406  ASN B CB  1 
ATOM   7261 C CG  . ASN B 1 406 ? 15.460  0.785   -29.740 1.00 45.02 ? 406  ASN B CG  1 
ATOM   7262 O OD1 . ASN B 1 406 ? 16.476  0.850   -30.419 1.00 45.33 ? 406  ASN B OD1 1 
ATOM   7263 N ND2 . ASN B 1 406 ? 15.230  -0.210  -28.885 1.00 44.31 ? 406  ASN B ND2 1 
ATOM   7264 N N   . VAL B 1 407 ? 12.977  4.777   -29.195 1.00 43.24 ? 407  VAL B N   1 
ATOM   7265 C CA  . VAL B 1 407 ? 11.987  5.756   -29.696 1.00 43.25 ? 407  VAL B CA  1 
ATOM   7266 C C   . VAL B 1 407 ? 11.806  7.018   -28.843 1.00 43.23 ? 407  VAL B C   1 
ATOM   7267 O O   . VAL B 1 407 ? 12.040  8.132   -29.332 1.00 43.66 ? 407  VAL B O   1 
ATOM   7268 C CB  . VAL B 1 407 ? 10.602  5.102   -29.924 1.00 43.43 ? 407  VAL B CB  1 
ATOM   7269 C CG1 . VAL B 1 407 ? 9.639   6.114   -30.553 1.00 42.84 ? 407  VAL B CG1 1 
ATOM   7270 C CG2 . VAL B 1 407 ? 10.741  3.867   -30.803 1.00 42.97 ? 407  VAL B CG2 1 
ATOM   7271 N N   . VAL B 1 408 ? 11.403  6.872   -27.584 1.00 43.43 ? 408  VAL B N   1 
ATOM   7272 C CA  . VAL B 1 408 ? 10.988  8.047   -26.802 1.00 43.15 ? 408  VAL B CA  1 
ATOM   7273 C C   . VAL B 1 408 ? 12.109  9.053   -26.669 1.00 43.70 ? 408  VAL B C   1 
ATOM   7274 O O   . VAL B 1 408 ? 11.920  10.243  -26.901 1.00 43.88 ? 408  VAL B O   1 
ATOM   7275 C CB  . VAL B 1 408 ? 10.439  7.683   -25.390 1.00 43.89 ? 408  VAL B CB  1 
ATOM   7276 C CG1 . VAL B 1 408 ? 9.922   8.948   -24.661 1.00 42.30 ? 408  VAL B CG1 1 
ATOM   7277 C CG2 . VAL B 1 408 ? 9.332   6.630   -25.502 1.00 41.79 ? 408  VAL B CG2 1 
ATOM   7278 N N   . CYS B 1 409 ? 13.294  8.583   -26.312 1.00 44.34 ? 409  CYS B N   1 
ATOM   7279 C CA  . CYS B 1 409 ? 14.378  9.494   -26.047 1.00 44.49 ? 409  CYS B CA  1 
ATOM   7280 C C   . CYS B 1 409 ? 14.993  10.069  -27.336 1.00 44.52 ? 409  CYS B C   1 
ATOM   7281 O O   . CYS B 1 409 ? 15.305  11.259  -27.381 1.00 45.06 ? 409  CYS B O   1 
ATOM   7282 C CB  . CYS B 1 409 ? 15.396  8.843   -25.104 1.00 45.25 ? 409  CYS B CB  1 
ATOM   7283 S SG  . CYS B 1 409 ? 14.714  8.562   -23.400 1.00 45.95 ? 409  CYS B SG  1 
ATOM   7284 N N   . PRO B 1 410 ? 15.188  9.242   -28.379 1.00 44.22 ? 410  PRO B N   1 
ATOM   7285 C CA  . PRO B 1 410 ? 15.508  9.819   -29.687 1.00 43.96 ? 410  PRO B CA  1 
ATOM   7286 C C   . PRO B 1 410 ? 14.507  10.876  -30.166 1.00 43.62 ? 410  PRO B C   1 
ATOM   7287 O O   . PRO B 1 410 ? 14.924  11.917  -30.697 1.00 43.17 ? 410  PRO B O   1 
ATOM   7288 C CB  . PRO B 1 410 ? 15.517  8.602   -30.617 1.00 44.37 ? 410  PRO B CB  1 
ATOM   7289 C CG  . PRO B 1 410 ? 15.927  7.450   -29.704 1.00 44.59 ? 410  PRO B CG  1 
ATOM   7290 C CD  . PRO B 1 410 ? 15.246  7.768   -28.390 1.00 44.50 ? 410  PRO B CD  1 
ATOM   7291 N N   . VAL B 1 411 ? 13.213  10.636  -29.959 1.00 43.41 ? 411  VAL B N   1 
ATOM   7292 C CA  . VAL B 1 411 ? 12.182  11.649  -30.280 1.00 43.44 ? 411  VAL B CA  1 
ATOM   7293 C C   . VAL B 1 411 ? 12.349  12.930  -29.439 1.00 44.39 ? 411  VAL B C   1 
ATOM   7294 O O   . VAL B 1 411 ? 12.290  14.045  -29.976 1.00 44.81 ? 411  VAL B O   1 
ATOM   7295 C CB  . VAL B 1 411 ? 10.720  11.094  -30.151 1.00 43.88 ? 411  VAL B CB  1 
ATOM   7296 C CG1 . VAL B 1 411 ? 9.700   12.239  -30.094 1.00 42.84 ? 411  VAL B CG1 1 
ATOM   7297 C CG2 . VAL B 1 411 ? 10.393  10.135  -31.304 1.00 40.82 ? 411  VAL B CG2 1 
ATOM   7298 N N   . ALA B 1 412 ? 12.577  12.780  -28.136 1.00 44.56 ? 412  ALA B N   1 
ATOM   7299 C CA  . ALA B 1 412 ? 12.774  13.935  -27.260 1.00 44.76 ? 412  ALA B CA  1 
ATOM   7300 C C   . ALA B 1 412 ? 13.984  14.731  -27.735 1.00 45.08 ? 412  ALA B C   1 
ATOM   7301 O O   . ALA B 1 412 ? 13.953  15.956  -27.788 1.00 45.26 ? 412  ALA B O   1 
ATOM   7302 C CB  . ALA B 1 412 ? 12.947  13.510  -25.796 1.00 44.25 ? 412  ALA B CB  1 
ATOM   7303 N N   . GLN B 1 413 ? 15.036  14.024  -28.111 1.00 45.37 ? 413  GLN B N   1 
ATOM   7304 C CA  . GLN B 1 413 ? 16.239  14.672  -28.593 1.00 46.23 ? 413  GLN B CA  1 
ATOM   7305 C C   . GLN B 1 413 ? 16.026  15.474  -29.868 1.00 45.50 ? 413  GLN B C   1 
ATOM   7306 O O   . GLN B 1 413 ? 16.463  16.623  -29.963 1.00 45.99 ? 413  GLN B O   1 
ATOM   7307 C CB  . GLN B 1 413 ? 17.347  13.652  -28.818 1.00 47.03 ? 413  GLN B CB  1 
ATOM   7308 C CG  . GLN B 1 413 ? 18.577  14.303  -29.396 1.00 51.27 ? 413  GLN B CG  1 
ATOM   7309 C CD  . GLN B 1 413 ? 19.837  13.737  -28.839 1.00 57.99 ? 413  GLN B CD  1 
ATOM   7310 O OE1 . GLN B 1 413 ? 20.419  14.304  -27.903 1.00 62.37 ? 413  GLN B OE1 1 
ATOM   7311 N NE2 . GLN B 1 413 ? 20.270  12.596  -29.388 1.00 60.73 ? 413  GLN B NE2 1 
ATOM   7312 N N   . LEU B 1 414 ? 15.388  14.855  -30.855 1.00 44.79 ? 414  LEU B N   1 
ATOM   7313 C CA  . LEU B 1 414 ? 15.064  15.523  -32.113 1.00 44.40 ? 414  LEU B CA  1 
ATOM   7314 C C   . LEU B 1 414 ? 14.162  16.728  -31.873 1.00 44.55 ? 414  LEU B C   1 
ATOM   7315 O O   . LEU B 1 414 ? 14.424  17.818  -32.375 1.00 45.08 ? 414  LEU B O   1 
ATOM   7316 C CB  . LEU B 1 414 ? 14.370  14.539  -33.062 1.00 43.98 ? 414  LEU B CB  1 
ATOM   7317 C CG  . LEU B 1 414 ? 14.000  15.025  -34.469 1.00 44.00 ? 414  LEU B CG  1 
ATOM   7318 C CD1 . LEU B 1 414 ? 15.245  15.343  -35.279 1.00 43.56 ? 414  LEU B CD1 1 
ATOM   7319 C CD2 . LEU B 1 414 ? 13.163  13.979  -35.176 1.00 43.61 ? 414  LEU B CD2 1 
ATOM   7320 N N   . ALA B 1 415 ? 13.097  16.526  -31.107 1.00 44.76 ? 415  ALA B N   1 
ATOM   7321 C CA  . ALA B 1 415 ? 12.153  17.592  -30.794 1.00 45.40 ? 415  ALA B CA  1 
ATOM   7322 C C   . ALA B 1 415 ? 12.894  18.792  -30.270 1.00 46.67 ? 415  ALA B C   1 
ATOM   7323 O O   . ALA B 1 415 ? 12.680  19.899  -30.742 1.00 47.69 ? 415  ALA B O   1 
ATOM   7324 C CB  . ALA B 1 415 ? 11.126  17.128  -29.776 1.00 45.23 ? 415  ALA B CB  1 
ATOM   7325 N N   . GLY B 1 416 ? 13.790  18.570  -29.314 1.00 47.57 ? 416  GLY B N   1 
ATOM   7326 C CA  . GLY B 1 416 ? 14.515  19.671  -28.688 1.00 48.73 ? 416  GLY B CA  1 
ATOM   7327 C C   . GLY B 1 416 ? 15.456  20.409  -29.628 1.00 49.61 ? 416  GLY B C   1 
ATOM   7328 O O   . GLY B 1 416 ? 15.522  21.642  -29.593 1.00 50.38 ? 416  GLY B O   1 
ATOM   7329 N N   . ARG B 1 417 ? 16.192  19.664  -30.455 1.00 49.88 ? 417  ARG B N   1 
ATOM   7330 C CA  . ARG B 1 417 ? 17.127  20.265  -31.400 1.00 51.06 ? 417  ARG B CA  1 
ATOM   7331 C C   . ARG B 1 417 ? 16.388  20.996  -32.525 1.00 50.89 ? 417  ARG B C   1 
ATOM   7332 O O   . ARG B 1 417 ? 16.806  22.060  -32.939 1.00 51.40 ? 417  ARG B O   1 
ATOM   7333 C CB  . ARG B 1 417 ? 18.075  19.226  -32.011 1.00 51.40 ? 417  ARG B CB  1 
ATOM   7334 C CG  . ARG B 1 417 ? 19.014  18.493  -31.049 1.00 54.59 ? 417  ARG B CG  1 
ATOM   7335 C CD  . ARG B 1 417 ? 19.884  19.370  -30.140 1.00 60.63 ? 417  ARG B CD  1 
ATOM   7336 N NE  . ARG B 1 417 ? 20.777  20.282  -30.863 1.00 64.64 ? 417  ARG B NE  1 
ATOM   7337 C CZ  . ARG B 1 417 ? 21.976  20.713  -30.428 1.00 68.16 ? 417  ARG B CZ  1 
ATOM   7338 N NH1 . ARG B 1 417 ? 22.496  20.301  -29.265 1.00 70.14 ? 417  ARG B NH1 1 
ATOM   7339 N NH2 . ARG B 1 417 ? 22.688  21.552  -31.179 1.00 67.68 ? 417  ARG B NH2 1 
ATOM   7340 N N   . LEU B 1 418 ? 15.303  20.419  -33.030 1.00 50.73 ? 418  LEU B N   1 
ATOM   7341 C CA  . LEU B 1 418 ? 14.497  21.089  -34.051 1.00 50.97 ? 418  LEU B CA  1 
ATOM   7342 C C   . LEU B 1 418 ? 13.969  22.434  -33.544 1.00 51.75 ? 418  LEU B C   1 
ATOM   7343 O O   . LEU B 1 418 ? 14.035  23.434  -34.259 1.00 51.91 ? 418  LEU B O   1 
ATOM   7344 C CB  . LEU B 1 418 ? 13.333  20.205  -34.500 1.00 50.19 ? 418  LEU B CB  1 
ATOM   7345 C CG  . LEU B 1 418 ? 13.666  18.999  -35.379 1.00 49.98 ? 418  LEU B CG  1 
ATOM   7346 C CD1 . LEU B 1 418 ? 12.410  18.200  -35.687 1.00 46.05 ? 418  LEU B CD1 1 
ATOM   7347 C CD2 . LEU B 1 418 ? 14.377  19.418  -36.670 1.00 50.02 ? 418  LEU B CD2 1 
ATOM   7348 N N   . ALA B 1 419 ? 13.456  22.448  -32.311 1.00 52.23 ? 419  ALA B N   1 
ATOM   7349 C CA  . ALA B 1 419 ? 12.926  23.662  -31.693 1.00 53.34 ? 419  ALA B CA  1 
ATOM   7350 C C   . ALA B 1 419 ? 14.015  24.707  -31.440 1.00 54.95 ? 419  ALA B C   1 
ATOM   7351 O O   . ALA B 1 419 ? 13.831  25.876  -31.753 1.00 56.29 ? 419  ALA B O   1 
ATOM   7352 C CB  . ALA B 1 419 ? 12.223  23.320  -30.393 1.00 53.06 ? 419  ALA B CB  1 
ATOM   7353 N N   . ALA B 1 420 ? 15.144  24.286  -30.873 1.00 55.76 ? 420  ALA B N   1 
ATOM   7354 C CA  . ALA B 1 420 ? 16.277  25.187  -30.613 1.00 57.05 ? 420  ALA B CA  1 
ATOM   7355 C C   . ALA B 1 420 ? 16.799  25.834  -31.901 1.00 58.19 ? 420  ALA B C   1 
ATOM   7356 O O   . ALA B 1 420 ? 17.218  26.995  -31.896 1.00 59.71 ? 420  ALA B O   1 
ATOM   7357 C CB  . ALA B 1 420 ? 17.418  24.433  -29.902 1.00 56.65 ? 420  ALA B CB  1 
ATOM   7358 N N   . GLN B 1 421 ? 16.761  25.088  -33.000 1.00 58.20 ? 421  GLN B N   1 
ATOM   7359 C CA  . GLN B 1 421 ? 17.272  25.572  -34.272 1.00 58.89 ? 421  GLN B CA  1 
ATOM   7360 C C   . GLN B 1 421 ? 16.194  26.106  -35.209 1.00 58.38 ? 421  GLN B C   1 
ATOM   7361 O O   . GLN B 1 421 ? 16.346  26.079  -36.431 1.00 58.86 ? 421  GLN B O   1 
ATOM   7362 C CB  . GLN B 1 421 ? 18.135  24.486  -34.924 1.00 59.10 ? 421  GLN B CB  1 
ATOM   7363 C CG  . GLN B 1 421 ? 19.571  24.496  -34.342 1.00 61.92 ? 421  GLN B CG  1 
ATOM   7364 C CD  . GLN B 1 421 ? 19.998  23.156  -33.814 1.00 63.77 ? 421  GLN B CD  1 
ATOM   7365 O OE1 . GLN B 1 421 ? 20.369  23.014  -32.642 1.00 67.21 ? 421  GLN B OE1 1 
ATOM   7366 N NE2 . GLN B 1 421 ? 19.934  22.159  -34.663 1.00 64.94 ? 421  GLN B NE2 1 
ATOM   7367 N N   . GLY B 1 422 ? 15.106  26.601  -34.625 1.00 57.91 ? 422  GLY B N   1 
ATOM   7368 C CA  . GLY B 1 422 ? 14.151  27.448  -35.350 1.00 57.51 ? 422  GLY B CA  1 
ATOM   7369 C C   . GLY B 1 422 ? 12.893  26.799  -35.900 1.00 56.00 ? 422  GLY B C   1 
ATOM   7370 O O   . GLY B 1 422 ? 12.048  27.494  -36.448 1.00 56.53 ? 422  GLY B O   1 
ATOM   7371 N N   . ALA B 1 423 ? 12.757  25.484  -35.779 1.00 54.05 ? 423  ALA B N   1 
ATOM   7372 C CA  . ALA B 1 423 ? 11.541  24.813  -36.261 1.00 52.86 ? 423  ALA B CA  1 
ATOM   7373 C C   . ALA B 1 423 ? 10.345  25.028  -35.339 1.00 52.40 ? 423  ALA B C   1 
ATOM   7374 O O   . ALA B 1 423 ? 10.484  25.251  -34.143 1.00 52.16 ? 423  ALA B O   1 
ATOM   7375 C CB  . ALA B 1 423 ? 11.780  23.318  -36.451 1.00 51.37 ? 423  ALA B CB  1 
ATOM   7376 N N   . ARG B 1 424 ? 9.164   24.930  -35.924 1.00 52.38 ? 424  ARG B N   1 
ATOM   7377 C CA  . ARG B 1 424 ? 7.910   24.908  -35.186 1.00 52.74 ? 424  ARG B CA  1 
ATOM   7378 C C   . ARG B 1 424 ? 7.544   23.461  -34.920 1.00 50.09 ? 424  ARG B C   1 
ATOM   7379 O O   . ARG B 1 424 ? 7.261   22.699  -35.856 1.00 49.93 ? 424  ARG B O   1 
ATOM   7380 C CB  . ARG B 1 424 ? 6.839   25.585  -36.028 1.00 53.46 ? 424  ARG B CB  1 
ATOM   7381 C CG  . ARG B 1 424 ? 5.419   25.510  -35.506 1.00 55.96 ? 424  ARG B CG  1 
ATOM   7382 C CD  . ARG B 1 424 ? 4.514   26.352  -36.440 1.00 58.24 ? 424  ARG B CD  1 
ATOM   7383 N NE  . ARG B 1 424 ? 3.538   27.168  -35.729 1.00 63.53 ? 424  ARG B NE  1 
ATOM   7384 C CZ  . ARG B 1 424 ? 3.825   28.063  -34.779 1.00 63.73 ? 424  ARG B CZ  1 
ATOM   7385 N NH1 . ARG B 1 424 ? 2.844   28.724  -34.222 1.00 63.31 ? 424  ARG B NH1 1 
ATOM   7386 N NH2 . ARG B 1 424 ? 5.069   28.299  -34.366 1.00 66.06 ? 424  ARG B NH2 1 
ATOM   7387 N N   . VAL B 1 425 ? 7.538   23.080  -33.649 1.00 48.08 ? 425  VAL B N   1 
ATOM   7388 C CA  . VAL B 1 425 ? 7.372   21.679  -33.270 1.00 46.07 ? 425  VAL B CA  1 
ATOM   7389 C C   . VAL B 1 425 ? 6.123   21.483  -32.410 1.00 45.12 ? 425  VAL B C   1 
ATOM   7390 O O   . VAL B 1 425 ? 5.898   22.224  -31.474 1.00 44.83 ? 425  VAL B O   1 
ATOM   7391 C CB  . VAL B 1 425 ? 8.628   21.150  -32.500 1.00 45.49 ? 425  VAL B CB  1 
ATOM   7392 C CG1 . VAL B 1 425 ? 8.506   19.648  -32.204 1.00 44.10 ? 425  VAL B CG1 1 
ATOM   7393 C CG2 . VAL B 1 425 ? 9.896   21.445  -33.283 1.00 44.70 ? 425  VAL B CG2 1 
ATOM   7394 N N   . TYR B 1 426 ? 5.326   20.473  -32.742 1.00 44.05 ? 426  TYR B N   1 
ATOM   7395 C CA  . TYR B 1 426 ? 4.232   19.989  -31.879 1.00 43.60 ? 426  TYR B CA  1 
ATOM   7396 C C   . TYR B 1 426 ? 4.493   18.527  -31.524 1.00 43.13 ? 426  TYR B C   1 
ATOM   7397 O O   . TYR B 1 426 ? 4.925   17.752  -32.386 1.00 42.44 ? 426  TYR B O   1 
ATOM   7398 C CB  . TYR B 1 426 ? 2.891   20.104  -32.598 1.00 43.57 ? 426  TYR B CB  1 
ATOM   7399 C CG  . TYR B 1 426 ? 2.507   21.522  -32.919 1.00 43.68 ? 426  TYR B CG  1 
ATOM   7400 C CD1 . TYR B 1 426 ? 2.884   22.112  -34.120 1.00 43.59 ? 426  TYR B CD1 1 
ATOM   7401 C CD2 . TYR B 1 426 ? 1.781   22.282  -32.014 1.00 43.64 ? 426  TYR B CD2 1 
ATOM   7402 C CE1 . TYR B 1 426 ? 2.528   23.442  -34.419 1.00 43.10 ? 426  TYR B CE1 1 
ATOM   7403 C CE2 . TYR B 1 426 ? 1.423   23.611  -32.303 1.00 45.31 ? 426  TYR B CE2 1 
ATOM   7404 C CZ  . TYR B 1 426 ? 1.810   24.180  -33.498 1.00 44.71 ? 426  TYR B CZ  1 
ATOM   7405 O OH  . TYR B 1 426 ? 1.471   25.484  -33.767 1.00 45.17 ? 426  TYR B OH  1 
ATOM   7406 N N   . ALA B 1 427 ? 4.235   18.149  -30.271 1.00 43.08 ? 427  ALA B N   1 
ATOM   7407 C CA  . ALA B 1 427 ? 4.495   16.772  -29.812 1.00 42.87 ? 427  ALA B CA  1 
ATOM   7408 C C   . ALA B 1 427 ? 3.298   16.176  -29.093 1.00 43.59 ? 427  ALA B C   1 
ATOM   7409 O O   . ALA B 1 427 ? 2.491   16.904  -28.490 1.00 44.28 ? 427  ALA B O   1 
ATOM   7410 C CB  . ALA B 1 427 ? 5.746   16.702  -28.909 1.00 42.00 ? 427  ALA B CB  1 
ATOM   7411 N N   . TYR B 1 428 ? 3.205   14.845  -29.163 1.00 43.53 ? 428  TYR B N   1 
ATOM   7412 C CA  . TYR B 1 428 ? 2.103   14.095  -28.586 1.00 44.03 ? 428  TYR B CA  1 
ATOM   7413 C C   . TYR B 1 428 ? 2.560   12.765  -27.984 1.00 43.79 ? 428  TYR B C   1 
ATOM   7414 O O   . TYR B 1 428 ? 3.592   12.208  -28.355 1.00 42.99 ? 428  TYR B O   1 
ATOM   7415 C CB  . TYR B 1 428 ? 1.013   13.834  -29.640 1.00 44.35 ? 428  TYR B CB  1 
ATOM   7416 C CG  . TYR B 1 428 ? 1.443   12.868  -30.729 1.00 44.28 ? 428  TYR B CG  1 
ATOM   7417 C CD1 . TYR B 1 428 ? 1.346   11.491  -30.539 1.00 43.80 ? 428  TYR B CD1 1 
ATOM   7418 C CD2 . TYR B 1 428 ? 1.970   13.332  -31.942 1.00 43.51 ? 428  TYR B CD2 1 
ATOM   7419 C CE1 . TYR B 1 428 ? 1.764   10.599  -31.508 1.00 43.31 ? 428  TYR B CE1 1 
ATOM   7420 C CE2 . TYR B 1 428 ? 2.380   12.438  -32.938 1.00 43.30 ? 428  TYR B CE2 1 
ATOM   7421 C CZ  . TYR B 1 428 ? 2.276   11.072  -32.712 1.00 43.36 ? 428  TYR B CZ  1 
ATOM   7422 O OH  . TYR B 1 428 ? 2.697   10.158  -33.672 1.00 43.54 ? 428  TYR B OH  1 
ATOM   7423 N N   . ILE B 1 429 ? 1.772   12.279  -27.032 1.00 44.78 ? 429  ILE B N   1 
ATOM   7424 C CA  . ILE B 1 429 ? 1.772   10.868  -26.667 1.00 45.12 ? 429  ILE B CA  1 
ATOM   7425 C C   . ILE B 1 429 ? 0.388   10.306  -26.931 1.00 45.72 ? 429  ILE B C   1 
ATOM   7426 O O   . ILE B 1 429 ? -0.621  10.903  -26.530 1.00 46.23 ? 429  ILE B O   1 
ATOM   7427 C CB  . ILE B 1 429 ? 2.152   10.603  -25.183 1.00 45.66 ? 429  ILE B CB  1 
ATOM   7428 C CG1 . ILE B 1 429 ? 2.165   9.083   -24.930 1.00 45.67 ? 429  ILE B CG1 1 
ATOM   7429 C CG2 . ILE B 1 429 ? 1.202   11.327  -24.231 1.00 44.51 ? 429  ILE B CG2 1 
ATOM   7430 C CD1 . ILE B 1 429 ? 2.948   8.671   -23.707 1.00 46.15 ? 429  ILE B CD1 1 
ATOM   7431 N N   . PHE B 1 430 ? 0.354   9.160   -27.606 1.00 45.92 ? 430  PHE B N   1 
ATOM   7432 C CA  . PHE B 1 430 ? -0.880  8.488   -27.968 1.00 46.79 ? 430  PHE B CA  1 
ATOM   7433 C C   . PHE B 1 430 ? -1.131  7.350   -26.977 1.00 48.07 ? 430  PHE B C   1 
ATOM   7434 O O   . PHE B 1 430 ? -0.325  6.428   -26.875 1.00 47.20 ? 430  PHE B O   1 
ATOM   7435 C CB  . PHE B 1 430 ? -0.765  7.945   -29.391 1.00 46.53 ? 430  PHE B CB  1 
ATOM   7436 C CG  . PHE B 1 430 ? -2.029  7.326   -29.916 1.00 46.36 ? 430  PHE B CG  1 
ATOM   7437 C CD1 . PHE B 1 430 ? -2.286  5.979   -29.726 1.00 47.35 ? 430  PHE B CD1 1 
ATOM   7438 C CD2 . PHE B 1 430 ? -2.944  8.087   -30.626 1.00 47.07 ? 430  PHE B CD2 1 
ATOM   7439 C CE1 . PHE B 1 430 ? -3.448  5.394   -30.218 1.00 48.09 ? 430  PHE B CE1 1 
ATOM   7440 C CE2 . PHE B 1 430 ? -4.111  7.512   -31.129 1.00 49.16 ? 430  PHE B CE2 1 
ATOM   7441 C CZ  . PHE B 1 430 ? -4.371  6.168   -30.914 1.00 48.58 ? 430  PHE B CZ  1 
ATOM   7442 N N   . GLU B 1 431 ? -2.252  7.419   -26.260 1.00 49.61 ? 431  GLU B N   1 
ATOM   7443 C CA  . GLU B 1 431 ? -2.485  6.547   -25.108 1.00 51.39 ? 431  GLU B CA  1 
ATOM   7444 C C   . GLU B 1 431 ? -3.735  5.686   -25.187 1.00 52.62 ? 431  GLU B C   1 
ATOM   7445 O O   . GLU B 1 431 ? -4.090  5.030   -24.205 1.00 53.75 ? 431  GLU B O   1 
ATOM   7446 C CB  . GLU B 1 431 ? -2.597  7.385   -23.839 1.00 52.03 ? 431  GLU B CB  1 
ATOM   7447 C CG  . GLU B 1 431 ? -1.422  8.275   -23.546 1.00 51.43 ? 431  GLU B CG  1 
ATOM   7448 C CD  . GLU B 1 431 ? -1.541  8.889   -22.188 1.00 52.50 ? 431  GLU B CD  1 
ATOM   7449 O OE1 . GLU B 1 431 ? -2.638  9.416   -21.876 1.00 56.07 ? 431  GLU B OE1 1 
ATOM   7450 O OE2 . GLU B 1 431 ? -0.553  8.830   -21.423 1.00 54.41 ? 431  GLU B OE2 1 
ATOM   7451 N N   . HIS B 1 432 ? -4.414  5.688   -26.329 1.00 53.24 ? 432  HIS B N   1 
ATOM   7452 C CA  . HIS B 1 432 ? -5.626  4.917   -26.465 1.00 54.03 ? 432  HIS B CA  1 
ATOM   7453 C C   . HIS B 1 432 ? -5.336  3.542   -27.050 1.00 54.67 ? 432  HIS B C   1 
ATOM   7454 O O   . HIS B 1 432 ? -4.754  3.423   -28.129 1.00 53.61 ? 432  HIS B O   1 
ATOM   7455 C CB  . HIS B 1 432 ? -6.646  5.623   -27.340 1.00 54.26 ? 432  HIS B CB  1 
ATOM   7456 C CG  . HIS B 1 432 ? -7.841  4.778   -27.627 1.00 54.82 ? 432  HIS B CG  1 
ATOM   7457 N ND1 . HIS B 1 432 ? -8.764  4.452   -26.660 1.00 56.94 ? 432  HIS B ND1 1 
ATOM   7458 C CD2 . HIS B 1 432 ? -8.233  4.139   -28.755 1.00 54.99 ? 432  HIS B CD2 1 
ATOM   7459 C CE1 . HIS B 1 432 ? -9.693  3.672   -27.187 1.00 56.66 ? 432  HIS B CE1 1 
ATOM   7460 N NE2 . HIS B 1 432 ? -9.394  3.470   -28.457 1.00 55.54 ? 432  HIS B NE2 1 
ATOM   7461 N N   . ARG B 1 433 ? -5.782  2.511   -26.339 1.00 56.04 ? 433  ARG B N   1 
ATOM   7462 C CA  . ARG B 1 433 ? -5.626  1.137   -26.775 1.00 56.82 ? 433  ARG B CA  1 
ATOM   7463 C C   . ARG B 1 433 ? -6.878  0.716   -27.537 1.00 57.66 ? 433  ARG B C   1 
ATOM   7464 O O   . ARG B 1 433 ? -7.970  0.705   -26.979 1.00 58.10 ? 433  ARG B O   1 
ATOM   7465 C CB  . ARG B 1 433 ? -5.419  0.234   -25.562 1.00 57.45 ? 433  ARG B CB  1 
ATOM   7466 C CG  . ARG B 1 433 ? -5.056  -1.195  -25.929 1.00 58.76 ? 433  ARG B CG  1 
ATOM   7467 C CD  . ARG B 1 433 ? -5.054  -2.093  -24.712 1.00 59.52 ? 433  ARG B CD  1 
ATOM   7468 N NE  . ARG B 1 433 ? -5.507  -3.440  -25.043 1.00 60.87 ? 433  ARG B NE  1 
ATOM   7469 C CZ  . ARG B 1 433 ? -4.709  -4.472  -25.305 1.00 60.98 ? 433  ARG B CZ  1 
ATOM   7470 N NH1 . ARG B 1 433 ? -3.385  -4.353  -25.259 1.00 58.64 ? 433  ARG B NH1 1 
ATOM   7471 N NH2 . ARG B 1 433 ? -5.251  -5.654  -25.589 1.00 62.00 ? 433  ARG B NH2 1 
ATOM   7472 N N   . ALA B 1 434 ? -6.711  0.378   -28.815 1.00 57.73 ? 434  ALA B N   1 
ATOM   7473 C CA  . ALA B 1 434 ? -7.833  -0.020  -29.656 1.00 58.81 ? 434  ALA B CA  1 
ATOM   7474 C C   . ALA B 1 434 ? -8.657  -1.127  -28.995 1.00 60.48 ? 434  ALA B C   1 
ATOM   7475 O O   . ALA B 1 434 ? -8.110  -2.115  -28.488 1.00 60.72 ? 434  ALA B O   1 
ATOM   7476 C CB  . ALA B 1 434 ? -7.340  -0.462  -31.022 1.00 58.12 ? 434  ALA B CB  1 
ATOM   7477 N N   . SER B 1 435 ? -9.976  -0.950  -28.995 1.00 61.96 ? 435  SER B N   1 
ATOM   7478 C CA  . SER B 1 435 ? -10.894 -1.950  -28.458 1.00 63.66 ? 435  SER B CA  1 
ATOM   7479 C C   . SER B 1 435 ? -10.724 -3.297  -29.169 1.00 64.10 ? 435  SER B C   1 
ATOM   7480 O O   . SER B 1 435 ? -10.922 -4.356  -28.574 1.00 64.97 ? 435  SER B O   1 
ATOM   7481 C CB  . SER B 1 435 ? -12.349 -1.461  -28.554 1.00 64.66 ? 435  SER B CB  1 
ATOM   7482 O OG  . SER B 1 435 ? -12.744 -1.214  -29.897 1.00 64.88 ? 435  SER B OG  1 
ATOM   7483 N N   . THR B 1 436 ? -10.312 -3.238  -30.429 1.00 63.86 ? 436  THR B N   1 
ATOM   7484 C CA  . THR B 1 436 ? -10.171 -4.418  -31.282 1.00 64.57 ? 436  THR B CA  1 
ATOM   7485 C C   . THR B 1 436 ? -8.752  -5.022  -31.322 1.00 63.88 ? 436  THR B C   1 
ATOM   7486 O O   . THR B 1 436 ? -8.481  -5.897  -32.149 1.00 64.38 ? 436  THR B O   1 
ATOM   7487 C CB  . THR B 1 436 ? -10.577 -4.038  -32.709 1.00 64.45 ? 436  THR B CB  1 
ATOM   7488 O OG1 . THR B 1 436 ? -9.755  -2.944  -33.160 1.00 63.77 ? 436  THR B OG1 1 
ATOM   7489 C CG2 . THR B 1 436 ? -12.048 -3.609  -32.730 1.00 65.53 ? 436  THR B CG2 1 
ATOM   7490 N N   . LEU B 1 437 ? -7.859  -4.571  -30.436 1.00 63.18 ? 437  LEU B N   1 
ATOM   7491 C CA  . LEU B 1 437 ? -6.464  -5.039  -30.412 1.00 62.32 ? 437  LEU B CA  1 
ATOM   7492 C C   . LEU B 1 437 ? -6.410  -6.502  -30.010 1.00 63.06 ? 437  LEU B C   1 
ATOM   7493 O O   . LEU B 1 437 ? -7.080  -6.902  -29.059 1.00 64.25 ? 437  LEU B O   1 
ATOM   7494 C CB  . LEU B 1 437 ? -5.636  -4.209  -29.417 1.00 61.98 ? 437  LEU B CB  1 
ATOM   7495 C CG  . LEU B 1 437 ? -4.120  -4.136  -29.627 1.00 60.55 ? 437  LEU B CG  1 
ATOM   7496 C CD1 . LEU B 1 437 ? -3.788  -3.153  -30.722 1.00 59.89 ? 437  LEU B CD1 1 
ATOM   7497 C CD2 . LEU B 1 437 ? -3.429  -3.710  -28.354 1.00 60.68 ? 437  LEU B CD2 1 
ATOM   7498 N N   . THR B 1 438 ? -5.619  -7.297  -30.731 1.00 62.67 ? 438  THR B N   1 
ATOM   7499 C CA  . THR B 1 438 ? -5.547  -8.751  -30.500 1.00 63.57 ? 438  THR B CA  1 
ATOM   7500 C C   . THR B 1 438 ? -4.316  -9.155  -29.685 1.00 62.76 ? 438  THR B C   1 
ATOM   7501 O O   . THR B 1 438 ? -4.207  -10.300 -29.261 1.00 63.35 ? 438  THR B O   1 
ATOM   7502 C CB  . THR B 1 438 ? -5.566  -9.536  -31.836 1.00 63.83 ? 438  THR B CB  1 
ATOM   7503 O OG1 . THR B 1 438 ? -4.424  -9.183  -32.632 1.00 63.31 ? 438  THR B OG1 1 
ATOM   7504 C CG2 . THR B 1 438 ? -6.834  -9.219  -32.623 1.00 64.43 ? 438  THR B CG2 1 
ATOM   7505 N N   . TRP B 1 439 ? -3.392  -8.217  -29.467 1.00 61.18 ? 439  TRP B N   1 
ATOM   7506 C CA  . TRP B 1 439 ? -2.259  -8.453  -28.563 1.00 60.50 ? 439  TRP B CA  1 
ATOM   7507 C C   . TRP B 1 439 ? -2.762  -8.418  -27.125 1.00 60.84 ? 439  TRP B C   1 
ATOM   7508 O O   . TRP B 1 439 ? -3.787  -7.796  -26.846 1.00 61.45 ? 439  TRP B O   1 
ATOM   7509 C CB  . TRP B 1 439 ? -1.179  -7.394  -28.748 1.00 59.06 ? 439  TRP B CB  1 
ATOM   7510 C CG  . TRP B 1 439 ? -0.499  -7.408  -30.079 1.00 58.05 ? 439  TRP B CG  1 
ATOM   7511 C CD1 . TRP B 1 439 ? -0.758  -6.587  -31.135 1.00 57.53 ? 439  TRP B CD1 1 
ATOM   7512 C CD2 . TRP B 1 439 ? 0.587   -8.252  -30.488 1.00 57.26 ? 439  TRP B CD2 1 
ATOM   7513 N NE1 . TRP B 1 439 ? 0.086   -6.879  -32.178 1.00 56.65 ? 439  TRP B NE1 1 
ATOM   7514 C CE2 . TRP B 1 439 ? 0.926   -7.889  -31.802 1.00 56.59 ? 439  TRP B CE2 1 
ATOM   7515 C CE3 . TRP B 1 439 ? 1.306   -9.273  -29.868 1.00 58.46 ? 439  TRP B CE3 1 
ATOM   7516 C CZ2 . TRP B 1 439 ? 1.944   -8.517  -32.511 1.00 57.13 ? 439  TRP B CZ2 1 
ATOM   7517 C CZ3 . TRP B 1 439 ? 2.321   -9.892  -30.572 1.00 58.57 ? 439  TRP B CZ3 1 
ATOM   7518 C CH2 . TRP B 1 439 ? 2.627   -9.515  -31.881 1.00 57.77 ? 439  TRP B CH2 1 
ATOM   7519 N N   . PRO B 1 440 ? -2.054  -9.085  -26.202 1.00 60.73 ? 440  PRO B N   1 
ATOM   7520 C CA  . PRO B 1 440 ? -2.531  -9.110  -24.812 1.00 61.39 ? 440  PRO B CA  1 
ATOM   7521 C C   . PRO B 1 440 ? -2.452  -7.755  -24.110 1.00 60.60 ? 440  PRO B C   1 
ATOM   7522 O O   . PRO B 1 440 ? -1.742  -6.860  -24.571 1.00 59.12 ? 440  PRO B O   1 
ATOM   7523 C CB  . PRO B 1 440 ? -1.588  -10.111 -24.143 1.00 61.86 ? 440  PRO B CB  1 
ATOM   7524 C CG  . PRO B 1 440 ? -0.350  -10.025 -24.939 1.00 60.83 ? 440  PRO B CG  1 
ATOM   7525 C CD  . PRO B 1 440 ? -0.806  -9.844  -26.360 1.00 60.30 ? 440  PRO B CD  1 
ATOM   7526 N N   . LEU B 1 441 ? -3.161  -7.626  -22.990 1.00 61.39 ? 441  LEU B N   1 
ATOM   7527 C CA  . LEU B 1 441 ? -3.253  -6.359  -22.261 1.00 61.24 ? 441  LEU B CA  1 
ATOM   7528 C C   . LEU B 1 441 ? -1.907  -5.820  -21.780 1.00 60.01 ? 441  LEU B C   1 
ATOM   7529 O O   . LEU B 1 441 ? -1.693  -4.605  -21.771 1.00 58.89 ? 441  LEU B O   1 
ATOM   7530 C CB  . LEU B 1 441 ? -4.169  -6.492  -21.044 1.00 62.89 ? 441  LEU B CB  1 
ATOM   7531 C CG  . LEU B 1 441 ? -5.663  -6.740  -21.266 1.00 65.32 ? 441  LEU B CG  1 
ATOM   7532 C CD1 . LEU B 1 441 ? -6.322  -6.988  -19.909 1.00 68.17 ? 441  LEU B CD1 1 
ATOM   7533 C CD2 . LEU B 1 441 ? -6.321  -5.563  -21.984 1.00 66.47 ? 441  LEU B CD2 1 
ATOM   7534 N N   . TRP B 1 442 ? -1.010  -6.711  -21.363 1.00 59.73 ? 442  TRP B N   1 
ATOM   7535 C CA  . TRP B 1 442 ? 0.265   -6.270  -20.800 1.00 58.86 ? 442  TRP B CA  1 
ATOM   7536 C C   . TRP B 1 442 ? 1.076   -5.437  -21.797 1.00 57.04 ? 442  TRP B C   1 
ATOM   7537 O O   . TRP B 1 442 ? 1.872   -4.619  -21.390 1.00 56.30 ? 442  TRP B O   1 
ATOM   7538 C CB  . TRP B 1 442 ? 1.102   -7.447  -20.260 1.00 59.43 ? 442  TRP B CB  1 
ATOM   7539 C CG  . TRP B 1 442 ? 1.760   -8.325  -21.293 1.00 59.44 ? 442  TRP B CG  1 
ATOM   7540 C CD1 . TRP B 1 442 ? 1.315   -9.530  -21.745 1.00 60.34 ? 442  TRP B CD1 1 
ATOM   7541 C CD2 . TRP B 1 442 ? 2.992   -8.068  -21.984 1.00 58.61 ? 442  TRP B CD2 1 
ATOM   7542 N NE1 . TRP B 1 442 ? 2.185   -10.035 -22.678 1.00 60.11 ? 442  TRP B NE1 1 
ATOM   7543 C CE2 . TRP B 1 442 ? 3.221   -9.154  -22.844 1.00 58.61 ? 442  TRP B CE2 1 
ATOM   7544 C CE3 . TRP B 1 442 ? 3.920   -7.017  -21.961 1.00 57.63 ? 442  TRP B CE3 1 
ATOM   7545 C CZ2 . TRP B 1 442 ? 4.338   -9.225  -23.679 1.00 58.30 ? 442  TRP B CZ2 1 
ATOM   7546 C CZ3 . TRP B 1 442 ? 5.027   -7.087  -22.785 1.00 56.96 ? 442  TRP B CZ3 1 
ATOM   7547 C CH2 . TRP B 1 442 ? 5.228   -8.189  -23.635 1.00 57.38 ? 442  TRP B CH2 1 
ATOM   7548 N N   . MET B 1 443 ? 0.867   -5.649  -23.097 1.00 56.49 ? 443  MET B N   1 
ATOM   7549 C CA  . MET B 1 443 ? 1.598   -4.909  -24.129 1.00 55.05 ? 443  MET B CA  1 
ATOM   7550 C C   . MET B 1 443 ? 1.107   -3.460  -24.276 1.00 53.93 ? 443  MET B C   1 
ATOM   7551 O O   . MET B 1 443 ? 1.758   -2.643  -24.926 1.00 52.49 ? 443  MET B O   1 
ATOM   7552 C CB  . MET B 1 443 ? 1.516   -5.654  -25.464 1.00 54.93 ? 443  MET B CB  1 
ATOM   7553 C CG  . MET B 1 443 ? 2.252   -6.971  -25.426 1.00 55.71 ? 443  MET B CG  1 
ATOM   7554 S SD  . MET B 1 443 ? 2.321   -7.820  -27.013 1.00 56.81 ? 443  MET B SD  1 
ATOM   7555 C CE  . MET B 1 443 ? 3.327   -6.727  -27.990 1.00 54.98 ? 443  MET B CE  1 
ATOM   7556 N N   . GLY B 1 444 ? -0.050  -3.163  -23.690 1.00 54.41 ? 444  GLY B N   1 
ATOM   7557 C CA  . GLY B 1 444 ? -0.567  -1.801  -23.622 1.00 53.85 ? 444  GLY B CA  1 
ATOM   7558 C C   . GLY B 1 444 ? -0.960  -1.224  -24.970 1.00 53.12 ? 444  GLY B C   1 
ATOM   7559 O O   . GLY B 1 444 ? -1.786  -1.791  -25.668 1.00 53.74 ? 444  GLY B O   1 
ATOM   7560 N N   . VAL B 1 445 ? -0.385  -0.074  -25.314 1.00 52.28 ? 445  VAL B N   1 
ATOM   7561 C CA  . VAL B 1 445 ? -0.601  0.566   -26.607 1.00 51.42 ? 445  VAL B CA  1 
ATOM   7562 C C   . VAL B 1 445 ? 0.692   0.405   -27.388 1.00 50.66 ? 445  VAL B C   1 
ATOM   7563 O O   . VAL B 1 445 ? 1.599   1.184   -27.225 1.00 50.42 ? 445  VAL B O   1 
ATOM   7564 C CB  . VAL B 1 445 ? -0.930  2.067   -26.470 1.00 51.24 ? 445  VAL B CB  1 
ATOM   7565 C CG1 . VAL B 1 445 ? -1.266  2.671   -27.847 1.00 49.67 ? 445  VAL B CG1 1 
ATOM   7566 C CG2 . VAL B 1 445 ? -2.060  2.285   -25.465 1.00 50.69 ? 445  VAL B CG2 1 
ATOM   7567 N N   . PRO B 1 446 ? 0.792   -0.649  -28.212 1.00 50.99 ? 446  PRO B N   1 
ATOM   7568 C CA  . PRO B 1 446 ? 2.057   -0.944  -28.869 1.00 50.29 ? 446  PRO B CA  1 
ATOM   7569 C C   . PRO B 1 446 ? 2.406   -0.080  -30.077 1.00 49.60 ? 446  PRO B C   1 
