data_2HA5
# 
_entry.id   2HA5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2HA5         pdb_00002ha5 10.2210/pdb2ha5/pdb 
RCSB  RCSB038121   ?            ?                   
WWPDB D_1000038121 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1J06 'apo mACHE' unspecified 
PDB 2H9Y .           unspecified 
PDB 2HA0 .           unspecified 
PDB 2HA2 .           unspecified 
PDB 2HA3 .           unspecified 
PDB 2HA4 .           unspecified 
PDB 2HA6 .           unspecified 
PDB 2HA7 .           unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HA5 
_pdbx_database_status.recvd_initial_deposition_date   2006-06-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bourne, Y.'       1 
'Radic, Z.'        2 
'Sulzenbacher, G.' 3 
'Kim, E.'          4 
'Taylor, P.'       5 
'Marchot, P.'      6 
# 
_citation.id                        primary 
_citation.title                     
;Substrate and product trafficking through the active center gorge of acetylcholinesterase analyzed by crystallography and equilibrium binding
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                29256 
_citation.page_last                 29267 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16837465 
_citation.pdbx_database_id_DOI      10.1074/jbc.M603018200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bourne, Y.'       1 ? 
primary 'Radic, Z.'        2 ? 
primary 'Sulzenbacher, G.' 3 ? 
primary 'Kim, E.'          4 ? 
primary 'Taylor, P.'       5 ? 
primary 'Marchot, P.'      6 ? 
# 
_cell.entry_id           2HA5 
_cell.length_a           78.477 
_cell.length_b           109.837 
_cell.length_c           227.885 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HA5 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase                                                  59748.488 2   3.1.1.7 S203A 
'catalytic domain' ? 
2 branched    man 'alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose' 367.349   1   ?       ?     ? ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                              221.208   1   ?       ?     ? ? 
4 non-polymer syn 'ACETATE ION'                                                         59.044    2   ?       ?     ? ? 
5 non-polymer syn ACETYLTHIOCHOLINE                                                     162.273   5   ?       ?     ? ? 
6 non-polymer syn '2-(TRIMETHYLAMMONIUM)ETHYL THIOL'                                    120.236   4   ?       ?     ? ? 
7 non-polymer syn 'HEXAETHYLENE GLYCOL'                                                 282.331   1   ?       ?     ? ? 
8 water       nat water                                                                 18.015    886 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGEAAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGEAAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 ALA n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     Homo 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              'LAMBDA ZAP' 
_entity_src_gen.pdbx_host_org_cell_line            'HEK 293' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 'HUMAN EMBRYONIC KIDNEY CELLS (HEK)' 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           32 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2HA5 A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 2HA5 B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2HA5 ALA A 203 ? UNP P21836 SER 234 'engineered mutation' 203 1 
2 2HA5 ALA B 203 ? UNP P21836 SER 234 'engineered mutation' 203 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer                   . 'ACETATE ION'                            ? 'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
AT3 non-polymer                   . ACETYLTHIOCHOLINE                        
'2-{[(1S)-1-HYDROXYETHYL]THIO}-N,N,N-TRIMETHYLETHANAMINIUM' 'C7 H16 N O S 1' 162.273 
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
ETM non-polymer                   . '2-(TRIMETHYLAMMONIUM)ETHYL THIOL'       ? 'C5 H14 N S 1'   120.236 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                     
'alpha-L-fucose; 6-deoxy-alpha-L-galactopyranose; L-fucose; fucose' 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
P6G non-polymer                   . 'HEXAETHYLENE GLYCOL'                    'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7'     282.331 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2HA5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.11 
_exptl_crystal.density_percent_sol   70.05 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    
'25-32% PEG550 MME or PEG600, 60-100mM HEPES or Na acetate, pH 6.5-8.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2004-03-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.975 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.975 
# 
_reflns.entry_id                     2HA5 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.15 
_reflns.d_resolution_low             30 
_reflns.number_all                   ? 
_reflns.number_obs                   101293 
_reflns.percent_possible_obs         96.9 
_reflns.pdbx_Rmerge_I_obs            0.062 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.0 
_reflns.B_iso_Wilson_estimate        35.1 
_reflns.pdbx_redundancy              3.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.15 
_reflns_shell.d_res_low              2.25 
_reflns_shell.percent_possible_all   96.9 
_reflns_shell.Rmerge_I_obs           0.383 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.4 
_reflns_shell.pdbx_redundancy        3.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2HA5 
_refine.ls_number_reflns_obs                     98802 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.15 
_refine.ls_percent_reflns_obs                    96.59 
_refine.ls_R_factor_obs                          0.17744 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17681 
_refine.ls_R_factor_R_free                       0.20982 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  2062 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               .964 
_refine.correlation_coeff_Fo_to_Fc_free          .950 
_refine.B_iso_mean                               43.960 
_refine.aniso_B[1][1]                            2.93 
_refine.aniso_B[2][2]                            3.07 
_refine.aniso_B[3][3]                            -5.99 
_refine.aniso_B[1][2]                            .00 
_refine.aniso_B[1][3]                            .00 
_refine.aniso_B[2][3]                            .00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             .80 
_refine.pdbx_solvent_shrinkage_radii             .80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1J06 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       .149 
_refine.pdbx_overall_ESU_R_Free                  .140 
_refine.overall_SU_ML                            .108 
_refine.overall_SU_B                             7.989 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8334 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         143 
_refine_hist.number_atoms_solvent             886 
_refine_hist.number_atoms_total               9363 
_refine_hist.d_res_high                       2.15 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             .010   .022   ? 8772  'X-RAY DIFFRACTION' ? 
r_bond_other_d               .001   .020   ? 5939  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.231  1.971  ? 11985 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            .913   3.002  ? 14318 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.198  5.000  ? 1070  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.743 22.825 ? 400   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.339 15.000 ? 1269  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.957 15.000 ? 74    'X-RAY DIFFRACTION' ? 
r_chiral_restr               .074   .200   ? 1295  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         .004   .020   ? 9789  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           .001   .020   ? 1875  'X-RAY DIFFRACTION' ? 
r_nbd_refined                .199   .200   ? 1866  'X-RAY DIFFRACTION' ? 
r_nbd_other                  .195   .200   ? 6355  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              .178   .200   ? 4283  'X-RAY DIFFRACTION' ? 
r_nbtor_other                .084   .200   ? 4357  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        .164   .200   ? 628   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       .124   .200   ? 7     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         .250   .200   ? 48    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     .154   .200   ? 21    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  .636   1.500  ? 5680  'X-RAY DIFFRACTION' ? 
r_mcbond_other               .111   1.500  ? 2146  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 .937   2.000  ? 8621  'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.452  3.000  ? 3799  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.321  4.500  ? 3361  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.150 
_refine_ls_shell.d_res_low                        2.206 
_refine_ls_shell.number_reflns_R_work             5280 
_refine_ls_shell.R_factor_R_work                  0.233 
_refine_ls_shell.percent_reflns_obs               76.02 
_refine_ls_shell.R_factor_R_free                  0.307 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             122 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2HA5 
_struct.title                     'Crystal structure of mutant S203A of acetylcholinesterase complexed with acetylthiocholine' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HA5 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'HYDROLASE FOLD, SERINE ESTERASE, ACETYLCHOLINESTERASE, MUTANT, HOMODIMER, GLYCOSYLATED PROTEIN, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 5 ? 
I N N 6 ? 
J N N 4 ? 
K N N 5 ? 
L N N 6 ? 
M N N 5 ? 
N N N 6 ? 
O N N 5 ? 
P N N 7 ? 
Q N N 8 ? 
R N N 8 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  ALA A 203 ? SER A 215 ? ALA A 203 SER A 215 1 ? 13 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 ALA A 241 ? VAL A 255 ? ALA A 241 VAL A 255 1 ? 15 
HELX_P HELX_P12 12 ASN A 265 ? THR A 275 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P13 13 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 TRP A 286 ? LEU A 289 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 15 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 GLY A 335 ? VAL A 340 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASN A 464 ? GLY A 456 ASN A 464 5 ? 9  
HELX_P HELX_P24 24 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 25 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 26 ARG A 534 ? SER A 541 ? ARG A 534 SER A 541 1 ? 8  
HELX_P HELX_P27 27 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P28 28 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 29 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 30 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 31 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P32 32 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 33 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P34 34 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 35 ALA B 203 ? LEU B 214 ? ALA B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 36 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P37 37 ALA B 241 ? VAL B 255 ? ALA B 241 VAL B 255 1 ? 15 
HELX_P HELX_P38 38 ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P39 39 PRO B 277 ? HIS B 284 ? PRO B 277 HIS B 284 1 ? 8  
HELX_P HELX_P40 40 GLU B 285 ? VAL B 288 ? GLU B 285 VAL B 288 5 ? 4  
HELX_P HELX_P41 41 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 42 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 43 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 44 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 45 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 46 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 47 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 48 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 49 GLY B 456 ? ASN B 464 ? GLY B 456 ASN B 464 5 ? 9  
HELX_P HELX_P50 50 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 51 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 52 ARG B 534 ? THR B 543 ? ARG B 534 THR B 543 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.049 ? ?               
disulf2 disulf ?    ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.107 ? ?               
disulf3 disulf ?    ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf4 disulf ?    ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf5 disulf ?    ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.079 ? ?               
disulf6 disulf ?    ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
covale1 covale one  ? A ASN 350 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 C NAG 1   1_555 ? ? ? ? ? ? ? 1.460 ? N-Glycosylation 
covale2 covale one  ? A ASN 464 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 464 A NAG 701 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
covale3 covale both ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 2   1_555 ? ? ? ? ? ? ? 1.451 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -7.00 
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 0.10  
3 SER 497 B . ? SER 497 B PRO 498 B ? PRO 498 B 1 18.97 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 2  ? 
D ? 2  ? 
E ? 3  ? 
F ? 11 ? 
G ? 2  ? 
H ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
C 1  2  ? parallel      
D 1  2  ? parallel      
E 1  2  ? anti-parallel 
E 2  3  ? parallel      
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
F 3  4  ? anti-parallel 
F 4  5  ? parallel      
F 5  6  ? parallel      
F 6  7  ? parallel      
F 7  8  ? parallel      
F 8  9  ? parallel      
F 9  10 ? parallel      
F 10 11 ? anti-parallel 
G 1  2  ? parallel      
H 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
A 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
A 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
B 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
B 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
B 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
B 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
B 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
B 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
B 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
B 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
B 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
B 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
B 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
C 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
C 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
D 1  VAL A 239 ? SER A 240 ? VAL A 239 SER A 240 
D 2  VAL A 302 ? VAL A 303 ? VAL A 302 VAL A 303 
E 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
E 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
E 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
F 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
F 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
F 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
F 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
F 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
F 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
F 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
F 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
F 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
F 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
F 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
G 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
G 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
H 1  VAL B 239 ? SER B 240 ? VAL B 239 SER B 240 
H 2  VAL B 302 ? VAL B 303 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 10  ? N VAL A 10  O LEU A 17  ? O LEU A 17  
A 2  3  N GLN A 16  ? N GLN A 16  O LEU A 60  ? O LEU A 60  
B 1  2  N ILE A 20  ? N ILE A 20  O ALA A 31  ? O ALA A 31  
B 2  3  N PHE A 32  ? N PHE A 32  O VAL A 101 ? O VAL A 101 
B 3  4  N ASN A 100 ? N ASN A 100 O SER A 148 ? O SER A 148 
B 4  5  O VAL A 147 ? O VAL A 147 N TRP A 117 ? N TRP A 117 
B 5  6  N VAL A 114 ? N VAL A 114 O SER A 196 ? O SER A 196 
B 6  7  N GLY A 201 ? N GLY A 201 O GLN A 228 ? O GLN A 228 
B 7  8  N LEU A 227 ? N LEU A 227 O LEU A 327 ? O LEU A 327 
B 8  9  N VAL A 330 ? N VAL A 330 O PHE A 430 ? O PHE A 430 
B 9  10 N ILE A 429 ? N ILE A 429 O LEU A 513 ? O LEU A 513 
B 10 11 N TYR A 510 ? N TYR A 510 O ARG A 521 ? O ARG A 521 
C 1  2  N VAL A 68  ? N VAL A 68  O SER A 93  ? O SER A 93  
D 1  2  N VAL A 239 ? N VAL A 239 O VAL A 303 ? O VAL A 303 
E 1  2  N VAL B 10  ? N VAL B 10  O LEU B 17  ? O LEU B 17  
E 2  3  N GLN B 16  ? N GLN B 16  O LEU B 60  ? O LEU B 60  
F 1  2  N ILE B 20  ? N ILE B 20  O ALA B 31  ? O ALA B 31  
F 2  3  N PHE B 32  ? N PHE B 32  O VAL B 101 ? O VAL B 101 
F 3  4  N ASN B 100 ? N ASN B 100 O SER B 148 ? O SER B 148 
F 4  5  O VAL B 147 ? O VAL B 147 N TRP B 117 ? N TRP B 117 
F 5  6  N THR B 112 ? N THR B 112 O ASP B 193 ? O ASP B 193 
F 6  7  N GLY B 201 ? N GLY B 201 O GLN B 228 ? O GLN B 228 
F 7  8  N LEU B 227 ? N LEU B 227 O LEU B 327 ? O LEU B 327 
F 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
F 9  10 N ILE B 429 ? N ILE B 429 O LEU B 513 ? O LEU B 513 
F 10 11 N TYR B 510 ? N TYR B 510 O ARG B 521 ? O ARG B 521 
G 1  2  N VAL B 68  ? N VAL B 68  O SER B 93  ? O SER B 93  
H 1  2  N VAL B 239 ? N VAL B 239 O VAL B 303 ? O VAL B 303 
# 
_database_PDB_matrix.entry_id          2HA5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HA5 
_atom_sites.fract_transf_matrix[1][1]   0.012743 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009104 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004388 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 31.546  14.418  55.709  1.00 77.93  ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 30.091  14.532  55.405  1.00 77.25  ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 29.352  14.784  56.706  1.00 78.67  ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 29.987  14.917  57.760  1.00 80.23  ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 29.572  13.264  54.675  1.00 76.41  ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 29.626  11.966  55.477  1.00 76.23  ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 29.317  10.712  54.640  1.00 75.26  ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 28.243  10.096  54.871  1.00 72.03  ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 30.156  10.338  53.776  1.00 71.48  ? 1    GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 28.025  14.867  56.636  1.00 78.37  ? 2    GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 27.206  15.010  57.837  1.00 79.29  ? 2    GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 26.102  16.024  57.681  1.00 79.32  ? 2    GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 24.991  15.798  58.150  1.00 79.60  ? 2    GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 26.422  17.144  57.031  1.00 78.97  ? 3    ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 25.464  18.241  56.794  1.00 79.34  ? 3    ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 24.934  18.280  55.356  1.00 77.17  ? 3    ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 24.078  19.103  55.039  1.00 77.61  ? 3    ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 26.113  19.595  57.119  1.00 80.41  ? 3    ARG A CB  1 
ATOM   19   C CG  . ARG A 1 3   ? 26.052  20.011  58.578  1.00 83.89  ? 3    ARG A CG  1 
ATOM   20   C CD  . ARG A 1 3   ? 26.976  19.184  59.474  1.00 86.88  ? 3    ARG A CD  1 
ATOM   21   N NE  . ARG A 1 3   ? 27.454  19.937  60.646  1.00 89.35  ? 3    ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 3   ? 26.705  20.315  61.684  1.00 90.99  ? 3    ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 3   ? 25.405  20.037  61.738  1.00 91.02  ? 3    ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 3   ? 27.266  20.989  62.682  1.00 92.80  ? 3    ARG A NH2 1 
ATOM   25   N N   . GLU A 1 4   ? 25.431  17.389  54.504  1.00 74.95  ? 4    GLU A N   1 
ATOM   26   C CA  . GLU A 1 4   ? 25.082  17.370  53.091  1.00 73.22  ? 4    GLU A CA  1 
ATOM   27   C C   . GLU A 1 4   ? 23.905  16.468  52.809  1.00 71.30  ? 4    GLU A C   1 
ATOM   28   O O   . GLU A 1 4   ? 23.532  15.651  53.644  1.00 71.53  ? 4    GLU A O   1 
ATOM   29   C CB  . GLU A 1 4   ? 26.242  16.824  52.268  1.00 72.90  ? 4    GLU A CB  1 
ATOM   30   C CG  . GLU A 1 4   ? 27.559  17.532  52.482  1.00 76.40  ? 4    GLU A CG  1 
ATOM   31   C CD  . GLU A 1 4   ? 28.732  16.641  52.151  1.00 79.59  ? 4    GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 4   ? 28.788  15.510  52.689  1.00 81.92  ? 4    GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 4   ? 29.592  17.074  51.357  1.00 82.36  ? 4    GLU A OE2 1 
ATOM   34   N N   . ASP A 1 5   ? 23.372  16.597  51.593  1.00 68.56  ? 5    ASP A N   1 
ATOM   35   C CA  . ASP A 1 5   ? 22.265  15.777  51.111  1.00 66.95  ? 5    ASP A CA  1 
ATOM   36   C C   . ASP A 1 5   ? 22.740  14.329  50.949  1.00 65.85  ? 5    ASP A C   1 
ATOM   37   O O   . ASP A 1 5   ? 23.519  14.038  50.048  1.00 64.18  ? 5    ASP A O   1 
ATOM   38   C CB  . ASP A 1 5   ? 21.743  16.334  49.777  1.00 65.76  ? 5    ASP A CB  1 
ATOM   39   C CG  . ASP A 1 5   ? 20.577  15.535  49.213  1.00 65.07  ? 5    ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 5   ? 20.246  14.485  49.780  1.00 64.06  ? 5    ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 5   ? 19.979  15.956  48.197  1.00 63.74  ? 5    ASP A OD2 1 
ATOM   42   N N   . PRO A 1 6   ? 22.254  13.413  51.812  1.00 66.09  ? 6    PRO A N   1 
ATOM   43   C CA  . PRO A 1 6   ? 22.726  12.018  51.815  1.00 65.65  ? 6    PRO A CA  1 
ATOM   44   C C   . PRO A 1 6   ? 22.344  11.241  50.558  1.00 63.86  ? 6    PRO A C   1 
ATOM   45   O O   . PRO A 1 6   ? 22.887  10.173  50.282  1.00 62.91  ? 6    PRO A O   1 
ATOM   46   C CB  . PRO A 1 6   ? 22.023  11.421  53.042  1.00 67.13  ? 6    PRO A CB  1 
ATOM   47   C CG  . PRO A 1 6   ? 20.779  12.240  53.184  1.00 67.91  ? 6    PRO A CG  1 
ATOM   48   C CD  . PRO A 1 6   ? 21.196  13.625  52.820  1.00 67.46  ? 6    PRO A CD  1 
ATOM   49   N N   . GLN A 1 7   ? 21.426  11.796  49.785  1.00 62.90  ? 7    GLN A N   1 
ATOM   50   C CA  . GLN A 1 7   ? 20.971  11.150  48.571  1.00 61.78  ? 7    GLN A CA  1 
ATOM   51   C C   . GLN A 1 7   ? 21.898  11.456  47.383  1.00 59.79  ? 7    GLN A C   1 
ATOM   52   O O   . GLN A 1 7   ? 21.673  10.940  46.297  1.00 59.42  ? 7    GLN A O   1 
ATOM   53   C CB  . GLN A 1 7   ? 19.503  11.527  48.312  1.00 62.41  ? 7    GLN A CB  1 
ATOM   54   C CG  . GLN A 1 7   ? 18.668  11.464  49.623  1.00 65.43  ? 7    GLN A CG  1 
ATOM   55   C CD  . GLN A 1 7   ? 17.164  11.271  49.440  1.00 67.05  ? 7    GLN A CD  1 
ATOM   56   O OE1 . GLN A 1 7   ? 16.472  12.133  48.867  1.00 70.47  ? 7    GLN A OE1 1 
ATOM   57   N NE2 . GLN A 1 7   ? 16.639  10.145  49.968  1.00 69.93  ? 7    GLN A NE2 1 
ATOM   58   N N   . LEU A 1 8   ? 22.967  12.235  47.607  1.00 58.36  ? 8    LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? 23.914  12.612  46.549  1.00 56.78  ? 8    LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? 25.345  12.052  46.728  1.00 55.80  ? 8    LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? 26.260  12.389  45.962  1.00 54.15  ? 8    LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? 23.967  14.145  46.439  1.00 56.38  ? 8    LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? 22.674  14.821  45.951  1.00 55.89  ? 8    LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? 22.752  16.341  46.119  1.00 55.34  ? 8    LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? 22.354  14.447  44.506  1.00 53.27  ? 8    LEU A CD2 1 
ATOM   66   N N   . LEU A 1 9   ? 25.521  11.171  47.706  1.00 55.78  ? 9    LEU A N   1 
ATOM   67   C CA  . LEU A 1 9   ? 26.820  10.587  48.003  1.00 55.68  ? 9    LEU A CA  1 
ATOM   68   C C   . LEU A 1 9   ? 26.866  9.139   47.501  1.00 55.07  ? 9    LEU A C   1 
ATOM   69   O O   . LEU A 1 9   ? 26.057  8.311   47.914  1.00 55.33  ? 9    LEU A O   1 
ATOM   70   C CB  . LEU A 1 9   ? 27.073  10.661  49.514  1.00 56.98  ? 9    LEU A CB  1 
ATOM   71   C CG  . LEU A 1 9   ? 26.949  12.084  50.107  1.00 58.98  ? 9    LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 9   ? 26.949  12.092  51.677  1.00 59.32  ? 9    LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 9   ? 28.039  12.998  49.528  1.00 57.91  ? 9    LEU A CD2 1 
ATOM   74   N N   . VAL A 1 10  ? 27.801  8.854   46.598  1.00 54.14  ? 10   VAL A N   1 
ATOM   75   C CA  . VAL A 1 10  ? 27.907  7.551   45.921  1.00 54.03  ? 10   VAL A CA  1 
ATOM   76   C C   . VAL A 1 10  ? 29.391  7.144   45.829  1.00 53.92  ? 10   VAL A C   1 
ATOM   77   O O   . VAL A 1 10  ? 30.267  8.011   45.702  1.00 54.20  ? 10   VAL A O   1 
ATOM   78   C CB  . VAL A 1 10  ? 27.269  7.600   44.482  1.00 53.25  ? 10   VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 10  ? 27.472  6.293   43.735  1.00 53.84  ? 10   VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 10  ? 25.782  7.908   44.556  1.00 52.94  ? 10   VAL A CG2 1 
ATOM   81   N N   . ARG A 1 11  ? 29.675  5.841   45.916  1.00 53.50  ? 11   ARG A N   1 
ATOM   82   C CA  . ARG A 1 11  ? 31.039  5.341   45.734  1.00 53.07  ? 11   ARG A CA  1 
ATOM   83   C C   . ARG A 1 11  ? 31.144  4.553   44.438  1.00 52.35  ? 11   ARG A C   1 
ATOM   84   O O   . ARG A 1 11  ? 30.296  3.703   44.152  1.00 52.78  ? 11   ARG A O   1 
ATOM   85   C CB  . ARG A 1 11  ? 31.466  4.444   46.894  1.00 54.29  ? 11   ARG A CB  1 
ATOM   86   C CG  . ARG A 1 11  ? 32.887  3.897   46.736  1.00 54.62  ? 11   ARG A CG  1 
ATOM   87   C CD  . ARG A 1 11  ? 33.327  3.107   47.929  1.00 55.58  ? 11   ARG A CD  1 
ATOM   88   N NE  . ARG A 1 11  ? 33.759  3.973   49.026  1.00 57.11  ? 11   ARG A NE  1 
ATOM   89   C CZ  . ARG A 1 11  ? 34.988  4.456   49.195  1.00 56.49  ? 11   ARG A CZ  1 
ATOM   90   N NH1 . ARG A 1 11  ? 35.241  5.226   50.245  1.00 57.57  ? 11   ARG A NH1 1 
ATOM   91   N NH2 . ARG A 1 11  ? 35.962  4.178   48.342  1.00 55.81  ? 11   ARG A NH2 1 
ATOM   92   N N   . VAL A 1 12  ? 32.187  4.839   43.662  1.00 51.43  ? 12   VAL A N   1 
ATOM   93   C CA  . VAL A 1 12  ? 32.529  4.053   42.480  1.00 51.02  ? 12   VAL A CA  1 
ATOM   94   C C   . VAL A 1 12  ? 33.907  3.415   42.700  1.00 52.01  ? 12   VAL A C   1 
ATOM   95   O O   . VAL A 1 12  ? 34.513  3.600   43.759  1.00 52.51  ? 12   VAL A O   1 
ATOM   96   C CB  . VAL A 1 12  ? 32.481  4.919   41.187  1.00 49.74  ? 12   VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 12  ? 31.048  5.345   40.899  1.00 48.02  ? 12   VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 12  ? 33.400  6.156   41.298  1.00 48.29  ? 12   VAL A CG2 1 
ATOM   99   N N   . ARG A 1 13  ? 34.399  2.664   41.716  1.00 52.42  ? 13   ARG A N   1 
ATOM   100  C CA  . ARG A 1 13  ? 35.652  1.899   41.869  1.00 53.33  ? 13   ARG A CA  1 
ATOM   101  C C   . ARG A 1 13  ? 36.852  2.767   42.239  1.00 53.99  ? 13   ARG A C   1 
ATOM   102  O O   . ARG A 1 13  ? 37.714  2.342   43.000  1.00 55.15  ? 13   ARG A O   1 
ATOM   103  C CB  . ARG A 1 13  ? 35.954  1.121   40.582  1.00 53.43  ? 13   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 13  ? 37.277  0.343   40.574  1.00 54.20  ? 13   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 13  ? 37.321  -0.716  41.625  1.00 55.72  ? 13   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 13  ? 38.601  -1.424  41.652  1.00 57.02  ? 13   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 13  ? 39.697  -1.005  42.288  1.00 58.16  ? 13   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 13  ? 39.709  0.143   42.957  1.00 58.48  ? 13   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 13  ? 40.801  -1.742  42.262  1.00 59.28  ? 13   ARG A NH2 1 
ATOM   110  N N   . GLY A 1 14  ? 36.892  3.983   41.716  1.00 53.60  ? 14   GLY A N   1 
ATOM   111  C CA  . GLY A 1 14  ? 37.966  4.918   42.018  1.00 54.22  ? 14   GLY A CA  1 
ATOM   112  C C   . GLY A 1 14  ? 37.800  5.725   43.296  1.00 55.07  ? 14   GLY A C   1 
ATOM   113  O O   . GLY A 1 14  ? 38.744  6.407   43.730  1.00 55.81  ? 14   GLY A O   1 
ATOM   114  N N   . GLY A 1 15  ? 36.617  5.662   43.904  1.00 55.08  ? 15   GLY A N   1 
ATOM   115  C CA  . GLY A 1 15  ? 36.387  6.311   45.192  1.00 55.52  ? 15   GLY A CA  1 
ATOM   116  C C   . GLY A 1 15  ? 35.044  6.994   45.302  1.00 55.02  ? 15   GLY A C   1 
ATOM   117  O O   . GLY A 1 15  ? 34.123  6.706   44.538  1.00 53.97  ? 15   GLY A O   1 
ATOM   118  N N   . GLN A 1 16  ? 34.945  7.908   46.265  1.00 55.75  ? 16   GLN A N   1 
ATOM   119  C CA  . GLN A 1 16  ? 33.671  8.565   46.603  1.00 55.89  ? 16   GLN A CA  1 
ATOM   120  C C   . GLN A 1 16  ? 33.393  9.791   45.749  1.00 54.72  ? 16   GLN A C   1 
ATOM   121  O O   . GLN A 1 16  ? 34.311  10.543  45.426  1.00 54.21  ? 16   GLN A O   1 
ATOM   122  C CB  . GLN A 1 16  ? 33.653  8.981   48.071  1.00 57.11  ? 16   GLN A CB  1 
ATOM   123  C CG  . GLN A 1 16  ? 33.254  7.875   49.022  1.00 58.68  ? 16   GLN A CG  1 
ATOM   124  C CD  . GLN A 1 16  ? 33.359  8.302   50.468  1.00 59.66  ? 16   GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 16  ? 34.411  8.749   50.904  1.00 64.83  ? 16   GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 16  ? 32.276  8.161   51.219  1.00 59.99  ? 16   GLN A NE2 1 
ATOM   127  N N   . LEU A 1 17  ? 32.112  9.980   45.409  1.00 54.04  ? 17   LEU A N   1 
ATOM   128  C CA  . LEU A 1 17  ? 31.631  11.110  44.615  1.00 53.14  ? 17   LEU A CA  1 
ATOM   129  C C   . LEU A 1 17  ? 30.536  11.851  45.356  1.00 53.78  ? 17   LEU A C   1 
ATOM   130  O O   . LEU A 1 17  ? 29.800  11.249  46.137  1.00 53.55  ? 17   LEU A O   1 
ATOM   131  C CB  . LEU A 1 17  ? 31.009  10.617  43.303  1.00 52.47  ? 17   LEU A CB  1 
ATOM   132  C CG  . LEU A 1 17  ? 31.862  9.793   42.347  1.00 51.48  ? 17   LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 17  ? 30.956  9.137   41.320  1.00 49.90  ? 17   LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 17  ? 32.918  10.660  41.688  1.00 51.07  ? 17   LEU A CD2 1 
ATOM   135  N N   . ARG A 1 18  ? 30.419  13.148  45.083  1.00 54.03  ? 18   ARG A N   1 
ATOM   136  C CA  . ARG A 1 18  ? 29.284  13.943  45.528  1.00 55.13  ? 18   ARG A CA  1 
ATOM   137  C C   . ARG A 1 18  ? 28.624  14.581  44.309  1.00 53.55  ? 18   ARG A C   1 
ATOM   138  O O   . ARG A 1 18  ? 29.253  15.370  43.592  1.00 52.73  ? 18   ARG A O   1 
ATOM   139  C CB  . ARG A 1 18  ? 29.726  15.024  46.525  1.00 56.12  ? 18   ARG A CB  1 
ATOM   140  C CG  . ARG A 1 18  ? 28.572  15.866  47.118  1.00 57.71  ? 18   ARG A CG  1 
ATOM   141  C CD  . ARG A 1 18  ? 29.065  16.877  48.169  1.00 61.20  ? 18   ARG A CD  1 
ATOM   142  N NE  . ARG A 1 18  ? 30.312  17.509  47.722  1.00 64.88  ? 18   ARG A NE  1 
ATOM   143  C CZ  . ARG A 1 18  ? 31.510  17.403  48.315  1.00 66.34  ? 18   ARG A CZ  1 
ATOM   144  N NH1 . ARG A 1 18  ? 31.682  16.730  49.457  1.00 67.29  ? 18   ARG A NH1 1 
ATOM   145  N NH2 . ARG A 1 18  ? 32.558  18.005  47.753  1.00 65.24  ? 18   ARG A NH2 1 
ATOM   146  N N   . GLY A 1 19  ? 27.363  14.225  44.076  1.00 52.98  ? 19   GLY A N   1 
ATOM   147  C CA  . GLY A 1 19  ? 26.602  14.751  42.956  1.00 52.27  ? 19   GLY A CA  1 
ATOM   148  C C   . GLY A 1 19  ? 25.850  16.018  43.321  1.00 52.94  ? 19   GLY A C   1 
ATOM   149  O O   . GLY A 1 19  ? 26.082  16.614  44.380  1.00 53.46  ? 19   GLY A O   1 
ATOM   150  N N   . ILE A 1 20  ? 24.955  16.421  42.426  1.00 52.59  ? 20   ILE A N   1 
ATOM   151  C CA  . ILE A 1 20  ? 24.147  17.624  42.594  1.00 53.32  ? 20   ILE A CA  1 
ATOM   152  C C   . ILE A 1 20  ? 22.687  17.330  42.218  1.00 53.42  ? 20   ILE A C   1 
ATOM   153  O O   . ILE A 1 20  ? 22.401  16.559  41.292  1.00 52.13  ? 20   ILE A O   1 
ATOM   154  C CB  . ILE A 1 20  ? 24.711  18.807  41.758  1.00 53.08  ? 20   ILE A CB  1 
ATOM   155  C CG1 . ILE A 1 20  ? 23.928  20.103  42.032  1.00 54.53  ? 20   ILE A CG1 1 
ATOM   156  C CG2 . ILE A 1 20  ? 24.722  18.473  40.262  1.00 51.48  ? 20   ILE A CG2 1 
ATOM   157  C CD1 . ILE A 1 20  ? 24.672  21.390  41.579  1.00 53.97  ? 20   ILE A CD1 1 
ATOM   158  N N   . ARG A 1 21  ? 21.779  17.932  42.975  1.00 54.70  ? 21   ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? 20.357  17.854  42.711  1.00 55.95  ? 21   ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? 19.997  18.963  41.722  1.00 55.71  ? 21   ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? 20.110  20.141  42.050  1.00 55.73  ? 21   ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? 19.592  18.025  44.022  1.00 57.27  ? 21   ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? 18.097  17.814  43.943  1.00 58.93  ? 21   ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? 17.403  18.262  45.247  1.00 61.96  ? 21   ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? 16.115  18.863  44.936  1.00 66.48  ? 21   ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? 14.954  18.611  45.543  1.00 70.03  ? 21   ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? 14.862  17.769  46.585  1.00 72.44  ? 21   ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? 13.861  19.245  45.111  1.00 69.46  ? 21   ARG A NH2 1 
ATOM   169  N N   . LEU A 1 22  ? 19.588  18.582  40.513  1.00 55.20  ? 22   LEU A N   1 
ATOM   170  C CA  . LEU A 1 22  ? 19.171  19.546  39.500  1.00 55.70  ? 22   LEU A CA  1 
ATOM   171  C C   . LEU A 1 22  ? 17.652  19.579  39.417  1.00 56.96  ? 22   LEU A C   1 
ATOM   172  O O   . LEU A 1 22  ? 16.990  18.586  39.710  1.00 56.82  ? 22   LEU A O   1 
ATOM   173  C CB  . LEU A 1 22  ? 19.761  19.187  38.138  1.00 54.19  ? 22   LEU A CB  1 
ATOM   174  C CG  . LEU A 1 22  ? 21.288  19.186  38.057  1.00 53.91  ? 22   LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 22  ? 21.735  18.664  36.707  1.00 51.40  ? 22   LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 22  ? 21.865  20.575  38.342  1.00 53.95  ? 22   LEU A CD2 1 
ATOM   177  N N   . LYS A 1 23  ? 17.110  20.736  39.040  1.00 58.44  ? 23   LYS A N   1 
ATOM   178  C CA  . LYS A 1 23  ? 15.673  20.890  38.830  1.00 60.25  ? 23   LYS A CA  1 
ATOM   179  C C   . LYS A 1 23  ? 15.330  20.621  37.376  1.00 58.97  ? 23   LYS A C   1 
ATOM   180  O O   . LYS A 1 23  ? 15.828  21.302  36.485  1.00 58.61  ? 23   LYS A O   1 
ATOM   181  C CB  . LYS A 1 23  ? 15.191  22.302  39.217  1.00 61.59  ? 23   LYS A CB  1 
ATOM   182  C CG  . LYS A 1 23  ? 15.240  22.578  40.722  1.00 64.90  ? 23   LYS A CG  1 
ATOM   183  C CD  . LYS A 1 23  ? 14.260  23.706  41.171  1.00 66.52  ? 23   LYS A CD  1 
ATOM   184  C CE  . LYS A 1 23  ? 13.829  23.548  42.656  1.00 68.94  ? 23   LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 23  ? 12.626  24.395  43.045  1.00 71.37  ? 23   LYS A NZ  1 
ATOM   186  N N   . ALA A 1 24  ? 14.500  19.611  37.139  1.00 58.65  ? 24   ALA A N   1 
ATOM   187  C CA  . ALA A 1 24  ? 13.810  19.459  35.865  1.00 57.95  ? 24   ALA A CA  1 
ATOM   188  C C   . ALA A 1 24  ? 12.385  19.958  36.080  1.00 59.15  ? 24   ALA A C   1 
ATOM   189  O O   . ALA A 1 24  ? 11.939  20.076  37.219  1.00 59.96  ? 24   ALA A O   1 
ATOM   190  C CB  . ALA A 1 24  ? 13.810  18.020  35.412  1.00 57.15  ? 24   ALA A CB  1 
ATOM   191  N N   . PRO A 1 25  ? 11.660  20.265  34.991  1.00 59.11  ? 25   PRO A N   1 
ATOM   192  C CA  . PRO A 1 25  ? 10.328  20.858  35.137  1.00 59.96  ? 25   PRO A CA  1 
ATOM   193  C C   . PRO A 1 25  ? 9.352   20.052  35.988  1.00 60.57  ? 25   PRO A C   1 
ATOM   194  O O   . PRO A 1 25  ? 8.547   20.635  36.716  1.00 62.04  ? 25   PRO A O   1 
ATOM   195  C CB  . PRO A 1 25  ? 9.835   20.946  33.688  1.00 59.82  ? 25   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 25  ? 11.098  21.018  32.867  1.00 58.53  ? 25   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 25  ? 12.041  20.112  33.573  1.00 58.42  ? 25   PRO A CD  1 
ATOM   198  N N   . GLY A 1 26  ? 9.401   18.727  35.889  1.00 59.56  ? 26   GLY A N   1 
ATOM   199  C CA  . GLY A 1 26  ? 8.487   17.871  36.650  1.00 60.24  ? 26   GLY A CA  1 
ATOM   200  C C   . GLY A 1 26  ? 8.972   17.525  38.047  1.00 60.44  ? 26   GLY A C   1 
ATOM   201  O O   . GLY A 1 26  ? 8.232   16.935  38.838  1.00 61.27  ? 26   GLY A O   1 
ATOM   202  N N   . GLY A 1 27  ? 10.218  17.873  38.356  1.00 59.30  ? 27   GLY A N   1 
ATOM   203  C CA  . GLY A 1 27  ? 10.805  17.522  39.648  1.00 59.30  ? 27   GLY A CA  1 
ATOM   204  C C   . GLY A 1 27  ? 12.320  17.395  39.610  1.00 57.69  ? 27   GLY A C   1 
ATOM   205  O O   . GLY A 1 27  ? 12.945  17.638  38.570  1.00 56.71  ? 27   GLY A O   1 
ATOM   206  N N   . PRO A 1 28  ? 12.918  17.010  40.747  1.00 57.10  ? 28   PRO A N   1 
ATOM   207  C CA  . PRO A 1 28  ? 14.373  16.911  40.865  1.00 55.89  ? 28   PRO A CA  1 
ATOM   208  C C   . PRO A 1 28  ? 14.973  15.701  40.155  1.00 54.45  ? 28   PRO A C   1 
ATOM   209  O O   . PRO A 1 28  ? 14.299  14.688  39.975  1.00 54.20  ? 28   PRO A O   1 
ATOM   210  C CB  . PRO A 1 28  ? 14.605  16.809  42.376  1.00 56.75  ? 28   PRO A CB  1 
ATOM   211  C CG  . PRO A 1 28  ? 13.300  16.300  42.954  1.00 58.22  ? 28   PRO A CG  1 
ATOM   212  C CD  . PRO A 1 28  ? 12.214  16.674  42.001  1.00 58.41  ? 28   PRO A CD  1 
ATOM   213  N N   . VAL A 1 29  ? 16.227  15.839  39.721  1.00 53.09  ? 29   VAL A N   1 
ATOM   214  C CA  . VAL A 1 29  ? 17.018  14.707  39.252  1.00 51.99  ? 29   VAL A CA  1 
ATOM   215  C C   . VAL A 1 29  ? 18.391  14.770  39.919  1.00 51.62  ? 29   VAL A C   1 
ATOM   216  O O   . VAL A 1 29  ? 18.758  15.804  40.468  1.00 52.02  ? 29   VAL A O   1 
ATOM   217  C CB  . VAL A 1 29  ? 17.155  14.676  37.706  1.00 51.27  ? 29   VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 29  ? 15.782  14.589  37.058  1.00 50.29  ? 29   VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 29  ? 17.929  15.888  37.197  1.00 50.72  ? 29   VAL A CG2 1 
ATOM   220  N N   . SER A 1 30  ? 19.122  13.657  39.893  1.00 50.79  ? 30   SER A N   1 
ATOM   221  C CA  . SER A 1 30  ? 20.492  13.596  40.397  1.00 50.50  ? 30   SER A CA  1 
ATOM   222  C C   . SER A 1 30  ? 21.473  13.688  39.229  1.00 49.61  ? 30   SER A C   1 
ATOM   223  O O   . SER A 1 30  ? 21.279  13.032  38.204  1.00 49.67  ? 30   SER A O   1 
ATOM   224  C CB  . SER A 1 30  ? 20.761  12.274  41.112  1.00 50.68  ? 30   SER A CB  1 
ATOM   225  O OG  . SER A 1 30  ? 19.798  11.964  42.091  1.00 51.34  ? 30   SER A OG  1 
ATOM   226  N N   . ALA A 1 31  ? 22.539  14.465  39.399  1.00 49.07  ? 31   ALA A N   1 
ATOM   227  C CA  . ALA A 1 31  ? 23.561  14.582  38.376  1.00 48.19  ? 31   ALA A CA  1 
ATOM   228  C C   . ALA A 1 31  ? 24.913  14.358  39.018  1.00 48.20  ? 31   ALA A C   1 
ATOM   229  O O   . ALA A 1 31  ? 25.221  14.948  40.051  1.00 49.67  ? 31   ALA A O   1 
ATOM   230  C CB  . ALA A 1 31  ? 23.505  15.958  37.718  1.00 47.92  ? 31   ALA A CB  1 
ATOM   231  N N   . PHE A 1 32  ? 25.708  13.489  38.415  1.00 47.46  ? 32   PHE A N   1 
ATOM   232  C CA  . PHE A 1 32  ? 27.089  13.306  38.799  1.00 47.21  ? 32   PHE A CA  1 
ATOM   233  C C   . PHE A 1 32  ? 27.918  13.645  37.585  1.00 46.57  ? 32   PHE A C   1 
ATOM   234  O O   . PHE A 1 32  ? 27.994  12.873  36.657  1.00 46.46  ? 32   PHE A O   1 
ATOM   235  C CB  . PHE A 1 32  ? 27.311  11.887  39.275  1.00 47.30  ? 32   PHE A CB  1 
ATOM   236  C CG  . PHE A 1 32  ? 26.432  11.513  40.430  1.00 47.96  ? 32   PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 32  ? 25.139  11.049  40.214  1.00 48.54  ? 32   PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 32  ? 26.883  11.642  41.728  1.00 48.85  ? 32   PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 32  ? 24.320  10.712  41.281  1.00 49.29  ? 32   PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 32  ? 26.075  11.298  42.797  1.00 50.27  ? 32   PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 32  ? 24.789  10.841  42.573  1.00 49.84  ? 32   PHE A CZ  1 
ATOM   242  N N   . LEU A 1 33  ? 28.503  14.841  37.592  1.00 47.07  ? 33   LEU A N   1 
ATOM   243  C CA  . LEU A 1 33  ? 29.144  15.429  36.419  1.00 46.03  ? 33   LEU A CA  1 
ATOM   244  C C   . LEU A 1 33  ? 30.654  15.529  36.610  1.00 46.33  ? 33   LEU A C   1 
ATOM   245  O O   . LEU A 1 33  ? 31.135  15.795  37.705  1.00 47.07  ? 33   LEU A O   1 
ATOM   246  C CB  . LEU A 1 33  ? 28.553  16.810  36.158  1.00 46.15  ? 33   LEU A CB  1 
ATOM   247  C CG  . LEU A 1 33  ? 27.025  16.916  36.038  1.00 45.82  ? 33   LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 33  ? 26.600  18.357  35.912  1.00 45.63  ? 33   LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 33  ? 26.485  16.108  34.871  1.00 43.68  ? 33   LEU A CD2 1 
ATOM   250  N N   . GLY A 1 34  ? 31.403  15.275  35.544  1.00 45.94  ? 34   GLY A N   1 
ATOM   251  C CA  . GLY A 1 34  ? 32.863  15.394  35.592  1.00 45.93  ? 34   GLY A CA  1 
ATOM   252  C C   . GLY A 1 34  ? 33.559  14.263  36.324  1.00 46.20  ? 34   GLY A C   1 
ATOM   253  O O   . GLY A 1 34  ? 34.579  14.482  36.975  1.00 46.30  ? 34   GLY A O   1 
ATOM   254  N N   . ILE A 1 35  ? 33.021  13.046  36.209  1.00 45.95  ? 35   ILE A N   1 
ATOM   255  C CA  . ILE A 1 35  ? 33.666  11.866  36.784  1.00 46.08  ? 35   ILE A CA  1 
ATOM   256  C C   . ILE A 1 35  ? 34.819  11.405  35.864  1.00 46.36  ? 35   ILE A C   1 
ATOM   257  O O   . ILE A 1 35  ? 34.587  11.047  34.718  1.00 45.98  ? 35   ILE A O   1 
ATOM   258  C CB  . ILE A 1 35  ? 32.690  10.677  36.956  1.00 45.84  ? 35   ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 35  ? 31.409  11.085  37.699  1.00 46.01  ? 35   ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 35  ? 33.387  9.514   37.682  1.00 45.87  ? 35   ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 35  ? 30.343  9.993   37.729  1.00 45.89  ? 35   ILE A CD1 1 
ATOM   262  N N   . PRO A 1 36  ? 36.062  11.386  36.369  1.00 47.25  ? 36   PRO A N   1 
ATOM   263  C CA  . PRO A 1 36  ? 37.183  10.941  35.536  1.00 47.56  ? 36   PRO A CA  1 
ATOM   264  C C   . PRO A 1 36  ? 37.153  9.442   35.285  1.00 48.27  ? 36   PRO A C   1 
ATOM   265  O O   . PRO A 1 36  ? 37.057  8.692   36.242  1.00 49.08  ? 36   PRO A O   1 
ATOM   266  C CB  . PRO A 1 36  ? 38.407  11.262  36.398  1.00 48.39  ? 36   PRO A CB  1 
ATOM   267  C CG  . PRO A 1 36  ? 37.908  11.224  37.806  1.00 49.04  ? 36   PRO A CG  1 
ATOM   268  C CD  . PRO A 1 36  ? 36.490  11.744  37.732  1.00 48.18  ? 36   PRO A CD  1 
ATOM   269  N N   . PHE A 1 37  ? 37.254  9.008   34.029  1.00 48.28  ? 37   PHE A N   1 
ATOM   270  C CA  . PHE A 1 37  ? 37.264  7.567   33.716  1.00 48.78  ? 37   PHE A CA  1 
ATOM   271  C C   . PHE A 1 37  ? 38.621  7.060   33.199  1.00 49.60  ? 37   PHE A C   1 
ATOM   272  O O   . PHE A 1 37  ? 38.830  5.854   33.088  1.00 50.56  ? 37   PHE A O   1 
ATOM   273  C CB  . PHE A 1 37  ? 36.109  7.166   32.777  1.00 48.32  ? 37   PHE A CB  1 
ATOM   274  C CG  . PHE A 1 37  ? 36.193  7.746   31.401  1.00 47.36  ? 37   PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 37  ? 36.927  7.102   30.406  1.00 47.87  ? 37   PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 37  ? 35.549  8.932   31.094  1.00 46.87  ? 37   PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 37  ? 37.029  7.639   29.127  1.00 46.57  ? 37   PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 37  ? 35.644  9.480   29.811  1.00 46.45  ? 37   PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 37  ? 36.385  8.831   28.831  1.00 46.32  ? 37   PHE A CZ  1 
ATOM   280  N N   . ALA A 1 38  ? 39.541  7.974   32.929  1.00 49.65  ? 38   ALA A N   1 
ATOM   281  C CA  . ALA A 1 38  ? 40.886  7.625   32.491  1.00 50.52  ? 38   ALA A CA  1 
ATOM   282  C C   . ALA A 1 38  ? 41.910  8.555   33.146  1.00 51.17  ? 38   ALA A C   1 
ATOM   283  O O   . ALA A 1 38  ? 41.552  9.615   33.663  1.00 51.01  ? 38   ALA A O   1 
ATOM   284  C CB  . ALA A 1 38  ? 40.994  7.720   30.966  1.00 49.73  ? 38   ALA A CB  1 
ATOM   285  N N   . GLU A 1 39  ? 43.175  8.139   33.133  1.00 52.03  ? 39   GLU A N   1 
ATOM   286  C CA  . GLU A 1 39  ? 44.270  9.027   33.469  1.00 53.09  ? 39   GLU A CA  1 
ATOM   287  C C   . GLU A 1 39  ? 44.329  10.100  32.381  1.00 52.61  ? 39   GLU A C   1 
ATOM   288  O O   . GLU A 1 39  ? 44.107  9.788   31.200  1.00 52.44  ? 39   GLU A O   1 
ATOM   289  C CB  . GLU A 1 39  ? 45.603  8.269   33.509  1.00 54.37  ? 39   GLU A CB  1 
ATOM   290  C CG  . GLU A 1 39  ? 45.798  7.410   34.750  1.00 56.71  ? 39   GLU A CG  1 
ATOM   291  C CD  . GLU A 1 39  ? 45.832  8.243   36.018  1.00 59.15  ? 39   GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 39  ? 46.795  9.025   36.179  1.00 61.54  ? 39   GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 39  ? 44.890  8.130   36.837  1.00 58.07  ? 39   GLU A OE2 1 
ATOM   294  N N   . PRO A 1 40  ? 44.633  11.357  32.757  1.00 52.37  ? 40   PRO A N   1 
ATOM   295  C CA  . PRO A 1 40  ? 44.669  12.388  31.731  1.00 51.80  ? 40   PRO A CA  1 
ATOM   296  C C   . PRO A 1 40  ? 45.637  12.030  30.600  1.00 51.69  ? 40   PRO A C   1 
ATOM   297  O O   . PRO A 1 40  ? 46.784  11.695  30.856  1.00 52.51  ? 40   PRO A O   1 
ATOM   298  C CB  . PRO A 1 40  ? 45.118  13.634  32.507  1.00 52.21  ? 40   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 40  ? 44.715  13.376  33.883  1.00 52.44  ? 40   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 40  ? 44.946  11.915  34.084  1.00 52.99  ? 40   PRO A CD  1 
ATOM   301  N N   . PRO A 1 41  ? 45.162  12.060  29.348  1.00 50.85  ? 41   PRO A N   1 
ATOM   302  C CA  . PRO A 1 41  ? 46.002  11.655  28.230  1.00 50.76  ? 41   PRO A CA  1 
ATOM   303  C C   . PRO A 1 41  ? 46.930  12.778  27.760  1.00 51.01  ? 41   PRO A C   1 
ATOM   304  O O   . PRO A 1 41  ? 46.860  13.207  26.601  1.00 49.97  ? 41   PRO A O   1 
ATOM   305  C CB  . PRO A 1 41  ? 44.973  11.275  27.165  1.00 49.84  ? 41   PRO A CB  1 
ATOM   306  C CG  . PRO A 1 41  ? 43.834  12.220  27.427  1.00 49.94  ? 41   PRO A CG  1 
ATOM   307  C CD  . PRO A 1 41  ? 43.801  12.425  28.912  1.00 50.10  ? 41   PRO A CD  1 
ATOM   308  N N   . VAL A 1 42  ? 47.800  13.229  28.667  1.00 51.72  ? 42   VAL A N   1 
ATOM   309  C CA  . VAL A 1 42  ? 48.636  14.402  28.448  1.00 52.22  ? 42   VAL A CA  1 
ATOM   310  C C   . VAL A 1 42  ? 50.105  14.021  28.443  1.00 53.53  ? 42   VAL A C   1 
ATOM   311  O O   . VAL A 1 42  ? 50.489  12.942  28.910  1.00 53.92  ? 42   VAL A O   1 
ATOM   312  C CB  . VAL A 1 42  ? 48.392  15.507  29.518  1.00 52.38  ? 42   VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 42  ? 46.914  15.826  29.622  1.00 51.36  ? 42   VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 42  ? 48.958  15.110  30.879  1.00 52.80  ? 42   VAL A CG2 1 
ATOM   315  N N   . GLY A 1 43  ? 50.926  14.917  27.908  1.00 54.10  ? 43   GLY A N   1 
ATOM   316  C CA  . GLY A 1 43  ? 52.359  14.688  27.842  1.00 55.15  ? 43   GLY A CA  1 
ATOM   317  C C   . GLY A 1 43  ? 52.678  13.447  27.026  1.00 55.32  ? 43   GLY A C   1 
ATOM   318  O O   . GLY A 1 43  ? 52.180  13.281  25.904  1.00 53.88  ? 43   GLY A O   1 
ATOM   319  N N   . SER A 1 44  ? 53.489  12.568  27.612  1.00 56.30  ? 44   SER A N   1 
ATOM   320  C CA  . SER A 1 44  ? 53.891  11.307  26.986  1.00 57.03  ? 44   SER A CA  1 
ATOM   321  C C   . SER A 1 44  ? 52.711  10.411  26.605  1.00 56.32  ? 44   SER A C   1 
ATOM   322  O O   . SER A 1 44  ? 52.883  9.446   25.851  1.00 56.26  ? 44   SER A O   1 
ATOM   323  C CB  . SER A 1 44  ? 54.807  10.532  27.939  1.00 58.52  ? 44   SER A CB  1 
ATOM   324  O OG  . SER A 1 44  ? 54.093  10.135  29.103  1.00 58.85  ? 44   SER A OG  1 
ATOM   325  N N   . ARG A 1 45  ? 51.529  10.722  27.142  1.00 55.68  ? 45   ARG A N   1 
ATOM   326  C CA  . ARG A 1 45  ? 50.318  9.955   26.875  1.00 55.26  ? 45   ARG A CA  1 
ATOM   327  C C   . ARG A 1 45  ? 49.494  10.447  25.692  1.00 53.15  ? 45   ARG A C   1 
ATOM   328  O O   . ARG A 1 45  ? 48.517  9.802   25.319  1.00 51.97  ? 45   ARG A O   1 
ATOM   329  C CB  . ARG A 1 45  ? 49.431  9.921   28.116  1.00 55.90  ? 45   ARG A CB  1 
ATOM   330  C CG  . ARG A 1 45  ? 50.092  9.283   29.325  1.00 60.69  ? 45   ARG A CG  1 
ATOM   331  C CD  . ARG A 1 45  ? 49.174  8.268   29.975  1.00 67.62  ? 45   ARG A CD  1 
ATOM   332  N NE  . ARG A 1 45  ? 48.921  8.523   31.396  1.00 70.36  ? 45   ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 45  ? 49.647  8.055   32.409  1.00 73.71  ? 45   ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 45  ? 50.715  7.282   32.195  1.00 77.21  ? 45   ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 45  ? 49.296  8.361   33.659  1.00 74.80  ? 45   ARG A NH2 1 
ATOM   336  N N   . ARG A 1 46  ? 49.882  11.577  25.102  1.00 52.30  ? 46   ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? 49.233  12.058  23.876  1.00 50.96  ? 46   ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? 49.374  11.039  22.763  1.00 50.64  ? 46   ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? 50.458  10.473  22.571  1.00 51.95  ? 46   ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? 49.840  13.375  23.396  1.00 51.19  ? 46   ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? 49.082  13.998  22.219  1.00 50.69  ? 46   ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? 49.841  15.200  21.652  1.00 50.31  ? 46   ARG A CD  1 
ATOM   343  N NE  . ARG A 1 46  ? 49.624  16.407  22.429  1.00 49.91  ? 46   ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 46  ? 50.246  17.566  22.192  1.00 51.22  ? 46   ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 46  ? 51.142  17.659  21.221  1.00 50.88  ? 46   ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 46  ? 49.978  18.629  22.935  1.00 50.60  ? 46   ARG A NH2 1 
ATOM   347  N N   . PHE A 1 47  ? 48.278  10.850  22.034  1.00 49.19  ? 47   PHE A N   1 
ATOM   348  C CA  . PHE A 1 47  ? 48.106  9.853   20.963  1.00 49.18  ? 47   PHE A CA  1 
ATOM   349  C C   . PHE A 1 47  ? 47.995  8.412   21.424  1.00 50.14  ? 47   PHE A C   1 
ATOM   350  O O   . PHE A 1 47  ? 47.746  7.533   20.588  1.00 51.38  ? 47   PHE A O   1 
ATOM   351  C CB  . PHE A 1 47  ? 49.186  9.962   19.881  1.00 49.42  ? 47   PHE A CB  1 
ATOM   352  C CG  . PHE A 1 47  ? 49.430  11.369  19.402  1.00 49.25  ? 47   PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 47  ? 48.396  12.125  18.871  1.00 47.88  ? 47   PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 47  ? 50.693  11.937  19.487  1.00 48.07  ? 47   PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 47  ? 48.622  13.422  18.419  1.00 47.70  ? 47   PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 47  ? 50.920  13.225  19.054  1.00 47.73  ? 47   PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 47  ? 49.886  13.972  18.521  1.00 48.12  ? 47   PHE A CZ  1 
ATOM   358  N N   . MET A 1 48  ? 48.147  8.162   22.727  1.00 50.97  ? 48   MET A N   1 
ATOM   359  C CA  . MET A 1 48  ? 48.162  6.808   23.265  1.00 51.93  ? 48   MET A CA  1 
ATOM   360  C C   . MET A 1 48  ? 46.790  6.365   23.743  1.00 50.93  ? 48   MET A C   1 
ATOM   361  O O   . MET A 1 48  ? 45.957  7.189   24.121  1.00 50.39  ? 48   MET A O   1 
ATOM   362  C CB  . MET A 1 48  ? 49.143  6.703   24.431  1.00 53.47  ? 48   MET A CB  1 
ATOM   363  C CG  . MET A 1 48  ? 50.599  6.928   24.047  1.00 57.58  ? 48   MET A CG  1 
ATOM   364  S SD  . MET A 1 48  ? 51.476  5.447   23.512  1.00 66.68  ? 48   MET A SD  1 
ATOM   365  C CE  . MET A 1 48  ? 50.643  5.032   22.005  1.00 65.32  ? 48   MET A CE  1 
ATOM   366  N N   . PRO A 1 49  ? 46.546  5.052   23.740  1.00 51.37  ? 49   PRO A N   1 
ATOM   367  C CA  . PRO A 1 49  ? 45.316  4.528   24.322  1.00 51.03  ? 49   PRO A CA  1 
ATOM   368  C C   . PRO A 1 49  ? 45.106  5.065   25.736  1.00 51.15  ? 49   PRO A C   1 
ATOM   369  O O   . PRO A 1 49  ? 46.088  5.357   26.440  1.00 51.22  ? 49   PRO A O   1 
ATOM   370  C CB  . PRO A 1 49  ? 45.570  3.015   24.389  1.00 51.96  ? 49   PRO A CB  1 
ATOM   371  C CG  . PRO A 1 49  ? 46.593  2.746   23.358  1.00 53.20  ? 49   PRO A CG  1 
ATOM   372  C CD  . PRO A 1 49  ? 47.406  3.994   23.185  1.00 52.15  ? 49   PRO A CD  1 
ATOM   373  N N   . PRO A 1 50  ? 43.847  5.172   26.168  1.00 50.62  ? 50   PRO A N   1 
ATOM   374  C CA  . PRO A 1 50  ? 43.607  5.632   27.517  1.00 51.16  ? 50   PRO A CA  1 
ATOM   375  C C   . PRO A 1 50  ? 43.933  4.536   28.552  1.00 52.88  ? 50   PRO A C   1 
ATOM   376  O O   . PRO A 1 50  ? 43.736  3.337   28.304  1.00 52.30  ? 50   PRO A O   1 
ATOM   377  C CB  . PRO A 1 50  ? 42.110  5.930   27.516  1.00 50.15  ? 50   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 50  ? 41.561  4.916   26.574  1.00 50.09  ? 50   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 50  ? 42.596  4.813   25.481  1.00 50.26  ? 50   PRO A CD  1 
ATOM   380  N N   . GLU A 1 51  ? 44.432  4.976   29.698  1.00 54.80  ? 51   GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 44.643  4.118   30.851  1.00 57.22  ? 51   GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 43.562  4.381   31.881  1.00 56.14  ? 51   GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 43.207  5.528   32.111  1.00 55.24  ? 51   GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 45.992  4.428   31.464  1.00 58.47  ? 51   GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 47.145  4.004   30.595  1.00 61.96  ? 51   GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 48.484  4.330   31.228  1.00 64.04  ? 51   GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 48.783  5.543   31.386  1.00 70.25  ? 51   GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 49.237  3.383   31.554  1.00 71.53  ? 51   GLU A OE2 1 
ATOM   389  N N   . PRO A 1 52  ? 43.057  3.326   32.541  1.00 56.55  ? 52   PRO A N   1 
ATOM   390  C CA  . PRO A 1 52  ? 42.021  3.545   33.551  1.00 56.27  ? 52   PRO A CA  1 
ATOM   391  C C   . PRO A 1 52  ? 42.461  4.524   34.646  1.00 56.21  ? 52   PRO A C   1 
ATOM   392  O O   . PRO A 1 52  ? 43.611  4.523   35.050  1.00 56.36  ? 52   PRO A O   1 
ATOM   393  C CB  . PRO A 1 52  ? 41.789  2.153   34.143  1.00 57.41  ? 52   PRO A CB  1 
ATOM   394  C CG  . PRO A 1 52  ? 42.356  1.180   33.133  1.00 58.21  ? 52   PRO A CG  1 
ATOM   395  C CD  . PRO A 1 52  ? 43.439  1.907   32.410  1.00 57.80  ? 52   PRO A CD  1 
ATOM   396  N N   . LYS A 1 53  ? 41.545  5.373   35.081  1.00 55.54  ? 53   LYS A N   1 
ATOM   397  C CA  . LYS A 1 53  ? 41.802  6.325   36.148  1.00 56.07  ? 53   LYS A CA  1 
ATOM   398  C C   . LYS A 1 53  ? 42.223  5.628   37.448  1.00 57.51  ? 53   LYS A C   1 
ATOM   399  O O   . LYS A 1 53  ? 41.558  4.692   37.904  1.00 57.47  ? 53   LYS A O   1 
ATOM   400  C CB  . LYS A 1 53  ? 40.537  7.141   36.404  1.00 55.35  ? 53   LYS A CB  1 
ATOM   401  C CG  . LYS A 1 53  ? 40.616  8.122   37.561  1.00 56.63  ? 53   LYS A CG  1 
ATOM   402  C CD  . LYS A 1 53  ? 41.707  9.178   37.360  1.00 57.14  ? 53   LYS A CD  1 
ATOM   403  C CE  . LYS A 1 53  ? 41.618  10.282  38.421  1.00 57.96  ? 53   LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 53  ? 42.593  11.373  38.174  1.00 59.38  ? 53   LYS A NZ  1 
ATOM   405  N N   . ARG A 1 54  ? 43.311  6.104   38.046  1.00 58.26  ? 54   ARG A N   1 
ATOM   406  C CA  . ARG A 1 54  ? 43.748  5.615   39.342  1.00 60.37  ? 54   ARG A CA  1 
ATOM   407  C C   . ARG A 1 54  ? 42.816  6.147   40.428  1.00 58.94  ? 54   ARG A C   1 
ATOM   408  O O   . ARG A 1 54  ? 42.371  7.294   40.352  1.00 57.47  ? 54   ARG A O   1 
ATOM   409  C CB  . ARG A 1 54  ? 45.167  6.074   39.647  1.00 61.16  ? 54   ARG A CB  1 
ATOM   410  C CG  . ARG A 1 54  ? 46.198  5.569   38.669  1.00 64.29  ? 54   ARG A CG  1 
ATOM   411  C CD  . ARG A 1 54  ? 47.592  5.706   39.243  1.00 67.64  ? 54   ARG A CD  1 
ATOM   412  N NE  . ARG A 1 54  ? 48.627  5.591   38.212  1.00 73.23  ? 54   ARG A NE  1 
ATOM   413  C CZ  . ARG A 1 54  ? 49.157  6.617   37.541  1.00 76.19  ? 54   ARG A CZ  1 
ATOM   414  N NH1 . ARG A 1 54  ? 48.757  7.872   37.773  1.00 78.05  ? 54   ARG A NH1 1 
ATOM   415  N NH2 . ARG A 1 54  ? 50.098  6.390   36.621  1.00 76.45  ? 54   ARG A NH2 1 
ATOM   416  N N   . PRO A 1 55  ? 42.534  5.323   41.453  1.00 58.68  ? 55   PRO A N   1 
ATOM   417  C CA  . PRO A 1 55  ? 41.659  5.775   42.524  1.00 58.49  ? 55   PRO A CA  1 
ATOM   418  C C   . PRO A 1 55  ? 42.150  7.050   43.201  1.00 58.84  ? 55   PRO A C   1 
ATOM   419  O O   . PRO A 1 55  ? 43.355  7.290   43.303  1.00 59.00  ? 55   PRO A O   1 
ATOM   420  C CB  . PRO A 1 55  ? 41.684  4.605   43.508  1.00 59.42  ? 55   PRO A CB  1 
ATOM   421  C CG  . PRO A 1 55  ? 42.018  3.437   42.691  1.00 59.38  ? 55   PRO A CG  1 
ATOM   422  C CD  . PRO A 1 55  ? 42.985  3.939   41.676  1.00 59.28  ? 55   PRO A CD  1 
ATOM   423  N N   . TRP A 1 56  ? 41.200  7.857   43.651  1.00 58.93  ? 56   TRP A N   1 
ATOM   424  C CA  . TRP A 1 56  ? 41.492  9.107   44.348  1.00 59.54  ? 56   TRP A CA  1 
ATOM   425  C C   . TRP A 1 56  ? 41.172  8.963   45.820  1.00 60.80  ? 56   TRP A C   1 
ATOM   426  O O   . TRP A 1 56  ? 40.511  8.003   46.228  1.00 61.35  ? 56   TRP A O   1 
ATOM   427  C CB  . TRP A 1 56  ? 40.687  10.253  43.747  1.00 58.28  ? 56   TRP A CB  1 
ATOM   428  C CG  . TRP A 1 56  ? 39.223  10.022  43.712  1.00 57.46  ? 56   TRP A CG  1 
ATOM   429  C CD1 . TRP A 1 56  ? 38.323  10.326  44.686  1.00 57.92  ? 56   TRP A CD1 1 
ATOM   430  C CD2 . TRP A 1 56  ? 38.476  9.449   42.640  1.00 56.20  ? 56   TRP A CD2 1 
ATOM   431  N NE1 . TRP A 1 56  ? 37.062  9.976   44.290  1.00 56.78  ? 56   TRP A NE1 1 
ATOM   432  C CE2 . TRP A 1 56  ? 37.124  9.432   43.038  1.00 55.87  ? 56   TRP A CE2 1 
ATOM   433  C CE3 . TRP A 1 56  ? 38.816  8.956   41.377  1.00 55.19  ? 56   TRP A CE3 1 
ATOM   434  C CZ2 . TRP A 1 56  ? 36.109  8.939   42.222  1.00 55.49  ? 56   TRP A CZ2 1 
ATOM   435  C CZ3 . TRP A 1 56  ? 37.814  8.460   40.566  1.00 54.72  ? 56   TRP A CZ3 1 
ATOM   436  C CH2 . TRP A 1 56  ? 36.472  8.457   40.990  1.00 54.96  ? 56   TRP A CH2 1 
ATOM   437  N N   . SER A 1 57  ? 41.635  9.914   46.623  1.00 61.88  ? 57   SER A N   1 
ATOM   438  C CA  . SER A 1 57  ? 41.331  9.897   48.042  1.00 63.11  ? 57   SER A CA  1 
ATOM   439  C C   . SER A 1 57  ? 40.312  10.983  48.336  1.00 62.56  ? 57   SER A C   1 
ATOM   440  O O   . SER A 1 57  ? 40.284  12.014  47.667  1.00 62.04  ? 57   SER A O   1 
ATOM   441  C CB  . SER A 1 57  ? 42.602  10.068  48.873  1.00 64.82  ? 57   SER A CB  1 
ATOM   442  O OG  . SER A 1 57  ? 43.028  11.412  48.872  1.00 66.77  ? 57   SER A OG  1 
ATOM   443  N N   . GLY A 1 58  ? 39.440  10.728  49.304  1.00 62.64  ? 58   GLY A N   1 
ATOM   444  C CA  . GLY A 1 58  ? 38.408  11.688  49.673  1.00 62.44  ? 58   GLY A CA  1 
ATOM   445  C C   . GLY A 1 58  ? 37.224  11.684  48.726  1.00 60.93  ? 58   GLY A C   1 
ATOM   446  O O   . GLY A 1 58  ? 37.058  10.770  47.911  1.00 60.39  ? 58   GLY A O   1 
ATOM   447  N N   . VAL A 1 59  ? 36.396  12.713  48.852  1.00 60.55  ? 59   VAL A N   1 
ATOM   448  C CA  . VAL A 1 59  ? 35.181  12.850  48.054  1.00 59.38  ? 59   VAL A CA  1 
ATOM   449  C C   . VAL A 1 59  ? 35.441  13.721  46.831  1.00 58.53  ? 59   VAL A C   1 
ATOM   450  O O   . VAL A 1 59  ? 35.778  14.896  46.961  1.00 59.22  ? 59   VAL A O   1 
ATOM   451  C CB  . VAL A 1 59  ? 34.035  13.478  48.874  1.00 59.85  ? 59   VAL A CB  1 
ATOM   452  C CG1 . VAL A 1 59  ? 32.791  13.633  48.015  1.00 58.19  ? 59   VAL A CG1 1 
ATOM   453  C CG2 . VAL A 1 59  ? 33.737  12.635  50.110  1.00 59.72  ? 59   VAL A CG2 1 
ATOM   454  N N   . LEU A 1 60  ? 35.287  13.133  45.648  1.00 57.33  ? 60   LEU A N   1 
ATOM   455  C CA  . LEU A 1 60  ? 35.387  13.876  44.406  1.00 56.57  ? 60   LEU A CA  1 
ATOM   456  C C   . LEU A 1 60  ? 34.119  14.692  44.178  1.00 55.99  ? 60   LEU A C   1 
ATOM   457  O O   . LEU A 1 60  ? 33.005  14.172  44.251  1.00 56.14  ? 60   LEU A O   1 
ATOM   458  C CB  . LEU A 1 60  ? 35.654  12.936  43.221  1.00 55.67  ? 60   LEU A CB  1 
ATOM   459  C CG  . LEU A 1 60  ? 35.959  13.618  41.874  1.00 55.03  ? 60   LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 60  ? 37.121  12.961  41.145  1.00 55.91  ? 60   LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 60  ? 34.745  13.626  40.983  1.00 54.69  ? 60   LEU A CD2 1 
ATOM   462  N N   . ASP A 1 61  ? 34.290  15.979  43.918  1.00 55.75  ? 61   ASP A N   1 
ATOM   463  C CA  . ASP A 1 61  ? 33.158  16.832  43.617  1.00 55.54  ? 61   ASP A CA  1 
ATOM   464  C C   . ASP A 1 61  ? 32.688  16.605  42.191  1.00 53.39  ? 61   ASP A C   1 
ATOM   465  O O   . ASP A 1 61  ? 33.417  16.882  41.245  1.00 53.01  ? 61   ASP A O   1 
ATOM   466  C CB  . ASP A 1 61  ? 33.507  18.300  43.810  1.00 56.64  ? 61   ASP A CB  1 
ATOM   467  C CG  . ASP A 1 61  ? 32.297  19.189  43.657  1.00 59.01  ? 61   ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 61  ? 31.993  19.569  42.504  1.00 59.37  ? 61   ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 61  ? 31.634  19.466  44.695  1.00 64.33  ? 61   ASP A OD2 1 
ATOM   470  N N   . ALA A 1 62  ? 31.465  16.104  42.050  1.00 52.06  ? 62   ALA A N   1 
ATOM   471  C CA  . ALA A 1 62  ? 30.889  15.803  40.747  1.00 50.39  ? 62   ALA A CA  1 
ATOM   472  C C   . ALA A 1 62  ? 29.680  16.693  40.482  1.00 49.75  ? 62   ALA A C   1 
ATOM   473  O O   . ALA A 1 62  ? 28.634  16.213  40.068  1.00 48.90  ? 62   ALA A O   1 
ATOM   474  C CB  . ALA A 1 62  ? 30.503  14.327  40.674  1.00 50.05  ? 62   ALA A CB  1 
ATOM   475  N N   . THR A 1 63  ? 29.833  17.995  40.727  1.00 50.17  ? 63   THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? 28.723  18.948  40.622  1.00 50.16  ? 63   THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? 28.779  19.833  39.372  1.00 49.85  ? 63   THR A C   1 
ATOM   478  O O   . THR A 1 63  ? 27.801  20.515  39.064  1.00 49.59  ? 63   THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? 28.627  19.840  41.874  1.00 51.54  ? 63   THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? 29.790  20.686  41.973  1.00 51.65  ? 63   THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? 28.498  18.972  43.152  1.00 51.03  ? 63   THR A CG2 1 
ATOM   482  N N   . THR A 1 64  ? 29.910  19.815  38.660  1.00 49.40  ? 64   THR A N   1 
ATOM   483  C CA  . THR A 1 64  ? 30.090  20.620  37.468  1.00 49.29  ? 64   THR A CA  1 
ATOM   484  C C   . THR A 1 64  ? 30.655  19.797  36.312  1.00 48.40  ? 64   THR A C   1 
ATOM   485  O O   . THR A 1 64  ? 31.318  18.784  36.510  1.00 48.77  ? 64   THR A O   1 
ATOM   486  C CB  . THR A 1 64  ? 31.008  21.841  37.748  1.00 50.00  ? 64   THR A CB  1 
ATOM   487  O OG1 . THR A 1 64  ? 32.334  21.391  38.019  1.00 51.73  ? 64   THR A OG1 1 
ATOM   488  C CG2 . THR A 1 64  ? 30.527  22.610  38.959  1.00 50.23  ? 64   THR A CG2 1 
ATOM   489  N N   . PHE A 1 65  ? 30.352  20.235  35.097  1.00 47.93  ? 65   PHE A N   1 
ATOM   490  C CA  . PHE A 1 65  ? 30.970  19.694  33.911  1.00 47.14  ? 65   PHE A CA  1 
ATOM   491  C C   . PHE A 1 65  ? 32.478  19.957  33.911  1.00 47.76  ? 65   PHE A C   1 
ATOM   492  O O   . PHE A 1 65  ? 32.963  21.010  34.349  1.00 47.60  ? 65   PHE A O   1 
ATOM   493  C CB  . PHE A 1 65  ? 30.352  20.298  32.654  1.00 46.59  ? 65   PHE A CB  1 
ATOM   494  C CG  . PHE A 1 65  ? 28.967  19.822  32.368  1.00 45.34  ? 65   PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 65  ? 28.733  18.501  32.049  1.00 46.26  ? 65   PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 65  ? 27.893  20.696  32.399  1.00 47.09  ? 65   PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 65  ? 27.470  18.058  31.771  1.00 45.26  ? 65   PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 65  ? 26.621  20.252  32.130  1.00 46.35  ? 65   PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 65  ? 26.410  18.937  31.816  1.00 45.98  ? 65   PHE A CZ  1 
ATOM   500  N N   . GLN A 1 66  ? 33.211  18.982  33.390  1.00 47.66  ? 66   GLN A N   1 
ATOM   501  C CA  . GLN A 1 66  ? 34.648  19.104  33.256  1.00 47.97  ? 66   GLN A CA  1 
ATOM   502  C C   . GLN A 1 66  ? 35.056  19.677  31.893  1.00 47.42  ? 66   GLN A C   1 
ATOM   503  O O   . GLN A 1 66  ? 34.202  20.038  31.072  1.00 46.50  ? 66   GLN A O   1 
ATOM   504  C CB  . GLN A 1 66  ? 35.307  17.757  33.536  1.00 47.90  ? 66   GLN A CB  1 
ATOM   505  C CG  . GLN A 1 66  ? 35.739  17.639  34.973  1.00 49.11  ? 66   GLN A CG  1 
ATOM   506  C CD  . GLN A 1 66  ? 37.024  18.410  35.261  1.00 50.91  ? 66   GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 66  ? 37.556  19.123  34.394  1.00 52.91  ? 66   GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 66  ? 37.545  18.245  36.470  1.00 51.41  ? 66   GLN A NE2 1 
ATOM   509  N N   . ASN A 1 67  ? 36.368  19.814  31.699  1.00 47.80  ? 67   ASN A N   1 
ATOM   510  C CA  . ASN A 1 67  ? 36.927  20.368  30.464  1.00 47.55  ? 67   ASN A CA  1 
ATOM   511  C C   . ASN A 1 67  ? 36.463  19.634  29.213  1.00 46.76  ? 67   ASN A C   1 
ATOM   512  O O   . ASN A 1 67  ? 36.229  18.418  29.211  1.00 46.00  ? 67   ASN A O   1 
ATOM   513  C CB  . ASN A 1 67  ? 38.444  20.278  30.460  1.00 47.95  ? 67   ASN A CB  1 
ATOM   514  C CG  . ASN A 1 67  ? 39.097  21.024  31.602  1.00 49.66  ? 67   ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 67  ? 38.634  22.081  32.024  1.00 48.05  ? 67   ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 67  ? 40.208  20.472  32.095  1.00 48.80  ? 67   ASN A ND2 1 
ATOM   517  N N   . VAL A 1 68  ? 36.381  20.395  28.138  1.00 46.57  ? 68   VAL A N   1 
ATOM   518  C CA  . VAL A 1 68  ? 36.103  19.864  26.816  1.00 45.92  ? 68   VAL A CA  1 
ATOM   519  C C   . VAL A 1 68  ? 37.416  19.487  26.149  1.00 45.93  ? 68   VAL A C   1 
ATOM   520  O O   . VAL A 1 68  ? 38.430  20.157  26.323  1.00 46.17  ? 68   VAL A O   1 
ATOM   521  C CB  . VAL A 1 68  ? 35.353  20.905  26.000  1.00 45.81  ? 68   VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? 35.267  20.498  24.522  1.00 46.02  ? 68   VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? 33.980  21.116  26.633  1.00 45.44  ? 68   VAL A CG2 1 
ATOM   524  N N   . CYS A 1 69  ? 37.410  18.370  25.440  1.00 45.76  ? 69   CYS A N   1 
ATOM   525  C CA  . CYS A 1 69  ? 38.610  17.882  24.787  1.00 46.33  ? 69   CYS A CA  1 
ATOM   526  C C   . CYS A 1 69  ? 39.066  18.913  23.763  1.00 46.84  ? 69   CYS A C   1 
ATOM   527  O O   . CYS A 1 69  ? 38.238  19.551  23.098  1.00 46.33  ? 69   CYS A O   1 
ATOM   528  C CB  . CYS A 1 69  ? 38.336  16.541  24.138  1.00 45.66  ? 69   CYS A CB  1 
ATOM   529  S SG  . CYS A 1 69  ? 38.095  15.210  25.347  1.00 46.48  ? 69   CYS A SG  1 
ATOM   530  N N   . TYR A 1 70  ? 40.376  19.085  23.652  1.00 47.73  ? 70   TYR A N   1 
ATOM   531  C CA  . TYR A 1 70  ? 40.937  20.159  22.837  1.00 48.58  ? 70   TYR A CA  1 
ATOM   532  C C   . TYR A 1 70  ? 40.472  19.997  21.403  1.00 47.75  ? 70   TYR A C   1 
ATOM   533  O O   . TYR A 1 70  ? 40.549  18.890  20.833  1.00 46.95  ? 70   TYR A O   1 
ATOM   534  C CB  . TYR A 1 70  ? 42.472  20.173  22.911  1.00 50.37  ? 70   TYR A CB  1 
ATOM   535  C CG  . TYR A 1 70  ? 42.995  21.578  22.924  1.00 52.38  ? 70   TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 70  ? 43.430  22.183  24.096  1.00 54.61  ? 70   TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 70  ? 43.001  22.322  21.768  1.00 53.78  ? 70   TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 70  ? 43.874  23.510  24.089  1.00 55.02  ? 70   TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 70  ? 43.440  23.618  21.751  1.00 54.05  ? 70   TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 70  ? 43.870  24.207  22.905  1.00 54.93  ? 70   TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 70  ? 44.300  25.517  22.833  1.00 58.20  ? 70   TYR A OH  1 
ATOM   542  N N   . GLN A 1 71  ? 39.957  21.085  20.836  1.00 47.40  ? 71   GLN A N   1 
ATOM   543  C CA  . GLN A 1 71  ? 39.344  21.042  19.524  1.00 47.27  ? 71   GLN A CA  1 
ATOM   544  C C   . GLN A 1 71  ? 39.264  22.388  18.828  1.00 48.64  ? 71   GLN A C   1 
ATOM   545  O O   . GLN A 1 71  ? 39.307  23.434  19.461  1.00 48.44  ? 71   GLN A O   1 
ATOM   546  C CB  . GLN A 1 71  ? 37.926  20.472  19.614  1.00 46.53  ? 71   GLN A CB  1 
ATOM   547  C CG  . GLN A 1 71  ? 36.931  21.290  20.448  1.00 45.38  ? 71   GLN A CG  1 
ATOM   548  C CD  . GLN A 1 71  ? 35.670  20.522  20.730  1.00 45.65  ? 71   GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 71  ? 34.594  20.855  20.210  1.00 41.80  ? 71   GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 71  ? 35.789  19.459  21.529  1.00 41.88  ? 71   GLN A NE2 1 
ATOM   551  N N   . TYR A 1 72  ? 39.128  22.309  17.504  1.00 50.31  ? 72   TYR A N   1 
ATOM   552  C CA  . TYR A 1 72  ? 38.780  23.430  16.646  1.00 51.82  ? 72   TYR A CA  1 
ATOM   553  C C   . TYR A 1 72  ? 37.460  24.048  17.097  1.00 52.66  ? 72   TYR A C   1 
ATOM   554  O O   . TYR A 1 72  ? 36.530  23.329  17.423  1.00 53.05  ? 72   TYR A O   1 
ATOM   555  C CB  . TYR A 1 72  ? 38.663  22.932  15.193  1.00 52.13  ? 72   TYR A CB  1 
ATOM   556  C CG  . TYR A 1 72  ? 38.250  24.008  14.196  1.00 52.95  ? 72   TYR A CG  1 
ATOM   557  C CD1 . TYR A 1 72  ? 36.914  24.154  13.809  1.00 53.01  ? 72   TYR A CD1 1 
ATOM   558  C CD2 . TYR A 1 72  ? 39.181  24.884  13.659  1.00 53.85  ? 72   TYR A CD2 1 
ATOM   559  C CE1 . TYR A 1 72  ? 36.523  25.134  12.907  1.00 52.57  ? 72   TYR A CE1 1 
ATOM   560  C CE2 . TYR A 1 72  ? 38.795  25.877  12.744  1.00 54.63  ? 72   TYR A CE2 1 
ATOM   561  C CZ  . TYR A 1 72  ? 37.459  25.981  12.377  1.00 54.36  ? 72   TYR A CZ  1 
ATOM   562  O OH  . TYR A 1 72  ? 37.054  26.953  11.493  1.00 56.68  ? 72   TYR A OH  1 
ATOM   563  N N   . VAL A 1 73  ? 37.395  25.377  17.115  1.00 54.49  ? 73   VAL A N   1 
ATOM   564  C CA  . VAL A 1 73  ? 36.182  26.124  17.474  1.00 55.17  ? 73   VAL A CA  1 
ATOM   565  C C   . VAL A 1 73  ? 35.700  26.911  16.244  1.00 56.58  ? 73   VAL A C   1 
ATOM   566  O O   . VAL A 1 73  ? 36.457  27.693  15.662  1.00 56.53  ? 73   VAL A O   1 
ATOM   567  C CB  . VAL A 1 73  ? 36.455  27.124  18.623  1.00 56.12  ? 73   VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 73  ? 35.208  27.956  18.942  1.00 55.55  ? 73   VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 73  ? 36.999  26.402  19.869  1.00 54.88  ? 73   VAL A CG2 1 