ATOM   7570 O O   . PRO B 1 446 ? 1.557   0.612   -30.653 1.00 49.36 ? 446  PRO B O   1 
ATOM   7571 C CB  . PRO B 1 446 ? 1.897   -2.413  -29.301 1.00 50.91 ? 446  PRO B CB  1 
ATOM   7572 C CG  . PRO B 1 446 ? 0.609   -2.894  -28.659 1.00 52.06 ? 446  PRO B CG  1 
ATOM   7573 C CD  . PRO B 1 446 ? -0.218  -1.666  -28.534 1.00 51.63 ? 446  PRO B CD  1 
ATOM   7574 N N   . HIS B 1 447 ? 3.681   -0.153  -30.427 1.00 49.22 ? 447  HIS B N   1 
ATOM   7575 C CA  . HIS B 1 447 ? 4.267   0.464   -31.616 1.00 48.76 ? 447  HIS B CA  1 
ATOM   7576 C C   . HIS B 1 447 ? 3.416   0.146   -32.849 1.00 48.90 ? 447  HIS B C   1 
ATOM   7577 O O   . HIS B 1 447 ? 3.265   -1.010  -33.208 1.00 49.61 ? 447  HIS B O   1 
ATOM   7578 C CB  . HIS B 1 447 ? 5.673   -0.129  -31.762 1.00 48.79 ? 447  HIS B CB  1 
ATOM   7579 C CG  . HIS B 1 447 ? 6.563   0.571   -32.739 1.00 48.78 ? 447  HIS B CG  1 
ATOM   7580 N ND1 . HIS B 1 447 ? 7.060   1.832   -32.515 1.00 48.01 ? 447  HIS B ND1 1 
ATOM   7581 C CD2 . HIS B 1 447 ? 7.104   0.152   -33.909 1.00 47.87 ? 447  HIS B CD2 1 
ATOM   7582 C CE1 . HIS B 1 447 ? 7.846   2.176   -33.520 1.00 48.54 ? 447  HIS B CE1 1 
ATOM   7583 N NE2 . HIS B 1 447 ? 7.890   1.176   -34.378 1.00 47.42 ? 447  HIS B NE2 1 
ATOM   7584 N N   . GLY B 1 448 ? 2.831   1.176   -33.465 1.00 48.38 ? 448  GLY B N   1 
ATOM   7585 C CA  . GLY B 1 448 ? 2.083   1.018   -34.705 1.00 48.16 ? 448  GLY B CA  1 
ATOM   7586 C C   . GLY B 1 448 ? 0.574   1.150   -34.578 1.00 48.76 ? 448  GLY B C   1 
ATOM   7587 O O   . GLY B 1 448 ? -0.114  1.328   -35.591 1.00 48.90 ? 448  GLY B O   1 
ATOM   7588 N N   . TYR B 1 449 ? 0.046   1.080   -33.356 1.00 48.72 ? 449  TYR B N   1 
ATOM   7589 C CA  . TYR B 1 449 ? -1.415  0.973   -33.169 1.00 49.59 ? 449  TYR B CA  1 
ATOM   7590 C C   . TYR B 1 449 ? -2.176  2.300   -33.025 1.00 49.31 ? 449  TYR B C   1 
ATOM   7591 O O   . TYR B 1 449 ? -3.358  2.313   -32.709 1.00 49.82 ? 449  TYR B O   1 
ATOM   7592 C CB  . TYR B 1 449 ? -1.731  -0.058  -32.077 1.00 50.33 ? 449  TYR B CB  1 
ATOM   7593 C CG  . TYR B 1 449 ? -1.358  -1.413  -32.617 1.00 50.61 ? 449  TYR B CG  1 
ATOM   7594 C CD1 . TYR B 1 449 ? -0.082  -1.929  -32.441 1.00 49.50 ? 449  TYR B CD1 1 
ATOM   7595 C CD2 . TYR B 1 449 ? -2.247  -2.119  -33.412 1.00 52.03 ? 449  TYR B CD2 1 
ATOM   7596 C CE1 . TYR B 1 449 ? 0.277   -3.141  -32.986 1.00 51.54 ? 449  TYR B CE1 1 
ATOM   7597 C CE2 . TYR B 1 449 ? -1.899  -3.344  -33.965 1.00 52.90 ? 449  TYR B CE2 1 
ATOM   7598 C CZ  . TYR B 1 449 ? -0.636  -3.846  -33.754 1.00 52.08 ? 449  TYR B CZ  1 
ATOM   7599 O OH  . TYR B 1 449 ? -0.304  -5.058  -34.307 1.00 52.37 ? 449  TYR B OH  1 
ATOM   7600 N N   . GLU B 1 450 ? -1.494  3.399   -33.340 1.00 48.65 ? 450  GLU B N   1 
ATOM   7601 C CA  . GLU B 1 450 ? -2.141  4.688   -33.572 1.00 48.34 ? 450  GLU B CA  1 
ATOM   7602 C C   . GLU B 1 450 ? -2.556  4.858   -35.041 1.00 48.31 ? 450  GLU B C   1 
ATOM   7603 O O   . GLU B 1 450 ? -3.487  5.604   -35.349 1.00 47.65 ? 450  GLU B O   1 
ATOM   7604 C CB  . GLU B 1 450 ? -1.209  5.826   -33.135 1.00 48.13 ? 450  GLU B CB  1 
ATOM   7605 C CG  . GLU B 1 450 ? -0.179  6.314   -34.150 1.00 46.98 ? 450  GLU B CG  1 
ATOM   7606 C CD  . GLU B 1 450 ? 1.061   5.418   -34.289 1.00 46.78 ? 450  GLU B CD  1 
ATOM   7607 O OE1 . GLU B 1 450 ? 0.994   4.183   -34.051 1.00 43.39 ? 450  GLU B OE1 1 
ATOM   7608 O OE2 . GLU B 1 450 ? 2.113   5.982   -34.668 1.00 46.14 ? 450  GLU B OE2 1 
ATOM   7609 N N   . ILE B 1 451 ? -1.873  4.148   -35.942 1.00 48.14 ? 451  ILE B N   1 
ATOM   7610 C CA  . ILE B 1 451 ? -1.960  4.438   -37.371 1.00 48.02 ? 451  ILE B CA  1 
ATOM   7611 C C   . ILE B 1 451 ? -3.398  4.292   -37.848 1.00 49.13 ? 451  ILE B C   1 
ATOM   7612 O O   . ILE B 1 451 ? -3.926  5.165   -38.540 1.00 49.04 ? 451  ILE B O   1 
ATOM   7613 C CB  . ILE B 1 451 ? -1.029  3.514   -38.214 1.00 48.18 ? 451  ILE B CB  1 
ATOM   7614 C CG1 . ILE B 1 451 ? 0.453   3.749   -37.857 1.00 47.30 ? 451  ILE B CG1 1 
ATOM   7615 C CG2 . ILE B 1 451 ? -1.264  3.734   -39.725 1.00 46.92 ? 451  ILE B CG2 1 
ATOM   7616 C CD1 . ILE B 1 451 ? 1.394   2.676   -38.384 1.00 46.57 ? 451  ILE B CD1 1 
ATOM   7617 N N   . GLU B 1 452 ? -4.037  3.194   -37.454 1.00 50.16 ? 452  GLU B N   1 
ATOM   7618 C CA  . GLU B 1 452 ? -5.428  2.917   -37.861 1.00 51.47 ? 452  GLU B CA  1 
ATOM   7619 C C   . GLU B 1 452 ? -6.422  4.047   -37.520 1.00 51.39 ? 452  GLU B C   1 
ATOM   7620 O O   . GLU B 1 452 ? -7.426  4.230   -38.215 1.00 52.04 ? 452  GLU B O   1 
ATOM   7621 C CB  . GLU B 1 452 ? -5.899  1.571   -37.287 1.00 51.97 ? 452  GLU B CB  1 
ATOM   7622 C CG  . GLU B 1 452 ? -5.910  1.435   -35.739 1.00 53.93 ? 452  GLU B CG  1 
ATOM   7623 C CD  . GLU B 1 452 ? -5.878  -0.037  -35.296 1.00 55.36 ? 452  GLU B CD  1 
ATOM   7624 O OE1 . GLU B 1 452 ? -6.934  -0.574  -34.888 1.00 58.65 ? 452  GLU B OE1 1 
ATOM   7625 O OE2 . GLU B 1 452 ? -4.802  -0.671  -35.406 1.00 58.19 ? 452  GLU B OE2 1 
ATOM   7626 N N   . PHE B 1 453 ? -6.136  4.795   -36.457 1.00 51.00 ? 453  PHE B N   1 
ATOM   7627 C CA  . PHE B 1 453 ? -6.972  5.929   -36.041 1.00 51.13 ? 453  PHE B CA  1 
ATOM   7628 C C   . PHE B 1 453 ? -6.724  7.205   -36.854 1.00 50.53 ? 453  PHE B C   1 
ATOM   7629 O O   . PHE B 1 453 ? -7.676  7.906   -37.214 1.00 50.99 ? 453  PHE B O   1 
ATOM   7630 C CB  . PHE B 1 453 ? -6.767  6.201   -34.545 1.00 51.20 ? 453  PHE B CB  1 
ATOM   7631 C CG  . PHE B 1 453 ? -7.281  5.100   -33.666 1.00 51.13 ? 453  PHE B CG  1 
ATOM   7632 C CD1 . PHE B 1 453 ? -8.617  5.064   -33.291 1.00 52.88 ? 453  PHE B CD1 1 
ATOM   7633 C CD2 . PHE B 1 453 ? -6.441  4.096   -33.228 1.00 50.79 ? 453  PHE B CD2 1 
ATOM   7634 C CE1 . PHE B 1 453 ? -9.112  4.043   -32.485 1.00 53.40 ? 453  PHE B CE1 1 
ATOM   7635 C CE2 . PHE B 1 453 ? -6.930  3.057   -32.427 1.00 51.92 ? 453  PHE B CE2 1 
ATOM   7636 C CZ  . PHE B 1 453 ? -8.266  3.037   -32.055 1.00 52.97 ? 453  PHE B CZ  1 
ATOM   7637 N N   . ILE B 1 454 ? -5.452  7.503   -37.128 1.00 49.65 ? 454  ILE B N   1 
ATOM   7638 C CA  . ILE B 1 454 ? -5.057  8.654   -37.959 1.00 49.41 ? 454  ILE B CA  1 
ATOM   7639 C C   . ILE B 1 454 ? -5.623  8.522   -39.376 1.00 49.56 ? 454  ILE B C   1 
ATOM   7640 O O   . ILE B 1 454 ? -6.087  9.501   -39.958 1.00 49.77 ? 454  ILE B O   1 
ATOM   7641 C CB  . ILE B 1 454 ? -3.506  8.782   -38.083 1.00 48.82 ? 454  ILE B CB  1 
ATOM   7642 C CG1 . ILE B 1 454 ? -2.845  8.930   -36.715 1.00 49.65 ? 454  ILE B CG1 1 
ATOM   7643 C CG2 . ILE B 1 454 ? -3.114  9.944   -38.979 1.00 48.28 ? 454  ILE B CG2 1 
ATOM   7644 C CD1 . ILE B 1 454 ? -3.519  9.919   -35.853 1.00 53.09 ? 454  ILE B CD1 1 
ATOM   7645 N N   . PHE B 1 455 ? -5.574  7.309   -39.927 1.00 49.45 ? 455  PHE B N   1 
ATOM   7646 C CA  . PHE B 1 455 ? -6.126  7.036   -41.265 1.00 49.72 ? 455  PHE B CA  1 
ATOM   7647 C C   . PHE B 1 455 ? -7.652  6.968   -41.270 1.00 50.89 ? 455  PHE B C   1 
ATOM   7648 O O   . PHE B 1 455 ? -8.276  7.083   -42.325 1.00 51.42 ? 455  PHE B O   1 
ATOM   7649 C CB  . PHE B 1 455 ? -5.504  5.768   -41.871 1.00 48.92 ? 455  PHE B CB  1 
ATOM   7650 C CG  . PHE B 1 455 ? -4.199  6.027   -42.588 1.00 48.72 ? 455  PHE B CG  1 
ATOM   7651 C CD1 . PHE B 1 455 ? -2.990  6.049   -41.896 1.00 48.28 ? 455  PHE B CD1 1 
ATOM   7652 C CD2 . PHE B 1 455 ? -4.177  6.284   -43.945 1.00 48.29 ? 455  PHE B CD2 1 
ATOM   7653 C CE1 . PHE B 1 455 ? -1.785  6.299   -42.564 1.00 46.93 ? 455  PHE B CE1 1 
ATOM   7654 C CE2 . PHE B 1 455 ? -2.970  6.539   -44.610 1.00 47.54 ? 455  PHE B CE2 1 
ATOM   7655 C CZ  . PHE B 1 455 ? -1.786  6.546   -43.921 1.00 45.83 ? 455  PHE B CZ  1 
ATOM   7656 N N   . GLY B 1 456 ? -8.242  6.764   -40.095 1.00 51.64 ? 456  GLY B N   1 
ATOM   7657 C CA  . GLY B 1 456 ? -9.685  6.889   -39.912 1.00 52.86 ? 456  GLY B CA  1 
ATOM   7658 C C   . GLY B 1 456 ? -10.485 5.626   -40.162 1.00 53.74 ? 456  GLY B C   1 
ATOM   7659 O O   . GLY B 1 456 ? -11.654 5.691   -40.522 1.00 54.25 ? 456  GLY B O   1 
ATOM   7660 N N   . LEU B 1 457 ? -9.866  4.476   -39.926 1.00 53.96 ? 457  LEU B N   1 
ATOM   7661 C CA  . LEU B 1 457 ? -10.535 3.195   -40.112 1.00 54.98 ? 457  LEU B CA  1 
ATOM   7662 C C   . LEU B 1 457 ? -11.771 3.000   -39.217 1.00 57.06 ? 457  LEU B C   1 
ATOM   7663 O O   . LEU B 1 457 ? -12.750 2.386   -39.647 1.00 58.19 ? 457  LEU B O   1 
ATOM   7664 C CB  . LEU B 1 457 ? -9.554  2.042   -39.916 1.00 54.40 ? 457  LEU B CB  1 
ATOM   7665 C CG  . LEU B 1 457 ? -8.827  1.586   -41.187 1.00 53.68 ? 457  LEU B CG  1 
ATOM   7666 C CD1 . LEU B 1 457 ? -7.862  2.676   -41.726 1.00 50.92 ? 457  LEU B CD1 1 
ATOM   7667 C CD2 . LEU B 1 457 ? -8.114  0.300   -40.879 1.00 53.27 ? 457  LEU B CD2 1 
ATOM   7668 N N   . PRO B 1 458 ? -11.735 3.494   -37.971 1.00 57.63 ? 458  PRO B N   1 
ATOM   7669 C CA  . PRO B 1 458 ? -12.946 3.387   -37.147 1.00 59.62 ? 458  PRO B CA  1 
ATOM   7670 C C   . PRO B 1 458 ? -14.225 3.997   -37.738 1.00 61.66 ? 458  PRO B C   1 
ATOM   7671 O O   . PRO B 1 458 ? -15.312 3.700   -37.249 1.00 63.10 ? 458  PRO B O   1 
ATOM   7672 C CB  . PRO B 1 458 ? -12.544 4.094   -35.856 1.00 59.12 ? 458  PRO B CB  1 
ATOM   7673 C CG  . PRO B 1 458 ? -11.053 3.938   -35.799 1.00 57.31 ? 458  PRO B CG  1 
ATOM   7674 C CD  . PRO B 1 458 ? -10.613 4.073   -37.213 1.00 56.58 ? 458  PRO B CD  1 
ATOM   7675 N N   . LEU B 1 459 ? -14.104 4.816   -38.782 1.00 62.48 ? 459  LEU B N   1 
ATOM   7676 C CA  . LEU B 1 459 ? -15.271 5.352   -39.487 1.00 64.41 ? 459  LEU B CA  1 
ATOM   7677 C C   . LEU B 1 459 ? -15.989 4.315   -40.357 1.00 65.99 ? 459  LEU B C   1 
ATOM   7678 O O   . LEU B 1 459 ? -17.089 4.572   -40.836 1.00 67.54 ? 459  LEU B O   1 
ATOM   7679 C CB  . LEU B 1 459 ? -14.882 6.564   -40.341 1.00 63.88 ? 459  LEU B CB  1 
ATOM   7680 C CG  . LEU B 1 459 ? -14.753 7.894   -39.596 1.00 63.87 ? 459  LEU B CG  1 
ATOM   7681 C CD1 . LEU B 1 459 ? -13.685 7.839   -38.506 1.00 63.27 ? 459  LEU B CD1 1 
ATOM   7682 C CD2 . LEU B 1 459 ? -14.433 8.985   -40.600 1.00 63.58 ? 459  LEU B CD2 1 
ATOM   7683 N N   . ASP B 1 460 ? -15.359 3.162   -40.563 1.00 66.69 ? 460  ASP B N   1 
ATOM   7684 C CA  . ASP B 1 460 ? -15.964 2.027   -41.255 1.00 68.35 ? 460  ASP B CA  1 
ATOM   7685 C C   . ASP B 1 460 ? -16.723 1.154   -40.245 1.00 70.05 ? 460  ASP B C   1 
ATOM   7686 O O   . ASP B 1 460 ? -16.099 0.506   -39.401 1.00 69.74 ? 460  ASP B O   1 
ATOM   7687 C CB  . ASP B 1 460 ? -14.872 1.198   -41.950 1.00 67.18 ? 460  ASP B CB  1 
ATOM   7688 C CG  . ASP B 1 460 ? -15.443 0.123   -42.878 1.00 68.55 ? 460  ASP B CG  1 
ATOM   7689 O OD1 . ASP B 1 460 ? -16.662 -0.162  -42.803 1.00 70.56 ? 460  ASP B OD1 1 
ATOM   7690 O OD2 . ASP B 1 460 ? -14.665 -0.437  -43.687 1.00 67.65 ? 460  ASP B OD2 1 
ATOM   7691 N N   . PRO B 1 461 ? -18.072 1.116   -40.335 1.00 72.39 ? 461  PRO B N   1 
ATOM   7692 C CA  . PRO B 1 461 ? -18.871 0.383   -39.332 1.00 73.77 ? 461  PRO B CA  1 
ATOM   7693 C C   . PRO B 1 461 ? -18.638 -1.131  -39.321 1.00 74.40 ? 461  PRO B C   1 
ATOM   7694 O O   . PRO B 1 461 ? -18.852 -1.777  -38.287 1.00 75.23 ? 461  PRO B O   1 
ATOM   7695 C CB  . PRO B 1 461 ? -20.328 0.688   -39.728 1.00 75.54 ? 461  PRO B CB  1 
ATOM   7696 C CG  . PRO B 1 461 ? -20.258 1.846   -40.669 1.00 75.17 ? 461  PRO B CG  1 
ATOM   7697 C CD  . PRO B 1 461 ? -18.934 1.727   -41.364 1.00 73.43 ? 461  PRO B CD  1 
ATOM   7698 N N   . SER B 1 462 ? -18.198 -1.683  -40.453 1.00 74.10 ? 462  SER B N   1 
ATOM   7699 C CA  . SER B 1 462 ? -17.922 -3.116  -40.557 1.00 74.46 ? 462  SER B CA  1 
ATOM   7700 C C   . SER B 1 462 ? -16.764 -3.588  -39.680 1.00 73.57 ? 462  SER B C   1 
ATOM   7701 O O   . SER B 1 462 ? -16.659 -4.786  -39.417 1.00 74.32 ? 462  SER B O   1 
ATOM   7702 C CB  . SER B 1 462 ? -17.643 -3.506  -42.012 1.00 74.27 ? 462  SER B CB  1 
ATOM   7703 O OG  . SER B 1 462 ? -16.414 -2.969  -42.473 1.00 73.09 ? 462  SER B OG  1 
ATOM   7704 N N   . LEU B 1 463 ? -15.913 -2.660  -39.226 1.00 72.44 ? 463  LEU B N   1 
ATOM   7705 C CA  . LEU B 1 463 ? -14.693 -3.001  -38.481 1.00 71.28 ? 463  LEU B CA  1 
ATOM   7706 C C   . LEU B 1 463 ? -14.888 -3.061  -36.968 1.00 71.67 ? 463  LEU B C   1 
ATOM   7707 O O   . LEU B 1 463 ? -13.970 -3.450  -36.248 1.00 71.38 ? 463  LEU B O   1 
ATOM   7708 C CB  . LEU B 1 463 ? -13.568 -2.011  -38.815 1.00 69.66 ? 463  LEU B CB  1 
ATOM   7709 C CG  . LEU B 1 463 ? -13.136 -1.902  -40.280 1.00 68.99 ? 463  LEU B CG  1 
ATOM   7710 C CD1 . LEU B 1 463 ? -11.981 -0.919  -40.440 1.00 66.51 ? 463  LEU B CD1 1 
ATOM   7711 C CD2 . LEU B 1 463 ? -12.754 -3.269  -40.849 1.00 69.63 ? 463  LEU B CD2 1 
ATOM   7712 N N   . ASN B 1 464 ? -16.059 -2.649  -36.491 1.00 72.59 ? 464  ASN B N   1 
ATOM   7713 C CA  . ASN B 1 464 ? -16.481 -2.889  -35.102 1.00 73.46 ? 464  ASN B CA  1 
ATOM   7714 C C   . ASN B 1 464 ? -15.700 -2.134  -34.024 1.00 72.05 ? 464  ASN B C   1 
ATOM   7715 O O   . ASN B 1 464 ? -15.481 -2.661  -32.927 1.00 72.49 ? 464  ASN B O   1 
ATOM   7716 C CB  . ASN B 1 464 ? -16.465 -4.399  -34.776 1.00 74.63 ? 464  ASN B CB  1 
ATOM   7717 C CG  . ASN B 1 464 ? -17.334 -5.216  -35.723 1.00 77.15 ? 464  ASN B CG  1 
ATOM   7718 O OD1 . ASN B 1 464 ? -18.460 -4.830  -36.044 1.00 79.05 ? 464  ASN B OD1 1 
ATOM   7719 N ND2 . ASN B 1 464 ? -16.811 -6.360  -36.169 1.00 79.15 ? 464  ASN B ND2 1 
ATOM   7720 N N   . TYR B 1 465 ? -15.287 -0.902  -34.324 1.00 70.10 ? 465  TYR B N   1 
ATOM   7721 C CA  . TYR B 1 465 ? -14.761 -0.012  -33.300 1.00 68.53 ? 465  TYR B CA  1 
ATOM   7722 C C   . TYR B 1 465 ? -15.952 0.638   -32.604 1.00 69.15 ? 465  TYR B C   1 
ATOM   7723 O O   . TYR B 1 465 ? -17.043 0.697   -33.161 1.00 69.49 ? 465  TYR B O   1 
ATOM   7724 C CB  . TYR B 1 465 ? -13.908 1.096   -33.911 1.00 67.21 ? 465  TYR B CB  1 
ATOM   7725 C CG  . TYR B 1 465 ? -12.590 0.691   -34.538 1.00 65.44 ? 465  TYR B CG  1 
ATOM   7726 C CD1 . TYR B 1 465 ? -11.410 0.735   -33.809 1.00 64.47 ? 465  TYR B CD1 1 
ATOM   7727 C CD2 . TYR B 1 465 ? -12.517 0.324   -35.874 1.00 65.78 ? 465  TYR B CD2 1 
ATOM   7728 C CE1 . TYR B 1 465 ? -10.189 0.401   -34.387 1.00 63.44 ? 465  TYR B CE1 1 
ATOM   7729 C CE2 . TYR B 1 465 ? -11.301 -0.011  -36.466 1.00 65.34 ? 465  TYR B CE2 1 
ATOM   7730 C CZ  . TYR B 1 465 ? -10.137 0.035   -35.714 1.00 63.91 ? 465  TYR B CZ  1 
ATOM   7731 O OH  . TYR B 1 465 ? -8.929  -0.289  -36.293 1.00 62.74 ? 465  TYR B OH  1 
ATOM   7732 N N   . THR B 1 466 ? -15.723 1.163   -31.404 1.00 68.53 ? 466  THR B N   1 
ATOM   7733 C CA  . THR B 1 466 ? -16.769 1.847   -30.643 1.00 69.11 ? 466  THR B CA  1 
ATOM   7734 C C   . THR B 1 466 ? -17.100 3.220   -31.244 1.00 68.89 ? 466  THR B C   1 
ATOM   7735 O O   . THR B 1 466 ? -16.361 3.748   -32.079 1.00 67.47 ? 466  THR B O   1 
ATOM   7736 C CB  . THR B 1 466 ? -16.368 2.024   -29.151 1.00 69.01 ? 466  THR B CB  1 
ATOM   7737 O OG1 . THR B 1 466 ? -15.310 2.983   -29.033 1.00 66.45 ? 466  THR B OG1 1 
ATOM   7738 C CG2 . THR B 1 466 ? -15.921 0.693   -28.542 1.00 68.63 ? 466  THR B CG2 1 
ATOM   7739 N N   . THR B 1 467 ? -18.230 3.775   -30.819 1.00 70.03 ? 467  THR B N   1 
ATOM   7740 C CA  . THR B 1 467 ? -18.640 5.132   -31.189 1.00 70.17 ? 467  THR B CA  1 
ATOM   7741 C C   . THR B 1 467 ? -17.627 6.173   -30.714 1.00 68.95 ? 467  THR B C   1 
ATOM   7742 O O   . THR B 1 467 ? -17.315 7.131   -31.433 1.00 68.31 ? 467  THR B O   1 
ATOM   7743 C CB  . THR B 1 467 ? -20.026 5.455   -30.585 1.00 71.93 ? 467  THR B CB  1 
ATOM   7744 O OG1 . THR B 1 467 ? -21.030 4.815   -31.373 1.00 73.40 ? 467  THR B OG1 1 
ATOM   7745 C CG2 . THR B 1 467 ? -20.301 6.954   -30.558 1.00 72.27 ? 467  THR B CG2 1 
ATOM   7746 N N   . GLU B 1 468 ? -17.121 5.965   -29.502 1.00 68.47 ? 468  GLU B N   1 
ATOM   7747 C CA  . GLU B 1 468 ? -16.142 6.848   -28.891 1.00 67.40 ? 468  GLU B CA  1 
ATOM   7748 C C   . GLU B 1 468 ? -14.849 6.876   -29.743 1.00 65.28 ? 468  GLU B C   1 
ATOM   7749 O O   . GLU B 1 468 ? -14.273 7.933   -29.988 1.00 63.72 ? 468  GLU B O   1 
ATOM   7750 C CB  . GLU B 1 468 ? -15.850 6.386   -27.448 1.00 68.19 ? 468  GLU B CB  1 
ATOM   7751 C CG  . GLU B 1 468 ? -17.102 6.256   -26.522 1.00 72.84 ? 468  GLU B CG  1 
ATOM   7752 C CD  . GLU B 1 468 ? -17.790 4.866   -26.574 1.00 77.36 ? 468  GLU B CD  1 
ATOM   7753 O OE1 . GLU B 1 468 ? -18.865 4.744   -27.211 1.00 80.08 ? 468  GLU B OE1 1 
ATOM   7754 O OE2 . GLU B 1 468 ? -17.252 3.892   -25.989 1.00 79.31 ? 468  GLU B OE2 1 
ATOM   7755 N N   . GLU B 1 469 ? -14.431 5.700   -30.206 1.00 64.36 ? 469  GLU B N   1 
ATOM   7756 C CA  . GLU B 1 469 ? -13.252 5.546   -31.070 1.00 62.74 ? 469  GLU B CA  1 
ATOM   7757 C C   . GLU B 1 469 ? -13.394 6.218   -32.437 1.00 61.88 ? 469  GLU B C   1 
ATOM   7758 O O   . GLU B 1 469 ? -12.418 6.712   -33.007 1.00 60.79 ? 469  GLU B O   1 
ATOM   7759 C CB  . GLU B 1 469 ? -12.946 4.062   -31.261 1.00 62.27 ? 469  GLU B CB  1 
ATOM   7760 C CG  . GLU B 1 469 ? -12.237 3.463   -30.066 1.00 62.30 ? 469  GLU B CG  1 
ATOM   7761 C CD  . GLU B 1 469 ? -11.990 1.974   -30.197 1.00 62.75 ? 469  GLU B CD  1 
ATOM   7762 O OE1 . GLU B 1 469 ? -12.876 1.262   -30.710 1.00 63.59 ? 469  GLU B OE1 1 
ATOM   7763 O OE2 . GLU B 1 469 ? -10.911 1.510   -29.764 1.00 62.46 ? 469  GLU B OE2 1 
ATOM   7764 N N   . ARG B 1 470 ? -14.610 6.221   -32.959 1.00 62.21 ? 470  ARG B N   1 
ATOM   7765 C CA  . ARG B 1 470 ? -14.898 6.854   -34.225 1.00 62.03 ? 470  ARG B CA  1 
ATOM   7766 C C   . ARG B 1 470 ? -14.830 8.372   -34.105 1.00 60.76 ? 470  ARG B C   1 
ATOM   7767 O O   . ARG B 1 470 ? -14.288 9.036   -34.974 1.00 59.47 ? 470  ARG B O   1 
ATOM   7768 C CB  . ARG B 1 470 ? -16.264 6.395   -34.724 1.00 63.78 ? 470  ARG B CB  1 
ATOM   7769 C CG  . ARG B 1 470 ? -16.574 6.782   -36.147 1.00 66.87 ? 470  ARG B CG  1 
ATOM   7770 C CD  . ARG B 1 470 ? -17.596 7.908   -36.197 1.00 72.41 ? 470  ARG B CD  1 
ATOM   7771 N NE  . ARG B 1 470 ? -18.933 7.444   -35.807 1.00 75.65 ? 470  ARG B NE  1 
ATOM   7772 C CZ  . ARG B 1 470 ? -19.847 8.182   -35.171 1.00 78.31 ? 470  ARG B CZ  1 
ATOM   7773 N NH1 . ARG B 1 470 ? -19.593 9.449   -34.822 1.00 78.25 ? 470  ARG B NH1 1 
ATOM   7774 N NH2 . ARG B 1 470 ? -21.034 7.645   -34.872 1.00 79.96 ? 470  ARG B NH2 1 
ATOM   7775 N N   . ILE B 1 471 ? -15.372 8.912   -33.017 1.00 60.70 ? 471  ILE B N   1 
ATOM   7776 C CA  . ILE B 1 471 ? -15.261 10.347  -32.706 1.00 60.04 ? 471  ILE B CA  1 
ATOM   7777 C C   . ILE B 1 471 ? -13.800 10.752  -32.497 1.00 58.00 ? 471  ILE B C   1 
ATOM   7778 O O   . ILE B 1 471 ? -13.380 11.805  -32.950 1.00 57.40 ? 471  ILE B O   1 
ATOM   7779 C CB  . ILE B 1 471 ? -16.113 10.711  -31.460 1.00 61.11 ? 471  ILE B CB  1 
ATOM   7780 C CG1 . ILE B 1 471 ? -17.599 10.657  -31.811 1.00 62.59 ? 471  ILE B CG1 1 
ATOM   7781 C CG2 . ILE B 1 471 ? -15.746 12.077  -30.905 1.00 60.18 ? 471  ILE B CG2 1 
ATOM   7782 C CD1 . ILE B 1 471 ? -18.499 10.482  -30.590 1.00 64.57 ? 471  ILE B CD1 1 
ATOM   7783 N N   . PHE B 1 472 ? -13.045 9.890   -31.822 1.00 56.87 ? 472  PHE B N   1 
ATOM   7784 C CA  . PHE B 1 472 ? -11.615 10.078  -31.569 1.00 55.47 ? 472  PHE B CA  1 
ATOM   7785 C C   . PHE B 1 472 ? -10.799 10.094  -32.875 1.00 54.57 ? 472  PHE B C   1 
ATOM   7786 O O   . PHE B 1 472 ? -9.953  10.970  -33.070 1.00 53.40 ? 472  PHE B O   1 
ATOM   7787 C CB  . PHE B 1 472 ? -11.128 8.966   -30.616 1.00 55.22 ? 472  PHE B CB  1 
ATOM   7788 C CG  . PHE B 1 472 ? -9.652  9.007   -30.293 1.00 53.89 ? 472  PHE B CG  1 
ATOM   7789 C CD1 . PHE B 1 472 ? -9.046  10.178  -29.848 1.00 53.45 ? 472  PHE B CD1 1 
ATOM   7790 C CD2 . PHE B 1 472 ? -8.885  7.851   -30.379 1.00 53.47 ? 472  PHE B CD2 1 
ATOM   7791 C CE1 . PHE B 1 472 ? -7.699  10.202  -29.528 1.00 52.72 ? 472  PHE B CE1 1 
ATOM   7792 C CE2 . PHE B 1 472 ? -7.542  7.860   -30.061 1.00 52.43 ? 472  PHE B CE2 1 
ATOM   7793 C CZ  . PHE B 1 472 ? -6.942  9.042   -29.633 1.00 52.44 ? 472  PHE B CZ  1 
ATOM   7794 N N   . ALA B 1 473 ? -11.062 9.132   -33.761 1.00 54.28 ? 473  ALA B N   1 
ATOM   7795 C CA  . ALA B 1 473 ? -10.426 9.096   -35.081 1.00 53.55 ? 473  ALA B CA  1 
ATOM   7796 C C   . ALA B 1 473 ? -10.662 10.406  -35.841 1.00 54.08 ? 473  ALA B C   1 
ATOM   7797 O O   . ALA B 1 473 ? -9.730  10.985  -36.424 1.00 52.10 ? 473  ALA B O   1 
ATOM   7798 C CB  . ALA B 1 473 ? -10.954 7.920   -35.892 1.00 53.71 ? 473  ALA B CB  1 
ATOM   7799 N N   . GLN B 1 474 ? -11.916 10.860  -35.841 1.00 55.57 ? 474  GLN B N   1 
ATOM   7800 C CA  . GLN B 1 474 ? -12.279 12.100  -36.523 1.00 56.97 ? 474  GLN B CA  1 
ATOM   7801 C C   . GLN B 1 474 ? -11.448 13.266  -35.974 1.00 56.09 ? 474  GLN B C   1 
ATOM   7802 O O   . GLN B 1 474 ? -10.928 14.079  -36.741 1.00 55.74 ? 474  GLN B O   1 
ATOM   7803 C CB  . GLN B 1 474 ? -13.792 12.368  -36.407 1.00 58.48 ? 474  GLN B CB  1 
ATOM   7804 C CG  . GLN B 1 474 ? -14.633 11.360  -37.200 1.00 60.16 ? 474  GLN B CG  1 
ATOM   7805 C CD  . GLN B 1 474 ? -16.145 11.577  -37.100 1.00 62.86 ? 474  GLN B CD  1 
ATOM   7806 O OE1 . GLN B 1 474 ? -16.750 11.460  -36.027 1.00 66.71 ? 474  GLN B OE1 1 
ATOM   7807 N NE2 . GLN B 1 474 ? -16.769 11.860  -38.243 1.00 67.79 ? 474  GLN B NE2 1 
ATOM   7808 N N   . ARG B 1 475 ? -11.314 13.321  -34.650 1.00 55.83 ? 475  ARG B N   1 
ATOM   7809 C CA  . ARG B 1 475 ? -10.450 14.290  -33.992 1.00 55.44 ? 475  ARG B CA  1 
ATOM   7810 C C   . ARG B 1 475 ? -9.013  14.247  -34.524 1.00 53.63 ? 475  ARG B C   1 
ATOM   7811 O O   . ARG B 1 475 ? -8.428  15.289  -34.811 1.00 52.50 ? 475  ARG B O   1 
ATOM   7812 C CB  . ARG B 1 475 ? -10.407 14.052  -32.473 1.00 55.55 ? 475  ARG B CB  1 
ATOM   7813 C CG  . ARG B 1 475 ? -11.584 14.606  -31.690 1.00 58.33 ? 475  ARG B CG  1 
ATOM   7814 C CD  . ARG B 1 475 ? -11.406 14.377  -30.156 1.00 57.87 ? 475  ARG B CD  1 
ATOM   7815 N NE  . ARG B 1 475 ? -10.102 14.858  -29.700 1.00 57.26 ? 475  ARG B NE  1 
ATOM   7816 C CZ  . ARG B 1 475 ? -9.380  14.323  -28.719 1.00 55.34 ? 475  ARG B CZ  1 
ATOM   7817 N NH1 . ARG B 1 475 ? -9.818  13.280  -28.024 1.00 53.77 ? 475  ARG B NH1 1 
ATOM   7818 N NH2 . ARG B 1 475 ? -8.201  14.853  -28.422 1.00 54.60 ? 475  ARG B NH2 1 
ATOM   7819 N N   . LEU B 1 476 ? -8.453  13.041  -34.630 1.00 52.66 ? 476  LEU B N   1 
ATOM   7820 C CA  . LEU B 1 476 ? -7.052  12.865  -35.026 1.00 51.88 ? 476  LEU B CA  1 
ATOM   7821 C C   . LEU B 1 476 ? -6.818  13.231  -36.487 1.00 51.53 ? 476  LEU B C   1 
ATOM   7822 O O   . LEU B 1 476 ? -5.831  13.895  -36.826 1.00 50.22 ? 476  LEU B O   1 
ATOM   7823 C CB  . LEU B 1 476 ? -6.599  11.426  -34.765 1.00 51.63 ? 476  LEU B CB  1 
ATOM   7824 C CG  . LEU B 1 476 ? -6.595  11.011  -33.294 1.00 52.90 ? 476  LEU B CG  1 
ATOM   7825 C CD1 . LEU B 1 476 ? -6.280  9.540   -33.153 1.00 54.96 ? 476  LEU B CD1 1 
ATOM   7826 C CD2 . LEU B 1 476 ? -5.609  11.822  -32.510 1.00 52.11 ? 476  LEU B CD2 1 
ATOM   7827 N N   . MET B 1 477 ? -7.742  12.792  -37.340 1.00 52.23 ? 477  MET B N   1 
ATOM   7828 C CA  . MET B 1 477 ? -7.746  13.139  -38.750 1.00 52.86 ? 477  MET B CA  1 
ATOM   7829 C C   . MET B 1 477 ? -7.707  14.639  -38.933 1.00 52.69 ? 477  MET B C   1 
ATOM   7830 O O   . MET B 1 477 ? -7.035  15.132  -39.824 1.00 51.84 ? 477  MET B O   1 
ATOM   7831 C CB  . MET B 1 477 ? -8.999  12.583  -39.430 1.00 53.65 ? 477  MET B CB  1 
ATOM   7832 C CG  . MET B 1 477 ? -9.039  11.059  -39.539 1.00 54.95 ? 477  MET B CG  1 
ATOM   7833 S SD  . MET B 1 477 ? -10.593 10.447  -40.258 1.00 57.59 ? 477  MET B SD  1 
ATOM   7834 C CE  . MET B 1 477 ? -10.203 10.651  -41.986 1.00 55.08 ? 477  MET B CE  1 
ATOM   7835 N N   . LYS B 1 478 ? -8.444  15.352  -38.079 1.00 53.76 ? 478  LYS B N   1 
ATOM   7836 C CA  . LYS B 1 478 ? -8.469  16.812  -38.068 1.00 54.18 ? 478  LYS B CA  1 
ATOM   7837 C C   . LYS B 1 478 ? -7.161  17.440  -37.628 1.00 52.83 ? 478  LYS B C   1 
ATOM   7838 O O   . LYS B 1 478 ? -6.759  18.443  -38.206 1.00 52.70 ? 478  LYS B O   1 
ATOM   7839 C CB  . LYS B 1 478 ? -9.571  17.333  -37.144 1.00 55.98 ? 478  LYS B CB  1 
ATOM   7840 C CG  . LYS B 1 478 ? -10.824 17.751  -37.853 1.00 59.90 ? 478  LYS B CG  1 
ATOM   7841 C CD  . LYS B 1 478 ? -10.848 19.252  -38.157 1.00 62.98 ? 478  LYS B CD  1 
ATOM   7842 C CE  . LYS B 1 478 ? -12.164 19.639  -38.881 1.00 64.60 ? 478  LYS B CE  1 
ATOM   7843 N NZ  . LYS B 1 478 ? -12.266 19.086  -40.284 1.00 65.55 ? 478  LYS B NZ  1 
ATOM   7844 N N   . TYR B 1 479 ? -6.527  16.891  -36.585 1.00 51.29 ? 479  TYR B N   1 
ATOM   7845 C CA  . TYR B 1 479 ? -5.236  17.404  -36.116 1.00 50.10 ? 479  TYR B CA  1 
ATOM   7846 C C   . TYR B 1 479 ? -4.212  17.276  -37.238 1.00 48.85 ? 479  TYR B C   1 
ATOM   7847 O O   . TYR B 1 479 ? -3.504  18.224  -37.576 1.00 49.11 ? 479  TYR B O   1 
ATOM   7848 C CB  . TYR B 1 479 ? -4.711  16.618  -34.909 1.00 49.70 ? 479  TYR B CB  1 
ATOM   7849 C CG  . TYR B 1 479 ? -5.464  16.789  -33.606 1.00 50.59 ? 479  TYR B CG  1 
ATOM   7850 C CD1 . TYR B 1 479 ? -5.940  18.029  -33.199 1.00 51.57 ? 479  TYR B CD1 1 
ATOM   7851 C CD2 . TYR B 1 479 ? -5.649  15.708  -32.748 1.00 49.94 ? 479  TYR B CD2 1 
ATOM   7852 C CE1 . TYR B 1 479 ? -6.606  18.175  -31.995 1.00 52.70 ? 479  TYR B CE1 1 
ATOM   7853 C CE2 . TYR B 1 479 ? -6.323  15.843  -31.560 1.00 50.55 ? 479  TYR B CE2 1 
ATOM   7854 C CZ  . TYR B 1 479 ? -6.799  17.077  -31.188 1.00 51.91 ? 479  TYR B CZ  1 
ATOM   7855 O OH  . TYR B 1 479 ? -7.471  17.228  -30.006 1.00 52.99 ? 479  TYR B OH  1 
ATOM   7856 N N   . TRP B 1 480 ? -4.151  16.084  -37.811 1.00 47.81 ? 480  TRP B N   1 
ATOM   7857 C CA  . TRP B 1 480 ? -3.198  15.772  -38.881 1.00 46.66 ? 480  TRP B CA  1 
ATOM   7858 C C   . TRP B 1 480 ? -3.416  16.610  -40.145 1.00 46.68 ? 480  TRP B C   1 
ATOM   7859 O O   . TRP B 1 480 ? -2.455  17.126  -40.713 1.00 45.74 ? 480  TRP B O   1 
ATOM   7860 C CB  . TRP B 1 480 ? -3.257  14.279  -39.221 1.00 46.41 ? 480  TRP B CB  1 
ATOM   7861 C CG  . TRP B 1 480 ? -2.173  13.473  -38.553 1.00 45.21 ? 480  TRP B CG  1 
ATOM   7862 C CD1 . TRP B 1 480 ? -1.195  12.785  -39.168 1.00 44.80 ? 480  TRP B CD1 1 
ATOM   7863 C CD2 . TRP B 1 480 ? -1.960  13.306  -37.143 1.00 45.56 ? 480  TRP B CD2 1 
ATOM   7864 N NE1 . TRP B 1 480 ? -0.373  12.184  -38.242 1.00 45.12 ? 480  TRP B NE1 1 
ATOM   7865 C CE2 . TRP B 1 480 ? -0.817  12.496  -36.988 1.00 44.79 ? 480  TRP B CE2 1 
ATOM   7866 C CE3 . TRP B 1 480 ? -2.616  13.773  -35.998 1.00 45.84 ? 480  TRP B CE3 1 
ATOM   7867 C CZ2 . TRP B 1 480 ? -0.329  12.117  -35.739 1.00 44.78 ? 480  TRP B CZ2 1 
ATOM   7868 C CZ3 . TRP B 1 480 ? -2.123  13.408  -34.748 1.00 46.21 ? 480  TRP B CZ3 1 
ATOM   7869 C CH2 . TRP B 1 480 ? -0.992  12.588  -34.630 1.00 45.48 ? 480  TRP B CH2 1 
ATOM   7870 N N   . THR B 1 481 ? -4.669  16.749  -40.579 1.00 46.91 ? 481  THR B N   1 
ATOM   7871 C CA  . THR B 1 481 ? -4.957  17.512  -41.792 1.00 47.64 ? 481  THR B CA  1 
ATOM   7872 C C   . THR B 1 481 ? -4.855  19.014  -41.544 1.00 47.86 ? 481  THR B C   1 
ATOM   7873 O O   . THR B 1 481 ? -4.404  19.752  -42.409 1.00 47.89 ? 481  THR B O   1 
ATOM   7874 C CB  . THR B 1 481 ? -6.322  17.124  -42.415 1.00 48.25 ? 481  THR B CB  1 
ATOM   7875 O OG1 . THR B 1 481 ? -7.356  17.283  -41.442 1.00 50.64 ? 481  THR B OG1 1 
ATOM   7876 C CG2 . THR B 1 481 ? -6.300  15.662  -42.883 1.00 46.96 ? 481  THR B CG2 1 
ATOM   7877 N N   . ASN B 1 482 ? -5.237  19.465  -40.352 1.00 48.73 ? 482  ASN B N   1 
ATOM   7878 C CA  . ASN B 1 482 ? -5.022  20.869  -39.966 1.00 49.20 ? 482  ASN B CA  1 