ATOM   570  N N   . ASP A 1 74  ? 34.436  26.701  15.876  1.00 57.51  ? 74   ASP A N   1 
ATOM   571  C CA  . ASP A 1 74  ? 33.844  27.289  14.683  1.00 58.74  ? 74   ASP A CA  1 
ATOM   572  C C   . ASP A 1 74  ? 33.810  28.802  14.785  1.00 60.06  ? 74   ASP A C   1 
ATOM   573  O O   . ASP A 1 74  ? 33.351  29.359  15.775  1.00 60.58  ? 74   ASP A O   1 
ATOM   574  C CB  . ASP A 1 74  ? 32.418  26.769  14.473  1.00 58.49  ? 74   ASP A CB  1 
ATOM   575  C CG  . ASP A 1 74  ? 31.840  27.174  13.131  1.00 60.05  ? 74   ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 74  ? 31.906  26.351  12.210  1.00 64.22  ? 74   ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 74  ? 31.340  28.311  12.983  1.00 62.86  ? 74   ASP A OD2 1 
ATOM   578  N N   . THR A 1 75  ? 34.284  29.447  13.727  1.00 61.59  ? 75   THR A N   1 
ATOM   579  C CA  . THR A 1 75  ? 34.332  30.899  13.635  1.00 63.30  ? 75   THR A CA  1 
ATOM   580  C C   . THR A 1 75  ? 33.524  31.451  12.443  1.00 63.57  ? 75   THR A C   1 
ATOM   581  O O   . THR A 1 75  ? 33.517  32.656  12.218  1.00 64.25  ? 75   THR A O   1 
ATOM   582  C CB  . THR A 1 75  ? 35.807  31.339  13.481  1.00 64.31  ? 75   THR A CB  1 
ATOM   583  O OG1 . THR A 1 75  ? 36.408  30.587  12.419  1.00 65.01  ? 75   THR A OG1 1 
ATOM   584  C CG2 . THR A 1 75  ? 36.588  31.087  14.770  1.00 63.96  ? 75   THR A CG2 1 
ATOM   585  N N   . LEU A 1 76  ? 32.834  30.581  11.698  1.00 63.28  ? 76   LEU A N   1 
ATOM   586  C CA  . LEU A 1 76  ? 32.142  30.998  10.472  1.00 63.40  ? 76   LEU A CA  1 
ATOM   587  C C   . LEU A 1 76  ? 31.180  32.143  10.738  1.00 64.17  ? 76   LEU A C   1 
ATOM   588  O O   . LEU A 1 76  ? 31.212  33.153  10.031  1.00 64.45  ? 76   LEU A O   1 
ATOM   589  C CB  . LEU A 1 76  ? 31.379  29.836  9.830   1.00 62.97  ? 76   LEU A CB  1 
ATOM   590  C CG  . LEU A 1 76  ? 30.721  30.118  8.465   1.00 63.45  ? 76   LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 76  ? 31.762  30.604  7.444   1.00 63.84  ? 76   LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 76  ? 29.966  28.878  7.939   1.00 62.75  ? 76   LEU A CD2 1 
ATOM   593  N N   . TYR A 1 77  ? 30.337  31.985  11.762  1.00 63.83  ? 77   TYR A N   1 
ATOM   594  C CA  . TYR A 1 77  ? 29.342  33.008  12.122  1.00 64.30  ? 77   TYR A CA  1 
ATOM   595  C C   . TYR A 1 77  ? 29.402  33.362  13.596  1.00 64.70  ? 77   TYR A C   1 
ATOM   596  O O   . TYR A 1 77  ? 28.630  32.831  14.394  1.00 64.52  ? 77   TYR A O   1 
ATOM   597  C CB  . TYR A 1 77  ? 27.948  32.511  11.808  1.00 63.39  ? 77   TYR A CB  1 
ATOM   598  C CG  . TYR A 1 77  ? 27.707  32.237  10.366  1.00 62.84  ? 77   TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 77  ? 27.677  33.271  9.438   1.00 63.51  ? 77   TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 77  ? 27.474  30.941  9.922   1.00 61.70  ? 77   TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 77  ? 27.421  33.019  8.093   1.00 63.84  ? 77   TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 77  ? 27.219  30.674  8.588   1.00 62.33  ? 77   TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 77  ? 27.192  31.707  7.676   1.00 63.32  ? 77   TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 77  ? 26.922  31.428  6.353   1.00 63.19  ? 77   TYR A OH  1 
ATOM   605  N N   . PRO A 1 78  ? 30.320  34.258  13.969  1.00 65.53  ? 78   PRO A N   1 
ATOM   606  C CA  . PRO A 1 78  ? 30.482  34.661  15.376  1.00 65.52  ? 78   PRO A CA  1 
ATOM   607  C C   . PRO A 1 78  ? 29.223  35.302  15.986  1.00 65.58  ? 78   PRO A C   1 
ATOM   608  O O   . PRO A 1 78  ? 28.675  36.228  15.406  1.00 66.30  ? 78   PRO A O   1 
ATOM   609  C CB  . PRO A 1 78  ? 31.615  35.699  15.313  1.00 67.07  ? 78   PRO A CB  1 
ATOM   610  C CG  . PRO A 1 78  ? 32.347  35.396  14.032  1.00 67.34  ? 78   PRO A CG  1 
ATOM   611  C CD  . PRO A 1 78  ? 31.275  34.947  13.083  1.00 66.47  ? 78   PRO A CD  1 
ATOM   612  N N   . GLY A 1 79  ? 28.795  34.811  17.152  1.00 64.59  ? 79   GLY A N   1 
ATOM   613  C CA  . GLY A 1 79  ? 27.626  35.363  17.868  1.00 64.37  ? 79   GLY A CA  1 
ATOM   614  C C   . GLY A 1 79  ? 26.301  34.666  17.558  1.00 62.28  ? 79   GLY A C   1 
ATOM   615  O O   . GLY A 1 79  ? 25.275  34.954  18.190  1.00 62.81  ? 79   GLY A O   1 
ATOM   616  N N   . PHE A 1 80  ? 26.325  33.750  16.591  1.00 59.09  ? 80   PHE A N   1 
ATOM   617  C CA  . PHE A 1 80  ? 25.110  33.184  16.011  1.00 57.21  ? 80   PHE A CA  1 
ATOM   618  C C   . PHE A 1 80  ? 24.790  31.882  16.735  1.00 56.08  ? 80   PHE A C   1 
ATOM   619  O O   . PHE A 1 80  ? 25.639  30.985  16.820  1.00 54.59  ? 80   PHE A O   1 
ATOM   620  C CB  . PHE A 1 80  ? 25.331  32.956  14.511  1.00 55.87  ? 80   PHE A CB  1 
ATOM   621  C CG  . PHE A 1 80  ? 24.238  32.189  13.829  1.00 54.46  ? 80   PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 80  ? 22.950  32.690  13.767  1.00 54.42  ? 80   PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 80  ? 24.502  30.974  13.223  1.00 52.95  ? 80   PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 80  ? 21.955  31.985  13.134  1.00 54.58  ? 80   PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 80  ? 23.508  30.273  12.575  1.00 52.10  ? 80   PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 80  ? 22.231  30.778  12.534  1.00 52.72  ? 80   PHE A CZ  1 
ATOM   627  N N   . GLU A 1 81  ? 23.574  31.777  17.260  1.00 55.83  ? 81   GLU A N   1 
ATOM   628  C CA  . GLU A 1 81  ? 23.207  30.625  18.066  1.00 56.15  ? 81   GLU A CA  1 
ATOM   629  C C   . GLU A 1 81  ? 23.367  29.308  17.299  1.00 53.95  ? 81   GLU A C   1 
ATOM   630  O O   . GLU A 1 81  ? 23.808  28.309  17.866  1.00 53.02  ? 81   GLU A O   1 
ATOM   631  C CB  . GLU A 1 81  ? 21.782  30.754  18.588  1.00 56.79  ? 81   GLU A CB  1 
ATOM   632  C CG  . GLU A 1 81  ? 21.391  29.636  19.547  1.00 58.85  ? 81   GLU A CG  1 
ATOM   633  C CD  . GLU A 1 81  ? 19.962  29.755  20.024  1.00 60.86  ? 81   GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 81  ? 19.129  28.906  19.619  1.00 65.81  ? 81   GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 81  ? 19.658  30.719  20.778  1.00 68.92  ? 81   GLU A OE2 1 
ATOM   636  N N   . GLY A 1 82  ? 23.038  29.323  16.009  1.00 52.55  ? 82   GLY A N   1 
ATOM   637  C CA  . GLY A 1 82  ? 23.047  28.109  15.192  1.00 51.18  ? 82   GLY A CA  1 
ATOM   638  C C   . GLY A 1 82  ? 24.387  27.395  15.145  1.00 49.82  ? 82   GLY A C   1 
ATOM   639  O O   . GLY A 1 82  ? 24.442  26.171  14.974  1.00 48.14  ? 82   GLY A O   1 
ATOM   640  N N   . THR A 1 83  ? 25.469  28.158  15.277  1.00 49.63  ? 83   THR A N   1 
ATOM   641  C CA  . THR A 1 83  ? 26.804  27.562  15.353  1.00 49.12  ? 83   THR A CA  1 
ATOM   642  C C   . THR A 1 83  ? 27.305  27.463  16.802  1.00 49.72  ? 83   THR A C   1 
ATOM   643  O O   . THR A 1 83  ? 27.847  26.440  17.206  1.00 48.45  ? 83   THR A O   1 
ATOM   644  C CB  . THR A 1 83  ? 27.821  28.336  14.481  1.00 49.36  ? 83   THR A CB  1 
ATOM   645  O OG1 . THR A 1 83  ? 27.772  29.737  14.802  1.00 49.12  ? 83   THR A OG1 1 
ATOM   646  C CG2 . THR A 1 83  ? 27.501  28.125  13.007  1.00 47.48  ? 83   THR A CG2 1 
ATOM   647  N N   . GLU A 1 84  ? 27.109  28.524  17.582  1.00 51.21  ? 84   GLU A N   1 
ATOM   648  C CA  . GLU A 1 84  ? 27.667  28.586  18.923  1.00 52.40  ? 84   GLU A CA  1 
ATOM   649  C C   . GLU A 1 84  ? 27.080  27.522  19.839  1.00 51.59  ? 84   GLU A C   1 
ATOM   650  O O   . GLU A 1 84  ? 27.745  27.084  20.762  1.00 52.18  ? 84   GLU A O   1 
ATOM   651  C CB  . GLU A 1 84  ? 27.483  29.979  19.544  1.00 54.24  ? 84   GLU A CB  1 
ATOM   652  C CG  . GLU A 1 84  ? 28.218  31.124  18.812  1.00 58.02  ? 84   GLU A CG  1 
ATOM   653  C CD  . GLU A 1 84  ? 29.736  31.168  19.043  1.00 64.55  ? 84   GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 84  ? 30.301  30.259  19.723  1.00 67.28  ? 84   GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 84  ? 30.367  32.140  18.530  1.00 68.13  ? 84   GLU A OE2 1 
ATOM   656  N N   . MET A 1 85  ? 25.853  27.080  19.576  1.00 51.00  ? 85   MET A N   1 
ATOM   657  C CA  . MET A 1 85  ? 25.241  26.037  20.387  1.00 50.39  ? 85   MET A CA  1 
ATOM   658  C C   . MET A 1 85  ? 26.005  24.707  20.346  1.00 49.04  ? 85   MET A C   1 
ATOM   659  O O   . MET A 1 85  ? 25.766  23.852  21.199  1.00 48.95  ? 85   MET A O   1 
ATOM   660  C CB  . MET A 1 85  ? 23.785  25.817  19.969  1.00 50.33  ? 85   MET A CB  1 
ATOM   661  C CG  . MET A 1 85  ? 23.579  25.206  18.583  1.00 50.19  ? 85   MET A CG  1 
ATOM   662  S SD  . MET A 1 85  ? 21.818  25.037  18.183  1.00 53.27  ? 85   MET A SD  1 
ATOM   663  C CE  . MET A 1 85  ? 21.491  23.496  19.036  1.00 48.90  ? 85   MET A CE  1 
ATOM   664  N N   . TRP A 1 86  ? 26.882  24.528  19.350  1.00 48.05  ? 86   TRP A N   1 
ATOM   665  C CA  . TRP A 1 86  ? 27.703  23.312  19.208  1.00 47.43  ? 86   TRP A CA  1 
ATOM   666  C C   . TRP A 1 86  ? 29.145  23.517  19.652  1.00 47.12  ? 86   TRP A C   1 
ATOM   667  O O   . TRP A 1 86  ? 29.922  22.578  19.684  1.00 45.86  ? 86   TRP A O   1 
ATOM   668  C CB  . TRP A 1 86  ? 27.701  22.813  17.756  1.00 46.72  ? 86   TRP A CB  1 
ATOM   669  C CG  . TRP A 1 86  ? 26.345  22.666  17.173  1.00 46.75  ? 86   TRP A CG  1 
ATOM   670  C CD1 . TRP A 1 86  ? 25.751  23.505  16.280  1.00 47.67  ? 86   TRP A CD1 1 
ATOM   671  C CD2 . TRP A 1 86  ? 25.389  21.643  17.463  1.00 45.88  ? 86   TRP A CD2 1 
ATOM   672  N NE1 . TRP A 1 86  ? 24.490  23.059  15.981  1.00 47.42  ? 86   TRP A NE1 1 
ATOM   673  C CE2 . TRP A 1 86  ? 24.244  21.914  16.690  1.00 46.56  ? 86   TRP A CE2 1 
ATOM   674  C CE3 . TRP A 1 86  ? 25.394  20.515  18.293  1.00 45.66  ? 86   TRP A CE3 1 
ATOM   675  C CZ2 . TRP A 1 86  ? 23.109  21.107  16.726  1.00 45.52  ? 86   TRP A CZ2 1 
ATOM   676  C CZ3 . TRP A 1 86  ? 24.267  19.718  18.333  1.00 46.55  ? 86   TRP A CZ3 1 
ATOM   677  C CH2 . TRP A 1 86  ? 23.139  20.016  17.550  1.00 46.80  ? 86   TRP A CH2 1 
ATOM   678  N N   . ASN A 1 87  ? 29.495  24.746  20.002  1.00 47.85  ? 87   ASN A N   1 
ATOM   679  C CA  . ASN A 1 87  ? 30.857  25.076  20.373  1.00 48.67  ? 87   ASN A CA  1 
ATOM   680  C C   . ASN A 1 87  ? 31.129  24.689  21.830  1.00 48.29  ? 87   ASN A C   1 
ATOM   681  O O   . ASN A 1 87  ? 30.198  24.571  22.623  1.00 47.92  ? 87   ASN A O   1 
ATOM   682  C CB  . ASN A 1 87  ? 31.114  26.583  20.161  1.00 49.88  ? 87   ASN A CB  1 
ATOM   683  C CG  . ASN A 1 87  ? 31.585  26.910  18.745  1.00 52.05  ? 87   ASN A CG  1 
ATOM   684  O OD1 . ASN A 1 87  ? 32.037  26.031  18.001  1.00 57.31  ? 87   ASN A OD1 1 
ATOM   685  N ND2 . ASN A 1 87  ? 31.523  28.179  18.386  1.00 53.62  ? 87   ASN A ND2 1 
ATOM   686  N N   . PRO A 1 88  ? 32.411  24.515  22.196  1.00 47.85  ? 88   PRO A N   1 
ATOM   687  C CA  . PRO A 1 88  ? 32.702  24.116  23.582  1.00 47.50  ? 88   PRO A CA  1 
ATOM   688  C C   . PRO A 1 88  ? 32.145  25.099  24.578  1.00 47.41  ? 88   PRO A C   1 
ATOM   689  O O   . PRO A 1 88  ? 32.209  26.306  24.344  1.00 46.90  ? 88   PRO A O   1 
ATOM   690  C CB  . PRO A 1 88  ? 34.234  24.123  23.650  1.00 47.77  ? 88   PRO A CB  1 
ATOM   691  C CG  . PRO A 1 88  ? 34.687  23.967  22.218  1.00 48.17  ? 88   PRO A CG  1 
ATOM   692  C CD  . PRO A 1 88  ? 33.636  24.682  21.396  1.00 47.93  ? 88   PRO A CD  1 
ATOM   693  N N   . ASN A 1 89  ? 31.589  24.587  25.668  1.00 46.90  ? 89   ASN A N   1 
ATOM   694  C CA  . ASN A 1 89  ? 31.014  25.432  26.712  1.00 47.59  ? 89   ASN A CA  1 
ATOM   695  C C   . ASN A 1 89  ? 31.747  25.315  28.037  1.00 48.12  ? 89   ASN A C   1 
ATOM   696  O O   . ASN A 1 89  ? 31.270  25.792  29.045  1.00 48.75  ? 89   ASN A O   1 
ATOM   697  C CB  . ASN A 1 89  ? 29.521  25.138  26.889  1.00 46.97  ? 89   ASN A CB  1 
ATOM   698  C CG  . ASN A 1 89  ? 29.253  23.743  27.358  1.00 46.09  ? 89   ASN A CG  1 
ATOM   699  O OD1 . ASN A 1 89  ? 30.112  22.872  27.255  1.00 43.16  ? 89   ASN A OD1 1 
ATOM   700  N ND2 . ASN A 1 89  ? 28.033  23.501  27.849  1.00 45.08  ? 89   ASN A ND2 1 
ATOM   701  N N   . ARG A 1 90  ? 32.911  24.679  28.016  1.00 48.84  ? 90   ARG A N   1 
ATOM   702  C CA  . ARG A 1 90  ? 33.850  24.659  29.140  1.00 50.55  ? 90   ARG A CA  1 
ATOM   703  C C   . ARG A 1 90  ? 35.255  24.824  28.557  1.00 50.37  ? 90   ARG A C   1 
ATOM   704  O O   . ARG A 1 90  ? 35.423  24.788  27.337  1.00 50.11  ? 90   ARG A O   1 
ATOM   705  C CB  . ARG A 1 90  ? 33.762  23.336  29.915  1.00 50.64  ? 90   ARG A CB  1 
ATOM   706  C CG  . ARG A 1 90  ? 32.438  23.083  30.627  1.00 53.85  ? 90   ARG A CG  1 
ATOM   707  C CD  . ARG A 1 90  ? 32.299  23.946  31.874  1.00 60.40  ? 90   ARG A CD  1 
ATOM   708  N NE  . ARG A 1 90  ? 30.948  23.847  32.418  1.00 64.36  ? 90   ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 90  ? 29.916  24.657  32.141  1.00 66.49  ? 90   ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 90  ? 30.050  25.706  31.331  1.00 65.73  ? 90   ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 90  ? 28.719  24.413  32.694  1.00 66.47  ? 90   ARG A NH2 1 
ATOM   712  N N   . GLU A 1 91  ? 36.243  24.969  29.431  1.00 50.81  ? 91   GLU A N   1 
ATOM   713  C CA  . GLU A 1 91  ? 37.635  25.168  29.039  1.00 51.45  ? 91   GLU A CA  1 
ATOM   714  C C   . GLU A 1 91  ? 38.123  24.021  28.183  1.00 50.06  ? 91   GLU A C   1 
ATOM   715  O O   . GLU A 1 91  ? 37.838  22.844  28.471  1.00 49.51  ? 91   GLU A O   1 
ATOM   716  C CB  . GLU A 1 91  ? 38.529  25.280  30.287  1.00 52.40  ? 91   GLU A CB  1 
ATOM   717  C CG  . GLU A 1 91  ? 40.031  25.136  30.048  1.00 53.22  ? 91   GLU A CG  1 
ATOM   718  C CD  . GLU A 1 91  ? 40.866  25.295  31.326  1.00 55.94  ? 91   GLU A CD  1 
ATOM   719  O OE1 . GLU A 1 91  ? 40.345  25.800  32.348  1.00 59.12  ? 91   GLU A OE1 1 
ATOM   720  O OE2 . GLU A 1 91  ? 42.055  24.904  31.310  1.00 58.67  ? 91   GLU A OE2 1 
ATOM   721  N N   . LEU A 1 92  ? 38.874  24.359  27.140  1.00 49.17  ? 92   LEU A N   1 
ATOM   722  C CA  . LEU A 1 92  ? 39.515  23.337  26.316  1.00 48.49  ? 92   LEU A CA  1 
ATOM   723  C C   . LEU A 1 92  ? 40.747  22.846  27.022  1.00 48.91  ? 92   LEU A C   1 
ATOM   724  O O   . LEU A 1 92  ? 41.559  23.648  27.476  1.00 49.39  ? 92   LEU A O   1 
ATOM   725  C CB  . LEU A 1 92  ? 39.931  23.881  24.961  1.00 48.19  ? 92   LEU A CB  1 
ATOM   726  C CG  . LEU A 1 92  ? 38.813  24.313  24.028  1.00 48.45  ? 92   LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 92  ? 39.393  25.009  22.792  1.00 48.66  ? 92   LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 92  ? 37.985  23.104  23.656  1.00 46.78  ? 92   LEU A CD2 1 
ATOM   729  N N   . SER A 1 93  ? 40.901  21.527  27.077  1.00 48.43  ? 93   SER A N   1 
ATOM   730  C CA  . SER A 1 93  ? 42.094  20.906  27.641  1.00 48.36  ? 93   SER A CA  1 
ATOM   731  C C   . SER A 1 93  ? 42.268  19.493  27.101  1.00 47.93  ? 93   SER A C   1 
ATOM   732  O O   . SER A 1 93  ? 41.289  18.851  26.739  1.00 47.22  ? 93   SER A O   1 
ATOM   733  C CB  . SER A 1 93  ? 41.979  20.869  29.166  1.00 49.00  ? 93   SER A CB  1 
ATOM   734  O OG  . SER A 1 93  ? 43.002  20.097  29.752  1.00 48.69  ? 93   SER A OG  1 
ATOM   735  N N   . GLU A 1 94  ? 43.516  19.023  27.057  1.00 48.19  ? 94   GLU A N   1 
ATOM   736  C CA  . GLU A 1 94  ? 43.824  17.620  26.800  1.00 48.14  ? 94   GLU A CA  1 
ATOM   737  C C   . GLU A 1 94  ? 43.473  16.742  28.000  1.00 48.66  ? 94   GLU A C   1 
ATOM   738  O O   . GLU A 1 94  ? 43.296  15.528  27.844  1.00 49.08  ? 94   GLU A O   1 
ATOM   739  C CB  . GLU A 1 94  ? 45.301  17.427  26.462  1.00 48.98  ? 94   GLU A CB  1 
ATOM   740  C CG  . GLU A 1 94  ? 45.734  18.042  25.132  1.00 48.87  ? 94   GLU A CG  1 
ATOM   741  C CD  . GLU A 1 94  ? 47.153  17.642  24.763  1.00 49.37  ? 94   GLU A CD  1 
ATOM   742  O OE1 . GLU A 1 94  ? 47.353  16.537  24.219  1.00 46.84  ? 94   GLU A OE1 1 
ATOM   743  O OE2 . GLU A 1 94  ? 48.071  18.438  25.029  1.00 52.06  ? 94   GLU A OE2 1 
ATOM   744  N N   . ASP A 1 95  ? 43.396  17.345  29.188  1.00 48.62  ? 95   ASP A N   1 
ATOM   745  C CA  . ASP A 1 95  ? 42.830  16.684  30.362  1.00 48.45  ? 95   ASP A CA  1 
ATOM   746  C C   . ASP A 1 95  ? 41.315  16.822  30.275  1.00 47.31  ? 95   ASP A C   1 
ATOM   747  O O   . ASP A 1 95  ? 40.735  17.806  30.755  1.00 47.04  ? 95   ASP A O   1 
ATOM   748  C CB  . ASP A 1 95  ? 43.373  17.324  31.643  1.00 49.65  ? 95   ASP A CB  1 
ATOM   749  C CG  . ASP A 1 95  ? 42.842  16.675  32.905  1.00 50.92  ? 95   ASP A CG  1 
ATOM   750  O OD1 . ASP A 1 95  ? 42.131  15.647  32.847  1.00 51.45  ? 95   ASP A OD1 1 
ATOM   751  O OD2 . ASP A 1 95  ? 43.141  17.221  33.981  1.00 56.91  ? 95   ASP A OD2 1 
ATOM   752  N N   . CYS A 1 96  ? 40.682  15.843  29.637  1.00 46.33  ? 96   CYS A N   1 
ATOM   753  C CA  . CYS A 1 96  ? 39.268  15.945  29.282  1.00 44.92  ? 96   CYS A CA  1 
ATOM   754  C C   . CYS A 1 96  ? 38.445  14.656  29.375  1.00 44.50  ? 96   CYS A C   1 
ATOM   755  O O   . CYS A 1 96  ? 37.266  14.663  29.049  1.00 44.40  ? 96   CYS A O   1 
ATOM   756  C CB  . CYS A 1 96  ? 39.164  16.494  27.863  1.00 44.78  ? 96   CYS A CB  1 
ATOM   757  S SG  . CYS A 1 96  ? 39.724  15.353  26.582  1.00 45.10  ? 96   CYS A SG  1 
ATOM   758  N N   . LEU A 1 97  ? 39.035  13.571  29.857  1.00 44.56  ? 97   LEU A N   1 
ATOM   759  C CA  . LEU A 1 97  ? 38.384  12.274  29.833  1.00 44.01  ? 97   LEU A CA  1 
ATOM   760  C C   . LEU A 1 97  ? 37.527  12.097  31.081  1.00 44.26  ? 97   LEU A C   1 
ATOM   761  O O   . LEU A 1 97  ? 37.920  11.453  32.049  1.00 44.65  ? 97   LEU A O   1 
ATOM   762  C CB  . LEU A 1 97  ? 39.438  11.171  29.650  1.00 44.35  ? 97   LEU A CB  1 
ATOM   763  C CG  . LEU A 1 97  ? 40.079  11.159  28.248  1.00 44.02  ? 97   LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 97  ? 41.058  9.960   28.081  1.00 42.00  ? 97   LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 97  ? 38.978  11.134  27.138  1.00 42.65  ? 97   LEU A CD2 1 
ATOM   766  N N   . TYR A 1 98  ? 36.358  12.736  31.041  1.00 44.08  ? 98   TYR A N   1 
ATOM   767  C CA  . TYR A 1 98  ? 35.403  12.727  32.131  1.00 44.27  ? 98   TYR A CA  1 
ATOM   768  C C   . TYR A 1 98  ? 34.066  12.303  31.564  1.00 43.63  ? 98   TYR A C   1 
ATOM   769  O O   . TYR A 1 98  ? 33.839  12.400  30.368  1.00 42.45  ? 98   TYR A O   1 
ATOM   770  C CB  . TYR A 1 98  ? 35.323  14.125  32.771  1.00 45.15  ? 98   TYR A CB  1 
ATOM   771  C CG  . TYR A 1 98  ? 36.650  14.565  33.366  1.00 45.46  ? 98   TYR A CG  1 
ATOM   772  C CD1 . TYR A 1 98  ? 36.993  14.240  34.678  1.00 46.26  ? 98   TYR A CD1 1 
ATOM   773  C CD2 . TYR A 1 98  ? 37.583  15.235  32.598  1.00 45.79  ? 98   TYR A CD2 1 
ATOM   774  C CE1 . TYR A 1 98  ? 38.213  14.601  35.201  1.00 46.71  ? 98   TYR A CE1 1 
ATOM   775  C CE2 . TYR A 1 98  ? 38.801  15.599  33.113  1.00 46.47  ? 98   TYR A CE2 1 
ATOM   776  C CZ  . TYR A 1 98  ? 39.111  15.281  34.415  1.00 46.89  ? 98   TYR A CZ  1 
ATOM   777  O OH  . TYR A 1 98  ? 40.329  15.645  34.928  1.00 47.53  ? 98   TYR A OH  1 
ATOM   778  N N   . LEU A 1 99  ? 33.204  11.769  32.416  1.00 44.09  ? 99   LEU A N   1 
ATOM   779  C CA  . LEU A 1 99  ? 31.870  11.383  32.003  1.00 43.80  ? 99   LEU A CA  1 
ATOM   780  C C   . LEU A 1 99  ? 30.837  11.915  32.993  1.00 44.31  ? 99   LEU A C   1 
ATOM   781  O O   . LEU A 1 99  ? 31.171  12.341  34.095  1.00 45.27  ? 99   LEU A O   1 
ATOM   782  C CB  . LEU A 1 99  ? 31.766  9.861   31.813  1.00 44.01  ? 99   LEU A CB  1 
ATOM   783  C CG  . LEU A 1 99  ? 32.049  8.859   32.936  1.00 45.28  ? 99   LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 99  ? 30.916  8.805   33.952  1.00 45.31  ? 99   LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 99  ? 32.271  7.454   32.355  1.00 44.18  ? 99   LEU A CD2 1 
ATOM   786  N N   . ASN A 1 100 ? 29.586  11.905  32.557  1.00 44.37  ? 100  ASN A N   1 
ATOM   787  C CA  . ASN A 1 100 ? 28.459  12.457  33.296  1.00 44.35  ? 100  ASN A CA  1 
ATOM   788  C C   . ASN A 1 100 ? 27.368  11.404  33.465  1.00 44.09  ? 100  ASN A C   1 
ATOM   789  O O   . ASN A 1 100 ? 27.090  10.647  32.541  1.00 43.65  ? 100  ASN A O   1 
ATOM   790  C CB  . ASN A 1 100 ? 27.891  13.635  32.516  1.00 43.93  ? 100  ASN A CB  1 
ATOM   791  C CG  . ASN A 1 100 ? 28.958  14.611  32.074  1.00 43.87  ? 100  ASN A CG  1 
ATOM   792  O OD1 . ASN A 1 100 ? 29.671  15.183  32.902  1.00 45.49  ? 100  ASN A OD1 1 
ATOM   793  N ND2 . ASN A 1 100 ? 29.081  14.805  30.760  1.00 43.07  ? 100  ASN A ND2 1 
ATOM   794  N N   . VAL A 1 101 ? 26.728  11.388  34.632  1.00 45.00  ? 101  VAL A N   1 
ATOM   795  C CA  . VAL A 1 101 ? 25.580  10.499  34.907  1.00 44.83  ? 101  VAL A CA  1 
ATOM   796  C C   . VAL A 1 101 ? 24.373  11.309  35.423  1.00 45.90  ? 101  VAL A C   1 
ATOM   797  O O   . VAL A 1 101 ? 24.511  12.117  36.342  1.00 46.07  ? 101  VAL A O   1 
ATOM   798  C CB  . VAL A 1 101 ? 25.945  9.432   35.955  1.00 45.24  ? 101  VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 101 ? 24.766  8.468   36.198  1.00 44.96  ? 101  VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 101 ? 27.201  8.656   35.523  1.00 44.52  ? 101  VAL A CG2 1 
ATOM   801  N N   . TRP A 1 102 ? 23.199  11.088  34.833  1.00 46.00  ? 102  TRP A N   1 
ATOM   802  C CA  . TRP A 1 102 ? 21.941  11.622  35.362  1.00 46.84  ? 102  TRP A CA  1 
ATOM   803  C C   . TRP A 1 102 ? 21.064  10.453  35.737  1.00 47.45  ? 102  TRP A C   1 
ATOM   804  O O   . TRP A 1 102 ? 20.993  9.465   35.010  1.00 46.84  ? 102  TRP A O   1 
ATOM   805  C CB  . TRP A 1 102 ? 21.169  12.414  34.310  1.00 47.31  ? 102  TRP A CB  1 
ATOM   806  C CG  . TRP A 1 102 ? 21.726  13.710  33.927  1.00 46.55  ? 102  TRP A CG  1 
ATOM   807  C CD1 . TRP A 1 102 ? 21.382  14.942  34.420  1.00 47.60  ? 102  TRP A CD1 1 
ATOM   808  C CD2 . TRP A 1 102 ? 22.688  13.935  32.913  1.00 46.26  ? 102  TRP A CD2 1 
ATOM   809  N NE1 . TRP A 1 102 ? 22.108  15.917  33.792  1.00 47.14  ? 102  TRP A NE1 1 
ATOM   810  C CE2 . TRP A 1 102 ? 22.915  15.326  32.855  1.00 46.98  ? 102  TRP A CE2 1 
ATOM   811  C CE3 . TRP A 1 102 ? 23.387  13.097  32.044  1.00 45.75  ? 102  TRP A CE3 1 
ATOM   812  C CZ2 . TRP A 1 102 ? 23.813  15.890  31.962  1.00 46.78  ? 102  TRP A CZ2 1 
ATOM   813  C CZ3 . TRP A 1 102 ? 24.291  13.658  31.176  1.00 45.89  ? 102  TRP A CZ3 1 
ATOM   814  C CH2 . TRP A 1 102 ? 24.496  15.038  31.136  1.00 45.44  ? 102  TRP A CH2 1 
ATOM   815  N N   . THR A 1 103 ? 20.369  10.578  36.855  1.00 48.79  ? 103  THR A N   1 
ATOM   816  C CA  . THR A 1 103 ? 19.446  9.543   37.312  1.00 49.77  ? 103  THR A CA  1 
ATOM   817  C C   . THR A 1 103 ? 18.268  10.238  37.982  1.00 50.63  ? 103  THR A C   1 
ATOM   818  O O   . THR A 1 103 ? 18.346  11.429  38.295  1.00 50.52  ? 103  THR A O   1 
ATOM   819  C CB  . THR A 1 103 ? 20.126  8.578   38.324  1.00 50.56  ? 103  THR A CB  1 
ATOM   820  O OG1 . THR A 1 103 ? 20.075  9.142   39.632  1.00 52.64  ? 103  THR A OG1 1 
ATOM   821  C CG2 . THR A 1 103 ? 21.604  8.337   37.978  1.00 50.61  ? 103  THR A CG2 1 
ATOM   822  N N   . PRO A 1 104 ? 17.154  9.515   38.178  1.00 51.54  ? 104  PRO A N   1 
ATOM   823  C CA  . PRO A 1 104 ? 16.099  10.023  39.036  1.00 53.04  ? 104  PRO A CA  1 
ATOM   824  C C   . PRO A 1 104 ? 16.604  10.446  40.413  1.00 53.99  ? 104  PRO A C   1 
ATOM   825  O O   . PRO A 1 104 ? 17.695  10.042  40.819  1.00 54.29  ? 104  PRO A O   1 
ATOM   826  C CB  . PRO A 1 104 ? 15.151  8.823   39.157  1.00 53.78  ? 104  PRO A CB  1 
ATOM   827  C CG  . PRO A 1 104 ? 15.321  8.117   37.864  1.00 52.83  ? 104  PRO A CG  1 
ATOM   828  C CD  . PRO A 1 104 ? 16.789  8.218   37.584  1.00 51.46  ? 104  PRO A CD  1 
ATOM   829  N N   . TYR A 1 105 ? 15.817  11.279  41.093  1.00 55.04  ? 105  TYR A N   1 
ATOM   830  C CA  . TYR A 1 105 ? 16.069  11.683  42.477  1.00 56.27  ? 105  TYR A CA  1 
ATOM   831  C C   . TYR A 1 105 ? 14.797  11.430  43.277  1.00 58.18  ? 105  TYR A C   1 
ATOM   832  O O   . TYR A 1 105 ? 13.745  11.991  42.946  1.00 58.12  ? 105  TYR A O   1 
ATOM   833  C CB  . TYR A 1 105 ? 16.440  13.166  42.575  1.00 55.56  ? 105  TYR A CB  1 
ATOM   834  C CG  . TYR A 1 105 ? 16.773  13.678  43.982  1.00 56.08  ? 105  TYR A CG  1 
ATOM   835  C CD1 . TYR A 1 105 ? 18.090  13.875  44.377  1.00 55.44  ? 105  TYR A CD1 1 
ATOM   836  C CD2 . TYR A 1 105 ? 15.773  14.001  44.897  1.00 57.38  ? 105  TYR A CD2 1 
ATOM   837  C CE1 . TYR A 1 105 ? 18.407  14.362  45.656  1.00 55.93  ? 105  TYR A CE1 1 
ATOM   838  C CE2 . TYR A 1 105 ? 16.080  14.492  46.181  1.00 57.44  ? 105  TYR A CE2 1 
ATOM   839  C CZ  . TYR A 1 105 ? 17.403  14.675  46.547  1.00 57.77  ? 105  TYR A CZ  1 
ATOM   840  O OH  . TYR A 1 105 ? 17.736  15.164  47.801  1.00 57.56  ? 105  TYR A OH  1 
ATOM   841  N N   . PRO A 1 106 ? 14.884  10.595  44.334  1.00 60.00  ? 106  PRO A N   1 
ATOM   842  C CA  . PRO A 1 106 ? 16.049  9.794   44.706  1.00 60.32  ? 106  PRO A CA  1 
ATOM   843  C C   . PRO A 1 106 ? 16.386  8.755   43.638  1.00 60.51  ? 106  PRO A C   1 
ATOM   844  O O   . PRO A 1 106 ? 15.577  8.506   42.734  1.00 60.02  ? 106  PRO A O   1 
ATOM   845  C CB  . PRO A 1 106 ? 15.624  9.122   46.018  1.00 61.71  ? 106  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 106 ? 14.151  9.197   46.046  1.00 62.50  ? 106  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 106 ? 13.781  10.437  45.298  1.00 61.47  ? 106  PRO A CD  1 
ATOM   848  N N   . ARG A 1 107 ? 17.584  8.181   43.738  1.00 61.16  ? 107  ARG A N   1 
ATOM   849  C CA  . ARG A 1 107 ? 18.067  7.222   42.747  1.00 61.46  ? 107  ARG A CA  1 
ATOM   850  C C   . ARG A 1 107 ? 17.151  6.017   42.733  1.00 62.79  ? 107  ARG A C   1 
ATOM   851  O O   . ARG A 1 107 ? 16.544  5.708   43.743  1.00 64.42  ? 107  ARG A O   1 
ATOM   852  C CB  . ARG A 1 107 ? 19.508  6.800   43.041  1.00 60.95  ? 107  ARG A CB  1 
ATOM   853  C CG  . ARG A 1 107 ? 20.498  7.958   42.936  1.00 60.55  ? 107  ARG A CG  1 
ATOM   854  C CD  . ARG A 1 107 ? 21.938  7.487   42.897  1.00 60.68  ? 107  ARG A CD  1 
ATOM   855  N NE  . ARG A 1 107 ? 22.298  6.694   44.080  1.00 62.21  ? 107  ARG A NE  1 
ATOM   856  C CZ  . ARG A 1 107 ? 22.598  7.210   45.269  1.00 61.85  ? 107  ARG A CZ  1 
ATOM   857  N NH1 . ARG A 1 107 ? 22.615  8.518   45.446  1.00 60.49  ? 107  ARG A NH1 1 
ATOM   858  N NH2 . ARG A 1 107 ? 22.905  6.402   46.279  1.00 63.41  ? 107  ARG A NH2 1 
ATOM   859  N N   . PRO A 1 108 ? 17.023  5.346   41.578  1.00 63.50  ? 108  PRO A N   1 
ATOM   860  C CA  . PRO A 1 108 ? 16.097  4.215   41.497  1.00 64.90  ? 108  PRO A CA  1 
ATOM   861  C C   . PRO A 1 108 ? 16.472  3.094   42.469  1.00 66.44  ? 108  PRO A C   1 
ATOM   862  O O   . PRO A 1 108 ? 17.656  2.901   42.762  1.00 66.46  ? 108  PRO A O   1 
ATOM   863  C CB  . PRO A 1 108 ? 16.254  3.730   40.050  1.00 64.03  ? 108  PRO A CB  1 
ATOM   864  C CG  . PRO A 1 108 ? 16.867  4.835   39.319  1.00 62.58  ? 108  PRO A CG  1 
ATOM   865  C CD  . PRO A 1 108 ? 17.710  5.582   40.297  1.00 62.30  ? 108  PRO A CD  1 
ATOM   866  N N   . ALA A 1 109 ? 15.474  2.358   42.941  1.00 68.13  ? 109  ALA A N   1 
ATOM   867  C CA  . ALA A 1 109 ? 15.695  1.302   43.924  1.00 69.82  ? 109  ALA A CA  1 
ATOM   868  C C   . ALA A 1 109 ? 15.872  -0.079  43.269  1.00 70.25  ? 109  ALA A C   1 
ATOM   869  O O   . ALA A 1 109 ? 16.496  -0.968  43.860  1.00 71.53  ? 109  ALA A O   1 
ATOM   870  C CB  . ALA A 1 109 ? 14.543  1.274   44.927  1.00 71.42  ? 109  ALA A CB  1 
ATOM   871  N N   . SER A 1 110 ? 15.307  -0.262  42.072  1.00 69.49  ? 110  SER A N   1 
ATOM   872  C CA  . SER A 1 110 ? 15.538  -1.470  41.283  1.00 68.51  ? 110  SER A CA  1 
ATOM   873  C C   . SER A 1 110 ? 16.347  -1.114  40.025  1.00 66.69  ? 110  SER A C   1 
ATOM   874  O O   . SER A 1 110 ? 16.347  0.053   39.596  1.00 65.89  ? 110  SER A O   1 
ATOM   875  C CB  . SER A 1 110 ? 14.207  -2.109  40.907  1.00 69.84  ? 110  SER A CB  1 
ATOM   876  O OG  . SER A 1 110 ? 13.514  -1.278  40.010  1.00 70.43  ? 110  SER A OG  1 
ATOM   877  N N   . PRO A 1 111 ? 17.052  -2.107  39.438  1.00 65.22  ? 111  PRO A N   1 
ATOM   878  C CA  . PRO A 1 111 ? 17.961  -1.843  38.313  1.00 63.36  ? 111  PRO A CA  1 
ATOM   879  C C   . PRO A 1 111 ? 17.272  -1.230  37.084  1.00 61.21  ? 111  PRO A C   1 
ATOM   880  O O   . PRO A 1 111 ? 16.285  -1.767  36.589  1.00 61.51  ? 111  PRO A O   1 
ATOM   881  C CB  . PRO A 1 111 ? 18.535  -3.228  37.986  1.00 63.57  ? 111  PRO A CB  1 
ATOM   882  C CG  . PRO A 1 111 ? 18.343  -4.023  39.220  1.00 65.22  ? 111  PRO A CG  1 
ATOM   883  C CD  . PRO A 1 111 ? 17.055  -3.535  39.804  1.00 66.24  ? 111  PRO A CD  1 
ATOM   884  N N   . THR A 1 112 ? 17.817  -0.120  36.599  1.00 58.68  ? 112  THR A N   1 
ATOM   885  C CA  . THR A 1 112 ? 17.151  0.702   35.595  1.00 57.30  ? 112  THR A CA  1 
ATOM   886  C C   . THR A 1 112 ? 17.931  0.710   34.287  1.00 55.57  ? 112  THR A C   1 
ATOM   887  O O   . THR A 1 112 ? 19.149  0.876   34.296  1.00 54.77  ? 112  THR A O   1 
ATOM   888  C CB  . THR A 1 112 ? 17.013  2.125   36.118  1.00 56.88  ? 112  THR A CB  1 
ATOM   889  O OG1 . THR A 1 112 ? 16.320  2.079   37.372  1.00 58.59  ? 112  THR A OG1 1 
ATOM   890  C CG2 . THR A 1 112 ? 16.262  3.020   35.125  1.00 56.06  ? 112  THR A CG2 1 
ATOM   891  N N   . PRO A 1 113 ? 17.242  0.499   33.154  1.00 54.92  ? 113  PRO A N   1 
ATOM   892  C CA  . PRO A 1 113 ? 17.924  0.530   31.861  1.00 53.71  ? 113  PRO A CA  1 
ATOM   893  C C   . PRO A 1 113 ? 18.757  1.811   31.646  1.00 52.39  ? 113  PRO A C   1 
ATOM   894  O O   . PRO A 1 113 ? 18.318  2.917   31.994  1.00 51.74  ? 113  PRO A O   1 
ATOM   895  C CB  . PRO A 1 113 ? 16.774  0.448   30.859  1.00 53.97  ? 113  PRO A CB  1 
ATOM   896  C CG  . PRO A 1 113 ? 15.702  -0.267  31.582  1.00 55.62  ? 113  PRO A CG  1 
ATOM   897  C CD  . PRO A 1 113 ? 15.811  0.178   33.005  1.00 55.99  ? 113  PRO A CD  1 
ATOM   898  N N   . VAL A 1 114 ? 19.950  1.633   31.087  1.00 51.09  ? 114  VAL A N   1 
ATOM   899  C CA  . VAL A 1 114 ? 20.895  2.713   30.895  1.00 50.07  ? 114  VAL A CA  1 
ATOM   900  C C   . VAL A 1 114 ? 21.013  3.135   29.422  1.00 49.23  ? 114  VAL A C   1 
ATOM   901  O O   . VAL A 1 114 ? 21.059  2.290   28.528  1.00 49.12  ? 114  VAL A O   1 
ATOM   902  C CB  . VAL A 1 114 ? 22.276  2.271   31.388  1.00 50.17  ? 114  VAL A CB  1 
ATOM   903  C CG1 . VAL A 1 114 ? 23.297  3.402   31.193  1.00 48.40  ? 114  VAL A CG1 1 
ATOM   904  C CG2 . VAL A 1 114 ? 22.183  1.821   32.841  1.00 49.39  ? 114  VAL A CG2 1 
ATOM   905  N N   . LEU A 1 115 ? 21.055  4.441   29.188  1.00 48.24  ? 115  LEU A N   1 
ATOM   906  C CA  . LEU A 1 115 ? 21.274  5.002   27.864  1.00 47.83  ? 115  LEU A CA  1 
ATOM   907  C C   . LEU A 1 115 ? 22.619  5.702   27.903  1.00 46.44  ? 115  LEU A C   1 
ATOM   908  O O   . LEU A 1 115 ? 22.877  6.470   28.820  1.00 46.34  ? 115  LEU A O   1 
ATOM   909  C CB  . LEU A 1 115 ? 20.197  6.029   27.510  1.00 48.22  ? 115  LEU A CB  1 
ATOM   910  C CG  . LEU A 1 115 ? 18.849  5.572   26.934  1.00 51.29  ? 115  LEU A CG  1 
ATOM   911  C CD1 . LEU A 1 115 ? 17.863  6.753   26.930  1.00 53.88  ? 115  LEU A CD1 1 
ATOM   912  C CD2 . LEU A 1 115 ? 19.010  5.065   25.512  1.00 53.49  ? 115  LEU A CD2 1 
ATOM   913  N N   . ILE A 1 116 ? 23.480  5.411   26.933  1.00 45.42  ? 116  ILE A N   1 
ATOM   914  C CA  . ILE A 1 116 ? 24.780  6.063   26.830  1.00 44.02  ? 116  ILE A CA  1 
ATOM   915  C C   . ILE A 1 116 ? 24.872  6.900   25.560  1.00 43.33  ? 116  ILE A C   1 
ATOM   916  O O   . ILE A 1 116 ? 24.744  6.363   24.453  1.00 43.05  ? 116  ILE A O   1 
ATOM   917  C CB  . ILE A 1 116 ? 25.929  5.038   26.820  1.00 44.12  ? 116  ILE A CB  1 
ATOM   918  C CG1 . ILE A 1 116 ? 25.873  4.147   28.062  1.00 43.85  ? 116  ILE A CG1 1 
ATOM   919  C CG2 . ILE A 1 116 ? 27.247  5.772   26.757  1.00 41.84  ? 116  ILE A CG2 1 
ATOM   920  C CD1 . ILE A 1 116 ? 26.962  3.072   28.108  1.00 44.48  ? 116  ILE A CD1 1 
ATOM   921  N N   . TRP A 1 117 ? 25.105  8.205   25.724  1.00 43.16  ? 117  TRP A N   1 
ATOM   922  C CA  . TRP A 1 117 ? 25.178  9.134   24.604  1.00 42.28  ? 117  TRP A CA  1 
ATOM   923  C C   . TRP A 1 117 ? 26.599  9.305   24.124  1.00 42.25  ? 117  TRP A C   1 
ATOM   924  O O   . TRP A 1 117 ? 27.510  9.555   24.915  1.00 41.83  ? 117  TRP A O   1 
ATOM   925  C CB  . TRP A 1 117 ? 24.615  10.502  24.986  1.00 42.73  ? 117  TRP A CB  1 
ATOM   926  C CG  . TRP A 1 117 ? 24.729  11.566  23.901  1.00 42.23  ? 117  TRP A CG  1 
ATOM   927  C CD1 . TRP A 1 117 ? 25.556  12.668  23.901  1.00 43.22  ? 117  TRP A CD1 1 
ATOM   928  C CD2 . TRP A 1 117 ? 23.988  11.628  22.680  1.00 42.23  ? 117  TRP A CD2 1 
ATOM   929  N NE1 . TRP A 1 117 ? 25.370  13.398  22.753  1.00 43.01  ? 117  TRP A NE1 1 
ATOM   930  C CE2 . TRP A 1 117 ? 24.413  12.775  21.987  1.00 43.18  ? 117  TRP A CE2 1 
ATOM   931  C CE3 . TRP A 1 117 ? 23.008  10.813  22.099  1.00 43.75  ? 117  TRP A CE3 1 
ATOM   932  C CZ2 . TRP A 1 117 ? 23.879  13.138  20.755  1.00 42.43  ? 117  TRP A CZ2 1 
ATOM   933  C CZ3 . TRP A 1 117 ? 22.484  11.177  20.871  1.00 43.17  ? 117  TRP A CZ3 1 
ATOM   934  C CH2 . TRP A 1 117 ? 22.922  12.325  20.216  1.00 42.30  ? 117  TRP A CH2 1 
ATOM   935  N N   . ILE A 1 118 ? 26.779  9.213   22.809  1.00 41.82  ? 118  ILE A N   1 
ATOM   936  C CA  . ILE A 1 118 ? 28.058  9.521   22.201  1.00 40.93  ? 118  ILE A CA  1 
ATOM   937  C C   . ILE A 1 118 ? 27.845  10.661  21.215  1.00 40.82  ? 118  ILE A C   1 
ATOM   938  O O   . ILE A 1 118 ? 27.203  10.488  20.187  1.00 40.38  ? 118  ILE A O   1 
ATOM   939  C CB  . ILE A 1 118 ? 28.651  8.314   21.464  1.00 40.83  ? 118  ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 118 ? 28.640  7.067   22.377  1.00 41.23  ? 118  ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 118 ? 30.026  8.669   20.965  1.00 40.94  ? 118  ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 118 ? 29.257  5.821   21.770  1.00 40.69  ? 118  ILE A CD1 1 
ATOM   943  N N   . TYR A 1 119 ? 28.376  11.832  21.546  1.00 41.41  ? 119  TYR A N   1 
ATOM   944  C CA  . TYR A 1 119 ? 28.239  12.996  20.703  1.00 41.51  ? 119  TYR A CA  1 
ATOM   945  C C   . TYR A 1 119 ? 28.962  12.881  19.366  1.00 41.73  ? 119  TYR A C   1 
ATOM   946  O O   . TYR A 1 119 ? 29.913  12.101  19.197  1.00 41.44  ? 119  TYR A O   1 
ATOM   947  C CB  . TYR A 1 119 ? 28.701  14.271  21.421  1.00 41.91  ? 119  TYR A CB  1 
ATOM   948  C CG  . TYR A 1 119 ? 30.151  14.302  21.858  1.00 42.03  ? 119  TYR A CG  1 
ATOM   949  C CD1 . TYR A 1 119 ? 31.177  14.526  20.945  1.00 42.13  ? 119  TYR A CD1 1 
ATOM   950  C CD2 . TYR A 1 119 ? 30.488  14.162  23.197  1.00 42.22  ? 119  TYR A CD2 1 
ATOM   951  C CE1 . TYR A 1 119 ? 32.513  14.582  21.358  1.00 43.99  ? 119  TYR A CE1 1 
ATOM   952  C CE2 . TYR A 1 119 ? 31.799  14.200  23.619  1.00 43.94  ? 119  TYR A CE2 1 
ATOM   953  C CZ  . TYR A 1 119 ? 32.824  14.414  22.700  1.00 44.04  ? 119  TYR A CZ  1 
ATOM   954  O OH  . TYR A 1 119 ? 34.139  14.450  23.122  1.00 43.03  ? 119  TYR A OH  1 
ATOM   955  N N   . GLY A 1 120 ? 28.468  13.686  18.426  1.00 42.09  ? 120  GLY A N   1 
ATOM   956  C CA  . GLY A 1 120 ? 29.081  13.904  17.117  1.00 42.36  ? 120  GLY A CA  1 
ATOM   957  C C   . GLY A 1 120 ? 29.807  15.233  17.044  1.00 42.18  ? 120  GLY A C   1 
ATOM   958  O O   . GLY A 1 120 ? 30.000  15.905  18.059  1.00 43.21  ? 120  GLY A O   1 
ATOM   959  N N   . GLY A 1 121 ? 30.152  15.630  15.823  1.00 42.15  ? 121  GLY A N   1 
ATOM   960  C CA  . GLY A 1 121 ? 31.099  16.721  15.559  1.00 42.12  ? 121  GLY A CA  1 
ATOM   961  C C   . GLY A 1 121 ? 32.260  16.342  14.647  1.00 41.89  ? 121  GLY A C   1 
ATOM   962  O O   . GLY A 1 121 ? 33.374  16.885  14.779  1.00 42.03  ? 121  GLY A O   1 
ATOM   963  N N   . GLY A 1 122 ? 32.018  15.393  13.742  1.00 41.25  ? 122  GLY A N   1 
ATOM   964  C CA  . GLY A 1 122 ? 32.943  15.063  12.664  1.00 41.29  ? 122  GLY A CA  1 
ATOM   965  C C   . GLY A 1 122 ? 34.217  14.387  13.118  1.00 41.77  ? 122  GLY A C   1 
ATOM   966  O O   . GLY A 1 122 ? 35.200  14.346  12.373  1.00 41.79  ? 122  GLY A O   1 
ATOM   967  N N   . PHE A 1 123 ? 34.190  13.858  14.345  1.00 41.60  ? 123  PHE A N   1 
ATOM   968  C CA  . PHE A 1 123 ? 35.358  13.335  15.017  1.00 41.61  ? 123  PHE A CA  1 
ATOM   969  C C   . PHE A 1 123 ? 36.435  14.406  15.302  1.00 41.65  ? 123  PHE A C   1 
ATOM   970  O O   . PHE A 1 123 ? 37.517  14.059  15.744  1.00 42.05  ? 123  PHE A O   1 
ATOM   971  C CB  . PHE A 1 123 ? 35.966  12.168  14.229  1.00 41.86  ? 123  PHE A CB  1 
ATOM   972  C CG  . PHE A 1 123 ? 35.129  10.914  14.216  1.00 41.80  ? 123  PHE A CG  1 
ATOM   973  C CD1 . PHE A 1 123 ? 34.971  10.157  15.365  1.00 42.56  ? 123  PHE A CD1 1 
ATOM   974  C CD2 . PHE A 1 123 ? 34.530  10.473  13.043  1.00 42.52  ? 123  PHE A CD2 1 
ATOM   975  C CE1 . PHE A 1 123 ? 34.221  8.983   15.362  1.00 42.31  ? 123  PHE A CE1 1 
ATOM   976  C CE2 . PHE A 1 123 ? 33.785  9.288   13.019  1.00 43.91  ? 123  PHE A CE2 1 
ATOM   977  C CZ  . PHE A 1 123 ? 33.640  8.535   14.185  1.00 43.25  ? 123  PHE A CZ  1 
ATOM   978  N N   . TYR A 1 124 ? 36.129  15.685  15.062  1.00 41.87  ? 124  TYR A N   1 
ATOM   979  C CA  . TYR A 1 124 ? 37.042  16.808  15.335  1.00 42.06  ? 124  TYR A CA  1 
ATOM   980  C C   . TYR A 1 124 ? 36.523  17.753  16.429  1.00 42.20  ? 124  TYR A C   1 
ATOM   981  O O   . TYR A 1 124 ? 37.230  18.685  16.846  1.00 41.38  ? 124  TYR A O   1 
ATOM   982  C CB  . TYR A 1 124 ? 37.339  17.614  14.043  1.00 43.28  ? 124  TYR A CB  1 
ATOM   983  C CG  . TYR A 1 124 ? 36.198  18.505  13.589  1.00 43.37  ? 124  TYR A CG  1 
ATOM   984  C CD1 . TYR A 1 124 ? 36.063  19.806  14.061  1.00 45.64  ? 124  TYR A CD1 1 
ATOM   985  C CD2 . TYR A 1 124 ? 35.267  18.046  12.682  1.00 44.92  ? 124  TYR A CD2 1 
ATOM   986  C CE1 . TYR A 1 124 ? 34.994  20.611  13.645  1.00 45.01  ? 124  TYR A CE1 1 
ATOM   987  C CE2 . TYR A 1 124 ? 34.225  18.829  12.268  1.00 44.94  ? 124  TYR A CE2 1 
ATOM   988  C CZ  . TYR A 1 124 ? 34.087  20.104  12.756  1.00 44.04  ? 124  TYR A CZ  1 
ATOM   989  O OH  . TYR A 1 124 ? 33.022  20.850  12.317  1.00 46.05  ? 124  TYR A OH  1 
ATOM   990  N N   . SER A 1 125 ? 35.298  17.513  16.908  1.00 41.68  ? 125  SER A N   1 
ATOM   991  C CA  . SER A 1 125 ? 34.677  18.416  17.853  1.00 41.56  ? 125  SER A CA  1 
ATOM   992  C C   . SER A 1 125 ? 33.584  17.729  18.672  1.00 41.05  ? 125  SER A C   1 
ATOM   993  O O   . SER A 1 125 ? 33.208  16.568  18.418  1.00 40.95  ? 125  SER A O   1 
ATOM   994  C CB  . SER A 1 125 ? 34.082  19.609  17.089  1.00 41.47  ? 125  SER A CB  1 
ATOM   995  O OG  . SER A 1 125 ? 33.080  19.171  16.165  1.00 40.22  ? 125  SER A OG  1 
ATOM   996  N N   . GLY A 1 126 ? 33.057  18.480  19.629  1.00 41.25  ? 126  GLY A N   1 
ATOM   997  C CA  . GLY A 1 126 ? 31.916  18.055  20.434  1.00 41.98  ? 126  GLY A CA  1 
ATOM   998  C C   . GLY A 1 126 ? 32.282  17.931  21.897  1.00 42.83  ? 126  GLY A C   1 
ATOM   999  O O   . GLY A 1 126 ? 33.471  17.941  22.262  1.00 43.79  ? 126  GLY A O   1 
ATOM   1000 N N   . ALA A 1 127 ? 31.254  17.798  22.726  1.00 42.91  ? 127  ALA A N   1 
ATOM   1001 C CA  . ALA A 1 127 ? 31.392  17.764  24.181  1.00 43.44  ? 127  ALA A CA  1 
ATOM   1002 C C   . ALA A 1 127 ? 30.119  17.150  24.752  1.00 43.75  ? 127  ALA A C   1 
ATOM   1003 O O   . ALA A 1 127 ? 29.028  17.381  24.230  1.00 43.81  ? 127  ALA A O   1 
ATOM   1004 C CB  . ALA A 1 127 ? 31.601  19.175  24.741  1.00 43.46  ? 127  ALA A CB  1 
ATOM   1005 N N   . ALA A 1 128 ? 30.252  16.374  25.820  1.00 43.95  ? 128  ALA A N   1 
ATOM   1006 C CA  . ALA A 1 128 ? 29.084  15.790  26.475  1.00 44.43  ? 128  ALA A CA  1 
ATOM   1007 C C   . ALA A 1 128 ? 28.336  16.838  27.316  1.00 45.04  ? 128  ALA A C   1 
ATOM   1008 O O   . ALA A 1 128 ? 27.261  16.552  27.834  1.00 45.78  ? 128  ALA A O   1 
ATOM   1009 C CB  . ALA A 1 128 ? 29.500  14.593  27.337  1.00 43.96  ? 128  ALA A CB  1 
ATOM   1010 N N   . SER A 1 129 ? 28.905  18.043  27.440  1.00 44.95  ? 129  SER A N   1 
ATOM   1011 C CA  . SER A 1 129 ? 28.376  19.091  28.310  1.00 45.58  ? 129  SER A CA  1 
ATOM   1012 C C   . SER A 1 129 ? 27.456  20.114  27.622  1.00 45.92  ? 129  SER A C   1 
ATOM   1013 O O   . SER A 1 129 ? 26.962  21.039  28.267  1.00 46.69  ? 129  SER A O   1 
ATOM   1014 C CB  . SER A 1 129 ? 29.536  19.824  29.010  1.00 46.12  ? 129  SER A CB  1 
ATOM   1015 O OG  . SER A 1 129 ? 30.470  20.391  28.085  1.00 45.03  ? 129  SER A OG  1 
ATOM   1016 N N   . LEU A 1 130 ? 27.191  19.939  26.330  1.00 45.58  ? 130  LEU A N   1 
ATOM   1017 C CA  . LEU A 1 130 ? 26.356  20.878  25.596  1.00 44.83  ? 130  LEU A CA  1 
ATOM   1018 C C   . LEU A 1 130 ? 24.921  20.796  26.073  1.00 45.57  ? 130  LEU A C   1 
ATOM   1019 O O   . LEU A 1 130 ? 24.444  19.728  26.469  1.00 44.53  ? 130  LEU A O   1 
ATOM   1020 C CB  . LEU A 1 130 ? 26.398  20.604  24.093  1.00 44.32  ? 130  LEU A CB  1 
ATOM   1021 C CG  . LEU A 1 130 ? 27.765  20.560  23.387  1.00 43.60  ? 130  LEU A CG  1 
ATOM   1022 C CD1 . LEU A 1 130 ? 27.527  20.342  21.909  1.00 40.23  ? 130  LEU A CD1 1 
ATOM   1023 C CD2 . LEU A 1 130 ? 28.606  21.824  23.650  1.00 41.55  ? 130  LEU A CD2 1 
ATOM   1024 N N   . ASP A 1 131 ? 24.238  21.936  26.015  1.00 45.86  ? 131  ASP A N   1 
ATOM   1025 C CA  . ASP A 1 131 ? 22.874  22.059  26.502  1.00 47.01  ? 131  ASP A CA  1 
ATOM   1026 C C   . ASP A 1 131 ? 21.919  21.079  25.850  1.00 46.75  ? 131  ASP A C   1 
ATOM   1027 O O   . ASP A 1 131 ? 20.996  20.618  26.515  1.00 47.51  ? 131  ASP A O   1 
ATOM   1028 C CB  . ASP A 1 131 ? 22.323  23.473  26.280  1.00 47.72  ? 131  ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 131 ? 22.902  24.494  27.235  1.00 49.05  ? 131  ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 131 ? 23.660  24.145  28.163  1.00 51.21  ? 131  ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 131 ? 22.577  25.680  27.065  1.00 54.61  ? 131  ASP A OD2 1 
ATOM   1032 N N   . VAL A 1 132 ? 22.125  20.770  24.567  1.00 46.22  ? 132  VAL A N   1 
ATOM   1033 C CA  . VAL A 1 132 ? 21.222  19.851  23.847  1.00 45.95  ? 132  VAL A CA  1 
ATOM   1034 C C   . VAL A 1 132 ? 21.403  18.397  24.240  1.00 45.14  ? 132  VAL A C   1 
ATOM   1035 O O   . VAL A 1 132 ? 20.582  17.566  23.855  1.00 45.74  ? 132  VAL A O   1 
ATOM   1036 C CB  . VAL A 1 132 ? 21.321  19.966  22.290  1.00 45.82  ? 132  VAL A CB  1 
ATOM   1037 C CG1 . VAL A 1 132 ? 20.670  21.265  21.823  1.00 47.54  ? 132  VAL A CG1 1 
ATOM   1038 C CG2 . VAL A 1 132 ? 22.756  19.873  21.816  1.00 45.04  ? 132  VAL A CG2 1 
ATOM   1039 N N   . TYR A 1 133 ? 22.463  18.084  24.993  1.00 44.95  ? 133  TYR A N   1 
ATOM   1040 C CA  . TYR A 1 133 ? 22.714  16.709  25.466  1.00 44.69  ? 133  TYR A CA  1 
ATOM   1041 C C   . TYR A 1 133 ? 22.364  16.555  26.961  1.00 45.67  ? 133  TYR A C   1 
ATOM   1042 O O   . TYR A 1 133 ? 22.766  15.578  27.615  1.00 45.18  ? 133  TYR A O   1 
ATOM   1043 C CB  . TYR A 1 133 ? 24.165  16.280  25.211  1.00 44.04  ? 133  TYR A CB  1 
ATOM   1044 C CG  . TYR A 1 133 ? 24.712  16.495  23.803  1.00 43.43  ? 133  TYR A CG  1 
ATOM   1045 C CD1 . TYR A 1 133 ? 23.923  16.305  22.677  1.00 44.18  ? 133  TYR A CD1 1 
ATOM   1046 C CD2 . TYR A 1 133 ? 26.043  16.849  23.600  1.00 43.80  ? 133  TYR A CD2 1 
ATOM   1047 C CE1 . TYR A 1 133 ? 24.431  16.497  21.388  1.00 42.52  ? 133  TYR A CE1 1 
ATOM   1048 C CE2 . TYR A 1 133 ? 26.561  17.025  22.308  1.00 43.37  ? 133  TYR A CE2 1 
ATOM   1049 C CZ  . TYR A 1 133 ? 25.742  16.843  21.206  1.00 42.99  ? 133  TYR A CZ  1 
ATOM   1050 O OH  . TYR A 1 133 ? 26.225  17.020  19.915  1.00 41.73  ? 133  TYR A OH  1 
ATOM   1051 N N   . ASP A 1 134 ? 21.570  17.498  27.473  1.00 46.26  ? 134  ASP A N   1 
ATOM   1052 C CA  . ASP A 1 134 ? 21.175  17.549  28.879  1.00 47.13  ? 134  ASP A CA  1 
ATOM   1053 C C   . ASP A 1 134 ? 20.243  16.396  29.240  1.00 47.44  ? 134  ASP A C   1 
ATOM   1054 O O   . ASP A 1 134 ? 19.073  16.361  28.820  1.00 48.10  ? 134  ASP A O   1 
ATOM   1055 C CB  . ASP A 1 134 ? 20.495  18.897  29.154  1.00 47.73  ? 134  ASP A CB  1 
ATOM   1056 C CG  . ASP A 1 134 ? 20.084  19.086  30.599  1.00 49.03  ? 134  ASP A CG  1 
ATOM   1057 O OD1 . ASP A 1 134 ? 20.141  18.144  31.429  1.00 50.57  ? 134  ASP A OD1 1 
ATOM   1058 O OD2 . ASP A 1 134 ? 19.676  20.218  30.903  1.00 52.08  ? 134  ASP A OD2 1 
ATOM   1059 N N   . GLY A 1 135 ? 20.752  15.487  30.070  1.00 47.17  ? 135  GLY A N   1 
ATOM   1060 C CA  . GLY A 1 135 ? 20.036  14.273  30.438  1.00 47.46  ? 135  GLY A CA  1 
ATOM   1061 C C   . GLY A 1 135 ? 18.924  14.395  31.460  1.00 48.34  ? 135  GLY A C   1 
ATOM   1062 O O   . GLY A 1 135 ? 18.288  13.404  31.776  1.00 48.94  ? 135  GLY A O   1 
ATOM   1063 N N   . ARG A 1 136 ? 18.658  15.595  31.973  1.00 48.84  ? 136  ARG A N   1 
ATOM   1064 C CA  . ARG A 1 136 ? 17.711  15.730  33.087  1.00 50.05  ? 136  ARG A CA  1 
ATOM   1065 C C   . ARG A 1 136 ? 16.259  15.386  32.725  1.00 50.45  ? 136  ARG A C   1 
ATOM   1066 O O   . ARG A 1 136 ? 15.524  14.857  33.573  1.00 50.93  ? 136  ARG A O   1 
ATOM   1067 C CB  . ARG A 1 136 ? 17.804  17.118  33.744  1.00 50.45  ? 136  ARG A CB  1 
ATOM   1068 C CG  . ARG A 1 136 ? 17.180  18.261  32.977  1.00 51.67  ? 136  ARG A CG  1 
ATOM   1069 C CD  . ARG A 1 136 ? 17.326  19.598  33.726  1.00 53.02  ? 136  ARG A CD  1 
ATOM   1070 N NE  . ARG A 1 136 ? 18.704  20.074  33.675  1.00 54.44  ? 136  ARG A NE  1 
ATOM   1071 C CZ  . ARG A 1 136 ? 19.246  21.008  34.464  1.00 56.06  ? 136  ARG A CZ  1 
ATOM   1072 N NH1 . ARG A 1 136 ? 20.527  21.332  34.289  1.00 55.64  ? 136  ARG A NH1 1 
ATOM   1073 N NH2 . ARG A 1 136 ? 18.544  21.613  35.419  1.00 56.40  ? 136  ARG A NH2 1 
ATOM   1074 N N   . PHE A 1 137 ? 15.850  15.662  31.482  1.00 49.98  ? 137  PHE A N   1 
ATOM   1075 C CA  . PHE A 1 137 ? 14.464  15.420  31.065  1.00 50.28  ? 137  PHE A CA  1 
ATOM   1076 C C   . PHE A 1 137 ? 14.206  13.921  30.885  1.00 50.48  ? 137  PHE A C   1 
ATOM   1077 O O   . PHE A 1 137 ? 13.186  13.396  31.325  1.00 51.19  ? 137  PHE A O   1 
ATOM   1078 C CB  . PHE A 1 137 ? 14.131  16.173  29.778  1.00 49.87  ? 137  PHE A CB  1 
ATOM   1079 C CG  . PHE A 1 137 ? 14.529  17.618  29.808  1.00 49.91  ? 137  PHE A CG  1 
ATOM   1080 C CD1 . PHE A 1 137 ? 13.718  18.560  30.426  1.00 51.35  ? 137  PHE A CD1 1 
ATOM   1081 C CD2 . PHE A 1 137 ? 15.730  18.034  29.242  1.00 48.63  ? 137  PHE A CD2 1 
ATOM   1082 C CE1 . PHE A 1 137 ? 14.095  19.903  30.473  1.00 51.40  ? 137  PHE A CE1 1 
ATOM   1083 C CE2 . PHE A 1 137 ? 16.117  19.362  29.287  1.00 49.55  ? 137  PHE A CE2 1 
ATOM   1084 C CZ  . PHE A 1 137 ? 15.291  20.306  29.902  1.00 49.50  ? 137  PHE A CZ  1 
ATOM   1085 N N   . LEU A 1 138 ? 15.128  13.226  30.236  1.00 49.68  ? 138  LEU A N   1 
ATOM   1086 C CA  . LEU A 1 138 ? 14.994  11.783  30.111  1.00 49.92  ? 138  LEU A CA  1 
ATOM   1087 C C   . LEU A 1 138 ? 14.979  11.099  31.479  1.00 50.24  ? 138  LEU A C   1 
ATOM   1088 O O   . LEU A 1 138 ? 14.174  10.214  31.716  1.00 51.03  ? 138  LEU A O   1 
ATOM   1089 C CB  . LEU A 1 138 ? 16.096  11.216  29.219  1.00 49.24  ? 138  LEU A CB  1 
ATOM   1090 C CG  . LEU A 1 138 ? 15.843  11.429  27.724  1.00 48.72  ? 138  LEU A CG  1 
ATOM   1091 C CD1 . LEU A 1 138 ? 17.158  11.300  26.911  1.00 47.11  ? 138  LEU A CD1 1 
ATOM   1092 C CD2 . LEU A 1 138 ? 14.767  10.455  27.231  1.00 48.41  ? 138  LEU A CD2 1 
ATOM   1093 N N   . ALA A 1 139 ? 15.853  11.522  32.380  1.00 50.30  ? 139  ALA A N   1 
ATOM   1094 C CA  . ALA A 1 139 ? 15.913  10.941  33.728  1.00 51.03  ? 139  ALA A CA  1 
ATOM   1095 C C   . ALA A 1 139 ? 14.633  11.221  34.529  1.00 52.35  ? 139  ALA A C   1 
ATOM   1096 O O   . ALA A 1 139 ? 14.057  10.319  35.138  1.00 53.11  ? 139  ALA A O   1 
ATOM   1097 C CB  . ALA A 1 139 ? 17.120  11.465  34.473  1.00 50.20  ? 139  ALA A CB  1 
ATOM   1098 N N   . GLN A 1 140 ? 14.182  12.470  34.511  1.00 52.52  ? 140  GLN A N   1 
ATOM   1099 C CA  . GLN A 1 140 ? 13.012  12.856  35.290  1.00 53.84  ? 140  GLN A CA  1 
ATOM   1100 C C   . GLN A 1 140 ? 11.740  12.244  34.712  1.00 54.51  ? 140  GLN A C   1 
ATOM   1101 O O   . GLN A 1 140 ? 10.988  11.586  35.437  1.00 55.77  ? 140  GLN A O   1 
ATOM   1102 C CB  . GLN A 1 140 ? 12.887  14.379  35.371  1.00 53.86  ? 140  GLN A CB  1 
ATOM   1103 C CG  . GLN A 1 140 ? 12.130  14.868  36.591  1.00 55.25  ? 140  GLN A CG  1 
ATOM   1104 C CD  . GLN A 1 140 ? 10.641  14.613  36.498  1.00 56.91  ? 140  GLN A CD  1 
ATOM   1105 O OE1 . GLN A 1 140 ? 10.054  14.739  35.423  1.00 57.85  ? 140  GLN A OE1 1 
ATOM   1106 N NE2 . GLN A 1 140 ? 10.015  14.258  37.632  1.00 57.03  ? 140  GLN A NE2 1 
ATOM   1107 N N   . VAL A 1 141 ? 11.506  12.449  33.417  1.00 53.82  ? 141  VAL A N   1 
ATOM   1108 C CA  . VAL A 1 141 ? 10.244  12.051  32.804  1.00 54.47  ? 141  VAL A CA  1 
ATOM   1109 C C   . VAL A 1 141 ? 10.192  10.551  32.539  1.00 54.58  ? 141  VAL A C   1 
ATOM   1110 O O   . VAL A 1 141 ? 9.179   9.929   32.794  1.00 55.83  ? 141  VAL A O   1 
ATOM   1111 C CB  . VAL A 1 141 ? 9.955   12.836  31.487  1.00 54.50  ? 141  VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 141 ? 8.638   12.378  30.842  1.00 55.04  ? 141  VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 141 ? 9.909   14.335  31.756  1.00 54.44  ? 141  VAL A CG2 1 
ATOM   1114 N N   . GLU A 1 142 ? 11.267  9.963   32.021  1.00 53.87  ? 142  GLU A N   1 
ATOM   1115 C CA  . GLU A 1 142 ? 11.252  8.523   31.710  1.00 53.96  ? 142  GLU A CA  1 
ATOM   1116 C C   . GLU A 1 142 ? 11.932  7.638   32.754  1.00 53.56  ? 142  GLU A C   1 
ATOM   1117 O O   . GLU A 1 142 ? 11.869  6.415   32.657  1.00 53.61  ? 142  GLU A O   1 
ATOM   1118 C CB  . GLU A 1 142 ? 11.851  8.269   30.328  1.00 53.25  ? 142  GLU A CB  1 
ATOM   1119 C CG  . GLU A 1 142 ? 11.032  8.883   29.194  1.00 54.59  ? 142  GLU A CG  1 
ATOM   1120 C CD  . GLU A 1 142 ? 9.643   8.252   29.027  1.00 58.09  ? 142  GLU A CD  1 
ATOM   1121 O OE1 . GLU A 1 142 ? 9.384   7.137   29.524  1.00 59.75  ? 142  GLU A OE1 1 
ATOM   1122 O OE2 . GLU A 1 142 ? 8.793   8.890   28.383  1.00 62.79  ? 142  GLU A OE2 1 
ATOM   1123 N N   . GLY A 1 143 ? 12.552  8.241   33.761  1.00 52.95  ? 143  GLY A N   1 
ATOM   1124 C CA  . GLY A 1 143 ? 13.189  7.470   34.827  1.00 53.16  ? 143  GLY A CA  1 
ATOM   1125 C C   . GLY A 1 143 ? 14.480  6.831   34.358  1.00 52.05  ? 143  GLY A C   1 
ATOM   1126 O O   . GLY A 1 143 ? 14.943  5.866   34.950  1.00 52.50  ? 143  GLY A O   1 
ATOM   1127 N N   . ALA A 1 144 ? 15.064  7.376   33.289  1.00 50.78  ? 144  ALA A N   1 
ATOM   1128 C CA  . ALA A 1 144 ? 16.275  6.811   32.700  1.00 49.57  ? 144  ALA A CA  1 
ATOM   1129 C C   . ALA A 1 144 ? 17.522  7.134   33.520  1.00 49.11  ? 144  ALA A C   1 
ATOM   1130 O O   . ALA A 1 144 ? 17.603  8.187   34.168  1.00 48.16  ? 144  ALA A O   1 
ATOM   1131 C CB  . ALA A 1 144 ? 16.455  7.318   31.244  1.00 48.40  ? 144  ALA A CB  1 
ATOM   1132 N N   . VAL A 1 145 ? 18.491  6.213   33.476  1.00 48.80  ? 145  VAL A N   1 
ATOM   1133 C CA  . VAL A 1 145 ? 19.862  6.509   33.853  1.00 48.08  ? 145  VAL A CA  1 
ATOM   1134 C C   . VAL A 1 145 ? 20.620  6.812   32.568  1.00 47.77  ? 145  VAL A C   1 
ATOM   1135 O O   . VAL A 1 145 ? 20.695  5.975   31.686  1.00 47.88  ? 145  VAL A O   1 
ATOM   1136 C CB  . VAL A 1 145 ? 20.537  5.345   34.557  1.00 48.56  ? 145  VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 145 ? 22.016  5.672   34.781  1.00 47.43  ? 145  VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 145 ? 19.812  5.013   35.876  1.00 48.65  ? 145  VAL A CG2 1 
ATOM   1139 N N   . LEU A 1 146 ? 21.158  8.020   32.450  1.00 47.66  ? 146  LEU A N   1 
ATOM   1140 C CA  . LEU A 1 146 ? 21.777  8.445   31.221  1.00 46.95  ? 146  LEU A CA  1 
ATOM   1141 C C   . LEU A 1 146 ? 23.216  8.799   31.486  1.00 46.33  ? 146  LEU A C   1 
ATOM   1142 O O   . LEU A 1 146 ? 23.526  9.517   32.437  1.00 46.68  ? 146  LEU A O   1 
ATOM   1143 C CB  . LEU A 1 146 ? 21.036  9.647   30.644  1.00 47.63  ? 146  LEU A CB  1 
ATOM   1144 C CG  . LEU A 1 146 ? 21.443  10.021  29.200  1.00 48.52  ? 146  LEU A CG  1 
ATOM   1145 C CD1 . LEU A 1 146 ? 20.220  10.399  28.415  1.00 48.92  ? 146  LEU A CD1 1 
ATOM   1146 C CD2 . LEU A 1 146 ? 22.504  11.130  29.139  1.00 46.90  ? 146  LEU A CD2 1 
ATOM   1147 N N   . VAL A 1 147 ? 24.094  8.300   30.632  1.00 45.56  ? 147  VAL A N   1 
ATOM   1148 C CA  . VAL A 1 147 ? 25.525  8.512   30.774  1.00 44.66  ? 147  VAL A CA  1 
ATOM   1149 C C   . VAL A 1 147 ? 26.034  9.143   29.494  1.00 44.21  ? 147  VAL A C   1 
ATOM   1150 O O   . VAL A 1 147 ? 25.628  8.747   28.426  1.00 43.74  ? 147  VAL A O   1 
ATOM   1151 C CB  . VAL A 1 147 ? 26.277  7.170   30.981  1.00 45.30  ? 147  VAL A CB  1 
ATOM   1152 C CG1 . VAL A 1 147 ? 27.832  7.416   31.079  1.00 43.74  ? 147  VAL A CG1 1 
ATOM   1153 C CG2 . VAL A 1 147 ? 25.720  6.396   32.199  1.00 42.67  ? 147  VAL A CG2 1 
ATOM   1154 N N   . SER A 1 148 ? 26.918  10.127  29.607  1.00 44.42  ? 148  SER A N   1 
ATOM   1155 C CA  . SER A 1 148 ? 27.605  10.694  28.453  1.00 43.79  ? 148  SER A CA  1 
ATOM   1156 C C   . SER A 1 148 ? 29.077  10.921  28.788  1.00 44.28  ? 148  SER A C   1 
ATOM   1157 O O   . SER A 1 148 ? 29.404  11.385  29.881  1.00 44.58  ? 148  SER A O   1 
ATOM   1158 C CB  . SER A 1 148 ? 26.935  11.999  28.041  1.00 43.84  ? 148  SER A CB  1 
ATOM   1159 O OG  . SER A 1 148 ? 27.130  13.023  29.004  1.00 44.15  ? 148  SER A OG  1 
ATOM   1160 N N   . MET A 1 149 ? 29.962  10.562  27.858  1.00 44.49  ? 149  MET A N   1 
ATOM   1161 C CA  . MET A 1 149 ? 31.391  10.706  28.045  1.00 44.44  ? 149  MET A CA  1 
ATOM   1162 C C   . MET A 1 149 ? 32.001  11.671  27.043  1.00 44.64  ? 149  MET A C   1 
ATOM   1163 O O   . MET A 1 149 ? 31.501  11.836  25.925  1.00 44.49  ? 149  MET A O   1 
ATOM   1164 C CB  . MET A 1 149 ? 32.088  9.337   27.941  1.00 45.04  ? 149  MET A CB  1 
ATOM   1165 C CG  . MET A 1 149 ? 32.535  8.902   26.529  1.00 44.56  ? 149  MET A CG  1 
ATOM   1166 S SD  . MET A 1 149 ? 31.167  8.530   25.422  1.00 44.77  ? 149  MET A SD  1 
ATOM   1167 C CE  . MET A 1 149 ? 30.606  6.932   26.028  1.00 43.98  ? 149  MET A CE  1 
ATOM   1168 N N   . ASN A 1 150 ? 33.084  12.325  27.471  1.00 44.49  ? 150  ASN A N   1 
ATOM   1169 C CA  . ASN A 1 150 ? 33.972  13.045  26.581  1.00 44.14  ? 150  ASN A CA  1 
ATOM   1170 C C   . ASN A 1 150 ? 34.947  12.000  26.010  1.00 44.19  ? 150  ASN A C   1 
ATOM   1171 O O   . ASN A 1 150 ? 35.355  11.053  26.702  1.00 43.73  ? 150  ASN A O   1 
ATOM   1172 C CB  . ASN A 1 150 ? 34.756  14.140  27.329  1.00 43.94  ? 150  ASN A CB  1 
ATOM   1173 C CG  . ASN A 1 150 ? 33.954  15.436  27.544  1.00 45.57  ? 150  ASN A CG  1 
ATOM   1174 O OD1 . ASN A 1 150 ? 32.793  15.558  27.142  1.00 44.52  ? 150  ASN A OD1 1 
ATOM   1175 N ND2 . ASN A 1 150 ? 34.595  16.417  28.192  1.00 44.14  ? 150  ASN A ND2 1 
ATOM   1176 N N   . TYR A 1 151 ? 35.295  12.168  24.740  1.00 43.76  ? 151  TYR A N   1 
ATOM   1177 C CA  . TYR A 1 151 ? 36.290  11.329  24.095  1.00 43.62  ? 151  TYR A CA  1 
ATOM   1178 C C   . TYR A 1 151 ? 37.165  12.247  23.247  1.00 43.48  ? 151  TYR A C   1 
ATOM   1179 O O   . TYR A 1 151 ? 36.708  13.291  22.776  1.00 43.80  ? 151  TYR A O   1 
ATOM   1180 C CB  . TYR A 1 151 ? 35.622  10.196  23.277  1.00 43.40  ? 151  TYR A CB  1 
ATOM   1181 C CG  . TYR A 1 151 ? 34.769  10.641  22.093  1.00 42.19  ? 151  TYR A CG  1 
ATOM   1182 C CD1 . TYR A 1 151 ? 33.400  10.861  22.222  1.00 42.26  ? 151  TYR A CD1 1 
ATOM   1183 C CD2 . TYR A 1 151 ? 35.330  10.816  20.847  1.00 42.71  ? 151  TYR A CD2 1 
ATOM   1184 C CE1 . TYR A 1 151 ? 32.626  11.282  21.135  1.00 40.54  ? 151  TYR A CE1 1 
ATOM   1185 C CE2 . TYR A 1 151 ? 34.572  11.235  19.767  1.00 42.27  ? 151  TYR A CE2 1 
ATOM   1186 C CZ  . TYR A 1 151 ? 33.223  11.460  19.911  1.00 41.90  ? 151  TYR A CZ  1 
ATOM   1187 O OH  . TYR A 1 151 ? 32.498  11.861  18.807  1.00 41.40  ? 151  TYR A OH  1 
ATOM   1188 N N   . ARG A 1 152 ? 38.437  11.895  23.107  1.00 43.51  ? 152  ARG A N   1 
ATOM   1189 C CA  . ARG A 1 152 ? 39.357  12.719  22.350  1.00 43.31  ? 152  ARG A CA  1 
ATOM   1190 C C   . ARG A 1 152 ? 38.977  12.824  20.884  1.00 42.97  ? 152  ARG A C   1 
ATOM   1191 O O   . ARG A 1 152 ? 38.518  11.856  20.267  1.00 42.05  ? 152  ARG A O   1 
ATOM   1192 C CB  . ARG A 1 152 ? 40.782  12.201  22.471  1.00 44.21  ? 152  ARG A CB  1 
ATOM   1193 C CG  . ARG A 1 152 ? 41.377  12.454  23.842  1.00 44.10  ? 152  ARG A CG  1 
ATOM   1194 C CD  . ARG A 1 152 ? 42.694  11.782  23.968  1.00 44.17  ? 152  ARG A CD  1 
ATOM   1195 N NE  . ARG A 1 152 ? 42.532  10.362  24.273  1.00 43.17  ? 152  ARG A NE  1 
ATOM   1196 C CZ  . ARG A 1 152 ? 43.539  9.508   24.334  1.00 43.55  ? 152  ARG A CZ  1 
ATOM   1197 N NH1 . ARG A 1 152 ? 44.786  9.914   24.101  1.00 43.53  ? 152  ARG A NH1 1 
ATOM   1198 N NH2 . ARG A 1 152 ? 43.299  8.241   24.624  1.00 45.47  ? 152  ARG A NH2 1 
ATOM   1199 N N   . VAL A 1 153 ? 39.193  14.021  20.336  1.00 42.70  ? 153  VAL A N   1 
ATOM   1200 C CA  . VAL A 1 153 ? 38.805  14.330  18.973  1.00 42.37  ? 153  VAL A CA  1 
ATOM   1201 C C   . VAL A 1 153 ? 40.004  14.888  18.219  1.00 43.84  ? 153  VAL A C   1 
ATOM   1202 O O   . VAL A 1 153 ? 41.052  15.183  18.823  1.00 44.71  ? 153  VAL A O   1 
ATOM   1203 C CB  . VAL A 1 153 ? 37.597  15.295  18.935  1.00 42.22  ? 153  VAL A CB  1 
ATOM   1204 C CG1 . VAL A 1 153 ? 36.341  14.593  19.522  1.00 39.71  ? 153  VAL A CG1 1 
ATOM   1205 C CG2 . VAL A 1 153 ? 37.885  16.634  19.666  1.00 40.30  ? 153  VAL A CG2 1 
ATOM   1206 N N   . GLY A 1 154 ? 39.882  14.982  16.897  1.00 43.98  ? 154  GLY A N   1 
ATOM   1207 C CA  . GLY A 1 154 ? 40.957  15.564  16.084  1.00 44.18  ? 154  GLY A CA  1 
ATOM   1208 C C   . GLY A 1 154 ? 42.220  14.744  16.145  1.00 44.72  ? 154  GLY A C   1 
ATOM   1209 O O   . GLY A 1 154 ? 42.168  13.512  16.286  1.00 45.42  ? 154  GLY A O   1 
ATOM   1210 N N   . THR A 1 155 ? 43.367  15.422  16.066  1.00 45.04  ? 155  THR A N   1 
ATOM   1211 C CA  . THR A 1 155 ? 44.648  14.755  16.123  1.00 45.36  ? 155  THR A CA  1 
ATOM   1212 C C   . THR A 1 155 ? 44.783  13.932  17.431  1.00 45.87  ? 155  THR A C   1 
ATOM   1213 O O   . THR A 1 155 ? 45.289  12.799  17.429  1.00 45.92  ? 155  THR A O   1 
ATOM   1214 C CB  . THR A 1 155 ? 45.829  15.794  15.967  1.00 46.57  ? 155  THR A CB  1 
ATOM   1215 O OG1 . THR A 1 155 ? 45.723  16.829  16.957  1.00 45.86  ? 155  THR A OG1 1 
ATOM   1216 C CG2 . THR A 1 155 ? 45.819  16.435  14.561  1.00 43.70  ? 155  THR A CG2 1 
ATOM   1217 N N   . PHE A 1 156 ? 44.290  14.495  18.532  1.00 45.30  ? 156  PHE A N   1 
ATOM   1218 C CA  . PHE A 1 156 ? 44.455  13.904  19.861  1.00 45.17  ? 156  PHE A CA  1 
ATOM   1219 C C   . PHE A 1 156 ? 43.745  12.562  19.963  1.00 44.76  ? 156  PHE A C   1 
ATOM   1220 O O   . PHE A 1 156 ? 44.190  11.661  20.664  1.00 45.23  ? 156  PHE A O   1 
ATOM   1221 C CB  . PHE A 1 156 ? 43.961  14.873  20.932  1.00 45.17  ? 156  PHE A CB  1 
ATOM   1222 C CG  . PHE A 1 156 ? 44.512  16.269  20.774  1.00 45.13  ? 156  PHE A CG  1 
ATOM   1223 C CD1 . PHE A 1 156 ? 45.779  16.567  21.181  1.00 46.87  ? 156  PHE A CD1 1 
ATOM   1224 C CD2 . PHE A 1 156 ? 43.768  17.256  20.169  1.00 46.24  ? 156  PHE A CD2 1 
ATOM   1225 C CE1 . PHE A 1 156 ? 46.303  17.842  21.004  1.00 47.77  ? 156  PHE A CE1 1 
ATOM   1226 C CE2 . PHE A 1 156 ? 44.270  18.542  19.992  1.00 45.17  ? 156  PHE A CE2 1 
ATOM   1227 C CZ  . PHE A 1 156 ? 45.554  18.825  20.410  1.00 47.06  ? 156  PHE A CZ  1 
ATOM   1228 N N   . GLY A 1 157 ? 42.642  12.429  19.247  1.00 43.82  ? 157  GLY A N   1 
ATOM   1229 C CA  . GLY A 1 157 ? 41.868  11.199  19.292  1.00 43.35  ? 157  GLY A CA  1 
ATOM   1230 C C   . GLY A 1 157 ? 42.177  10.249  18.158  1.00 43.18  ? 157  GLY A C   1 
ATOM   1231 O O   . GLY A 1 157 ? 42.032  9.042   18.320  1.00 42.78  ? 157  GLY A O   1 
ATOM   1232 N N   . PHE A 1 158 ? 42.625  10.785  17.020  1.00 43.33  ? 158  PHE A N   1 
ATOM   1233 C CA  . PHE A 1 158 ? 42.600  10.028  15.765  1.00 43.44  ? 158  PHE A CA  1 
ATOM   1234 C C   . PHE A 1 158 ? 43.812  10.101  14.852  1.00 44.44  ? 158  PHE A C   1 
ATOM   1235 O O   . PHE A 1 158 ? 43.835  9.410   13.827  1.00 45.20  ? 158  PHE A O   1 
ATOM   1236 C CB  . PHE A 1 158 ? 41.310  10.387  15.017  1.00 42.80  ? 158  PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 158 ? 40.082  10.004  15.785  1.00 41.71  ? 158  PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 158 ? 39.714  8.672   15.888  1.00 43.32  ? 158  PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 158 ? 39.354  10.946  16.468  1.00 41.87  ? 158  PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 158 ? 38.630  8.289   16.642  1.00 42.21  ? 158  PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 158 ? 38.249  10.579  17.210  1.00 41.40  ? 158  PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 158 ? 37.899  9.239   17.303  1.00 41.96  ? 158  PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 159 ? 44.817  10.915  15.190  1.00 45.10  ? 159  LEU A N   1 
ATOM   1244 C CA  . LEU A 1 159 ? 46.057  10.912  14.422  1.00 46.16  ? 159  LEU A CA  1 
ATOM   1245 C C   . LEU A 1 159 ? 46.682  9.545   14.609  1.00 47.47  ? 159  LEU A C   1 
ATOM   1246 O O   . LEU A 1 159 ? 46.797  9.075   15.738  1.00 47.96  ? 159  LEU A O   1 
ATOM   1247 C CB  . LEU A 1 159 ? 47.017  11.995  14.900  1.00 46.61  ? 159  LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 159 ? 48.369  12.122  14.182  1.00 47.26  ? 159  LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 159 ? 48.827  13.587  14.101  1.00 46.41  ? 159  LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 159 ? 49.420  11.248  14.858  1.00 47.92  ? 159  LEU A CD2 1 
ATOM   1251 N N   . ALA A 1 160 ? 47.068  8.911   13.505  1.00 48.46  ? 160  ALA A N   1 
ATOM   1252 C CA  . ALA A 1 160 ? 47.607  7.535   13.524  1.00 49.65  ? 160  ALA A CA  1 
ATOM   1253 C C   . ALA A 1 160 ? 48.808  7.411   12.611  1.00 50.65  ? 160  ALA A C   1 
ATOM   1254 O O   . ALA A 1 160 ? 48.845  8.023   11.552  1.00 50.47  ? 160  ALA A O   1 
ATOM   1255 C CB  . ALA A 1 160 ? 46.522  6.519   13.098  1.00 48.90  ? 160  ALA A CB  1 
ATOM   1256 N N   . LEU A 1 161 ? 49.806  6.663   13.070  1.00 51.77  ? 161  LEU A N   1 
ATOM   1257 C CA  . LEU A 1 161 ? 50.828  6.093   12.217  1.00 53.06  ? 161  LEU A CA  1 
ATOM   1258 C C   . LEU A 1 161 ? 50.642  4.593   12.393  1.00 53.39  ? 161  LEU A C   1 
ATOM   1259 O O   . LEU A 1 161 ? 51.180  4.010   13.330  1.00 54.02  ? 161  LEU A O   1 
ATOM   1260 C CB  . LEU A 1 161 ? 52.212  6.558   12.654  1.00 54.11  ? 161  LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 161 ? 52.410  8.051   12.348  1.00 54.16  ? 161  LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 161 ? 53.460  8.635   13.240  1.00 57.09  ? 161  LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 161 ? 52.760  8.290   10.886  1.00 52.92  ? 161  LEU A CD2 1 
ATOM   1264 N N   . PRO A 1 162 ? 49.798  3.983   11.546  1.00 53.19  ? 162  PRO A N   1 
ATOM   1265 C CA  . PRO A 1 162 ? 49.398  2.592   11.769  1.00 53.83  ? 162  PRO A CA  1 
ATOM   1266 C C   . PRO A 1 162 ? 50.576  1.635   11.871  1.00 55.82  ? 162  PRO A C   1 
ATOM   1267 O O   . PRO A 1 162 ? 51.539  1.773   11.142  1.00 56.69  ? 162  PRO A O   1 
ATOM   1268 C CB  . PRO A 1 162 ? 48.511  2.286   10.554  1.00 53.48  ? 162  PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 162 ? 47.951  3.626   10.169  1.00 52.21  ? 162  PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 162 ? 49.092  4.572   10.389  1.00 52.67  ? 162  PRO A CD  1 
ATOM   1271 N N   . GLY A 1 163 ? 50.491  0.689   12.795  1.00 56.82  ? 163  GLY A N   1 
ATOM   1272 C CA  . GLY A 1 163 ? 51.583  -0.229  13.075  1.00 58.84  ? 163  GLY A CA  1 
ATOM   1273 C C   . GLY A 1 163 ? 52.512  0.284   14.160  1.00 59.63  ? 163  GLY A C   1 
ATOM   1274 O O   . GLY A 1 163 ? 53.290  -0.479  14.700  1.00 60.79  ? 163  GLY A O   1 
ATOM   1275 N N   . SER A 1 164 ? 52.442  1.573   14.487  1.00 59.17  ? 164  SER A N   1 
ATOM   1276 C CA  . SER A 1 164 ? 53.314  2.135   15.514  1.00 59.87  ? 164  SER A CA  1 
ATOM   1277 C C   . SER A 1 164 ? 52.789  1.820   16.901  1.00 60.61  ? 164  SER A C   1 
ATOM   1278 O O   . SER A 1 164 ? 51.585  1.605   17.092  1.00 60.03  ? 164  SER A O   1 
ATOM   1279 C CB  . SER A 1 164 ? 53.444  3.654   15.367  1.00 59.14  ? 164  SER A CB  1 
ATOM   1280 O OG  . SER A 1 164 ? 52.237  4.310   15.740  1.00 55.66  ? 164  SER A OG  1 
ATOM   1281 N N   . ARG A 1 165 ? 53.710  1.810   17.859  1.00 62.66  ? 165  ARG A N   1 
ATOM   1282 C CA  . ARG A 1 165 ? 53.390  1.702   19.272  1.00 63.21  ? 165  ARG A CA  1 
ATOM   1283 C C   . ARG A 1 165 ? 52.865  3.027   19.823  1.00 60.76  ? 165  ARG A C   1 
ATOM   1284 O O   . ARG A 1 165 ? 51.992  3.036   20.686  1.00 60.26  ? 165  ARG A O   1 
ATOM   1285 C CB  . ARG A 1 165 ? 54.651  1.313   20.056  1.00 64.72  ? 165  ARG A CB  1 
ATOM   1286 C CG  . ARG A 1 165 ? 54.405  0.867   21.524  1.00 66.66  ? 165  ARG A CG  1 
ATOM   1287 C CD  . ARG A 1 165 ? 55.712  0.908   22.405  1.00 71.04  ? 165  ARG A CD  1 
ATOM   1288 N NE  . ARG A 1 165 ? 55.897  2.246   22.993  1.00 75.95  ? 165  ARG A NE  1 
ATOM   1289 C CZ  . ARG A 1 165 ? 55.223  2.721   24.050  1.00 77.48  ? 165  ARG A CZ  1 
ATOM   1290 N NH1 . ARG A 1 165 ? 54.322  1.967   24.694  1.00 78.15  ? 165  ARG A NH1 1 
ATOM   1291 N NH2 . ARG A 1 165 ? 55.454  3.966   24.473  1.00 77.11  ? 165  ARG A NH2 1 
ATOM   1292 N N   . GLU A 1 166 ? 53.397  4.141   19.323  1.00 59.75  ? 166  GLU A N   1 
ATOM   1293 C CA  . GLU A 1 166 ? 53.200  5.441   19.959  1.00 58.53  ? 166  GLU A CA  1 
ATOM   1294 C C   . GLU A 1 166 ? 52.003  6.232   19.425  1.00 56.04  ? 166  GLU A C   1 
ATOM   1295 O O   . GLU A 1 166 ? 51.560  7.173   20.054  1.00 55.49  ? 166  GLU A O   1 
ATOM   1296 C CB  . GLU A 1 166 ? 54.480  6.273   19.862  1.00 59.94  ? 166  GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 166 ? 55.753  5.526   20.334  1.00 63.06  ? 166  GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 166 ? 56.547  4.844   19.201  1.00 66.67  ? 166  GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 166 ? 56.011  4.646   18.084  1.00 66.31  ? 166  GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 166 ? 57.733  4.499   19.443  1.00 70.89  ? 166  GLU A OE2 1 
ATOM   1301 N N   . ALA A 1 167 ? 51.482  5.862   18.266  1.00 54.65  ? 167  ALA A N   1 
ATOM   1302 C CA  . ALA A 1 167 ? 50.287  6.514   17.717  1.00 52.58  ? 167  ALA A CA  1 
ATOM   1303 C C   . ALA A 1 167 ? 49.523  5.470   16.918  1.00 52.06  ? 167  ALA A C   1 
ATOM   1304 O O   . ALA A 1 167 ? 49.507  5.518   15.685  1.00 51.16  ? 167  ALA A O   1 
ATOM   1305 C CB  . ALA A 1 167 ? 50.677  7.694   16.845  1.00 52.15  ? 167  ALA A CB  1 
ATOM   1306 N N   . PRO A 1 168 ? 48.936  4.482   17.621  1.00 52.05  ? 168  PRO A N   1 
ATOM   1307 C CA  . PRO A 1 168 ? 48.343  3.329   16.945  1.00 52.70  ? 168  PRO A CA  1 
ATOM   1308 C C   . PRO A 1 168 ? 47.037  3.641   16.233  1.00 51.72  ? 168  PRO A C   1 
ATOM   1309 O O   . PRO A 1 168 ? 46.601  2.852   15.389  1.00 52.52  ? 168  PRO A O   1 
ATOM   1310 C CB  . PRO A 1 168 ? 48.097  2.334   18.096  1.00 53.22  ? 168  PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 168 ? 47.850  3.220   19.290  1.00 52.08  ? 168  PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 168 ? 48.821  4.369   19.091  1.00 52.32  ? 168  PRO A CD  1 
ATOM   1313 N N   . GLY A 1 169 ? 46.412  4.770   16.567  1.00 50.63  ? 169  GLY A N   1 
ATOM   1314 C CA  . GLY A 1 169 ? 45.144  5.161   15.955  1.00 48.96  ? 169  GLY A CA  1 
ATOM   1315 C C   . GLY A 1 169 ? 43.923  4.752   16.755  1.00 48.27  ? 169  GLY A C   1 
ATOM   1316 O O   . GLY A 1 169 ? 44.010  3.905   17.633  1.00 48.12  ? 169  GLY A O   1 
ATOM   1317 N N   . ASN A 1 170 ? 42.783  5.378   16.463  1.00 47.02  ? 170  ASN A N   1 
ATOM   1318 C CA  . ASN A 1 170 ? 41.497  5.015   17.080  1.00 47.16  ? 170  ASN A CA  1 
ATOM   1319 C C   . ASN A 1 170 ? 41.398  5.205   18.607  1.00 47.04  ? 170  ASN A C   1 
ATOM   1320 O O   . ASN A 1 170 ? 40.539  4.608   19.260  1.00 46.87  ? 170  ASN A O   1 
ATOM   1321 C CB  . ASN A 1 170 ? 41.117  3.563   16.729  1.00 47.89  ? 170  ASN A CB  1 
ATOM   1322 C CG  . ASN A 1 170 ? 40.848  3.365   15.251  1.00 48.27  ? 170  ASN A CG  1 
ATOM   1323 O OD1 . ASN A 1 170 ? 40.296  4.245   14.588  1.00 48.34  ? 170  ASN A OD1 1 
ATOM   1324 N ND2 . ASN A 1 170 ? 41.197  2.188   14.735  1.00 48.78  ? 170  ASN A ND2 1 
ATOM   1325 N N   . VAL A 1 171 ? 42.240  6.054   19.183  1.00 46.99  ? 171  VAL A N   1 
ATOM   1326 C CA  . VAL A 1 171 ? 42.289  6.155   20.642  1.00 46.78  ? 171  VAL A CA  1 
ATOM   1327 C C   . VAL A 1 171 ? 41.049  6.854   21.195  1.00 45.97  ? 171  VAL A C   1 
ATOM   1328 O O   . VAL A 1 171 ? 40.619  6.548   22.297  1.00 46.07  ? 171  VAL A O   1 
ATOM   1329 C CB  . VAL A 1 171 ? 43.616  6.757   21.165  1.00 47.42  ? 171  VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 171 ? 44.810  5.880   20.688  1.00 47.89  ? 171  VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 171 ? 43.782  8.236   20.776  1.00 47.52  ? 171  VAL A CG2 1 
ATOM   1332 N N   . GLY A 1 172 ? 40.438  7.734   20.403  1.00 45.07  ? 172  GLY A N   1 
ATOM   1333 C CA  . GLY A 1 172 ? 39.182  8.346   20.791  1.00 44.55  ? 172  GLY A CA  1 
ATOM   1334 C C   . GLY A 1 172 ? 38.062  7.327   20.928  1.00 44.35  ? 172  GLY A C   1 
ATOM   1335 O O   . GLY A 1 172 ? 37.186  7.467   21.769  1.00 44.59  ? 172  GLY A O   1 
ATOM   1336 N N   . LEU A 1 173 ? 38.086  6.294   20.091  1.00 44.98  ? 173  LEU A N   1 
ATOM   1337 C CA  . LEU A 1 173 ? 37.138  5.185   20.200  1.00 44.45  ? 173  LEU A CA  1 
ATOM   1338 C C   . LEU A 1 173 ? 37.429  4.322   21.421  1.00 45.77  ? 173  LEU A C   1 
ATOM   1339 O O   . LEU A 1 173 ? 36.506  3.766   22.050  1.00 46.25  ? 173  LEU A O   1 
ATOM   1340 C CB  . LEU A 1 173 ? 37.187  4.335   18.935  1.00 44.79  ? 173  LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 173 ? 36.525  4.942   17.686  1.00 43.74  ? 173  LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 173 ? 36.816  4.082   16.463  1.00 43.30  ? 173  LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 173 ? 35.031  5.091   17.879  1.00 43.02  ? 173  LEU A CD2 1 