ATOM   7879 C C   . ASN B 1 482 ? -3.555  21.205  -40.002 1.00 48.68 ? 482  ASN B C   1 
ATOM   7880 O O   . ASN B 1 482 ? -3.169  22.254  -40.518 1.00 48.94 ? 482  ASN B O   1 
ATOM   7881 C CB  . ASN B 1 482 ? -5.571  21.166  -38.572 1.00 49.73 ? 482  ASN B CB  1 
ATOM   7882 C CG  . ASN B 1 482 ? -7.064  21.424  -38.577 1.00 51.23 ? 482  ASN B CG  1 
ATOM   7883 O OD1 . ASN B 1 482 ? -7.621  21.874  -39.577 1.00 51.45 ? 482  ASN B OD1 1 
ATOM   7884 N ND2 . ASN B 1 482 ? -7.717  21.162  -37.443 1.00 53.89 ? 482  ASN B ND2 1 
ATOM   7885 N N   . PHE B 1 483 ? -2.744  20.311  -39.448 1.00 47.80 ? 483  PHE B N   1 
ATOM   7886 C CA  . PHE B 1 483 ? -1.302  20.456  -39.535 1.00 48.00 ? 483  PHE B CA  1 
ATOM   7887 C C   . PHE B 1 483 ? -0.829  20.538  -40.999 1.00 48.45 ? 483  PHE B C   1 
ATOM   7888 O O   . PHE B 1 483 ? -0.014  21.389  -41.341 1.00 48.39 ? 483  PHE B O   1 
ATOM   7889 C CB  . PHE B 1 483 ? -0.589  19.312  -38.815 1.00 46.97 ? 483  PHE B CB  1 
ATOM   7890 C CG  . PHE B 1 483 ? 0.899   19.421  -38.870 1.00 46.89 ? 483  PHE B CG  1 
ATOM   7891 C CD1 . PHE B 1 483 ? 1.567   20.356  -38.083 1.00 48.00 ? 483  PHE B CD1 1 
ATOM   7892 C CD2 . PHE B 1 483 ? 1.636   18.619  -39.722 1.00 46.16 ? 483  PHE B CD2 1 
ATOM   7893 C CE1 . PHE B 1 483 ? 2.935   20.473  -38.144 1.00 46.82 ? 483  PHE B CE1 1 
ATOM   7894 C CE2 . PHE B 1 483 ? 3.009   18.724  -39.780 1.00 45.73 ? 483  PHE B CE2 1 
ATOM   7895 C CZ  . PHE B 1 483 ? 3.662   19.643  -38.993 1.00 46.06 ? 483  PHE B CZ  1 
ATOM   7896 N N   . ALA B 1 484 ? -1.350  19.663  -41.857 1.00 49.10 ? 484  ALA B N   1 
ATOM   7897 C CA  . ALA B 1 484 ? -1.005  19.686  -43.284 1.00 49.96 ? 484  ALA B CA  1 
ATOM   7898 C C   . ALA B 1 484 ? -1.356  21.021  -43.956 1.00 51.24 ? 484  ALA B C   1 
ATOM   7899 O O   . ALA B 1 484 ? -0.562  21.538  -44.741 1.00 51.11 ? 484  ALA B O   1 
ATOM   7900 C CB  . ALA B 1 484 ? -1.668  18.521  -44.020 1.00 49.43 ? 484  ALA B CB  1 
ATOM   7901 N N   . ARG B 1 485 ? -2.536  21.561  -43.638 1.00 52.67 ? 485  ARG B N   1 
ATOM   7902 C CA  . ARG B 1 485 ? -3.028  22.814  -44.228 1.00 54.84 ? 485  ARG B CA  1 
ATOM   7903 C C   . ARG B 1 485 ? -2.262  24.042  -43.755 1.00 55.09 ? 485  ARG B C   1 
ATOM   7904 O O   . ARG B 1 485 ? -1.985  24.932  -44.554 1.00 55.62 ? 485  ARG B O   1 
ATOM   7905 C CB  . ARG B 1 485 ? -4.518  23.043  -43.892 1.00 55.77 ? 485  ARG B CB  1 
ATOM   7906 C CG  . ARG B 1 485 ? -5.498  22.195  -44.683 1.00 58.37 ? 485  ARG B CG  1 
ATOM   7907 C CD  . ARG B 1 485 ? -6.971  22.519  -44.340 1.00 60.20 ? 485  ARG B CD  1 
ATOM   7908 N NE  . ARG B 1 485 ? -7.425  21.724  -43.196 1.00 63.48 ? 485  ARG B NE  1 
ATOM   7909 C CZ  . ARG B 1 485 ? -8.113  20.580  -43.265 1.00 63.62 ? 485  ARG B CZ  1 
ATOM   7910 N NH1 . ARG B 1 485 ? -8.482  20.062  -44.434 1.00 64.24 ? 485  ARG B NH1 1 
ATOM   7911 N NH2 . ARG B 1 485 ? -8.448  19.953  -42.135 1.00 63.04 ? 485  ARG B NH2 1 
ATOM   7912 N N   . THR B 1 486 ? -1.953  24.088  -42.454 1.00 54.80 ? 486  THR B N   1 
ATOM   7913 C CA  . THR B 1 486 ? -1.471  25.299  -41.801 1.00 55.33 ? 486  THR B CA  1 
ATOM   7914 C C   . THR B 1 486 ? -0.104  25.201  -41.099 1.00 54.33 ? 486  THR B C   1 
ATOM   7915 O O   . THR B 1 486 ? 0.496   26.233  -40.793 1.00 55.29 ? 486  THR B O   1 
ATOM   7916 C CB  . THR B 1 486 ? -2.491  25.759  -40.732 1.00 56.41 ? 486  THR B CB  1 
ATOM   7917 O OG1 . THR B 1 486 ? -2.521  24.802  -39.656 1.00 56.23 ? 486  THR B OG1 1 
ATOM   7918 C CG2 . THR B 1 486 ? -3.904  25.905  -41.356 1.00 57.22 ? 486  THR B CG2 1 
ATOM   7919 N N   . GLY B 1 487 ? 0.387   23.992  -40.832 1.00 52.48 ? 487  GLY B N   1 
ATOM   7920 C CA  . GLY B 1 487 ? 1.560   23.826  -39.978 1.00 51.30 ? 487  GLY B CA  1 
ATOM   7921 C C   . GLY B 1 487 ? 1.240   23.945  -38.496 1.00 51.14 ? 487  GLY B C   1 
ATOM   7922 O O   . GLY B 1 487 ? 2.138   24.116  -37.685 1.00 50.47 ? 487  GLY B O   1 
ATOM   7923 N N   . ASP B 1 488 ? -0.045  23.821  -38.155 1.00 51.32 ? 488  ASP B N   1 
ATOM   7924 C CA  . ASP B 1 488 ? -0.555  23.978  -36.796 1.00 51.16 ? 488  ASP B CA  1 
ATOM   7925 C C   . ASP B 1 488 ? -1.744  23.021  -36.670 1.00 51.54 ? 488  ASP B C   1 
ATOM   7926 O O   . ASP B 1 488 ? -2.727  23.189  -37.381 1.00 52.18 ? 488  ASP B O   1 
ATOM   7927 C CB  . ASP B 1 488 ? -0.999  25.432  -36.593 1.00 51.66 ? 488  ASP B CB  1 
ATOM   7928 C CG  . ASP B 1 488 ? -1.564  25.718  -35.192 1.00 51.38 ? 488  ASP B CG  1 
ATOM   7929 O OD1 . ASP B 1 488 ? -1.965  24.796  -34.452 1.00 49.52 ? 488  ASP B OD1 1 
ATOM   7930 O OD2 . ASP B 1 488 ? -1.616  26.908  -34.833 1.00 53.00 ? 488  ASP B OD2 1 
ATOM   7931 N N   . PRO B 1 489 ? -1.675  22.036  -35.759 1.00 51.76 ? 489  PRO B N   1 
ATOM   7932 C CA  . PRO B 1 489 ? -2.740  21.039  -35.671 1.00 53.06 ? 489  PRO B CA  1 
ATOM   7933 C C   . PRO B 1 489 ? -4.036  21.519  -35.008 1.00 55.64 ? 489  PRO B C   1 
ATOM   7934 O O   . PRO B 1 489 ? -5.012  20.775  -34.974 1.00 56.10 ? 489  PRO B O   1 
ATOM   7935 C CB  . PRO B 1 489 ? -2.102  19.925  -34.834 1.00 51.75 ? 489  PRO B CB  1 
ATOM   7936 C CG  . PRO B 1 489 ? -1.140  20.604  -33.975 1.00 51.01 ? 489  PRO B CG  1 
ATOM   7937 C CD  . PRO B 1 489 ? -0.626  21.788  -34.757 1.00 51.37 ? 489  PRO B CD  1 
ATOM   7938 N N   . ASN B 1 490 ? -4.048  22.732  -34.471 1.00 58.46 ? 490  ASN B N   1 
ATOM   7939 C CA  . ASN B 1 490 ? -5.243  23.252  -33.801 1.00 61.19 ? 490  ASN B CA  1 
ATOM   7940 C C   . ASN B 1 490 ? -6.347  23.614  -34.785 1.00 64.56 ? 490  ASN B C   1 
ATOM   7941 O O   . ASN B 1 490 ? -6.069  24.001  -35.913 1.00 64.56 ? 490  ASN B O   1 
ATOM   7942 C CB  . ASN B 1 490 ? -4.893  24.476  -32.958 1.00 60.77 ? 490  ASN B CB  1 
ATOM   7943 C CG  . ASN B 1 490 ? -4.042  24.127  -31.770 1.00 58.24 ? 490  ASN B CG  1 
ATOM   7944 O OD1 . ASN B 1 490 ? -4.537  23.621  -30.769 1.00 56.27 ? 490  ASN B OD1 1 
ATOM   7945 N ND2 . ASN B 1 490 ? -2.751  24.393  -31.871 1.00 53.91 ? 490  ASN B ND2 1 
ATOM   7946 N N   . ASP B 1 491 ? -7.592  23.510  -34.326 1.00 68.66 ? 491  ASP B N   1 
ATOM   7947 C CA  . ASP B 1 491 ? -8.770  23.790  -35.153 1.00 72.55 ? 491  ASP B CA  1 
ATOM   7948 C C   . ASP B 1 491 ? -9.065  25.312  -35.168 1.00 74.66 ? 491  ASP B C   1 
ATOM   7949 O O   . ASP B 1 491 ? -9.552  25.861  -34.162 1.00 75.64 ? 491  ASP B O   1 
ATOM   7950 C CB  . ASP B 1 491 ? -9.957  22.976  -34.601 1.00 73.35 ? 491  ASP B CB  1 
ATOM   7951 C CG  . ASP B 1 491 ? -11.022 22.657  -35.654 1.00 75.72 ? 491  ASP B CG  1 
ATOM   7952 O OD1 . ASP B 1 491 ? -10.987 23.199  -36.786 1.00 78.25 ? 491  ASP B OD1 1 
ATOM   7953 O OD2 . ASP B 1 491 ? -11.909 21.836  -35.332 1.00 78.37 ? 491  ASP B OD2 1 
ATOM   7954 N N   . PRO B 1 492 ? -8.780  25.996  -36.306 1.00 76.39 ? 492  PRO B N   1 
ATOM   7955 C CA  . PRO B 1 492 ? -8.743  27.473  -36.384 1.00 78.02 ? 492  PRO B CA  1 
ATOM   7956 C C   . PRO B 1 492 ? -10.089 28.194  -36.432 1.00 81.21 ? 492  PRO B C   1 
ATOM   7957 O O   . PRO B 1 492 ? -10.165 29.375  -36.068 1.00 82.40 ? 492  PRO B O   1 
ATOM   7958 C CB  . PRO B 1 492 ? -7.996  27.737  -37.696 1.00 78.15 ? 492  PRO B CB  1 
ATOM   7959 C CG  . PRO B 1 492 ? -8.324  26.547  -38.559 1.00 77.40 ? 492  PRO B CG  1 
ATOM   7960 C CD  . PRO B 1 492 ? -8.498  25.378  -37.619 1.00 76.21 ? 492  PRO B CD  1 
ATOM   7961 N N   . ARG B 1 493 ? -11.127 27.521  -36.922 1.00 83.07 ? 493  ARG B N   1 
ATOM   7962 C CA  . ARG B 1 493 ? -12.489 28.073  -36.879 1.00 85.58 ? 493  ARG B CA  1 
ATOM   7963 C C   . ARG B 1 493 ? -13.054 27.860  -35.466 1.00 86.67 ? 493  ARG B C   1 
ATOM   7964 O O   . ARG B 1 493 ? -13.939 28.605  -35.013 1.00 88.14 ? 493  ARG B O   1 
ATOM   7965 C CB  . ARG B 1 493 ? -13.382 27.404  -37.941 1.00 86.03 ? 493  ARG B CB  1 
ATOM   7966 N N   . ASP B 1 494 ? -12.509 26.851  -34.776 1.00 86.03 ? 494  ASP B N   1 
ATOM   7967 C CA  . ASP B 1 494 ? -12.963 26.460  -33.449 1.00 86.75 ? 494  ASP B CA  1 
ATOM   7968 C C   . ASP B 1 494 ? -12.259 27.246  -32.335 1.00 86.83 ? 494  ASP B C   1 
ATOM   7969 O O   . ASP B 1 494 ? -11.038 27.188  -32.201 1.00 85.87 ? 494  ASP B O   1 
ATOM   7970 C CB  . ASP B 1 494 ? -12.712 24.956  -33.251 1.00 85.73 ? 494  ASP B CB  1 
ATOM   7971 C CG  . ASP B 1 494 ? -13.393 24.392  -32.009 1.00 86.67 ? 494  ASP B CG  1 
ATOM   7972 O OD1 . ASP B 1 494 ? -14.604 24.646  -31.817 1.00 89.95 ? 494  ASP B OD1 1 
ATOM   7973 O OD2 . ASP B 1 494 ? -12.726 23.675  -31.230 1.00 85.53 ? 494  ASP B OD2 1 
ATOM   7974 N N   . SER B 1 495 ? -13.037 27.985  -31.543 1.00 88.38 ? 495  SER B N   1 
ATOM   7975 C CA  . SER B 1 495 ? -12.622 28.325  -30.176 1.00 88.34 ? 495  SER B CA  1 
ATOM   7976 C C   . SER B 1 495 ? -12.972 27.146  -29.261 1.00 88.02 ? 495  SER B C   1 
ATOM   7977 O O   . SER B 1 495 ? -13.465 26.113  -29.733 1.00 88.31 ? 495  SER B O   1 
ATOM   7978 C CB  . SER B 1 495 ? -13.302 29.581  -29.665 1.00 89.91 ? 495  SER B CB  1 
ATOM   7979 O OG  . SER B 1 495 ? -12.965 29.770  -28.293 1.00 89.57 ? 495  SER B OG  1 
ATOM   7980 N N   . LYS B 1 496 ? -12.748 27.300  -27.958 1.00 87.68 ? 496  LYS B N   1 
ATOM   7981 C CA  . LYS B 1 496 ? -12.765 26.160  -27.042 1.00 86.70 ? 496  LYS B CA  1 
ATOM   7982 C C   . LYS B 1 496 ? -11.819 25.104  -27.598 1.00 84.53 ? 496  LYS B C   1 
ATOM   7983 O O   . LYS B 1 496 ? -12.011 24.565  -28.711 1.00 83.91 ? 496  LYS B O   1 
ATOM   7984 C CB  . LYS B 1 496 ? -14.173 25.566  -26.855 1.00 88.10 ? 496  LYS B CB  1 
ATOM   7985 C CG  . LYS B 1 496 ? -14.272 24.550  -25.696 1.00 88.39 ? 496  LYS B CG  1 
ATOM   7986 C CD  . LYS B 1 496 ? -13.781 23.133  -26.080 1.00 88.46 ? 496  LYS B CD  1 
ATOM   7987 C CE  . LYS B 1 496 ? -13.384 22.299  -24.856 1.00 88.36 ? 496  LYS B CE  1 
ATOM   7988 N NZ  . LYS B 1 496 ? -12.257 22.907  -24.076 1.00 88.98 ? 496  LYS B NZ  1 
ATOM   7989 N N   . SER B 1 497 ? -10.793 24.798  -26.816 1.00 82.46 ? 497  SER B N   1 
ATOM   7990 C CA  . SER B 1 497 ? -9.832  23.807  -27.234 1.00 79.77 ? 497  SER B CA  1 
ATOM   7991 C C   . SER B 1 497 ? -9.801  22.622  -26.214 1.00 77.44 ? 497  SER B C   1 
ATOM   7992 O O   . SER B 1 497 ? -10.696 21.769  -26.300 1.00 78.03 ? 497  SER B O   1 
ATOM   7993 C CB  . SER B 1 497 ? -8.525  24.526  -27.595 1.00 79.61 ? 497  SER B CB  1 
ATOM   7994 O OG  . SER B 1 497 ? -8.766  25.555  -28.561 1.00 81.33 ? 497  SER B OG  1 
ATOM   7995 N N   . PRO B 1 498 ? -8.834  22.536  -25.262 1.00 74.14 ? 498  PRO B N   1 
ATOM   7996 C CA  . PRO B 1 498 ? -7.678  23.356  -24.904 1.00 71.78 ? 498  PRO B CA  1 
ATOM   7997 C C   . PRO B 1 498 ? -6.689  23.319  -26.038 1.00 68.27 ? 498  PRO B C   1 
ATOM   7998 O O   . PRO B 1 498 ? -6.671  22.355  -26.798 1.00 67.26 ? 498  PRO B O   1 
ATOM   7999 C CB  . PRO B 1 498 ? -7.087  22.657  -23.664 1.00 71.60 ? 498  PRO B CB  1 
ATOM   8000 C CG  . PRO B 1 498 ? -8.090  21.684  -23.219 1.00 73.06 ? 498  PRO B CG  1 
ATOM   8001 C CD  . PRO B 1 498 ? -8.907  21.329  -24.413 1.00 73.89 ? 498  PRO B CD  1 
ATOM   8002 N N   . GLN B 1 499 ? -5.910  24.381  -26.187 1.00 65.31 ? 499  GLN B N   1 
ATOM   8003 C CA  . GLN B 1 499 ? -5.059  24.498  -27.355 1.00 62.51 ? 499  GLN B CA  1 
ATOM   8004 C C   . GLN B 1 499 ? -3.874  23.548  -27.208 1.00 58.69 ? 499  GLN B C   1 
ATOM   8005 O O   . GLN B 1 499 ? -3.421  23.274  -26.109 1.00 57.61 ? 499  GLN B O   1 
ATOM   8006 C CB  . GLN B 1 499 ? -4.601  25.954  -27.563 1.00 63.19 ? 499  GLN B CB  1 
ATOM   8007 C CG  . GLN B 1 499 ? -5.643  26.845  -28.251 1.00 64.54 ? 499  GLN B CG  1 
ATOM   8008 C CD  . GLN B 1 499 ? -5.520  26.868  -29.767 1.00 66.59 ? 499  GLN B CD  1 
ATOM   8009 O OE1 . GLN B 1 499 ? -4.425  27.141  -30.320 1.00 66.66 ? 499  GLN B OE1 1 
ATOM   8010 N NE2 . GLN B 1 499 ? -6.645  26.600  -30.462 1.00 66.00 ? 499  GLN B NE2 1 
ATOM   8011 N N   . TRP B 1 500 ? -3.413  23.030  -28.334 1.00 55.59 ? 500  TRP B N   1 
ATOM   8012 C CA  . TRP B 1 500 ? -2.180  22.262  -28.393 1.00 52.88 ? 500  TRP B CA  1 
ATOM   8013 C C   . TRP B 1 500 ? -1.010  23.256  -28.552 1.00 52.03 ? 500  TRP B C   1 
ATOM   8014 O O   . TRP B 1 500 ? -0.832  23.831  -29.622 1.00 51.66 ? 500  TRP B O   1 
ATOM   8015 C CB  . TRP B 1 500 ? -2.268  21.283  -29.577 1.00 52.24 ? 500  TRP B CB  1 
ATOM   8016 C CG  . TRP B 1 500 ? -1.156  20.282  -29.712 1.00 50.37 ? 500  TRP B CG  1 
ATOM   8017 C CD1 . TRP B 1 500 ? 0.085   20.340  -29.164 1.00 50.11 ? 500  TRP B CD1 1 
ATOM   8018 C CD2 . TRP B 1 500 ? -1.188  19.085  -30.493 1.00 50.91 ? 500  TRP B CD2 1 
ATOM   8019 N NE1 . TRP B 1 500 ? 0.827   19.251  -29.541 1.00 48.77 ? 500  TRP B NE1 1 
ATOM   8020 C CE2 . TRP B 1 500 ? 0.070   18.467  -30.364 1.00 49.22 ? 500  TRP B CE2 1 
ATOM   8021 C CE3 . TRP B 1 500 ? -2.166  18.468  -31.282 1.00 50.16 ? 500  TRP B CE3 1 
ATOM   8022 C CZ2 . TRP B 1 500 ? 0.376   17.264  -30.986 1.00 49.27 ? 500  TRP B CZ2 1 
ATOM   8023 C CZ3 . TRP B 1 500 ? -1.862  17.290  -31.906 1.00 49.81 ? 500  TRP B CZ3 1 
ATOM   8024 C CH2 . TRP B 1 500 ? -0.604  16.690  -31.753 1.00 49.55 ? 500  TRP B CH2 1 
ATOM   8025 N N   . PRO B 1 501 ? -0.194  23.447  -27.493 1.00 51.01 ? 501  PRO B N   1 
ATOM   8026 C CA  . PRO B 1 501 ? 0.895   24.420  -27.605 1.00 50.67 ? 501  PRO B CA  1 
ATOM   8027 C C   . PRO B 1 501 ? 2.108   23.838  -28.338 1.00 49.49 ? 501  PRO B C   1 
ATOM   8028 O O   . PRO B 1 501 ? 2.303   22.618  -28.327 1.00 49.06 ? 501  PRO B O   1 
ATOM   8029 C CB  . PRO B 1 501 ? 1.257   24.706  -26.150 1.00 50.39 ? 501  PRO B CB  1 
ATOM   8030 C CG  . PRO B 1 501 ? 0.936   23.460  -25.425 1.00 50.52 ? 501  PRO B CG  1 
ATOM   8031 C CD  . PRO B 1 501 ? -0.178  22.761  -26.185 1.00 50.68 ? 501  PRO B CD  1 
ATOM   8032 N N   . PRO B 1 502 ? 2.911   24.692  -28.986 1.00 48.94 ? 502  PRO B N   1 
ATOM   8033 C CA  . PRO B 1 502 ? 4.174   24.207  -29.541 1.00 48.33 ? 502  PRO B CA  1 
ATOM   8034 C C   . PRO B 1 502 ? 5.139   23.644  -28.479 1.00 48.01 ? 502  PRO B C   1 
ATOM   8035 O O   . PRO B 1 502 ? 5.185   24.127  -27.348 1.00 48.64 ? 502  PRO B O   1 
ATOM   8036 C CB  . PRO B 1 502 ? 4.767   25.447  -30.222 1.00 48.68 ? 502  PRO B CB  1 
ATOM   8037 C CG  . PRO B 1 502 ? 3.632   26.376  -30.428 1.00 49.50 ? 502  PRO B CG  1 
ATOM   8038 C CD  . PRO B 1 502 ? 2.685   26.114  -29.285 1.00 49.56 ? 502  PRO B CD  1 
ATOM   8039 N N   . TYR B 1 503 ? 5.865   22.598  -28.853 1.00 47.68 ? 503  TYR B N   1 
ATOM   8040 C CA  . TYR B 1 503 ? 6.953   22.061  -28.045 1.00 47.51 ? 503  TYR B CA  1 
ATOM   8041 C C   . TYR B 1 503 ? 8.138   23.006  -28.120 1.00 47.52 ? 503  TYR B C   1 
ATOM   8042 O O   . TYR B 1 503 ? 8.506   23.441  -29.207 1.00 46.94 ? 503  TYR B O   1 
ATOM   8043 C CB  . TYR B 1 503 ? 7.395   20.700  -28.564 1.00 46.98 ? 503  TYR B CB  1 
ATOM   8044 C CG  . TYR B 1 503 ? 8.447   20.040  -27.707 1.00 47.48 ? 503  TYR B CG  1 
ATOM   8045 C CD1 . TYR B 1 503 ? 9.803   20.266  -27.922 1.00 47.49 ? 503  TYR B CD1 1 
ATOM   8046 C CD2 . TYR B 1 503 ? 8.080   19.191  -26.664 1.00 47.92 ? 503  TYR B CD2 1 
ATOM   8047 C CE1 . TYR B 1 503 ? 10.763  19.653  -27.114 1.00 47.83 ? 503  TYR B CE1 1 
ATOM   8048 C CE2 . TYR B 1 503 ? 9.014   18.591  -25.863 1.00 47.40 ? 503  TYR B CE2 1 
ATOM   8049 C CZ  . TYR B 1 503 ? 10.353  18.814  -26.088 1.00 48.21 ? 503  TYR B CZ  1 
ATOM   8050 O OH  . TYR B 1 503 ? 11.266  18.179  -25.273 1.00 49.25 ? 503  TYR B OH  1 
ATOM   8051 N N   . THR B 1 504 ? 8.722   23.296  -26.956 1.00 48.22 ? 504  THR B N   1 
ATOM   8052 C CA  . THR B 1 504 ? 9.864   24.194  -26.814 1.00 48.80 ? 504  THR B CA  1 
ATOM   8053 C C   . THR B 1 504 ? 10.866  23.569  -25.840 1.00 49.43 ? 504  THR B C   1 
ATOM   8054 O O   . THR B 1 504 ? 10.503  22.728  -25.038 1.00 48.49 ? 504  THR B O   1 
ATOM   8055 C CB  . THR B 1 504 ? 9.422   25.610  -26.294 1.00 49.90 ? 504  THR B CB  1 
ATOM   8056 O OG1 . THR B 1 504 ? 8.761   25.485  -25.032 1.00 48.47 ? 504  THR B OG1 1 
ATOM   8057 C CG2 . THR B 1 504 ? 8.475   26.294  -27.294 1.00 49.07 ? 504  THR B CG2 1 
ATOM   8058 N N   . THR B 1 505 ? 12.128  23.984  -25.911 1.00 50.99 ? 505  THR B N   1 
ATOM   8059 C CA  . THR B 1 505 ? 13.157  23.432  -25.026 1.00 51.89 ? 505  THR B CA  1 
ATOM   8060 C C   . THR B 1 505 ? 12.952  23.921  -23.584 1.00 52.85 ? 505  THR B C   1 
ATOM   8061 O O   . THR B 1 505 ? 13.215  23.183  -22.636 1.00 52.95 ? 505  THR B O   1 
ATOM   8062 C CB  . THR B 1 505 ? 14.609  23.748  -25.526 1.00 52.30 ? 505  THR B CB  1 
ATOM   8063 O OG1 . THR B 1 505 ? 14.834  25.159  -25.527 1.00 55.14 ? 505  THR B OG1 1 
ATOM   8064 C CG2 . THR B 1 505 ? 14.821  23.221  -26.928 1.00 50.99 ? 505  THR B CG2 1 
ATOM   8065 N N   . ALA B 1 506 ? 12.448  25.145  -23.424 1.00 53.66 ? 506  ALA B N   1 
ATOM   8066 C CA  . ALA B 1 506 ? 12.167  25.679  -22.090 1.00 54.62 ? 506  ALA B CA  1 
ATOM   8067 C C   . ALA B 1 506 ? 11.036  24.890  -21.417 1.00 54.46 ? 506  ALA B C   1 
ATOM   8068 O O   . ALA B 1 506 ? 11.243  24.274  -20.362 1.00 55.56 ? 506  ALA B O   1 
ATOM   8069 C CB  . ALA B 1 506 ? 11.802  27.158  -22.172 1.00 55.13 ? 506  ALA B CB  1 
ATOM   8070 N N   . ALA B 1 507 ? 9.856   24.888  -22.047 1.00 53.48 ? 507  ALA B N   1 
ATOM   8071 C CA  . ALA B 1 507 ? 8.632   24.396  -21.415 1.00 52.35 ? 507  ALA B CA  1 
ATOM   8072 C C   . ALA B 1 507 ? 8.360   22.924  -21.699 1.00 50.80 ? 507  ALA B C   1 
ATOM   8073 O O   . ALA B 1 507 ? 7.690   22.261  -20.912 1.00 50.47 ? 507  ALA B O   1 
ATOM   8074 C CB  . ALA B 1 507 ? 7.447   25.256  -21.832 1.00 52.74 ? 507  ALA B CB  1 
ATOM   8075 N N   . GLN B 1 508 ? 8.849   22.422  -22.828 1.00 49.32 ? 508  GLN B N   1 
ATOM   8076 C CA  . GLN B 1 508 ? 8.770   20.999  -23.154 1.00 48.30 ? 508  GLN B CA  1 
ATOM   8077 C C   . GLN B 1 508 ? 7.322   20.451  -23.162 1.00 47.86 ? 508  GLN B C   1 
ATOM   8078 O O   . GLN B 1 508 ? 7.059   19.307  -22.762 1.00 47.03 ? 508  GLN B O   1 
ATOM   8079 C CB  . GLN B 1 508 ? 9.687   20.195  -22.229 1.00 47.95 ? 508  GLN B CB  1 
ATOM   8080 C CG  . GLN B 1 508 ? 11.150  20.634  -22.301 1.00 48.82 ? 508  GLN B CG  1 
ATOM   8081 C CD  . GLN B 1 508 ? 12.056  19.928  -21.287 1.00 49.24 ? 508  GLN B CD  1 
ATOM   8082 O OE1 . GLN B 1 508 ? 12.044  18.704  -21.171 1.00 51.09 ? 508  GLN B OE1 1 
ATOM   8083 N NE2 . GLN B 1 508 ? 12.857  20.705  -20.567 1.00 49.99 ? 508  GLN B NE2 1 
ATOM   8084 N N   . GLN B 1 509 ? 6.399   21.268  -23.664 1.00 47.64 ? 509  GLN B N   1 
ATOM   8085 C CA  . GLN B 1 509 ? 4.981   20.922  -23.649 1.00 47.80 ? 509  GLN B CA  1 
ATOM   8086 C C   . GLN B 1 509 ? 4.584   19.989  -24.791 1.00 46.87 ? 509  GLN B C   1 
ATOM   8087 O O   . GLN B 1 509 ? 4.981   20.188  -25.945 1.00 46.40 ? 509  GLN B O   1 
ATOM   8088 C CB  . GLN B 1 509 ? 4.110   22.176  -23.691 1.00 48.27 ? 509  GLN B CB  1 
ATOM   8089 C CG  . GLN B 1 509 ? 4.147   22.997  -22.417 1.00 49.46 ? 509  GLN B CG  1 
ATOM   8090 C CD  . GLN B 1 509 ? 3.556   24.368  -22.621 1.00 50.03 ? 509  GLN B CD  1 
ATOM   8091 O OE1 . GLN B 1 509 ? 4.067   25.159  -23.410 1.00 52.24 ? 509  GLN B OE1 1 
ATOM   8092 N NE2 . GLN B 1 509 ? 2.472   24.656  -21.921 1.00 51.47 ? 509  GLN B NE2 1 
ATOM   8093 N N   . TYR B 1 510 ? 3.790   18.978  -24.443 1.00 46.61 ? 510  TYR B N   1 
ATOM   8094 C CA  . TYR B 1 510 ? 3.200   18.037  -25.403 1.00 46.00 ? 510  TYR B CA  1 
ATOM   8095 C C   . TYR B 1 510 ? 1.801   17.679  -24.930 1.00 46.23 ? 510  TYR B C   1 
ATOM   8096 O O   . TYR B 1 510 ? 1.427   18.020  -23.821 1.00 47.02 ? 510  TYR B O   1 
ATOM   8097 C CB  . TYR B 1 510 ? 4.059   16.778  -25.530 1.00 45.42 ? 510  TYR B CB  1 
ATOM   8098 C CG  . TYR B 1 510 ? 4.187   15.966  -24.259 1.00 45.55 ? 510  TYR B CG  1 
ATOM   8099 C CD1 . TYR B 1 510 ? 5.042   16.359  -23.242 1.00 46.18 ? 510  TYR B CD1 1 
ATOM   8100 C CD2 . TYR B 1 510 ? 3.471   14.792  -24.087 1.00 45.90 ? 510  TYR B CD2 1 
ATOM   8101 C CE1 . TYR B 1 510 ? 5.167   15.611  -22.078 1.00 45.71 ? 510  TYR B CE1 1 
ATOM   8102 C CE2 . TYR B 1 510 ? 3.590   14.042  -22.927 1.00 46.41 ? 510  TYR B CE2 1 
ATOM   8103 C CZ  . TYR B 1 510 ? 4.439   14.460  -21.928 1.00 45.73 ? 510  TYR B CZ  1 
ATOM   8104 O OH  . TYR B 1 510 ? 4.558   13.715  -20.775 1.00 46.88 ? 510  TYR B OH  1 
ATOM   8105 N N   . VAL B 1 511 ? 1.029   16.985  -25.761 1.00 46.14 ? 511  VAL B N   1 
ATOM   8106 C CA  . VAL B 1 511 ? -0.341  16.622  -25.403 1.00 45.89 ? 511  VAL B CA  1 
ATOM   8107 C C   . VAL B 1 511 ? -0.571  15.102  -25.405 1.00 46.07 ? 511  VAL B C   1 
ATOM   8108 O O   . VAL B 1 511 ? 0.077   14.352  -26.156 1.00 44.84 ? 511  VAL B O   1 
ATOM   8109 C CB  . VAL B 1 511 ? -1.356  17.297  -26.353 1.00 46.39 ? 511  VAL B CB  1 
ATOM   8110 C CG1 . VAL B 1 511 ? -1.198  18.835  -26.312 1.00 45.27 ? 511  VAL B CG1 1 
ATOM   8111 C CG2 . VAL B 1 511 ? -1.211  16.765  -27.774 1.00 44.84 ? 511  VAL B CG2 1 
ATOM   8112 N N   . SER B 1 512 ? -1.490  14.661  -24.546 1.00 46.81 ? 512  SER B N   1 
ATOM   8113 C CA  . SER B 1 512 ? -1.992  13.298  -24.573 1.00 47.06 ? 512  SER B CA  1 
ATOM   8114 C C   . SER B 1 512 ? -3.107  13.203  -25.606 1.00 47.88 ? 512  SER B C   1 
ATOM   8115 O O   . SER B 1 512 ? -4.034  14.015  -25.615 1.00 48.44 ? 512  SER B O   1 
ATOM   8116 C CB  . SER B 1 512 ? -2.522  12.869  -23.203 1.00 47.84 ? 512  SER B CB  1 
ATOM   8117 O OG  . SER B 1 512 ? -3.438  13.828  -22.678 1.00 48.00 ? 512  SER B OG  1 
ATOM   8118 N N   . LEU B 1 513 ? -2.989  12.218  -26.494 1.00 48.20 ? 513  LEU B N   1 
ATOM   8119 C CA  . LEU B 1 513 ? -4.047  11.892  -27.445 1.00 48.98 ? 513  LEU B CA  1 
ATOM   8120 C C   . LEU B 1 513 ? -4.730  10.617  -26.956 1.00 49.87 ? 513  LEU B C   1 
ATOM   8121 O O   . LEU B 1 513 ? -4.175  9.532   -27.047 1.00 49.42 ? 513  LEU B O   1 
ATOM   8122 C CB  . LEU B 1 513 ? -3.474  11.710  -28.851 1.00 48.16 ? 513  LEU B CB  1 
ATOM   8123 C CG  . LEU B 1 513 ? -2.774  12.939  -29.445 1.00 47.29 ? 513  LEU B CG  1 
ATOM   8124 C CD1 . LEU B 1 513 ? -2.181  12.609  -30.824 1.00 45.24 ? 513  LEU B CD1 1 
ATOM   8125 C CD2 . LEU B 1 513 ? -3.750  14.114  -29.532 1.00 47.35 ? 513  LEU B CD2 1 
ATOM   8126 N N   . ASN B 1 514 ? -5.920  10.782  -26.385 1.00 51.71 ? 514  ASN B N   1 
ATOM   8127 C CA  . ASN B 1 514 ? -6.743  9.671   -25.929 1.00 52.66 ? 514  ASN B CA  1 
ATOM   8128 C C   . ASN B 1 514 ? -8.218  10.068  -26.030 1.00 54.39 ? 514  ASN B C   1 
ATOM   8129 O O   . ASN B 1 514 ? -8.536  11.075  -26.646 1.00 54.18 ? 514  ASN B O   1 
ATOM   8130 C CB  . ASN B 1 514 ? -6.330  9.242   -24.517 1.00 52.66 ? 514  ASN B CB  1 
ATOM   8131 C CG  . ASN B 1 514 ? -6.319  10.393  -23.515 1.00 53.79 ? 514  ASN B CG  1 
ATOM   8132 O OD1 . ASN B 1 514 ? -7.231  11.226  -23.474 1.00 55.07 ? 514  ASN B OD1 1 
ATOM   8133 N ND2 . ASN B 1 514 ? -5.278  10.431  -22.683 1.00 54.51 ? 514  ASN B ND2 1 
ATOM   8134 N N   . LEU B 1 515 ? -9.118  9.278   -25.455 1.00 56.18 ? 515  LEU B N   1 
ATOM   8135 C CA  . LEU B 1 515 ? -10.546 9.539   -25.583 1.00 58.00 ? 515  LEU B CA  1 
ATOM   8136 C C   . LEU B 1 515 ? -10.972 10.835  -24.878 1.00 59.44 ? 515  LEU B C   1 
ATOM   8137 O O   . LEU B 1 515 ? -11.956 11.466  -25.265 1.00 60.29 ? 515  LEU B O   1 
ATOM   8138 C CB  . LEU B 1 515 ? -11.353 8.351   -25.044 1.00 59.01 ? 515  LEU B CB  1 
ATOM   8139 C CG  . LEU B 1 515 ? -11.180 7.005   -25.771 1.00 58.72 ? 515  LEU B CG  1 
ATOM   8140 C CD1 . LEU B 1 515 ? -12.210 6.014   -25.262 1.00 58.24 ? 515  LEU B CD1 1 
ATOM   8141 C CD2 . LEU B 1 515 ? -11.288 7.140   -27.286 1.00 56.78 ? 515  LEU B CD2 1 
ATOM   8142 N N   . LYS B 1 516 ? -10.218 11.237  -23.859 1.00 60.08 ? 516  LYS B N   1 
ATOM   8143 C CA  . LYS B 1 516 ? -10.483 12.485  -23.139 1.00 61.24 ? 516  LYS B CA  1 
ATOM   8144 C C   . LYS B 1 516 ? -10.005 13.684  -23.961 1.00 60.21 ? 516  LYS B C   1 
ATOM   8145 O O   . LYS B 1 516 ? -9.211  13.523  -24.888 1.00 59.27 ? 516  LYS B O   1 
ATOM   8146 C CB  . LYS B 1 516 ? -9.799  12.456  -21.766 1.00 60.99 ? 516  LYS B CB  1 
ATOM   8147 C CG  . LYS B 1 516 ? -10.247 11.267  -20.907 1.00 63.23 ? 516  LYS B CG  1 
ATOM   8148 C CD  . LYS B 1 516 ? -9.671  11.308  -19.490 1.00 63.98 ? 516  LYS B CD  1 
ATOM   8149 C CE  . LYS B 1 516 ? -8.220  10.788  -19.445 1.00 65.62 ? 516  LYS B CE  1 
ATOM   8150 N NZ  . LYS B 1 516 ? -7.661  10.810  -18.038 1.00 66.26 ? 516  LYS B NZ  1 
ATOM   8151 N N   . PRO B 1 517 ? -10.490 14.894  -23.632 1.00 60.65 ? 517  PRO B N   1 
ATOM   8152 C CA  . PRO B 1 517 ? -9.962  16.101  -24.299 1.00 60.13 ? 517  PRO B CA  1 
ATOM   8153 C C   . PRO B 1 517 ? -8.458  16.263  -24.081 1.00 58.79 ? 517  PRO B C   1 
ATOM   8154 O O   . PRO B 1 517 ? -7.941  15.786  -23.071 1.00 58.60 ? 517  PRO B O   1 
ATOM   8155 C CB  . PRO B 1 517 ? -10.720 17.247  -23.611 1.00 61.00 ? 517  PRO B CB  1 
ATOM   8156 C CG  . PRO B 1 517 ? -11.944 16.609  -23.021 1.00 62.13 ? 517  PRO B CG  1 
ATOM   8157 C CD  . PRO B 1 517 ? -11.523 15.225  -22.632 1.00 61.77 ? 517  PRO B CD  1 
ATOM   8158 N N   . LEU B 1 518 ? -7.771  16.919  -25.014 1.00 58.04 ? 518  LEU B N   1 
ATOM   8159 C CA  . LEU B 1 518 ? -6.325  17.143  -24.896 1.00 57.29 ? 518  LEU B CA  1 
ATOM   8160 C C   . LEU B 1 518 ? -5.937  17.642  -23.507 1.00 57.37 ? 518  LEU B C   1 
ATOM   8161 O O   . LEU B 1 518 ? -6.562  18.553  -22.967 1.00 57.81 ? 518  LEU B O   1 
ATOM   8162 C CB  . LEU B 1 518 ? -5.828  18.200  -25.887 1.00 57.15 ? 518  LEU B CB  1 
ATOM   8163 C CG  . LEU B 1 518 ? -5.715  17.964  -27.386 1.00 57.11 ? 518  LEU B CG  1 
ATOM   8164 C CD1 . LEU B 1 518 ? -5.113  19.248  -27.991 1.00 57.57 ? 518  LEU B CD1 1 
ATOM   8165 C CD2 . LEU B 1 518 ? -4.869  16.761  -27.721 1.00 54.98 ? 518  LEU B CD2 1 
ATOM   8166 N N   . GLU B 1 519 ? -4.880  17.057  -22.965 1.00 56.47 ? 519  GLU B N   1 
ATOM   8167 C CA  . GLU B 1 519 ? -4.283  17.499  -21.719 1.00 57.14 ? 519  GLU B CA  1 
ATOM   8168 C C   . GLU B 1 519 ? -2.834  17.882  -22.031 1.00 54.95 ? 519  GLU B C   1 
ATOM   8169 O O   . GLU B 1 519 ? -2.132  17.123  -22.697 1.00 54.37 ? 519  GLU B O   1 
ATOM   8170 C CB  . GLU B 1 519 ? -4.370  16.361  -20.697 1.00 57.34 ? 519  GLU B CB  1 
ATOM   8171 C CG  . GLU B 1 519 ? -3.393  16.407  -19.529 1.00 59.43 ? 519  GLU B CG  1 
ATOM   8172 C CD  . GLU B 1 519 ? -3.561  15.204  -18.585 1.00 60.35 ? 519  GLU B CD  1 
ATOM   8173 O OE1 . GLU B 1 519 ? -4.725  14.885  -18.230 1.00 66.57 ? 519  GLU B OE1 1 
ATOM   8174 O OE2 . GLU B 1 519 ? -2.538  14.578  -18.205 1.00 61.36 ? 519  GLU B OE2 1 
ATOM   8175 N N   . VAL B 1 520 ? -2.394  19.053  -21.577 1.00 53.72 ? 520  VAL B N   1 
ATOM   8176 C CA  . VAL B 1 520 ? -1.025  19.492  -21.824 1.00 52.40 ? 520  VAL B CA  1 
ATOM   8177 C C   . VAL B 1 520 ? -0.117  18.999  -20.703 1.00 51.75 ? 520  VAL B C   1 
ATOM   8178 O O   . VAL B 1 520 ? -0.416  19.182  -19.533 1.00 52.36 ? 520  VAL B O   1 
ATOM   8179 C CB  . VAL B 1 520 ? -0.916  21.034  -21.955 1.00 52.46 ? 520  VAL B CB  1 
ATOM   8180 C CG1 . VAL B 1 520 ? 0.518   21.448  -22.213 1.00 51.46 ? 520  VAL B CG1 1 
ATOM   8181 C CG2 . VAL B 1 520 ? -1.811  21.541  -23.069 1.00 51.98 ? 520  VAL B CG2 1 
ATOM   8182 N N   . ARG B 1 521 ? 0.979   18.352  -21.072 1.00 50.61 ? 521  ARG B N   1 
ATOM   8183 C CA  . ARG B 1 521 ? 1.975   17.896  -20.105 1.00 50.50 ? 521  ARG B CA  1 
ATOM   8184 C C   . ARG B 1 521 ? 3.319   18.505  -20.446 1.00 50.17 ? 521  ARG B C   1 
ATOM   8185 O O   . ARG B 1 521 ? 3.504   19.043  -21.534 1.00 49.84 ? 521  ARG B O   1 
ATOM   8186 C CB  . ARG B 1 521 ? 2.070   16.379  -20.124 1.00 50.18 ? 521  ARG B CB  1 
ATOM   8187 C CG  . ARG B 1 521 ? 0.741   15.697  -19.893 1.00 50.46 ? 521  ARG B CG  1 
ATOM   8188 C CD  . ARG B 1 521 ? 0.873   14.214  -19.952 1.00 50.78 ? 521  ARG B CD  1 