ATOM   1344 N N   . LEU A 1 174 ? 38.716  4.187   21.747  1.00 45.85  ? 174  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 174 ? 39.120  3.446   22.926  1.00 46.12  ? 174  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 174 ? 38.713  4.214   24.180  1.00 45.96  ? 174  LEU A C   1 
ATOM   1347 O O   . LEU A 1 174 ? 38.335  3.596   25.178  1.00 45.80  ? 174  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 174 ? 40.627  3.152   22.928  1.00 46.16  ? 174  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 174 ? 41.122  2.145   21.893  1.00 46.48  ? 174  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 174 ? 42.645  1.951   22.008  1.00 46.57  ? 174  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 174 ? 40.402  0.802   22.033  1.00 46.84  ? 174  LEU A CD2 1 
ATOM   1352 N N   . ASP A 1 175 ? 38.782  5.549   24.129  1.00 45.05  ? 175  ASP A N   1 
ATOM   1353 C CA  . ASP A 1 175 ? 38.249  6.390   25.225  1.00 45.03  ? 175  ASP A CA  1 
ATOM   1354 C C   . ASP A 1 175 ? 36.765  6.035   25.466  1.00 44.94  ? 175  ASP A C   1 
ATOM   1355 O O   . ASP A 1 175 ? 36.328  5.808   26.604  1.00 45.07  ? 175  ASP A O   1 
ATOM   1356 C CB  . ASP A 1 175 ? 38.350  7.891   24.905  1.00 44.05  ? 175  ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 175 ? 39.786  8.388   24.743  1.00 44.89  ? 175  ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 175 ? 40.734  7.726   25.209  1.00 45.49  ? 175  ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 175 ? 39.974  9.491   24.172  1.00 46.11  ? 175  ASP A OD2 1 
ATOM   1360 N N   . GLN A 1 176 ? 35.999  5.962   24.379  1.00 45.12  ? 176  GLN A N   1 
ATOM   1361 C CA  . GLN A 1 176 ? 34.581  5.612   24.460  1.00 44.40  ? 176  GLN A CA  1 
ATOM   1362 C C   . GLN A 1 176 ? 34.402  4.242   25.069  1.00 45.53  ? 176  GLN A C   1 
ATOM   1363 O O   . GLN A 1 176 ? 33.522  4.030   25.916  1.00 45.64  ? 176  GLN A O   1 
ATOM   1364 C CB  . GLN A 1 176 ? 33.934  5.628   23.075  1.00 44.29  ? 176  GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 176 ? 33.817  7.017   22.421  1.00 43.42  ? 176  GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 176 ? 33.358  6.940   20.969  1.00 43.56  ? 176  GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 176 ? 32.901  5.890   20.519  1.00 45.27  ? 176  GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 176 ? 33.479  8.056   20.230  1.00 42.78  ? 176  GLN A NE2 1 
ATOM   1369 N N   . ARG A 1 177 ? 35.221  3.295   24.622  1.00 45.95  ? 177  ARG A N   1 
ATOM   1370 C CA  . ARG A 1 177 ? 35.111  1.930   25.098  1.00 46.60  ? 177  ARG A CA  1 
ATOM   1371 C C   . ARG A 1 177 ? 35.393  1.833   26.595  1.00 46.47  ? 177  ARG A C   1 
ATOM   1372 O O   . ARG A 1 177 ? 34.740  1.052   27.285  1.00 45.86  ? 177  ARG A O   1 
ATOM   1373 C CB  . ARG A 1 177 ? 36.066  1.009   24.333  1.00 47.25  ? 177  ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 177 ? 36.100  -0.436  24.853  1.00 48.83  ? 177  ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 177 ? 37.081  -1.252  24.041  1.00 49.97  ? 177  ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 177 ? 36.479  -1.644  22.776  1.00 53.34  ? 177  ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 177 ? 37.166  -2.114  21.730  1.00 54.97  ? 177  ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 177 ? 38.498  -2.255  21.798  1.00 54.55  ? 177  ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 177 ? 36.518  -2.461  20.617  1.00 52.53  ? 177  ARG A NH2 1 
ATOM   1380 N N   . LEU A 1 178 ? 36.387  2.592   27.067  1.00 45.92  ? 178  LEU A N   1 
ATOM   1381 C CA  . LEU A 1 178 ? 36.745  2.615   28.483  1.00 46.10  ? 178  LEU A CA  1 
ATOM   1382 C C   . LEU A 1 178 ? 35.598  3.169   29.306  1.00 46.12  ? 178  LEU A C   1 
ATOM   1383 O O   . LEU A 1 178 ? 35.346  2.695   30.406  1.00 45.94  ? 178  LEU A O   1 
ATOM   1384 C CB  . LEU A 1 178 ? 38.012  3.442   28.722  1.00 46.22  ? 178  LEU A CB  1 
ATOM   1385 C CG  . LEU A 1 178 ? 38.598  3.524   30.137  1.00 46.99  ? 178  LEU A CG  1 
ATOM   1386 C CD1 . LEU A 1 178 ? 38.994  2.142   30.712  1.00 46.15  ? 178  LEU A CD1 1 
ATOM   1387 C CD2 . LEU A 1 178 ? 39.797  4.479   30.165  1.00 45.72  ? 178  LEU A CD2 1 
ATOM   1388 N N   . ALA A 1 179 ? 34.898  4.177   28.780  1.00 45.74  ? 179  ALA A N   1 
ATOM   1389 C CA  . ALA A 1 179 ? 33.698  4.670   29.444  1.00 45.35  ? 179  ALA A CA  1 
ATOM   1390 C C   . ALA A 1 179 ? 32.638  3.572   29.497  1.00 46.45  ? 179  ALA A C   1 
ATOM   1391 O O   . ALA A 1 179 ? 31.944  3.446   30.504  1.00 47.57  ? 179  ALA A O   1 
ATOM   1392 C CB  . ALA A 1 179 ? 33.154  5.920   28.759  1.00 44.08  ? 179  ALA A CB  1 
ATOM   1393 N N   . LEU A 1 180 ? 32.500  2.774   28.438  1.00 46.65  ? 180  LEU A N   1 
ATOM   1394 C CA  . LEU A 1 180 ? 31.506  1.686   28.456  1.00 47.81  ? 180  LEU A CA  1 
ATOM   1395 C C   . LEU A 1 180 ? 31.876  0.661   29.527  1.00 48.47  ? 180  LEU A C   1 
ATOM   1396 O O   . LEU A 1 180 ? 31.001  0.144   30.219  1.00 48.59  ? 180  LEU A O   1 
ATOM   1397 C CB  . LEU A 1 180 ? 31.349  1.000   27.096  1.00 47.51  ? 180  LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 180 ? 31.047  1.851   25.848  1.00 48.49  ? 180  LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 180 ? 30.672  0.960   24.635  1.00 46.92  ? 180  LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 180 ? 29.987  2.927   26.089  1.00 47.41  ? 180  LEU A CD2 1 
ATOM   1401 N N   . GLN A 1 181 ? 33.174  0.386   29.667  1.00 49.10  ? 181  GLN A N   1 
ATOM   1402 C CA  . GLN A 1 181 ? 33.668  -0.522  30.717  1.00 50.80  ? 181  GLN A CA  1 
ATOM   1403 C C   . GLN A 1 181 ? 33.369  0.049   32.099  1.00 49.97  ? 181  GLN A C   1 
ATOM   1404 O O   . GLN A 1 181 ? 32.921  -0.678  33.001  1.00 51.33  ? 181  GLN A O   1 
ATOM   1405 C CB  . GLN A 1 181 ? 35.170  -0.777  30.559  1.00 51.37  ? 181  GLN A CB  1 
ATOM   1406 C CG  . GLN A 1 181 ? 35.494  -1.629  29.328  1.00 54.26  ? 181  GLN A CG  1 
ATOM   1407 C CD  . GLN A 1 181 ? 36.990  -1.721  28.972  1.00 54.88  ? 181  GLN A CD  1 
ATOM   1408 O OE1 . GLN A 1 181 ? 37.774  -0.797  29.197  1.00 58.91  ? 181  GLN A OE1 1 
ATOM   1409 N NE2 . GLN A 1 181 ? 37.368  -2.839  28.369  1.00 59.40  ? 181  GLN A NE2 1 
ATOM   1410 N N   . TRP A 1 182 ? 33.589  1.355   32.256  1.00 47.81  ? 182  TRP A N   1 
ATOM   1411 C CA  . TRP A 1 182 ? 33.256  2.050   33.494  1.00 47.05  ? 182  TRP A CA  1 
ATOM   1412 C C   . TRP A 1 182 ? 31.789  1.839   33.858  1.00 46.18  ? 182  TRP A C   1 
ATOM   1413 O O   . TRP A 1 182 ? 31.468  1.548   34.999  1.00 46.01  ? 182  TRP A O   1 
ATOM   1414 C CB  . TRP A 1 182 ? 33.557  3.547   33.376  1.00 46.42  ? 182  TRP A CB  1 
ATOM   1415 C CG  . TRP A 1 182 ? 33.391  4.309   34.661  1.00 46.98  ? 182  TRP A CG  1 
ATOM   1416 C CD1 . TRP A 1 182 ? 34.370  4.623   35.561  1.00 46.63  ? 182  TRP A CD1 1 
ATOM   1417 C CD2 . TRP A 1 182 ? 32.176  4.858   35.183  1.00 46.25  ? 182  TRP A CD2 1 
ATOM   1418 N NE1 . TRP A 1 182 ? 33.838  5.326   36.607  1.00 47.21  ? 182  TRP A NE1 1 
ATOM   1419 C CE2 . TRP A 1 182 ? 32.493  5.481   36.404  1.00 46.77  ? 182  TRP A CE2 1 
ATOM   1420 C CE3 . TRP A 1 182 ? 30.851  4.876   34.741  1.00 46.35  ? 182  TRP A CE3 1 
ATOM   1421 C CZ2 . TRP A 1 182 ? 31.531  6.122   37.189  1.00 47.27  ? 182  TRP A CZ2 1 
ATOM   1422 C CZ3 . TRP A 1 182 ? 29.899  5.523   35.516  1.00 46.04  ? 182  TRP A CZ3 1 
ATOM   1423 C CH2 . TRP A 1 182 ? 30.245  6.134   36.727  1.00 46.57  ? 182  TRP A CH2 1 
ATOM   1424 N N   . VAL A 1 183 ? 30.899  1.988   32.891  1.00 45.38  ? 183  VAL A N   1 
ATOM   1425 C CA  . VAL A 1 183 ? 29.471  1.753   33.148  1.00 45.45  ? 183  VAL A CA  1 
ATOM   1426 C C   . VAL A 1 183 ? 29.235  0.318   33.632  1.00 46.69  ? 183  VAL A C   1 
ATOM   1427 O O   . VAL A 1 183 ? 28.553  0.092   34.621  1.00 47.58  ? 183  VAL A O   1 
ATOM   1428 C CB  . VAL A 1 183 ? 28.615  2.099   31.904  1.00 44.99  ? 183  VAL A CB  1 
ATOM   1429 C CG1 . VAL A 1 183 ? 27.164  1.592   32.043  1.00 44.45  ? 183  VAL A CG1 1 
ATOM   1430 C CG2 . VAL A 1 183 ? 28.660  3.608   31.675  1.00 43.12  ? 183  VAL A CG2 1 
ATOM   1431 N N   . GLN A 1 184 ? 29.839  -0.658  32.971  1.00 47.70  ? 184  GLN A N   1 
ATOM   1432 C CA  . GLN A 1 184 ? 29.648  -2.058  33.377  1.00 48.94  ? 184  GLN A CA  1 
ATOM   1433 C C   . GLN A 1 184 ? 30.001  -2.253  34.842  1.00 49.77  ? 184  GLN A C   1 
ATOM   1434 O O   . GLN A 1 184 ? 29.265  -2.900  35.577  1.00 50.51  ? 184  GLN A O   1 
ATOM   1435 C CB  . GLN A 1 184 ? 30.489  -3.009  32.508  1.00 49.15  ? 184  GLN A CB  1 
ATOM   1436 C CG  . GLN A 1 184 ? 29.894  -3.251  31.151  1.00 49.27  ? 184  GLN A CG  1 
ATOM   1437 C CD  . GLN A 1 184 ? 28.488  -3.795  31.235  1.00 50.04  ? 184  GLN A CD  1 
ATOM   1438 O OE1 . GLN A 1 184 ? 28.281  -4.904  31.714  1.00 52.25  ? 184  GLN A OE1 1 
ATOM   1439 N NE2 . GLN A 1 184 ? 27.512  -3.008  30.793  1.00 48.08  ? 184  GLN A NE2 1 
ATOM   1440 N N   . GLU A 1 185 ? 31.115  -1.674  35.271  1.00 49.96  ? 185  GLU A N   1 
ATOM   1441 C CA  . GLU A 1 185 ? 31.580  -1.880  36.631  1.00 51.39  ? 185  GLU A CA  1 
ATOM   1442 C C   . GLU A 1 185 ? 30.859  -1.027  37.667  1.00 50.84  ? 185  GLU A C   1 
ATOM   1443 O O   . GLU A 1 185 ? 30.676  -1.469  38.786  1.00 51.30  ? 185  GLU A O   1 
ATOM   1444 C CB  . GLU A 1 185 ? 33.089  -1.650  36.745  1.00 51.52  ? 185  GLU A CB  1 
ATOM   1445 C CG  . GLU A 1 185 ? 33.561  -1.803  38.196  1.00 53.74  ? 185  GLU A CG  1 
ATOM   1446 C CD  . GLU A 1 185 ? 35.043  -2.067  38.363  1.00 55.13  ? 185  GLU A CD  1 
ATOM   1447 O OE1 . GLU A 1 185 ? 35.398  -2.611  39.438  1.00 56.57  ? 185  GLU A OE1 1 
ATOM   1448 O OE2 . GLU A 1 185 ? 35.839  -1.712  37.452  1.00 57.12  ? 185  GLU A OE2 1 
ATOM   1449 N N   . ASN A 1 186 ? 30.476  0.196   37.302  1.00 50.41  ? 186  ASN A N   1 
ATOM   1450 C CA  . ASN A 1 186 ? 30.050  1.205   38.284  1.00 50.05  ? 186  ASN A CA  1 
ATOM   1451 C C   . ASN A 1 186 ? 28.591  1.650   38.283  1.00 49.86  ? 186  ASN A C   1 
ATOM   1452 O O   . ASN A 1 186 ? 28.128  2.212   39.285  1.00 50.12  ? 186  ASN A O   1 
ATOM   1453 C CB  . ASN A 1 186 ? 30.924  2.438   38.125  1.00 49.46  ? 186  ASN A CB  1 
ATOM   1454 C CG  . ASN A 1 186 ? 32.370  2.153   38.433  1.00 49.05  ? 186  ASN A CG  1 
ATOM   1455 O OD1 . ASN A 1 186 ? 32.712  1.791   39.561  1.00 46.89  ? 186  ASN A OD1 1 
ATOM   1456 N ND2 . ASN A 1 186 ? 33.241  2.318   37.428  1.00 48.60  ? 186  ASN A ND2 1 
ATOM   1457 N N   . ILE A 1 187 ? 27.863  1.414   37.192  1.00 49.23  ? 187  ILE A N   1 
ATOM   1458 C CA  . ILE A 1 187 ? 26.543  2.036   37.025  1.00 48.69  ? 187  ILE A CA  1 
ATOM   1459 C C   . ILE A 1 187 ? 25.482  1.496   38.008  1.00 49.77  ? 187  ILE A C   1 
ATOM   1460 O O   . ILE A 1 187 ? 24.493  2.183   38.306  1.00 50.10  ? 187  ILE A O   1 
ATOM   1461 C CB  . ILE A 1 187 ? 26.042  1.941   35.568  1.00 47.73  ? 187  ILE A CB  1 
ATOM   1462 C CG1 . ILE A 1 187 ? 25.092  3.100   35.254  1.00 47.08  ? 187  ILE A CG1 1 
ATOM   1463 C CG2 . ILE A 1 187 ? 25.393  0.576   35.283  1.00 48.30  ? 187  ILE A CG2 1 
ATOM   1464 C CD1 . ILE A 1 187 ? 25.727  4.518   35.375  1.00 44.50  ? 187  ILE A CD1 1 
ATOM   1465 N N   . ALA A 1 188 ? 25.691  0.290   38.521  1.00 50.17  ? 188  ALA A N   1 
ATOM   1466 C CA  . ALA A 1 188 ? 24.802  -0.266  39.557  1.00 51.24  ? 188  ALA A CA  1 
ATOM   1467 C C   . ALA A 1 188 ? 24.848  0.568   40.837  1.00 51.57  ? 188  ALA A C   1 
ATOM   1468 O O   . ALA A 1 188 ? 23.869  0.613   41.564  1.00 52.58  ? 188  ALA A O   1 
ATOM   1469 C CB  . ALA A 1 188 ? 25.141  -1.728  39.853  1.00 51.51  ? 188  ALA A CB  1 
ATOM   1470 N N   . ALA A 1 189 ? 25.959  1.259   41.091  1.00 51.27  ? 189  ALA A N   1 
ATOM   1471 C CA  . ALA A 1 189 ? 26.067  2.154   42.249  1.00 51.70  ? 189  ALA A CA  1 
ATOM   1472 C C   . ALA A 1 189 ? 25.066  3.300   42.185  1.00 51.87  ? 189  ALA A C   1 
ATOM   1473 O O   . ALA A 1 189 ? 24.776  3.920   43.207  1.00 53.24  ? 189  ALA A O   1 
ATOM   1474 C CB  . ALA A 1 189 ? 27.494  2.705   42.382  1.00 51.13  ? 189  ALA A CB  1 
ATOM   1475 N N   . PHE A 1 190 ? 24.543  3.578   40.988  1.00 51.71  ? 190  PHE A N   1 
ATOM   1476 C CA  . PHE A 1 190 ? 23.595  4.674   40.757  1.00 51.15  ? 190  PHE A CA  1 
ATOM   1477 C C   . PHE A 1 190 ? 22.178  4.151   40.514  1.00 52.06  ? 190  PHE A C   1 
ATOM   1478 O O   . PHE A 1 190 ? 21.259  4.943   40.299  1.00 52.35  ? 190  PHE A O   1 
ATOM   1479 C CB  . PHE A 1 190 ? 24.018  5.504   39.543  1.00 49.89  ? 190  PHE A CB  1 
ATOM   1480 C CG  . PHE A 1 190 ? 25.393  6.110   39.651  1.00 49.09  ? 190  PHE A CG  1 
ATOM   1481 C CD1 . PHE A 1 190 ? 26.508  5.390   39.268  1.00 49.30  ? 190  PHE A CD1 1 
ATOM   1482 C CD2 . PHE A 1 190 ? 25.567  7.400   40.116  1.00 48.97  ? 190  PHE A CD2 1 
ATOM   1483 C CE1 . PHE A 1 190 ? 27.776  5.938   39.352  1.00 48.88  ? 190  PHE A CE1 1 
ATOM   1484 C CE2 . PHE A 1 190 ? 26.824  7.968   40.205  1.00 47.77  ? 190  PHE A CE2 1 
ATOM   1485 C CZ  . PHE A 1 190 ? 27.937  7.238   39.829  1.00 49.03  ? 190  PHE A CZ  1 
ATOM   1486 N N   . GLY A 1 191 ? 21.995  2.828   40.549  1.00 52.59  ? 191  GLY A N   1 
ATOM   1487 C CA  . GLY A 1 191 ? 20.700  2.222   40.254  1.00 52.89  ? 191  GLY A CA  1 
ATOM   1488 C C   . GLY A 1 191 ? 20.524  1.806   38.802  1.00 52.43  ? 191  GLY A C   1 
ATOM   1489 O O   . GLY A 1 191 ? 19.454  1.340   38.419  1.00 52.80  ? 191  GLY A O   1 
ATOM   1490 N N   . GLY A 1 192 ? 21.564  1.966   37.988  1.00 51.64  ? 192  GLY A N   1 
ATOM   1491 C CA  . GLY A 1 192 ? 21.516  1.532   36.594  1.00 51.18  ? 192  GLY A CA  1 
ATOM   1492 C C   . GLY A 1 192 ? 21.748  0.032   36.453  1.00 51.97  ? 192  GLY A C   1 
ATOM   1493 O O   . GLY A 1 192 ? 22.405  -0.582  37.285  1.00 52.11  ? 192  GLY A O   1 
ATOM   1494 N N   . ASP A 1 193 ? 21.217  -0.538  35.374  1.00 52.05  ? 193  ASP A N   1 
ATOM   1495 C CA  . ASP A 1 193 ? 21.309  -1.957  35.085  1.00 53.04  ? 193  ASP A CA  1 
ATOM   1496 C C   . ASP A 1 193 ? 22.420  -2.199  34.066  1.00 52.34  ? 193  ASP A C   1 
ATOM   1497 O O   . ASP A 1 193 ? 22.229  -1.954  32.888  1.00 51.70  ? 193  ASP A O   1 
ATOM   1498 C CB  . ASP A 1 193 ? 19.965  -2.452  34.523  1.00 53.54  ? 193  ASP A CB  1 
ATOM   1499 C CG  . ASP A 1 193 ? 19.900  -3.963  34.377  1.00 55.86  ? 193  ASP A CG  1 
ATOM   1500 O OD1 . ASP A 1 193 ? 20.936  -4.643  34.566  1.00 55.89  ? 193  ASP A OD1 1 
ATOM   1501 O OD2 . ASP A 1 193 ? 18.795  -4.473  34.074  1.00 58.06  ? 193  ASP A OD2 1 
ATOM   1502 N N   . PRO A 1 194 ? 23.577  -2.724  34.505  1.00 52.78  ? 194  PRO A N   1 
ATOM   1503 C CA  . PRO A 1 194 ? 24.614  -3.011  33.501  1.00 52.37  ? 194  PRO A CA  1 
ATOM   1504 C C   . PRO A 1 194 ? 24.185  -4.062  32.452  1.00 52.97  ? 194  PRO A C   1 
ATOM   1505 O O   . PRO A 1 194 ? 24.811  -4.173  31.402  1.00 52.63  ? 194  PRO A O   1 
ATOM   1506 C CB  . PRO A 1 194 ? 25.798  -3.516  34.349  1.00 52.48  ? 194  PRO A CB  1 
ATOM   1507 C CG  . PRO A 1 194 ? 25.150  -4.082  35.591  1.00 53.95  ? 194  PRO A CG  1 
ATOM   1508 C CD  . PRO A 1 194 ? 24.004  -3.117  35.862  1.00 53.60  ? 194  PRO A CD  1 
ATOM   1509 N N   . MET A 1 195 ? 23.144  -4.836  32.728  1.00 53.99  ? 195  MET A N   1 
ATOM   1510 C CA  . MET A 1 195 ? 22.693  -5.831  31.773  1.00 55.82  ? 195  MET A CA  1 
ATOM   1511 C C   . MET A 1 195 ? 21.660  -5.265  30.785  1.00 54.31  ? 195  MET A C   1 
ATOM   1512 O O   . MET A 1 195 ? 21.095  -6.018  29.984  1.00 54.45  ? 195  MET A O   1 
ATOM   1513 C CB  . MET A 1 195 ? 22.155  -7.079  32.508  1.00 57.40  ? 195  MET A CB  1 
ATOM   1514 C CG  . MET A 1 195 ? 23.252  -7.986  33.096  1.00 58.61  ? 195  MET A CG  1 
ATOM   1515 S SD  . MET A 1 195 ? 22.522  -9.366  33.998  1.00 65.93  ? 195  MET A SD  1 
ATOM   1516 C CE  . MET A 1 195 ? 21.702  -10.240 32.633  1.00 68.61  ? 195  MET A CE  1 
ATOM   1517 N N   . SER A 1 196 ? 21.420  -3.948  30.841  1.00 52.71  ? 196  SER A N   1 
ATOM   1518 C CA  . SER A 1 196 ? 20.595  -3.258  29.862  1.00 51.81  ? 196  SER A CA  1 
ATOM   1519 C C   . SER A 1 196 ? 21.136  -1.865  29.550  1.00 50.49  ? 196  SER A C   1 
ATOM   1520 O O   . SER A 1 196 ? 20.703  -0.867  30.128  1.00 49.89  ? 196  SER A O   1 
ATOM   1521 C CB  . SER A 1 196 ? 19.158  -3.136  30.349  1.00 52.73  ? 196  SER A CB  1 
ATOM   1522 O OG  . SER A 1 196 ? 18.401  -2.374  29.425  1.00 51.68  ? 196  SER A OG  1 
ATOM   1523 N N   . VAL A 1 197 ? 22.050  -1.824  28.591  1.00 49.65  ? 197  VAL A N   1 
ATOM   1524 C CA  . VAL A 1 197 ? 22.740  -0.619  28.164  1.00 48.56  ? 197  VAL A CA  1 
ATOM   1525 C C   . VAL A 1 197 ? 22.482  -0.426  26.678  1.00 48.06  ? 197  VAL A C   1 
ATOM   1526 O O   . VAL A 1 197 ? 22.741  -1.317  25.860  1.00 48.71  ? 197  VAL A O   1 
ATOM   1527 C CB  . VAL A 1 197 ? 24.261  -0.727  28.383  1.00 48.43  ? 197  VAL A CB  1 
ATOM   1528 C CG1 . VAL A 1 197 ? 24.999  0.459   27.721  1.00 47.16  ? 197  VAL A CG1 1 
ATOM   1529 C CG2 . VAL A 1 197 ? 24.578  -0.803  29.869  1.00 48.77  ? 197  VAL A CG2 1 
ATOM   1530 N N   . THR A 1 198 ? 21.966  0.744   26.335  1.00 47.16  ? 198  THR A N   1 
ATOM   1531 C CA  . THR A 1 198 ? 21.679  1.086   24.955  1.00 46.21  ? 198  THR A CA  1 
ATOM   1532 C C   . THR A 1 198 ? 22.583  2.246   24.589  1.00 44.85  ? 198  THR A C   1 
ATOM   1533 O O   . THR A 1 198 ? 22.584  3.252   25.286  1.00 44.01  ? 198  THR A O   1 
ATOM   1534 C CB  . THR A 1 198 ? 20.209  1.466   24.817  1.00 46.64  ? 198  THR A CB  1 
ATOM   1535 O OG1 . THR A 1 198 ? 19.423  0.319   25.136  1.00 48.11  ? 198  THR A OG1 1 
ATOM   1536 C CG2 . THR A 1 198 ? 19.864  1.921   23.410  1.00 45.92  ? 198  THR A CG2 1 
ATOM   1537 N N   . LEU A 1 199 ? 23.379  2.092   23.530  1.00 44.37  ? 199  LEU A N   1 
ATOM   1538 C CA  . LEU A 1 199 ? 24.172  3.223   23.008  1.00 44.05  ? 199  LEU A CA  1 
ATOM   1539 C C   . LEU A 1 199 ? 23.319  4.053   22.069  1.00 43.99  ? 199  LEU A C   1 
ATOM   1540 O O   . LEU A 1 199 ? 22.551  3.506   21.260  1.00 45.24  ? 199  LEU A O   1 
ATOM   1541 C CB  . LEU A 1 199 ? 25.386  2.727   22.237  1.00 43.44  ? 199  LEU A CB  1 
ATOM   1542 C CG  . LEU A 1 199 ? 26.298  1.743   22.963  1.00 43.73  ? 199  LEU A CG  1 
ATOM   1543 C CD1 . LEU A 1 199 ? 27.500  1.450   22.076  1.00 42.15  ? 199  LEU A CD1 1 
ATOM   1544 C CD2 . LEU A 1 199 ? 26.726  2.280   24.333  1.00 40.73  ? 199  LEU A CD2 1 
ATOM   1545 N N   . PHE A 1 200 ? 23.430  5.365   22.170  1.00 43.76  ? 200  PHE A N   1 
ATOM   1546 C CA  . PHE A 1 200 ? 22.863  6.224   21.143  1.00 43.40  ? 200  PHE A CA  1 
ATOM   1547 C C   . PHE A 1 200 ? 23.788  7.375   20.853  1.00 42.91  ? 200  PHE A C   1 
ATOM   1548 O O   . PHE A 1 200 ? 24.517  7.808   21.724  1.00 43.12  ? 200  PHE A O   1 
ATOM   1549 C CB  . PHE A 1 200 ? 21.389  6.609   21.423  1.00 43.37  ? 200  PHE A CB  1 
ATOM   1550 C CG  . PHE A 1 200 ? 21.143  7.653   22.508  1.00 43.32  ? 200  PHE A CG  1 
ATOM   1551 C CD1 . PHE A 1 200 ? 21.626  7.515   23.794  1.00 44.95  ? 200  PHE A CD1 1 
ATOM   1552 C CD2 . PHE A 1 200 ? 20.283  8.710   22.258  1.00 43.16  ? 200  PHE A CD2 1 
ATOM   1553 C CE1 . PHE A 1 200 ? 21.317  8.462   24.788  1.00 43.57  ? 200  PHE A CE1 1 
ATOM   1554 C CE2 . PHE A 1 200 ? 19.985  9.650   23.248  1.00 43.92  ? 200  PHE A CE2 1 
ATOM   1555 C CZ  . PHE A 1 200 ? 20.510  9.521   24.503  1.00 42.96  ? 200  PHE A CZ  1 
ATOM   1556 N N   . GLY A 1 201 ? 23.786  7.830   19.602  1.00 43.01  ? 201  GLY A N   1 
ATOM   1557 C CA  . GLY A 1 201 ? 24.637  8.919   19.166  1.00 42.53  ? 201  GLY A CA  1 
ATOM   1558 C C   . GLY A 1 201 ? 24.156  9.476   17.844  1.00 42.91  ? 201  GLY A C   1 
ATOM   1559 O O   . GLY A 1 201 ? 23.409  8.813   17.112  1.00 43.77  ? 201  GLY A O   1 
ATOM   1560 N N   . GLU A 1 202 ? 24.560  10.711  17.561  1.00 42.32  ? 202  GLU A N   1 
ATOM   1561 C CA  . GLU A 1 202 ? 24.252  11.364  16.313  1.00 42.10  ? 202  GLU A CA  1 
ATOM   1562 C C   . GLU A 1 202 ? 25.523  11.684  15.510  1.00 42.02  ? 202  GLU A C   1 
ATOM   1563 O O   . GLU A 1 202 ? 26.598  11.994  16.078  1.00 41.39  ? 202  GLU A O   1 
ATOM   1564 C CB  . GLU A 1 202 ? 23.432  12.621  16.572  1.00 42.70  ? 202  GLU A CB  1 
ATOM   1565 C CG  . GLU A 1 202 ? 22.941  13.350  15.303  1.00 42.93  ? 202  GLU A CG  1 
ATOM   1566 C CD  . GLU A 1 202 ? 23.838  14.515  14.901  1.00 44.07  ? 202  GLU A CD  1 
ATOM   1567 O OE1 . GLU A 1 202 ? 24.787  14.831  15.653  1.00 44.27  ? 202  GLU A OE1 1 
ATOM   1568 O OE2 . GLU A 1 202 ? 23.563  15.123  13.845  1.00 43.98  ? 202  GLU A OE2 1 
ATOM   1569 N N   . ALA A 1 203 ? 25.395  11.583  14.187  1.00 41.68  ? 203  ALA A N   1 
ATOM   1570 C CA  . ALA A 1 203 ? 26.465  11.951  13.255  1.00 41.42  ? 203  ALA A CA  1 
ATOM   1571 C C   . ALA A 1 203 ? 27.702  11.089  13.545  1.00 40.95  ? 203  ALA A C   1 
ATOM   1572 O O   . ALA A 1 203 ? 27.595  9.853   13.567  1.00 41.65  ? 203  ALA A O   1 
ATOM   1573 C CB  . ALA A 1 203 ? 26.768  13.468  13.341  1.00 40.16  ? 203  ALA A CB  1 
ATOM   1574 N N   . ALA A 1 204 ? 28.850  11.702  13.820  1.00 40.43  ? 204  ALA A N   1 
ATOM   1575 C CA  . ALA A 1 204 ? 30.056  10.932  14.183  1.00 40.68  ? 204  ALA A CA  1 
ATOM   1576 C C   . ALA A 1 204 ? 29.837  10.033  15.419  1.00 41.71  ? 204  ALA A C   1 
ATOM   1577 O O   . ALA A 1 204 ? 30.479  8.974   15.566  1.00 41.90  ? 204  ALA A O   1 
ATOM   1578 C CB  . ALA A 1 204 ? 31.259  11.849  14.395  1.00 40.73  ? 204  ALA A CB  1 
ATOM   1579 N N   . GLY A 1 205 ? 28.926  10.450  16.299  1.00 41.41  ? 205  GLY A N   1 
ATOM   1580 C CA  . GLY A 1 205 ? 28.558  9.661   17.463  1.00 41.61  ? 205  GLY A CA  1 
ATOM   1581 C C   . GLY A 1 205 ? 27.846  8.395   17.050  1.00 42.02  ? 205  GLY A C   1 
ATOM   1582 O O   . GLY A 1 205 ? 28.069  7.347   17.637  1.00 43.67  ? 205  GLY A O   1 
ATOM   1583 N N   . ALA A 1 206 ? 26.986  8.506   16.041  1.00 41.48  ? 206  ALA A N   1 
ATOM   1584 C CA  . ALA A 1 206 ? 26.323  7.356   15.402  1.00 41.86  ? 206  ALA A CA  1 
ATOM   1585 C C   . ALA A 1 206 ? 27.320  6.428   14.703  1.00 42.05  ? 206  ALA A C   1 
ATOM   1586 O O   . ALA A 1 206 ? 27.232  5.209   14.807  1.00 43.24  ? 206  ALA A O   1 
ATOM   1587 C CB  . ALA A 1 206 ? 25.263  7.856   14.393  1.00 41.20  ? 206  ALA A CB  1 
ATOM   1588 N N   . ALA A 1 207 ? 28.255  7.012   13.961  1.00 42.04  ? 207  ALA A N   1 
ATOM   1589 C CA  . ALA A 1 207 ? 29.352  6.272   13.343  1.00 41.98  ? 207  ALA A CA  1 
ATOM   1590 C C   . ALA A 1 207 ? 30.096  5.470   14.415  1.00 42.69  ? 207  ALA A C   1 
ATOM   1591 O O   . ALA A 1 207 ? 30.372  4.285   14.241  1.00 44.32  ? 207  ALA A O   1 
ATOM   1592 C CB  . ALA A 1 207 ? 30.319  7.265   12.616  1.00 41.19  ? 207  ALA A CB  1 
ATOM   1593 N N   . SER A 1 208 ? 30.416  6.129   15.526  1.00 42.61  ? 208  SER A N   1 
ATOM   1594 C CA  . SER A 1 208 ? 31.089  5.504   16.669  1.00 42.60  ? 208  SER A CA  1 
ATOM   1595 C C   . SER A 1 208 ? 30.282  4.326   17.222  1.00 43.62  ? 208  SER A C   1 
ATOM   1596 O O   . SER A 1 208 ? 30.837  3.251   17.438  1.00 44.79  ? 208  SER A O   1 
ATOM   1597 C CB  . SER A 1 208 ? 31.314  6.538   17.783  1.00 42.13  ? 208  SER A CB  1 
ATOM   1598 O OG  . SER A 1 208 ? 32.193  7.587   17.373  1.00 41.22  ? 208  SER A OG  1 
ATOM   1599 N N   . VAL A 1 209 ? 28.979  4.526   17.444  1.00 43.52  ? 209  VAL A N   1 
ATOM   1600 C CA  . VAL A 1 209 ? 28.082  3.434   17.866  1.00 43.73  ? 209  VAL A CA  1 
ATOM   1601 C C   . VAL A 1 209 ? 28.241  2.252   16.919  1.00 44.63  ? 209  VAL A C   1 
ATOM   1602 O O   . VAL A 1 209 ? 28.416  1.116   17.354  1.00 46.06  ? 209  VAL A O   1 
ATOM   1603 C CB  . VAL A 1 209 ? 26.583  3.876   17.893  1.00 43.67  ? 209  VAL A CB  1 
ATOM   1604 C CG1 . VAL A 1 209 ? 25.649  2.674   18.047  1.00 43.47  ? 209  VAL A CG1 1 
ATOM   1605 C CG2 . VAL A 1 209 ? 26.333  4.910   19.008  1.00 42.91  ? 209  VAL A CG2 1 
ATOM   1606 N N   . GLY A 1 210 ? 28.185  2.533   15.619  1.00 44.61  ? 210  GLY A N   1 
ATOM   1607 C CA  . GLY A 1 210 ? 28.344  1.522   14.586  1.00 45.33  ? 210  GLY A CA  1 
ATOM   1608 C C   . GLY A 1 210 ? 29.667  0.785   14.658  1.00 45.89  ? 210  GLY A C   1 
ATOM   1609 O O   . GLY A 1 210 ? 29.723  -0.418  14.448  1.00 45.84  ? 210  GLY A O   1 
ATOM   1610 N N   . MET A 1 211 ? 30.742  1.501   14.949  1.00 45.78  ? 211  MET A N   1 
ATOM   1611 C CA  . MET A 1 211 ? 32.041  0.846   15.123  1.00 47.30  ? 211  MET A CA  1 
ATOM   1612 C C   . MET A 1 211 ? 32.130  -0.020  16.377  1.00 46.89  ? 211  MET A C   1 
ATOM   1613 O O   . MET A 1 211 ? 32.810  -1.061  16.373  1.00 47.89  ? 211  MET A O   1 
ATOM   1614 C CB  . MET A 1 211 ? 33.151  1.870   15.072  1.00 47.21  ? 211  MET A CB  1 
ATOM   1615 C CG  . MET A 1 211 ? 33.261  2.444   13.654  1.00 48.84  ? 211  MET A CG  1 
ATOM   1616 S SD  . MET A 1 211 ? 34.279  3.875   13.630  1.00 50.82  ? 211  MET A SD  1 
ATOM   1617 C CE  . MET A 1 211 ? 33.843  4.556   12.020  1.00 49.02  ? 211  MET A CE  1 
ATOM   1618 N N   . HIS A 1 212 ? 31.411  0.350   17.430  1.00 45.96  ? 212  HIS A N   1 
ATOM   1619 C CA  . HIS A 1 212 ? 31.297  -0.548  18.577  1.00 45.96  ? 212  HIS A CA  1 
ATOM   1620 C C   . HIS A 1 212 ? 30.537  -1.818  18.226  1.00 46.72  ? 212  HIS A C   1 
ATOM   1621 O O   . HIS A 1 212 ? 30.890  -2.875  18.719  1.00 46.58  ? 212  HIS A O   1 
ATOM   1622 C CB  . HIS A 1 212 ? 30.686  0.143   19.790  1.00 45.58  ? 212  HIS A CB  1 
ATOM   1623 C CG  . HIS A 1 212 ? 31.567  1.209   20.357  1.00 45.56  ? 212  HIS A CG  1 
ATOM   1624 N ND1 . HIS A 1 212 ? 32.802  0.936   20.909  1.00 47.04  ? 212  HIS A ND1 1 
ATOM   1625 C CD2 . HIS A 1 212 ? 31.423  2.549   20.392  1.00 43.61  ? 212  HIS A CD2 1 
ATOM   1626 C CE1 . HIS A 1 212 ? 33.370  2.068   21.277  1.00 45.54  ? 212  HIS A CE1 1 
ATOM   1627 N NE2 . HIS A 1 212 ? 32.553  3.062   20.974  1.00 44.47  ? 212  HIS A NE2 1 
ATOM   1628 N N   . ILE A 1 213 ? 29.510  -1.717  17.377  1.00 46.84  ? 213  ILE A N   1 
ATOM   1629 C CA  . ILE A 1 213 ? 28.808  -2.912  16.861  1.00 47.73  ? 213  ILE A CA  1 
ATOM   1630 C C   . ILE A 1 213 ? 29.774  -3.789  16.067  1.00 49.43  ? 213  ILE A C   1 
ATOM   1631 O O   . ILE A 1 213 ? 29.687  -5.008  16.100  1.00 50.67  ? 213  ILE A O   1 
ATOM   1632 C CB  . ILE A 1 213 ? 27.599  -2.548  15.954  1.00 47.50  ? 213  ILE A CB  1 
ATOM   1633 C CG1 . ILE A 1 213 ? 26.530  -1.805  16.762  1.00 46.85  ? 213  ILE A CG1 1 
ATOM   1634 C CG2 . ILE A 1 213 ? 26.998  -3.820  15.247  1.00 48.28  ? 213  ILE A CG2 1 
ATOM   1635 C CD1 . ILE A 1 213 ? 25.366  -1.250  15.937  1.00 46.08  ? 213  ILE A CD1 1 
ATOM   1636 N N   . LEU A 1 214 ? 30.707  -3.169  15.359  1.00 50.18  ? 214  LEU A N   1 
ATOM   1637 C CA  . LEU A 1 214 ? 31.580  -3.909  14.455  1.00 51.74  ? 214  LEU A CA  1 
ATOM   1638 C C   . LEU A 1 214 ? 32.881  -4.358  15.105  1.00 52.94  ? 214  LEU A C   1 
ATOM   1639 O O   . LEU A 1 214 ? 33.679  -5.055  14.469  1.00 54.21  ? 214  LEU A O   1 
ATOM   1640 C CB  . LEU A 1 214 ? 31.860  -3.069  13.200  1.00 51.32  ? 214  LEU A CB  1 
ATOM   1641 C CG  . LEU A 1 214 ? 30.623  -2.773  12.340  1.00 51.14  ? 214  LEU A CG  1 
ATOM   1642 C CD1 . LEU A 1 214 ? 30.960  -1.780  11.229  1.00 49.34  ? 214  LEU A CD1 1 
ATOM   1643 C CD2 . LEU A 1 214 ? 30.017  -4.077  11.780  1.00 51.68  ? 214  LEU A CD2 1 
ATOM   1644 N N   . SER A 1 215 ? 33.092  -3.982  16.367  1.00 53.23  ? 215  SER A N   1 
ATOM   1645 C CA  . SER A 1 215 ? 34.340  -4.310  17.076  1.00 54.24  ? 215  SER A CA  1 
ATOM   1646 C C   . SER A 1 215 ? 34.084  -5.224  18.261  1.00 55.33  ? 215  SER A C   1 
ATOM   1647 O O   . SER A 1 215 ? 33.396  -4.861  19.199  1.00 54.36  ? 215  SER A O   1 
ATOM   1648 C CB  . SER A 1 215 ? 35.053  -3.045  17.545  1.00 53.37  ? 215  SER A CB  1 
ATOM   1649 O OG  . SER A 1 215 ? 36.380  -3.356  17.924  1.00 53.87  ? 215  SER A OG  1 
ATOM   1650 N N   . LEU A 1 216 ? 34.680  -6.410  18.207  1.00 57.50  ? 216  LEU A N   1 
ATOM   1651 C CA  . LEU A 1 216 ? 34.362  -7.507  19.123  1.00 58.81  ? 216  LEU A CA  1 
ATOM   1652 C C   . LEU A 1 216 ? 34.442  -7.121  20.607  1.00 57.98  ? 216  LEU A C   1 
ATOM   1653 O O   . LEU A 1 216 ? 33.476  -7.320  21.337  1.00 58.59  ? 216  LEU A O   1 
ATOM   1654 C CB  . LEU A 1 216 ? 35.271  -8.710  18.844  1.00 60.61  ? 216  LEU A CB  1 
ATOM   1655 C CG  . LEU A 1 216 ? 34.659  -10.102 18.939  1.00 64.06  ? 216  LEU A CG  1 
ATOM   1656 C CD1 . LEU A 1 216 ? 34.546  -10.696 17.517  1.00 67.03  ? 216  LEU A CD1 1 
ATOM   1657 C CD2 . LEU A 1 216 ? 35.519  -11.019 19.847  1.00 67.06  ? 216  LEU A CD2 1 
ATOM   1658 N N   . PRO A 1 217 ? 35.574  -6.548  21.057  1.00 56.97  ? 217  PRO A N   1 
ATOM   1659 C CA  . PRO A 1 217 ? 35.657  -6.220  22.488  1.00 56.76  ? 217  PRO A CA  1 
ATOM   1660 C C   . PRO A 1 217 ? 34.616  -5.215  23.002  1.00 55.83  ? 217  PRO A C   1 
ATOM   1661 O O   . PRO A 1 217 ? 34.400  -5.137  24.201  1.00 55.61  ? 217  PRO A O   1 
ATOM   1662 C CB  . PRO A 1 217 ? 37.080  -5.662  22.641  1.00 56.44  ? 217  PRO A CB  1 
ATOM   1663 C CG  . PRO A 1 217 ? 37.828  -6.166  21.440  1.00 56.91  ? 217  PRO A CG  1 
ATOM   1664 C CD  . PRO A 1 217 ? 36.810  -6.184  20.346  1.00 56.78  ? 217  PRO A CD  1 
ATOM   1665 N N   . SER A 1 218 ? 33.980  -4.452  22.117  1.00 55.31  ? 218  SER A N   1 
ATOM   1666 C CA  . SER A 1 218 ? 32.895  -3.548  22.532  1.00 55.19  ? 218  SER A CA  1 
ATOM   1667 C C   . SER A 1 218 ? 31.548  -4.256  22.716  1.00 56.13  ? 218  SER A C   1 
ATOM   1668 O O   . SER A 1 218 ? 30.693  -3.755  23.441  1.00 55.26  ? 218  SER A O   1 
ATOM   1669 C CB  . SER A 1 218 ? 32.729  -2.394  21.537  1.00 53.95  ? 218  SER A CB  1 
ATOM   1670 O OG  . SER A 1 218 ? 33.833  -1.500  21.590  1.00 53.62  ? 218  SER A OG  1 
ATOM   1671 N N   . ARG A 1 219 ? 31.365  -5.412  22.075  1.00 58.22  ? 219  ARG A N   1 
ATOM   1672 C CA  . ARG A 1 219 ? 30.035  -6.065  22.005  1.00 59.38  ? 219  ARG A CA  1 
ATOM   1673 C C   . ARG A 1 219 ? 29.525  -6.640  23.315  1.00 59.75  ? 219  ARG A C   1 
ATOM   1674 O O   . ARG A 1 219 ? 28.317  -6.804  23.499  1.00 60.87  ? 219  ARG A O   1 
ATOM   1675 C CB  . ARG A 1 219 ? 29.993  -7.173  20.929  1.00 61.27  ? 219  ARG A CB  1 
ATOM   1676 C CG  . ARG A 1 219 ? 29.704  -6.687  19.486  1.00 63.73  ? 219  ARG A CG  1 
ATOM   1677 C CD  . ARG A 1 219 ? 28.387  -5.873  19.306  1.00 67.86  ? 219  ARG A CD  1 
ATOM   1678 N NE  . ARG A 1 219 ? 27.131  -6.648  19.280  1.00 71.26  ? 219  ARG A NE  1 
ATOM   1679 C CZ  . ARG A 1 219 ? 26.231  -6.730  20.279  1.00 73.31  ? 219  ARG A CZ  1 
ATOM   1680 N NH1 . ARG A 1 219 ? 26.410  -6.123  21.455  1.00 72.68  ? 219  ARG A NH1 1 
ATOM   1681 N NH2 . ARG A 1 219 ? 25.127  -7.453  20.112  1.00 74.61  ? 219  ARG A NH2 1 
ATOM   1682 N N   . SER A 1 220 ? 30.437  -6.960  24.216  1.00 59.55  ? 220  SER A N   1 
ATOM   1683 C CA  . SER A 1 220 ? 30.084  -7.394  25.551  1.00 59.71  ? 220  SER A CA  1 
ATOM   1684 C C   . SER A 1 220 ? 29.692  -6.226  26.449  1.00 57.99  ? 220  SER A C   1 
ATOM   1685 O O   . SER A 1 220 ? 29.251  -6.442  27.581  1.00 58.55  ? 220  SER A O   1 
ATOM   1686 C CB  . SER A 1 220 ? 31.279  -8.122  26.163  1.00 60.93  ? 220  SER A CB  1 
ATOM   1687 O OG  . SER A 1 220 ? 32.478  -7.414  25.868  1.00 61.56  ? 220  SER A OG  1 
ATOM   1688 N N   . LEU A 1 221 ? 29.841  -4.992  25.959  1.00 55.74  ? 221  LEU A N   1 
ATOM   1689 C CA  . LEU A 1 221 ? 29.646  -3.804  26.801  1.00 53.85  ? 221  LEU A CA  1 
ATOM   1690 C C   . LEU A 1 221 ? 28.321  -3.086  26.582  1.00 52.85  ? 221  LEU A C   1 
ATOM   1691 O O   . LEU A 1 221 ? 28.081  -2.057  27.219  1.00 51.94  ? 221  LEU A O   1 
ATOM   1692 C CB  . LEU A 1 221 ? 30.811  -2.817  26.624  1.00 52.77  ? 221  LEU A CB  1 
ATOM   1693 C CG  . LEU A 1 221 ? 32.221  -3.402  26.794  1.00 52.91  ? 221  LEU A CG  1 
ATOM   1694 C CD1 . LEU A 1 221 ? 33.298  -2.368  26.401  1.00 49.75  ? 221  LEU A CD1 1 
ATOM   1695 C CD2 . LEU A 1 221 ? 32.419  -3.957  28.217  1.00 50.87  ? 221  LEU A CD2 1 
ATOM   1696 N N   . PHE A 1 222 ? 27.464  -3.621  25.709  1.00 52.67  ? 222  PHE A N   1 
ATOM   1697 C CA  . PHE A 1 222 ? 26.127  -3.045  25.475  1.00 51.99  ? 222  PHE A CA  1 
ATOM   1698 C C   . PHE A 1 222 ? 25.202  -4.036  24.782  1.00 52.51  ? 222  PHE A C   1 
ATOM   1699 O O   . PHE A 1 222 ? 25.663  -5.052  24.283  1.00 52.67  ? 222  PHE A O   1 
ATOM   1700 C CB  . PHE A 1 222 ? 26.202  -1.786  24.618  1.00 51.47  ? 222  PHE A CB  1 
ATOM   1701 C CG  . PHE A 1 222 ? 26.589  -2.039  23.189  1.00 51.16  ? 222  PHE A CG  1 
ATOM   1702 C CD1 . PHE A 1 222 ? 27.916  -2.266  22.848  1.00 51.22  ? 222  PHE A CD1 1 
ATOM   1703 C CD2 . PHE A 1 222 ? 25.631  -2.026  22.185  1.00 51.16  ? 222  PHE A CD2 1 
ATOM   1704 C CE1 . PHE A 1 222 ? 28.280  -2.484  21.534  1.00 52.57  ? 222  PHE A CE1 1 
ATOM   1705 C CE2 . PHE A 1 222 ? 25.983  -2.248  20.862  1.00 52.00  ? 222  PHE A CE2 1 
ATOM   1706 C CZ  . PHE A 1 222 ? 27.311  -2.468  20.531  1.00 52.38  ? 222  PHE A CZ  1 
ATOM   1707 N N   . HIS A 1 223 ? 23.913  -3.706  24.707  1.00 52.00  ? 223  HIS A N   1 
ATOM   1708 C CA  . HIS A 1 223 ? 22.911  -4.663  24.242  1.00 53.40  ? 223  HIS A CA  1 
ATOM   1709 C C   . HIS A 1 223 ? 22.083  -4.229  23.029  1.00 53.53  ? 223  HIS A C   1 
ATOM   1710 O O   . HIS A 1 223 ? 21.616  -5.077  22.254  1.00 54.05  ? 223  HIS A O   1 
ATOM   1711 C CB  . HIS A 1 223 ? 22.017  -5.043  25.425  1.00 54.29  ? 223  HIS A CB  1 
ATOM   1712 C CG  . HIS A 1 223 ? 22.799  -5.367  26.658  1.00 54.35  ? 223  HIS A CG  1 
ATOM   1713 N ND1 . HIS A 1 223 ? 23.136  -6.658  27.008  1.00 56.11  ? 223  HIS A ND1 1 
ATOM   1714 C CD2 . HIS A 1 223 ? 23.390  -4.561  27.572  1.00 52.38  ? 223  HIS A CD2 1 
ATOM   1715 C CE1 . HIS A 1 223 ? 23.874  -6.632  28.103  1.00 56.36  ? 223  HIS A CE1 1 
ATOM   1716 N NE2 . HIS A 1 223 ? 24.049  -5.370  28.461  1.00 54.99  ? 223  HIS A NE2 1 
ATOM   1717 N N   . ARG A 1 224 ? 21.900  -2.921  22.870  1.00 52.53  ? 224  ARG A N   1 
ATOM   1718 C CA  . ARG A 1 224 ? 21.101  -2.345  21.790  1.00 52.51  ? 224  ARG A CA  1 
ATOM   1719 C C   . ARG A 1 224 ? 21.744  -1.023  21.366  1.00 50.36  ? 224  ARG A C   1 
ATOM   1720 O O   . ARG A 1 224 ? 22.543  -0.469  22.107  1.00 49.36  ? 224  ARG A O   1 
ATOM   1721 C CB  . ARG A 1 224 ? 19.685  -2.094  22.288  1.00 52.93  ? 224  ARG A CB  1 
ATOM   1722 C CG  . ARG A 1 224 ? 18.834  -3.346  22.287  1.00 56.61  ? 224  ARG A CG  1 
ATOM   1723 C CD  . ARG A 1 224 ? 17.520  -3.136  23.013  1.00 57.37  ? 224  ARG A CD  1 
ATOM   1724 N NE  . ARG A 1 224 ? 17.796  -2.887  24.415  1.00 60.27  ? 224  ARG A NE  1 
ATOM   1725 C CZ  . ARG A 1 224 ? 17.974  -3.817  25.348  1.00 61.27  ? 224  ARG A CZ  1 
ATOM   1726 N NH1 . ARG A 1 224 ? 17.883  -5.113  25.071  1.00 62.35  ? 224  ARG A NH1 1 
ATOM   1727 N NH2 . ARG A 1 224 ? 18.244  -3.426  26.585  1.00 62.04  ? 224  ARG A NH2 1 
ATOM   1728 N N   . ALA A 1 225 ? 21.399  -0.528  20.183  1.00 49.37  ? 225  ALA A N   1 
ATOM   1729 C CA  . ALA A 1 225 ? 22.074  0.641   19.627  1.00 47.86  ? 225  ALA A CA  1 
ATOM   1730 C C   . ALA A 1 225 ? 21.137  1.514   18.805  1.00 47.21  ? 225  ALA A C   1 
ATOM   1731 O O   . ALA A 1 225 ? 20.256  1.006   18.108  1.00 47.40  ? 225  ALA A O   1 
ATOM   1732 C CB  . ALA A 1 225 ? 23.263  0.197   18.765  1.00 47.75  ? 225  ALA A CB  1 
ATOM   1733 N N   . VAL A 1 226 ? 21.365  2.828   18.881  1.00 46.15  ? 226  VAL A N   1 
ATOM   1734 C CA  . VAL A 1 226 ? 20.647  3.809   18.080  1.00 45.42  ? 226  VAL A CA  1 
ATOM   1735 C C   . VAL A 1 226 ? 21.645  4.650   17.306  1.00 44.02  ? 226  VAL A C   1 
ATOM   1736 O O   . VAL A 1 226 ? 22.529  5.278   17.899  1.00 44.11  ? 226  VAL A O   1 
ATOM   1737 C CB  . VAL A 1 226 ? 19.795  4.748   18.947  1.00 45.54  ? 226  VAL A CB  1 
ATOM   1738 C CG1 . VAL A 1 226 ? 18.942  5.694   18.045  1.00 44.57  ? 226  VAL A CG1 1 
ATOM   1739 C CG2 . VAL A 1 226 ? 18.931  3.950   19.909  1.00 45.50  ? 226  VAL A CG2 1 
ATOM   1740 N N   . LEU A 1 227 ? 21.505  4.665   15.986  1.00 43.56  ? 227  LEU A N   1 
ATOM   1741 C CA  . LEU A 1 227 ? 22.351  5.463   15.110  1.00 42.22  ? 227  LEU A CA  1 
ATOM   1742 C C   . LEU A 1 227 ? 21.544  6.557   14.424  1.00 42.54  ? 227  LEU A C   1 
ATOM   1743 O O   . LEU A 1 227 ? 20.783  6.294   13.495  1.00 42.09  ? 227  LEU A O   1 
ATOM   1744 C CB  . LEU A 1 227 ? 23.016  4.580   14.058  1.00 42.69  ? 227  LEU A CB  1 
ATOM   1745 C CG  . LEU A 1 227 ? 24.033  3.513   14.516  1.00 42.95  ? 227  LEU A CG  1 
ATOM   1746 C CD1 . LEU A 1 227 ? 23.324  2.249   15.013  1.00 41.41  ? 227  LEU A CD1 1 
ATOM   1747 C CD2 . LEU A 1 227 ? 25.012  3.182   13.377  1.00 41.69  ? 227  LEU A CD2 1 
ATOM   1748 N N   . GLN A 1 228 ? 21.750  7.803   14.861  1.00 42.68  ? 228  GLN A N   1 
ATOM   1749 C CA  . GLN A 1 228 ? 21.048  8.953   14.331  1.00 42.06  ? 228  GLN A CA  1 
ATOM   1750 C C   . GLN A 1 228 ? 21.942  9.714   13.351  1.00 42.14  ? 228  GLN A C   1 
ATOM   1751 O O   . GLN A 1 228 ? 22.974  10.264  13.749  1.00 41.14  ? 228  GLN A O   1 
ATOM   1752 C CB  . GLN A 1 228 ? 20.638  9.886   15.481  1.00 42.47  ? 228  GLN A CB  1 
ATOM   1753 C CG  . GLN A 1 228 ? 19.830  9.226   16.599  1.00 42.00  ? 228  GLN A CG  1 
ATOM   1754 C CD  . GLN A 1 228 ? 19.619  10.110  17.809  1.00 42.60  ? 228  GLN A CD  1 
ATOM   1755 O OE1 . GLN A 1 228 ? 19.386  9.605   18.900  1.00 44.64  ? 228  GLN A OE1 1 
ATOM   1756 N NE2 . GLN A 1 228 ? 19.671  11.432  17.625  1.00 43.11  ? 228  GLN A NE2 1 
ATOM   1757 N N   . SER A 1 229 ? 21.549  9.752   12.075  1.00 42.18  ? 229  SER A N   1 
ATOM   1758 C CA  . SER A 1 229 ? 22.253  10.552  11.055  1.00 41.81  ? 229  SER A CA  1 
ATOM   1759 C C   . SER A 1 229 ? 23.735  10.269  10.928  1.00 41.50  ? 229  SER A C   1 
ATOM   1760 O O   . SER A 1 229 ? 24.540  11.191  10.760  1.00 42.00  ? 229  SER A O   1 
ATOM   1761 C CB  . SER A 1 229 ? 22.065  12.062  11.309  1.00 41.27  ? 229  SER A CB  1 
ATOM   1762 O OG  . SER A 1 229 ? 20.699  12.418  11.216  1.00 42.12  ? 229  SER A OG  1 
ATOM   1763 N N   . GLY A 1 230 ? 24.103  9.000   10.970  1.00 42.33  ? 230  GLY A N   1 
ATOM   1764 C CA  . GLY A 1 230 ? 25.497  8.624   10.864  1.00 42.32  ? 230  GLY A CA  1 
ATOM   1765 C C   . GLY A 1 230 ? 25.672  7.138   10.863  1.00 42.82  ? 230  GLY A C   1 
ATOM   1766 O O   . GLY A 1 230 ? 24.876  6.411   11.453  1.00 44.13  ? 230  GLY A O   1 
ATOM   1767 N N   . THR A 1 231 ? 26.736  6.692   10.204  1.00 43.65  ? 231  THR A N   1 
ATOM   1768 C CA  . THR A 1 231 ? 27.021  5.277   10.033  1.00 43.99  ? 231  THR A CA  1 
ATOM   1769 C C   . THR A 1 231 ? 28.526  5.046   10.021  1.00 43.85  ? 231  THR A C   1 
ATOM   1770 O O   . THR A 1 231 ? 29.304  5.960   9.750   1.00 43.37  ? 231  THR A O   1 
ATOM   1771 C CB  . THR A 1 231 ? 26.424  4.745   8.695   1.00 44.76  ? 231  THR A CB  1 
ATOM   1772 O OG1 . THR A 1 231 ? 26.944  5.516   7.608   1.00 45.73  ? 231  THR A OG1 1 
ATOM   1773 C CG2 . THR A 1 231 ? 24.893  4.825   8.690   1.00 44.30  ? 231  THR A CG2 1 
ATOM   1774 N N   . PRO A 1 232 ? 28.951  3.818   10.344  1.00 44.10  ? 232  PRO A N   1 
ATOM   1775 C CA  . PRO A 1 232 ? 30.383  3.497   10.289  1.00 44.23  ? 232  PRO A CA  1 
ATOM   1776 C C   . PRO A 1 232 ? 30.880  3.334   8.846   1.00 44.91  ? 232  PRO A C   1 
ATOM   1777 O O   . PRO A 1 232 ? 32.009  3.679   8.537   1.00 44.23  ? 232  PRO A O   1 
ATOM   1778 C CB  . PRO A 1 232 ? 30.474  2.185   11.072  1.00 44.30  ? 232  PRO A CB  1 
ATOM   1779 C CG  . PRO A 1 232 ? 29.126  1.534   10.876  1.00 44.64  ? 232  PRO A CG  1 
ATOM   1780 C CD  . PRO A 1 232 ? 28.134  2.680   10.818  1.00 44.50  ? 232  PRO A CD  1 
ATOM   1781 N N   . ASN A 1 233 ? 30.023  2.789   7.988   1.00 46.34  ? 233  ASN A N   1 
ATOM   1782 C CA  . ASN A 1 233 ? 30.255  2.749   6.554   1.00 47.00  ? 233  ASN A CA  1 
ATOM   1783 C C   . ASN A 1 233 ? 29.990  4.135   5.958   1.00 46.97  ? 233  ASN A C   1 
ATOM   1784 O O   . ASN A 1 233 ? 29.398  5.002   6.612   1.00 47.29  ? 233  ASN A O   1 
ATOM   1785 C CB  . ASN A 1 233 ? 29.330  1.729   5.889   1.00 47.33  ? 233  ASN A CB  1 
ATOM   1786 C CG  . ASN A 1 233 ? 27.865  1.991   6.191   1.00 46.99  ? 233  ASN A CG  1 
ATOM   1787 O OD1 . ASN A 1 233 ? 27.463  1.954   7.352   1.00 46.38  ? 233  ASN A OD1 1 
ATOM   1788 N ND2 . ASN A 1 233 ? 27.060  2.246   5.156   1.00 45.14  ? 233  ASN A ND2 1 
ATOM   1789 N N   . GLY A 1 234 ? 30.417  4.332   4.714   1.00 47.56  ? 234  GLY A N   1 
ATOM   1790 C CA  . GLY A 1 234 ? 30.230  5.596   4.017   1.00 47.25  ? 234  GLY A CA  1 
ATOM   1791 C C   . GLY A 1 234 ? 31.541  6.317   3.821   1.00 47.04  ? 234  GLY A C   1 
ATOM   1792 O O   . GLY A 1 234 ? 32.581  5.835   4.259   1.00 48.30  ? 234  GLY A O   1 
ATOM   1793 N N   . PRO A 1 235 ? 31.501  7.475   3.146   1.00 45.87  ? 235  PRO A N   1 
ATOM   1794 C CA  . PRO A 1 235 ? 32.680  8.157   2.646   1.00 45.65  ? 235  PRO A CA  1 
ATOM   1795 C C   . PRO A 1 235 ? 33.522  8.989   3.617   1.00 44.80  ? 235  PRO A C   1 
ATOM   1796 O O   . PRO A 1 235 ? 34.653  9.348   3.266   1.00 44.36  ? 235  PRO A O   1 
ATOM   1797 C CB  . PRO A 1 235 ? 32.095  9.065   1.562   1.00 46.01  ? 235  PRO A CB  1 
ATOM   1798 C CG  . PRO A 1 235 ? 30.764  9.392   2.041   1.00 45.26  ? 235  PRO A CG  1 
ATOM   1799 C CD  . PRO A 1 235 ? 30.264  8.150   2.720   1.00 45.81  ? 235  PRO A CD  1 
ATOM   1800 N N   . TRP A 1 236 ? 33.017  9.268   4.818   1.00 43.86  ? 236  TRP A N   1 
ATOM   1801 C CA  . TRP A 1 236 ? 33.711  10.183  5.741   1.00 43.09  ? 236  TRP A CA  1 
ATOM   1802 C C   . TRP A 1 236 ? 34.126  9.618   7.092   1.00 42.90  ? 236  TRP A C   1 
ATOM   1803 O O   . TRP A 1 236 ? 34.946  10.229  7.767   1.00 42.45  ? 236  TRP A O   1 
ATOM   1804 C CB  . TRP A 1 236 ? 32.847  11.437  5.997   1.00 42.73  ? 236  TRP A CB  1 
ATOM   1805 C CG  . TRP A 1 236 ? 31.530  11.121  6.559   1.00 42.03  ? 236  TRP A CG  1 
ATOM   1806 C CD1 . TRP A 1 236 ? 30.381  10.917  5.858   1.00 43.14  ? 236  TRP A CD1 1 
ATOM   1807 C CD2 . TRP A 1 236 ? 31.197  10.924  7.942   1.00 42.15  ? 236  TRP A CD2 1 
ATOM   1808 N NE1 . TRP A 1 236 ? 29.353  10.633  6.713   1.00 43.11  ? 236  TRP A NE1 1 
ATOM   1809 C CE2 . TRP A 1 236 ? 29.825  10.626  7.998   1.00 41.48  ? 236  TRP A CE2 1 
ATOM   1810 C CE3 . TRP A 1 236 ? 31.925  10.975  9.140   1.00 42.66  ? 236  TRP A CE3 1 
ATOM   1811 C CZ2 . TRP A 1 236 ? 29.159  10.378  9.198   1.00 41.67  ? 236  TRP A CZ2 1 
ATOM   1812 C CZ3 . TRP A 1 236 ? 31.260  10.727  10.328  1.00 42.07  ? 236  TRP A CZ3 1 
ATOM   1813 C CH2 . TRP A 1 236 ? 29.892  10.440  10.348  1.00 41.50  ? 236  TRP A CH2 1 
ATOM   1814 N N   . ALA A 1 237 ? 33.573  8.480   7.498   1.00 43.16  ? 237  ALA A N   1 
ATOM   1815 C CA  . ALA A 1 237 ? 33.711  8.011   8.890   1.00 43.09  ? 237  ALA A CA  1 
ATOM   1816 C C   . ALA A 1 237 ? 35.019  7.273   9.174   1.00 43.28  ? 237  ALA A C   1 
ATOM   1817 O O   . ALA A 1 237 ? 35.401  7.134   10.330  1.00 42.68  ? 237  ALA A O   1 
ATOM   1818 C CB  . ALA A 1 237 ? 32.515  7.121   9.283   1.00 42.91  ? 237  ALA A CB  1 
ATOM   1819 N N   . THR A 1 238 ? 35.660  6.737   8.131   1.00 44.15  ? 238  THR A N   1 
ATOM   1820 C CA  . THR A 1 238 ? 36.942  6.039   8.284   1.00 43.97  ? 238  THR A CA  1 
ATOM   1821 C C   . THR A 1 238 ? 37.903  6.445   7.182   1.00 44.16  ? 238  THR A C   1 
ATOM   1822 O O   . THR A 1 238 ? 37.479  6.955   6.152   1.00 43.28  ? 238  THR A O   1 
ATOM   1823 C CB  . THR A 1 238 ? 36.777  4.512   8.193   1.00 45.05  ? 238  THR A CB  1 
ATOM   1824 O OG1 . THR A 1 238 ? 36.297  4.155   6.886   1.00 45.22  ? 238  THR A OG1 1 
ATOM   1825 C CG2 . THR A 1 238 ? 35.803  4.005   9.249   1.00 44.85  ? 238  THR A CG2 1 
ATOM   1826 N N   . VAL A 1 239 ? 39.192  6.184   7.406   1.00 44.42  ? 239  VAL A N   1 
ATOM   1827 C CA  . VAL A 1 239 ? 40.223  6.284   6.376   1.00 44.96  ? 239  VAL A CA  1 
ATOM   1828 C C   . VAL A 1 239 ? 41.040  4.986   6.385   1.00 46.51  ? 239  VAL A C   1 
ATOM   1829 O O   . VAL A 1 239 ? 41.032  4.235   7.370   1.00 46.90  ? 239  VAL A O   1 
ATOM   1830 C CB  . VAL A 1 239 ? 41.161  7.516   6.597   1.00 45.25  ? 239  VAL A CB  1 
ATOM   1831 C CG1 . VAL A 1 239 ? 40.406  8.824   6.340   1.00 44.82  ? 239  VAL A CG1 1 
ATOM   1832 C CG2 . VAL A 1 239 ? 41.779  7.499   8.016   1.00 42.82  ? 239  VAL A CG2 1 
ATOM   1833 N N   . SER A 1 240 ? 41.706  4.690   5.277   1.00 47.50  ? 240  SER A N   1 
ATOM   1834 C CA  . SER A 1 240 ? 42.631  3.555   5.229   1.00 48.71  ? 240  SER A CA  1 
ATOM   1835 C C   . SER A 1 240 ? 43.887  3.878   6.032   1.00 49.31  ? 240  SER A C   1 
ATOM   1836 O O   . SER A 1 240 ? 44.155  5.047   6.347   1.00 48.86  ? 240  SER A O   1 
ATOM   1837 C CB  . SER A 1 240 ? 43.031  3.293   3.786   1.00 49.48  ? 240  SER A CB  1 
ATOM   1838 O OG  . SER A 1 240 ? 43.739  4.408   3.290   1.00 49.49  ? 240  SER A OG  1 
ATOM   1839 N N   . ALA A 1 241 ? 44.676  2.849   6.329   1.00 50.42  ? 241  ALA A N   1 
ATOM   1840 C CA  . ALA A 1 241 ? 45.931  3.016   7.039   1.00 50.81  ? 241  ALA A CA  1 
ATOM   1841 C C   . ALA A 1 241 ? 46.872  3.973   6.278   1.00 51.11  ? 241  ALA A C   1 
ATOM   1842 O O   . ALA A 1 241 ? 47.460  4.872   6.869   1.00 51.08  ? 241  ALA A O   1 
ATOM   1843 C CB  . ALA A 1 241 ? 46.608  1.638   7.272   1.00 52.20  ? 241  ALA A CB  1 
ATOM   1844 N N   . GLY A 1 242 ? 46.988  3.779   4.968   1.00 51.43  ? 242  GLY A N   1 
ATOM   1845 C CA  . GLY A 1 242 ? 47.849  4.606   4.134   1.00 51.64  ? 242  GLY A CA  1 
ATOM   1846 C C   . GLY A 1 242 ? 47.457  6.076   4.129   1.00 50.34  ? 242  GLY A C   1 
ATOM   1847 O O   . GLY A 1 242 ? 48.320  6.956   4.162   1.00 49.39  ? 242  GLY A O   1 
ATOM   1848 N N   . GLU A 1 243 ? 46.156  6.347   4.092   1.00 49.21  ? 243  GLU A N   1 
ATOM   1849 C CA  . GLU A 1 243 ? 45.681  7.727   4.126   1.00 48.92  ? 243  GLU A CA  1 
ATOM   1850 C C   . GLU A 1 243 ? 45.934  8.369   5.501   1.00 48.96  ? 243  GLU A C   1 
ATOM   1851 O O   . GLU A 1 243 ? 46.375  9.516   5.579   1.00 49.07  ? 243  GLU A O   1 
ATOM   1852 C CB  . GLU A 1 243 ? 44.205  7.792   3.725   1.00 47.97  ? 243  GLU A CB  1 
ATOM   1853 C CG  . GLU A 1 243 ? 43.602  9.186   3.612   1.00 47.36  ? 243  GLU A CG  1 
ATOM   1854 C CD  . GLU A 1 243 ? 44.339  10.141  2.673   1.00 49.50  ? 243  GLU A CD  1 
ATOM   1855 O OE1 . GLU A 1 243 ? 44.046  11.344  2.744   1.00 46.95  ? 243  GLU A OE1 1 
ATOM   1856 O OE2 . GLU A 1 243 ? 45.215  9.727   1.879   1.00 52.44  ? 243  GLU A OE2 1 
ATOM   1857 N N   . ALA A 1 244 ? 45.697  7.624   6.578   1.00 49.12  ? 244  ALA A N   1 
ATOM   1858 C CA  . ALA A 1 244 ? 45.941  8.132   7.933   1.00 48.92  ? 244  ALA A CA  1 
ATOM   1859 C C   . ALA A 1 244 ? 47.412  8.497   8.100   1.00 50.02  ? 244  ALA A C   1 
ATOM   1860 O O   . ALA A 1 244 ? 47.753  9.577   8.623   1.00 50.17  ? 244  ALA A O   1 
ATOM   1861 C CB  . ALA A 1 244 ? 45.514  7.101   8.980   1.00 48.48  ? 244  ALA A CB  1 
ATOM   1862 N N   . ARG A 1 245 ? 48.280  7.619   7.612   1.00 50.56  ? 245  ARG A N   1 
ATOM   1863 C CA  . ARG A 1 245 ? 49.720  7.849   7.660   1.00 52.02  ? 245  ARG A CA  1 
ATOM   1864 C C   . ARG A 1 245 ? 50.140  9.076   6.869   1.00 52.11  ? 245  ARG A C   1 
ATOM   1865 O O   . ARG A 1 245 ? 51.009  9.832   7.313   1.00 52.66  ? 245  ARG A O   1 
ATOM   1866 C CB  . ARG A 1 245 ? 50.478  6.633   7.125   1.00 52.94  ? 245  ARG A CB  1 
ATOM   1867 C CG  . ARG A 1 245 ? 51.983  6.826   7.045   1.00 54.77  ? 245  ARG A CG  1 
ATOM   1868 C CD  . ARG A 1 245 ? 52.697  5.501   6.839   1.00 56.15  ? 245  ARG A CD  1 
ATOM   1869 N NE  . ARG A 1 245 ? 52.568  4.641   8.012   1.00 56.69  ? 245  ARG A NE  1 
ATOM   1870 C CZ  . ARG A 1 245 ? 53.364  4.684   9.075   1.00 58.09  ? 245  ARG A CZ  1 
ATOM   1871 N NH1 . ARG A 1 245 ? 54.368  5.547   9.145   1.00 58.88  ? 245  ARG A NH1 1 
ATOM   1872 N NH2 . ARG A 1 245 ? 53.152  3.843   10.077  1.00 57.99  ? 245  ARG A NH2 1 
ATOM   1873 N N   . ARG A 1 246 ? 49.537  9.250   5.697   1.00 51.91  ? 246  ARG A N   1 
ATOM   1874 C CA  . ARG A 1 246 ? 49.813  10.397  4.836   1.00 52.44  ? 246  ARG A CA  1 
ATOM   1875 C C   . ARG A 1 246 ? 49.443  11.701  5.536   1.00 50.98  ? 246  ARG A C   1 
ATOM   1876 O O   . ARG A 1 246 ? 50.205  12.672  5.522   1.00 50.21  ? 246  ARG A O   1 
ATOM   1877 C CB  . ARG A 1 246 ? 49.013  10.285  3.535   1.00 52.28  ? 246  ARG A CB  1 
ATOM   1878 C CG  . ARG A 1 246 ? 49.454  11.284  2.465   1.00 54.44  ? 246  ARG A CG  1 
ATOM   1879 C CD  . ARG A 1 246 ? 48.463  11.396  1.302   1.00 54.25  ? 246  ARG A CD  1 
ATOM   1880 N NE  . ARG A 1 246 ? 47.164  11.964  1.680   1.00 54.26  ? 246  ARG A NE  1 
ATOM   1881 C CZ  . ARG A 1 246 ? 46.970  13.251  1.971   1.00 54.97  ? 246  ARG A CZ  1 
ATOM   1882 N NH1 . ARG A 1 246 ? 47.971  14.124  1.951   1.00 57.16  ? 246  ARG A NH1 1 
ATOM   1883 N NH2 . ARG A 1 246 ? 45.766  13.677  2.289   1.00 54.93  ? 246  ARG A NH2 1 
ATOM   1884 N N   . ARG A 1 247 ? 48.245  11.714  6.120   1.00 49.37  ? 247  ARG A N   1 
ATOM   1885 C CA  . ARG A 1 247 ? 47.744  12.873  6.870   1.00 48.56  ? 247  ARG A CA  1 
ATOM   1886 C C   . ARG A 1 247 ? 48.572  13.188  8.126   1.00 49.10  ? 247  ARG A C   1 
ATOM   1887 O O   . ARG A 1 247 ? 48.902  14.342  8.379   1.00 49.60  ? 247  ARG A O   1 
ATOM   1888 C CB  . ARG A 1 247 ? 46.278  12.669  7.244   1.00 47.20  ? 247  ARG A CB  1 
ATOM   1889 C CG  . ARG A 1 247 ? 45.373  12.644  6.031   1.00 46.17  ? 247  ARG A CG  1 
ATOM   1890 C CD  . ARG A 1 247 ? 43.927  12.507  6.416   1.00 45.63  ? 247  ARG A CD  1 
ATOM   1891 N NE  . ARG A 1 247 ? 43.116  12.254  5.240   1.00 43.70  ? 247  ARG A NE  1 
ATOM   1892 C CZ  . ARG A 1 247 ? 41.796  12.237  5.244   1.00 44.90  ? 247  ARG A CZ  1 
ATOM   1893 N NH1 . ARG A 1 247 ? 41.117  12.503  6.352   1.00 44.40  ? 247  ARG A NH1 1 
ATOM   1894 N NH2 . ARG A 1 247 ? 41.151  11.972  4.125   1.00 45.51  ? 247  ARG A NH2 1 
ATOM   1895 N N   . ALA A 1 248 ? 48.905  12.161  8.897   1.00 49.66  ? 248  ALA A N   1 
ATOM   1896 C CA  . ALA A 1 248 ? 49.729  12.323  10.096  1.00 49.90  ? 248  ALA A CA  1 
ATOM   1897 C C   . ALA A 1 248 ? 51.082  12.901  9.740   1.00 51.26  ? 248  ALA A C   1 
ATOM   1898 O O   . ALA A 1 248 ? 51.572  13.804  10.418  1.00 52.09  ? 248  ALA A O   1 
ATOM   1899 C CB  . ALA A 1 248 ? 49.894  11.010  10.817  1.00 49.50  ? 248  ALA A CB  1 
ATOM   1900 N N   . THR A 1 249 ? 51.673  12.383  8.664   1.00 51.97  ? 249  THR A N   1 
ATOM   1901 C CA  . THR A 1 249 ? 53.004  12.787  8.238   1.00 52.89  ? 249  THR A CA  1 
ATOM   1902 C C   . THR A 1 249 ? 53.023  14.218  7.720   1.00 52.62  ? 249  THR A C   1 
ATOM   1903 O O   . THR A 1 249 ? 53.929  14.970  8.032   1.00 53.53  ? 249  THR A O   1 
ATOM   1904 C CB  . THR A 1 249 ? 53.552  11.825  7.163   1.00 53.83  ? 249  THR A CB  1 
ATOM   1905 O OG1 . THR A 1 249 ? 53.529  10.491  7.680   1.00 53.72  ? 249  THR A OG1 1 
ATOM   1906 C CG2 . THR A 1 249 ? 54.975  12.192  6.778   1.00 54.08  ? 249  THR A CG2 1 
ATOM   1907 N N   . LEU A 1 250 ? 52.022  14.586  6.929   1.00 52.26  ? 250  LEU A N   1 
ATOM   1908 C CA  . LEU A 1 250 ? 51.876  15.959  6.448   1.00 52.06  ? 250  LEU A CA  1 
ATOM   1909 C C   . LEU A 1 250 ? 51.673  16.925  7.626   1.00 52.41  ? 250  LEU A C   1 
ATOM   1910 O O   . LEU A 1 250 ? 52.313  17.970  7.692   1.00 52.65  ? 250  LEU A O   1 
ATOM   1911 C CB  . LEU A 1 250 ? 50.720  16.057  5.435   1.00 51.37  ? 250  LEU A CB  1 
ATOM   1912 C CG  . LEU A 1 250 ? 50.414  17.437  4.838   1.00 50.97  ? 250  LEU A CG  1 
ATOM   1913 C CD1 . LEU A 1 250 ? 51.667  18.045  4.220   1.00 48.86  ? 250  LEU A CD1 1 
ATOM   1914 C CD2 . LEU A 1 250 ? 49.288  17.362  3.810   1.00 49.65  ? 250  LEU A CD2 1 
ATOM   1915 N N   . LEU A 1 251 ? 50.786  16.581  8.558   1.00 52.38  ? 251  LEU A N   1 
ATOM   1916 C CA  . LEU A 1 251 ? 50.572  17.430  9.739   1.00 52.52  ? 251  LEU A CA  1 
ATOM   1917 C C   . LEU A 1 251 ? 51.876  17.660  10.498  1.00 53.61  ? 251  LEU A C   1 
ATOM   1918 O O   . LEU A 1 251 ? 52.196  18.784  10.873  1.00 53.53  ? 251  LEU A O   1 
ATOM   1919 C CB  . LEU A 1 251 ? 49.547  16.810  10.696  1.00 52.11  ? 251  LEU A CB  1 
ATOM   1920 C CG  . LEU A 1 251 ? 49.351  17.696  11.944  1.00 52.37  ? 251  LEU A CG  1 
ATOM   1921 C CD1 . LEU A 1 251 ? 48.351  18.782  11.618  1.00 50.81  ? 251  LEU A CD1 1 
ATOM   1922 C CD2 . LEU A 1 251 ? 48.930  16.910  13.155  1.00 53.27  ? 251  LEU A CD2 1 
ATOM   1923 N N   . ALA A 1 252 ? 52.616  16.582  10.742  1.00 54.63  ? 252  ALA A N   1 
ATOM   1924 C CA  . ALA A 1 252 ? 53.926  16.680  11.376  1.00 56.22  ? 252  ALA A CA  1 
ATOM   1925 C C   . ALA A 1 252 ? 54.831  17.713  10.665  1.00 57.39  ? 252  ALA A C   1 
ATOM   1926 O O   . ALA A 1 252 ? 55.387  18.607  11.308  1.00 57.51  ? 252  ALA A O   1 
ATOM   1927 C CB  . ALA A 1 252 ? 54.584  15.322  11.416  1.00 56.50  ? 252  ALA A CB  1 
ATOM   1928 N N   . ARG A 1 253 ? 54.966  17.590  9.348   1.00 58.22  ? 253  ARG A N   1 
ATOM   1929 C CA  . ARG A 1 253 ? 55.722  18.569  8.551   1.00 60.04  ? 253  ARG A CA  1 
ATOM   1930 C C   . ARG A 1 253 ? 55.206  19.995  8.781   1.00 59.29  ? 253  ARG A C   1 
ATOM   1931 O O   . ARG A 1 253 ? 55.963  20.900  9.086   1.00 59.79  ? 253  ARG A O   1 
ATOM   1932 C CB  . ARG A 1 253 ? 55.647  18.242  7.056   1.00 60.07  ? 253  ARG A CB  1 
ATOM   1933 C CG  . ARG A 1 253 ? 56.695  17.268  6.558   1.00 63.57  ? 253  ARG A CG  1 
ATOM   1934 C CD  . ARG A 1 253 ? 56.760  17.251  5.015   1.00 65.65  ? 253  ARG A CD  1 
ATOM   1935 N NE  . ARG A 1 253 ? 55.584  16.556  4.474   1.00 70.42  ? 253  ARG A NE  1 
ATOM   1936 C CZ  . ARG A 1 253 ? 55.516  15.249  4.183   1.00 71.75  ? 253  ARG A CZ  1 
ATOM   1937 N NH1 . ARG A 1 253 ? 54.365  14.744  3.733   1.00 68.48  ? 253  ARG A NH1 1 
ATOM   1938 N NH2 . ARG A 1 253 ? 56.586  14.443  4.327   1.00 73.61  ? 253  ARG A NH2 1 
ATOM   1939 N N   . LEU A 1 254 ? 53.902  20.184  8.656   1.00 57.89  ? 254  LEU A N   1 
ATOM   1940 C CA  . LEU A 1 254 ? 53.314  21.512  8.823   1.00 57.43  ? 254  LEU A CA  1 
ATOM   1941 C C   . LEU A 1 254 ? 53.572  22.159  10.181  1.00 58.16  ? 254  LEU A C   1 
ATOM   1942 O O   . LEU A 1 254 ? 53.637  23.378  10.271  1.00 58.05  ? 254  LEU A O   1 
ATOM   1943 C CB  . LEU A 1 254 ? 51.815  21.466  8.548   1.00 55.55  ? 254  LEU A CB  1 
ATOM   1944 C CG  . LEU A 1 254 ? 51.452  21.151  7.099   1.00 54.39  ? 254  LEU A CG  1 
ATOM   1945 C CD1 . LEU A 1 254 ? 49.917  20.963  6.955   1.00 52.61  ? 254  LEU A CD1 1 
ATOM   1946 C CD2 . LEU A 1 254 ? 51.978  22.245  6.185   1.00 54.59  ? 254  LEU A CD2 1 
ATOM   1947 N N   . VAL A 1 255 ? 53.718  21.351  11.228  1.00 59.02  ? 255  VAL A N   1 
ATOM   1948 C CA  . VAL A 1 255 ? 54.023  21.877  12.565  1.00 60.09  ? 255  VAL A CA  1 
ATOM   1949 C C   . VAL A 1 255 ? 55.513  21.789  12.892  1.00 62.27  ? 255  VAL A C   1 
ATOM   1950 O O   . VAL A 1 255 ? 55.920  22.086  14.007  1.00 64.21  ? 255  VAL A O   1 
ATOM   1951 C CB  . VAL A 1 255 ? 53.181  21.195  13.668  1.00 59.13  ? 255  VAL A CB  1 
ATOM   1952 C CG1 . VAL A 1 255 ? 51.684  21.424  13.409  1.00 56.88  ? 255  VAL A CG1 1 
ATOM   1953 C CG2 . VAL A 1 255 ? 53.490  19.708  13.757  1.00 59.07  ? 255  VAL A CG2 1 
ATOM   1954 N N   . GLY A 1 256 ? 56.328  21.386  11.925  1.00 63.61  ? 256  GLY A N   1 
ATOM   1955 C CA  . GLY A 1 256 ? 57.794  21.456  12.063  1.00 65.31  ? 256  GLY A CA  1 
ATOM   1956 C C   . GLY A 1 256 ? 58.472  20.197  12.569  1.00 66.02  ? 256  GLY A C   1 
ATOM   1957 O O   . GLY A 1 256 ? 59.572  20.254  13.119  1.00 67.61  ? 256  GLY A O   1 
ATOM   1958 N N   . CYS A 1 257 ? 57.831  19.054  12.359  1.00 64.99  ? 257  CYS A N   1 
ATOM   1959 C CA  . CYS A 1 257 ? 58.342  17.779  12.835  1.00 64.97  ? 257  CYS A CA  1 
ATOM   1960 C C   . CYS A 1 257 ? 58.683  16.877  11.662  1.00 65.85  ? 257  CYS A C   1 
ATOM   1961 O O   . CYS A 1 257 ? 57.812  16.199  11.120  1.00 65.54  ? 257  CYS A O   1 
ATOM   1962 C CB  . CYS A 1 257 ? 57.293  17.121  13.737  1.00 63.55  ? 257  CYS A CB  1 
ATOM   1963 S SG  . CYS A 1 257 ? 57.164  17.918  15.345  1.00 61.22  ? 257  CYS A SG  1 
ATOM   1964 N N   . ASN A 1 265 ? 61.232  7.058   10.621  1.00 76.86  ? 265  ASN A N   1 
ATOM   1965 C CA  . ASN A 1 265 ? 61.114  6.568   12.000  1.00 76.50  ? 265  ASN A CA  1 
ATOM   1966 C C   . ASN A 1 265 ? 59.933  7.211   12.731  1.00 73.50  ? 265  ASN A C   1 
ATOM   1967 O O   . ASN A 1 265 ? 59.928  8.423   12.954  1.00 73.45  ? 265  ASN A O   1 
ATOM   1968 C CB  . ASN A 1 265 ? 62.430  6.829   12.752  1.00 78.57  ? 265  ASN A CB  1 
ATOM   1969 C CG  . ASN A 1 265 ? 62.303  6.677   14.271  1.00 79.91  ? 265  ASN A CG  1 
ATOM   1970 O OD1 . ASN A 1 265 ? 62.943  7.413   15.027  1.00 82.87  ? 265  ASN A OD1 1 
ATOM   1971 N ND2 . ASN A 1 265 ? 61.495  5.716   14.719  1.00 80.92  ? 265  ASN A ND2 1 
ATOM   1972 N N   . ASP A 1 266 ? 58.955  6.390   13.115  1.00 70.99  ? 266  ASP A N   1 
ATOM   1973 C CA  . ASP A 1 266 ? 57.700  6.879   13.704  1.00 68.01  ? 266  ASP A CA  1 
ATOM   1974 C C   . ASP A 1 266 ? 57.881  7.426   15.106  1.00 66.84  ? 266  ASP A C   1 
ATOM   1975 O O   . ASP A 1 266 ? 57.235  8.402   15.475  1.00 65.95  ? 266  ASP A O   1 
ATOM   1976 C CB  . ASP A 1 266 ? 56.657  5.761   13.776  1.00 67.18  ? 266  ASP A CB  1 
ATOM   1977 C CG  . ASP A 1 266 ? 56.051  5.419   12.425  1.00 66.66  ? 266  ASP A CG  1 
ATOM   1978 O OD1 . ASP A 1 266 ? 56.321  6.113   11.421  1.00 65.81  ? 266  ASP A OD1 1 
ATOM   1979 O OD2 . ASP A 1 266 ? 55.276  4.443   12.381  1.00 65.47  ? 266  ASP A OD2 1 
ATOM   1980 N N   . THR A 1 267 ? 58.722  6.761   15.893  1.00 66.55  ? 267  THR A N   1 
ATOM   1981 C CA  . THR A 1 267 ? 58.992  7.149   17.274  1.00 65.60  ? 267  THR A CA  1 
ATOM   1982 C C   . THR A 1 267 ? 59.461  8.587   17.365  1.00 65.61  ? 267  THR A C   1 
ATOM   1983 O O   . THR A 1 267 ? 58.947  9.353   18.169  1.00 64.73  ? 267  THR A O   1 
ATOM   1984 C CB  . THR A 1 267 ? 60.070  6.239   17.904  1.00 67.06  ? 267  THR A CB  1 
ATOM   1985 O OG1 . THR A 1 267 ? 59.632  4.880   17.828  1.00 65.95  ? 267  THR A OG1 1 
ATOM   1986 C CG2 . THR A 1 267 ? 60.336  6.615   19.361  1.00 65.62  ? 267  THR A CG2 1 
ATOM   1987 N N   . GLU A 1 268 ? 60.440  8.935   16.538  1.00 66.82  ? 268  GLU A N   1 
ATOM   1988 C CA  . GLU A 1 268 ? 60.996  10.287  16.501  1.00 67.33  ? 268  GLU A CA  1 
ATOM   1989 C C   . GLU A 1 268 ? 59.964  11.325  16.028  1.00 64.93  ? 268  GLU A C   1 
ATOM   1990 O O   . GLU A 1 268 ? 59.938  12.449  16.525  1.00 64.50  ? 268  GLU A O   1 
ATOM   1991 C CB  . GLU A 1 268 ? 62.257  10.312  15.622  1.00 69.03  ? 268  GLU A CB  1 
ATOM   1992 C CG  . GLU A 1 268 ? 62.855  11.702  15.394  1.00 70.73  ? 268  GLU A CG  1 
ATOM   1993 C CD  . GLU A 1 268 ? 64.237  11.671  14.735  1.00 73.84  ? 268  GLU A CD  1 
ATOM   1994 O OE1 . GLU A 1 268 ? 64.481  12.512  13.827  1.00 77.51  ? 268  GLU A OE1 1 
ATOM   1995 O OE2 . GLU A 1 268 ? 65.074  10.812  15.121  1.00 78.58  ? 268  GLU A OE2 1 
ATOM   1996 N N   . LEU A 1 269 ? 59.110  10.938  15.087  1.00 63.03  ? 269  LEU A N   1 
ATOM   1997 C CA  . LEU A 1 269 ? 58.104  11.837  14.556  1.00 61.06  ? 269  LEU A CA  1 
ATOM   1998 C C   . LEU A 1 269 ? 57.044  12.118  15.622  1.00 58.92  ? 269  LEU A C   1 
ATOM   1999 O O   . LEU A 1 269 ? 56.684  13.269  15.852  1.00 58.05  ? 269  LEU A O   1 
ATOM   2000 C CB  . LEU A 1 269 ? 57.484  11.241  13.282  1.00 60.89  ? 269  LEU A CB  1 
ATOM   2001 C CG  . LEU A 1 269 ? 56.436  12.038  12.494  1.00 60.33  ? 269  LEU A CG  1 
ATOM   2002 C CD1 . LEU A 1 269 ? 56.449  11.619  11.034  1.00 62.17  ? 269  LEU A CD1 1 
ATOM   2003 C CD2 . LEU A 1 269 ? 55.040  11.838  13.062  1.00 59.88  ? 269  LEU A CD2 1 
ATOM   2004 N N   . ILE A 1 270 ? 56.582  11.064  16.293  1.00 57.41  ? 270  ILE A N   1 
ATOM   2005 C CA  . ILE A 1 270 ? 55.572  11.197  17.330  1.00 55.90  ? 270  ILE A CA  1 
ATOM   2006 C C   . ILE A 1 270 ? 56.143  11.915  18.555  1.00 55.76  ? 270  ILE A C   1 
ATOM   2007 O O   . ILE A 1 270 ? 55.488  12.774  19.134  1.00 54.84  ? 270  ILE A O   1 
ATOM   2008 C CB  . ILE A 1 270 ? 54.963  9.828   17.713  1.00 55.43  ? 270  ILE A CB  1 
ATOM   2009 C CG1 . ILE A 1 270 ? 54.305  9.177   16.490  1.00 55.57  ? 270  ILE A CG1 1 
ATOM   2010 C CG2 . ILE A 1 270 ? 53.947  9.986   18.823  1.00 53.61  ? 270  ILE A CG2 1 
ATOM   2011 C CD1 . ILE A 1 270 ? 54.358  7.632   16.497  1.00 55.76  ? 270  ILE A CD1 1 
ATOM   2012 N N   . ALA A 1 271 ? 57.371  11.593  18.928  1.00 56.97  ? 271  ALA A N   1 
ATOM   2013 C CA  . ALA A 1 271 ? 58.052  12.313  20.002  1.00 57.83  ? 271  ALA A CA  1 
ATOM   2014 C C   . ALA A 1 271 ? 58.012  13.821  19.742  1.00 57.86  ? 271  ALA A C   1 
ATOM   2015 O O   . ALA A 1 271 ? 57.713  14.607  20.641  1.00 57.69  ? 271  ALA A O   1 
ATOM   2016 C CB  . ALA A 1 271 ? 59.506  11.820  20.158  1.00 58.91  ? 271  ALA A CB  1 
ATOM   2017 N N   . CYS A 1 272 ? 58.301  14.220  18.506  1.00 58.92  ? 272  CYS A N   1 
ATOM   2018 C CA  . CYS A 1 272 ? 58.319  15.636  18.139  1.00 58.68  ? 272  CYS A CA  1 
ATOM   2019 C C   . CYS A 1 272 ? 56.903  16.214  18.187  1.00 56.63  ? 272  CYS A C   1 
ATOM   2020 O O   . CYS A 1 272 ? 56.722  17.310  18.691  1.00 56.17  ? 272  CYS A O   1 
ATOM   2021 C CB  . CYS A 1 272 ? 58.960  15.832  16.762  1.00 59.90  ? 272  CYS A CB  1 
ATOM   2022 S SG  . CYS A 1 272 ? 59.069  17.571  16.176  1.00 61.82  ? 272  CYS A SG  1 
ATOM   2023 N N   . LEU A 1 273 ? 55.905  15.472  17.706  1.00 55.10  ? 273  LEU A N   1 
ATOM   2024 C CA  . LEU A 1 273 ? 54.502  15.941  17.777  1.00 53.54  ? 273  LEU A CA  1 
ATOM   2025 C C   . LEU A 1 273 ? 54.061  16.145  19.231  1.00 53.02  ? 273  LEU A C   1 
ATOM   2026 O O   . LEU A 1 273 ? 53.344  17.086  19.537  1.00 52.60  ? 273  LEU A O   1 
ATOM   2027 C CB  . LEU A 1 273 ? 53.532  14.968  17.091  1.00 52.20  ? 273  LEU A CB  1 
ATOM   2028 C CG  . LEU A 1 273 ? 53.398  14.986  15.562  1.00 51.93  ? 273  LEU A CG  1 
ATOM   2029 C CD1 . LEU A 1 273 ? 52.409  13.896  15.129  1.00 48.75  ? 273  LEU A CD1 1 
ATOM   2030 C CD2 . LEU A 1 273 ? 52.975  16.369  14.984  1.00 49.29  ? 273  LEU A CD2 1 
ATOM   2031 N N   . ARG A 1 274 ? 54.525  15.283  20.132  1.00 53.32  ? 274  ARG A N   1 
ATOM   2032 C CA  . ARG A 1 274 ? 54.213  15.426  21.559  1.00 52.75  ? 274  ARG A CA  1 
ATOM   2033 C C   . ARG A 1 274 ? 54.775  16.675  22.188  1.00 54.17  ? 274  ARG A C   1 
ATOM   2034 O O   . ARG A 1 274 ? 54.285  17.090  23.237  1.00 54.12  ? 274  ARG A O   1 
ATOM   2035 C CB  A ARG A 1 274 ? 54.696  14.207  22.349  0.50 53.22  ? 274  ARG A CB  1 
ATOM   2036 C CB  B ARG A 1 274 ? 54.655  14.188  22.346  0.50 53.23  ? 274  ARG A CB  1 
ATOM   2037 C CG  A ARG A 1 274 ? 53.648  13.149  22.411  0.50 51.53  ? 274  ARG A CG  1 
ATOM   2038 C CG  B ARG A 1 274 ? 53.783  12.958  22.092  0.50 51.64  ? 274  ARG A CG  1 
ATOM   2039 C CD  A ARG A 1 274 ? 54.180  11.780  22.758  0.50 51.03  ? 274  ARG A CD  1 
ATOM   2040 C CD  B ARG A 1 274 ? 53.974  11.906  23.178  0.50 51.64  ? 274  ARG A CD  1 
ATOM   2041 N NE  A ARG A 1 274 ? 53.238  10.776  22.272  0.50 50.93  ? 274  ARG A NE  1 
ATOM   2042 N NE  B ARG A 1 274 ? 55.381  11.556  23.314  0.50 52.03  ? 274  ARG A NE  1 
ATOM   2043 C CZ  A ARG A 1 274 ? 53.371  9.470   22.438  0.50 49.46  ? 274  ARG A CZ  1 
ATOM   2044 C CZ  B ARG A 1 274 ? 55.993  10.537  22.719  0.50 51.50  ? 274  ARG A CZ  1 
ATOM   2045 N NH1 A ARG A 1 274 ? 54.417  8.964   23.087  0.50 52.25  ? 274  ARG A NH1 1 
ATOM   2046 N NH1 B ARG A 1 274 ? 57.296  10.360  22.931  0.50 52.34  ? 274  ARG A NH1 1 
ATOM   2047 N NH2 A ARG A 1 274 ? 52.456  8.672   21.939  0.50 46.05  ? 274  ARG A NH2 1 
ATOM   2048 N NH2 B ARG A 1 274 ? 55.329  9.703   21.925  0.50 48.97  ? 274  ARG A NH2 1 
ATOM   2049 N N   . THR A 1 275 ? 55.788  17.277  21.566  1.00 55.91  ? 275  THR A N   1 
ATOM   2050 C CA  . THR A 1 275 ? 56.341  18.533  22.061  1.00 57.26  ? 275  THR A CA  1 
ATOM   2051 C C   . THR A 1 275 ? 55.534  19.748  21.616  1.00 57.48  ? 275  THR A C   1 
ATOM   2052 O O   . THR A 1 275 ? 55.712  20.817  22.165  1.00 58.55  ? 275  THR A O   1 
ATOM   2053 C CB  . THR A 1 275 ? 57.815  18.740  21.621  1.00 58.86  ? 275  THR A CB  1 
ATOM   2054 O OG1 . THR A 1 275 ? 57.884  18.921  20.199  1.00 58.00  ? 275  THR A OG1 1 
ATOM   2055 C CG2 . THR A 1 275 ? 58.660  17.558  22.026  1.00 58.70  ? 275  THR A CG2 1 
ATOM   2056 N N   . ARG A 1 276 ? 54.645  19.602  20.637  1.00 57.42  ? 276  ARG A N   1 
ATOM   2057 C CA  . ARG A 1 276 ? 53.924  20.764  20.119  1.00 57.57  ? 276  ARG A CA  1 
ATOM   2058 C C   . ARG A 1 276 ? 52.751  21.170  21.016  1.00 56.81  ? 276  ARG A C   1 
ATOM   2059 O O   . ARG A 1 276 ? 52.043  20.307  21.544  1.00 55.80  ? 276  ARG A O   1 
ATOM   2060 C CB  . ARG A 1 276 ? 53.395  20.512  18.700  1.00 57.46  ? 276  ARG A CB  1 
ATOM   2061 C CG  . ARG A 1 276 ? 54.400  19.995  17.653  1.00 60.64  ? 276  ARG A CG  1 
ATOM   2062 C CD  . ARG A 1 276 ? 55.795  20.536  17.806  1.00 67.08  ? 276  ARG A CD  1 
ATOM   2063 N NE  . ARG A 1 276 ? 55.850  21.994  17.849  1.00 70.24  ? 276  ARG A NE  1 
ATOM   2064 C CZ  . ARG A 1 276 ? 56.838  22.695  18.419  1.00 73.61  ? 276  ARG A CZ  1 
ATOM   2065 N NH1 . ARG A 1 276 ? 57.866  22.076  19.012  1.00 75.08  ? 276  ARG A NH1 1 
ATOM   2066 N NH2 . ARG A 1 276 ? 56.797  24.030  18.411  1.00 73.65  ? 276  ARG A NH2 1 
ATOM   2067 N N   . PRO A 1 277 ? 52.526  22.490  21.179  1.00 56.88  ? 277  PRO A N   1 
ATOM   2068 C CA  . PRO A 1 277 ? 51.313  22.959  21.835  1.00 55.98  ? 277  PRO A CA  1 
ATOM   2069 C C   . PRO A 1 277 ? 50.074  22.381  21.177  1.00 54.63  ? 277  PRO A C   1 
ATOM   2070 O O   . PRO A 1 277 ? 50.053  22.232  19.959  1.00 54.44  ? 277  PRO A O   1 
ATOM   2071 C CB  . PRO A 1 277 ? 51.356  24.474  21.617  1.00 56.70  ? 277  PRO A CB  1 
ATOM   2072 C CG  . PRO A 1 277 ? 52.796  24.799  21.486  1.00 58.38  ? 277  PRO A CG  1 
ATOM   2073 C CD  . PRO A 1 277 ? 53.405  23.611  20.785  1.00 58.39  ? 277  PRO A CD  1 
ATOM   2074 N N   . ALA A 1 278 ? 49.054  22.062  21.971  1.00 53.75  ? 278  ALA A N   1 
ATOM   2075 C CA  . ALA A 1 278 ? 47.801  21.516  21.435  1.00 52.56  ? 278  ALA A CA  1 
ATOM   2076 C C   . ALA A 1 278 ? 47.218  22.413  20.347  1.00 52.46  ? 278  ALA A C   1 
ATOM   2077 O O   . ALA A 1 278 ? 46.672  21.920  19.363  1.00 51.61  ? 278  ALA A O   1 
ATOM   2078 C CB  . ALA A 1 278 ? 46.780  21.305  22.550  1.00 51.36  ? 278  ALA A CB  1 
ATOM   2079 N N   . GLN A 1 279 ? 47.345  23.726  20.515  1.00 53.56  ? 279  GLN A N   1 
ATOM   2080 C CA  . GLN A 1 279 ? 46.713  24.655  19.588  1.00 53.75  ? 279  GLN A CA  1 
ATOM   2081 C C   . GLN A 1 279 ? 47.386  24.647  18.221  1.00 53.97  ? 279  GLN A C   1 
ATOM   2082 O O   . GLN A 1 279 ? 46.716  24.869  17.214  1.00 53.32  ? 279  GLN A O   1 
ATOM   2083 C CB  . GLN A 1 279 ? 46.681  26.078  20.160  1.00 54.86  ? 279  GLN A CB  1 
ATOM   2084 C CG  . GLN A 1 279 ? 45.744  27.045  19.412  1.00 54.84  ? 279  GLN A CG  1 
ATOM   2085 C CD  . GLN A 1 279 ? 44.284  26.668  19.524  1.00 55.95  ? 279  GLN A CD  1 
ATOM   2086 O OE1 . GLN A 1 279 ? 43.748  26.549  20.625  1.00 58.23  ? 279  GLN A OE1 1 
ATOM   2087 N NE2 . GLN A 1 279 ? 43.630  26.490  18.386  1.00 54.73  ? 279  GLN A NE2 1 
ATOM   2088 N N   . ASP A 1 280 ? 48.699  24.407  18.187  1.00 54.80  ? 280  ASP A N   1 
ATOM   2089 C CA  . ASP A 1 280 ? 49.421  24.294  16.923  1.00 55.48  ? 280  ASP A CA  1 
ATOM   2090 C C   . ASP A 1 280 ? 48.865  23.144  16.085  1.00 54.00  ? 280  ASP A C   1 
ATOM   2091 O O   . ASP A 1 280 ? 48.741  23.274  14.875  1.00 54.52  ? 280  ASP A O   1 
ATOM   2092 C CB  . ASP A 1 280 ? 50.931  24.099  17.142  1.00 57.37  ? 280  ASP A CB  1 
ATOM   2093 C CG  . ASP A 1 280 ? 51.623  25.358  17.645  1.00 61.32  ? 280  ASP A CG  1 
ATOM   2094 O OD1 . ASP A 1 280 ? 50.916  26.355  17.973  1.00 64.94  ? 280  ASP A OD1 1 
ATOM   2095 O OD2 . ASP A 1 280 ? 52.880  25.353  17.718  1.00 66.07  ? 280  ASP A OD2 1 
ATOM   2096 N N   . LEU A 1 281 ? 48.531  22.027  16.726  1.00 52.68  ? 281  LEU A N   1 
ATOM   2097 C CA  . LEU A 1 281 ? 47.950  20.875  16.023  1.00 51.14  ? 281  LEU A CA  1 
ATOM   2098 C C   . LEU A 1 281 ? 46.571  21.245  15.472  1.00 49.74  ? 281  LEU A C   1 
ATOM   2099 O O   . LEU A 1 281 ? 46.265  20.975  14.306  1.00 49.76  ? 281  LEU A O   1 
ATOM   2100 C CB  . LEU A 1 281 ? 47.861  19.657  16.951  1.00 50.42  ? 281  LEU A CB  1 
ATOM   2101 C CG  . LEU A 1 281 ? 49.192  19.144  17.546  1.00 51.86  ? 281  LEU A CG  1 
ATOM   2102 C CD1 . LEU A 1 281 ? 49.014  17.793  18.213  1.00 50.81  ? 281  LEU A CD1 1 
ATOM   2103 C CD2 . LEU A 1 281 ? 50.268  19.052  16.476  1.00 50.02  ? 281  LEU A CD2 1 
ATOM   2104 N N   . VAL A 1 282 ? 45.759  21.892  16.304  1.00 48.82  ? 282  VAL A N   1 
ATOM   2105 C CA  . VAL A 1 282 ? 44.427  22.342  15.894  1.00 47.45  ? 282  VAL A CA  1 
ATOM   2106 C C   . VAL A 1 282 ? 44.507  23.310  14.726  1.00 48.55  ? 282  VAL A C   1 
ATOM   2107 O O   . VAL A 1 282 ? 43.759  23.167  13.754  1.00 48.06  ? 282  VAL A O   1 
ATOM   2108 C CB  . VAL A 1 282 ? 43.619  22.970  17.076  1.00 47.29  ? 282  VAL A CB  1 
ATOM   2109 C CG1 . VAL A 1 282 ? 42.300  23.623  16.576  1.00 44.04  ? 282  VAL A CG1 1 
ATOM   2110 C CG2 . VAL A 1 282 ? 43.341  21.909  18.157  1.00 44.97  ? 282  VAL A CG2 1 
ATOM   2111 N N   . ASP A 1 283 ? 45.419  24.278  14.811  1.00 50.09  ? 283  ASP A N   1 
ATOM   2112 C CA  . ASP A 1 283 ? 45.565  25.299  13.778  1.00 51.38  ? 283  ASP A CA  1 
ATOM   2113 C C   . ASP A 1 283 ? 45.916  24.737  12.397  1.00 51.76  ? 283  ASP A C   1 
ATOM   2114 O O   . ASP A 1 283 ? 45.679  25.412  11.396  1.00 51.03  ? 283  ASP A O   1 
ATOM   2115 C CB  . ASP A 1 283 ? 46.621  26.347  14.178  1.00 52.55  ? 283  ASP A CB  1 
ATOM   2116 C CG  . ASP A 1 283 ? 46.144  27.268  15.311  1.00 54.62  ? 283  ASP A CG  1 
ATOM   2117 O OD1 . ASP A 1 283 ? 44.961  27.187  15.733  1.00 57.15  ? 283  ASP A OD1 1 
ATOM   2118 O OD2 . ASP A 1 283 ? 46.969  28.070  15.791  1.00 57.61  ? 283  ASP A OD2 1 
ATOM   2119 N N   . HIS A 1 284 ? 46.467  23.521  12.328  1.00 52.03  ? 284  HIS A N   1 
ATOM   2120 C CA  . HIS A 1 284 ? 46.834  22.955  11.030  1.00 52.95  ? 284  HIS A CA  1 
ATOM   2121 C C   . HIS A 1 284 ? 46.014  21.764  10.592  1.00 52.70  ? 284  HIS A C   1 
ATOM   2122 O O   . HIS A 1 284 ? 46.260  21.226  9.519   1.00 52.11  ? 284  HIS A O   1 
ATOM   2123 C CB  . HIS A 1 284 ? 48.320  22.592  11.002  1.00 54.47  ? 284  HIS A CB  1 
ATOM   2124 C CG  . HIS A 1 284 ? 49.217  23.781  11.106  1.00 55.99  ? 284  HIS A CG  1 
ATOM   2125 N ND1 . HIS A 1 284 ? 49.658  24.270  12.318  1.00 57.14  ? 284  HIS A ND1 1 
ATOM   2126 C CD2 . HIS A 1 284 ? 49.723  24.604  10.157  1.00 57.06  ? 284  HIS A CD2 1 
ATOM   2127 C CE1 . HIS A 1 284 ? 50.416  25.333  12.106  1.00 59.13  ? 284  HIS A CE1 1 