ATOM   8189 N NE  . ARG B 1 521 ? -0.417  13.544  -19.773 1.00 52.08 ? 521  ARG B NE  1 
ATOM   8190 C CZ  . ARG B 1 521 ? -0.641  12.268  -20.076 1.00 52.93 ? 521  ARG B CZ  1 
ATOM   8191 N NH1 . ARG B 1 521 ? 0.323   11.528  -20.624 1.00 53.63 ? 521  ARG B NH1 1 
ATOM   8192 N NH2 . ARG B 1 521 ? -1.843  11.738  -19.879 1.00 53.14 ? 521  ARG B NH2 1 
ATOM   8193 N N   . ARG B 1 522 ? 4.251   18.435  -19.507 1.00 50.71 ? 522  ARG B N   1 
ATOM   8194 C CA  . ARG B 1 522 ? 5.572   19.015  -19.688 1.00 51.07 ? 522  ARG B CA  1 
ATOM   8195 C C   . ARG B 1 522 ? 6.656   17.963  -19.484 1.00 51.10 ? 522  ARG B C   1 
ATOM   8196 O O   . ARG B 1 522 ? 6.630   17.217  -18.512 1.00 51.69 ? 522  ARG B O   1 
ATOM   8197 C CB  . ARG B 1 522 ? 5.754   20.214  -18.760 1.00 51.55 ? 522  ARG B CB  1 
ATOM   8198 C CG  . ARG B 1 522 ? 4.902   21.385  -19.206 1.00 52.44 ? 522  ARG B CG  1 
ATOM   8199 C CD  . ARG B 1 522 ? 4.926   22.557  -18.262 1.00 54.26 ? 522  ARG B CD  1 
ATOM   8200 N NE  . ARG B 1 522 ? 6.221   23.225  -18.254 1.00 55.73 ? 522  ARG B NE  1 
ATOM   8201 C CZ  . ARG B 1 522 ? 6.466   24.389  -17.662 1.00 55.80 ? 522  ARG B CZ  1 
ATOM   8202 N NH1 . ARG B 1 522 ? 5.498   25.033  -17.037 1.00 56.53 ? 522  ARG B NH1 1 
ATOM   8203 N NH2 . ARG B 1 522 ? 7.691   24.910  -17.711 1.00 56.14 ? 522  ARG B NH2 1 
ATOM   8204 N N   . GLY B 1 523 ? 7.581   17.884  -20.438 1.00 51.25 ? 523  GLY B N   1 
ATOM   8205 C CA  . GLY B 1 523 ? 8.744   17.008  -20.338 1.00 51.37 ? 523  GLY B CA  1 
ATOM   8206 C C   . GLY B 1 523 ? 8.440   15.585  -20.752 1.00 51.30 ? 523  GLY B C   1 
ATOM   8207 O O   . GLY B 1 523 ? 7.735   14.879  -20.044 1.00 51.84 ? 523  GLY B O   1 
ATOM   8208 N N   . LEU B 1 524 ? 8.963   15.169  -21.902 1.00 51.49 ? 524  LEU B N   1 
ATOM   8209 C CA  . LEU B 1 524 ? 8.827   13.783  -22.366 1.00 52.19 ? 524  LEU B CA  1 
ATOM   8210 C C   . LEU B 1 524 ? 9.879   12.923  -21.698 1.00 52.00 ? 524  LEU B C   1 
ATOM   8211 O O   . LEU B 1 524 ? 11.038  12.938  -22.132 1.00 52.10 ? 524  LEU B O   1 
ATOM   8212 C CB  . LEU B 1 524 ? 9.071   13.669  -23.876 1.00 52.17 ? 524  LEU B CB  1 
ATOM   8213 C CG  . LEU B 1 524 ? 7.968   13.932  -24.880 1.00 54.50 ? 524  LEU B CG  1 
ATOM   8214 C CD1 . LEU B 1 524 ? 8.623   13.997  -26.280 1.00 55.52 ? 524  LEU B CD1 1 
ATOM   8215 C CD2 . LEU B 1 524 ? 6.890   12.839  -24.793 1.00 55.06 ? 524  LEU B CD2 1 
ATOM   8216 N N   . ARG B 1 525 ? 9.487   12.170  -20.671 1.00 52.25 ? 525  ARG B N   1 
ATOM   8217 C CA  . ARG B 1 525 ? 10.430  11.367  -19.887 1.00 52.60 ? 525  ARG B CA  1 
ATOM   8218 C C   . ARG B 1 525 ? 11.701  12.165  -19.594 1.00 51.48 ? 525  ARG B C   1 
ATOM   8219 O O   . ARG B 1 525 ? 12.793  11.701  -19.894 1.00 50.24 ? 525  ARG B O   1 
ATOM   8220 C CB  . ARG B 1 525 ? 10.834  10.137  -20.685 1.00 53.20 ? 525  ARG B CB  1 
ATOM   8221 C CG  . ARG B 1 525 ? 9.734   9.184   -20.977 1.00 56.55 ? 525  ARG B CG  1 
ATOM   8222 C CD  . ARG B 1 525 ? 9.446   8.310   -19.816 1.00 61.41 ? 525  ARG B CD  1 
ATOM   8223 N NE  . ARG B 1 525 ? 9.235   6.947   -20.273 1.00 64.19 ? 525  ARG B NE  1 
ATOM   8224 C CZ  . ARG B 1 525 ? 8.145   6.505   -20.890 1.00 65.23 ? 525  ARG B CZ  1 
ATOM   8225 N NH1 . ARG B 1 525 ? 7.124   7.320   -21.152 1.00 66.75 ? 525  ARG B NH1 1 
ATOM   8226 N NH2 . ARG B 1 525 ? 8.087   5.229   -21.253 1.00 64.99 ? 525  ARG B NH2 1 
ATOM   8227 N N   . ALA B 1 526 ? 11.563  13.369  -19.055 1.00 50.84 ? 526  ALA B N   1 
ATOM   8228 C CA  . ALA B 1 526 ? 12.702  14.298  -19.026 1.00 50.58 ? 526  ALA B CA  1 
ATOM   8229 C C   . ALA B 1 526 ? 13.911  13.735  -18.285 1.00 50.28 ? 526  ALA B C   1 
ATOM   8230 O O   . ALA B 1 526 ? 15.026  13.833  -18.781 1.00 50.17 ? 526  ALA B O   1 
ATOM   8231 C CB  . ALA B 1 526 ? 12.296  15.670  -18.457 1.00 50.83 ? 526  ALA B CB  1 
ATOM   8232 N N   . GLN B 1 527 ? 13.685  13.128  -17.121 1.00 50.55 ? 527  GLN B N   1 
ATOM   8233 C CA  . GLN B 1 527 ? 14.779  12.624  -16.278 1.00 50.78 ? 527  GLN B CA  1 
ATOM   8234 C C   . GLN B 1 527 ? 15.437  11.406  -16.890 1.00 50.02 ? 527  GLN B C   1 
ATOM   8235 O O   . GLN B 1 527 ? 16.662  11.321  -16.942 1.00 49.94 ? 527  GLN B O   1 
ATOM   8236 C CB  . GLN B 1 527 ? 14.301  12.260  -14.859 1.00 51.50 ? 527  GLN B CB  1 
ATOM   8237 C CG  . GLN B 1 527 ? 13.951  13.425  -13.960 1.00 52.62 ? 527  GLN B CG  1 
ATOM   8238 C CD  . GLN B 1 527 ? 15.044  14.482  -13.860 1.00 54.08 ? 527  GLN B CD  1 
ATOM   8239 O OE1 . GLN B 1 527 ? 14.839  15.621  -14.289 1.00 55.72 ? 527  GLN B OE1 1 
ATOM   8240 N NE2 . GLN B 1 527 ? 16.200  14.120  -13.281 1.00 52.92 ? 527  GLN B NE2 1 
ATOM   8241 N N   . THR B 1 528 ? 14.618  10.461  -17.339 1.00 49.59 ? 528  THR B N   1 
ATOM   8242 C CA  . THR B 1 528 ? 15.127  9.237   -17.942 1.00 49.33 ? 528  THR B CA  1 
ATOM   8243 C C   . THR B 1 528 ? 15.808  9.521   -19.274 1.00 48.77 ? 528  THR B C   1 
ATOM   8244 O O   . THR B 1 528 ? 16.841  8.925   -19.570 1.00 49.07 ? 528  THR B O   1 
ATOM   8245 C CB  . THR B 1 528 ? 14.019  8.161   -18.084 1.00 49.39 ? 528  THR B CB  1 
ATOM   8246 O OG1 . THR B 1 528 ? 13.783  7.568   -16.798 1.00 51.10 ? 528  THR B OG1 1 
ATOM   8247 C CG2 . THR B 1 528 ? 14.418  7.059   -19.073 1.00 48.35 ? 528  THR B CG2 1 
ATOM   8248 N N   . CYS B 1 529 ? 15.262  10.435  -20.072 1.00 47.97 ? 529  CYS B N   1 
ATOM   8249 C CA  . CYS B 1 529 ? 15.913  10.769  -21.341 1.00 48.16 ? 529  CYS B CA  1 
ATOM   8250 C C   . CYS B 1 529 ? 17.232  11.518  -21.155 1.00 48.30 ? 529  CYS B C   1 
ATOM   8251 O O   . CYS B 1 529 ? 18.108  11.431  -22.000 1.00 47.87 ? 529  CYS B O   1 
ATOM   8252 C CB  . CYS B 1 529 ? 14.944  11.471  -22.309 1.00 47.66 ? 529  CYS B CB  1 
ATOM   8253 S SG  . CYS B 1 529 ? 13.667  10.279  -22.944 1.00 49.27 ? 529  CYS B SG  1 
ATOM   8254 N N   . ALA B 1 530 ? 17.389  12.229  -20.042 1.00 49.19 ? 530  ALA B N   1 
ATOM   8255 C CA  . ALA B 1 530 ? 18.695  12.820  -19.691 1.00 50.02 ? 530  ALA B CA  1 
ATOM   8256 C C   . ALA B 1 530 ? 19.765  11.727  -19.498 1.00 50.15 ? 530  ALA B C   1 
ATOM   8257 O O   . ALA B 1 530 ? 20.927  11.903  -19.873 1.00 50.55 ? 530  ALA B O   1 
ATOM   8258 C CB  . ALA B 1 530 ? 18.580  13.694  -18.420 1.00 50.20 ? 530  ALA B CB  1 
ATOM   8259 N N   . PHE B 1 531 ? 19.348  10.606  -18.920 1.00 49.67 ? 531  PHE B N   1 
ATOM   8260 C CA  . PHE B 1 531 ? 20.196  9.431   -18.768 1.00 49.77 ? 531  PHE B CA  1 
ATOM   8261 C C   . PHE B 1 531 ? 20.654  8.867   -20.126 1.00 49.47 ? 531  PHE B C   1 
ATOM   8262 O O   . PHE B 1 531 ? 21.851  8.677   -20.347 1.00 49.89 ? 531  PHE B O   1 
ATOM   8263 C CB  . PHE B 1 531 ? 19.454  8.369   -17.920 1.00 49.55 ? 531  PHE B CB  1 
ATOM   8264 C CG  . PHE B 1 531 ? 20.090  7.005   -17.933 1.00 49.70 ? 531  PHE B CG  1 
ATOM   8265 C CD1 . PHE B 1 531 ? 21.233  6.747   -17.187 1.00 50.74 ? 531  PHE B CD1 1 
ATOM   8266 C CD2 . PHE B 1 531 ? 19.524  5.969   -18.669 1.00 50.26 ? 531  PHE B CD2 1 
ATOM   8267 C CE1 . PHE B 1 531 ? 21.820  5.494   -17.196 1.00 51.16 ? 531  PHE B CE1 1 
ATOM   8268 C CE2 . PHE B 1 531 ? 20.099  4.713   -18.688 1.00 50.08 ? 531  PHE B CE2 1 
ATOM   8269 C CZ  . PHE B 1 531 ? 21.253  4.469   -17.945 1.00 51.30 ? 531  PHE B CZ  1 
ATOM   8270 N N   . TRP B 1 532 ? 19.705  8.579   -21.014 1.00 49.06 ? 532  TRP B N   1 
ATOM   8271 C CA  . TRP B 1 532 ? 20.029  8.040   -22.344 1.00 48.98 ? 532  TRP B CA  1 
ATOM   8272 C C   . TRP B 1 532 ? 20.767  9.048   -23.221 1.00 49.47 ? 532  TRP B C   1 
ATOM   8273 O O   . TRP B 1 532 ? 21.716  8.680   -23.904 1.00 49.64 ? 532  TRP B O   1 
ATOM   8274 C CB  . TRP B 1 532 ? 18.774  7.574   -23.094 1.00 48.09 ? 532  TRP B CB  1 
ATOM   8275 C CG  . TRP B 1 532 ? 18.145  6.349   -22.524 1.00 47.33 ? 532  TRP B CG  1 
ATOM   8276 C CD1 . TRP B 1 532 ? 17.047  6.296   -21.731 1.00 46.71 ? 532  TRP B CD1 1 
ATOM   8277 C CD2 . TRP B 1 532 ? 18.591  4.997   -22.691 1.00 46.66 ? 532  TRP B CD2 1 
ATOM   8278 N NE1 . TRP B 1 532 ? 16.762  4.993   -21.404 1.00 47.75 ? 532  TRP B NE1 1 
ATOM   8279 C CE2 . TRP B 1 532 ? 17.704  4.176   -21.971 1.00 47.43 ? 532  TRP B CE2 1 
ATOM   8280 C CE3 . TRP B 1 532 ? 19.657  4.406   -23.379 1.00 46.64 ? 532  TRP B CE3 1 
ATOM   8281 C CZ2 . TRP B 1 532 ? 17.843  2.789   -21.919 1.00 47.59 ? 532  TRP B CZ2 1 
ATOM   8282 C CZ3 . TRP B 1 532 ? 19.799  3.041   -23.327 1.00 48.36 ? 532  TRP B CZ3 1 
ATOM   8283 C CH2 . TRP B 1 532 ? 18.893  2.239   -22.604 1.00 48.38 ? 532  TRP B CH2 1 
ATOM   8284 N N   . ASN B 1 533 ? 20.338  10.308  -23.194 1.00 49.96 ? 533  ASN B N   1 
ATOM   8285 C CA  . ASN B 1 533 ? 20.838  11.314  -24.144 1.00 50.49 ? 533  ASN B CA  1 
ATOM   8286 C C   . ASN B 1 533 ? 22.039  12.113  -23.679 1.00 51.99 ? 533  ASN B C   1 
ATOM   8287 O O   . ASN B 1 533 ? 22.801  12.613  -24.514 1.00 52.19 ? 533  ASN B O   1 
ATOM   8288 C CB  . ASN B 1 533 ? 19.712  12.264  -24.550 1.00 50.29 ? 533  ASN B CB  1 
ATOM   8289 C CG  . ASN B 1 533 ? 18.571  11.539  -25.234 1.00 49.45 ? 533  ASN B CG  1 
ATOM   8290 O OD1 . ASN B 1 533 ? 18.714  10.383  -25.604 1.00 51.40 ? 533  ASN B OD1 1 
ATOM   8291 N ND2 . ASN B 1 533 ? 17.442  12.208  -25.400 1.00 48.18 ? 533  ASN B ND2 1 
ATOM   8292 N N   . ARG B 1 534 ? 22.213  12.238  -22.363 1.00 52.97 ? 534  ARG B N   1 
ATOM   8293 C CA  . ARG B 1 534 ? 23.338  12.984  -21.815 1.00 54.35 ? 534  ARG B CA  1 
ATOM   8294 C C   . ARG B 1 534 ? 24.361  12.101  -21.118 1.00 55.06 ? 534  ARG B C   1 
ATOM   8295 O O   . ARG B 1 534 ? 25.553  12.232  -21.380 1.00 56.19 ? 534  ARG B O   1 
ATOM   8296 C CB  . ARG B 1 534 ? 22.857  14.078  -20.856 1.00 54.14 ? 534  ARG B CB  1 
ATOM   8297 C CG  . ARG B 1 534 ? 22.013  15.136  -21.517 1.00 54.41 ? 534  ARG B CG  1 
ATOM   8298 C CD  . ARG B 1 534 ? 21.371  16.042  -20.489 1.00 56.13 ? 534  ARG B CD  1 
ATOM   8299 N NE  . ARG B 1 534 ? 20.333  16.877  -21.081 1.00 57.34 ? 534  ARG B NE  1 
ATOM   8300 C CZ  . ARG B 1 534 ? 20.526  18.093  -21.594 1.00 59.70 ? 534  ARG B CZ  1 
ATOM   8301 N NH1 . ARG B 1 534 ? 21.729  18.686  -21.572 1.00 59.73 ? 534  ARG B NH1 1 
ATOM   8302 N NH2 . ARG B 1 534 ? 19.480  18.735  -22.118 1.00 59.28 ? 534  ARG B NH2 1 
ATOM   8303 N N   . PHE B 1 535 ? 23.923  11.215  -20.230 1.00 55.36 ? 535  PHE B N   1 
ATOM   8304 C CA  . PHE B 1 535 ? 24.889  10.449  -19.450 1.00 56.36 ? 535  PHE B CA  1 
ATOM   8305 C C   . PHE B 1 535 ? 25.548  9.311   -20.209 1.00 57.06 ? 535  PHE B C   1 
ATOM   8306 O O   . PHE B 1 535 ? 26.769  9.206   -20.209 1.00 57.62 ? 535  PHE B O   1 
ATOM   8307 C CB  . PHE B 1 535 ? 24.310  9.876   -18.165 1.00 56.22 ? 535  PHE B CB  1 
ATOM   8308 C CG  . PHE B 1 535 ? 25.313  9.077   -17.395 1.00 56.25 ? 535  PHE B CG  1 
ATOM   8309 C CD1 . PHE B 1 535 ? 26.432  9.695   -16.866 1.00 56.37 ? 535  PHE B CD1 1 
ATOM   8310 C CD2 . PHE B 1 535 ? 25.181  7.708   -17.257 1.00 56.29 ? 535  PHE B CD2 1 
ATOM   8311 C CE1 . PHE B 1 535 ? 27.377  8.976   -16.177 1.00 57.41 ? 535  PHE B CE1 1 
ATOM   8312 C CE2 . PHE B 1 535 ? 26.131  6.981   -16.573 1.00 57.16 ? 535  PHE B CE2 1 
ATOM   8313 C CZ  . PHE B 1 535 ? 27.227  7.616   -16.033 1.00 58.25 ? 535  PHE B CZ  1 
ATOM   8314 N N   . LEU B 1 536 ? 24.757  8.438   -20.817 1.00 57.32 ? 536  LEU B N   1 
ATOM   8315 C CA  . LEU B 1 536 ? 25.339  7.270   -21.472 1.00 58.87 ? 536  LEU B CA  1 
ATOM   8316 C C   . LEU B 1 536 ? 26.387  7.612   -22.544 1.00 60.59 ? 536  LEU B C   1 
ATOM   8317 O O   . LEU B 1 536 ? 27.445  6.973   -22.597 1.00 61.29 ? 536  LEU B O   1 
ATOM   8318 C CB  . LEU B 1 536 ? 24.258  6.339   -22.032 1.00 58.10 ? 536  LEU B CB  1 
ATOM   8319 C CG  . LEU B 1 536 ? 23.570  5.453   -20.988 1.00 57.96 ? 536  LEU B CG  1 
ATOM   8320 C CD1 . LEU B 1 536 ? 22.654  4.481   -21.689 1.00 57.36 ? 536  LEU B CD1 1 
ATOM   8321 C CD2 . LEU B 1 536 ? 24.576  4.694   -20.085 1.00 58.37 ? 536  LEU B CD2 1 
ATOM   8322 N N   . PRO B 1 537 ? 26.109  8.615   -23.394 1.00 61.72 ? 537  PRO B N   1 
ATOM   8323 C CA  . PRO B 1 537 ? 27.168  9.086   -24.302 1.00 63.71 ? 537  PRO B CA  1 
ATOM   8324 C C   . PRO B 1 537 ? 28.454  9.549   -23.589 1.00 65.34 ? 537  PRO B C   1 
ATOM   8325 O O   . PRO B 1 537 ? 29.539  9.234   -24.067 1.00 66.37 ? 537  PRO B O   1 
ATOM   8326 C CB  . PRO B 1 537 ? 26.502  10.248  -25.051 1.00 62.68 ? 537  PRO B CB  1 
ATOM   8327 C CG  . PRO B 1 537 ? 25.036  9.940   -24.972 1.00 61.55 ? 537  PRO B CG  1 
ATOM   8328 C CD  . PRO B 1 537 ? 24.848  9.338   -23.612 1.00 60.80 ? 537  PRO B CD  1 
ATOM   8329 N N   . LYS B 1 538 ? 28.336  10.278  -22.472 1.00 66.50 ? 538  LYS B N   1 
ATOM   8330 C CA  . LYS B 1 538 ? 29.513  10.677  -21.674 1.00 68.22 ? 538  LYS B CA  1 
ATOM   8331 C C   . LYS B 1 538 ? 30.278  9.447   -21.194 1.00 69.82 ? 538  LYS B C   1 
ATOM   8332 O O   . LYS B 1 538 ? 31.508  9.441   -21.181 1.00 71.12 ? 538  LYS B O   1 
ATOM   8333 C CB  . LYS B 1 538 ? 29.131  11.521  -20.450 1.00 68.54 ? 538  LYS B CB  1 
ATOM   8334 C CG  . LYS B 1 538 ? 28.911  13.022  -20.701 1.00 69.31 ? 538  LYS B CG  1 
ATOM   8335 C CD  . LYS B 1 538 ? 28.375  13.719  -19.423 1.00 69.38 ? 538  LYS B CD  1 
ATOM   8336 C CE  . LYS B 1 538 ? 27.558  15.002  -19.716 1.00 70.16 ? 538  LYS B CE  1 
ATOM   8337 N NZ  . LYS B 1 538 ? 28.298  16.273  -19.416 1.00 72.20 ? 538  LYS B NZ  1 
ATOM   8338 N N   . LEU B 1 539 ? 29.547  8.413   -20.791 1.00 70.40 ? 539  LEU B N   1 
ATOM   8339 C CA  . LEU B 1 539 ? 30.159  7.169   -20.332 1.00 71.79 ? 539  LEU B CA  1 
ATOM   8340 C C   . LEU B 1 539 ? 30.953  6.530   -21.460 1.00 73.46 ? 539  LEU B C   1 
ATOM   8341 O O   . LEU B 1 539 ? 32.068  6.054   -21.251 1.00 74.27 ? 539  LEU B O   1 
ATOM   8342 C CB  . LEU B 1 539 ? 29.083  6.200   -19.814 1.00 71.24 ? 539  LEU B CB  1 
ATOM   8343 C CG  . LEU B 1 539 ? 29.484  4.819   -19.291 1.00 71.36 ? 539  LEU B CG  1 
ATOM   8344 C CD1 . LEU B 1 539 ? 30.593  4.922   -18.250 1.00 72.07 ? 539  LEU B CD1 1 
ATOM   8345 C CD2 . LEU B 1 539 ? 28.270  4.110   -18.714 1.00 70.49 ? 539  LEU B CD2 1 
ATOM   8346 N N   . LEU B 1 540 ? 30.369  6.546   -22.654 1.00 74.61 ? 540  LEU B N   1 
ATOM   8347 C CA  . LEU B 1 540 ? 30.947  5.918   -23.847 1.00 76.02 ? 540  LEU B CA  1 
ATOM   8348 C C   . LEU B 1 540 ? 32.287  6.569   -24.210 1.00 78.26 ? 540  LEU B C   1 
ATOM   8349 O O   . LEU B 1 540 ? 33.322  5.899   -24.266 1.00 79.05 ? 540  LEU B O   1 
ATOM   8350 C CB  . LEU B 1 540 ? 29.946  6.028   -25.010 1.00 75.00 ? 540  LEU B CB  1 
ATOM   8351 C CG  . LEU B 1 540 ? 30.260  5.384   -26.364 1.00 74.89 ? 540  LEU B CG  1 
ATOM   8352 C CD1 . LEU B 1 540 ? 30.318  3.870   -26.233 1.00 75.16 ? 540  LEU B CD1 1 
ATOM   8353 C CD2 . LEU B 1 540 ? 29.211  5.805   -27.399 1.00 73.74 ? 540  LEU B CD2 1 
ATOM   8354 N N   . SER B 1 541 ? 32.253  7.881   -24.428 1.00 79.77 ? 541  SER B N   1 
ATOM   8355 C CA  . SER B 1 541 ? 33.452  8.663   -24.728 1.00 82.23 ? 541  SER B CA  1 
ATOM   8356 C C   . SER B 1 541 ? 34.192  8.996   -23.436 1.00 84.28 ? 541  SER B C   1 
ATOM   8357 O O   . SER B 1 541 ? 34.014  10.075  -22.869 1.00 84.96 ? 541  SER B O   1 
ATOM   8358 C CB  . SER B 1 541 ? 33.063  9.957   -25.442 1.00 81.81 ? 541  SER B CB  1 
ATOM   8359 O OG  . SER B 1 541 ? 32.091  10.656  -24.688 1.00 81.51 ? 541  SER B OG  1 
ATOM   8360 N N   . ALA B 1 542 ? 35.037  8.072   -22.994 1.00 86.29 ? 542  ALA B N   1 
ATOM   8361 C CA  . ALA B 1 542 ? 35.601  8.083   -21.635 1.00 87.84 ? 542  ALA B CA  1 
ATOM   8362 C C   . ALA B 1 542 ? 35.991  6.645   -21.286 1.00 89.26 ? 542  ALA B C   1 
ATOM   8363 O O   . ALA B 1 542 ? 37.066  6.399   -20.735 1.00 90.82 ? 542  ALA B O   1 
ATOM   8364 C CB  . ALA B 1 542 ? 34.597  8.638   -20.609 1.00 86.93 ? 542  ALA B CB  1 
ATOM   8365 N N   . THR B 1 543 ? 35.099  5.708   -21.607 1.00 89.33 ? 543  THR B N   1 
ATOM   8366 C CA  . THR B 1 543 ? 35.427  4.286   -21.636 1.00 90.56 ? 543  THR B CA  1 
ATOM   8367 C C   . THR B 1 543 ? 36.128  3.977   -22.968 1.00 91.26 ? 543  THR B C   1 
ATOM   8368 O O   . THR B 1 543 ? 35.560  3.395   -23.901 1.00 91.08 ? 543  THR B O   1 
ATOM   8369 C CB  . THR B 1 543 ? 34.159  3.411   -21.474 1.00 89.78 ? 543  THR B CB  1 
ATOM   8370 O OG1 . THR B 1 543 ? 33.476  3.776   -20.267 1.00 89.68 ? 543  THR B OG1 1 
ATOM   8371 C CG2 . THR B 1 543 ? 34.518  1.920   -21.430 1.00 90.96 ? 543  THR B CG2 1 
ATOM   8372 O OXT . THR B 1 543 ? 37.299  4.325   -23.152 1.00 92.51 ? 543  THR B OXT 1 
HETATM 8373 C C1  . NAG C 2 .   ? 24.278  35.479  -0.571  1.00 78.00 ? 1    NAG C C1  1 
HETATM 8374 C C2  . NAG C 2 .   ? 24.509  35.830  -2.046  1.00 82.69 ? 1    NAG C C2  1 
HETATM 8375 C C3  . NAG C 2 .   ? 25.834  35.307  -2.634  1.00 83.54 ? 1    NAG C C3  1 
HETATM 8376 C C4  . NAG C 2 .   ? 27.004  35.556  -1.698  1.00 84.16 ? 1    NAG C C4  1 
HETATM 8377 C C5  . NAG C 2 .   ? 26.655  35.083  -0.294  1.00 85.05 ? 1    NAG C C5  1 
HETATM 8378 C C6  . NAG C 2 .   ? 27.787  35.400  0.687   1.00 87.78 ? 1    NAG C C6  1 
HETATM 8379 C C7  . NAG C 2 .   ? 22.606  36.343  -3.489  1.00 86.39 ? 1    NAG C C7  1 
HETATM 8380 C C8  . NAG C 2 .   ? 21.877  35.854  -4.716  1.00 86.79 ? 1    NAG C C8  1 
HETATM 8381 N N2  . NAG C 2 .   ? 23.330  35.432  -2.819  1.00 84.14 ? 1    NAG C N2  1 
HETATM 8382 O O3  . NAG C 2 .   ? 26.157  35.937  -3.858  1.00 82.97 ? 1    NAG C O3  1 
HETATM 8383 O O4  . NAG C 2 .   ? 28.134  34.869  -2.190  1.00 84.79 ? 1    NAG C O4  1 
HETATM 8384 O O5  . NAG C 2 .   ? 25.465  35.708  0.161   1.00 80.71 ? 1    NAG C O5  1 
HETATM 8385 O O6  . NAG C 2 .   ? 28.048  36.795  0.763   1.00 92.08 ? 1    NAG C O6  1 
HETATM 8386 O O7  . NAG C 2 .   ? 22.514  37.530  -3.141  1.00 87.36 ? 1    NAG C O7  1 
HETATM 8387 C C1  . FUC C 2 .   ? 27.489  37.436  1.943   1.00 95.01 ? 2    FUC C C1  1 
HETATM 8388 C C2  . FUC C 2 .   ? 28.479  38.497  2.415   1.00 96.62 ? 2    FUC C C2  1 
HETATM 8389 C C3  . FUC C 2 .   ? 28.577  39.686  1.453   1.00 97.75 ? 2    FUC C C3  1 
HETATM 8390 C C4  . FUC C 2 .   ? 27.283  40.030  0.667   1.00 98.00 ? 2    FUC C C4  1 
HETATM 8391 C C5  . FUC C 2 .   ? 26.210  38.918  0.603   1.00 97.30 ? 2    FUC C C5  1 
HETATM 8392 C C6  . FUC C 2 .   ? 24.799  39.473  0.391   1.00 96.89 ? 2    FUC C C6  1 
HETATM 8393 O O2  . FUC C 2 .   ? 29.765  37.920  2.563   1.00 97.38 ? 2    FUC C O2  1 
HETATM 8394 O O3  . FUC C 2 .   ? 29.046  40.801  2.195   1.00 97.57 ? 2    FUC C O3  1 
HETATM 8395 O O4  . FUC C 2 .   ? 26.714  41.251  1.120   1.00 98.39 ? 2    FUC C O4  1 
HETATM 8396 O O5  . FUC C 2 .   ? 26.235  38.076  1.752   1.00 95.76 ? 2    FUC C O5  1 
HETATM 8397 C C1  . NAG D 3 .   ? 11.863  33.930  25.745  1.00 82.09 ? 701  NAG A C1  1 
HETATM 8398 C C2  . NAG D 3 .   ? 13.218  34.655  25.743  1.00 85.48 ? 701  NAG A C2  1 
HETATM 8399 C C3  . NAG D 3 .   ? 13.274  35.877  26.667  1.00 86.83 ? 701  NAG A C3  1 
HETATM 8400 C C4  . NAG D 3 .   ? 12.030  36.723  26.402  1.00 87.40 ? 701  NAG A C4  1 
HETATM 8401 C C5  . NAG D 3 .   ? 10.815  35.875  26.789  1.00 87.25 ? 701  NAG A C5  1 
HETATM 8402 C C6  . NAG D 3 .   ? 9.488   36.651  26.768  1.00 88.04 ? 701  NAG A C6  1 
HETATM 8403 C C7  . NAG D 3 .   ? 14.770  32.882  25.092  1.00 86.14 ? 701  NAG A C7  1 
HETATM 8404 C C8  . NAG D 3 .   ? 15.358  31.573  25.545  1.00 85.57 ? 701  NAG A C8  1 
HETATM 8405 N N2  . NAG D 3 .   ? 14.278  33.695  26.031  1.00 85.51 ? 701  NAG A N2  1 
HETATM 8406 O O3  . NAG D 3 .   ? 14.457  36.629  26.451  1.00 87.15 ? 701  NAG A O3  1 
HETATM 8407 O O4  . NAG D 3 .   ? 12.077  37.951  27.105  1.00 88.68 ? 701  NAG A O4  1 
HETATM 8408 O O5  . NAG D 3 .   ? 10.725  34.779  25.892  1.00 84.69 ? 701  NAG A O5  1 
HETATM 8409 O O6  . NAG D 3 .   ? 9.159   37.096  25.464  1.00 88.16 ? 701  NAG A O6  1 
HETATM 8410 O O7  . NAG D 3 .   ? 14.759  33.165  23.895  1.00 86.93 ? 701  NAG A O7  1 
HETATM 8411 O O1  . P6G E 4 .   ? 15.081  6.389   -12.048 1.00 70.19 ? 901  P6G A O1  1 
HETATM 8412 C C2  . P6G E 4 .   ? 16.171  6.022   -11.177 1.00 68.00 ? 901  P6G A C2  1 
HETATM 8413 C C3  . P6G E 4 .   ? 17.605  6.594   -11.049 1.00 67.26 ? 901  P6G A C3  1 
HETATM 8414 O O4  . P6G E 4 .   ? 18.469  6.067   -9.851  1.00 66.96 ? 901  P6G A O4  1 
HETATM 8415 C C5  . P6G E 4 .   ? 18.803  4.664   -9.901  1.00 66.76 ? 901  P6G A C5  1 
HETATM 8416 C C6  . P6G E 4 .   ? 20.229  4.521   -9.981  1.00 64.97 ? 901  P6G A C6  1 
HETATM 8417 O O7  . P6G E 4 .   ? 20.890  4.919   -11.304 1.00 65.43 ? 901  P6G A O7  1 
HETATM 8418 C C8  . P6G E 4 .   ? 22.149  4.270   -11.574 1.00 62.18 ? 901  P6G A C8  1 
HETATM 8419 C C9  . P6G E 4 .   ? 22.699  4.760   -12.926 1.00 60.23 ? 901  P6G A C9  1 
HETATM 8420 O O10 . P6G E 4 .   ? 22.727  6.352   -13.149 1.00 60.85 ? 901  P6G A O10 1 
HETATM 8421 C C11 . P6G E 4 .   ? 23.750  6.915   -13.970 1.00 60.43 ? 901  P6G A C11 1 
HETATM 8422 C C12 . P6G E 4 .   ? 23.680  8.365   -13.962 1.00 62.19 ? 901  P6G A C12 1 
HETATM 8423 O O13 . P6G E 4 .   ? 22.279  9.094   -14.045 1.00 67.23 ? 901  P6G A O13 1 
HETATM 8424 C C14 . P6G E 4 .   ? 22.073  10.100  -15.087 1.00 67.54 ? 901  P6G A C14 1 
HETATM 8425 C C15 . P6G E 4 .   ? 21.003  11.033  -14.780 1.00 68.86 ? 901  P6G A C15 1 
HETATM 8426 O O16 . P6G E 4 .   ? 19.535  10.495  -14.951 1.00 71.29 ? 901  P6G A O16 1 
HETATM 8427 C C17 . P6G E 4 .   ? 18.465  11.036  -14.137 1.00 69.85 ? 901  P6G A C17 1 
HETATM 8428 C C18 . P6G E 4 .   ? 18.180  10.141  -13.073 1.00 68.46 ? 901  P6G A C18 1 
HETATM 8429 O O19 . P6G E 4 .   ? 17.156  10.721  -11.998 1.00 68.12 ? 901  P6G A O19 1 
HETATM 8430 C C4  . CHT F 5 .   ? 25.515  20.811  14.204  1.00 80.34 ? 951  CHT A C4  1 
HETATM 8431 C C5  . CHT F 5 .   ? 26.838  20.291  14.785  1.00 79.08 ? 951  CHT A C5  1 
HETATM 8432 C C6  . CHT F 5 .   ? 26.979  17.948  14.225  1.00 76.96 ? 951  CHT A C6  1 
HETATM 8433 C C7  . CHT F 5 .   ? 27.770  18.731  16.332  1.00 78.20 ? 951  CHT A C7  1 
HETATM 8434 C C8  . CHT F 5 .   ? 25.451  18.649  15.933  1.00 78.10 ? 951  CHT A C8  1 
HETATM 8435 O O6  . CHT F 5 .   ? 24.953  19.892  13.263  1.00 81.31 ? 951  CHT A O6  1 
HETATM 8436 N N1  . CHT F 5 .   ? 26.745  18.915  15.303  1.00 77.59 ? 951  CHT A N1  1 
HETATM 8437 C C4  . CHT G 5 .   ? 37.186  24.940  8.374   0.80 86.19 ? 952  CHT A C4  1 
HETATM 8438 C C5  . CHT G 5 .   ? 36.261  24.830  9.586   0.80 86.19 ? 952  CHT A C5  1 
HETATM 8439 C C6  . CHT G 5 .   ? 35.367  22.648  9.006   0.80 86.20 ? 952  CHT A C6  1 
HETATM 8440 C C7  . CHT G 5 .   ? 34.189  24.079  10.512  0.80 86.12 ? 952  CHT A C7  1 
HETATM 8441 C C8  . CHT G 5 .   ? 34.287  24.624  8.197   0.80 86.72 ? 952  CHT A C8  1 
HETATM 8442 O O6  . CHT G 5 .   ? 38.092  26.033  8.567   0.80 86.19 ? 952  CHT A O6  1 
HETATM 8443 N N1  . CHT G 5 .   ? 35.040  24.046  9.316   0.80 86.23 ? 952  CHT A N1  1 
HETATM 8444 C C1  . NAG H 3 .   ? 5.068   -17.587 -21.425 1.00 83.34 ? 601  NAG B C1  1 
HETATM 8445 C C2  . NAG H 3 .   ? 6.332   -17.984 -22.235 1.00 86.64 ? 601  NAG B C2  1 
HETATM 8446 C C3  . NAG H 3 .   ? 7.277   -18.937 -21.483 1.00 87.52 ? 601  NAG B C3  1 
HETATM 8447 C C4  . NAG H 3 .   ? 7.447   -18.518 -20.025 1.00 88.46 ? 601  NAG B C4  1 
HETATM 8448 C C5  . NAG H 3 .   ? 6.055   -18.365 -19.409 1.00 88.59 ? 601  NAG B C5  1 
HETATM 8449 C C6  . NAG H 3 .   ? 6.074   -18.111 -17.900 1.00 89.29 ? 601  NAG B C6  1 
HETATM 8450 C C7  . NAG H 3 .   ? 5.725   -19.724 -23.972 1.00 89.56 ? 601  NAG B C7  1 
HETATM 8451 C C8  . NAG H 3 .   ? 6.854   -20.695 -24.190 1.00 89.65 ? 601  NAG B C8  1 
HETATM 8452 N N2  . NAG H 3 .   ? 6.064   -18.469 -23.603 1.00 88.25 ? 601  NAG B N2  1 
HETATM 8453 O O3  . NAG H 3 .   ? 8.544   -19.000 -22.112 1.00 88.00 ? 601  NAG B O3  1 
HETATM 8454 O O4  . NAG H 3 .   ? 8.228   -19.469 -19.330 1.00 89.17 ? 601  NAG B O4  1 
HETATM 8455 O O5  . NAG H 3 .   ? 5.437   -17.284 -20.087 1.00 86.30 ? 601  NAG B O5  1 
HETATM 8456 O O6  . NAG H 3 .   ? 5.103   -17.141 -17.552 1.00 90.12 ? 601  NAG B O6  1 
HETATM 8457 O O7  . NAG H 3 .   ? 4.562   -20.101 -24.181 1.00 89.19 ? 601  NAG B O7  1 
HETATM 8458 C C4  . CHT I 5 .   ? 5.013   -2.509  -35.671 1.00 84.86 ? 961  CHT B C4  1 
HETATM 8459 C C5  . CHT I 5 .   ? 5.274   -2.769  -37.154 1.00 84.02 ? 961  CHT B C5  1 
HETATM 8460 C C6  . CHT I 5 .   ? 5.065   -1.995  -39.384 1.00 83.09 ? 961  CHT B C6  1 
HETATM 8461 C C7  . CHT I 5 .   ? 3.740   -0.963  -37.672 1.00 82.94 ? 961  CHT B C7  1 
HETATM 8462 C C8  . CHT I 5 .   ? 6.094   -0.581  -37.741 1.00 83.39 ? 961  CHT B C8  1 
HETATM 8463 O O6  . CHT I 5 .   ? 3.638   -2.746  -35.343 1.00 85.74 ? 961  CHT B O6  1 
HETATM 8464 N N1  . CHT I 5 .   ? 5.038   -1.575  -37.978 1.00 83.19 ? 961  CHT B N1  1 
HETATM 8465 C C4  . CHT J 5 .   ? 11.720  -7.464  -35.916 0.80 88.28 ? 962  CHT B C4  1 
HETATM 8466 C C5  . CHT J 5 .   ? 11.515  -8.861  -36.527 0.80 88.38 ? 962  CHT B C5  1 
HETATM 8467 C C6  . CHT J 5 .   ? 13.074  -10.568 -35.792 0.80 88.43 ? 962  CHT B C6  1 
HETATM 8468 C C7  . CHT J 5 .   ? 12.655  -10.301 -38.115 0.80 88.07 ? 962  CHT B C7  1 
HETATM 8469 C C8  . CHT J 5 .   ? 13.902  -8.640  -36.953 0.80 88.56 ? 962  CHT B C8  1 
HETATM 8470 O O6  . CHT J 5 .   ? 10.654  -7.135  -35.008 0.80 87.80 ? 962  CHT B O6  1 
HETATM 8471 N N1  . CHT J 5 .   ? 12.776  -9.577  -36.840 0.80 88.47 ? 962  CHT B N1  1 
HETATM 8472 O O   . HOH K 6 .   ? 22.021  20.215  7.612   1.00 35.69 ? 953  HOH A O   1 
HETATM 8473 O O   . HOH K 6 .   ? 38.896  16.172  1.102   1.00 34.06 ? 954  HOH A O   1 
HETATM 8474 O O   . HOH K 6 .   ? 21.201  15.255  13.212  1.00 39.07 ? 955  HOH A O   1 
HETATM 8475 O O   . HOH K 6 .   ? 18.862  12.245  13.341  1.00 37.77 ? 956  HOH A O   1 
HETATM 8476 O O   . HOH K 6 .   ? 38.358  15.506  12.691  1.00 41.83 ? 957  HOH A O   1 
HETATM 8477 O O   . HOH K 6 .   ? 33.180  14.756  17.375  1.00 36.88 ? 958  HOH A O   1 
HETATM 8478 O O   . HOH K 6 .   ? 19.449  20.392  18.786  1.00 41.06 ? 959  HOH A O   1 
HETATM 8479 O O   . HOH K 6 .   ? 25.768  15.407  28.239  1.00 44.52 ? 960  HOH A O   1 
HETATM 8480 O O   . HOH K 6 .   ? 47.454  8.050   17.864  1.00 41.53 ? 961  HOH A O   1 
HETATM 8481 O O   . HOH K 6 .   ? 53.509  26.178  8.388   1.00 45.45 ? 962  HOH A O   1 
HETATM 8482 O O   . HOH K 6 .   ? 33.344  12.058  -2.515  1.00 37.39 ? 963  HOH A O   1 
HETATM 8483 O O   . HOH K 6 .   ? 30.929  8.215   6.794   1.00 41.22 ? 964  HOH A O   1 
HETATM 8484 O O   . HOH K 6 .   ? 46.209  12.999  22.669  1.00 43.16 ? 965  HOH A O   1 
HETATM 8485 O O   . HOH K 6 .   ? 41.912  14.225  31.604  1.00 37.58 ? 966  HOH A O   1 
HETATM 8486 O O   . HOH K 6 .   ? 35.193  17.720  24.645  1.00 45.05 ? 967  HOH A O   1 
HETATM 8487 O O   . HOH K 6 .   ? 52.731  9.831   21.572  1.00 45.01 ? 968  HOH A O   1 
HETATM 8488 O O   . HOH K 6 .   ? 17.614  15.218  29.149  1.00 43.61 ? 969  HOH A O   1 
HETATM 8489 O O   . HOH K 6 .   ? 38.328  8.902   47.864  1.00 48.61 ? 970  HOH A O   1 
HETATM 8490 O O   . HOH K 6 .   ? 11.450  1.208   10.938  1.00 47.54 ? 971  HOH A O   1 
HETATM 8491 O O   . HOH K 6 .   ? 41.096  16.984  21.805  1.00 38.50 ? 972  HOH A O   1 
HETATM 8492 O O   . HOH K 6 .   ? 27.856  -1.150  37.645  1.00 41.87 ? 973  HOH A O   1 
HETATM 8493 O O   . HOH K 6 .   ? 28.951  18.165  20.007  1.00 37.37 ? 974  HOH A O   1 
HETATM 8494 O O   . HOH K 6 .   ? 25.101  18.978  29.004  1.00 42.50 ? 975  HOH A O   1 
HETATM 8495 O O   . HOH K 6 .   ? 29.478  12.436  24.818  1.00 41.73 ? 976  HOH A O   1 
HETATM 8496 O O   . HOH K 6 .   ? 19.600  0.809   28.290  1.00 46.05 ? 977  HOH A O   1 
HETATM 8497 O O   . HOH K 6 .   ? 26.231  15.801  18.443  1.00 38.77 ? 978  HOH A O   1 
HETATM 8498 O O   . HOH K 6 .   ? 32.472  17.045  32.734  1.00 37.26 ? 979  HOH A O   1 
HETATM 8499 O O   . HOH K 6 .   ? 34.566  6.659   -10.748 1.00 53.02 ? 980  HOH A O   1 
HETATM 8500 O O   . HOH K 6 .   ? 17.732  22.057  -12.133 1.00 58.86 ? 981  HOH A O   1 
HETATM 8501 O O   . HOH K 6 .   ? 41.173  7.259   2.987   1.00 41.09 ? 982  HOH A O   1 
HETATM 8502 O O   . HOH K 6 .   ? 46.647  11.039  10.914  1.00 40.86 ? 983  HOH A O   1 
HETATM 8503 O O   . HOH K 6 .   ? 42.489  0.751   45.103  1.00 45.56 ? 984  HOH A O   1 
HETATM 8504 O O   . HOH K 6 .   ? 34.282  23.828  18.703  1.00 45.13 ? 985  HOH A O   1 
HETATM 8505 O O   . HOH K 6 .   ? 32.169  20.968  6.362   1.00 45.97 ? 986  HOH A O   1 
HETATM 8506 O O   . HOH K 6 .   ? 40.529  17.176  12.594  1.00 46.81 ? 987  HOH A O   1 
HETATM 8507 O O   . HOH K 6 .   ? 24.073  9.083   48.626  1.00 48.90 ? 988  HOH A O   1 
HETATM 8508 O O   . HOH K 6 .   ? 9.926   -2.948  6.929   1.00 55.47 ? 989  HOH A O   1 
HETATM 8509 O O   . HOH K 6 .   ? 36.698  12.975  7.004   1.00 39.62 ? 990  HOH A O   1 
HETATM 8510 O O   . HOH K 6 .   ? 42.738  7.920   14.193  1.00 45.35 ? 991  HOH A O   1 
HETATM 8511 O O   . HOH K 6 .   ? 40.815  12.785  33.656  1.00 44.34 ? 992  HOH A O   1 
HETATM 8512 O O   . HOH K 6 .   ? 34.249  1.530   4.629   1.00 49.18 ? 993  HOH A O   1 
HETATM 8513 O O   . HOH K 6 .   ? 41.744  19.426  18.238  1.00 42.45 ? 994  HOH A O   1 
HETATM 8514 O O   . HOH K 6 .   ? 14.770  8.247   -4.185  1.00 47.35 ? 995  HOH A O   1 
HETATM 8515 O O   . HOH K 6 .   ? 11.389  22.932  6.962   1.00 47.25 ? 996  HOH A O   1 
HETATM 8516 O O   . HOH K 6 .   ? 19.762  17.868  2.614   1.00 47.28 ? 997  HOH A O   1 
HETATM 8517 O O   . HOH K 6 .   ? 33.964  5.247   6.586   1.00 41.82 ? 998  HOH A O   1 
HETATM 8518 O O   . HOH K 6 .   ? 8.464   11.645  27.994  1.00 53.38 ? 999  HOH A O   1 
HETATM 8519 O O   . HOH K 6 .   ? 23.985  23.959  23.410  1.00 46.45 ? 1000 HOH A O   1 
HETATM 8520 O O   . HOH K 6 .   ? 39.817  20.528  16.490  1.00 42.15 ? 1001 HOH A O   1 
HETATM 8521 O O   . HOH K 6 .   ? 15.969  25.655  17.940  1.00 48.71 ? 1002 HOH A O   1 
HETATM 8522 O O   . HOH K 6 .   ? 29.507  15.743  13.387  1.00 47.93 ? 1003 HOH A O   1 
HETATM 8523 O O   . HOH K 6 .   ? 18.270  15.071  4.156   1.00 43.40 ? 1004 HOH A O   1 
HETATM 8524 O O   . HOH K 6 .   ? 31.075  21.216  16.562  1.00 41.98 ? 1005 HOH A O   1 
HETATM 8525 O O   . HOH K 6 .   ? 37.449  9.840   4.459   1.00 38.01 ? 1006 HOH A O   1 
HETATM 8526 O O   . HOH K 6 .   ? 50.648  3.515   7.405   1.00 50.55 ? 1007 HOH A O   1 
HETATM 8527 O O   . HOH K 6 .   ? 28.819  0.041   29.664  1.00 40.58 ? 1008 HOH A O   1 
HETATM 8528 O O   . HOH K 6 .   ? 40.560  11.451  1.516   1.00 43.15 ? 1009 HOH A O   1 
HETATM 8529 O O   . HOH K 6 .   ? 52.400  16.692  24.508  1.00 48.33 ? 1010 HOH A O   1 
HETATM 8530 O O   . HOH K 6 .   ? 11.470  27.892  12.477  1.00 61.22 ? 1011 HOH A O   1 
HETATM 8531 O O   . HOH K 6 .   ? 30.700  16.068  1.219   1.00 47.38 ? 1012 HOH A O   1 
HETATM 8532 O O   . HOH K 6 .   ? 39.455  28.241  26.984  1.00 46.61 ? 1013 HOH A O   1 
HETATM 8533 O O   . HOH K 6 .   ? 47.056  8.624   27.161  1.00 52.28 ? 1014 HOH A O   1 
HETATM 8534 O O   . HOH K 6 .   ? 29.783  20.644  18.981  1.00 39.17 ? 1015 HOH A O   1 
HETATM 8535 O O   . HOH K 6 .   ? 39.280  9.258   2.589   1.00 41.05 ? 1016 HOH A O   1 
HETATM 8536 O O   . HOH K 6 .   ? 5.588   11.692  14.259  1.00 44.66 ? 1017 HOH A O   1 
HETATM 8537 O O   . HOH K 6 .   ? 45.654  8.490   29.828  1.00 54.75 ? 1018 HOH A O   1 
HETATM 8538 O O   . HOH K 6 .   ? 32.247  0.850   41.854  1.00 43.61 ? 1019 HOH A O   1 
HETATM 8539 O O   . HOH K 6 .   ? 49.692  6.511   28.048  1.00 65.51 ? 1020 HOH A O   1 
HETATM 8540 O O   . HOH K 6 .   ? 36.883  19.720  -4.679  1.00 49.94 ? 1021 HOH A O   1 
HETATM 8541 O O   . HOH K 6 .   ? 26.930  -5.363  21.915  1.00 55.90 ? 1022 HOH A O   1 
HETATM 8542 O O   . HOH K 6 .   ? 29.518  27.291  -6.033  1.00 49.92 ? 1023 HOH A O   1 
HETATM 8543 O O   . HOH K 6 .   ? 28.164  4.532   47.165  1.00 43.29 ? 1024 HOH A O   1 
HETATM 8544 O O   . HOH K 6 .   ? 44.307  11.598  9.435   1.00 43.50 ? 1025 HOH A O   1 
HETATM 8545 O O   . HOH K 6 .   ? 36.604  1.991   37.145  1.00 52.74 ? 1026 HOH A O   1 
HETATM 8546 O O   . HOH K 6 .   ? 17.200  -2.523  34.269  1.00 53.36 ? 1027 HOH A O   1 
HETATM 8547 O O   . HOH K 6 .   ? 19.667  15.057  1.975   1.00 48.56 ? 1028 HOH A O   1 
HETATM 8548 O O   . HOH K 6 .   ? 29.583  2.564   45.979  1.00 41.31 ? 1029 HOH A O   1 
HETATM 8549 O O   . HOH K 6 .   ? 25.391  22.801  30.097  1.00 47.32 ? 1030 HOH A O   1 
HETATM 8550 O O   . HOH K 6 .   ? 31.894  17.133  29.923  1.00 44.60 ? 1031 HOH A O   1 
HETATM 8551 O O   . HOH K 6 .   ? 43.790  15.621  25.230  1.00 52.64 ? 1032 HOH A O   1 
HETATM 8552 O O   . HOH K 6 .   ? 10.089  25.411  26.243  1.00 54.11 ? 1033 HOH A O   1 
HETATM 8553 O O   . HOH K 6 .   ? 43.590  0.814   6.133   1.00 46.96 ? 1034 HOH A O   1 
HETATM 8554 O O   . HOH K 6 .   ? 49.968  23.222  24.911  1.00 52.57 ? 1035 HOH A O   1 
HETATM 8555 O O   . HOH K 6 .   ? 43.134  9.807   11.285  1.00 42.82 ? 1036 HOH A O   1 
HETATM 8556 O O   . HOH K 6 .   ? 17.589  23.606  1.232   1.00 53.30 ? 1037 HOH A O   1 
HETATM 8557 O O   . HOH K 6 .   ? 34.161  -1.340  41.929  1.00 46.89 ? 1038 HOH A O   1 
HETATM 8558 O O   . HOH K 6 .   ? 32.055  2.765   3.554   1.00 49.79 ? 1039 HOH A O   1 
HETATM 8559 O O   . HOH K 6 .   ? 25.684  4.584   46.288  1.00 43.97 ? 1040 HOH A O   1 
HETATM 8560 O O   . HOH K 6 .   ? 47.046  17.818  1.110   1.00 52.74 ? 1041 HOH A O   1 
HETATM 8561 O O   . HOH K 6 .   ? 10.992  17.538  34.340  1.00 46.50 ? 1042 HOH A O   1 
HETATM 8562 O O   . HOH K 6 .   ? 33.076  19.558  29.259  1.00 45.21 ? 1043 HOH A O   1 
HETATM 8563 O O   . HOH K 6 .   ? 48.243  1.503   14.277  1.00 50.64 ? 1044 HOH A O   1 
HETATM 8564 O O   . HOH K 6 .   ? 34.481  27.860  11.186  1.00 57.72 ? 1045 HOH A O   1 
HETATM 8565 O O   . HOH K 6 .   ? 40.992  26.718  19.652  1.00 50.15 ? 1046 HOH A O   1 
HETATM 8566 O O   . HOH K 6 .   ? 42.623  17.415  23.975  1.00 51.44 ? 1047 HOH A O   1 
HETATM 8567 O O   . HOH K 6 .   ? 36.429  5.348   39.322  1.00 52.12 ? 1048 HOH A O   1 
HETATM 8568 O O   . HOH K 6 .   ? 40.383  27.762  17.193  1.00 50.47 ? 1049 HOH A O   1 
HETATM 8569 O O   . HOH K 6 .   ? 37.068  2.950   5.339   1.00 51.94 ? 1050 HOH A O   1 
HETATM 8570 O O   . HOH K 6 .   ? 25.479  29.251  -14.856 1.00 51.69 ? 1051 HOH A O   1 
HETATM 8571 O O   . HOH K 6 .   ? 46.360  15.008  24.374  1.00 45.54 ? 1052 HOH A O   1 
HETATM 8572 O O   . HOH K 6 .   ? 24.481  36.620  13.076  1.00 68.77 ? 1053 HOH A O   1 
HETATM 8573 O O   . HOH K 6 .   ? 5.600   18.970  12.168  1.00 65.17 ? 1054 HOH A O   1 
HETATM 8574 O O   . HOH K 6 .   ? 38.163  12.347  4.904   1.00 44.28 ? 1055 HOH A O   1 
HETATM 8575 O O   . HOH K 6 .   ? 36.799  2.885   46.086  1.00 47.30 ? 1056 HOH A O   1 
HETATM 8576 O O   . HOH K 6 .   ? 40.231  2.223   26.052  1.00 47.55 ? 1057 HOH A O   1 
HETATM 8577 O O   . HOH K 6 .   ? 43.778  19.121  16.453  1.00 46.74 ? 1058 HOH A O   1 
HETATM 8578 O O   . HOH K 6 .   ? 13.479  11.099  2.673   1.00 72.73 ? 1059 HOH A O   1 
HETATM 8579 O O   . HOH K 6 .   ? 36.886  -4.594  14.196  1.00 46.60 ? 1060 HOH A O   1 
HETATM 8580 O O   . HOH K 6 .   ? 14.018  4.029   32.884  1.00 57.41 ? 1061 HOH A O   1 
HETATM 8581 O O   . HOH K 6 .   ? 17.666  20.996  1.847   1.00 47.83 ? 1062 HOH A O   1 
HETATM 8582 O O   . HOH K 6 .   ? 15.307  1.988   1.948   1.00 50.29 ? 1063 HOH A O   1 
HETATM 8583 O O   . HOH K 6 .   ? 38.538  12.404  -13.307 1.00 60.48 ? 1064 HOH A O   1 
HETATM 8584 O O   . HOH K 6 .   ? 35.535  9.760   0.801   1.00 44.14 ? 1065 HOH A O   1 
HETATM 8585 O O   . HOH K 6 .   ? 34.931  15.851  -7.297  1.00 47.18 ? 1066 HOH A O   1 
HETATM 8586 O O   . HOH K 6 .   ? 50.495  17.875  26.164  1.00 48.43 ? 1067 HOH A O   1 
HETATM 8587 O O   . HOH K 6 .   ? 30.082  0.876   2.714   1.00 68.82 ? 1068 HOH A O   1 
HETATM 8588 O O   . HOH K 6 .   ? 32.239  21.909  21.726  1.00 44.60 ? 1069 HOH A O   1 
HETATM 8589 O O   . HOH K 6 .   ? 58.045  19.375  1.377   1.00 58.85 ? 1070 HOH A O   1 
HETATM 8590 O O   . HOH K 6 .   ? 37.018  2.184   34.276  1.00 57.92 ? 1071 HOH A O   1 
HETATM 8591 O O   . HOH K 6 .   ? 27.415  7.909   -0.245  1.00 50.53 ? 1072 HOH A O   1 
HETATM 8592 O O   . HOH K 6 .   ? 44.783  11.697  -0.568  1.00 55.02 ? 1073 HOH A O   1 
HETATM 8593 O O   . HOH K 6 .   ? 0.956   5.393   8.601   1.00 54.24 ? 1074 HOH A O   1 
HETATM 8594 O O   . HOH K 6 .   ? 50.816  3.483   4.675   1.00 59.99 ? 1075 HOH A O   1 
HETATM 8595 O O   . HOH K 6 .   ? 44.753  1.445   43.584  1.00 53.93 ? 1076 HOH A O   1 
HETATM 8596 O O   . HOH K 6 .   ? 39.992  14.426  45.302  1.00 65.74 ? 1077 HOH A O   1 
HETATM 8597 O O   . HOH K 6 .   ? 45.288  1.431   16.359  1.00 52.62 ? 1078 HOH A O   1 
HETATM 8598 O O   . HOH K 6 .   ? 3.036   15.504  18.855  1.00 56.61 ? 1079 HOH A O   1 
HETATM 8599 O O   . HOH K 6 .   ? 31.013  10.818  49.164  1.00 56.25 ? 1080 HOH A O   1 
HETATM 8600 O O   . HOH K 6 .   ? 28.141  3.755   2.655   1.00 53.22 ? 1081 HOH A O   1 
HETATM 8601 O O   . HOH K 6 .   ? 26.931  8.915   7.714   1.00 44.33 ? 1082 HOH A O   1 
HETATM 8602 O O   . HOH K 6 .   ? 26.437  5.561   0.723   1.00 53.72 ? 1083 HOH A O   1 
HETATM 8603 O O   . HOH K 6 .   ? 17.009  19.543  -0.486  1.00 47.59 ? 1084 HOH A O   1 
HETATM 8604 O O   . HOH K 6 .   ? 24.054  20.645  30.770  1.00 57.37 ? 1085 HOH A O   1 
HETATM 8605 O O   . HOH K 6 .   ? 6.090   7.747   22.479  1.00 55.66 ? 1086 HOH A O   1 
HETATM 8606 O O   . HOH K 6 .   ? 54.557  15.512  3.853   1.00 60.42 ? 1087 HOH A O   1 
HETATM 8607 O O   . HOH K 6 .   ? 39.324  3.835   45.662  1.00 47.01 ? 1088 HOH A O   1 
HETATM 8608 O O   . HOH K 6 .   ? 37.317  -6.002  16.469  1.00 54.63 ? 1089 HOH A O   1 
HETATM 8609 O O   . HOH K 6 .   ? 33.735  18.436  38.859  1.00 53.25 ? 1090 HOH A O   1 
HETATM 8610 O O   . HOH K 6 .   ? 40.249  3.950   39.766  1.00 54.80 ? 1091 HOH A O   1 
HETATM 8611 O O   . HOH K 6 .   ? 36.951  16.881  38.318  1.00 47.09 ? 1092 HOH A O   1 
HETATM 8612 O O   . HOH K 6 .   ? 34.993  -2.435  33.346  1.00 52.79 ? 1093 HOH A O   1 
HETATM 8613 O O   . HOH K 6 .   ? 33.030  24.037  13.681  1.00 57.24 ? 1094 HOH A O   1 
HETATM 8614 O O   . HOH K 6 .   ? 14.323  21.358  14.492  1.00 51.10 ? 1095 HOH A O   1 
HETATM 8615 O O   . HOH K 6 .   ? 45.999  10.661  18.338  1.00 54.57 ? 1096 HOH A O   1 
HETATM 8616 O O   . HOH K 6 .   ? 45.394  -2.515  8.210   1.00 57.69 ? 1097 HOH A O   1 
HETATM 8617 O O   . HOH K 6 .   ? 13.163  -8.704  4.687   1.00 61.68 ? 1098 HOH A O   1 
HETATM 8618 O O   . HOH K 6 .   ? 29.838  18.229  56.080  1.00 70.20 ? 1099 HOH A O   1 
HETATM 8619 O O   . HOH K 6 .   ? 2.123   8.860   17.115  1.00 54.17 ? 1100 HOH A O   1 
HETATM 8620 O O   . HOH K 6 .   ? 16.646  -8.608  10.578  1.00 58.80 ? 1101 HOH A O   1 
HETATM 8621 O O   . HOH K 6 .   ? 38.596  13.536  2.095   1.00 45.98 ? 1102 HOH A O   1 
HETATM 8622 O O   . HOH K 6 .   ? 14.786  -5.281  11.434  1.00 49.80 ? 1103 HOH A O   1 
HETATM 8623 O O   . HOH K 6 .   ? 33.126  1.343   44.500  1.00 42.70 ? 1104 HOH A O   1 
HETATM 8624 O O   . HOH K 6 .   ? 40.819  -1.557  24.210  1.00 53.21 ? 1105 HOH A O   1 
HETATM 8625 O O   . HOH K 6 .   ? 37.968  3.679   38.318  1.00 56.99 ? 1106 HOH A O   1 
HETATM 8626 O O   . HOH K 6 .   ? 43.474  -3.677  7.440   1.00 57.40 ? 1107 HOH A O   1 
HETATM 8627 O O   . HOH K 6 .   ? 29.928  26.070  16.043  1.00 49.23 ? 1108 HOH A O   1 
HETATM 8628 O O   . HOH K 6 .   ? 3.279   6.819   18.483  1.00 52.04 ? 1109 HOH A O   1 
HETATM 8629 O O   . HOH K 6 .   ? 8.128   -3.528  16.725  1.00 62.76 ? 1110 HOH A O   1 
HETATM 8630 O O   . HOH K 6 .   ? 23.337  20.102  45.892  1.00 53.69 ? 1111 HOH A O   1 
HETATM 8631 O O   . HOH K 6 .   ? 15.282  31.371  3.595   1.00 57.59 ? 1112 HOH A O   1 
HETATM 8632 O O   . HOH K 6 .   ? 20.259  33.168  10.265  1.00 62.00 ? 1113 HOH A O   1 
HETATM 8633 O O   . HOH K 6 .   ? 36.488  10.694  -14.987 1.00 58.22 ? 1114 HOH A O   1 
HETATM 8634 O O   . HOH K 6 .   ? 6.238   12.528  29.330  1.00 57.82 ? 1115 HOH A O   1 
HETATM 8635 O O   . HOH K 6 .   ? 36.636  21.974  -6.273  1.00 48.87 ? 1116 HOH A O   1 
HETATM 8636 O O   . HOH K 6 .   ? 19.344  23.702  38.972  1.00 58.66 ? 1117 HOH A O   1 
HETATM 8637 O O   . HOH K 6 .   ? 35.709  19.793  4.831   1.00 54.61 ? 1118 HOH A O   1 
HETATM 8638 O O   . HOH K 6 .   ? 59.862  4.401   11.745  1.00 77.99 ? 1119 HOH A O   1 
HETATM 8639 O O   . HOH K 6 .   ? 2.772   17.859  19.499  1.00 55.77 ? 1120 HOH A O   1 
HETATM 8640 O O   . HOH K 6 .   ? 48.208  21.654  26.350  1.00 52.31 ? 1121 HOH A O   1 
HETATM 8641 O O   . HOH K 6 .   ? 37.348  17.255  -6.024  1.00 55.45 ? 1122 HOH A O   1 
HETATM 8642 O O   . HOH K 6 .   ? 30.022  18.366  12.261  1.00 65.71 ? 1123 HOH A O   1 
HETATM 8643 O O   . HOH K 6 .   ? 21.833  25.471  23.427  1.00 49.93 ? 1124 HOH A O   1 
HETATM 8644 O O   . HOH K 6 .   ? 50.043  0.665   16.047  1.00 68.31 ? 1125 HOH A O   1 
HETATM 8645 O O   . HOH K 6 .   ? 11.241  26.434  -8.024  1.00 68.19 ? 1126 HOH A O   1 
HETATM 8646 O O   . HOH K 6 .   ? 52.243  25.855  3.766   1.00 53.32 ? 1127 HOH A O   1 
HETATM 8647 O O   . HOH K 6 .   ? 49.836  25.653  4.539   1.00 61.15 ? 1128 HOH A O   1 
HETATM 8648 O O   . HOH K 6 .   ? 51.804  27.678  1.410   1.00 62.97 ? 1129 HOH A O   1 
HETATM 8649 O O   . HOH K 6 .   ? 34.207  8.460   -1.071  1.00 60.91 ? 1130 HOH A O   1 
HETATM 8650 O O   . HOH K 6 .   ? 33.164  9.773   -3.386  1.00 55.49 ? 1131 HOH A O   1 
HETATM 8651 O O   . HOH K 6 .   ? 31.694  4.855   -4.729  1.00 53.45 ? 1132 HOH A O   1 
HETATM 8652 O O   . HOH K 6 .   ? 37.975  8.354   0.488   1.00 53.70 ? 1133 HOH A O   1 
HETATM 8653 O O   . HOH K 6 .   ? 31.656  6.348   0.441   1.00 59.56 ? 1134 HOH A O   1 
HETATM 8654 O O   . HOH K 6 .   ? 42.098  13.566  36.108  1.00 55.65 ? 1135 HOH A O   1 
HETATM 8655 O O   . HOH K 6 .   ? 46.148  21.575  27.896  1.00 56.94 ? 1136 HOH A O   1 
HETATM 8656 O O   . HOH K 6 .   ? 56.862  13.817  25.474  1.00 56.31 ? 1137 HOH A O   1 
HETATM 8657 O O   . HOH K 6 .   ? 37.450  15.304  51.097  1.00 58.85 ? 1138 HOH A O   1 
HETATM 8658 O O   . HOH K 6 .   ? 40.385  6.088   46.642  1.00 55.92 ? 1139 HOH A O   1 
HETATM 8659 O O   . HOH K 6 .   ? 41.474  2.379   46.651  1.00 53.66 ? 1140 HOH A O   1 
HETATM 8660 O O   . HOH K 6 .   ? 43.728  4.052   47.009  1.00 60.87 ? 1141 HOH A O   1 
HETATM 8661 O O   . HOH K 6 .   ? 46.210  6.025   43.315  1.00 49.29 ? 1142 HOH A O   1 
HETATM 8662 O O   . HOH K 6 .   ? 9.080   -7.071  6.192   1.00 67.48 ? 1143 HOH A O   1 
HETATM 8663 O O   . HOH K 6 .   ? 8.608   -5.179  10.065  1.00 69.82 ? 1144 HOH A O   1 
HETATM 8664 O O   . HOH K 6 .   ? 25.760  -5.010  39.323  1.00 50.59 ? 1145 HOH A O   1 
HETATM 8665 O O   . HOH K 6 .   ? 22.402  -1.809  39.471  1.00 59.10 ? 1146 HOH A O   1 
HETATM 8666 O O   . HOH K 6 .   ? 27.589  -6.627  35.364  1.00 55.63 ? 1147 HOH A O   1 
HETATM 8667 O O   . HOH K 6 .   ? 33.156  -4.788  35.480  1.00 63.35 ? 1148 HOH A O   1 
HETATM 8668 O O   . HOH K 6 .   ? 25.016  -6.559  37.208  1.00 65.34 ? 1149 HOH A O   1 
HETATM 8669 O O   . HOH K 6 .   ? 22.273  -5.819  36.921  1.00 67.53 ? 1150 HOH A O   1 
HETATM 8670 O O   . HOH K 6 .   ? 33.985  -5.674  38.425  1.00 56.65 ? 1151 HOH A O   1 
HETATM 8671 O O   . HOH K 6 .   ? 31.907  24.105  16.546  1.00 61.10 ? 1152 HOH A O   1 
HETATM 8672 O O   . HOH K 6 .   ? 27.854  26.076  23.823  1.00 55.79 ? 1153 HOH A O   1 
HETATM 8673 O O   . HOH K 6 .   ? 12.439  16.824  -14.463 1.00 64.73 ? 1154 HOH A O   1 
HETATM 8674 O O   . HOH K 6 .   ? 16.414  -2.946  29.969  1.00 49.73 ? 1155 HOH A O   1 
HETATM 8675 O O   . HOH K 6 .   ? 19.539  -5.658  28.357  1.00 54.56 ? 1156 HOH A O   1 
HETATM 8676 O O   . HOH K 6 .   ? 22.152  -8.199  29.412  1.00 70.66 ? 1157 HOH A O   1 
HETATM 8677 O O   . HOH K 6 .   ? 29.090  23.190  35.630  1.00 56.85 ? 1158 HOH A O   1 
HETATM 8678 O O   . HOH K 6 .   ? 25.091  22.421  35.129  1.00 70.43 ? 1159 HOH A O   1 
HETATM 8679 O O   . HOH K 6 .   ? 26.690  23.036  38.364  1.00 73.55 ? 1160 HOH A O   1 
HETATM 8680 O O   . HOH K 6 .   ? 36.254  8.026   -14.302 1.00 70.00 ? 1161 HOH A O   1 
HETATM 8681 O O   . HOH K 6 .   ? 38.914  7.798   -12.987 1.00 65.51 ? 1162 HOH A O   1 
HETATM 8682 O O   . HOH K 6 .   ? 39.471  11.177  -9.125  1.00 72.78 ? 1163 HOH A O   1 
HETATM 8683 O O   . HOH K 6 .   ? 12.138  22.827  -9.783  1.00 57.44 ? 1164 HOH A O   1 
HETATM 8684 O O   . HOH K 6 .   ? 25.690  23.360  -17.164 1.00 68.20 ? 1165 HOH A O   1 
HETATM 8685 O O   . HOH K 6 .   ? 46.507  13.952  -1.463  1.00 60.18 ? 1166 HOH A O   1 
HETATM 8686 O O   . HOH K 6 .   ? 46.736  8.615   0.626   1.00 58.84 ? 1167 HOH A O   1 
HETATM 8687 O O   . HOH K 6 .   ? 42.364  6.745   0.653   1.00 60.60 ? 1168 HOH A O   1 
HETATM 8688 O O   . HOH K 6 .   ? 39.630  2.577   4.226   1.00 52.84 ? 1169 HOH A O   1 
HETATM 8689 O O   . HOH K 6 .   ? 41.713  0.781   4.640   1.00 50.70 ? 1170 HOH A O   1 
HETATM 8690 O O   . HOH K 6 .   ? 46.239  2.068   3.374   1.00 52.93 ? 1171 HOH A O   1 
HETATM 8691 O O   . HOH K 6 .   ? 45.638  3.523   45.067  1.00 57.85 ? 1172 HOH A O   1 
HETATM 8692 O O   . HOH K 6 .   ? 44.693  -1.541  40.093  1.00 53.08 ? 1173 HOH A O   1 
HETATM 8693 O O   . HOH K 6 .   ? 47.667  -1.540  40.787  1.00 63.10 ? 1174 HOH A O   1 
HETATM 8694 O O   . HOH K 6 .   ? 33.316  29.273  23.353  1.00 71.02 ? 1175 HOH A O   1 
HETATM 8695 O O   . HOH K 6 .   ? 43.956  24.753  10.015  1.00 67.23 ? 1176 HOH A O   1 
HETATM 8696 O O   . HOH K 6 .   ? 20.408  6.564   47.132  1.00 63.08 ? 1177 HOH A O   1 
HETATM 8697 O O   . HOH K 6 .   ? 22.973  4.128   47.759  1.00 53.23 ? 1178 HOH A O   1 
HETATM 8698 O O   . HOH K 6 .   ? 38.466  4.611   34.547  1.00 47.00 ? 1179 HOH A O   1 
HETATM 8699 O O   . HOH K 6 .   ? 48.926  12.295  32.950  1.00 55.54 ? 1180 HOH A O   1 
HETATM 8700 O O   . HOH K 6 .   ? 15.434  9.341   -8.415  1.00 60.70 ? 1181 HOH A O   1 
HETATM 8701 O O   . HOH K 6 .   ? 12.112  5.904   -1.545  1.00 63.28 ? 1182 HOH A O   1 
HETATM 8702 O O   . HOH K 6 .   ? 9.602   6.930   1.063   1.00 54.70 ? 1183 HOH A O   1 
HETATM 8703 O O   . HOH K 6 .   ? 10.200  10.650  3.640   1.00 48.75 ? 1184 HOH A O   1 
HETATM 8704 O O   . HOH K 6 .   ? 12.782  6.299   -4.194  1.00 59.53 ? 1185 HOH A O   1 
HETATM 8705 O O   . HOH K 6 .   ? 11.951  25.660  6.166   1.00 55.97 ? 1186 HOH A O   1 
HETATM 8706 O O   . HOH K 6 .   ? 8.215   21.683  10.685  1.00 51.01 ? 1187 HOH A O   1 
HETATM 8707 O O   . HOH K 6 .   ? 17.103  17.096  0.858   1.00 60.81 ? 1188 HOH A O   1 
HETATM 8708 O O   . HOH K 6 .   ? 16.143  17.831  -4.721  1.00 60.56 ? 1189 HOH A O   1 
HETATM 8709 O O   . HOH K 6 .   ? 8.406   17.966  33.154  1.00 59.39 ? 1190 HOH A O   1 
HETATM 8710 O O   . HOH K 6 .   ? 19.202  27.883  16.397  1.00 71.96 ? 1191 HOH A O   1 
HETATM 8711 O O   . HOH K 6 .   ? 17.412  25.656  22.437  1.00 65.44 ? 1192 HOH A O   1 
HETATM 8712 O O   . HOH K 6 .   ? 8.585   29.129  19.934  1.00 62.94 ? 1193 HOH A O   1 
HETATM 8713 O O   . HOH K 6 .   ? 50.882  7.416   2.984   1.00 52.12 ? 1194 HOH A O   1 
HETATM 8714 O O   . HOH K 6 .   ? 53.350  11.587  2.801   1.00 52.38 ? 1195 HOH A O   1 
HETATM 8715 O O   . HOH K 6 .   ? 32.854  -5.698  31.054  1.00 63.06 ? 1196 HOH A O   1 
HETATM 8716 O O   . HOH K 6 .   ? 6.624   25.188  14.963  1.00 59.69 ? 1197 HOH A O   1 
HETATM 8717 O O   . HOH K 6 .   ? 58.838  21.316  8.208   1.00 58.01 ? 1198 HOH A O   1 
HETATM 8718 O O   . HOH K 6 .   ? 53.844  8.460   29.068  1.00 69.39 ? 1199 HOH A O   1 
HETATM 8719 O O   . HOH K 6 .   ? 51.331  13.042  31.430  1.00 56.53 ? 1200 HOH A O   1 
HETATM 8720 O O   . HOH K 6 .   ? 54.665  13.774  30.417  1.00 62.19 ? 1201 HOH A O   1 
HETATM 8721 O O   . HOH K 6 .   ? 4.119   11.767  11.254  1.00 54.81 ? 1202 HOH A O   1 
HETATM 8722 O O   . HOH K 6 .   ? 0.559   10.569  18.361  1.00 66.11 ? 1203 HOH A O   1 
HETATM 8723 O O   . HOH K 6 .   ? 3.783   12.995  8.576   1.00 66.70 ? 1204 HOH A O   1 
HETATM 8724 O O   . HOH K 6 .   ? 0.959   11.278  8.723   1.00 70.79 ? 1205 HOH A O   1 
HETATM 8725 O O   . HOH K 6 .   ? 49.153  4.308   27.053  1.00 62.07 ? 1206 HOH A O   1 
HETATM 8726 O O   . HOH K 6 .   ? 34.538  23.501  -7.373  1.00 51.36 ? 1207 HOH A O   1 
HETATM 8727 O O   . HOH K 6 .   ? 34.639  24.015  -10.022 1.00 55.25 ? 1208 HOH A O   1 
HETATM 8728 O O   . HOH K 6 .   ? 26.558  -7.561  25.559  1.00 66.62 ? 1209 HOH A O   1 
HETATM 8729 O O   . HOH K 6 .   ? 24.186  -8.358  24.441  1.00 61.73 ? 1210 HOH A O   1 
HETATM 8730 O O   . HOH K 6 .   ? 30.328  31.707  -6.874  1.00 55.86 ? 1211 HOH A O   1 
HETATM 8731 O O   . HOH K 6 .   ? 31.227  28.827  -7.600  1.00 57.08 ? 1212 HOH A O   1 
HETATM 8732 O O   . HOH K 6 .   ? 33.824  28.232  -8.076  1.00 52.99 ? 1213 HOH A O   1 
HETATM 8733 O O   . HOH K 6 .   ? 31.129  25.510  -12.804 1.00 53.95 ? 1214 HOH A O   1 
HETATM 8734 O O   . HOH K 6 .   ? 21.524  24.593  31.949  1.00 68.55 ? 1215 HOH A O   1 
HETATM 8735 O O   . HOH K 6 .   ? 17.200  23.400  32.647  1.00 64.47 ? 1216 HOH A O   1 
HETATM 8736 O O   . HOH K 6 .   ? 30.241  29.348  25.193  1.00 56.17 ? 1217 HOH A O   1 
HETATM 8737 O O   . HOH K 6 .   ? 7.685   20.968  31.795  1.00 61.49 ? 1218 HOH A O   1 
HETATM 8738 O O   . HOH K 6 .   ? 6.642   26.259  26.548  1.00 72.72 ? 1219 HOH A O   1 
HETATM 8739 O O   . HOH K 6 .   ? 14.308  9.816   50.971  1.00 58.25 ? 1220 HOH A O   1 
HETATM 8740 O O   . HOH K 6 .   ? 21.316  19.341  47.941  1.00 55.71 ? 1221 HOH A O   1 
HETATM 8741 O O   . HOH K 6 .   ? 47.069  16.525  -1.116  1.00 58.06 ? 1222 HOH A O   1 
HETATM 8742 O O   . HOH K 6 .   ? 52.330  14.004  3.540   1.00 49.63 ? 1223 HOH A O   1 
HETATM 8743 O O   . HOH K 6 .   ? 50.838  14.867  1.412   1.00 46.70 ? 1224 HOH A O   1 
HETATM 8744 O O   . HOH K 6 .   ? 47.702  0.156   11.926  1.00 57.11 ? 1225 HOH A O   1 
HETATM 8745 O O   . HOH K 6 .   ? 31.442  14.917  51.959  1.00 65.70 ? 1226 HOH A O   1 
HETATM 8746 O O   . HOH K 6 .   ? 26.192  19.669  46.308  1.00 57.83 ? 1227 HOH A O   1 
HETATM 8747 O O   . HOH K 6 .   ? 21.306  34.558  17.343  1.00 59.31 ? 1228 HOH A O   1 
HETATM 8748 O O   . HOH K 6 .   ? 5.244   24.464  17.048  1.00 64.03 ? 1229 HOH A O   1 
HETATM 8749 O O   . HOH K 6 .   ? 40.358  -2.777  19.656  1.00 59.69 ? 1230 HOH A O   1 
HETATM 8750 O O   . HOH K 6 .   ? 42.973  -0.476  19.468  1.00 65.10 ? 1231 HOH A O   1 
HETATM 8751 O O   . HOH K 6 .   ? 39.386  -4.918  17.704  1.00 64.29 ? 1232 HOH A O   1 
HETATM 8752 O O   . HOH K 6 .   ? 14.143  5.124   37.331  1.00 59.15 ? 1233 HOH A O   1 
HETATM 8753 O O   . HOH K 6 .   ? 12.718  10.927  37.915  1.00 54.35 ? 1234 HOH A O   1 
HETATM 8754 O O   . HOH K 6 .   ? 17.302  3.012   0.479   1.00 57.96 ? 1235 HOH A O   1 
HETATM 8755 O O   . HOH K 6 .   ? 18.255  1.824   -2.520  1.00 56.85 ? 1236 HOH A O   1 
HETATM 8756 O O   . HOH K 6 .   ? 30.647  19.597  -11.478 1.00 55.28 ? 1237 HOH A O   1 
HETATM 8757 O O   . HOH K 6 .   ? 59.158  21.156  2.939   1.00 60.16 ? 1238 HOH A O   1 
HETATM 8758 O O   . HOH K 6 .   ? 23.692  32.927  -4.110  1.00 56.97 ? 1239 HOH A O   1 
HETATM 8759 O O   . HOH K 6 .   ? 35.067  -3.478  31.144  1.00 57.37 ? 1240 HOH A O   1 
HETATM 8760 O O   . HOH K 6 .   ? 29.645  7.670   -1.584  1.00 54.29 ? 1241 HOH A O   1 
HETATM 8761 O O   . HOH K 6 .   ? 0.083   11.323  10.918  1.00 63.35 ? 1242 HOH A O   1 
HETATM 8762 O O   . HOH K 6 .   ? 37.762  17.826  43.943  1.00 59.18 ? 1243 HOH A O   1 
HETATM 8763 O O   . HOH K 6 .   ? 21.650  0.652   -0.244  1.00 63.14 ? 1244 HOH A O   1 
HETATM 8764 O O   . HOH K 6 .   ? 33.008  -7.066  14.202  1.00 61.79 ? 1245 HOH A O   1 
HETATM 8765 O O   . HOH K 6 .   ? 15.747  -7.835  6.628   1.00 66.71 ? 1246 HOH A O   1 
HETATM 8766 O O   . HOH K 6 .   ? 25.177  13.950  55.810  1.00 48.95 ? 1247 HOH A O   1 
HETATM 8767 O O   . HOH K 6 .   ? 18.203  -8.969  17.318  1.00 72.87 ? 1248 HOH A O   1 
HETATM 8768 O O   . HOH K 6 .   ? 15.346  -9.681  14.283  1.00 71.59 ? 1249 HOH A O   1 
HETATM 8769 O O   . HOH K 6 .   ? 4.141   -2.447  17.830  1.00 57.97 ? 1250 HOH A O   1 
HETATM 8770 O O   . HOH K 6 .   ? 24.350  19.603  50.468  1.00 66.56 ? 1251 HOH A O   1 
HETATM 8771 O O   . HOH K 6 .   ? 19.901  22.538  29.028  1.00 65.33 ? 1252 HOH A O   1 
HETATM 8772 O O   . HOH K 6 .   ? 44.346  2.071   18.714  1.00 60.45 ? 1253 HOH A O   1 
HETATM 8773 O O   . HOH K 6 .   ? 35.251  8.922   -8.321  1.00 56.01 ? 1254 HOH A O   1 
HETATM 8774 O O   . HOH K 6 .   ? 43.871  16.540  36.300  1.00 60.41 ? 1255 HOH A O   1 
HETATM 8775 O O   . HOH K 6 .   ? 59.121  8.249   22.243  1.00 69.39 ? 1256 HOH A O   1 
HETATM 8776 O O   . HOH K 6 .   ? 55.990  16.127  25.925  1.00 66.29 ? 1257 HOH A O   1 
HETATM 8777 O O   . HOH K 6 .   ? 23.062  -4.242  39.155  1.00 59.83 ? 1258 HOH A O   1 
HETATM 8778 O O   . HOH K 6 .   ? 26.950  -6.117  32.628  1.00 58.68 ? 1259 HOH A O   1 
HETATM 8779 O O   . HOH K 6 .   ? 26.300  -7.316  30.501  1.00 62.09 ? 1260 HOH A O   1 
HETATM 8780 O O   . HOH K 6 .   ? 15.101  -3.160  32.463  1.00 54.71 ? 1261 HOH A O   1 
HETATM 8781 O O   . HOH K 6 .   ? 32.851  24.441  35.228  1.00 66.06 ? 1262 HOH A O   1 
HETATM 8782 O O   . HOH K 6 .   ? 15.450  26.371  -15.974 1.00 63.43 ? 1263 HOH A O   1 
HETATM 8783 O O   . HOH K 6 .   ? 25.335  20.847  -16.980 1.00 58.72 ? 1264 HOH A O   1 
HETATM 8784 O O   . HOH K 6 .   ? 46.194  -0.752  43.737  1.00 58.67 ? 1265 HOH A O   1 
HETATM 8785 O O   . HOH K 6 .   ? 31.548  22.061  9.211   1.00 78.81 ? 1266 HOH A O   1 
HETATM 8786 O O   . HOH K 6 .   ? 13.388  11.642  -2.265  1.00 70.78 ? 1267 HOH A O   1 
HETATM 8787 O O   . HOH K 6 .   ? 8.003   14.634  35.523  1.00 52.47 ? 1268 HOH A O   1 
HETATM 8788 O O   . HOH K 6 .   ? 51.909  5.184   3.182   1.00 61.50 ? 1269 HOH A O   1 
HETATM 8789 O O   . HOH K 6 .   ? 52.430  9.150   3.576   1.00 58.67 ? 1270 HOH A O   1 
HETATM 8790 O O   . HOH K 6 .   ? 14.680  32.751  6.662   1.00 70.83 ? 1271 HOH A O   1 
HETATM 8791 O O   . HOH K 6 .   ? 60.805  23.354  9.629   1.00 71.11 ? 1272 HOH A O   1 
HETATM 8792 O O   . HOH K 6 .   ? 0.378   13.115  18.622  1.00 72.59 ? 1273 HOH A O   1 
HETATM 8793 O O   . HOH K 6 .   ? 43.754  0.475   29.604  1.00 70.89 ? 1274 HOH A O   1 
HETATM 8794 O O   . HOH K 6 .   ? 30.540  28.999  -10.133 1.00 55.82 ? 1275 HOH A O   1 
HETATM 8795 O O   . HOH K 6 .   ? 32.331  27.745  -11.804 1.00 62.02 ? 1276 HOH A O   1 
HETATM 8796 O O   . HOH K 6 .   ? 29.934  32.823  -0.820  1.00 72.20 ? 1277 HOH A O   1 
HETATM 8797 O O   . HOH K 6 .   ? 16.308  7.963   49.947  1.00 67.68 ? 1278 HOH A O   1 
HETATM 8798 O O   . HOH K 6 .   ? 18.689  15.067  51.390  1.00 56.69 ? 1279 HOH A O   1 
HETATM 8799 O O   . HOH K 6 .   ? 34.813  -8.144  38.255  1.00 64.40 ? 1280 HOH A O   1 
HETATM 8800 O O   . HOH K 6 .   ? 12.539  14.576  40.636  1.00 52.61 ? 1281 HOH A O   1 
HETATM 8801 O O   . HOH K 6 .   ? 13.771  12.188  39.936  1.00 58.06 ? 1282 HOH A O   1 
HETATM 8802 O O   . HOH K 6 .   ? 12.329  8.824   0.773   1.00 70.51 ? 1283 HOH A O   1 
HETATM 8803 O O   . HOH K 6 .   ? 41.193  -6.427  15.161  1.00 64.86 ? 1284 HOH A O   1 
HETATM 8804 O O   . HOH K 6 .   ? 14.280  2.387   37.809  1.00 68.11 ? 1285 HOH A O   1 
HETATM 8805 O O   . HOH K 6 .   ? 20.734  0.696   -2.921  1.00 62.33 ? 1286 HOH A O   1 
HETATM 8806 O O   . HOH K 6 .   ? 39.269  13.359  -7.562  1.00 75.53 ? 1287 HOH A O   1 