ATOM   2128 N NE2 . HIS A 1 284 ? 50.470  25.557  10.803  1.00 58.01  ? 284  HIS A NE2 1 
ATOM   2129 N N   . GLU A 1 285 ? 45.024  21.354  11.383  1.00 52.93  ? 285  GLU A N   1 
ATOM   2130 C CA  . GLU A 1 285 ? 44.389  20.068  11.118  1.00 53.27  ? 285  GLU A CA  1 
ATOM   2131 C C   . GLU A 1 285 ? 43.580  20.040  9.811   1.00 52.49  ? 285  GLU A C   1 
ATOM   2132 O O   . GLU A 1 285 ? 43.478  18.993  9.166   1.00 51.89  ? 285  GLU A O   1 
ATOM   2133 C CB  . GLU A 1 285 ? 43.559  19.575  12.320  1.00 52.79  ? 285  GLU A CB  1 
ATOM   2134 C CG  . GLU A 1 285 ? 42.137  20.046  12.367  1.00 53.54  ? 285  GLU A CG  1 
ATOM   2135 C CD  . GLU A 1 285 ? 41.312  19.265  13.378  1.00 54.26  ? 285  GLU A CD  1 
ATOM   2136 O OE1 . GLU A 1 285 ? 41.450  19.555  14.579  1.00 56.28  ? 285  GLU A OE1 1 
ATOM   2137 O OE2 . GLU A 1 285 ? 40.520  18.369  12.964  1.00 58.37  ? 285  GLU A OE2 1 
ATOM   2138 N N   . TRP A 1 286 ? 43.025  21.176  9.408   1.00 52.49  ? 286  TRP A N   1 
ATOM   2139 C CA  . TRP A 1 286 ? 42.273  21.228  8.160   1.00 52.64  ? 286  TRP A CA  1 
ATOM   2140 C C   . TRP A 1 286 ? 43.166  21.203  6.925   1.00 52.92  ? 286  TRP A C   1 
ATOM   2141 O O   . TRP A 1 286 ? 42.693  20.933  5.826   1.00 53.45  ? 286  TRP A O   1 
ATOM   2142 C CB  . TRP A 1 286 ? 41.368  22.451  8.123   1.00 53.24  ? 286  TRP A CB  1 
ATOM   2143 C CG  . TRP A 1 286 ? 40.320  22.347  9.139   1.00 53.85  ? 286  TRP A CG  1 
ATOM   2144 C CD1 . TRP A 1 286 ? 40.288  22.970  10.351  1.00 54.48  ? 286  TRP A CD1 1 
ATOM   2145 C CD2 . TRP A 1 286 ? 39.176  21.494  9.091   1.00 53.62  ? 286  TRP A CD2 1 
ATOM   2146 N NE1 . TRP A 1 286 ? 39.177  22.581  11.049  1.00 54.78  ? 286  TRP A NE1 1 
ATOM   2147 C CE2 . TRP A 1 286 ? 38.471  21.680  10.296  1.00 54.04  ? 286  TRP A CE2 1 
ATOM   2148 C CE3 . TRP A 1 286 ? 38.670  20.603  8.134   1.00 53.26  ? 286  TRP A CE3 1 
ATOM   2149 C CZ2 . TRP A 1 286 ? 37.273  21.025  10.570  1.00 52.77  ? 286  TRP A CZ2 1 
ATOM   2150 C CZ3 . TRP A 1 286 ? 37.485  19.942  8.403   1.00 52.97  ? 286  TRP A CZ3 1 
ATOM   2151 C CH2 . TRP A 1 286 ? 36.795  20.156  9.616   1.00 53.10  ? 286  TRP A CH2 1 
ATOM   2152 N N   . HIS A 1 287 ? 44.454  21.453  7.098   1.00 52.83  ? 287  HIS A N   1 
ATOM   2153 C CA  . HIS A 1 287 ? 45.352  21.567  5.955   1.00 53.37  ? 287  HIS A CA  1 
ATOM   2154 C C   . HIS A 1 287 ? 45.753  20.244  5.317   1.00 52.64  ? 287  HIS A C   1 
ATOM   2155 O O   . HIS A 1 287 ? 46.444  20.253  4.305   1.00 53.35  ? 287  HIS A O   1 
ATOM   2156 C CB  . HIS A 1 287 ? 46.623  22.305  6.355   1.00 54.86  ? 287  HIS A CB  1 
ATOM   2157 C CG  . HIS A 1 287 ? 46.391  23.710  6.807   1.00 56.70  ? 287  HIS A CG  1 
ATOM   2158 N ND1 . HIS A 1 287 ? 45.321  24.464  6.379   1.00 61.01  ? 287  HIS A ND1 1 
ATOM   2159 C CD2 . HIS A 1 287 ? 47.108  24.509  7.628   1.00 59.84  ? 287  HIS A CD2 1 
ATOM   2160 C CE1 . HIS A 1 287 ? 45.386  25.668  6.923   1.00 61.70  ? 287  HIS A CE1 1 
ATOM   2161 N NE2 . HIS A 1 287 ? 46.463  25.721  7.684   1.00 60.57  ? 287  HIS A NE2 1 
ATOM   2162 N N   . VAL A 1 288 ? 45.340  19.116  5.894   1.00 51.10  ? 288  VAL A N   1 
ATOM   2163 C CA  . VAL A 1 288 ? 45.793  17.808  5.418   1.00 50.45  ? 288  VAL A CA  1 
ATOM   2164 C C   . VAL A 1 288 ? 44.783  17.056  4.563   1.00 50.26  ? 288  VAL A C   1 
ATOM   2165 O O   . VAL A 1 288 ? 45.105  16.009  4.024   1.00 50.18  ? 288  VAL A O   1 
ATOM   2166 C CB  . VAL A 1 288 ? 46.262  16.904  6.604   1.00 50.33  ? 288  VAL A CB  1 
ATOM   2167 C CG1 . VAL A 1 288 ? 47.381  17.596  7.374   1.00 49.07  ? 288  VAL A CG1 1 
ATOM   2168 C CG2 . VAL A 1 288 ? 45.086  16.536  7.532   1.00 47.34  ? 288  VAL A CG2 1 
ATOM   2169 N N   . LEU A 1 289 ? 43.557  17.559  4.433   1.00 50.08  ? 289  LEU A N   1 
ATOM   2170 C CA  . LEU A 1 289 ? 42.575  16.893  3.559   1.00 49.83  ? 289  LEU A CA  1 
ATOM   2171 C C   . LEU A 1 289 ? 43.088  16.893  2.107   1.00 51.29  ? 289  LEU A C   1 
ATOM   2172 O O   . LEU A 1 289 ? 43.685  17.877  1.654   1.00 51.77  ? 289  LEU A O   1 
ATOM   2173 C CB  . LEU A 1 289 ? 41.210  17.578  3.635   1.00 48.81  ? 289  LEU A CB  1 
ATOM   2174 C CG  . LEU A 1 289 ? 40.368  17.292  4.878   1.00 47.79  ? 289  LEU A CG  1 
ATOM   2175 C CD1 . LEU A 1 289 ? 39.098  18.188  4.892   1.00 45.68  ? 289  LEU A CD1 1 
ATOM   2176 C CD2 . LEU A 1 289 ? 40.009  15.819  4.942   1.00 43.31  ? 289  LEU A CD2 1 
ATOM   2177 N N   . PRO A 1 290 ? 42.875  15.788  1.381   1.00 52.03  ? 290  PRO A N   1 
ATOM   2178 C CA  . PRO A 1 290 ? 43.388  15.697  0.020   1.00 53.77  ? 290  PRO A CA  1 
ATOM   2179 C C   . PRO A 1 290 ? 42.697  16.620  -1.010  1.00 54.14  ? 290  PRO A C   1 
ATOM   2180 O O   . PRO A 1 290 ? 43.328  17.023  -1.978  1.00 55.00  ? 290  PRO A O   1 
ATOM   2181 C CB  . PRO A 1 290 ? 43.183  14.224  -0.332  1.00 53.97  ? 290  PRO A CB  1 
ATOM   2182 C CG  . PRO A 1 290 ? 42.100  13.746  0.565   1.00 52.67  ? 290  PRO A CG  1 
ATOM   2183 C CD  . PRO A 1 290 ? 42.161  14.569  1.794   1.00 52.05  ? 290  PRO A CD  1 
ATOM   2184 N N   . GLN A 1 291 ? 41.426  16.950  -0.814  1.00 54.04  ? 291  GLN A N   1 
ATOM   2185 C CA  . GLN A 1 291 ? 40.722  17.844  -1.739  1.00 54.50  ? 291  GLN A CA  1 
ATOM   2186 C C   . GLN A 1 291 ? 40.033  18.989  -1.022  1.00 54.13  ? 291  GLN A C   1 
ATOM   2187 O O   . GLN A 1 291 ? 39.808  18.932  0.178   1.00 54.08  ? 291  GLN A O   1 
ATOM   2188 C CB  . GLN A 1 291 ? 39.654  17.071  -2.500  1.00 54.82  ? 291  GLN A CB  1 
ATOM   2189 C CG  . GLN A 1 291 ? 40.178  16.257  -3.654  1.00 58.14  ? 291  GLN A CG  1 
ATOM   2190 C CD  . GLN A 1 291 ? 40.604  14.882  -3.237  1.00 62.51  ? 291  GLN A CD  1 
ATOM   2191 O OE1 . GLN A 1 291 ? 41.498  14.287  -3.847  1.00 67.41  ? 291  GLN A OE1 1 
ATOM   2192 N NE2 . GLN A 1 291 ? 39.979  14.361  -2.181  1.00 62.62  ? 291  GLN A NE2 1 
ATOM   2193 N N   . GLU A 1 292 ? 39.678  20.020  -1.773  1.00 54.45  ? 292  GLU A N   1 
ATOM   2194 C CA  . GLU A 1 292 ? 38.724  21.017  -1.310  1.00 54.98  ? 292  GLU A CA  1 
ATOM   2195 C C   . GLU A 1 292 ? 37.401  20.276  -1.140  1.00 52.85  ? 292  GLU A C   1 
ATOM   2196 O O   . GLU A 1 292 ? 36.885  19.693  -2.095  1.00 53.30  ? 292  GLU A O   1 
ATOM   2197 C CB  . GLU A 1 292 ? 38.596  22.133  -2.354  1.00 55.53  ? 292  GLU A CB  1 
ATOM   2198 C CG  . GLU A 1 292 ? 37.689  23.284  -1.955  1.00 57.84  ? 292  GLU A CG  1 
ATOM   2199 C CD  . GLU A 1 292 ? 37.540  24.350  -3.053  1.00 60.15  ? 292  GLU A CD  1 
ATOM   2200 O OE1 . GLU A 1 292 ? 38.076  24.180  -4.191  1.00 67.41  ? 292  GLU A OE1 1 
ATOM   2201 O OE2 . GLU A 1 292 ? 36.892  25.385  -2.770  1.00 65.88  ? 292  GLU A OE2 1 
ATOM   2202 N N   . SER A 1 293 ? 36.871  20.244  0.074   1.00 51.02  ? 293  SER A N   1 
ATOM   2203 C CA  . SER A 1 293 ? 35.682  19.443  0.325   1.00 49.58  ? 293  SER A CA  1 
ATOM   2204 C C   . SER A 1 293 ? 34.806  19.927  1.459   1.00 47.64  ? 293  SER A C   1 
ATOM   2205 O O   . SER A 1 293 ? 35.215  20.747  2.253   1.00 47.13  ? 293  SER A O   1 
ATOM   2206 C CB  . SER A 1 293 ? 36.117  18.013  0.622   1.00 49.72  ? 293  SER A CB  1 
ATOM   2207 O OG  . SER A 1 293 ? 37.017  17.982  1.704   1.00 51.45  ? 293  SER A OG  1 
ATOM   2208 N N   . ILE A 1 294 ? 33.582  19.400  1.525   1.00 46.22  ? 294  ILE A N   1 
ATOM   2209 C CA  . ILE A 1 294 ? 32.739  19.537  2.710   1.00 44.56  ? 294  ILE A CA  1 
ATOM   2210 C C   . ILE A 1 294 ? 32.321  18.141  3.162   1.00 43.96  ? 294  ILE A C   1 
ATOM   2211 O O   . ILE A 1 294 ? 32.381  17.176  2.372   1.00 43.96  ? 294  ILE A O   1 
ATOM   2212 C CB  . ILE A 1 294 ? 31.511  20.417  2.471   1.00 44.42  ? 294  ILE A CB  1 
ATOM   2213 C CG1 . ILE A 1 294 ? 30.622  19.818  1.363   1.00 44.99  ? 294  ILE A CG1 1 
ATOM   2214 C CG2 . ILE A 1 294 ? 31.947  21.839  2.160   1.00 44.67  ? 294  ILE A CG2 1 
ATOM   2215 C CD1 . ILE A 1 294 ? 29.371  20.592  1.057   1.00 44.39  ? 294  ILE A CD1 1 
ATOM   2216 N N   . PHE A 1 295 ? 31.918  18.035  4.429   1.00 42.79  ? 295  PHE A N   1 
ATOM   2217 C CA  . PHE A 1 295 ? 31.569  16.744  5.050   1.00 42.22  ? 295  PHE A CA  1 
ATOM   2218 C C   . PHE A 1 295 ? 32.769  15.777  4.961   1.00 42.31  ? 295  PHE A C   1 
ATOM   2219 O O   . PHE A 1 295 ? 32.606  14.557  4.771   1.00 41.90  ? 295  PHE A O   1 
ATOM   2220 C CB  . PHE A 1 295 ? 30.304  16.155  4.406   1.00 42.65  ? 295  PHE A CB  1 
ATOM   2221 C CG  . PHE A 1 295 ? 29.351  15.484  5.385   1.00 43.18  ? 295  PHE A CG  1 
ATOM   2222 C CD1 . PHE A 1 295 ? 29.804  14.581  6.339   1.00 44.10  ? 295  PHE A CD1 1 
ATOM   2223 C CD2 . PHE A 1 295 ? 27.977  15.762  5.336   1.00 45.38  ? 295  PHE A CD2 1 
ATOM   2224 C CE1 . PHE A 1 295 ? 28.919  13.972  7.227   1.00 44.04  ? 295  PHE A CE1 1 
ATOM   2225 C CE2 . PHE A 1 295 ? 27.082  15.156  6.225   1.00 44.87  ? 295  PHE A CE2 1 
ATOM   2226 C CZ  . PHE A 1 295 ? 27.552  14.257  7.171   1.00 43.58  ? 295  PHE A CZ  1 
ATOM   2227 N N   . ARG A 1 296 ? 33.973  16.332  5.098   1.00 41.24  ? 296  ARG A N   1 
ATOM   2228 C CA  . ARG A 1 296 ? 35.185  15.529  5.249   1.00 41.98  ? 296  ARG A CA  1 
ATOM   2229 C C   . ARG A 1 296 ? 36.003  16.069  6.402   1.00 41.96  ? 296  ARG A C   1 
ATOM   2230 O O   . ARG A 1 296 ? 36.079  17.286  6.611   1.00 41.53  ? 296  ARG A O   1 
ATOM   2231 C CB  . ARG A 1 296 ? 36.056  15.555  3.993   1.00 42.53  ? 296  ARG A CB  1 
ATOM   2232 C CG  . ARG A 1 296 ? 35.450  14.902  2.787   1.00 43.72  ? 296  ARG A CG  1 
ATOM   2233 C CD  . ARG A 1 296 ? 35.239  13.421  2.952   1.00 45.44  ? 296  ARG A CD  1 
ATOM   2234 N NE  . ARG A 1 296 ? 34.733  12.826  1.717   1.00 44.87  ? 296  ARG A NE  1 
ATOM   2235 C CZ  . ARG A 1 296 ? 33.449  12.657  1.416   1.00 46.59  ? 296  ARG A CZ  1 
ATOM   2236 N NH1 . ARG A 1 296 ? 32.494  13.007  2.255   1.00 45.24  ? 296  ARG A NH1 1 
ATOM   2237 N NH2 . ARG A 1 296 ? 33.118  12.104  0.259   1.00 47.52  ? 296  ARG A NH2 1 
ATOM   2238 N N   . PHE A 1 297 ? 36.628  15.150  7.138   1.00 41.87  ? 297  PHE A N   1 
ATOM   2239 C CA  . PHE A 1 297 ? 37.340  15.482  8.362   1.00 41.49  ? 297  PHE A CA  1 
ATOM   2240 C C   . PHE A 1 297 ? 38.690  14.769  8.374   1.00 42.41  ? 297  PHE A C   1 
ATOM   2241 O O   . PHE A 1 297 ? 38.808  13.595  7.964   1.00 41.95  ? 297  PHE A O   1 
ATOM   2242 C CB  . PHE A 1 297 ? 36.479  15.076  9.557   1.00 41.17  ? 297  PHE A CB  1 
ATOM   2243 C CG  . PHE A 1 297 ? 35.017  15.388  9.370   1.00 40.13  ? 297  PHE A CG  1 
ATOM   2244 C CD1 . PHE A 1 297 ? 34.568  16.709  9.359   1.00 39.12  ? 297  PHE A CD1 1 
ATOM   2245 C CD2 . PHE A 1 297 ? 34.091  14.368  9.173   1.00 40.34  ? 297  PHE A CD2 1 
ATOM   2246 C CE1 . PHE A 1 297 ? 33.180  17.002  9.160   1.00 39.59  ? 297  PHE A CE1 1 
ATOM   2247 C CE2 . PHE A 1 297 ? 32.727  14.666  8.968   1.00 39.57  ? 297  PHE A CE2 1 
ATOM   2248 C CZ  . PHE A 1 297 ? 32.288  15.971  8.967   1.00 39.06  ? 297  PHE A CZ  1 
ATOM   2249 N N   . SER A 1 298 ? 39.703  15.486  8.840   1.00 42.12  ? 298  SER A N   1 
ATOM   2250 C CA  . SER A 1 298 ? 41.083  15.056  8.691   1.00 43.14  ? 298  SER A CA  1 
ATOM   2251 C C   . SER A 1 298 ? 41.438  13.835  9.517   1.00 43.50  ? 298  SER A C   1 
ATOM   2252 O O   . SER A 1 298 ? 42.104  12.903  9.035   1.00 45.16  ? 298  SER A O   1 
ATOM   2253 C CB  . SER A 1 298 ? 41.999  16.199  9.090   1.00 43.42  ? 298  SER A CB  1 
ATOM   2254 O OG  . SER A 1 298 ? 41.859  17.246  8.154   1.00 44.33  ? 298  SER A OG  1 
ATOM   2255 N N   . PHE A 1 299 ? 41.023  13.835  10.774  1.00 42.75  ? 299  PHE A N   1 
ATOM   2256 C CA  . PHE A 1 299 ? 41.451  12.790  11.692  1.00 42.12  ? 299  PHE A CA  1 
ATOM   2257 C C   . PHE A 1 299 ? 40.251  12.021  12.218  1.00 41.59  ? 299  PHE A C   1 
ATOM   2258 O O   . PHE A 1 299 ? 39.501  12.515  13.060  1.00 40.84  ? 299  PHE A O   1 
ATOM   2259 C CB  . PHE A 1 299 ? 42.326  13.410  12.765  1.00 42.06  ? 299  PHE A CB  1 
ATOM   2260 C CG  . PHE A 1 299 ? 43.620  13.959  12.200  1.00 42.12  ? 299  PHE A CG  1 
ATOM   2261 C CD1 . PHE A 1 299 ? 44.650  13.105  11.865  1.00 40.99  ? 299  PHE A CD1 1 
ATOM   2262 C CD2 . PHE A 1 299 ? 43.769  15.303  11.949  1.00 42.12  ? 299  PHE A CD2 1 
ATOM   2263 C CE1 . PHE A 1 299 ? 45.801  13.563  11.314  1.00 42.91  ? 299  PHE A CE1 1 
ATOM   2264 C CE2 . PHE A 1 299 ? 44.946  15.807  11.382  1.00 41.99  ? 299  PHE A CE2 1 
ATOM   2265 C CZ  . PHE A 1 299 ? 45.975  14.943  11.078  1.00 42.65  ? 299  PHE A CZ  1 
ATOM   2266 N N   . VAL A 1 300 ? 40.086  10.805  11.683  1.00 41.45  ? 300  VAL A N   1 
ATOM   2267 C CA  . VAL A 1 300 ? 38.933  9.944   11.945  1.00 40.38  ? 300  VAL A CA  1 
ATOM   2268 C C   . VAL A 1 300 ? 39.376  8.491   12.193  1.00 40.97  ? 300  VAL A C   1 
ATOM   2269 O O   . VAL A 1 300 ? 40.561  8.153   12.023  1.00 41.54  ? 300  VAL A O   1 
ATOM   2270 C CB  . VAL A 1 300 ? 37.924  10.002  10.754  1.00 41.01  ? 300  VAL A CB  1 
ATOM   2271 C CG1 . VAL A 1 300 ? 37.447  11.438  10.510  1.00 38.83  ? 300  VAL A CG1 1 
ATOM   2272 C CG2 . VAL A 1 300 ? 38.529  9.408   9.476   1.00 40.99  ? 300  VAL A CG2 1 
ATOM   2273 N N   . PRO A 1 301 ? 38.443  7.622   12.621  1.00 40.48  ? 301  PRO A N   1 
ATOM   2274 C CA  . PRO A 1 301 ? 38.817  6.219   12.745  1.00 41.43  ? 301  PRO A CA  1 
ATOM   2275 C C   . PRO A 1 301 ? 39.588  5.680   11.551  1.00 42.59  ? 301  PRO A C   1 
ATOM   2276 O O   . PRO A 1 301 ? 39.334  6.061   10.406  1.00 42.60  ? 301  PRO A O   1 
ATOM   2277 C CB  . PRO A 1 301 ? 37.468  5.510   12.918  1.00 41.01  ? 301  PRO A CB  1 
ATOM   2278 C CG  . PRO A 1 301 ? 36.622  6.562   13.689  1.00 40.42  ? 301  PRO A CG  1 
ATOM   2279 C CD  . PRO A 1 301 ? 37.046  7.867   13.049  1.00 39.87  ? 301  PRO A CD  1 
ATOM   2280 N N   . VAL A 1 302 ? 40.537  4.797   11.832  1.00 44.47  ? 302  VAL A N   1 
ATOM   2281 C CA  . VAL A 1 302 ? 41.383  4.215   10.804  1.00 45.65  ? 302  VAL A CA  1 
ATOM   2282 C C   . VAL A 1 302 ? 41.093  2.704   10.730  1.00 47.54  ? 302  VAL A C   1 
ATOM   2283 O O   . VAL A 1 302 ? 40.871  2.045   11.754  1.00 47.63  ? 302  VAL A O   1 
ATOM   2284 C CB  . VAL A 1 302 ? 42.881  4.494   11.079  1.00 46.16  ? 302  VAL A CB  1 
ATOM   2285 C CG1 . VAL A 1 302 ? 43.292  3.933   12.441  1.00 44.76  ? 302  VAL A CG1 1 
ATOM   2286 C CG2 . VAL A 1 302 ? 43.776  3.952   9.933   1.00 46.93  ? 302  VAL A CG2 1 
ATOM   2287 N N   . VAL A 1 303 ? 41.057  2.168   9.511   1.00 49.00  ? 303  VAL A N   1 
ATOM   2288 C CA  . VAL A 1 303 ? 40.928  0.725   9.333   1.00 50.51  ? 303  VAL A CA  1 
ATOM   2289 C C   . VAL A 1 303 ? 42.307  0.160   9.631   1.00 51.90  ? 303  VAL A C   1 
ATOM   2290 O O   . VAL A 1 303 ? 43.175  0.116   8.768   1.00 53.11  ? 303  VAL A O   1 
ATOM   2291 C CB  . VAL A 1 303 ? 40.405  0.356   7.939   1.00 50.86  ? 303  VAL A CB  1 
ATOM   2292 C CG1 . VAL A 1 303 ? 40.211  -1.153  7.845   1.00 52.11  ? 303  VAL A CG1 1 
ATOM   2293 C CG2 . VAL A 1 303 ? 39.072  1.113   7.654   1.00 49.28  ? 303  VAL A CG2 1 
ATOM   2294 N N   . ASP A 1 304 ? 42.493  -0.212  10.895  1.00 52.85  ? 304  ASP A N   1 
ATOM   2295 C CA  . ASP A 1 304 ? 43.789  -0.596  11.464  1.00 53.98  ? 304  ASP A CA  1 
ATOM   2296 C C   . ASP A 1 304 ? 44.030  -2.095  11.537  1.00 55.63  ? 304  ASP A C   1 
ATOM   2297 O O   . ASP A 1 304 ? 45.146  -2.525  11.840  1.00 56.47  ? 304  ASP A O   1 
ATOM   2298 C CB  . ASP A 1 304 ? 43.934  -0.011  12.886  1.00 53.62  ? 304  ASP A CB  1 
ATOM   2299 C CG  . ASP A 1 304 ? 42.794  -0.427  13.837  1.00 53.55  ? 304  ASP A CG  1 
ATOM   2300 O OD1 . ASP A 1 304 ? 41.804  -1.040  13.376  1.00 53.19  ? 304  ASP A OD1 1 
ATOM   2301 O OD2 . ASP A 1 304 ? 42.863  -0.098  15.049  1.00 52.70  ? 304  ASP A OD2 1 
ATOM   2302 N N   . GLY A 1 305 ? 42.998  -2.892  11.293  1.00 56.01  ? 305  GLY A N   1 
ATOM   2303 C CA  . GLY A 1 305 ? 43.121  -4.348  11.425  1.00 57.47  ? 305  GLY A CA  1 
ATOM   2304 C C   . GLY A 1 305 ? 43.098  -4.800  12.873  1.00 57.99  ? 305  GLY A C   1 
ATOM   2305 O O   . GLY A 1 305 ? 43.458  -5.927  13.171  1.00 59.29  ? 305  GLY A O   1 
ATOM   2306 N N   . ASP A 1 306 ? 42.645  -3.922  13.768  1.00 57.13  ? 306  ASP A N   1 
ATOM   2307 C CA  . ASP A 1 306 ? 42.647  -4.166  15.208  1.00 56.98  ? 306  ASP A CA  1 
ATOM   2308 C C   . ASP A 1 306 ? 41.269  -3.750  15.739  1.00 55.72  ? 306  ASP A C   1 
ATOM   2309 O O   . ASP A 1 306 ? 40.362  -4.570  15.761  1.00 56.20  ? 306  ASP A O   1 
ATOM   2310 C CB  . ASP A 1 306 ? 43.798  -3.397  15.870  1.00 57.41  ? 306  ASP A CB  1 
ATOM   2311 C CG  . ASP A 1 306 ? 43.928  -3.678  17.371  1.00 59.89  ? 306  ASP A CG  1 
ATOM   2312 O OD1 . ASP A 1 306 ? 43.375  -4.686  17.872  1.00 62.48  ? 306  ASP A OD1 1 
ATOM   2313 O OD2 . ASP A 1 306 ? 44.614  -2.884  18.058  1.00 62.90  ? 306  ASP A OD2 1 
ATOM   2314 N N   . PHE A 1 307 ? 41.074  -2.487  16.118  1.00 54.09  ? 307  PHE A N   1 
ATOM   2315 C CA  . PHE A 1 307 ? 39.720  -2.027  16.473  1.00 52.43  ? 307  PHE A CA  1 
ATOM   2316 C C   . PHE A 1 307 ? 38.765  -2.360  15.336  1.00 52.17  ? 307  PHE A C   1 
ATOM   2317 O O   . PHE A 1 307 ? 37.682  -2.919  15.553  1.00 52.04  ? 307  PHE A O   1 
ATOM   2318 C CB  . PHE A 1 307 ? 39.685  -0.537  16.793  1.00 50.28  ? 307  PHE A CB  1 
ATOM   2319 C CG  . PHE A 1 307 ? 38.456  -0.112  17.555  1.00 49.38  ? 307  PHE A CG  1 
ATOM   2320 C CD1 . PHE A 1 307 ? 37.228  0.012   16.914  1.00 47.23  ? 307  PHE A CD1 1 
ATOM   2321 C CD2 . PHE A 1 307 ? 38.520  0.135   18.924  1.00 48.38  ? 307  PHE A CD2 1 
ATOM   2322 C CE1 . PHE A 1 307 ? 36.083  0.378   17.630  1.00 47.14  ? 307  PHE A CE1 1 
ATOM   2323 C CE2 . PHE A 1 307 ? 37.380  0.506   19.643  1.00 47.79  ? 307  PHE A CE2 1 
ATOM   2324 C CZ  . PHE A 1 307 ? 36.160  0.622   18.996  1.00 46.69  ? 307  PHE A CZ  1 
ATOM   2325 N N   . LEU A 1 308 ? 39.174  -2.019  14.120  1.00 52.49  ? 308  LEU A N   1 
ATOM   2326 C CA  . LEU A 1 308 ? 38.411  -2.386  12.933  1.00 52.92  ? 308  LEU A CA  1 
ATOM   2327 C C   . LEU A 1 308 ? 39.196  -3.438  12.183  1.00 54.51  ? 308  LEU A C   1 
ATOM   2328 O O   . LEU A 1 308 ? 40.256  -3.146  11.636  1.00 54.96  ? 308  LEU A O   1 
ATOM   2329 C CB  . LEU A 1 308 ? 38.174  -1.168  12.053  1.00 51.72  ? 308  LEU A CB  1 
ATOM   2330 C CG  . LEU A 1 308 ? 37.240  -0.112  12.647  1.00 50.58  ? 308  LEU A CG  1 
ATOM   2331 C CD1 . LEU A 1 308 ? 37.163  1.070   11.698  1.00 48.64  ? 308  LEU A CD1 1 
ATOM   2332 C CD2 . LEU A 1 308 ? 35.834  -0.691  12.907  1.00 49.92  ? 308  LEU A CD2 1 
ATOM   2333 N N   . SER A 1 309 ? 38.698  -4.667  12.186  1.00 55.75  ? 309  SER A N   1 
ATOM   2334 C CA  . SER A 1 309 ? 39.454  -5.780  11.616  1.00 58.08  ? 309  SER A CA  1 
ATOM   2335 C C   . SER A 1 309 ? 39.423  -5.745  10.089  1.00 58.40  ? 309  SER A C   1 
ATOM   2336 O O   . SER A 1 309 ? 40.282  -6.316  9.439   1.00 59.92  ? 309  SER A O   1 
ATOM   2337 C CB  . SER A 1 309 ? 38.946  -7.129  12.143  1.00 58.99  ? 309  SER A CB  1 
ATOM   2338 O OG  . SER A 1 309 ? 37.590  -7.339  11.804  1.00 61.23  ? 309  SER A OG  1 
ATOM   2339 N N   . ASP A 1 310 ? 38.425  -5.074  9.530   1.00 57.64  ? 310  ASP A N   1 
ATOM   2340 C CA  . ASP A 1 310 ? 38.329  -4.848  8.092   1.00 57.69  ? 310  ASP A CA  1 
ATOM   2341 C C   . ASP A 1 310 ? 37.525  -3.556  7.904   1.00 56.28  ? 310  ASP A C   1 
ATOM   2342 O O   . ASP A 1 310 ? 37.102  -2.931  8.883   1.00 54.33  ? 310  ASP A O   1 
ATOM   2343 C CB  . ASP A 1 310 ? 37.632  -6.037  7.418   1.00 58.59  ? 310  ASP A CB  1 
ATOM   2344 C CG  . ASP A 1 310 ? 38.055  -6.235  5.961   1.00 60.62  ? 310  ASP A CG  1 
ATOM   2345 O OD1 . ASP A 1 310 ? 38.473  -5.253  5.304   1.00 57.94  ? 310  ASP A OD1 1 
ATOM   2346 O OD2 . ASP A 1 310 ? 37.969  -7.394  5.471   1.00 64.34  ? 310  ASP A OD2 1 
ATOM   2347 N N   . THR A 1 311 ? 37.303  -3.151  6.661   1.00 56.72  ? 311  THR A N   1 
ATOM   2348 C CA  . THR A 1 311 ? 36.538  -1.938  6.425   1.00 56.30  ? 311  THR A CA  1 
ATOM   2349 C C   . THR A 1 311 ? 35.143  -2.191  6.969   1.00 56.47  ? 311  THR A C   1 
ATOM   2350 O O   . THR A 1 311 ? 34.692  -3.333  6.978   1.00 57.28  ? 311  THR A O   1 
ATOM   2351 C CB  . THR A 1 311 ? 36.438  -1.591  4.939   1.00 56.38  ? 311  THR A CB  1 
ATOM   2352 O OG1 . THR A 1 311 ? 35.711  -2.619  4.267   1.00 57.48  ? 311  THR A OG1 1 
ATOM   2353 C CG2 . THR A 1 311 ? 37.819  -1.442  4.310   1.00 56.88  ? 311  THR A CG2 1 
ATOM   2354 N N   . PRO A 1 312 ? 34.474  -1.139  7.470   1.00 56.70  ? 312  PRO A N   1 
ATOM   2355 C CA  . PRO A 1 312 ? 33.057  -1.252  7.818   1.00 57.44  ? 312  PRO A CA  1 
ATOM   2356 C C   . PRO A 1 312 ? 32.180  -1.870  6.716   1.00 58.51  ? 312  PRO A C   1 
ATOM   2357 O O   . PRO A 1 312 ? 31.255  -2.593  7.034   1.00 58.50  ? 312  PRO A O   1 
ATOM   2358 C CB  . PRO A 1 312 ? 32.660  0.193   8.098   1.00 55.92  ? 312  PRO A CB  1 
ATOM   2359 C CG  . PRO A 1 312 ? 33.901  0.792   8.625   1.00 55.42  ? 312  PRO A CG  1 
ATOM   2360 C CD  . PRO A 1 312 ? 34.994  0.201   7.793   1.00 55.37  ? 312  PRO A CD  1 
ATOM   2361 N N   . GLU A 1 313 ? 32.475  -1.590  5.447   1.00 60.06  ? 313  GLU A N   1 
ATOM   2362 C CA  . GLU A 1 313 ? 31.738  -2.186  4.318   1.00 61.47  ? 313  GLU A CA  1 
ATOM   2363 C C   . GLU A 1 313 ? 31.820  -3.701  4.357   1.00 62.24  ? 313  GLU A C   1 
ATOM   2364 O O   . GLU A 1 313 ? 30.803  -4.393  4.292   1.00 62.63  ? 313  GLU A O   1 
ATOM   2365 C CB  . GLU A 1 313 ? 32.303  -1.680  2.982   1.00 62.08  ? 313  GLU A CB  1 
ATOM   2366 C CG  . GLU A 1 313 ? 31.623  -2.267  1.727   1.00 64.30  ? 313  GLU A CG  1 
ATOM   2367 C CD  . GLU A 1 313 ? 32.077  -1.595  0.416   1.00 67.05  ? 313  GLU A CD  1 
ATOM   2368 O OE1 . GLU A 1 313 ? 33.254  -1.151  0.333   1.00 73.39  ? 313  GLU A OE1 1 
ATOM   2369 O OE2 . GLU A 1 313 ? 31.251  -1.511  -0.534  1.00 73.62  ? 313  GLU A OE2 1 
ATOM   2370 N N   . ALA A 1 314 ? 33.041  -4.215  4.470   1.00 62.46  ? 314  ALA A N   1 
ATOM   2371 C CA  . ALA A 1 314 ? 33.247  -5.647  4.549   1.00 63.66  ? 314  ALA A CA  1 
ATOM   2372 C C   . ALA A 1 314 ? 32.532  -6.210  5.763   1.00 63.50  ? 314  ALA A C   1 
ATOM   2373 O O   . ALA A 1 314 ? 31.848  -7.212  5.660   1.00 64.86  ? 314  ALA A O   1 
ATOM   2374 C CB  . ALA A 1 314 ? 34.742  -5.986  4.599   1.00 64.23  ? 314  ALA A CB  1 
ATOM   2375 N N   . LEU A 1 315 ? 32.678  -5.553  6.908   1.00 62.65  ? 315  LEU A N   1 
ATOM   2376 C CA  . LEU A 1 315 ? 32.151  -6.082  8.169   1.00 62.87  ? 315  LEU A CA  1 
ATOM   2377 C C   . LEU A 1 315 ? 30.618  -6.107  8.217   1.00 63.55  ? 315  LEU A C   1 
ATOM   2378 O O   . LEU A 1 315 ? 30.045  -7.065  8.742   1.00 64.41  ? 315  LEU A O   1 
ATOM   2379 C CB  . LEU A 1 315 ? 32.739  -5.337  9.377   1.00 61.72  ? 315  LEU A CB  1 
ATOM   2380 C CG  . LEU A 1 315 ? 34.252  -5.481  9.606   1.00 61.20  ? 315  LEU A CG  1 
ATOM   2381 C CD1 . LEU A 1 315 ? 34.730  -4.596  10.739  1.00 58.51  ? 315  LEU A CD1 1 
ATOM   2382 C CD2 . LEU A 1 315 ? 34.662  -6.941  9.857   1.00 63.29  ? 315  LEU A CD2 1 
ATOM   2383 N N   . ILE A 1 316 ? 29.945  -5.105  7.651   1.00 63.52  ? 316  ILE A N   1 
ATOM   2384 C CA  . ILE A 1 316 ? 28.477  -5.165  7.561   1.00 64.77  ? 316  ILE A CA  1 
ATOM   2385 C C   . ILE A 1 316 ? 27.987  -6.171  6.493   1.00 66.95  ? 316  ILE A C   1 
ATOM   2386 O O   . ILE A 1 316 ? 26.859  -6.648  6.576   1.00 67.45  ? 316  ILE A O   1 
ATOM   2387 C CB  . ILE A 1 316 ? 27.798  -3.761  7.386   1.00 63.55  ? 316  ILE A CB  1 
ATOM   2388 C CG1 . ILE A 1 316 ? 27.921  -3.228  5.953   1.00 63.91  ? 316  ILE A CG1 1 
ATOM   2389 C CG2 . ILE A 1 316 ? 28.379  -2.752  8.388   1.00 61.25  ? 316  ILE A CG2 1 
ATOM   2390 C CD1 . ILE A 1 316 ? 27.082  -1.977  5.680   1.00 62.56  ? 316  ILE A CD1 1 
ATOM   2391 N N   . ASN A 1 317 ? 28.822  -6.507  5.508   1.00 68.59  ? 317  ASN A N   1 
ATOM   2392 C CA  . ASN A 1 317 ? 28.422  -7.484  4.478   1.00 70.48  ? 317  ASN A CA  1 
ATOM   2393 C C   . ASN A 1 317 ? 28.524  -8.924  4.958   1.00 72.42  ? 317  ASN A C   1 
ATOM   2394 O O   . ASN A 1 317 ? 27.704  -9.752  4.580   1.00 74.10  ? 317  ASN A O   1 
ATOM   2395 C CB  . ASN A 1 317 ? 29.241  -7.321  3.193   1.00 71.36  ? 317  ASN A CB  1 
ATOM   2396 C CG  . ASN A 1 317 ? 28.978  -5.993  2.481   1.00 72.21  ? 317  ASN A CG  1 
ATOM   2397 O OD1 . ASN A 1 317 ? 28.050  -5.253  2.822   1.00 75.58  ? 317  ASN A OD1 1 
ATOM   2398 N ND2 . ASN A 1 317 ? 29.811  -5.685  1.482   1.00 74.65  ? 317  ASN A ND2 1 
ATOM   2399 N N   . THR A 1 318 ? 29.528  -9.218  5.784   1.00 72.67  ? 318  THR A N   1 
ATOM   2400 C CA  . THR A 1 318 ? 29.796  -10.575 6.240   1.00 74.27  ? 318  THR A CA  1 
ATOM   2401 C C   . THR A 1 318 ? 29.324  -10.858 7.662   1.00 74.15  ? 318  THR A C   1 
ATOM   2402 O O   . THR A 1 318 ? 29.239  -12.012 8.062   1.00 75.92  ? 318  THR A O   1 
ATOM   2403 C CB  . THR A 1 318 ? 31.314  -10.904 6.174   1.00 74.86  ? 318  THR A CB  1 
ATOM   2404 O OG1 . THR A 1 318 ? 32.056  -10.001 7.011   1.00 73.85  ? 318  THR A OG1 1 
ATOM   2405 C CG2 . THR A 1 318 ? 31.822  -10.826 4.736   1.00 75.52  ? 318  THR A CG2 1 
ATOM   2406 N N   . GLY A 1 319 ? 29.020  -9.825  8.433   1.00 72.58  ? 319  GLY A N   1 
ATOM   2407 C CA  . GLY A 1 319 ? 28.694  -10.016 9.843   1.00 72.42  ? 319  GLY A CA  1 
ATOM   2408 C C   . GLY A 1 319 ? 27.407  -10.784 10.119  1.00 73.11  ? 319  GLY A C   1 
ATOM   2409 O O   . GLY A 1 319 ? 26.480  -10.777 9.305   1.00 73.36  ? 319  GLY A O   1 
ATOM   2410 N N   . ASP A 1 320 ? 27.365  -11.440 11.279  1.00 73.40  ? 320  ASP A N   1 
ATOM   2411 C CA  . ASP A 1 320 ? 26.160  -12.103 11.782  1.00 74.02  ? 320  ASP A CA  1 
ATOM   2412 C C   . ASP A 1 320 ? 25.538  -11.228 12.868  1.00 72.08  ? 320  ASP A C   1 
ATOM   2413 O O   . ASP A 1 320 ? 26.098  -11.113 13.951  1.00 71.92  ? 320  ASP A O   1 
ATOM   2414 C CB  . ASP A 1 320 ? 26.519  -13.477 12.362  1.00 75.77  ? 320  ASP A CB  1 
ATOM   2415 C CG  . ASP A 1 320 ? 25.303  -14.222 12.923  1.00 78.03  ? 320  ASP A CG  1 
ATOM   2416 O OD1 . ASP A 1 320 ? 24.270  -13.569 13.186  1.00 78.74  ? 320  ASP A OD1 1 
ATOM   2417 O OD2 . ASP A 1 320 ? 25.383  -15.461 13.102  1.00 80.61  ? 320  ASP A OD2 1 
ATOM   2418 N N   . PHE A 1 321 ? 24.380  -10.632 12.591  1.00 70.85  ? 321  PHE A N   1 
ATOM   2419 C CA  . PHE A 1 321 ? 23.762  -9.677  13.520  1.00 69.41  ? 321  PHE A CA  1 
ATOM   2420 C C   . PHE A 1 321 ? 22.421  -10.154 14.065  1.00 70.03  ? 321  PHE A C   1 
ATOM   2421 O O   . PHE A 1 321 ? 21.547  -9.346  14.382  1.00 68.75  ? 321  PHE A O   1 
ATOM   2422 C CB  . PHE A 1 321 ? 23.592  -8.317  12.833  1.00 67.93  ? 321  PHE A CB  1 
ATOM   2423 C CG  . PHE A 1 321 ? 24.867  -7.757  12.306  1.00 66.71  ? 321  PHE A CG  1 
ATOM   2424 C CD1 . PHE A 1 321 ? 25.815  -7.243  13.172  1.00 65.40  ? 321  PHE A CD1 1 
ATOM   2425 C CD2 . PHE A 1 321 ? 25.130  -7.756  10.945  1.00 67.45  ? 321  PHE A CD2 1 
ATOM   2426 C CE1 . PHE A 1 321 ? 27.000  -6.733  12.694  1.00 65.02  ? 321  PHE A CE1 1 
ATOM   2427 C CE2 . PHE A 1 321 ? 26.316  -7.242  10.458  1.00 66.38  ? 321  PHE A CE2 1 
ATOM   2428 C CZ  . PHE A 1 321 ? 27.255  -6.734  11.334  1.00 65.50  ? 321  PHE A CZ  1 
ATOM   2429 N N   . GLN A 1 322 ? 22.277  -11.471 14.193  1.00 71.77  ? 322  GLN A N   1 
ATOM   2430 C CA  . GLN A 1 322 ? 21.040  -12.081 14.672  1.00 72.92  ? 322  GLN A CA  1 
ATOM   2431 C C   . GLN A 1 322 ? 20.615  -11.588 16.056  1.00 71.63  ? 322  GLN A C   1 
ATOM   2432 O O   . GLN A 1 322 ? 19.422  -11.440 16.324  1.00 72.35  ? 322  GLN A O   1 
ATOM   2433 C CB  . GLN A 1 322 ? 21.187  -13.608 14.709  1.00 74.98  ? 322  GLN A CB  1 
ATOM   2434 C CG  . GLN A 1 322 ? 21.167  -14.272 13.339  1.00 76.81  ? 322  GLN A CG  1 
ATOM   2435 C CD  . GLN A 1 322 ? 21.329  -15.789 13.409  1.00 79.44  ? 322  GLN A CD  1 
ATOM   2436 O OE1 . GLN A 1 322 ? 21.312  -16.464 12.381  1.00 82.75  ? 322  GLN A OE1 1 
ATOM   2437 N NE2 . GLN A 1 322 ? 21.483  -16.330 14.624  1.00 81.52  ? 322  GLN A NE2 1 
ATOM   2438 N N   . ASP A 1 323 ? 21.582  -11.329 16.930  1.00 70.37  ? 323  ASP A N   1 
ATOM   2439 C CA  A ASP A 1 323 ? 21.356  -10.904 18.311  0.50 69.77  ? 323  ASP A CA  1 
ATOM   2440 C CA  B ASP A 1 323 ? 21.211  -10.909 18.287  0.50 69.74  ? 323  ASP A CA  1 
ATOM   2441 C C   . ASP A 1 323 ? 21.275  -9.378  18.474  1.00 67.69  ? 323  ASP A C   1 
ATOM   2442 O O   . ASP A 1 323 ? 21.316  -8.866  19.598  1.00 67.02  ? 323  ASP A O   1 
ATOM   2443 C CB  A ASP A 1 323 ? 22.496  -11.436 19.201  0.50 70.02  ? 323  ASP A CB  1 
ATOM   2444 C CB  B ASP A 1 323 ? 22.000  -11.707 19.341  0.50 70.32  ? 323  ASP A CB  1 
ATOM   2445 C CG  A ASP A 1 323 ? 23.836  -10.731 18.945  0.50 69.55  ? 323  ASP A CG  1 
ATOM   2446 C CG  B ASP A 1 323 ? 21.473  -13.150 19.499  0.50 72.45  ? 323  ASP A CG  1 
ATOM   2447 O OD1 A ASP A 1 323 ? 24.036  -10.163 17.847  0.50 70.05  ? 323  ASP A OD1 1 
ATOM   2448 O OD1 B ASP A 1 323 ? 20.799  -13.435 20.515  0.50 72.71  ? 323  ASP A OD1 1 
ATOM   2449 O OD2 A ASP A 1 323 ? 24.695  -10.750 19.850  0.50 70.50  ? 323  ASP A OD2 1 
ATOM   2450 O OD2 B ASP A 1 323 ? 21.709  -13.992 18.601  0.50 73.30  ? 323  ASP A OD2 1 
ATOM   2451 N N   . LEU A 1 324 ? 21.195  -8.650  17.361  1.00 66.33  ? 324  LEU A N   1 
ATOM   2452 C CA  . LEU A 1 324 ? 21.251  -7.185  17.383  1.00 63.88  ? 324  LEU A CA  1 
ATOM   2453 C C   . LEU A 1 324 ? 19.900  -6.539  17.140  1.00 62.64  ? 324  LEU A C   1 
ATOM   2454 O O   . LEU A 1 324 ? 19.181  -6.925  16.221  1.00 62.89  ? 324  LEU A O   1 
ATOM   2455 C CB  . LEU A 1 324 ? 22.221  -6.678  16.309  1.00 63.59  ? 324  LEU A CB  1 
ATOM   2456 C CG  . LEU A 1 324 ? 22.510  -5.169  16.359  1.00 62.25  ? 324  LEU A CG  1 
ATOM   2457 C CD1 . LEU A 1 324 ? 23.313  -4.820  17.611  1.00 60.95  ? 324  LEU A CD1 1 
ATOM   2458 C CD2 . LEU A 1 324 ? 23.224  -4.715  15.093  1.00 61.66  ? 324  LEU A CD2 1 
ATOM   2459 N N   . GLN A 1 325 ? 19.582  -5.532  17.950  1.00 60.75  ? 325  GLN A N   1 
ATOM   2460 C CA  . GLN A 1 325 ? 18.444  -4.657  17.702  1.00 60.03  ? 325  GLN A CA  1 
ATOM   2461 C C   . GLN A 1 325 ? 18.930  -3.220  17.563  1.00 57.97  ? 325  GLN A C   1 
ATOM   2462 O O   . GLN A 1 325 ? 19.652  -2.712  18.423  1.00 56.47  ? 325  GLN A O   1 
ATOM   2463 C CB  . GLN A 1 325 ? 17.442  -4.765  18.837  1.00 60.88  ? 325  GLN A CB  1 
ATOM   2464 C CG  . GLN A 1 325 ? 16.987  -6.173  19.083  1.00 63.95  ? 325  GLN A CG  1 
ATOM   2465 C CD  . GLN A 1 325 ? 16.701  -6.464  20.533  1.00 67.43  ? 325  GLN A CD  1 
ATOM   2466 O OE1 . GLN A 1 325 ? 15.764  -7.201  20.837  1.00 72.26  ? 325  GLN A OE1 1 
ATOM   2467 N NE2 . GLN A 1 325 ? 17.516  -5.920  21.438  1.00 65.08  ? 325  GLN A NE2 1 
ATOM   2468 N N   . VAL A 1 326 ? 18.564  -2.582  16.455  1.00 57.03  ? 326  VAL A N   1 
ATOM   2469 C CA  . VAL A 1 326 ? 19.049  -1.257  16.141  1.00 55.42  ? 326  VAL A CA  1 
ATOM   2470 C C   . VAL A 1 326 ? 17.913  -0.351  15.664  1.00 54.71  ? 326  VAL A C   1 
ATOM   2471 O O   . VAL A 1 326 ? 16.988  -0.793  14.982  1.00 54.96  ? 326  VAL A O   1 
ATOM   2472 C CB  . VAL A 1 326 ? 20.191  -1.283  15.093  1.00 55.43  ? 326  VAL A CB  1 
ATOM   2473 C CG1 . VAL A 1 326 ? 21.397  -1.980  15.662  1.00 56.31  ? 326  VAL A CG1 1 
ATOM   2474 C CG2 . VAL A 1 326 ? 19.759  -1.981  13.812  1.00 56.43  ? 326  VAL A CG2 1 
ATOM   2475 N N   . LEU A 1 327 ? 17.995  0.906   16.082  1.00 52.93  ? 327  LEU A N   1 
ATOM   2476 C CA  . LEU A 1 327 ? 17.129  1.970   15.625  1.00 52.31  ? 327  LEU A CA  1 
ATOM   2477 C C   . LEU A 1 327 ? 18.029  2.930   14.845  1.00 50.85  ? 327  LEU A C   1 
ATOM   2478 O O   . LEU A 1 327 ? 19.076  3.338   15.360  1.00 50.53  ? 327  LEU A O   1 
ATOM   2479 C CB  . LEU A 1 327 ? 16.482  2.635   16.844  1.00 52.22  ? 327  LEU A CB  1 
ATOM   2480 C CG  . LEU A 1 327 ? 15.600  3.896   16.793  1.00 53.27  ? 327  LEU A CG  1 
ATOM   2481 C CD1 . LEU A 1 327 ? 14.787  4.029   15.528  1.00 55.51  ? 327  LEU A CD1 1 
ATOM   2482 C CD2 . LEU A 1 327 ? 14.673  3.882   18.013  1.00 54.14  ? 327  LEU A CD2 1 
ATOM   2483 N N   . VAL A 1 328 ? 17.665  3.246   13.597  1.00 49.98  ? 328  VAL A N   1 
ATOM   2484 C CA  . VAL A 1 328 ? 18.468  4.146   12.740  1.00 49.18  ? 328  VAL A CA  1 
ATOM   2485 C C   . VAL A 1 328 ? 17.591  5.146   12.019  1.00 47.93  ? 328  VAL A C   1 
ATOM   2486 O O   . VAL A 1 328 ? 16.421  4.882   11.782  1.00 48.11  ? 328  VAL A O   1 
ATOM   2487 C CB  . VAL A 1 328 ? 19.275  3.357   11.661  1.00 49.77  ? 328  VAL A CB  1 
ATOM   2488 C CG1 . VAL A 1 328 ? 20.144  2.304   12.316  1.00 50.51  ? 328  VAL A CG1 1 
ATOM   2489 C CG2 . VAL A 1 328 ? 18.330  2.667   10.654  1.00 51.34  ? 328  VAL A CG2 1 
ATOM   2490 N N   . GLY A 1 329 ? 18.149  6.287   11.628  1.00 46.07  ? 329  GLY A N   1 
ATOM   2491 C CA  . GLY A 1 329 ? 17.361  7.226   10.843  1.00 45.97  ? 329  GLY A CA  1 
ATOM   2492 C C   . GLY A 1 329 ? 18.081  8.496   10.491  1.00 44.95  ? 329  GLY A C   1 
ATOM   2493 O O   . GLY A 1 329 ? 19.274  8.623   10.740  1.00 44.07  ? 329  GLY A O   1 
ATOM   2494 N N   . VAL A 1 330 ? 17.339  9.422   9.892   1.00 44.78  ? 330  VAL A N   1 
ATOM   2495 C CA  . VAL A 1 330 ? 17.902  10.605  9.264   1.00 44.04  ? 330  VAL A CA  1 
ATOM   2496 C C   . VAL A 1 330 ? 16.958  11.769  9.452   1.00 44.59  ? 330  VAL A C   1 
ATOM   2497 O O   . VAL A 1 330 ? 15.772  11.566  9.755   1.00 44.56  ? 330  VAL A O   1 
ATOM   2498 C CB  . VAL A 1 330 ? 18.152  10.348  7.741   1.00 45.06  ? 330  VAL A CB  1 
ATOM   2499 C CG1 . VAL A 1 330 ? 19.118  9.198   7.565   1.00 44.48  ? 330  VAL A CG1 1 
ATOM   2500 C CG2 . VAL A 1 330 ? 16.823  10.032  6.982   1.00 44.47  ? 330  VAL A CG2 1 
ATOM   2501 N N   . VAL A 1 331 ? 17.470  12.994  9.281   1.00 44.03  ? 331  VAL A N   1 
ATOM   2502 C CA  . VAL A 1 331 ? 16.586  14.179  9.227   1.00 44.47  ? 331  VAL A CA  1 
ATOM   2503 C C   . VAL A 1 331 ? 16.265  14.516  7.774   1.00 46.05  ? 331  VAL A C   1 
ATOM   2504 O O   . VAL A 1 331 ? 16.883  13.977  6.856   1.00 45.83  ? 331  VAL A O   1 
ATOM   2505 C CB  . VAL A 1 331 ? 17.191  15.420  9.942   1.00 43.79  ? 331  VAL A CB  1 
ATOM   2506 C CG1 . VAL A 1 331 ? 17.427  15.124  11.413  1.00 41.89  ? 331  VAL A CG1 1 
ATOM   2507 C CG2 . VAL A 1 331 ? 18.481  15.871  9.262   1.00 42.26  ? 331  VAL A CG2 1 
ATOM   2508 N N   . LYS A 1 332 ? 15.296  15.412  7.564   1.00 47.62  ? 332  LYS A N   1 
ATOM   2509 C CA  . LYS A 1 332 ? 14.819  15.717  6.225   1.00 48.94  ? 332  LYS A CA  1 
ATOM   2510 C C   . LYS A 1 332 ? 15.909  16.355  5.359   1.00 48.24  ? 332  LYS A C   1 
ATOM   2511 O O   . LYS A 1 332 ? 15.981  16.095  4.154   1.00 48.32  ? 332  LYS A O   1 
ATOM   2512 C CB  . LYS A 1 332 ? 13.601  16.637  6.293   1.00 49.69  ? 332  LYS A CB  1 
ATOM   2513 C CG  . LYS A 1 332 ? 12.814  16.777  4.982   1.00 51.82  ? 332  LYS A CG  1 
ATOM   2514 C CD  . LYS A 1 332 ? 11.553  17.666  5.167   1.00 53.89  ? 332  LYS A CD  1 
ATOM   2515 C CE  . LYS A 1 332 ? 11.621  19.035  4.394   1.00 59.58  ? 332  LYS A CE  1 
ATOM   2516 N NZ  . LYS A 1 332 ? 12.534  20.142  4.944   1.00 58.08  ? 332  LYS A NZ  1 
ATOM   2517 N N   . ASP A 1 333 ? 16.758  17.180  5.961   1.00 47.91  ? 333  ASP A N   1 
ATOM   2518 C CA  . ASP A 1 333 ? 17.764  17.929  5.178   1.00 47.55  ? 333  ASP A CA  1 
ATOM   2519 C C   . ASP A 1 333 ? 19.184  17.803  5.710   1.00 47.03  ? 333  ASP A C   1 
ATOM   2520 O O   . ASP A 1 333 ? 19.808  18.789  6.151   1.00 47.86  ? 333  ASP A O   1 