HETATM 8807 O O   . HOH K 6 .   ? 30.328  17.994  -13.190 1.00 61.82 ? 1288 HOH A O   1 
HETATM 8808 O O   . HOH K 6 .   ? 6.140   5.532   1.369   1.00 55.98 ? 1289 HOH A O   1 
HETATM 8809 O O   . HOH K 6 .   ? 39.451  16.060  47.069  1.00 64.72 ? 1290 HOH A O   1 
HETATM 8810 O O   . HOH K 6 .   ? 5.969   -3.622  19.251  1.00 63.31 ? 1291 HOH A O   1 
HETATM 8811 O O   . HOH K 6 .   ? 32.746  23.400  -11.849 1.00 61.13 ? 1292 HOH A O   1 
HETATM 8812 O O   . HOH K 6 .   ? 30.329  25.436  -15.310 1.00 57.02 ? 1293 HOH A O   1 
HETATM 8813 O O   . HOH K 6 .   ? 14.171  23.683  35.317  1.00 67.19 ? 1294 HOH A O   1 
HETATM 8814 O O   . HOH K 6 .   ? 42.389  25.956  12.529  1.00 71.69 ? 1295 HOH A O   1 
HETATM 8815 O O   . HOH K 6 .   ? 27.668  15.412  54.714  1.00 66.98 ? 1296 HOH A O   1 
HETATM 8816 O O   . HOH K 6 .   ? 32.045  6.305   -8.817  1.00 63.15 ? 1297 HOH A O   1 
HETATM 8817 O O   . HOH K 6 .   ? 38.960  21.354  2.190   1.00 65.73 ? 1298 HOH A O   1 
HETATM 8818 O O   . HOH K 6 .   ? 41.983  11.224  -0.903  1.00 60.55 ? 1299 HOH A O   1 
HETATM 8819 O O   . HOH K 6 .   ? 29.287  -4.910  36.240  1.00 56.29 ? 1300 HOH A O   1 
HETATM 8820 O O   . HOH K 6 .   ? 35.518  0.917   1.903   1.00 66.96 ? 1301 HOH A O   1 
HETATM 8821 O O   . HOH K 6 .   ? 19.757  9.493   46.482  1.00 59.16 ? 1302 HOH A O   1 
HETATM 8822 O O   . HOH K 6 .   ? 42.758  27.776  14.858  1.00 71.02 ? 1303 HOH A O   1 
HETATM 8823 O O   . HOH K 6 .   ? 34.627  20.249  -12.734 1.00 61.03 ? 1304 HOH A O   1 
HETATM 8824 O O   . HOH K 6 .   ? 27.248  32.123  -11.686 1.00 59.98 ? 1305 HOH A O   1 
HETATM 8825 O O   . HOH K 6 .   ? 2.316   27.338  22.272  1.00 66.92 ? 1306 HOH A O   1 
HETATM 8826 O O   . HOH K 6 .   ? 50.783  17.321  0.166   1.00 58.32 ? 1307 HOH A O   1 
HETATM 8827 O O   . HOH K 6 .   ? 22.440  29.084  -14.668 1.00 62.57 ? 1308 HOH A O   1 
HETATM 8828 O O   . HOH K 6 .   ? 28.794  35.857  21.395  1.00 64.26 ? 1309 HOH A O   1 
HETATM 8829 O O   . HOH K 6 .   ? 49.100  1.831   3.622   1.00 71.28 ? 1310 HOH A O   1 
HETATM 8830 O O   . HOH K 6 .   ? 48.823  -0.337  5.575   1.00 64.43 ? 1311 HOH A O   1 
HETATM 8831 O O   . HOH K 6 .   ? 42.506  -7.300  10.568  1.00 66.24 ? 1312 HOH A O   1 
HETATM 8832 O O   . HOH K 6 .   ? 8.750   -1.032  24.283  1.00 72.45 ? 1313 HOH A O   1 
HETATM 8833 O O   . HOH K 6 .   ? 11.451  12.897  2.917   1.00 67.04 ? 1314 HOH A O   1 
HETATM 8834 O O   . HOH K 6 .   ? 23.384  -3.679  -7.353  1.00 69.00 ? 1315 HOH A O   1 
HETATM 8835 O O   . HOH K 6 .   ? 33.073  -9.685  10.126  1.00 79.98 ? 1316 HOH A O   1 
HETATM 8836 O O   . HOH K 6 .   ? 13.828  2.305   40.954  1.00 74.96 ? 1317 HOH A O   1 
HETATM 8837 O O   . HOH K 6 .   ? 32.673  16.831  -14.088 1.00 58.84 ? 1318 HOH A O   1 
HETATM 8838 O O   . HOH K 6 .   ? 27.502  22.558  45.268  1.00 70.15 ? 1319 HOH A O   1 
HETATM 8839 O O   . HOH K 6 .   ? 8.448   24.328  35.076  1.00 71.23 ? 1320 HOH A O   1 
HETATM 8840 O O   . HOH K 6 .   ? 8.374   21.328  40.637  1.00 71.94 ? 1321 HOH A O   1 
HETATM 8841 O O   . HOH K 6 .   ? 39.277  0.267   33.572  1.00 64.65 ? 1322 HOH A O   1 
HETATM 8842 O O   . HOH K 6 .   ? 37.696  8.112   50.550  1.00 63.94 ? 1323 HOH A O   1 
HETATM 8843 O O   . HOH K 6 .   ? 24.901  29.523  22.758  1.00 82.52 ? 1324 HOH A O   1 
HETATM 8844 O O   . HOH K 6 .   ? 57.060  3.417   16.333  1.00 62.67 ? 1325 HOH A O   1 
HETATM 8845 O O   . HOH K 6 .   ? 18.872  -5.844  32.664  1.00 65.24 ? 1326 HOH A O   1 
HETATM 8846 O O   . HOH K 6 .   ? 62.639  18.067  12.712  1.00 78.79 ? 1327 HOH A O   1 
HETATM 8847 O O   . HOH K 6 .   ? 61.652  16.736  19.371  1.00 65.91 ? 1328 HOH A O   1 
HETATM 8848 O O   . HOH K 6 .   ? 48.286  26.145  23.126  1.00 55.77 ? 1329 HOH A O   1 
HETATM 8849 O O   . HOH K 6 .   ? 53.962  28.606  18.665  1.00 68.04 ? 1330 HOH A O   1 
HETATM 8850 O O   . HOH K 6 .   ? 44.761  28.732  11.182  1.00 61.45 ? 1331 HOH A O   1 
HETATM 8851 O O   . HOH K 6 .   ? 40.415  20.323  -4.617  1.00 69.00 ? 1332 HOH A O   1 
HETATM 8852 O O   . HOH K 6 .   ? 46.738  -0.761  17.203  1.00 65.46 ? 1333 HOH A O   1 
HETATM 8853 O O   . HOH K 6 .   ? 37.818  -8.632  9.928   1.00 67.35 ? 1334 HOH A O   1 
HETATM 8854 O O   . HOH K 6 .   ? 13.891  14.736  3.423   1.00 61.34 ? 1335 HOH A O   1 
HETATM 8855 O O   . HOH K 6 .   ? 34.562  27.271  -10.058 1.00 61.86 ? 1336 HOH A O   1 
HETATM 8856 O O   . HOH K 6 .   ? 17.330  13.252  -3.051  1.00 59.62 ? 1337 HOH A O   1 
HETATM 8857 O O   . HOH K 6 .   ? 51.968  27.393  -1.996  1.00 70.35 ? 1338 HOH A O   1 
HETATM 8858 O O   . HOH K 6 .   ? 9.503   32.071  28.564  1.00 82.10 ? 1339 HOH A O   1 
HETATM 8859 O O   . HOH K 6 .   ? 7.942   -2.090  -0.056  1.00 77.59 ? 1340 HOH A O   1 
HETATM 8860 O O   . HOH K 6 .   ? 10.252  3.502   33.633  1.00 77.68 ? 1341 HOH A O   1 
HETATM 8861 O O   . HOH K 6 .   ? 13.787  39.588  25.767  1.00 76.16 ? 1342 HOH A O   1 
HETATM 8862 O O   . HOH K 6 .   ? 20.186  7.660   -12.552 1.00 77.75 ? 1343 HOH A O   1 
HETATM 8863 O O   . HOH K 6 .   ? 56.180  25.420  18.255  1.00 77.12 ? 1344 HOH A O   1 
HETATM 8864 O O   . HOH K 6 .   ? 28.444  1.499   -0.982  1.00 68.60 ? 1345 HOH A O   1 
HETATM 8865 O O   . HOH K 6 .   ? 61.621  23.033  16.866  1.00 73.55 ? 1346 HOH A O   1 
HETATM 8866 O O   . HOH K 6 .   ? 20.000  -6.101  -2.565  1.00 63.62 ? 1347 HOH A O   1 
HETATM 8867 O O   . HOH K 6 .   ? 61.849  3.219   17.979  1.00 75.48 ? 1348 HOH A O   1 
HETATM 8868 O O   . HOH L 6 .   ? 3.867   4.000   -33.681 1.00 39.04 ? 963  HOH B O   1 
HETATM 8869 O O   . HOH L 6 .   ? 6.426   24.051  -24.956 1.00 41.26 ? 964  HOH B O   1 
HETATM 8870 O O   . HOH L 6 .   ? 22.169  -6.516  -33.110 1.00 58.95 ? 965  HOH B O   1 
HETATM 8871 O O   . HOH L 6 .   ? 0.187   19.487  -46.964 1.00 39.38 ? 966  HOH B O   1 
HETATM 8872 O O   . HOH L 6 .   ? 4.371   4.611   -48.139 1.00 42.91 ? 967  HOH B O   1 
HETATM 8873 O O   . HOH L 6 .   ? 4.386   0.900   -68.978 1.00 40.16 ? 968  HOH B O   1 
HETATM 8874 O O   . HOH L 6 .   ? 5.450   -1.638  -28.846 1.00 47.93 ? 969  HOH B O   1 
HETATM 8875 O O   . HOH L 6 .   ? 16.339  -3.455  -42.639 1.00 48.31 ? 970  HOH B O   1 
HETATM 8876 O O   . HOH L 6 .   ? 17.192  5.277   -34.676 1.00 40.76 ? 971  HOH B O   1 
HETATM 8877 O O   . HOH L 6 .   ? 3.553   20.106  -28.226 1.00 38.93 ? 972  HOH B O   1 
HETATM 8878 O O   . HOH L 6 .   ? 12.509  -4.812  -51.530 1.00 40.23 ? 973  HOH B O   1 
HETATM 8879 O O   . HOH L 6 .   ? 13.426  6.425   -33.185 1.00 44.35 ? 974  HOH B O   1 
HETATM 8880 O O   . HOH L 6 .   ? 19.300  -1.413  -37.227 1.00 39.76 ? 975  HOH B O   1 
HETATM 8881 O O   . HOH L 6 .   ? 6.268   16.535  -53.448 1.00 45.78 ? 976  HOH B O   1 
HETATM 8882 O O   . HOH L 6 .   ? -0.075  26.825  -32.294 1.00 38.91 ? 977  HOH B O   1 
HETATM 8883 O O   . HOH L 6 .   ? 3.184   7.770   -32.875 1.00 42.66 ? 978  HOH B O   1 
HETATM 8884 O O   . HOH L 6 .   ? 17.504  -3.199  -55.571 1.00 41.00 ? 979  HOH B O   1 
HETATM 8885 O O   . HOH L 6 .   ? 12.865  14.881  -22.709 1.00 43.98 ? 980  HOH B O   1 
HETATM 8886 O O   . HOH L 6 .   ? 9.184   1.205   -68.060 1.00 53.26 ? 981  HOH B O   1 
HETATM 8887 O O   . HOH L 6 .   ? 6.901   -8.476  -44.304 1.00 47.51 ? 982  HOH B O   1 
HETATM 8888 O O   . HOH L 6 .   ? 13.256  -8.130  -46.054 1.00 48.47 ? 983  HOH B O   1 
HETATM 8889 O O   . HOH L 6 .   ? -7.670  7.557   -44.783 1.00 46.86 ? 984  HOH B O   1 
HETATM 8890 O O   . HOH L 6 .   ? 9.004   -1.181  -60.432 1.00 39.24 ? 985  HOH B O   1 
HETATM 8891 O O   . HOH L 6 .   ? 8.396   24.859  -31.560 1.00 42.57 ? 986  HOH B O   1 
HETATM 8892 O O   . HOH L 6 .   ? 1.914   19.087  -59.980 1.00 48.74 ? 987  HOH B O   1 
HETATM 8893 O O   . HOH L 6 .   ? 10.432  -0.180  -43.748 1.00 42.10 ? 988  HOH B O   1 
HETATM 8894 O O   . HOH L 6 .   ? -6.896  13.567  -26.304 1.00 48.44 ? 989  HOH B O   1 
HETATM 8895 O O   . HOH L 6 .   ? 6.504   -0.230  -64.433 1.00 47.70 ? 990  HOH B O   1 
HETATM 8896 O O   . HOH L 6 .   ? 23.226  -3.181  -34.446 1.00 47.16 ? 991  HOH B O   1 
HETATM 8897 O O   . HOH L 6 .   ? 4.321   -1.178  -43.098 1.00 40.65 ? 992  HOH B O   1 
HETATM 8898 O O   . HOH L 6 .   ? -3.722  1.018   -48.409 1.00 46.63 ? 993  HOH B O   1 
HETATM 8899 O O   . HOH L 6 .   ? 11.145  16.848  -22.939 1.00 46.93 ? 994  HOH B O   1 
HETATM 8900 O O   . HOH L 6 .   ? -16.194 8.865   -45.225 1.00 58.53 ? 995  HOH B O   1 
HETATM 8901 O O   . HOH L 6 .   ? 14.225  -7.555  -48.488 1.00 45.50 ? 996  HOH B O   1 
HETATM 8902 O O   . HOH L 6 .   ? 4.310   2.100   -40.637 1.00 42.12 ? 997  HOH B O   1 
HETATM 8903 O O   . HOH L 6 .   ? 8.103   -0.882  -66.823 1.00 47.32 ? 998  HOH B O   1 
HETATM 8904 O O   . HOH L 6 .   ? 20.880  1.030   -51.039 1.00 56.52 ? 999  HOH B O   1 
HETATM 8905 O O   . HOH L 6 .   ? 20.691  6.776   -36.410 1.00 44.15 ? 1000 HOH B O   1 
HETATM 8906 O O   . HOH L 6 .   ? 0.377   0.168   -55.730 1.00 44.11 ? 1001 HOH B O   1 
HETATM 8907 O O   . HOH L 6 .   ? 13.204  -6.854  -33.097 1.00 54.16 ? 1002 HOH B O   1 
HETATM 8908 O O   . HOH L 6 .   ? 22.919  0.332   -52.945 1.00 44.81 ? 1003 HOH B O   1 
HETATM 8909 O O   . HOH L 6 .   ? -6.444  18.889  -46.490 1.00 64.51 ? 1004 HOH B O   1 
HETATM 8910 O O   . HOH L 6 .   ? 23.894  -2.737  -43.832 1.00 41.61 ? 1005 HOH B O   1 
HETATM 8911 O O   . HOH L 6 .   ? 4.619   -3.959  -42.325 1.00 43.37 ? 1006 HOH B O   1 
HETATM 8912 O O   . HOH L 6 .   ? -2.677  0.850   -36.588 1.00 49.28 ? 1007 HOH B O   1 
HETATM 8913 O O   . HOH L 6 .   ? 4.574   -13.451 -53.144 1.00 48.43 ? 1008 HOH B O   1 
HETATM 8914 O O   . HOH L 6 .   ? -8.756  7.291   -23.206 1.00 55.08 ? 1009 HOH B O   1 
HETATM 8915 O O   . HOH L 6 .   ? 16.735  -8.441  -48.263 1.00 44.33 ? 1010 HOH B O   1 
HETATM 8916 O O   . HOH L 6 .   ? 25.129  -3.135  -46.399 1.00 50.88 ? 1011 HOH B O   1 
HETATM 8917 O O   . HOH L 6 .   ? 21.841  1.894   -47.293 1.00 50.50 ? 1012 HOH B O   1 
HETATM 8918 O O   . HOH L 6 .   ? -1.819  -3.101  -60.401 1.00 61.86 ? 1013 HOH B O   1 
HETATM 8919 O O   . HOH L 6 .   ? 15.012  2.071   -61.763 1.00 44.37 ? 1014 HOH B O   1 
HETATM 8920 O O   . HOH L 6 .   ? 12.332  27.497  -25.496 1.00 58.41 ? 1015 HOH B O   1 
HETATM 8921 O O   . HOH L 6 .   ? 4.114   10.507  -65.059 1.00 50.28 ? 1016 HOH B O   1 
HETATM 8922 O O   . HOH L 6 .   ? -1.650  -9.644  -20.360 1.00 55.95 ? 1017 HOH B O   1 
HETATM 8923 O O   . HOH L 6 .   ? 1.364   0.060   -53.057 1.00 51.63 ? 1018 HOH B O   1 
HETATM 8924 O O   . HOH L 6 .   ? 27.151  1.533   -37.301 1.00 49.47 ? 1019 HOH B O   1 
HETATM 8925 O O   . HOH L 6 .   ? 8.959   14.159  -17.686 1.00 46.20 ? 1020 HOH B O   1 
HETATM 8926 O O   . HOH L 6 .   ? -1.368  3.835   -48.532 1.00 48.99 ? 1021 HOH B O   1 
HETATM 8927 O O   . HOH L 6 .   ? 11.595  10.590  -16.716 1.00 52.29 ? 1022 HOH B O   1 
HETATM 8928 O O   . HOH L 6 .   ? 10.141  -5.941  -64.276 1.00 49.38 ? 1023 HOH B O   1 
HETATM 8929 O O   . HOH L 6 .   ? -4.760  -1.969  -62.068 1.00 67.82 ? 1024 HOH B O   1 
HETATM 8930 O O   . HOH L 6 .   ? 24.526  -5.096  -24.271 1.00 56.69 ? 1025 HOH B O   1 
HETATM 8931 O O   . HOH L 6 .   ? -2.921  0.185   -22.190 1.00 54.04 ? 1026 HOH B O   1 
HETATM 8932 O O   . HOH L 6 .   ? 31.551  9.106   -45.459 1.00 55.20 ? 1027 HOH B O   1 
HETATM 8933 O O   . HOH L 6 .   ? 1.457   21.139  -18.330 1.00 49.04 ? 1028 HOH B O   1 
HETATM 8934 O O   . HOH L 6 .   ? 12.525  26.164  -28.176 1.00 47.64 ? 1029 HOH B O   1 
HETATM 8935 O O   . HOH L 6 .   ? 22.896  6.859   -52.707 1.00 51.94 ? 1030 HOH B O   1 
HETATM 8936 O O   . HOH L 6 .   ? 20.640  -1.741  -52.196 1.00 52.91 ? 1031 HOH B O   1 
HETATM 8937 O O   . HOH L 6 .   ? 22.331  16.972  -47.795 1.00 48.73 ? 1032 HOH B O   1 
HETATM 8938 O O   . HOH L 6 .   ? 22.602  1.019   -36.038 1.00 43.55 ? 1033 HOH B O   1 
HETATM 8939 O O   . HOH L 6 .   ? 6.604   -2.626  -50.519 1.00 46.13 ? 1034 HOH B O   1 
HETATM 8940 O O   . HOH L 6 .   ? 22.644  15.475  -45.749 1.00 46.49 ? 1035 HOH B O   1 
HETATM 8941 O O   . HOH L 6 .   ? 22.505  15.369  -49.975 1.00 55.89 ? 1036 HOH B O   1 
HETATM 8942 O O   . HOH L 6 .   ? 21.909  -1.689  -36.573 1.00 42.81 ? 1037 HOH B O   1 
HETATM 8943 O O   . HOH L 6 .   ? 12.426  -0.853  -68.088 1.00 49.34 ? 1038 HOH B O   1 
HETATM 8944 O O   . HOH L 6 .   ? 18.681  6.272   -26.925 1.00 49.85 ? 1039 HOH B O   1 
HETATM 8945 O O   . HOH L 6 .   ? 12.425  -5.313  -54.010 1.00 50.80 ? 1040 HOH B O   1 
HETATM 8946 O O   . HOH L 6 .   ? 17.242  0.816   -60.148 1.00 49.26 ? 1041 HOH B O   1 
HETATM 8947 O O   . HOH L 6 .   ? -6.343  -3.556  -55.308 1.00 52.68 ? 1042 HOH B O   1 
HETATM 8948 O O   . HOH L 6 .   ? 9.745   -1.144  -12.107 1.00 68.76 ? 1043 HOH B O   1 
HETATM 8949 O O   . HOH L 6 .   ? 15.721  -4.826  -56.732 1.00 47.66 ? 1044 HOH B O   1 
HETATM 8950 O O   . HOH L 6 .   ? 23.553  9.802   -35.559 1.00 57.93 ? 1045 HOH B O   1 
HETATM 8951 O O   . HOH L 6 .   ? 6.806   4.254   -24.566 1.00 59.14 ? 1046 HOH B O   1 
HETATM 8952 O O   . HOH L 6 .   ? 30.740  10.733  -43.643 1.00 61.14 ? 1047 HOH B O   1 
HETATM 8953 O O   . HOH L 6 .   ? -1.154  26.640  -29.825 1.00 56.46 ? 1048 HOH B O   1 
HETATM 8954 O O   . HOH L 6 .   ? 22.287  -0.396  -27.787 1.00 54.20 ? 1049 HOH B O   1 
HETATM 8955 O O   . HOH L 6 .   ? 24.307  -2.904  -58.744 1.00 58.10 ? 1050 HOH B O   1 
HETATM 8956 O O   . HOH L 6 .   ? 15.771  9.798   -56.459 1.00 44.74 ? 1051 HOH B O   1 
HETATM 8957 O O   . HOH L 6 .   ? -0.888  6.648   -76.603 1.00 59.79 ? 1052 HOH B O   1 
HETATM 8958 O O   . HOH L 6 .   ? 1.632   -2.792  -52.766 1.00 52.13 ? 1053 HOH B O   1 
HETATM 8959 O O   . HOH L 6 .   ? -15.281 0.646   -52.739 1.00 50.14 ? 1054 HOH B O   1 
HETATM 8960 O O   . HOH L 6 .   ? 9.112   3.418   -23.711 1.00 46.25 ? 1055 HOH B O   1 
HETATM 8961 O O   . HOH L 6 .   ? 29.859  6.446   -42.125 1.00 48.11 ? 1056 HOH B O   1 
HETATM 8962 O O   . HOH L 6 .   ? 4.280   -5.667  -45.862 1.00 47.83 ? 1057 HOH B O   1 
HETATM 8963 O O   . HOH L 6 .   ? 10.463  -7.249  -4.974  1.00 56.59 ? 1058 HOH B O   1 
HETATM 8964 O O   . HOH L 6 .   ? 3.805   -13.918 -37.418 1.00 66.79 ? 1059 HOH B O   1 
HETATM 8965 O O   . HOH L 6 .   ? -0.959  -9.868  -55.767 1.00 60.10 ? 1060 HOH B O   1 
HETATM 8966 O O   . HOH L 6 .   ? 7.580   0.702   -61.754 1.00 49.78 ? 1061 HOH B O   1 
HETATM 8967 O O   . HOH L 6 .   ? -0.564  7.312   -72.405 1.00 51.58 ? 1062 HOH B O   1 
HETATM 8968 O O   . HOH L 6 .   ? -3.284  -3.929  -42.527 1.00 50.37 ? 1063 HOH B O   1 
HETATM 8969 O O   . HOH L 6 .   ? 25.017  6.803   -51.366 1.00 55.18 ? 1064 HOH B O   1 
HETATM 8970 O O   . HOH L 6 .   ? 11.461  21.396  -46.684 1.00 50.10 ? 1065 HOH B O   1 
HETATM 8971 O O   . HOH L 6 .   ? 22.931  -0.633  -44.922 1.00 46.10 ? 1066 HOH B O   1 
HETATM 8972 O O   . HOH L 6 .   ? 6.617   -5.224  -41.001 1.00 45.49 ? 1067 HOH B O   1 
HETATM 8973 O O   . HOH L 6 .   ? 5.420   14.630  -18.546 1.00 52.40 ? 1068 HOH B O   1 
HETATM 8974 O O   . HOH L 6 .   ? -3.360  -5.455  -44.848 1.00 58.08 ? 1069 HOH B O   1 
HETATM 8975 O O   . HOH L 6 .   ? 23.079  1.020   -32.051 1.00 54.82 ? 1070 HOH B O   1 
HETATM 8976 O O   . HOH L 6 .   ? 2.840   -12.033 -50.790 1.00 64.67 ? 1071 HOH B O   1 
HETATM 8977 O O   . HOH L 6 .   ? -4.606  -10.231 -22.401 1.00 57.51 ? 1072 HOH B O   1 
HETATM 8978 O O   . HOH L 6 .   ? 14.503  -16.983 -14.445 1.00 60.07 ? 1073 HOH B O   1 
HETATM 8979 O O   . HOH L 6 .   ? 10.046  23.904  -49.613 1.00 60.11 ? 1074 HOH B O   1 
HETATM 8980 O O   . HOH L 6 .   ? 3.351   11.422  -20.314 1.00 46.73 ? 1075 HOH B O   1 
HETATM 8981 O O   . HOH L 6 .   ? 1.568   23.521  -19.597 1.00 63.52 ? 1076 HOH B O   1 
HETATM 8982 O O   . HOH L 6 .   ? 22.996  -8.910  -26.787 1.00 54.92 ? 1077 HOH B O   1 
HETATM 8983 O O   . HOH L 6 .   ? 25.708  -2.134  -35.145 1.00 50.40 ? 1078 HOH B O   1 
HETATM 8984 O O   . HOH L 6 .   ? 11.884  3.486   -74.486 1.00 44.31 ? 1079 HOH B O   1 
HETATM 8985 O O   . HOH L 6 .   ? 17.129  -5.770  -43.520 1.00 59.11 ? 1080 HOH B O   1 
HETATM 8986 O O   . HOH L 6 .   ? -5.593  -2.759  -48.626 1.00 52.29 ? 1081 HOH B O   1 
HETATM 8987 O O   . HOH L 6 .   ? 19.383  9.837   -30.135 1.00 53.62 ? 1082 HOH B O   1 
HETATM 8988 O O   . HOH L 6 .   ? 32.205  -2.248  -19.275 1.00 61.94 ? 1083 HOH B O   1 
HETATM 8989 O O   . HOH L 6 .   ? 16.751  -8.248  -59.919 1.00 48.53 ? 1084 HOH B O   1 
HETATM 8990 O O   . HOH L 6 .   ? 6.621   11.788  -19.766 1.00 66.91 ? 1085 HOH B O   1 
HETATM 8991 O O   . HOH L 6 .   ? -4.325  1.390   -30.146 1.00 56.38 ? 1086 HOH B O   1 
HETATM 8992 O O   . HOH L 6 .   ? 11.021  3.470   -10.272 1.00 63.45 ? 1087 HOH B O   1 
HETATM 8993 O O   . HOH L 6 .   ? 22.278  5.501   -29.694 1.00 49.10 ? 1088 HOH B O   1 
HETATM 8994 O O   . HOH L 6 .   ? -9.008  -0.510  -45.341 1.00 64.12 ? 1089 HOH B O   1 
HETATM 8995 O O   . HOH L 6 .   ? 9.527   -0.228  -38.030 1.00 59.07 ? 1090 HOH B O   1 
HETATM 8996 O O   . HOH L 6 .   ? 19.291  -8.935  -60.111 1.00 51.07 ? 1091 HOH B O   1 
HETATM 8997 O O   . HOH L 6 .   ? -1.654  -1.626  -64.417 1.00 54.92 ? 1092 HOH B O   1 
HETATM 8998 O O   . HOH L 6 .   ? 22.602  -7.003  -17.553 1.00 70.94 ? 1093 HOH B O   1 
HETATM 8999 O O   . HOH L 6 .   ? 7.516   3.037   -71.178 1.00 52.59 ? 1094 HOH B O   1 
HETATM 9000 O O   . HOH L 6 .   ? -13.513 30.897  -25.650 1.00 46.13 ? 1095 HOH B O   1 
HETATM 9001 O O   . HOH L 6 .   ? 2.143   21.469  -61.199 1.00 59.24 ? 1096 HOH B O   1 
HETATM 9002 O O   . HOH L 6 .   ? 18.269  15.261  -22.006 1.00 60.24 ? 1097 HOH B O   1 
HETATM 9003 O O   . HOH L 6 .   ? 6.190   -8.247  -41.373 1.00 53.70 ? 1098 HOH B O   1 
HETATM 9004 O O   . HOH L 6 .   ? 9.436   -2.941  -37.317 1.00 59.54 ? 1099 HOH B O   1 
HETATM 9005 O O   . HOH L 6 .   ? 4.810   26.744  -26.715 1.00 53.71 ? 1100 HOH B O   1 
HETATM 9006 O O   . HOH L 6 .   ? 2.321   28.629  -26.766 1.00 58.06 ? 1101 HOH B O   1 
HETATM 9007 O O   . HOH L 6 .   ? 30.019  -4.503  -35.778 1.00 67.68 ? 1102 HOH B O   1 
HETATM 9008 O O   . HOH L 6 .   ? 16.856  -7.757  -34.134 1.00 63.81 ? 1103 HOH B O   1 
HETATM 9009 O O   . HOH L 6 .   ? 24.946  -7.240  -26.408 1.00 54.92 ? 1104 HOH B O   1 
HETATM 9010 O O   . HOH L 6 .   ? 20.132  -10.371 -33.486 1.00 67.53 ? 1105 HOH B O   1 
HETATM 9011 O O   . HOH L 6 .   ? 28.066  -2.898  -33.690 1.00 58.97 ? 1106 HOH B O   1 
HETATM 9012 O O   . HOH L 6 .   ? 2.589   25.327  -47.993 1.00 50.88 ? 1107 HOH B O   1 
HETATM 9013 O O   . HOH L 6 .   ? 0.094   26.466  -48.253 1.00 52.06 ? 1108 HOH B O   1 
HETATM 9014 O O   . HOH L 6 .   ? -3.607  24.306  -51.195 1.00 57.88 ? 1109 HOH B O   1 
HETATM 9015 O O   . HOH L 6 .   ? -1.531  24.579  -47.304 1.00 55.33 ? 1110 HOH B O   1 
HETATM 9016 O O   . HOH L 6 .   ? -4.002  -0.613  -72.162 1.00 52.54 ? 1111 HOH B O   1 
HETATM 9017 O O   . HOH L 6 .   ? -1.704  -1.331  -73.705 1.00 51.86 ? 1112 HOH B O   1 
HETATM 9018 O O   . HOH L 6 .   ? -0.869  0.694   -74.990 1.00 61.85 ? 1113 HOH B O   1 
HETATM 9019 O O   . HOH L 6 .   ? 7.606   0.987   -23.800 1.00 53.16 ? 1114 HOH B O   1 
HETATM 9020 O O   . HOH L 6 .   ? 8.588   -8.866  -39.552 1.00 53.50 ? 1115 HOH B O   1 
HETATM 9021 O O   . HOH L 6 .   ? 18.667  8.804   -27.638 1.00 57.39 ? 1116 HOH B O   1 
HETATM 9022 O O   . HOH L 6 .   ? 25.253  0.546   -35.670 1.00 51.52 ? 1117 HOH B O   1 
HETATM 9023 O O   . HOH L 6 .   ? 24.688  7.418   -37.627 1.00 58.51 ? 1118 HOH B O   1 
HETATM 9024 O O   . HOH L 6 .   ? 13.304  -4.239  -55.764 1.00 48.62 ? 1119 HOH B O   1 
HETATM 9025 O O   . HOH L 6 .   ? 21.876  9.453   -33.137 1.00 49.94 ? 1120 HOH B O   1 
HETATM 9026 O O   . HOH L 6 .   ? 25.801  1.588   -33.247 1.00 64.61 ? 1121 HOH B O   1 
HETATM 9027 O O   . HOH L 6 .   ? 16.944  -2.464  -28.929 1.00 55.48 ? 1122 HOH B O   1 
HETATM 9028 O O   . HOH L 6 .   ? 7.146   25.000  -53.088 1.00 60.33 ? 1123 HOH B O   1 
HETATM 9029 O O   . HOH L 6 .   ? -4.944  25.068  -37.435 1.00 60.52 ? 1124 HOH B O   1 
HETATM 9030 O O   . HOH L 6 .   ? 14.323  -9.780  -61.056 1.00 50.28 ? 1125 HOH B O   1 
HETATM 9031 O O   . HOH L 6 .   ? 10.923  12.937  -15.851 1.00 55.96 ? 1126 HOH B O   1 
HETATM 9032 O O   . HOH L 6 .   ? 15.740  15.533  -20.780 1.00 53.78 ? 1127 HOH B O   1 
HETATM 9033 O O   . HOH L 6 .   ? 17.519  15.272  -24.928 1.00 60.15 ? 1128 HOH B O   1 
HETATM 9034 O O   . HOH L 6 .   ? 14.340  6.643   -67.336 1.00 54.41 ? 1129 HOH B O   1 
HETATM 9035 O O   . HOH L 6 .   ? 10.948  9.746   -67.979 1.00 60.91 ? 1130 HOH B O   1 
HETATM 9036 O O   . HOH L 6 .   ? 4.367   -9.008  -39.228 1.00 55.56 ? 1131 HOH B O   1 
HETATM 9037 O O   . HOH L 6 .   ? 10.519  -14.643 -45.767 1.00 54.01 ? 1132 HOH B O   1 
HETATM 9038 O O   . HOH L 6 .   ? 4.968   -5.606  -60.390 1.00 56.99 ? 1133 HOH B O   1 
HETATM 9039 O O   . HOH L 6 .   ? 11.647  26.906  -32.498 1.00 57.19 ? 1134 HOH B O   1 
HETATM 9040 O O   . HOH L 6 .   ? -3.152  22.065  -57.845 1.00 69.44 ? 1135 HOH B O   1 
HETATM 9041 O O   . HOH L 6 .   ? 1.334   16.869  -65.084 1.00 60.18 ? 1136 HOH B O   1 
HETATM 9042 O O   . HOH L 6 .   ? -6.197  13.714  -22.938 1.00 57.75 ? 1137 HOH B O   1 
HETATM 9043 O O   . HOH L 6 .   ? -4.945  12.904  -20.322 1.00 73.38 ? 1138 HOH B O   1 
HETATM 9044 O O   . HOH L 6 .   ? -9.481  18.099  -27.126 1.00 56.78 ? 1139 HOH B O   1 
HETATM 9045 O O   . HOH L 6 .   ? 5.082   7.992   -64.036 1.00 52.16 ? 1140 HOH B O   1 
HETATM 9046 O O   . HOH L 6 .   ? -2.679  -0.603  -61.076 1.00 56.27 ? 1141 HOH B O   1 
HETATM 9047 O O   . HOH L 6 .   ? -1.536  -7.512  -44.576 1.00 52.98 ? 1142 HOH B O   1 
HETATM 9048 O O   . HOH L 6 .   ? -6.104  0.023   -48.744 1.00 58.54 ? 1143 HOH B O   1 
HETATM 9049 O O   . HOH L 6 .   ? -6.992  -4.042  -50.734 1.00 50.03 ? 1144 HOH B O   1 
HETATM 9050 O O   . HOH L 6 .   ? -8.562  -1.768  -53.425 1.00 69.42 ? 1145 HOH B O   1 
HETATM 9051 O O   . HOH L 6 .   ? -10.175 -2.384  -47.605 1.00 67.87 ? 1146 HOH B O   1 
HETATM 9052 O O   . HOH L 6 .   ? -18.148 12.441  -44.530 1.00 59.65 ? 1147 HOH B O   1 
HETATM 9053 O O   . HOH L 6 .   ? 11.592  2.884   -5.921  1.00 64.85 ? 1148 HOH B O   1 
HETATM 9054 O O   . HOH L 6 .   ? 27.426  6.532   -38.137 1.00 56.04 ? 1149 HOH B O   1 
HETATM 9055 O O   . HOH L 6 .   ? 29.245  7.492   -39.698 1.00 50.65 ? 1150 HOH B O   1 
HETATM 9056 O O   . HOH L 6 .   ? -3.835  -5.709  -56.527 1.00 52.96 ? 1151 HOH B O   1 
HETATM 9057 O O   . HOH L 6 .   ? -0.613  -7.196  -57.439 1.00 66.02 ? 1152 HOH B O   1 
HETATM 9058 O O   . HOH L 6 .   ? 28.389  5.169   -51.178 1.00 56.22 ? 1153 HOH B O   1 
HETATM 9059 O O   . HOH L 6 .   ? 29.486  6.437   -49.204 1.00 54.51 ? 1154 HOH B O   1 
HETATM 9060 O O   . HOH L 6 .   ? -10.706 21.542  -46.197 1.00 69.14 ? 1155 HOH B O   1 
HETATM 9061 O O   . HOH L 6 .   ? -6.902  -2.940  -33.467 1.00 62.85 ? 1156 HOH B O   1 
HETATM 9062 O O   . HOH L 6 .   ? -1.848  -11.877 -53.044 1.00 77.13 ? 1157 HOH B O   1 
HETATM 9063 O O   . HOH L 6 .   ? -0.862  -12.334 -50.050 1.00 65.92 ? 1158 HOH B O   1 
HETATM 9064 O O   . HOH L 6 .   ? -6.898  3.080   -23.641 1.00 57.38 ? 1159 HOH B O   1 
HETATM 9065 O O   . HOH L 6 .   ? 1.791   7.527   -20.356 1.00 64.13 ? 1160 HOH B O   1 
HETATM 9066 O O   . HOH L 6 .   ? 18.240  -14.755 -42.317 1.00 67.72 ? 1161 HOH B O   1 
HETATM 9067 O O   . HOH L 6 .   ? 22.476  9.420   -52.818 1.00 56.98 ? 1162 HOH B O   1 
HETATM 9068 O O   . HOH L 6 .   ? 20.295  3.874   -61.691 1.00 62.54 ? 1163 HOH B O   1 
HETATM 9069 O O   . HOH L 6 .   ? 6.817   12.667  -63.893 1.00 53.28 ? 1164 HOH B O   1 
HETATM 9070 O O   . HOH L 6 .   ? 9.149   9.066   -62.556 1.00 53.47 ? 1165 HOH B O   1 
HETATM 9071 O O   . HOH L 6 .   ? 3.122   8.940   -73.068 1.00 53.15 ? 1166 HOH B O   1 
HETATM 9072 O O   . HOH L 6 .   ? 0.948   13.096  -71.017 1.00 58.50 ? 1167 HOH B O   1 
HETATM 9073 O O   . HOH L 6 .   ? 31.889  -2.191  -38.301 1.00 58.59 ? 1168 HOH B O   1 
HETATM 9074 O O   . HOH L 6 .   ? 29.651  0.926   -36.229 1.00 59.87 ? 1169 HOH B O   1 
HETATM 9075 O O   . HOH L 6 .   ? 32.839  3.849   -41.168 1.00 52.93 ? 1170 HOH B O   1 
HETATM 9076 O O   . HOH L 6 .   ? 32.567  6.107   -42.160 1.00 51.64 ? 1171 HOH B O   1 
HETATM 9077 O O   . HOH L 6 .   ? 3.333   17.324  -16.796 1.00 51.93 ? 1172 HOH B O   1 
HETATM 9078 O O   . HOH L 6 .   ? 31.465  -17.894 -49.882 1.00 67.24 ? 1173 HOH B O   1 
HETATM 9079 O O   . HOH L 6 .   ? 15.024  2.086   -69.007 1.00 53.63 ? 1174 HOH B O   1 
HETATM 9080 O O   . HOH L 6 .   ? 21.261  -12.008 -22.655 1.00 61.33 ? 1175 HOH B O   1 
HETATM 9081 O O   . HOH L 6 .   ? -3.639  -2.589  -21.474 1.00 57.90 ? 1176 HOH B O   1 
HETATM 9082 O O   . HOH L 6 .   ? -8.118  -3.601  -26.261 1.00 59.63 ? 1177 HOH B O   1 
HETATM 9083 O O   . HOH L 6 .   ? -4.092  20.986  -20.116 1.00 47.72 ? 1178 HOH B O   1 
HETATM 9084 O O   . HOH L 6 .   ? 25.412  6.699   -25.728 1.00 57.61 ? 1179 HOH B O   1 
HETATM 9085 O O   . HOH L 6 .   ? 21.198  5.366   -27.053 1.00 53.60 ? 1180 HOH B O   1 
HETATM 9086 O O   . HOH L 6 .   ? 22.837  7.255   -25.904 1.00 58.54 ? 1181 HOH B O   1 
HETATM 9087 O O   . HOH L 6 .   ? 22.532  11.794  -27.298 1.00 61.83 ? 1182 HOH B O   1 
HETATM 9088 O O   . HOH L 6 .   ? 22.135  9.252   -27.447 1.00 59.02 ? 1183 HOH B O   1 
HETATM 9089 O O   . HOH L 6 .   ? -9.431  -2.105  -56.667 1.00 60.97 ? 1184 HOH B O   1 
HETATM 9090 O O   . HOH L 6 .   ? 5.150   -1.645  -13.075 1.00 78.30 ? 1185 HOH B O   1 
HETATM 9091 O O   . HOH L 6 .   ? 22.043  11.776  -31.416 1.00 66.75 ? 1186 HOH B O   1 
HETATM 9092 O O   . HOH L 6 .   ? 6.841   2.505   -21.019 1.00 54.69 ? 1187 HOH B O   1 
HETATM 9093 O O   . HOH L 6 .   ? 10.522  5.025   -18.348 1.00 59.77 ? 1188 HOH B O   1 
HETATM 9094 O O   . HOH L 6 .   ? 4.308   -3.720  -20.560 1.00 62.65 ? 1189 HOH B O   1 
HETATM 9095 O O   . HOH L 6 .   ? 5.009   -1.436  -21.727 1.00 49.87 ? 1190 HOH B O   1 
HETATM 9096 O O   . HOH L 6 .   ? 6.402   0.024   -19.467 1.00 54.76 ? 1191 HOH B O   1 
HETATM 9097 O O   . HOH L 6 .   ? 2.776   1.885   -78.391 1.00 55.05 ? 1192 HOH B O   1 
HETATM 9098 O O   . HOH L 6 .   ? -15.389 0.190   -57.582 1.00 65.03 ? 1193 HOH B O   1 
HETATM 9099 O O   . HOH L 6 .   ? 2.650   2.050   -20.064 1.00 58.28 ? 1194 HOH B O   1 
HETATM 9100 O O   . HOH L 6 .   ? 2.036   -12.153 -46.487 1.00 58.92 ? 1195 HOH B O   1 
HETATM 9101 O O   . HOH L 6 .   ? -5.457  -6.833  -47.125 1.00 61.32 ? 1196 HOH B O   1 
HETATM 9102 O O   . HOH L 6 .   ? 15.103  -13.045 -20.649 1.00 61.01 ? 1197 HOH B O   1 
HETATM 9103 O O   . HOH L 6 .   ? 4.868   27.083  -50.671 1.00 69.63 ? 1198 HOH B O   1 
HETATM 9104 O O   . HOH L 6 .   ? 5.061   9.373   -20.762 1.00 57.51 ? 1199 HOH B O   1 
HETATM 9105 O O   . HOH L 6 .   ? -1.479  24.467  -19.715 1.00 66.13 ? 1200 HOH B O   1 
HETATM 9106 O O   . HOH L 6 .   ? 22.463  16.206  -25.495 1.00 70.37 ? 1201 HOH B O   1 
HETATM 9107 O O   . HOH L 6 .   ? 31.820  -4.367  -21.661 1.00 71.84 ? 1202 HOH B O   1 
HETATM 9108 O O   . HOH L 6 .   ? 12.286  3.959   -12.157 1.00 54.99 ? 1203 HOH B O   1 
HETATM 9109 O O   . HOH L 6 .   ? 24.623  17.123  -20.408 1.00 69.81 ? 1204 HOH B O   1 
HETATM 9110 O O   . HOH L 6 .   ? 2.402   27.764  -23.884 1.00 66.49 ? 1205 HOH B O   1 
HETATM 9111 O O   . HOH L 6 .   ? 27.347  -10.975 -37.638 1.00 60.99 ? 1206 HOH B O   1 
HETATM 9112 O O   . HOH L 6 .   ? 23.271  -5.417  -33.273 1.00 48.68 ? 1207 HOH B O   1 
HETATM 9113 O O   . HOH L 6 .   ? 0.593   -0.716  -62.905 1.00 57.87 ? 1208 HOH B O   1 
HETATM 9114 O O   . HOH L 6 .   ? 3.720   -0.277  -65.498 1.00 61.23 ? 1209 HOH B O   1 
HETATM 9115 O O   . HOH L 6 .   ? -0.268  -6.658  -59.913 1.00 75.72 ? 1210 HOH B O   1 
HETATM 9116 O O   . HOH L 6 .   ? 14.958  17.870  -21.062 1.00 58.32 ? 1211 HOH B O   1 
HETATM 9117 O O   . HOH L 6 .   ? 5.412   21.585  -60.021 1.00 64.33 ? 1212 HOH B O   1 
HETATM 9118 O O   . HOH L 6 .   ? -14.546 14.861  -30.096 1.00 68.95 ? 1213 HOH B O   1 
HETATM 9119 O O   . HOH L 6 .   ? -12.648 11.964  -28.294 1.00 64.36 ? 1214 HOH B O   1 
HETATM 9120 O O   . HOH L 6 .   ? -17.661 9.011   -42.592 1.00 65.17 ? 1215 HOH B O   1 
HETATM 9121 O O   . HOH L 6 .   ? 15.021  -14.711 -43.461 1.00 61.96 ? 1216 HOH B O   1 
HETATM 9122 O O   . HOH L 6 .   ? 26.547  7.998   -53.011 1.00 64.26 ? 1217 HOH B O   1 
HETATM 9123 O O   . HOH L 6 .   ? 9.408   -13.333 -37.806 1.00 67.03 ? 1218 HOH B O   1 
HETATM 9124 O O   . HOH L 6 .   ? -8.322  20.354  -47.654 1.00 63.54 ? 1219 HOH B O   1 
HETATM 9125 O O   . HOH L 6 .   ? -9.548  21.558  -51.769 1.00 58.33 ? 1220 HOH B O   1 
HETATM 9126 O O   . HOH L 6 .   ? -8.561  -3.293  -37.393 1.00 77.09 ? 1221 HOH B O   1 
HETATM 9127 O O   . HOH L 6 .   ? -5.478  -4.261  -40.905 1.00 61.04 ? 1222 HOH B O   1 
HETATM 9128 O O   . HOH L 6 .   ? 14.739  29.468  -31.030 1.00 66.87 ? 1223 HOH B O   1 
HETATM 9129 O O   . HOH L 6 .   ? 0.787   16.770  -67.391 1.00 60.33 ? 1224 HOH B O   1 
HETATM 9130 O O   . HOH L 6 .   ? -2.703  -12.250 -28.211 1.00 65.95 ? 1225 HOH B O   1 
HETATM 9131 O O   . HOH L 6 .   ? 2.570   19.977  -16.434 1.00 68.53 ? 1226 HOH B O   1 
HETATM 9132 O O   . HOH L 6 .   ? 33.227  -2.692  -23.615 1.00 63.51 ? 1227 HOH B O   1 
HETATM 9133 O O   . HOH L 6 .   ? -4.829  2.141   -22.416 1.00 65.02 ? 1228 HOH B O   1 
HETATM 9134 O O   . HOH L 6 .   ? -0.960  17.418  -16.855 1.00 66.82 ? 1229 HOH B O   1 
HETATM 9135 O O   . HOH L 6 .   ? 20.759  19.252  -43.947 1.00 71.86 ? 1230 HOH B O   1 
HETATM 9136 O O   . HOH L 6 .   ? 18.974  12.496  -55.506 1.00 59.52 ? 1231 HOH B O   1 
HETATM 9137 O O   . HOH L 6 .   ? 23.973  1.365   -27.043 1.00 56.60 ? 1232 HOH B O   1 
HETATM 9138 O O   . HOH L 6 .   ? 8.446   1.600   -15.720 1.00 67.83 ? 1233 HOH B O   1 
HETATM 9139 O O   . HOH L 6 .   ? -3.867  1.442   -76.067 1.00 58.01 ? 1234 HOH B O   1 
HETATM 9140 O O   . HOH L 6 .   ? 32.958  2.286   -38.646 1.00 73.42 ? 1235 HOH B O   1 
HETATM 9141 O O   . HOH L 6 .   ? 20.627  -13.059 -16.223 1.00 60.38 ? 1236 HOH B O   1 
HETATM 9142 O O   . HOH L 6 .   ? -9.115  17.953  -33.798 1.00 59.39 ? 1237 HOH B O   1 
HETATM 9143 O O   . HOH L 6 .   ? -4.659  -6.702  -33.448 1.00 69.18 ? 1238 HOH B O   1 
HETATM 9144 O O   . HOH L 6 .   ? 35.509  -0.901  -43.580 1.00 59.67 ? 1239 HOH B O   1 
HETATM 9145 O O   . HOH L 6 .   ? 33.954  -2.954  -42.806 1.00 52.90 ? 1240 HOH B O   1 
HETATM 9146 O O   . HOH L 6 .   ? 34.254  -5.138  -44.153 1.00 55.73 ? 1241 HOH B O   1 
HETATM 9147 O O   . HOH L 6 .   ? 34.120  -7.686  -43.134 1.00 56.86 ? 1242 HOH B O   1 
HETATM 9148 O O   . HOH L 6 .   ? 32.118  -9.074  -43.043 1.00 52.33 ? 1243 HOH B O   1 
HETATM 9149 O O   . HOH L 6 .   ? 31.721  -9.932  -40.374 1.00 59.77 ? 1244 HOH B O   1 
HETATM 9150 O O   . HOH L 6 .   ? 32.420  -11.466 -49.122 1.00 68.81 ? 1245 HOH B O   1 
HETATM 9151 O O   . HOH L 6 .   ? 32.695  -11.753 -44.245 1.00 60.74 ? 1246 HOH B O   1 
HETATM 9152 O O   . HOH L 6 .   ? 29.763  9.815   -27.034 1.00 72.70 ? 1247 HOH B O   1 
HETATM 9153 O O   . HOH L 6 .   ? -12.535 2.350   -62.998 1.00 60.51 ? 1248 HOH B O   1 
HETATM 9154 O O   . HOH L 6 .   ? -14.769 2.872   -61.044 1.00 59.47 ? 1249 HOH B O   1 
HETATM 9155 O O   . HOH L 6 .   ? 21.404  19.180  -25.748 1.00 70.07 ? 1250 HOH B O   1 
HETATM 9156 O O   . HOH L 6 .   ? 17.118  -11.979 -30.822 1.00 66.90 ? 1251 HOH B O   1 
HETATM 9157 O O   . HOH L 6 .   ? 27.870  -4.262  -31.597 1.00 52.95 ? 1252 HOH B O   1 
HETATM 9158 O O   . HOH L 6 .   ? -7.215  22.366  -30.840 1.00 66.72 ? 1253 HOH B O   1 
HETATM 9159 O O   . HOH L 6 .   ? -6.756  27.340  -33.228 1.00 68.57 ? 1254 HOH B O   1 
HETATM 9160 O O   . HOH L 6 .   ? 14.509  19.970  -24.786 1.00 70.01 ? 1255 HOH B O   1 
HETATM 9161 O O   . HOH L 6 .   ? 7.709   27.576  -39.411 1.00 71.56 ? 1256 HOH B O   1 
HETATM 9162 O O   . HOH L 6 .   ? -12.085 17.171  -27.129 1.00 64.25 ? 1257 HOH B O   1 
HETATM 9163 O O   . HOH L 6 .   ? -12.234 14.294  -39.216 1.00 54.10 ? 1258 HOH B O   1 
HETATM 9164 O O   . HOH L 6 .   ? -14.479 14.230  -33.354 1.00 56.71 ? 1259 HOH B O   1 
HETATM 9165 O O   . HOH L 6 .   ? 26.531  9.169   -34.046 1.00 58.14 ? 1260 HOH B O   1 
HETATM 9166 O O   . HOH L 6 .   ? 3.017   -14.892 -16.989 1.00 72.28 ? 1261 HOH B O   1 
HETATM 9167 O O   . HOH L 6 .   ? 13.111  8.623   -13.765 1.00 71.58 ? 1262 HOH B O   1 
HETATM 9168 O O   . HOH L 6 .   ? -10.093 -2.961  -61.384 1.00 71.30 ? 1263 HOH B O   1 
HETATM 9169 O O   . HOH L 6 .   ? 22.859  -12.442 -20.667 1.00 69.67 ? 1264 HOH B O   1 
HETATM 9170 O O   . HOH L 6 .   ? 28.853  -4.990  -26.565 1.00 70.31 ? 1265 HOH B O   1 
HETATM 9171 O O   . HOH L 6 .   ? -18.377 2.876   -56.107 1.00 69.04 ? 1266 HOH B O   1 
HETATM 9172 O O   . HOH L 6 .   ? 7.090   -15.085 -49.473 1.00 67.43 ? 1267 HOH B O   1 
HETATM 9173 O O   . HOH L 6 .   ? -3.869  23.239  -20.658 1.00 58.85 ? 1268 HOH B O   1 
HETATM 9174 O O   . HOH L 6 .   ? 19.949  -19.176 -49.187 1.00 71.57 ? 1269 HOH B O   1 
HETATM 9175 O O   . HOH L 6 .   ? -5.599  15.343  -66.409 1.00 61.34 ? 1270 HOH B O   1 
HETATM 9176 O O   . HOH L 6 .   ? 31.706  -12.331 -39.484 1.00 67.77 ? 1271 HOH B O   1 
HETATM 9177 O O   . HOH L 6 .   ? -14.217 9.885   -28.151 1.00 60.38 ? 1272 HOH B O   1 
HETATM 9178 O O   . HOH L 6 .   ? -15.875 0.916   -36.943 1.00 56.48 ? 1273 HOH B O   1 
HETATM 9179 O O   . HOH L 6 .   ? -19.980 2.194   -29.212 1.00 66.77 ? 1274 HOH B O   1 
HETATM 9180 O O   . HOH L 6 .   ? -5.884  -13.325 -34.487 1.00 69.83 ? 1275 HOH B O   1 
HETATM 9181 O O   . HOH L 6 .   ? 23.805  20.991  -40.993 1.00 77.62 ? 1276 HOH B O   1 
HETATM 9182 O O   . HOH L 6 .   ? 22.380  -11.610 -17.894 1.00 71.63 ? 1277 HOH B O   1 
HETATM 9183 O O   . HOH L 6 .   ? 17.001  -15.206 -19.965 1.00 63.52 ? 1278 HOH B O   1 
HETATM 9184 O O   . HOH L 6 .   ? 33.288  1.916   -46.954 1.00 67.42 ? 1279 HOH B O   1 
HETATM 9185 O O   . HOH L 6 .   ? 30.500  -7.720  -35.728 1.00 69.24 ? 1280 HOH B O   1 
HETATM 9186 O O   . HOH L 6 .   ? -13.153 5.949   -66.529 1.00 66.81 ? 1281 HOH B O   1 
HETATM 9187 O O   . HOH L 6 .   ? -18.056 12.895  -63.970 1.00 69.78 ? 1282 HOH B O   1 
HETATM 9188 O O   . HOH L 6 .   ? -7.978  13.123  -69.196 1.00 68.95 ? 1283 HOH B O   1 
HETATM 9189 O O   . HOH L 6 .   ? 1.284   16.558  -69.573 1.00 65.92 ? 1284 HOH B O   1 
HETATM 9190 O O   . HOH L 6 .   ? 19.871  1.672   -63.170 1.00 74.16 ? 1285 HOH B O   1 
HETATM 9191 O O   . HOH L 6 .   ? -15.095 16.936  -53.747 1.00 66.65 ? 1286 HOH B O   1 
HETATM 9192 O O   . HOH L 6 .   ? -1.699  23.999  -58.507 1.00 60.29 ? 1287 HOH B O   1 
HETATM 9193 O O   . HOH L 6 .   ? 33.674  4.522   -47.309 1.00 68.41 ? 1288 HOH B O   1 
HETATM 9194 O O   . HOH L 6 .   ? 28.646  -12.898 -61.502 1.00 61.69 ? 1289 HOH B O   1 
HETATM 9195 O O   . HOH L 6 .   ? 30.300  13.373  -37.248 1.00 72.82 ? 1290 HOH B O   1 
HETATM 9196 O O   . HOH L 6 .   ? 17.841  29.005  -36.816 1.00 76.91 ? 1291 HOH B O   1 
HETATM 9197 O O   . HOH L 6 .   ? 11.099  -17.564 -23.869 1.00 66.61 ? 1292 HOH B O   1 
HETATM 9198 O O   . HOH L 6 .   ? 0.310   -18.676 -30.228 1.00 69.73 ? 1293 HOH B O   1 
HETATM 9199 O O   . HOH L 6 .   ? 16.234  -14.083 -10.754 1.00 66.84 ? 1294 HOH B O   1 
HETATM 9200 O O   . HOH L 6 .   ? 7.402   -15.156 -18.318 1.00 74.81 ? 1295 HOH B O   1 
HETATM 9201 O O   . HOH L 6 .   ? 30.169  2.741   -22.287 1.00 50.29 ? 1296 HOH B O   1 
HETATM 9202 O O   . HOH L 6 .   ? 7.892   -0.551  -14.018 1.00 70.73 ? 1297 HOH B O   1 
HETATM 9203 O O   . HOH L 6 .   ? -0.911  8.270   -18.737 1.00 72.37 ? 1298 HOH B O   1 
HETATM 9204 O O   . HOH L 6 .   ? -18.552 -0.174  -35.423 1.00 73.47 ? 1299 HOH B O   1 
HETATM 9205 O O   . HOH L 6 .   ? -13.311 16.161  -34.709 1.00 65.51 ? 1300 HOH B O   1 
HETATM 9206 O O   . HOH L 6 .   ? -8.608  19.713  -29.380 1.00 61.75 ? 1301 HOH B O   1 
HETATM 9207 O O   . HOH L 6 .   ? -17.624 -8.213  -37.455 1.00 78.18 ? 1302 HOH B O   1 
HETATM 9208 O O   . HOH L 6 .   ? 37.512  -5.594  -61.453 1.00 87.60 ? 1303 HOH B O   1 
HETATM 9209 O O   . HOH L 6 .   ? -13.106 21.268  -29.349 1.00 74.50 ? 1304 HOH B O   1 
HETATM 9210 O O   . HOH L 6 .   ? 9.622   -21.576 -22.982 1.00 77.84 ? 1305 HOH B O   1 
HETATM 9211 O O   . HOH L 6 .   ? 21.301  -5.980  -10.289 1.00 62.91 ? 1306 HOH B O   1 
HETATM 9212 O O   . HOH L 6 .   ? 29.137  11.399  -30.978 1.00 64.87 ? 1307 HOH B O   1 
HETATM 9213 O O   . HOH L 6 .   ? 35.878  -1.874  -57.830 1.00 78.16 ? 1308 HOH B O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'NAG B 601 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 PRO 259 259 259 PRO PRO A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 GLY 261 261 ?   ?   ?   A . n 
A 1 262 ALA 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 HIS 284 284 284 HIS HIS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 GLN 325 325 325 GLN GLN A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 GLN 358 358 358 GLN GLN A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ASP 372 372 372 ASP ASP A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 TYR 382 382 382 TYR TYR A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 TRP 385 385 385 TRP TRP A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 HIS 393 393 393 HIS HIS A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 MET 398 398 398 MET MET A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 VAL 402 402 402 VAL VAL A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 CYS 409 409 409 CYS CYS A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 TYR 428 428 428 TYR TYR A . n 
A 1 429 ILE 429 429 429 ILE ILE A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 HIS 432 432 432 HIS HIS A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 SER 435 435 435 SER SER A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 TRP 439 439 439 TRP TRP A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 TRP 442 442 442 TRP TRP A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 HIS 447 447 447 HIS HIS A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 TYR 449 449 449 TYR TYR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ILE 451 451 451 ILE ILE A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 THR 466 466 466 THR THR A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 LEU 476 476 476 LEU LEU A . n 
A 1 477 MET 477 477 477 MET MET A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 TRP 480 480 480 TRP TRP A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASN 482 482 482 ASN ASN A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 ARG 485 485 485 ARG ARG A . n 
A 1 486 THR 486 486 486 THR THR A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 PRO 489 489 489 PRO PRO A . n 
A 1 490 ASN 490 490 490 ASN ASN A . n 
A 1 491 ASP 491 491 491 ASP ASP A . n 
A 1 492 PRO 492 492 492 PRO PRO A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 ASP 494 494 494 ASP ASP A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 SER 497 497 497 SER SER A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 GLN 499 499 499 GLN GLN A . n 
A 1 500 TRP 500 500 500 TRP TRP A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 THR 504 504 504 THR THR A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ALA 506 506 506 ALA ALA A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 ASN 514 514 514 ASN ASN A . n 
A 1 515 LEU 515 515 515 LEU LEU A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 PRO 517 517 517 PRO PRO A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ARG 521 521 521 ARG ARG A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ARG 525 525 525 ARG ARG A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 THR 528 528 528 THR THR A . n 
A 1 529 CYS 529 529 529 CYS CYS A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 PHE 531 531 531 PHE PHE A . n 
A 1 532 TRP 532 532 532 TRP TRP A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 SER 541 541 541 SER SER A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 THR 543 543 543 THR ALA A . n 
B 1 1   GLU 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  PRO 25  25  25  PRO PRO B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  MET 48  48  48  MET MET B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  TRP 56  56  56  TRP TRP B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  CYS 69  69  69  CYS CYS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  TRP 86  86  86  TRP TRP B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  CYS 96  96  96  CYS CYS B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  TYR 98  98  98  TYR TYR B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 PRO 111 111 111 PRO PRO B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 PHE 158 158 158 PHE PHE B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 GLN 184 184 184 GLN GLN B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 ILE 187 187 187 ILE ILE B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 MET 195 195 195 MET MET B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 PHE 200 200 200 PHE PHE B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 SER 208 208 208 SER SER B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 MET 211 211 211 MET MET B . n 
B 1 212 HIS 212 212 212 HIS HIS B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 LEU 221 221 221 LEU LEU B . n 
B 1 222 PHE 222 222 222 PHE PHE B . n 
B 1 223 HIS 223 223 223 HIS HIS B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ARG 245 245 245 ARG ARG B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ARG 247 247 247 ARG ARG B . n 
B 1 248 ALA 248 248 248 ALA ALA B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ARG 253 253 253 ARG ARG B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 CYS 257 257 257 CYS CYS B . n 
B 1 258 PRO 258 258 258 PRO PRO B . n 
B 1 259 PRO 259 259 ?   ?   ?   B . n 
B 1 260 GLY 260 260 ?   ?   ?   B . n 
B 1 261 GLY 261 261 ?   ?   ?   B . n 
B 1 262 ALA 262 262 ?   ?   ?   B . n 
B 1 263 GLY 263 263 ?   ?   ?   B . n 
B 1 264 GLY 264 264 ?   ?   ?   B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 ASP 266 266 266 ASP ASP B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ARG 274 274 274 ARG ARG B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 ASP 283 283 283 ASP ASP B . n 
B 1 284 HIS 284 284 284 HIS HIS B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 TRP 286 286 286 TRP TRP B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 PHE 295 295 295 PHE PHE B . n 
B 1 296 ARG 296 296 296 ARG ARG B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 VAL 300 300 300 VAL VAL B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 ASP 304 304 304 ASP ASP B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 PHE 307 307 307 PHE PHE B . n 
B 1 308 LEU 308 308 308 LEU LEU B . n 
B 1 309 SER 309 309 309 SER SER B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 PRO 312 312 312 PRO PRO B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 ILE 316 316 316 ILE ILE B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 GLN 322 322 322 GLN GLN B . n 
B 1 323 ASP 323 323 323 ASP ASP B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 GLN 325 325 325 GLN GLN B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 VAL 331 331 331 VAL VAL B . n 
B 1 332 LYS 332 332 332 LYS LYS B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 TYR 337 337 337 TYR TYR B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 TYR 341 341 341 TYR TYR B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 PRO 344 344 344 PRO PRO B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 PHE 346 346 346 PHE PHE B . n 
B 1 347 SER 347 347 347 SER SER B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 ASN 350 350 350 ASN ASN B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 ILE 354 354 354 ILE ILE B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 ARG 356 356 356 ARG ARG B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 GLN 358 358 358 GLN GLN B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 VAL 363 363 363 VAL VAL B . n 
B 1 364 ARG 364 364 364 ARG ARG B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 GLY 366 366 366 GLY GLY B . n 
B 1 367 VAL 367 367 367 VAL VAL B . n 
B 1 368 PRO 368 368 368 PRO PRO B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 SER 371 371 371 SER SER B . n 
B 1 372 ASP 372 372 372 ASP ASP B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 ALA 375 375 375 ALA ALA B . n 
B 1 376 GLU 376 376 376 GLU GLU B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 VAL 379 379 379 VAL VAL B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 HIS 381 381 381 HIS HIS B . n 
B 1 382 TYR 382 382 382 TYR TYR B . n 
B 1 383 THR 383 383 383 THR THR B . n 
B 1 384 ASP 384 384 384 ASP ASP B . n 
B 1 385 TRP 385 385 385 TRP TRP B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 HIS 387 387 387 HIS HIS B . n 
B 1 388 PRO 388 388 388 PRO PRO B . n 
B 1 389 GLU 389 389 389 GLU GLU B . n 
B 1 390 ASP 390 390 390 ASP ASP B . n 
B 1 391 PRO 391 391 391 PRO PRO B . n 
B 1 392 THR 392 392 392 THR THR B . n 
B 1 393 HIS 393 393 393 HIS HIS B . n 
B 1 394 LEU 394 394 394 LEU LEU B . n 
B 1 395 ARG 395 395 395 ARG ARG B . n 
B 1 396 ASP 396 396 396 ASP ASP B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 MET 398 398 398 MET MET B . n 
B 1 399 SER 399 399 399 SER SER B . n 
B 1 400 ALA 400 400 400 ALA ALA B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 VAL 402 402 402 VAL VAL B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 ASP 404 404 404 ASP ASP B . n 
B 1 405 HIS 405 405 405 HIS HIS B . n 
B 1 406 ASN 406 406 406 ASN ASN B . n 
B 1 407 VAL 407 407 407 VAL VAL B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 CYS 409 409 409 CYS CYS B . n 
B 1 410 PRO 410 410 410 PRO PRO B . n 
B 1 411 VAL 411 411 411 VAL VAL B . n 
B 1 412 ALA 412 412 412 ALA ALA B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 ALA 415 415 415 ALA ALA B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 ARG 417 417 417 ARG ARG B . n 
B 1 418 LEU 418 418 418 LEU LEU B . n 
B 1 419 ALA 419 419 419 ALA ALA B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 GLN 421 421 421 GLN GLN B . n 
B 1 422 GLY 422 422 422 GLY GLY B . n 
B 1 423 ALA 423 423 423 ALA ALA B . n 
B 1 424 ARG 424 424 424 ARG ARG B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 TYR 426 426 426 TYR TYR B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 TYR 428 428 428 TYR TYR B . n 
B 1 429 ILE 429 429 429 ILE ILE B . n 
B 1 430 PHE 430 430 430 PHE PHE B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 HIS 432 432 432 HIS HIS B . n 
B 1 433 ARG 433 433 433 ARG ARG B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 SER 435 435 435 SER SER B . n 
B 1 436 THR 436 436 436 THR THR B . n 
B 1 437 LEU 437 437 437 LEU LEU B . n 
B 1 438 THR 438 438 438 THR THR B . n 
B 1 439 TRP 439 439 439 TRP TRP B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 LEU 441 441 441 LEU LEU B . n 
B 1 442 TRP 442 442 442 TRP TRP B . n 
B 1 443 MET 443 443 443 MET MET B . n 
B 1 444 GLY 444 444 444 GLY GLY B . n 
B 1 445 VAL 445 445 445 VAL VAL B . n 
B 1 446 PRO 446 446 446 PRO PRO B . n 
B 1 447 HIS 447 447 447 HIS HIS B . n 
B 1 448 GLY 448 448 448 GLY GLY B . n 
B 1 449 TYR 449 449 449 TYR TYR B . n 
B 1 450 GLU 450 450 450 GLU GLU B . n 
B 1 451 ILE 451 451 451 ILE ILE B . n 
B 1 452 GLU 452 452 452 GLU GLU B . n 
B 1 453 PHE 453 453 453 PHE PHE B . n 
B 1 454 ILE 454 454 454 ILE ILE B . n 
B 1 455 PHE 455 455 455 PHE PHE B . n 
B 1 456 GLY 456 456 456 GLY GLY B . n 
B 1 457 LEU 457 457 457 LEU LEU B . n 
B 1 458 PRO 458 458 458 PRO PRO B . n 
B 1 459 LEU 459 459 459 LEU LEU B . n 
B 1 460 ASP 460 460 460 ASP ASP B . n 
B 1 461 PRO 461 461 461 PRO PRO B . n 
B 1 462 SER 462 462 462 SER SER B . n 
B 1 463 LEU 463 463 463 LEU LEU B . n 
B 1 464 ASN 464 464 464 ASN ASN B . n 
B 1 465 TYR 465 465 465 TYR TYR B . n 
B 1 466 THR 466 466 466 THR THR B . n 
B 1 467 THR 467 467 467 THR THR B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 GLU 469 469 469 GLU GLU B . n 
B 1 470 ARG 470 470 470 ARG ARG B . n 
B 1 471 ILE 471 471 471 ILE ILE B . n 
B 1 472 PHE 472 472 472 PHE PHE B . n 
B 1 473 ALA 473 473 473 ALA ALA B . n 
B 1 474 GLN 474 474 474 GLN GLN B . n 
B 1 475 ARG 475 475 475 ARG ARG B . n 
B 1 476 LEU 476 476 476 LEU LEU B . n 
B 1 477 MET 477 477 477 MET MET B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 TYR 479 479 479 TYR TYR B . n 
B 1 480 TRP 480 480 480 TRP TRP B . n 
B 1 481 THR 481 481 481 THR THR B . n 
B 1 482 ASN 482 482 482 ASN ASN B . n 
B 1 483 PHE 483 483 483 PHE PHE B . n 
B 1 484 ALA 484 484 484 ALA ALA B . n 
B 1 485 ARG 485 485 485 ARG ARG B . n 
B 1 486 THR 486 486 486 THR THR B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 ASP 488 488 488 ASP ASP B . n 
B 1 489 PRO 489 489 489 PRO PRO B . n 
B 1 490 ASN 490 490 490 ASN ASN B . n 
B 1 491 ASP 491 491 491 ASP ASP B . n 
B 1 492 PRO 492 492 492 PRO PRO B . n 
B 1 493 ARG 493 493 493 ARG ARG B . n 
B 1 494 ASP 494 494 494 ASP ASP B . n 
B 1 495 SER 495 495 495 SER SER B . n 
B 1 496 LYS 496 496 496 LYS LYS B . n 
B 1 497 SER 497 497 497 SER SER B . n 
B 1 498 PRO 498 498 498 PRO PRO B . n 
B 1 499 GLN 499 499 499 GLN GLN B . n 
B 1 500 TRP 500 500 500 TRP TRP B . n 
B 1 501 PRO 501 501 501 PRO PRO B . n 
B 1 502 PRO 502 502 502 PRO PRO B . n 
B 1 503 TYR 503 503 503 TYR TYR B . n 
B 1 504 THR 504 504 504 THR THR B . n 
B 1 505 THR 505 505 505 THR THR B . n 
B 1 506 ALA 506 506 506 ALA ALA B . n 
B 1 507 ALA 507 507 507 ALA ALA B . n 
B 1 508 GLN 508 508 508 GLN GLN B . n 
B 1 509 GLN 509 509 509 GLN GLN B . n 
B 1 510 TYR 510 510 510 TYR TYR B . n 
B 1 511 VAL 511 511 511 VAL VAL B . n 
B 1 512 SER 512 512 512 SER SER B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 ASN 514 514 514 ASN ASN B . n 
B 1 515 LEU 515 515 515 LEU LEU B . n 
B 1 516 LYS 516 516 516 LYS LYS B . n 
B 1 517 PRO 517 517 517 PRO PRO B . n 
B 1 518 LEU 518 518 518 LEU LEU B . n 
B 1 519 GLU 519 519 519 GLU GLU B . n 
B 1 520 VAL 520 520 520 VAL VAL B . n 
B 1 521 ARG 521 521 521 ARG ARG B . n 
B 1 522 ARG 522 522 522 ARG ARG B . n 
B 1 523 GLY 523 523 523 GLY GLY B . n 
B 1 524 LEU 524 524 524 LEU LEU B . n 
B 1 525 ARG 525 525 525 ARG ARG B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 GLN 527 527 527 GLN GLN B . n 
B 1 528 THR 528 528 528 THR THR B . n 
B 1 529 CYS 529 529 529 CYS CYS B . n 
B 1 530 ALA 530 530 530 ALA ALA B . n 
B 1 531 PHE 531 531 531 PHE PHE B . n 
B 1 532 TRP 532 532 532 TRP TRP B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ARG 534 534 534 ARG ARG B . n 
B 1 535 PHE 535 535 535 PHE PHE B . n 
B 1 536 LEU 536 536 536 LEU LEU B . n 
B 1 537 PRO 537 537 537 PRO PRO B . n 
B 1 538 LYS 538 538 538 LYS LYS B . n 
B 1 539 LEU 539 539 539 LEU LEU B . n 
B 1 540 LEU 540 540 540 LEU LEU B . n 
B 1 541 SER 541 541 541 SER SER B . n 
B 1 542 ALA 542 542 542 ALA ALA B . n 
B 1 543 THR 543 543 543 THR THR B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 NAG 1   701  701 NAG NAG A . 
E 4 P6G 1   901  901 P6G PEG A . 
F 5 CHT 1   951  951 CHT CHO A . 
G 5 CHT 1   952  952 CHT CHO A . 
H 3 NAG 1   601  601 NAG NAG B . 
I 5 CHT 1   961  961 CHT CHO B . 
J 5 CHT 1   962  962 CHT CHO B . 
K 6 HOH 1   953  1   HOH HOH A . 
K 6 HOH 2   954  2   HOH HOH A . 
K 6 HOH 3   955  3   HOH HOH A . 
K 6 HOH 4   956  4   HOH HOH A . 
K 6 HOH 5   957  6   HOH HOH A . 
K 6 HOH 6   958  7   HOH HOH A . 
K 6 HOH 7   959  10  HOH HOH A . 
K 6 HOH 8   960  13  HOH HOH A . 
K 6 HOH 9   961  15  HOH HOH A . 
K 6 HOH 10  962  16  HOH HOH A . 
K 6 HOH 11  963  18  HOH HOH A . 
K 6 HOH 12  964  19  HOH HOH A . 
K 6 HOH 13  965  20  HOH HOH A . 
K 6 HOH 14  966  21  HOH HOH A . 
K 6 HOH 15  967  22  HOH HOH A . 
K 6 HOH 16  968  23  HOH HOH A . 
K 6 HOH 17  969  24  HOH HOH A . 
K 6 HOH 18  970  26  HOH HOH A . 
K 6 HOH 19  971  29  HOH HOH A . 
K 6 HOH 20  972  30  HOH HOH A . 
K 6 HOH 21  973  33  HOH HOH A . 
K 6 HOH 22  974  34  HOH HOH A . 
K 6 HOH 23  975  35  HOH HOH A . 
K 6 HOH 24  976  36  HOH HOH A . 
K 6 HOH 25  977  43  HOH HOH A . 
K 6 HOH 26  978  49  HOH HOH A . 
K 6 HOH 27  979  50  HOH HOH A . 
K 6 HOH 28  980  53  HOH HOH A . 
K 6 HOH 29  981  54  HOH HOH A . 
K 6 HOH 30  982  57  HOH HOH A . 
K 6 HOH 31  983  58  HOH HOH A . 
K 6 HOH 32  984  60  HOH HOH A . 
K 6 HOH 33  985  62  HOH HOH A . 
K 6 HOH 34  986  63  HOH HOH A . 
K 6 HOH 35  987  64  HOH HOH A . 
K 6 HOH 36  988  66  HOH HOH A . 
K 6 HOH 37  989  69  HOH HOH A . 
K 6 HOH 38  990  71  HOH HOH A . 
K 6 HOH 39  991  73  HOH HOH A . 
K 6 HOH 40  992  75  HOH HOH A . 
K 6 HOH 41  993  76  HOH HOH A . 
K 6 HOH 42  994  78  HOH HOH A . 
K 6 HOH 43  995  79  HOH HOH A . 
K 6 HOH 44  996  80  HOH HOH A . 
K 6 HOH 45  997  81  HOH HOH A . 
K 6 HOH 46  998  82  HOH HOH A . 
K 6 HOH 47  999  83  HOH HOH A . 
K 6 HOH 48  1000 85  HOH HOH A . 
K 6 HOH 49  1001 86  HOH HOH A . 
K 6 HOH 50  1002 87  HOH HOH A . 
K 6 HOH 51  1003 88  HOH HOH A . 
K 6 HOH 52  1004 90  HOH HOH A . 
K 6 HOH 53  1005 91  HOH HOH A . 
K 6 HOH 54  1006 94  HOH HOH A . 
K 6 HOH 55  1007 95  HOH HOH A . 
K 6 HOH 56  1008 96  HOH HOH A . 
K 6 HOH 57  1009 97  HOH HOH A . 
K 6 HOH 58  1010 99  HOH HOH A . 
K 6 HOH 59  1011 100 HOH HOH A . 
K 6 HOH 60  1012 108 HOH HOH A . 
K 6 HOH 61  1013 109 HOH HOH A . 
K 6 HOH 62  1014 110 HOH HOH A . 
K 6 HOH 63  1015 111 HOH HOH A . 
K 6 HOH 64  1016 112 HOH HOH A . 
K 6 HOH 65  1017 118 HOH HOH A . 
K 6 HOH 66  1018 120 HOH HOH A . 
K 6 HOH 67  1019 123 HOH HOH A . 
K 6 HOH 68  1020 124 HOH HOH A . 
K 6 HOH 69  1021 126 HOH HOH A . 
K 6 HOH 70  1022 127 HOH HOH A . 
K 6 HOH 71  1023 128 HOH HOH A . 
K 6 HOH 72  1024 129 HOH HOH A . 
K 6 HOH 73  1025 130 HOH HOH A . 
K 6 HOH 74  1026 132 HOH HOH A . 
K 6 HOH 75  1027 134 HOH HOH A . 
K 6 HOH 76  1028 136 HOH HOH A . 
K 6 HOH 77  1029 137 HOH HOH A . 
K 6 HOH 78  1030 139 HOH HOH A . 
K 6 HOH 79  1031 142 HOH HOH A . 
K 6 HOH 80  1032 143 HOH HOH A . 
K 6 HOH 81  1033 145 HOH HOH A . 
K 6 HOH 82  1034 150 HOH HOH A . 
K 6 HOH 83  1035 151 HOH HOH A . 
K 6 HOH 84  1036 152 HOH HOH A . 
K 6 HOH 85  1037 153 HOH HOH A . 
K 6 HOH 86  1038 154 HOH HOH A . 
K 6 HOH 87  1039 155 HOH HOH A . 
K 6 HOH 88  1040 156 HOH HOH A . 
K 6 HOH 89  1041 159 HOH HOH A . 
K 6 HOH 90  1042 161 HOH HOH A . 
K 6 HOH 91  1043 165 HOH HOH A . 
K 6 HOH 92  1044 167 HOH HOH A . 
K 6 HOH 93  1045 168 HOH HOH A . 
K 6 HOH 94  1046 169 HOH HOH A . 
K 6 HOH 95  1047 170 HOH HOH A . 
K 6 HOH 96  1048 172 HOH HOH A . 
K 6 HOH 97  1049 176 HOH HOH A . 
K 6 HOH 98  1050 177 HOH HOH A . 
K 6 HOH 99  1051 178 HOH HOH A . 
K 6 HOH 100 1052 183 HOH HOH A . 
K 6 HOH 101 1053 185 HOH HOH A . 
K 6 HOH 102 1054 188 HOH HOH A . 
K 6 HOH 103 1055 190 HOH HOH A . 
K 6 HOH 104 1056 191 HOH HOH A . 
K 6 HOH 105 1057 192 HOH HOH A . 
K 6 HOH 106 1058 193 HOH HOH A . 
K 6 HOH 107 1059 194 HOH HOH A . 
K 6 HOH 108 1060 195 HOH HOH A . 
K 6 HOH 109 1061 198 HOH HOH A . 
K 6 HOH 110 1062 201 HOH HOH A . 
K 6 HOH 111 1063 203 HOH HOH A . 
K 6 HOH 112 1064 204 HOH HOH A . 
K 6 HOH 113 1065 205 HOH HOH A . 
K 6 HOH 114 1066 206 HOH HOH A . 
K 6 HOH 115 1067 208 HOH HOH A . 
K 6 HOH 116 1068 210 HOH HOH A . 
K 6 HOH 117 1069 212 HOH HOH A . 
K 6 HOH 118 1070 214 HOH HOH A . 
K 6 HOH 119 1071 215 HOH HOH A . 
K 6 HOH 120 1072 216 HOH HOH A . 
K 6 HOH 121 1073 217 HOH HOH A . 
K 6 HOH 122 1074 218 HOH HOH A . 
K 6 HOH 123 1075 219 HOH HOH A . 
K 6 HOH 124 1076 220 HOH HOH A . 
K 6 HOH 125 1077 223 HOH HOH A . 
K 6 HOH 126 1078 224 HOH HOH A . 
K 6 HOH 127 1079 225 HOH HOH A . 
K 6 HOH 128 1080 226 HOH HOH A . 
K 6 HOH 129 1081 228 HOH HOH A . 
K 6 HOH 130 1082 229 HOH HOH A . 
K 6 HOH 131 1083 233 HOH HOH A . 
K 6 HOH 132 1084 235 HOH HOH A . 
K 6 HOH 133 1085 238 HOH HOH A . 
K 6 HOH 134 1086 239 HOH HOH A . 
K 6 HOH 135 1087 240 HOH HOH A . 
K 6 HOH 136 1088 242 HOH HOH A . 
K 6 HOH 137 1089 243 HOH HOH A . 
K 6 HOH 138 1090 245 HOH HOH A . 
K 6 HOH 139 1091 248 HOH HOH A . 
K 6 HOH 140 1092 250 HOH HOH A . 
K 6 HOH 141 1093 251 HOH HOH A . 
K 6 HOH 142 1094 252 HOH HOH A . 
K 6 HOH 143 1095 253 HOH HOH A . 
K 6 HOH 144 1096 256 HOH HOH A . 
K 6 HOH 145 1097 258 HOH HOH A . 
K 6 HOH 146 1098 262 HOH HOH A . 
K 6 HOH 147 1099 263 HOH HOH A . 
K 6 HOH 148 1100 266 HOH HOH A . 
K 6 HOH 149 1101 267 HOH HOH A . 
K 6 HOH 150 1102 268 HOH HOH A . 
K 6 HOH 151 1103 270 HOH HOH A . 
K 6 HOH 152 1104 271 HOH HOH A . 
K 6 HOH 153 1105 273 HOH HOH A . 
K 6 HOH 154 1106 275 HOH HOH A . 
K 6 HOH 155 1107 280 HOH HOH A . 
K 6 HOH 156 1108 282 HOH HOH A . 
K 6 HOH 157 1109 284 HOH HOH A . 
K 6 HOH 158 1110 285 HOH HOH A . 
K 6 HOH 159 1111 287 HOH HOH A . 
K 6 HOH 160 1112 288 HOH HOH A . 
K 6 HOH 161 1113 291 HOH HOH A . 
K 6 HOH 162 1114 292 HOH HOH A . 
K 6 HOH 163 1115 294 HOH HOH A . 
K 6 HOH 164 1116 295 HOH HOH A . 
K 6 HOH 165 1117 297 HOH HOH A . 
K 6 HOH 166 1118 298 HOH HOH A . 
K 6 HOH 167 1119 302 HOH HOH A . 
K 6 HOH 168 1120 303 HOH HOH A . 
K 6 HOH 169 1121 304 HOH HOH A . 
K 6 HOH 170 1122 307 HOH HOH A . 
K 6 HOH 171 1123 309 HOH HOH A . 
K 6 HOH 172 1124 317 HOH HOH A . 
K 6 HOH 173 1125 325 HOH HOH A . 
K 6 HOH 174 1126 326 HOH HOH A . 
K 6 HOH 175 1127 327 HOH HOH A . 
K 6 HOH 176 1128 328 HOH HOH A . 
K 6 HOH 177 1129 329 HOH HOH A . 
K 6 HOH 178 1130 331 HOH HOH A . 
K 6 HOH 179 1131 332 HOH HOH A . 
K 6 HOH 180 1132 333 HOH HOH A . 
K 6 HOH 181 1133 334 HOH HOH A . 
K 6 HOH 182 1134 335 HOH HOH A . 
K 6 HOH 183 1135 336 HOH HOH A . 
K 6 HOH 184 1136 337 HOH HOH A . 
K 6 HOH 185 1137 338 HOH HOH A . 
K 6 HOH 186 1138 340 HOH HOH A . 
K 6 HOH 187 1139 341 HOH HOH A . 
K 6 HOH 188 1140 342 HOH HOH A . 
K 6 HOH 189 1141 343 HOH HOH A . 
K 6 HOH 190 1142 344 HOH HOH A . 
K 6 HOH 191 1143 348 HOH HOH A . 
K 6 HOH 192 1144 349 HOH HOH A . 
K 6 HOH 193 1145 352 HOH HOH A . 
K 6 HOH 194 1146 353 HOH HOH A . 
K 6 HOH 195 1147 354 HOH HOH A . 
K 6 HOH 196 1148 355 HOH HOH A . 
K 6 HOH 197 1149 356 HOH HOH A . 
K 6 HOH 198 1150 357 HOH HOH A . 
K 6 HOH 199 1151 358 HOH HOH A . 
K 6 HOH 200 1152 359 HOH HOH A . 
K 6 HOH 201 1153 360 HOH HOH A . 
K 6 HOH 202 1154 367 HOH HOH A . 
K 6 HOH 203 1155 370 HOH HOH A . 
K 6 HOH 204 1156 371 HOH HOH A . 
K 6 HOH 205 1157 372 HOH HOH A . 
K 6 HOH 206 1158 378 HOH HOH A . 
K 6 HOH 207 1159 379 HOH HOH A . 
K 6 HOH 208 1160 380 HOH HOH A . 
K 6 HOH 209 1161 384 HOH HOH A . 
K 6 HOH 210 1162 385 HOH HOH A . 
K 6 HOH 211 1163 386 HOH HOH A . 
K 6 HOH 212 1164 387 HOH HOH A . 
K 6 HOH 213 1165 388 HOH HOH A . 
K 6 HOH 214 1166 392 HOH HOH A . 
K 6 HOH 215 1167 393 HOH HOH A . 
K 6 HOH 216 1168 394 HOH HOH A . 
K 6 HOH 217 1169 395 HOH HOH A . 
K 6 HOH 218 1170 396 HOH HOH A . 
K 6 HOH 219 1171 397 HOH HOH A . 
K 6 HOH 220 1172 399 HOH HOH A . 
K 6 HOH 221 1173 400 HOH HOH A . 
K 6 HOH 222 1174 402 HOH HOH A . 
K 6 HOH 223 1175 403 HOH HOH A . 
K 6 HOH 224 1176 404 HOH HOH A . 
K 6 HOH 225 1177 406 HOH HOH A . 
K 6 HOH 226 1178 407 HOH HOH A . 
K 6 HOH 227 1179 413 HOH HOH A . 
K 6 HOH 228 1180 414 HOH HOH A . 
K 6 HOH 229 1181 415 HOH HOH A . 
K 6 HOH 230 1182 416 HOH HOH A . 
K 6 HOH 231 1183 417 HOH HOH A . 
K 6 HOH 232 1184 418 HOH HOH A . 
K 6 HOH 233 1185 420 HOH HOH A . 
K 6 HOH 234 1186 421 HOH HOH A . 
K 6 HOH 235 1187 422 HOH HOH A . 
K 6 HOH 236 1188 423 HOH HOH A . 
K 6 HOH 237 1189 424 HOH HOH A . 
K 6 HOH 238 1190 425 HOH HOH A . 
K 6 HOH 239 1191 426 HOH HOH A . 
K 6 HOH 240 1192 427 HOH HOH A . 
K 6 HOH 241 1193 428 HOH HOH A . 
K 6 HOH 242 1194 433 HOH HOH A . 
K 6 HOH 243 1195 434 HOH HOH A . 
K 6 HOH 244 1196 435 HOH HOH A . 
K 6 HOH 245 1197 438 HOH HOH A . 
K 6 HOH 246 1198 441 HOH HOH A . 
K 6 HOH 247 1199 447 HOH HOH A . 
K 6 HOH 248 1200 448 HOH HOH A . 
K 6 HOH 249 1201 449 HOH HOH A . 
K 6 HOH 250 1202 452 HOH HOH A . 
K 6 HOH 251 1203 453 HOH HOH A . 
K 6 HOH 252 1204 454 HOH HOH A . 
K 6 HOH 253 1205 455 HOH HOH A . 
K 6 HOH 254 1206 460 HOH HOH A . 
K 6 HOH 255 1207 465 HOH HOH A . 
K 6 HOH 256 1208 466 HOH HOH A . 
K 6 HOH 257 1209 467 HOH HOH A . 
K 6 HOH 258 1210 468 HOH HOH A . 
K 6 HOH 259 1211 469 HOH HOH A . 
K 6 HOH 260 1212 470 HOH HOH A . 
K 6 HOH 261 1213 471 HOH HOH A . 
K 6 HOH 262 1214 472 HOH HOH A . 
K 6 HOH 263 1215 476 HOH HOH A . 
K 6 HOH 264 1216 477 HOH HOH A . 
K 6 HOH 265 1217 478 HOH HOH A . 
K 6 HOH 266 1218 482 HOH HOH A . 
K 6 HOH 267 1219 483 HOH HOH A . 
K 6 HOH 268 1220 485 HOH HOH A . 
K 6 HOH 269 1221 486 HOH HOH A . 
K 6 HOH 270 1222 487 HOH HOH A . 
K 6 HOH 271 1223 488 HOH HOH A . 
K 6 HOH 272 1224 489 HOH HOH A . 
K 6 HOH 273 1225 490 HOH HOH A . 
K 6 HOH 274 1226 492 HOH HOH A . 
K 6 HOH 275 1227 493 HOH HOH A . 
K 6 HOH 276 1228 506 HOH HOH A . 
K 6 HOH 277 1229 507 HOH HOH A . 
K 6 HOH 278 1230 508 HOH HOH A . 
K 6 HOH 279 1231 509 HOH HOH A . 
K 6 HOH 280 1232 510 HOH HOH A . 
K 6 HOH 281 1233 511 HOH HOH A . 
K 6 HOH 282 1234 512 HOH HOH A . 
K 6 HOH 283 1235 515 HOH HOH A . 
K 6 HOH 284 1236 516 HOH HOH A . 
K 6 HOH 285 1237 517 HOH HOH A . 
K 6 HOH 286 1238 519 HOH HOH A . 
K 6 HOH 287 1239 520 HOH HOH A . 
K 6 HOH 288 1240 521 HOH HOH A . 
K 6 HOH 289 1241 522 HOH HOH A . 
K 6 HOH 290 1242 523 HOH HOH A . 
K 6 HOH 291 1243 526 HOH HOH A . 
K 6 HOH 292 1244 527 HOH HOH A . 
K 6 HOH 293 1245 528 HOH HOH A . 
K 6 HOH 294 1246 533 HOH HOH A . 
K 6 HOH 295 1247 534 HOH HOH A . 
K 6 HOH 296 1248 535 HOH HOH A . 
K 6 HOH 297 1249 536 HOH HOH A . 
K 6 HOH 298 1250 540 HOH HOH A . 
K 6 HOH 299 1251 541 HOH HOH A . 
K 6 HOH 300 1252 546 HOH HOH A . 
K 6 HOH 301 1253 549 HOH HOH A . 
K 6 HOH 302 1254 550 HOH HOH A . 
K 6 HOH 303 1255 551 HOH HOH A . 
K 6 HOH 304 1256 552 HOH HOH A . 
K 6 HOH 305 1257 553 HOH HOH A . 
K 6 HOH 306 1258 555 HOH HOH A . 
K 6 HOH 307 1259 556 HOH HOH A . 
K 6 HOH 308 1260 557 HOH HOH A . 
K 6 HOH 309 1261 560 HOH HOH A . 
K 6 HOH 310 1262 561 HOH HOH A . 
K 6 HOH 311 1263 563 HOH HOH A . 
K 6 HOH 312 1264 564 HOH HOH A . 
K 6 HOH 313 1265 567 HOH HOH A . 
K 6 HOH 314 1266 568 HOH HOH A . 
K 6 HOH 315 1267 571 HOH HOH A . 
K 6 HOH 316 1268 572 HOH HOH A . 
K 6 HOH 317 1269 575 HOH HOH A . 
K 6 HOH 318 1270 576 HOH HOH A . 
K 6 HOH 319 1271 577 HOH HOH A . 
K 6 HOH 320 1272 582 HOH HOH A . 
K 6 HOH 321 1273 584 HOH HOH A . 
K 6 HOH 322 1274 586 HOH HOH A . 
K 6 HOH 323 1275 588 HOH HOH A . 
K 6 HOH 324 1276 589 HOH HOH A . 
K 6 HOH 325 1277 590 HOH HOH A . 
K 6 HOH 326 1278 595 HOH HOH A . 
K 6 HOH 327 1279 596 HOH HOH A . 
K 6 HOH 328 1280 597 HOH HOH A . 
K 6 HOH 329 1281 598 HOH HOH A . 
K 6 HOH 330 1282 599 HOH HOH A . 
K 6 HOH 331 1283 604 HOH HOH A . 
K 6 HOH 332 1284 605 HOH HOH A . 
K 6 HOH 333 1285 606 HOH HOH A . 
K 6 HOH 334 1286 608 HOH HOH A . 
K 6 HOH 335 1287 609 HOH HOH A . 
K 6 HOH 336 1288 610 HOH HOH A . 
K 6 HOH 337 1289 612 HOH HOH A . 
K 6 HOH 338 1290 613 HOH HOH A . 
K 6 HOH 339 1291 615 HOH HOH A . 
K 6 HOH 340 1292 624 HOH HOH A . 
K 6 HOH 341 1293 625 HOH HOH A . 
K 6 HOH 342 1294 628 HOH HOH A . 
K 6 HOH 343 1295 633 HOH HOH A . 
K 6 HOH 344 1296 634 HOH HOH A . 
K 6 HOH 345 1297 635 HOH HOH A . 
K 6 HOH 346 1298 636 HOH HOH A . 
K 6 HOH 347 1299 637 HOH HOH A . 
K 6 HOH 348 1300 640 HOH HOH A . 
K 6 HOH 349 1301 646 HOH HOH A . 
K 6 HOH 350 1302 647 HOH HOH A . 
K 6 HOH 351 1303 650 HOH HOH A . 
K 6 HOH 352 1304 653 HOH HOH A . 
K 6 HOH 353 1305 654 HOH HOH A . 
K 6 HOH 354 1306 658 HOH HOH A . 
K 6 HOH 355 1307 659 HOH HOH A . 
K 6 HOH 356 1308 661 HOH HOH A . 
K 6 HOH 357 1309 662 HOH HOH A . 
K 6 HOH 358 1310 664 HOH HOH A . 
K 6 HOH 359 1311 665 HOH HOH A . 
K 6 HOH 360 1312 667 HOH HOH A . 
K 6 HOH 361 1313 669 HOH HOH A . 
K 6 HOH 362 1314 672 HOH HOH A . 
K 6 HOH 363 1315 673 HOH HOH A . 
K 6 HOH 364 1316 674 HOH HOH A . 
K 6 HOH 365 1317 681 HOH HOH A . 
K 6 HOH 366 1318 682 HOH HOH A . 
K 6 HOH 367 1319 687 HOH HOH A . 
K 6 HOH 368 1320 688 HOH HOH A . 
K 6 HOH 369 1321 689 HOH HOH A . 
K 6 HOH 370 1322 690 HOH HOH A . 
K 6 HOH 371 1323 691 HOH HOH A . 
K 6 HOH 372 1324 692 HOH HOH A . 
K 6 HOH 373 1325 693 HOH HOH A . 
K 6 HOH 374 1326 694 HOH HOH A . 
K 6 HOH 375 1327 695 HOH HOH A . 
K 6 HOH 376 1328 696 HOH HOH A . 
K 6 HOH 377 1329 698 HOH HOH A . 
K 6 HOH 378 1330 699 HOH HOH A . 
K 6 HOH 379 1331 700 HOH HOH A . 
K 6 HOH 380 1332 701 HOH HOH A . 
K 6 HOH 381 1333 702 HOH HOH A . 
K 6 HOH 382 1334 703 HOH HOH A . 
K 6 HOH 383 1335 704 HOH HOH A . 
K 6 HOH 384 1336 705 HOH HOH A . 
K 6 HOH 385 1337 706 HOH HOH A . 
K 6 HOH 386 1338 707 HOH HOH A . 
K 6 HOH 387 1339 708 HOH HOH A . 
K 6 HOH 388 1340 709 HOH HOH A . 
K 6 HOH 389 1341 735 HOH HOH A . 
K 6 HOH 390 1342 736 HOH HOH A . 
K 6 HOH 391 1343 737 HOH HOH A . 
K 6 HOH 392 1344 742 HOH HOH A . 
K 6 HOH 393 1345 743 HOH HOH A . 
K 6 HOH 394 1346 745 HOH HOH A . 
K 6 HOH 395 1347 747 HOH HOH A . 
K 6 HOH 396 1348 748 HOH HOH A . 
L 6 HOH 1   963  5   HOH HOH B . 
L 6 HOH 2   964  8   HOH HOH B . 
L 6 HOH 3   965  9   HOH HOH B . 
L 6 HOH 4   966  11  HOH HOH B . 
L 6 HOH 5   967  12  HOH HOH B . 
L 6 HOH 6   968  14  HOH HOH B . 
L 6 HOH 7   969  17  HOH HOH B . 
L 6 HOH 8   970  25  HOH HOH B . 
L 6 HOH 9   971  27  HOH HOH B . 
L 6 HOH 10  972  28  HOH HOH B . 
L 6 HOH 11  973  31  HOH HOH B . 
L 6 HOH 12  974  32  HOH HOH B . 
L 6 HOH 13  975  37  HOH HOH B . 
L 6 HOH 14  976  38  HOH HOH B . 
L 6 HOH 15  977  39  HOH HOH B . 
L 6 HOH 16  978  40  HOH HOH B . 
L 6 HOH 17  979  41  HOH HOH B . 
L 6 HOH 18  980  42  HOH HOH B . 
L 6 HOH 19  981  44  HOH HOH B . 
L 6 HOH 20  982  45  HOH HOH B . 
L 6 HOH 21  983  46  HOH HOH B . 
L 6 HOH 22  984  47  HOH HOH B . 
L 6 HOH 23  985  48  HOH HOH B . 
L 6 HOH 24  986  51  HOH HOH B . 
L 6 HOH 25  987  52  HOH HOH B . 
L 6 HOH 26  988  55  HOH HOH B . 
L 6 HOH 27  989  56  HOH HOH B . 
L 6 HOH 28  990  59  HOH HOH B . 
L 6 HOH 29  991  61  HOH HOH B . 
L 6 HOH 30  992  65  HOH HOH B . 
L 6 HOH 31  993  67  HOH HOH B . 
L 6 HOH 32  994  68  HOH HOH B . 
L 6 HOH 33  995  70  HOH HOH B . 
L 6 HOH 34  996  72  HOH HOH B . 
L 6 HOH 35  997  74  HOH HOH B . 
L 6 HOH 36  998  77  HOH HOH B . 
L 6 HOH 37  999  84  HOH HOH B . 
L 6 HOH 38  1000 89  HOH HOH B . 
L 6 HOH 39  1001 92  HOH HOH B . 
L 6 HOH 40  1002 93  HOH HOH B . 
L 6 HOH 41  1003 98  HOH HOH B . 
L 6 HOH 42  1004 101 HOH HOH B . 
L 6 HOH 43  1005 102 HOH HOH B . 
L 6 HOH 44  1006 103 HOH HOH B . 
L 6 HOH 45  1007 104 HOH HOH B . 
L 6 HOH 46  1008 105 HOH HOH B . 
L 6 HOH 47  1009 106 HOH HOH B . 
L 6 HOH 48  1010 107 HOH HOH B . 
L 6 HOH 49  1011 113 HOH HOH B . 
L 6 HOH 50  1012 114 HOH HOH B . 
L 6 HOH 51  1013 115 HOH HOH B . 
L 6 HOH 52  1014 116 HOH HOH B . 
L 6 HOH 53  1015 117 HOH HOH B . 
L 6 HOH 54  1016 119 HOH HOH B . 
L 6 HOH 55  1017 121 HOH HOH B . 
L 6 HOH 56  1018 122 HOH HOH B . 
L 6 HOH 57  1019 125 HOH HOH B . 
L 6 HOH 58  1020 131 HOH HOH B . 
L 6 HOH 59  1021 133 HOH HOH B . 
L 6 HOH 60  1022 135 HOH HOH B . 
L 6 HOH 61  1023 138 HOH HOH B . 
L 6 HOH 62  1024 140 HOH HOH B . 
L 6 HOH 63  1025 141 HOH HOH B . 
L 6 HOH 64  1026 144 HOH HOH B . 
L 6 HOH 65  1027 146 HOH HOH B . 
L 6 HOH 66  1028 147 HOH HOH B . 
L 6 HOH 67  1029 148 HOH HOH B . 
L 6 HOH 68  1030 149 HOH HOH B . 
L 6 HOH 69  1031 157 HOH HOH B . 
L 6 HOH 70  1032 158 HOH HOH B . 
L 6 HOH 71  1033 160 HOH HOH B . 
L 6 HOH 72  1034 162 HOH HOH B . 
L 6 HOH 73  1035 163 HOH HOH B . 
L 6 HOH 74  1036 164 HOH HOH B . 
L 6 HOH 75  1037 166 HOH HOH B . 
L 6 HOH 76  1038 171 HOH HOH B . 
L 6 HOH 77  1039 173 HOH HOH B . 
L 6 HOH 78  1040 174 HOH HOH B . 
L 6 HOH 79  1041 175 HOH HOH B . 
L 6 HOH 80  1042 179 HOH HOH B . 
L 6 HOH 81  1043 180 HOH HOH B . 
L 6 HOH 82  1044 181 HOH HOH B . 
L 6 HOH 83  1045 182 HOH HOH B . 
L 6 HOH 84  1046 184 HOH HOH B . 
L 6 HOH 85  1047 186 HOH HOH B . 
L 6 HOH 86  1048 187 HOH HOH B . 
L 6 HOH 87  1049 189 HOH HOH B . 
L 6 HOH 88  1050 196 HOH HOH B . 
L 6 HOH 89  1051 197 HOH HOH B . 
L 6 HOH 90  1052 199 HOH HOH B . 
L 6 HOH 91  1053 200 HOH HOH B . 
L 6 HOH 92  1054 202 HOH HOH B . 
L 6 HOH 93  1055 207 HOH HOH B . 
L 6 HOH 94  1056 209 HOH HOH B . 
L 6 HOH 95  1057 211 HOH HOH B . 
L 6 HOH 96  1058 213 HOH HOH B . 
L 6 HOH 97  1059 221 HOH HOH B . 
L 6 HOH 98  1060 222 HOH HOH B . 
L 6 HOH 99  1061 227 HOH HOH B . 
L 6 HOH 100 1062 230 HOH HOH B . 
L 6 HOH 101 1063 232 HOH HOH B . 
L 6 HOH 102 1064 234 HOH HOH B . 
L 6 HOH 103 1065 236 HOH HOH B . 
L 6 HOH 104 1066 237 HOH HOH B . 
L 6 HOH 105 1067 241 HOH HOH B . 
L 6 HOH 106 1068 244 HOH HOH B . 
L 6 HOH 107 1069 246 HOH HOH B . 
L 6 HOH 108 1070 247 HOH HOH B . 
L 6 HOH 109 1071 249 HOH HOH B . 
L 6 HOH 110 1072 254 HOH HOH B . 
L 6 HOH 111 1073 255 HOH HOH B . 
L 6 HOH 112 1074 257 HOH HOH B . 
L 6 HOH 113 1075 259 HOH HOH B . 
L 6 HOH 114 1076 260 HOH HOH B . 
L 6 HOH 115 1077 261 HOH HOH B . 
L 6 HOH 116 1078 264 HOH HOH B . 
L 6 HOH 117 1079 265 HOH HOH B . 
L 6 HOH 118 1080 269 HOH HOH B . 
L 6 HOH 119 1081 272 HOH HOH B . 
L 6 HOH 120 1082 274 HOH HOH B . 
L 6 HOH 121 1083 276 HOH HOH B . 
L 6 HOH 122 1084 277 HOH HOH B . 
L 6 HOH 123 1085 278 HOH HOH B . 
L 6 HOH 124 1086 279 HOH HOH B . 
L 6 HOH 125 1087 281 HOH HOH B . 
L 6 HOH 126 1088 283 HOH HOH B . 
L 6 HOH 127 1089 286 HOH HOH B . 
L 6 HOH 128 1090 289 HOH HOH B . 
L 6 HOH 129 1091 290 HOH HOH B . 
L 6 HOH 130 1092 293 HOH HOH B . 
L 6 HOH 131 1093 296 HOH HOH B . 
L 6 HOH 132 1094 299 HOH HOH B . 
L 6 HOH 133 1095 300 HOH HOH B . 
L 6 HOH 134 1096 301 HOH HOH B . 
L 6 HOH 135 1097 305 HOH HOH B . 
L 6 HOH 136 1098 306 HOH HOH B . 
L 6 HOH 137 1099 308 HOH HOH B . 
L 6 HOH 138 1100 310 HOH HOH B . 
L 6 HOH 139 1101 311 HOH HOH B . 
L 6 HOH 140 1102 312 HOH HOH B . 
L 6 HOH 141 1103 313 HOH HOH B . 
L 6 HOH 142 1104 314 HOH HOH B . 
L 6 HOH 143 1105 315 HOH HOH B . 
L 6 HOH 144 1106 316 HOH HOH B . 
L 6 HOH 145 1107 318 HOH HOH B . 
L 6 HOH 146 1108 319 HOH HOH B . 
L 6 HOH 147 1109 320 HOH HOH B . 
L 6 HOH 148 1110 321 HOH HOH B . 
L 6 HOH 149 1111 322 HOH HOH B . 
L 6 HOH 150 1112 323 HOH HOH B . 
L 6 HOH 151 1113 324 HOH HOH B . 
L 6 HOH 152 1114 330 HOH HOH B . 
L 6 HOH 153 1115 339 HOH HOH B . 
L 6 HOH 154 1116 345 HOH HOH B . 
L 6 HOH 155 1117 346 HOH HOH B . 
L 6 HOH 156 1118 347 HOH HOH B . 
L 6 HOH 157 1119 350 HOH HOH B . 
L 6 HOH 158 1120 351 HOH HOH B . 
L 6 HOH 159 1121 361 HOH HOH B . 
L 6 HOH 160 1122 362 HOH HOH B . 
L 6 HOH 161 1123 363 HOH HOH B . 
L 6 HOH 162 1124 364 HOH HOH B . 
L 6 HOH 163 1125 365 HOH HOH B . 
L 6 HOH 164 1126 366 HOH HOH B . 
L 6 HOH 165 1127 368 HOH HOH B . 
L 6 HOH 166 1128 369 HOH HOH B . 
L 6 HOH 167 1129 373 HOH HOH B . 
L 6 HOH 168 1130 374 HOH HOH B . 
L 6 HOH 169 1131 375 HOH HOH B . 
L 6 HOH 170 1132 376 HOH HOH B . 
L 6 HOH 171 1133 377 HOH HOH B . 
L 6 HOH 172 1134 381 HOH HOH B . 
L 6 HOH 173 1135 382 HOH HOH B . 
L 6 HOH 174 1136 383 HOH HOH B . 
L 6 HOH 175 1137 389 HOH HOH B . 
L 6 HOH 176 1138 390 HOH HOH B . 
L 6 HOH 177 1139 391 HOH HOH B . 
L 6 HOH 178 1140 398 HOH HOH B . 
L 6 HOH 179 1141 401 HOH HOH B . 
L 6 HOH 180 1142 405 HOH HOH B . 
L 6 HOH 181 1143 408 HOH HOH B . 
L 6 HOH 182 1144 409 HOH HOH B . 
L 6 HOH 183 1145 410 HOH HOH B . 
L 6 HOH 184 1146 411 HOH HOH B . 
L 6 HOH 185 1147 412 HOH HOH B . 
L 6 HOH 186 1148 419 HOH HOH B . 
L 6 HOH 187 1149 429 HOH HOH B . 
L 6 HOH 188 1150 430 HOH HOH B . 
L 6 HOH 189 1151 431 HOH HOH B . 
L 6 HOH 190 1152 432 HOH HOH B . 
L 6 HOH 191 1153 436 HOH HOH B . 
L 6 HOH 192 1154 437 HOH HOH B . 
L 6 HOH 193 1155 439 HOH HOH B . 
L 6 HOH 194 1156 440 HOH HOH B . 
L 6 HOH 195 1157 442 HOH HOH B . 
L 6 HOH 196 1158 443 HOH HOH B . 
L 6 HOH 197 1159 444 HOH HOH B . 
L 6 HOH 198 1160 445 HOH HOH B . 
L 6 HOH 199 1161 446 HOH HOH B . 
L 6 HOH 200 1162 450 HOH HOH B . 
L 6 HOH 201 1163 451 HOH HOH B . 
L 6 HOH 202 1164 456 HOH HOH B . 
L 6 HOH 203 1165 457 HOH HOH B . 
L 6 HOH 204 1166 458 HOH HOH B . 
L 6 HOH 205 1167 459 HOH HOH B . 
L 6 HOH 206 1168 461 HOH HOH B . 
L 6 HOH 207 1169 462 HOH HOH B . 
L 6 HOH 208 1170 463 HOH HOH B . 
L 6 HOH 209 1171 464 HOH HOH B . 
L 6 HOH 210 1172 473 HOH HOH B . 
L 6 HOH 211 1173 474 HOH HOH B . 
L 6 HOH 212 1174 475 HOH HOH B . 
L 6 HOH 213 1175 479 HOH HOH B . 
L 6 HOH 214 1176 480 HOH HOH B . 
L 6 HOH 215 1177 481 HOH HOH B . 
L 6 HOH 216 1178 484 HOH HOH B . 
L 6 HOH 217 1179 491 HOH HOH B . 
L 6 HOH 218 1180 494 HOH HOH B . 
L 6 HOH 219 1181 495 HOH HOH B . 
L 6 HOH 220 1182 496 HOH HOH B . 
L 6 HOH 221 1183 497 HOH HOH B . 
L 6 HOH 222 1184 498 HOH HOH B . 
L 6 HOH 223 1185 499 HOH HOH B . 
L 6 HOH 224 1186 500 HOH HOH B . 
L 6 HOH 225 1187 501 HOH HOH B . 
L 6 HOH 226 1188 502 HOH HOH B . 
L 6 HOH 227 1189 503 HOH HOH B . 
L 6 HOH 228 1190 504 HOH HOH B . 
L 6 HOH 229 1191 505 HOH HOH B . 
L 6 HOH 230 1192 513 HOH HOH B . 
L 6 HOH 231 1193 514 HOH HOH B . 
L 6 HOH 232 1194 518 HOH HOH B . 
L 6 HOH 233 1195 524 HOH HOH B . 
L 6 HOH 234 1196 525 HOH HOH B . 
L 6 HOH 235 1197 529 HOH HOH B . 
L 6 HOH 236 1198 530 HOH HOH B . 
L 6 HOH 237 1199 531 HOH HOH B . 
L 6 HOH 238 1200 532 HOH HOH B . 
L 6 HOH 239 1201 537 HOH HOH B . 
L 6 HOH 240 1202 538 HOH HOH B . 
L 6 HOH 241 1203 539 HOH HOH B . 
L 6 HOH 242 1204 542 HOH HOH B . 
L 6 HOH 243 1205 543 HOH HOH B . 
L 6 HOH 244 1206 544 HOH HOH B . 
L 6 HOH 245 1207 545 HOH HOH B . 
L 6 HOH 246 1208 547 HOH HOH B . 
L 6 HOH 247 1209 548 HOH HOH B . 
L 6 HOH 248 1210 554 HOH HOH B . 
L 6 HOH 249 1211 559 HOH HOH B . 
L 6 HOH 250 1212 562 HOH HOH B . 
L 6 HOH 251 1213 565 HOH HOH B . 
L 6 HOH 252 1214 566 HOH HOH B . 
L 6 HOH 253 1215 569 HOH HOH B . 
L 6 HOH 254 1216 570 HOH HOH B . 
L 6 HOH 255 1217 573 HOH HOH B . 
L 6 HOH 256 1218 574 HOH HOH B . 
L 6 HOH 257 1219 578 HOH HOH B . 
L 6 HOH 258 1220 579 HOH HOH B . 
L 6 HOH 259 1221 580 HOH HOH B . 
L 6 HOH 260 1222 581 HOH HOH B . 
L 6 HOH 261 1223 583 HOH HOH B . 
L 6 HOH 262 1224 585 HOH HOH B . 
L 6 HOH 263 1225 587 HOH HOH B . 
L 6 HOH 264 1226 591 HOH HOH B . 
L 6 HOH 265 1227 592 HOH HOH B . 
L 6 HOH 266 1228 593 HOH HOH B . 
L 6 HOH 267 1229 594 HOH HOH B . 
L 6 HOH 268 1230 600 HOH HOH B . 
L 6 HOH 269 1231 601 HOH HOH B . 
L 6 HOH 270 1232 602 HOH HOH B . 
L 6 HOH 271 1233 603 HOH HOH B . 
L 6 HOH 272 1234 607 HOH HOH B . 
L 6 HOH 273 1235 611 HOH HOH B . 
L 6 HOH 274 1236 614 HOH HOH B . 
L 6 HOH 275 1237 616 HOH HOH B . 
L 6 HOH 276 1238 617 HOH HOH B . 
L 6 HOH 277 1239 618 HOH HOH B . 
L 6 HOH 278 1240 619 HOH HOH B . 
L 6 HOH 279 1241 620 HOH HOH B . 
L 6 HOH 280 1242 621 HOH HOH B . 
L 6 HOH 281 1243 622 HOH HOH B . 
L 6 HOH 282 1244 623 HOH HOH B . 
L 6 HOH 283 1245 626 HOH HOH B . 
L 6 HOH 284 1246 627 HOH HOH B . 
L 6 HOH 285 1247 629 HOH HOH B . 
L 6 HOH 286 1248 630 HOH HOH B . 
L 6 HOH 287 1249 631 HOH HOH B . 
L 6 HOH 288 1250 632 HOH HOH B . 
L 6 HOH 289 1251 638 HOH HOH B . 
L 6 HOH 290 1252 639 HOH HOH B . 
L 6 HOH 291 1253 641 HOH HOH B . 
L 6 HOH 292 1254 642 HOH HOH B . 
L 6 HOH 293 1255 643 HOH HOH B . 
L 6 HOH 294 1256 644 HOH HOH B . 
L 6 HOH 295 1257 645 HOH HOH B . 
L 6 HOH 296 1258 648 HOH HOH B . 
L 6 HOH 297 1259 649 HOH HOH B . 
L 6 HOH 298 1260 651 HOH HOH B . 
L 6 HOH 299 1261 652 HOH HOH B . 
L 6 HOH 300 1262 655 HOH HOH B . 
L 6 HOH 301 1263 656 HOH HOH B . 
L 6 HOH 302 1264 657 HOH HOH B . 
L 6 HOH 303 1265 660 HOH HOH B . 
L 6 HOH 304 1266 663 HOH HOH B . 
L 6 HOH 305 1267 666 HOH HOH B . 
L 6 HOH 306 1268 668 HOH HOH B . 
L 6 HOH 307 1269 670 HOH HOH B . 
L 6 HOH 308 1270 671 HOH HOH B . 
L 6 HOH 309 1271 675 HOH HOH B . 
L 6 HOH 310 1272 676 HOH HOH B . 
L 6 HOH 311 1273 677 HOH HOH B . 
L 6 HOH 312 1274 678 HOH HOH B . 
L 6 HOH 313 1275 679 HOH HOH B . 
L 6 HOH 314 1276 680 HOH HOH B . 
L 6 HOH 315 1277 683 HOH HOH B . 
L 6 HOH 316 1278 684 HOH HOH B . 
L 6 HOH 317 1279 685 HOH HOH B . 
L 6 HOH 318 1280 686 HOH HOH B . 
L 6 HOH 319 1281 710 HOH HOH B . 
L 6 HOH 320 1282 711 HOH HOH B . 
L 6 HOH 321 1283 712 HOH HOH B . 
L 6 HOH 322 1284 713 HOH HOH B . 
L 6 HOH 323 1285 714 HOH HOH B . 
L 6 HOH 324 1286 715 HOH HOH B . 
L 6 HOH 325 1287 716 HOH HOH B . 
L 6 HOH 326 1288 717 HOH HOH B . 
L 6 HOH 327 1289 718 HOH HOH B . 
L 6 HOH 328 1290 719 HOH HOH B . 
L 6 HOH 329 1291 720 HOH HOH B . 
L 6 HOH 330 1292 721 HOH HOH B . 
L 6 HOH 331 1293 722 HOH HOH B . 
L 6 HOH 332 1294 723 HOH HOH B . 
L 6 HOH 333 1295 724 HOH HOH B . 
L 6 HOH 334 1296 725 HOH HOH B . 
L 6 HOH 335 1297 726 HOH HOH B . 
L 6 HOH 336 1298 727 HOH HOH B . 
L 6 HOH 337 1299 728 HOH HOH B . 
L 6 HOH 338 1300 729 HOH HOH B . 
L 6 HOH 339 1301 730 HOH HOH B . 
L 6 HOH 340 1302 731 HOH HOH B . 
L 6 HOH 341 1303 732 HOH HOH B . 
L 6 HOH 342 1304 733 HOH HOH B . 
L 6 HOH 343 1305 734 HOH HOH B . 
L 6 HOH 344 1306 741 HOH HOH B . 
L 6 HOH 345 1307 744 HOH HOH B . 
L 6 HOH 346 1308 746 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 350 A ASN 350 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 464 A ASN 464 ? ASN 'GLYCOSYLATION SITE' 
3 B ASN 350 B ASN 350 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-07-18 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' Advisory                    
5 4 'Structure model' 'Atomic model'              
6 4 'Structure model' 'Data collection'           
7 4 'Structure model' 'Derived calculations'      
8 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' database_PDB_caveat           
4  4 'Structure model' entity                        
5  4 'Structure model' pdbx_branch_scheme            
6  4 'Structure model' pdbx_chem_comp_identifier     
7  4 'Structure model' pdbx_entity_branch            
8  4 'Structure model' pdbx_entity_branch_descriptor 
9  4 'Structure model' pdbx_entity_branch_link       
10 4 'Structure model' pdbx_entity_branch_list       
11 4 'Structure model' pdbx_entity_nonpoly           
12 4 'Structure model' pdbx_nonpoly_scheme           
13 4 'Structure model' pdbx_struct_assembly_gen      
14 4 'Structure model' struct_asym                   
15 4 'Structure model' struct_conn                   
16 4 'Structure model' struct_site                   
17 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.auth_asym_id'                
2  4 'Structure model' '_atom_site.auth_seq_id'                 
3  4 'Structure model' '_atom_site.label_asym_id'               
4  4 'Structure model' '_atom_site.label_entity_id'             
5  4 'Structure model' '_chem_comp.name'                        
6  4 'Structure model' '_chem_comp.type'                        
7  4 'Structure model' '_entity.formula_weight'                 
8  4 'Structure model' '_entity.pdbx_description'               
9  4 'Structure model' '_entity.pdbx_number_of_molecules'       
10 4 'Structure model' '_entity.type'                           
11 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
12 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'    
13 4 'Structure model' '_struct_conn.pdbx_role'                 
14 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
15 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
16 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
17 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
18 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 27.5811 12.2054 16.9404  -.0659 -.1029 -.0282 -.0085 -.0019 .0314  .5621 .4962 1.4809 -.1139 .1045 -.2707 -.0581 .0133 
-.0263 .0115 -.0070 -.0054 .1098 -.0359 .0651 'X-RAY DIFFRACTION' 
2 ? refined 7.6618  4.5363  -40.3292 -.0860 -.0761 -.0587 -.0093 -.0127 -.0656 .4480 .6421 1.7855 -.0031 .1742 .3696  .0778  .0167 
-.0185 .0336 -.1191 .0802  .1181 -.0199 .0413 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 1 A 1 A 543 A 543 ? 'X-RAY DIFFRACTION' ? 
2 2 B 4 B 4 B 543 B 543 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0019 ? 1 
ADSC      'data collection' .        ? 2 
DENZO     'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   B HOH 965 ? ? O B HOH 1207 ? ? 1.56 
2 1 NE2 B GLN 291 ? ? O B HOH 1252 ? ? 2.16 
3 1 O   B ASN 490 ? ? O B HOH 1124 ? ? 2.17 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 76.26   -5.11   
2  1 ALA A 62  ? ? -115.94 50.18   
3  1 SER A 203 ? ? 56.58   -120.09 
4  1 CYS A 257 ? ? -115.12 66.06   
5  1 ASP A 306 ? ? -132.80 -84.10  
6  1 SER A 371 ? ? -59.32  172.58  
7  1 VAL A 407 ? ? -126.60 -60.55  
8  1 HIS A 447 ? ? -38.56  119.01  
9  1 LYS A 496 ? ? 47.59   71.77   
10 1 SER A 497 ? ? 3.38    102.83  
11 1 PHE B 47  ? ? 74.49   -1.85   
12 1 ALA B 62  ? ? -115.43 50.01   
13 1 SER B 203 ? ? 60.57   -124.65 
14 1 ASP B 306 ? ? -130.07 -81.85  
15 1 ASP B 323 ? ? -97.14  35.25   
16 1 VAL B 407 ? ? -127.71 -60.11  
17 1 LYS B 496 ? ? 52.78   118.46  
18 1 SER B 497 ? ? -119.66 -99.72  
19 1 ALA B 542 ? ? 155.61  -44.22  
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    B 
_pdbx_validate_chiral.auth_comp_id    NAG 
_pdbx_validate_chiral.auth_seq_id     601 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 496 ? CG  ? A LYS 496 CG  
2  1 Y 1 A LYS 496 ? CD  ? A LYS 496 CD  
3  1 Y 1 A LYS 496 ? CE  ? A LYS 496 CE  
4  1 Y 1 A LYS 496 ? NZ  ? A LYS 496 NZ  
5  1 Y 1 A THR 543 ? OG1 ? A THR 543 OG1 
6  1 Y 1 A THR 543 ? CG2 ? A THR 543 CG2 
7  1 Y 1 B ARG 493 ? CG  ? B ARG 493 CG  
8  1 Y 1 B ARG 493 ? CD  ? B ARG 493 CD  
9  1 Y 1 B ARG 493 ? NE  ? B ARG 493 NE  
10 1 Y 1 B ARG 493 ? CZ  ? B ARG 493 CZ  
11 1 Y 1 B ARG 493 ? NH1 ? B ARG 493 NH1 
12 1 Y 1 B ARG 493 ? NH2 ? B ARG 493 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 260 ? A GLY 260 
2  1 Y 1 A GLY 261 ? A GLY 261 
3  1 Y 1 A ALA 262 ? A ALA 262 
4  1 Y 1 A GLY 263 ? A GLY 263 
5  1 Y 1 A GLY 264 ? A GLY 264 
6  1 Y 1 B GLU 1   ? B GLU 1   
7  1 Y 1 B GLY 2   ? B GLY 2   
8  1 Y 1 B ARG 3   ? B ARG 3   
9  1 Y 1 B PRO 259 ? B PRO 259 
10 1 Y 1 B GLY 260 ? B GLY 260 
11 1 Y 1 B GLY 261 ? B GLY 261 
12 1 Y 1 B ALA 262 ? B ALA 262 
13 1 Y 1 B GLY 263 ? B GLY 263 
14 1 Y 1 B GLY 264 ? B GLY 264 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 S NAG 501 n 
C 2 FUC 2 C FUC 2 S FUC 502 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 LFucpa1-6DGlcpNAcb1-                                                 'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,2,1/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-2/a6-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(6+1)][a-L-Fucp]{}}}'                      LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  FUC 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O6 
_pdbx_entity_branch_link.leaving_atom_id_2          HO6 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 FUC 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
4 'HEXAETHYLENE GLYCOL'                    P6G 
5 'CHOLINE ION'                            CHT 
6 water                                    HOH 
#