ATOM   2521 C CB  . ASP A 1 333 ? 17.348  19.390  5.040   1.00 47.56  ? 333  ASP A CB  1 
ATOM   2522 C CG  . ASP A 1 333 ? 15.966  19.529  4.453   1.00 48.41  ? 333  ASP A CG  1 
ATOM   2523 O OD1 . ASP A 1 333 ? 14.988  19.457  5.210   1.00 50.25  ? 333  ASP A OD1 1 
ATOM   2524 O OD2 . ASP A 1 333 ? 15.852  19.651  3.222   1.00 48.02  ? 333  ASP A OD2 1 
ATOM   2525 N N   . GLU A 1 334 ? 19.719  16.598  5.584   1.00 46.51  ? 334  GLU A N   1 
ATOM   2526 C CA  . GLU A 1 334 ? 21.044  16.277  6.116   1.00 46.09  ? 334  GLU A CA  1 
ATOM   2527 C C   . GLU A 1 334 ? 22.157  17.169  5.549   1.00 46.28  ? 334  GLU A C   1 
ATOM   2528 O O   . GLU A 1 334 ? 23.083  17.562  6.266   1.00 45.55  ? 334  GLU A O   1 
ATOM   2529 C CB  . GLU A 1 334 ? 21.368  14.808  5.850   1.00 45.80  ? 334  GLU A CB  1 
ATOM   2530 C CG  . GLU A 1 334 ? 20.501  13.812  6.638   1.00 45.66  ? 334  GLU A CG  1 
ATOM   2531 C CD  . GLU A 1 334 ? 20.915  13.679  8.104   1.00 45.73  ? 334  GLU A CD  1 
ATOM   2532 O OE1 . GLU A 1 334 ? 21.920  14.310  8.537   1.00 45.34  ? 334  GLU A OE1 1 
ATOM   2533 O OE2 . GLU A 1 334 ? 20.233  12.934  8.830   1.00 43.52  ? 334  GLU A OE2 1 
ATOM   2534 N N   . GLY A 1 335 ? 22.051  17.512  4.268   1.00 47.00  ? 335  GLY A N   1 
ATOM   2535 C CA  . GLY A 1 335 ? 23.132  18.210  3.586   1.00 47.21  ? 335  GLY A CA  1 
ATOM   2536 C C   . GLY A 1 335 ? 23.247  19.702  3.772   1.00 47.30  ? 335  GLY A C   1 
ATOM   2537 O O   . GLY A 1 335 ? 24.331  20.256  3.617   1.00 47.35  ? 335  GLY A O   1 
ATOM   2538 N N   . SER A 1 336 ? 22.147  20.364  4.109   1.00 48.38  ? 336  SER A N   1 
ATOM   2539 C CA  . SER A 1 336 ? 22.064  21.821  3.961   1.00 49.50  ? 336  SER A CA  1 
ATOM   2540 C C   . SER A 1 336 ? 23.098  22.612  4.764   1.00 49.31  ? 336  SER A C   1 
ATOM   2541 O O   . SER A 1 336 ? 23.716  23.532  4.246   1.00 49.69  ? 336  SER A O   1 
ATOM   2542 C CB  . SER A 1 336 ? 20.634  22.313  4.262   1.00 49.43  ? 336  SER A CB  1 
ATOM   2543 O OG  . SER A 1 336 ? 20.232  22.026  5.586   1.00 48.54  ? 336  SER A OG  1 
ATOM   2544 N N   . TYR A 1 337 ? 23.259  22.244  6.028   1.00 50.39  ? 337  TYR A N   1 
ATOM   2545 C CA  . TYR A 1 337 ? 24.253  22.820  6.958   1.00 51.13  ? 337  TYR A CA  1 
ATOM   2546 C C   . TYR A 1 337 ? 25.640  23.018  6.333   1.00 50.87  ? 337  TYR A C   1 
ATOM   2547 O O   . TYR A 1 337 ? 26.263  24.079  6.432   1.00 50.72  ? 337  TYR A O   1 
ATOM   2548 C CB  . TYR A 1 337 ? 24.388  21.845  8.137   1.00 53.44  ? 337  TYR A CB  1 
ATOM   2549 C CG  . TYR A 1 337 ? 25.077  22.384  9.334   1.00 55.79  ? 337  TYR A CG  1 
ATOM   2550 C CD1 . TYR A 1 337 ? 24.338  22.971  10.358  1.00 59.39  ? 337  TYR A CD1 1 
ATOM   2551 C CD2 . TYR A 1 337 ? 26.460  22.293  9.475   1.00 58.60  ? 337  TYR A CD2 1 
ATOM   2552 C CE1 . TYR A 1 337 ? 24.951  23.487  11.502  1.00 59.48  ? 337  TYR A CE1 1 
ATOM   2553 C CE2 . TYR A 1 337 ? 27.103  22.818  10.619  1.00 59.90  ? 337  TYR A CE2 1 
ATOM   2554 C CZ  . TYR A 1 337 ? 26.326  23.412  11.631  1.00 59.59  ? 337  TYR A CZ  1 
ATOM   2555 O OH  . TYR A 1 337 ? 26.896  23.920  12.780  1.00 60.09  ? 337  TYR A OH  1 
ATOM   2556 N N   . PHE A 1 338 ? 26.093  21.963  5.673   1.00 49.65  ? 338  PHE A N   1 
ATOM   2557 C CA  . PHE A 1 338 ? 27.456  21.846  5.207   1.00 49.14  ? 338  PHE A CA  1 
ATOM   2558 C C   . PHE A 1 338 ? 27.805  22.757  4.041   1.00 49.10  ? 338  PHE A C   1 
ATOM   2559 O O   . PHE A 1 338 ? 28.973  23.078  3.836   1.00 49.29  ? 338  PHE A O   1 
ATOM   2560 C CB  . PHE A 1 338 ? 27.705  20.390  4.843   1.00 48.74  ? 338  PHE A CB  1 
ATOM   2561 C CG  . PHE A 1 338 ? 27.675  19.478  6.034   1.00 48.14  ? 338  PHE A CG  1 
ATOM   2562 C CD1 . PHE A 1 338 ? 26.499  18.875  6.437   1.00 47.86  ? 338  PHE A CD1 1 
ATOM   2563 C CD2 . PHE A 1 338 ? 28.831  19.245  6.763   1.00 47.33  ? 338  PHE A CD2 1 
ATOM   2564 C CE1 . PHE A 1 338 ? 26.472  18.045  7.547   1.00 48.40  ? 338  PHE A CE1 1 
ATOM   2565 C CE2 . PHE A 1 338 ? 28.820  18.411  7.866   1.00 48.14  ? 338  PHE A CE2 1 
ATOM   2566 C CZ  . PHE A 1 338 ? 27.643  17.810  8.261   1.00 47.82  ? 338  PHE A CZ  1 
ATOM   2567 N N   . LEU A 1 339 ? 26.788  23.188  3.302   1.00 48.57  ? 339  LEU A N   1 
ATOM   2568 C CA  . LEU A 1 339 ? 26.992  23.957  2.093   1.00 48.40  ? 339  LEU A CA  1 
ATOM   2569 C C   . LEU A 1 339 ? 27.585  25.340  2.345   1.00 48.87  ? 339  LEU A C   1 
ATOM   2570 O O   . LEU A 1 339 ? 28.319  25.852  1.508   1.00 48.91  ? 339  LEU A O   1 
ATOM   2571 C CB  . LEU A 1 339 ? 25.672  24.091  1.332   1.00 48.57  ? 339  LEU A CB  1 
ATOM   2572 C CG  . LEU A 1 339 ? 24.908  22.806  0.968   1.00 47.52  ? 339  LEU A CG  1 
ATOM   2573 C CD1 . LEU A 1 339 ? 23.680  23.159  0.135   1.00 45.58  ? 339  LEU A CD1 1 
ATOM   2574 C CD2 . LEU A 1 339 ? 25.808  21.822  0.242   1.00 47.32  ? 339  LEU A CD2 1 
ATOM   2575 N N   . VAL A 1 340 ? 27.255  25.954  3.478   1.00 49.11  ? 340  VAL A N   1 
ATOM   2576 C CA  . VAL A 1 340 ? 27.750  27.301  3.785   1.00 50.42  ? 340  VAL A CA  1 
ATOM   2577 C C   . VAL A 1 340 ? 29.189  27.260  4.314   1.00 51.11  ? 340  VAL A C   1 
ATOM   2578 O O   . VAL A 1 340 ? 29.789  28.284  4.557   1.00 51.76  ? 340  VAL A O   1 
ATOM   2579 C CB  . VAL A 1 340 ? 26.813  28.055  4.769   1.00 50.60  ? 340  VAL A CB  1 
ATOM   2580 C CG1 . VAL A 1 340 ? 25.377  27.998  4.264   1.00 50.06  ? 340  VAL A CG1 1 
ATOM   2581 C CG2 . VAL A 1 340 ? 26.902  27.476  6.187   1.00 50.15  ? 340  VAL A CG2 1 
ATOM   2582 N N   . TYR A 1 341 ? 29.742  26.064  4.441   1.00 51.96  ? 341  TYR A N   1 
ATOM   2583 C CA  . TYR A 1 341 ? 31.107  25.869  4.912   1.00 53.34  ? 341  TYR A CA  1 
ATOM   2584 C C   . TYR A 1 341 ? 32.084  25.577  3.774   1.00 54.01  ? 341  TYR A C   1 
ATOM   2585 O O   . TYR A 1 341 ? 33.197  25.092  4.013   1.00 55.38  ? 341  TYR A O   1 
ATOM   2586 C CB  . TYR A 1 341 ? 31.127  24.708  5.914   1.00 53.53  ? 341  TYR A CB  1 
ATOM   2587 C CG  . TYR A 1 341 ? 30.640  25.131  7.262   1.00 54.56  ? 341  TYR A CG  1 
ATOM   2588 C CD1 . TYR A 1 341 ? 29.330  24.883  7.669   1.00 56.01  ? 341  TYR A CD1 1 
ATOM   2589 C CD2 . TYR A 1 341 ? 31.480  25.834  8.118   1.00 56.49  ? 341  TYR A CD2 1 
ATOM   2590 C CE1 . TYR A 1 341 ? 28.877  25.311  8.909   1.00 56.49  ? 341  TYR A CE1 1 
ATOM   2591 C CE2 . TYR A 1 341 ? 31.046  26.254  9.353   1.00 56.81  ? 341  TYR A CE2 1 
ATOM   2592 C CZ  . TYR A 1 341 ? 29.741  26.001  9.746   1.00 56.47  ? 341  TYR A CZ  1 
ATOM   2593 O OH  . TYR A 1 341 ? 29.309  26.434  10.982  1.00 56.84  ? 341  TYR A OH  1 
ATOM   2594 N N   . GLY A 1 342 ? 31.682  25.824  2.537   1.00 54.15  ? 342  GLY A N   1 
ATOM   2595 C CA  . GLY A 1 342 ? 32.529  25.427  1.424   1.00 54.18  ? 342  GLY A CA  1 
ATOM   2596 C C   . GLY A 1 342 ? 32.032  25.597  0.003   1.00 53.94  ? 342  GLY A C   1 
ATOM   2597 O O   . GLY A 1 342 ? 32.847  25.696  -0.895  1.00 55.38  ? 342  GLY A O   1 
ATOM   2598 N N   . VAL A 1 343 ? 30.726  25.603  -0.242  1.00 52.89  ? 343  VAL A N   1 
ATOM   2599 C CA  . VAL A 1 343 ? 30.256  25.694  -1.627  1.00 52.07  ? 343  VAL A CA  1 
ATOM   2600 C C   . VAL A 1 343 ? 30.017  27.151  -1.988  1.00 52.14  ? 343  VAL A C   1 
ATOM   2601 O O   . VAL A 1 343 ? 29.150  27.795  -1.409  1.00 52.09  ? 343  VAL A O   1 
ATOM   2602 C CB  . VAL A 1 343 ? 28.993  24.858  -1.873  1.00 51.77  ? 343  VAL A CB  1 
ATOM   2603 C CG1 . VAL A 1 343 ? 28.651  24.863  -3.341  1.00 51.41  ? 343  VAL A CG1 1 
ATOM   2604 C CG2 . VAL A 1 343 ? 29.206  23.426  -1.378  1.00 51.38  ? 343  VAL A CG2 1 
ATOM   2605 N N   . PRO A 1 344 ? 30.783  27.686  -2.950  1.00 52.55  ? 344  PRO A N   1 
ATOM   2606 C CA  . PRO A 1 344 ? 30.520  29.076  -3.292  1.00 53.02  ? 344  PRO A CA  1 
ATOM   2607 C C   . PRO A 1 344 ? 29.069  29.267  -3.759  1.00 53.05  ? 344  PRO A C   1 
ATOM   2608 O O   . PRO A 1 344 ? 28.538  28.432  -4.510  1.00 52.63  ? 344  PRO A O   1 
ATOM   2609 C CB  . PRO A 1 344 ? 31.521  29.358  -4.422  1.00 53.65  ? 344  PRO A CB  1 
ATOM   2610 C CG  . PRO A 1 344 ? 32.590  28.349  -4.240  1.00 53.19  ? 344  PRO A CG  1 
ATOM   2611 C CD  . PRO A 1 344 ? 31.878  27.126  -3.760  1.00 52.67  ? 344  PRO A CD  1 
ATOM   2612 N N   . GLY A 1 345 ? 28.449  30.349  -3.284  1.00 53.01  ? 345  GLY A N   1 
ATOM   2613 C CA  . GLY A 1 345 ? 27.074  30.688  -3.613  1.00 53.17  ? 345  GLY A CA  1 
ATOM   2614 C C   . GLY A 1 345 ? 26.134  30.462  -2.447  1.00 52.55  ? 345  GLY A C   1 
ATOM   2615 O O   . GLY A 1 345 ? 25.000  30.933  -2.472  1.00 52.89  ? 345  GLY A O   1 
ATOM   2616 N N   . PHE A 1 346 ? 26.595  29.747  -1.419  1.00 51.81  ? 346  PHE A N   1 
ATOM   2617 C CA  . PHE A 1 346 ? 25.767  29.440  -0.263  1.00 51.34  ? 346  PHE A CA  1 
ATOM   2618 C C   . PHE A 1 346 ? 26.073  30.305  0.987   1.00 52.23  ? 346  PHE A C   1 
ATOM   2619 O O   . PHE A 1 346 ? 27.230  30.573  1.334   1.00 52.80  ? 346  PHE A O   1 
ATOM   2620 C CB  . PHE A 1 346 ? 25.865  27.950  0.051   1.00 50.88  ? 346  PHE A CB  1 
ATOM   2621 C CG  . PHE A 1 346 ? 25.225  27.053  -1.011  1.00 49.38  ? 346  PHE A CG  1 
ATOM   2622 C CD1 . PHE A 1 346 ? 25.926  26.682  -2.137  1.00 48.43  ? 346  PHE A CD1 1 
ATOM   2623 C CD2 . PHE A 1 346 ? 23.922  26.592  -0.856  1.00 49.07  ? 346  PHE A CD2 1 
ATOM   2624 C CE1 . PHE A 1 346 ? 25.339  25.879  -3.113  1.00 48.38  ? 346  PHE A CE1 1 
ATOM   2625 C CE2 . PHE A 1 346 ? 23.331  25.794  -1.817  1.00 48.65  ? 346  PHE A CE2 1 
ATOM   2626 C CZ  . PHE A 1 346 ? 24.045  25.436  -2.950  1.00 48.84  ? 346  PHE A CZ  1 
ATOM   2627 N N   . SER A 1 347 ? 25.010  30.742  1.650   1.00 52.67  ? 347  SER A N   1 
ATOM   2628 C CA  . SER A 1 347 ? 25.098  31.575  2.845   1.00 53.59  ? 347  SER A CA  1 
ATOM   2629 C C   . SER A 1 347 ? 23.855  31.379  3.685   1.00 53.75  ? 347  SER A C   1 
ATOM   2630 O O   . SER A 1 347 ? 22.769  31.127  3.150   1.00 54.23  ? 347  SER A O   1 
ATOM   2631 C CB  . SER A 1 347 ? 25.207  33.056  2.474   1.00 54.33  ? 347  SER A CB  1 
ATOM   2632 O OG  . SER A 1 347 ? 25.346  33.876  3.633   1.00 55.38  ? 347  SER A OG  1 
ATOM   2633 N N   . LYS A 1 348 ? 24.002  31.517  4.998   1.00 54.04  ? 348  LYS A N   1 
ATOM   2634 C CA  . LYS A 1 348 ? 22.849  31.485  5.889   1.00 54.57  ? 348  LYS A CA  1 
ATOM   2635 C C   . LYS A 1 348 ? 22.045  32.787  5.814   1.00 55.59  ? 348  LYS A C   1 
ATOM   2636 O O   . LYS A 1 348 ? 20.900  32.811  6.242   1.00 55.76  ? 348  LYS A O   1 
ATOM   2637 C CB  . LYS A 1 348 ? 23.276  31.227  7.336   1.00 54.48  ? 348  LYS A CB  1 
ATOM   2638 C CG  . LYS A 1 348 ? 23.734  32.476  8.078   1.00 55.27  ? 348  LYS A CG  1 
ATOM   2639 C CD  . LYS A 1 348 ? 24.057  32.188  9.522   1.00 54.89  ? 348  LYS A CD  1 
ATOM   2640 C CE  . LYS A 1 348 ? 24.323  33.490  10.266  1.00 56.27  ? 348  LYS A CE  1 
ATOM   2641 N NZ  . LYS A 1 348 ? 23.114  34.345  10.308  1.00 54.59  ? 348  LYS A NZ  1 
ATOM   2642 N N   . ASP A 1 349 ? 22.649  33.861  5.295   1.00 56.20  ? 349  ASP A N   1 
ATOM   2643 C CA  . ASP A 1 349 ? 22.048  35.208  5.351   1.00 57.76  ? 349  ASP A CA  1 
ATOM   2644 C C   . ASP A 1 349 ? 21.361  35.651  4.048   1.00 58.66  ? 349  ASP A C   1 
ATOM   2645 O O   . ASP A 1 349 ? 20.865  36.775  3.957   1.00 59.78  ? 349  ASP A O   1 
ATOM   2646 C CB  . ASP A 1 349 ? 23.105  36.238  5.775   1.00 58.36  ? 349  ASP A CB  1 
ATOM   2647 C CG  . ASP A 1 349 ? 23.693  35.935  7.150   1.00 59.37  ? 349  ASP A CG  1 
ATOM   2648 O OD1 . ASP A 1 349 ? 22.905  35.793  8.114   1.00 59.28  ? 349  ASP A OD1 1 
ATOM   2649 O OD2 . ASP A 1 349 ? 24.938  35.826  7.264   1.00 59.92  ? 349  ASP A OD2 1 
ATOM   2650 N N   . ASN A 1 350 ? 21.337  34.767  3.050   1.00 58.41  ? 350  ASN A N   1 
ATOM   2651 C CA  . ASN A 1 350 ? 20.493  34.932  1.865   1.00 59.10  ? 350  ASN A CA  1 
ATOM   2652 C C   . ASN A 1 350 ? 19.921  33.569  1.469   1.00 57.54  ? 350  ASN A C   1 
ATOM   2653 O O   . ASN A 1 350 ? 20.218  32.567  2.121   1.00 55.66  ? 350  ASN A O   1 
ATOM   2654 C CB  . ASN A 1 350 ? 21.244  35.639  0.712   1.00 60.27  ? 350  ASN A CB  1 
ATOM   2655 C CG  . ASN A 1 350 ? 22.438  34.844  0.173   1.00 63.89  ? 350  ASN A CG  1 
ATOM   2656 O OD1 . ASN A 1 350 ? 22.353  33.636  -0.046  1.00 64.44  ? 350  ASN A OD1 1 
ATOM   2657 N ND2 . ASN A 1 350 ? 23.550  35.547  -0.071  1.00 72.06  ? 350  ASN A ND2 1 
ATOM   2658 N N   . GLU A 1 351 ? 19.095  33.544  0.422   1.00 57.48  ? 351  GLU A N   1 
ATOM   2659 C CA  . GLU A 1 351 ? 18.354  32.343  0.013   1.00 57.01  ? 351  GLU A CA  1 
ATOM   2660 C C   . GLU A 1 351 ? 19.203  31.338  -0.765  1.00 55.49  ? 351  GLU A C   1 
ATOM   2661 O O   . GLU A 1 351 ? 18.714  30.274  -1.122  1.00 54.87  ? 351  GLU A O   1 
ATOM   2662 C CB  . GLU A 1 351 ? 17.148  32.725  -0.855  1.00 58.77  ? 351  GLU A CB  1 
ATOM   2663 C CG  . GLU A 1 351 ? 16.166  33.682  -0.210  1.00 61.64  ? 351  GLU A CG  1 
ATOM   2664 C CD  . GLU A 1 351 ? 15.716  33.214  1.157   1.00 65.48  ? 351  GLU A CD  1 
ATOM   2665 O OE1 . GLU A 1 351 ? 15.492  31.987  1.342   1.00 64.44  ? 351  GLU A OE1 1 
ATOM   2666 O OE2 . GLU A 1 351 ? 15.594  34.087  2.051   1.00 70.20  ? 351  GLU A OE2 1 
ATOM   2667 N N   . SER A 1 352 ? 20.452  31.698  -1.057  1.00 54.20  ? 352  SER A N   1 
ATOM   2668 C CA  . SER A 1 352 ? 21.415  30.797  -1.662  1.00 53.05  ? 352  SER A CA  1 
ATOM   2669 C C   . SER A 1 352 ? 20.931  30.190  -2.972  1.00 52.84  ? 352  SER A C   1 
ATOM   2670 O O   . SER A 1 352 ? 21.170  29.025  -3.257  1.00 51.96  ? 352  SER A O   1 
ATOM   2671 C CB  . SER A 1 352 ? 21.826  29.722  -0.651  1.00 52.35  ? 352  SER A CB  1 
ATOM   2672 O OG  . SER A 1 352 ? 22.478  30.353  0.449   1.00 52.44  ? 352  SER A OG  1 
ATOM   2673 N N   . LEU A 1 353 ? 20.247  31.005  -3.768  1.00 53.28  ? 353  LEU A N   1 
ATOM   2674 C CA  . LEU A 1 353 ? 19.851  30.613  -5.100  1.00 53.64  ? 353  LEU A CA  1 
ATOM   2675 C C   . LEU A 1 353 ? 21.112  30.581  -5.967  1.00 53.54  ? 353  LEU A C   1 
ATOM   2676 O O   . LEU A 1 353 ? 21.843  31.574  -6.051  1.00 54.96  ? 353  LEU A O   1 
ATOM   2677 C CB  . LEU A 1 353 ? 18.831  31.597  -5.657  1.00 54.82  ? 353  LEU A CB  1 
ATOM   2678 C CG  . LEU A 1 353 ? 17.471  31.665  -4.937  1.00 54.88  ? 353  LEU A CG  1 
ATOM   2679 C CD1 . LEU A 1 353 ? 16.526  32.420  -5.803  1.00 55.96  ? 353  LEU A CD1 1 
ATOM   2680 C CD2 . LEU A 1 353 ? 16.907  30.318  -4.645  1.00 54.05  ? 353  LEU A CD2 1 
ATOM   2681 N N   . ILE A 1 354 ? 21.392  29.438  -6.577  1.00 52.14  ? 354  ILE A N   1 
ATOM   2682 C CA  . ILE A 1 354 ? 22.658  29.264  -7.290  1.00 51.50  ? 354  ILE A CA  1 
ATOM   2683 C C   . ILE A 1 354 ? 22.415  28.996  -8.768  1.00 51.61  ? 354  ILE A C   1 
ATOM   2684 O O   . ILE A 1 354 ? 21.316  28.620  -9.172  1.00 51.57  ? 354  ILE A O   1 
ATOM   2685 C CB  . ILE A 1 354 ? 23.552  28.136  -6.671  1.00 50.38  ? 354  ILE A CB  1 
ATOM   2686 C CG1 . ILE A 1 354 ? 22.812  26.801  -6.589  1.00 49.70  ? 354  ILE A CG1 1 
ATOM   2687 C CG2 . ILE A 1 354 ? 24.058  28.565  -5.302  1.00 50.29  ? 354  ILE A CG2 1 
ATOM   2688 C CD1 . ILE A 1 354 ? 23.707  25.567  -6.594  1.00 48.80  ? 354  ILE A CD1 1 
ATOM   2689 N N   . SER A 1 355 ? 23.464  29.203  -9.550  1.00 51.07  ? 355  SER A N   1 
ATOM   2690 C CA  . SER A 1 355 ? 23.476  28.918  -10.965 1.00 51.16  ? 355  SER A CA  1 
ATOM   2691 C C   . SER A 1 355 ? 23.863  27.464  -11.221 1.00 50.91  ? 355  SER A C   1 
ATOM   2692 O O   . SER A 1 355 ? 24.373  26.760  -10.347 1.00 48.83  ? 355  SER A O   1 
ATOM   2693 C CB  . SER A 1 355 ? 24.502  29.826  -11.656 1.00 51.74  ? 355  SER A CB  1 
ATOM   2694 O OG  . SER A 1 355 ? 25.824  29.456  -11.288 1.00 49.40  ? 355  SER A OG  1 
ATOM   2695 N N   . ARG A 1 356 ? 23.657  27.036  -12.457 1.00 52.03  ? 356  ARG A N   1 
ATOM   2696 C CA  . ARG A 1 356 ? 24.057  25.715  -12.858 1.00 52.58  ? 356  ARG A CA  1 
ATOM   2697 C C   . ARG A 1 356 ? 25.576  25.549  -12.753 1.00 51.95  ? 356  ARG A C   1 
ATOM   2698 O O   . ARG A 1 356 ? 26.052  24.497  -12.351 1.00 50.67  ? 356  ARG A O   1 
ATOM   2699 C CB  . ARG A 1 356 ? 23.578  25.422  -14.264 1.00 54.37  ? 356  ARG A CB  1 
ATOM   2700 C CG  . ARG A 1 356 ? 23.820  23.985  -14.636 1.00 56.75  ? 356  ARG A CG  1 
ATOM   2701 C CD  . ARG A 1 356 ? 22.899  23.502  -15.746 1.00 60.62  ? 356  ARG A CD  1 
ATOM   2702 N NE  . ARG A 1 356 ? 23.169  22.081  -15.949 1.00 62.13  ? 356  ARG A NE  1 
ATOM   2703 C CZ  . ARG A 1 356 ? 22.709  21.102  -15.174 1.00 61.26  ? 356  ARG A CZ  1 
ATOM   2704 N NH1 . ARG A 1 356 ? 21.905  21.367  -14.152 1.00 61.29  ? 356  ARG A NH1 1 
ATOM   2705 N NH2 . ARG A 1 356 ? 23.038  19.849  -15.447 1.00 61.94  ? 356  ARG A NH2 1 
ATOM   2706 N N   . ALA A 1 357 ? 26.321  26.601  -13.089 1.00 52.43  ? 357  ALA A N   1 
ATOM   2707 C CA  . ALA A 1 357 ? 27.784  26.615  -12.930 1.00 52.19  ? 357  ALA A CA  1 
ATOM   2708 C C   . ALA A 1 357 ? 28.206  26.352  -11.482 1.00 51.01  ? 357  ALA A C   1 
ATOM   2709 O O   . ALA A 1 357 ? 29.111  25.571  -11.216 1.00 51.22  ? 357  ALA A O   1 
ATOM   2710 C CB  . ALA A 1 357 ? 28.351  27.966  -13.415 1.00 53.11  ? 357  ALA A CB  1 
ATOM   2711 N N   . GLN A 1 358 ? 27.540  27.018  -10.549 1.00 50.49  ? 358  GLN A N   1 
ATOM   2712 C CA  . GLN A 1 358 ? 27.833  26.872  -9.139  1.00 49.41  ? 358  GLN A CA  1 
ATOM   2713 C C   . GLN A 1 358 ? 27.410  25.506  -8.602  1.00 48.49  ? 358  GLN A C   1 
ATOM   2714 O O   . GLN A 1 358 ? 27.971  25.021  -7.622  1.00 48.10  ? 358  GLN A O   1 
ATOM   2715 C CB  . GLN A 1 358 ? 27.145  27.981  -8.347  1.00 49.61  ? 358  GLN A CB  1 
ATOM   2716 C CG  . GLN A 1 358 ? 27.740  29.370  -8.570  1.00 50.75  ? 358  GLN A CG  1 
ATOM   2717 C CD  . GLN A 1 358 ? 26.918  30.457  -7.917  1.00 51.73  ? 358  GLN A CD  1 
ATOM   2718 O OE1 . GLN A 1 358 ? 25.695  30.502  -8.072  1.00 54.51  ? 358  GLN A OE1 1 
ATOM   2719 N NE2 . GLN A 1 358 ? 27.580  31.345  -7.189  1.00 53.05  ? 358  GLN A NE2 1 
ATOM   2720 N N   . PHE A 1 359 ? 26.419  24.892  -9.236  1.00 48.40  ? 359  PHE A N   1 
ATOM   2721 C CA  . PHE A 1 359 ? 25.988  23.544  -8.891  1.00 47.64  ? 359  PHE A CA  1 
ATOM   2722 C C   . PHE A 1 359 ? 27.040  22.525  -9.314  1.00 48.04  ? 359  PHE A C   1 
ATOM   2723 O O   . PHE A 1 359 ? 27.409  21.660  -8.526  1.00 46.48  ? 359  PHE A O   1 
ATOM   2724 C CB  . PHE A 1 359 ? 24.632  23.240  -9.534  1.00 48.30  ? 359  PHE A CB  1 
ATOM   2725 C CG  . PHE A 1 359 ? 24.154  21.840  -9.322  1.00 47.08  ? 359  PHE A CG  1 
ATOM   2726 C CD1 . PHE A 1 359 ? 23.944  20.996  -10.399 1.00 47.66  ? 359  PHE A CD1 1 
ATOM   2727 C CD2 . PHE A 1 359 ? 23.914  21.362  -8.056  1.00 48.26  ? 359  PHE A CD2 1 
ATOM   2728 C CE1 . PHE A 1 359 ? 23.489  19.717  -10.229 1.00 46.99  ? 359  PHE A CE1 1 
ATOM   2729 C CE2 . PHE A 1 359 ? 23.464  20.050  -7.872  1.00 49.23  ? 359  PHE A CE2 1 
ATOM   2730 C CZ  . PHE A 1 359 ? 23.247  19.236  -8.974  1.00 48.49  ? 359  PHE A CZ  1 
ATOM   2731 N N   . LEU A 1 360 ? 27.544  22.639  -10.541 1.00 49.80  ? 360  LEU A N   1 
ATOM   2732 C CA  . LEU A 1 360 ? 28.604  21.734  -11.005 1.00 51.01  ? 360  LEU A CA  1 
ATOM   2733 C C   . LEU A 1 360 ? 29.877  21.833  -10.137 1.00 50.30  ? 360  LEU A C   1 
ATOM   2734 O O   . LEU A 1 360 ? 30.447  20.817  -9.736  1.00 50.05  ? 360  LEU A O   1 
ATOM   2735 C CB  . LEU A 1 360 ? 28.942  21.985  -12.476 1.00 52.32  ? 360  LEU A CB  1 
ATOM   2736 C CG  . LEU A 1 360 ? 27.808  21.922  -13.518 1.00 55.67  ? 360  LEU A CG  1 
ATOM   2737 C CD1 . LEU A 1 360 ? 28.366  21.875  -14.982 1.00 58.38  ? 360  LEU A CD1 1 
ATOM   2738 C CD2 . LEU A 1 360 ? 26.853  20.771  -13.285 1.00 56.63  ? 360  LEU A CD2 1 
ATOM   2739 N N   . ALA A 1 361 ? 30.298  23.061  -9.837  1.00 50.55  ? 361  ALA A N   1 
ATOM   2740 C CA  . ALA A 1 361 ? 31.429  23.319  -8.925  1.00 49.91  ? 361  ALA A CA  1 
ATOM   2741 C C   . ALA A 1 361 ? 31.165  22.731  -7.535  1.00 49.69  ? 361  ALA A C   1 
ATOM   2742 O O   . ALA A 1 361 ? 32.036  22.064  -6.933  1.00 50.22  ? 361  ALA A O   1 
ATOM   2743 C CB  . ALA A 1 361 ? 31.697  24.824  -8.826  1.00 49.63  ? 361  ALA A CB  1 
ATOM   2744 N N   . GLY A 1 362 ? 29.961  22.973  -7.029  1.00 49.34  ? 362  GLY A N   1 
ATOM   2745 C CA  . GLY A 1 362 ? 29.536  22.442  -5.747  1.00 48.74  ? 362  GLY A CA  1 
ATOM   2746 C C   . GLY A 1 362 ? 29.621  20.931  -5.669  1.00 48.29  ? 362  GLY A C   1 
ATOM   2747 O O   . GLY A 1 362 ? 30.018  20.388  -4.651  1.00 47.54  ? 362  GLY A O   1 
ATOM   2748 N N   . VAL A 1 363 ? 29.262  20.248  -6.748  1.00 48.91  ? 363  VAL A N   1 
ATOM   2749 C CA  . VAL A 1 363 ? 29.303  18.777  -6.767  1.00 49.05  ? 363  VAL A CA  1 
ATOM   2750 C C   . VAL A 1 363 ? 30.731  18.250  -6.616  1.00 49.49  ? 363  VAL A C   1 
ATOM   2751 O O   . VAL A 1 363 ? 30.933  17.209  -5.995  1.00 49.23  ? 363  VAL A O   1 
ATOM   2752 C CB  . VAL A 1 363 ? 28.635  18.199  -8.048  1.00 49.83  ? 363  VAL A CB  1 
ATOM   2753 C CG1 . VAL A 1 363 ? 28.855  16.691  -8.161  1.00 49.93  ? 363  VAL A CG1 1 
ATOM   2754 C CG2 . VAL A 1 363 ? 27.135  18.515  -8.043  1.00 49.02  ? 363  VAL A CG2 1 
ATOM   2755 N N   . ARG A 1 364 ? 31.722  18.963  -7.168  1.00 50.24  ? 364  ARG A N   1 
ATOM   2756 C CA  . ARG A 1 364 ? 33.116  18.544  -7.008  1.00 50.65  ? 364  ARG A CA  1 
ATOM   2757 C C   . ARG A 1 364 ? 33.558  18.700  -5.553  1.00 49.71  ? 364  ARG A C   1 
ATOM   2758 O O   . ARG A 1 364 ? 34.410  17.940  -5.083  1.00 49.69  ? 364  ARG A O   1 
ATOM   2759 C CB  . ARG A 1 364 ? 34.080  19.326  -7.915  1.00 51.29  ? 364  ARG A CB  1 
ATOM   2760 C CG  . ARG A 1 364 ? 33.770  19.332  -9.404  1.00 54.02  ? 364  ARG A CG  1 
ATOM   2761 C CD  . ARG A 1 364 ? 33.231  17.996  -9.934  1.00 57.40  ? 364  ARG A CD  1 
ATOM   2762 N NE  . ARG A 1 364 ? 34.196  16.894  -9.844  1.00 58.85  ? 364  ARG A NE  1 
ATOM   2763 C CZ  . ARG A 1 364 ? 35.079  16.566  -10.793 1.00 61.29  ? 364  ARG A CZ  1 
ATOM   2764 N NH1 . ARG A 1 364 ? 35.146  17.243  -11.942 1.00 62.16  ? 364  ARG A NH1 1 
ATOM   2765 N NH2 . ARG A 1 364 ? 35.901  15.537  -10.591 1.00 61.44  ? 364  ARG A NH2 1 
ATOM   2766 N N   . ILE A 1 365 ? 32.990  19.681  -4.850  1.00 48.66  ? 365  ILE A N   1 
ATOM   2767 C CA  . ILE A 1 365 ? 33.338  19.926  -3.450  1.00 48.09  ? 365  ILE A CA  1 
ATOM   2768 C C   . ILE A 1 365 ? 32.582  18.957  -2.525  1.00 47.99  ? 365  ILE A C   1 
ATOM   2769 O O   . ILE A 1 365 ? 33.135  18.475  -1.535  1.00 47.48  ? 365  ILE A O   1 
ATOM   2770 C CB  . ILE A 1 365 ? 33.096  21.404  -3.059  1.00 48.30  ? 365  ILE A CB  1 
ATOM   2771 C CG1 . ILE A 1 365 ? 33.976  22.316  -3.922  1.00 48.24  ? 365  ILE A CG1 1 
ATOM   2772 C CG2 . ILE A 1 365 ? 33.352  21.650  -1.552  1.00 47.25  ? 365  ILE A CG2 1 
ATOM   2773 C CD1 . ILE A 1 365 ? 33.499  23.741  -3.981  1.00 49.04  ? 365  ILE A CD1 1 
ATOM   2774 N N   . GLY A 1 366 ? 31.343  18.637  -2.877  1.00 47.95  ? 366  GLY A N   1 
ATOM   2775 C CA  . GLY A 1 366 ? 30.519  17.772  -2.064  1.00 48.02  ? 366  GLY A CA  1 
ATOM   2776 C C   . GLY A 1 366 ? 30.746  16.282  -2.286  1.00 48.47  ? 366  GLY A C   1 
ATOM   2777 O O   . GLY A 1 366 ? 30.397  15.466  -1.423  1.00 49.00  ? 366  GLY A O   1 
ATOM   2778 N N   . VAL A 1 367 ? 31.292  15.923  -3.449  1.00 48.56  ? 367  VAL A N   1 
ATOM   2779 C CA  . VAL A 1 367 ? 31.615  14.537  -3.774  1.00 48.53  ? 367  VAL A CA  1 
ATOM   2780 C C   . VAL A 1 367 ? 33.086  14.544  -4.183  1.00 48.98  ? 367  VAL A C   1 
ATOM   2781 O O   . VAL A 1 367 ? 33.428  14.277  -5.333  1.00 50.03  ? 367  VAL A O   1 
ATOM   2782 C CB  . VAL A 1 367 ? 30.704  13.983  -4.896  1.00 49.35  ? 367  VAL A CB  1 
ATOM   2783 C CG1 . VAL A 1 367 ? 30.870  12.470  -5.022  1.00 49.47  ? 367  VAL A CG1 1 
ATOM   2784 C CG2 . VAL A 1 367 ? 29.232  14.336  -4.624  1.00 47.35  ? 367  VAL A CG2 1 
ATOM   2785 N N   . PRO A 1 368 ? 33.968  14.887  -3.232  1.00 48.57  ? 368  PRO A N   1 
ATOM   2786 C CA  . PRO A 1 368 ? 35.366  15.206  -3.525  1.00 49.30  ? 368  PRO A CA  1 
ATOM   2787 C C   . PRO A 1 368 ? 36.231  14.097  -4.099  1.00 50.46  ? 368  PRO A C   1 
ATOM   2788 O O   . PRO A 1 368 ? 37.235  14.396  -4.756  1.00 51.50  ? 368  PRO A O   1 
ATOM   2789 C CB  . PRO A 1 368 ? 35.908  15.652  -2.161  1.00 49.00  ? 368  PRO A CB  1 
ATOM   2790 C CG  . PRO A 1 368 ? 35.007  15.076  -1.180  1.00 48.38  ? 368  PRO A CG  1 
ATOM   2791 C CD  . PRO A 1 368 ? 33.672  15.042  -1.798  1.00 47.34  ? 368  PRO A CD  1 
ATOM   2792 N N   . GLN A 1 369 ? 35.862  12.844  -3.854  1.00 50.97  ? 369  GLN A N   1 
ATOM   2793 C CA  A GLN A 1 369 ? 36.629  11.698  -4.342  0.50 52.24  ? 369  GLN A CA  1 
ATOM   2794 C CA  B GLN A 1 369 ? 36.624  11.687  -4.332  0.50 51.49  ? 369  GLN A CA  1 
ATOM   2795 C C   . GLN A 1 369 ? 36.169  11.221  -5.716  1.00 53.35  ? 369  GLN A C   1 
ATOM   2796 O O   . GLN A 1 369 ? 36.739  10.283  -6.274  1.00 54.71  ? 369  GLN A O   1 
ATOM   2797 C CB  A GLN A 1 369 ? 36.018  10.492  -3.390  0.00 32.23  ? 369  GLN A CB  1 
ATOM   2798 C CB  B GLN A 1 369 ? 36.519  10.532  -3.331  0.50 50.58  ? 369  GLN A CB  1 
ATOM   2799 C CG  A GLN A 1 369 ? 35.149  9.752   -3.162  0.50 47.24  ? 369  GLN A CG  1 
ATOM   2800 C CG  B GLN A 1 369 ? 37.533  10.588  -2.188  0.50 47.76  ? 369  GLN A CG  1 
ATOM   2801 C CD  A GLN A 1 369 ? 33.723  10.251  -3.195  0.50 46.12  ? 369  GLN A CD  1 
ATOM   2802 C CD  B GLN A 1 369 ? 37.303  11.731  -1.209  0.50 42.81  ? 369  GLN A CD  1 
ATOM   2803 O OE1 A GLN A 1 369 ? 33.403  11.320  -2.642  0.50 41.44  ? 369  GLN A OE1 1 
ATOM   2804 O OE1 B GLN A 1 369 ? 36.472  11.642  -0.312  0.50 36.67  ? 369  GLN A OE1 1 
ATOM   2805 N NE2 A GLN A 1 369 ? 32.855  9.489   -3.866  0.50 44.13  ? 369  GLN A NE2 1 
ATOM   2806 N NE2 B GLN A 1 369 ? 38.074  12.792  -1.360  0.50 40.33  ? 369  GLN A NE2 1 
ATOM   2807 N N   . ALA A 1 370 ? 35.147  11.874  -6.266  1.00 54.03  ? 370  ALA A N   1 
ATOM   2808 C CA  . ALA A 1 370 ? 34.573  11.498  -7.558  1.00 55.27  ? 370  ALA A CA  1 
ATOM   2809 C C   . ALA A 1 370 ? 35.425  11.932  -8.734  1.00 56.57  ? 370  ALA A C   1 
ATOM   2810 O O   . ALA A 1 370 ? 35.813  13.088  -8.832  1.00 56.60  ? 370  ALA A O   1 
ATOM   2811 C CB  . ALA A 1 370 ? 33.166  12.118  -7.707  1.00 54.96  ? 370  ALA A CB  1 
ATOM   2812 N N   . SER A 1 371 ? 35.671  11.000  -9.654  1.00 58.10  ? 371  SER A N   1 
ATOM   2813 C CA  . SER A 1 371 ? 36.200  11.331  -10.969 1.00 59.38  ? 371  SER A CA  1 
ATOM   2814 C C   . SER A 1 371 ? 35.257  12.260  -11.724 1.00 59.57  ? 371  SER A C   1 
ATOM   2815 O O   . SER A 1 371 ? 34.122  12.487  -11.307 1.00 58.97  ? 371  SER A O   1 
ATOM   2816 C CB  . SER A 1 371 ? 36.408  10.053  -11.784 1.00 60.76  ? 371  SER A CB  1 
ATOM   2817 O OG  . SER A 1 371 ? 35.202  9.314   -11.915 1.00 61.66  ? 371  SER A OG  1 
ATOM   2818 N N   . ASP A 1 372 ? 35.736  12.794  -12.841 1.00 60.52  ? 372  ASP A N   1 
ATOM   2819 C CA  . ASP A 1 372 ? 34.933  13.661  -13.692 1.00 61.21  ? 372  ASP A CA  1 
ATOM   2820 C C   . ASP A 1 372 ? 33.660  12.952  -14.178 1.00 61.22  ? 372  ASP A C   1 
ATOM   2821 O O   . ASP A 1 372 ? 32.589  13.560  -14.222 1.00 60.94  ? 372  ASP A O   1 
ATOM   2822 C CB  . ASP A 1 372 ? 35.730  14.126  -14.918 1.00 62.59  ? 372  ASP A CB  1 
ATOM   2823 C CG  . ASP A 1 372 ? 36.897  15.028  -14.567 1.00 64.43  ? 372  ASP A CG  1 
ATOM   2824 O OD1 . ASP A 1 372 ? 37.066  15.394  -13.383 1.00 66.01  ? 372  ASP A OD1 1 
ATOM   2825 O OD2 . ASP A 1 372 ? 37.662  15.375  -15.496 1.00 69.53  ? 372  ASP A OD2 1 
ATOM   2826 N N   . LEU A 1 373 ? 33.784  11.680  -14.556 1.00 61.21  ? 373  LEU A N   1 
ATOM   2827 C CA  . LEU A 1 373 ? 32.636  10.930  -15.070 1.00 61.45  ? 373  LEU A CA  1 
ATOM   2828 C C   . LEU A 1 373 ? 31.578  10.715  -13.979 1.00 59.99  ? 373  LEU A C   1 
ATOM   2829 O O   . LEU A 1 373 ? 30.385  10.874  -14.230 1.00 59.74  ? 373  LEU A O   1 
ATOM   2830 C CB  . LEU A 1 373 ? 33.075  9.573   -15.643 1.00 62.53  ? 373  LEU A CB  1 
ATOM   2831 C CG  . LEU A 1 373 ? 32.013  8.737   -16.374 1.00 63.61  ? 373  LEU A CG  1 
ATOM   2832 C CD1 . LEU A 1 373 ? 31.292  9.564   -17.447 1.00 63.37  ? 373  LEU A CD1 1 
ATOM   2833 C CD2 . LEU A 1 373 ? 32.630  7.459   -16.981 1.00 64.18  ? 373  LEU A CD2 1 
ATOM   2834 N N   . ALA A 1 374 ? 32.028  10.350  -12.780 1.00 58.66  ? 374  ALA A N   1 
ATOM   2835 C CA  . ALA A 1 374 ? 31.134  10.145  -11.641 1.00 57.40  ? 374  ALA A CA  1 
ATOM   2836 C C   . ALA A 1 374 ? 30.433  11.444  -11.272 1.00 56.43  ? 374  ALA A C   1 
ATOM   2837 O O   . ALA A 1 374 ? 29.243  11.439  -10.995 1.00 55.80  ? 374  ALA A O   1 
ATOM   2838 C CB  . ALA A 1 374 ? 31.900  9.581   -10.438 1.00 56.97  ? 374  ALA A CB  1 
ATOM   2839 N N   . ALA A 1 375 ? 31.171  12.553  -11.296 1.00 56.07  ? 375  ALA A N   1 
ATOM   2840 C CA  . ALA A 1 375 ? 30.597  13.864  -11.001 1.00 55.72  ? 375  ALA A CA  1 
ATOM   2841 C C   . ALA A 1 375 ? 29.508  14.184  -12.007 1.00 56.38  ? 375  ALA A C   1 
ATOM   2842 O O   . ALA A 1 375 ? 28.470  14.722  -11.639 1.00 56.30  ? 375  ALA A O   1 
ATOM   2843 C CB  . ALA A 1 375 ? 31.684  14.974  -10.990 1.00 55.24  ? 375  ALA A CB  1 
ATOM   2844 N N   . GLU A 1 376 ? 29.738  13.842  -13.275 1.00 57.53  ? 376  GLU A N   1 
ATOM   2845 C CA  . GLU A 1 376 ? 28.731  14.063  -14.319 1.00 58.19  ? 376  GLU A CA  1 
ATOM   2846 C C   . GLU A 1 376 ? 27.513  13.170  -14.100 1.00 56.70  ? 376  GLU A C   1 
ATOM   2847 O O   . GLU A 1 376 ? 26.379  13.621  -14.237 1.00 56.21  ? 376  GLU A O   1 
ATOM   2848 C CB  . GLU A 1 376 ? 29.320  13.886  -15.735 1.00 60.28  ? 376  GLU A CB  1 
ATOM   2849 C CG  . GLU A 1 376 ? 29.700  15.222  -16.433 1.00 64.67  ? 376  GLU A CG  1 
ATOM   2850 C CD  . GLU A 1 376 ? 28.508  16.218  -16.547 1.00 70.52  ? 376  GLU A CD  1 
ATOM   2851 O OE1 . GLU A 1 376 ? 28.647  17.408  -16.117 1.00 72.50  ? 376  GLU A OE1 1 
ATOM   2852 O OE2 . GLU A 1 376 ? 27.428  15.806  -17.055 1.00 74.15  ? 376  GLU A OE2 1 
ATOM   2853 N N   . ALA A 1 377 ? 27.742  11.915  -13.736 1.00 55.38  ? 377  ALA A N   1 
ATOM   2854 C CA  . ALA A 1 377 ? 26.641  11.038  -13.338 1.00 54.78  ? 377  ALA A CA  1 
ATOM   2855 C C   . ALA A 1 377 ? 25.781  11.691  -12.243 1.00 53.34  ? 377  ALA A C   1 
ATOM   2856 O O   . ALA A 1 377 ? 24.546  11.688  -12.332 1.00 53.65  ? 377  ALA A O   1 
ATOM   2857 C CB  . ALA A 1 377 ? 27.164  9.698   -12.873 1.00 54.40  ? 377  ALA A CB  1 
ATOM   2858 N N   . VAL A 1 378 ? 26.429  12.258  -11.227 1.00 51.62  ? 378  VAL A N   1 
ATOM   2859 C CA  . VAL A 1 378 ? 25.719  12.902  -10.117 1.00 50.17  ? 378  VAL A CA  1 
ATOM   2860 C C   . VAL A 1 378 ? 24.891  14.092  -10.611 1.00 50.53  ? 378  VAL A C   1 
ATOM   2861 O O   . VAL A 1 378 ? 23.696  14.204  -10.300 1.00 49.44  ? 378  VAL A O   1 
ATOM   2862 C CB  . VAL A 1 378 ? 26.691  13.355  -8.996  1.00 49.41  ? 378  VAL A CB  1 
ATOM   2863 C CG1 . VAL A 1 378 ? 25.972  14.228  -7.972  1.00 48.06  ? 378  VAL A CG1 1 
ATOM   2864 C CG2 . VAL A 1 378 ? 27.321  12.138  -8.306  1.00 47.74  ? 378  VAL A CG2 1 
ATOM   2865 N N   . VAL A 1 379 ? 25.527  14.981  -11.375 1.00 50.79  ? 379  VAL A N   1 
ATOM   2866 C CA  . VAL A 1 379 ? 24.840  16.165  -11.920 1.00 51.20  ? 379  VAL A CA  1 
ATOM   2867 C C   . VAL A 1 379 ? 23.623  15.797  -12.774 1.00 52.34  ? 379  VAL A C   1 
ATOM   2868 O O   . VAL A 1 379 ? 22.563  16.407  -12.672 1.00 52.54  ? 379  VAL A O   1 
ATOM   2869 C CB  . VAL A 1 379 ? 25.814  17.042  -12.740 1.00 51.61  ? 379  VAL A CB  1 
ATOM   2870 C CG1 . VAL A 1 379 ? 25.051  18.055  -13.595 1.00 52.27  ? 379  VAL A CG1 1 
ATOM   2871 C CG2 . VAL A 1 379 ? 26.808  17.760  -11.799 1.00 49.86  ? 379  VAL A CG2 1 
ATOM   2872 N N   . LEU A 1 380 ? 23.785  14.784  -13.606 1.00 53.63  ? 380  LEU A N   1 
ATOM   2873 C CA  . LEU A 1 380 ? 22.727  14.333  -14.481 1.00 54.91  ? 380  LEU A CA  1 
ATOM   2874 C C   . LEU A 1 380 ? 21.572  13.723  -13.699 1.00 54.37  ? 380  LEU A C   1 
ATOM   2875 O O   . LEU A 1 380 ? 20.413  13.941  -14.034 1.00 54.77  ? 380  LEU A O   1 
ATOM   2876 C CB  . LEU A 1 380 ? 23.285  13.360  -15.518 1.00 56.49  ? 380  LEU A CB  1 
ATOM   2877 C CG  . LEU A 1 380 ? 24.200  14.015  -16.575 1.00 59.31  ? 380  LEU A CG  1 
ATOM   2878 C CD1 . LEU A 1 380 ? 25.000  12.969  -17.386 1.00 62.00  ? 380  LEU A CD1 1 
ATOM   2879 C CD2 . LEU A 1 380 ? 23.409  14.901  -17.529 1.00 62.36  ? 380  LEU A CD2 1 
ATOM   2880 N N   . HIS A 1 381 ? 21.884  12.987  -12.639 1.00 53.39  ? 381  HIS A N   1 
ATOM   2881 C CA  . HIS A 1 381 ? 20.853  12.353  -11.809 1.00 52.90  ? 381  HIS A CA  1 
ATOM   2882 C C   . HIS A 1 381 ? 20.045  13.385  -11.026 1.00 51.81  ? 381  HIS A C   1 
ATOM   2883 O O   . HIS A 1 381 ? 18.835  13.245  -10.883 1.00 51.66  ? 381  HIS A O   1 
ATOM   2884 C CB  . HIS A 1 381 ? 21.484  11.339  -10.840 1.00 52.54  ? 381  HIS A CB  1 
ATOM   2885 C CG  . HIS A 1 381 ? 20.484  10.610  -9.993  1.00 53.24  ? 381  HIS A CG  1 
ATOM   2886 N ND1 . HIS A 1 381 ? 19.748  9.544   -10.463 1.00 55.79  ? 381  HIS A ND1 1 
ATOM   2887 C CD2 . HIS A 1 381 ? 20.091  10.800  -8.711  1.00 53.15  ? 381  HIS A CD2 1 
ATOM   2888 C CE1 . HIS A 1 381 ? 18.942  9.113   -9.508  1.00 56.12  ? 381  HIS A CE1 1 
ATOM   2889 N NE2 . HIS A 1 381 ? 19.131  9.858   -8.434  1.00 54.86  ? 381  HIS A NE2 1 
ATOM   2890 N N   . TYR A 1 382 ? 20.724  14.420  -10.535 1.00 50.45  ? 382  TYR A N   1 
ATOM   2891 C CA  . TYR A 1 382 ? 20.116  15.385  -9.616  1.00 49.87  ? 382  TYR A CA  1 
ATOM   2892 C C   . TYR A 1 382 ? 19.527  16.590  -10.320 1.00 50.20  ? 382  TYR A C   1 
ATOM   2893 O O   . TYR A 1 382 ? 18.714  17.289  -9.737  1.00 50.38  ? 382  TYR A O   1 
ATOM   2894 C CB  . TYR A 1 382 ? 21.116  15.805  -8.532  1.00 49.21  ? 382  TYR A CB  1 
ATOM   2895 C CG  . TYR A 1 382 ? 21.208  14.797  -7.397  1.00 48.42  ? 382  TYR A CG  1 
ATOM   2896 C CD1 . TYR A 1 382 ? 22.109  13.742  -7.444  1.00 48.73  ? 382  TYR A CD1 1 
ATOM   2897 C CD2 . TYR A 1 382 ? 20.371  14.894  -6.292  1.00 48.54  ? 382  TYR A CD2 1 
ATOM   2898 C CE1 . TYR A 1 382 ? 22.179  12.814  -6.425  1.00 48.48  ? 382  TYR A CE1 1 
ATOM   2899 C CE2 . TYR A 1 382 ? 20.438  13.973  -5.251  1.00 48.08  ? 382  TYR A CE2 1 
ATOM   2900 C CZ  . TYR A 1 382 ? 21.338  12.936  -5.323  1.00 49.45  ? 382  TYR A CZ  1 
ATOM   2901 O OH  . TYR A 1 382 ? 21.407  12.022  -4.289  1.00 48.35  ? 382  TYR A OH  1 
ATOM   2902 N N   . THR A 1 383 ? 19.900  16.809  -11.579 1.00 50.58  ? 383  THR A N   1 
ATOM   2903 C CA  . THR A 1 383 ? 19.250  17.810  -12.413 1.00 51.37  ? 383  THR A CA  1 
ATOM   2904 C C   . THR A 1 383 ? 17.785  17.460  -12.671 1.00 53.21  ? 383  THR A C   1 
ATOM   2905 O O   . THR A 1 383 ? 17.450  16.323  -12.991 1.00 54.06  ? 383  THR A O   1 
ATOM   2906 C CB  . THR A 1 383 ? 19.971  17.972  -13.781 1.00 51.61  ? 383  THR A CB  1 
ATOM   2907 O OG1 . THR A 1 383 ? 21.306  18.418  -13.555 1.00 50.27  ? 383  THR A OG1 1 
ATOM   2908 C CG2 . THR A 1 383 ? 19.268  18.957  -14.696 1.00 50.98  ? 383  THR A CG2 1 
ATOM   2909 N N   . ASP A 1 384 ? 16.927  18.461  -12.531 1.00 54.10  ? 384  ASP A N   1 
ATOM   2910 C CA  . ASP A 1 384 ? 15.572  18.390  -13.011 1.00 56.00  ? 384  ASP A CA  1 
ATOM   2911 C C   . ASP A 1 384 ? 15.559  18.829  -14.470 1.00 57.06  ? 384  ASP A C   1 
ATOM   2912 O O   . ASP A 1 384 ? 15.644  20.032  -14.760 1.00 57.53  ? 384  ASP A O   1 
ATOM   2913 C CB  . ASP A 1 384 ? 14.675  19.311  -12.191 1.00 56.28  ? 384  ASP A CB  1 
ATOM   2914 C CG  . ASP A 1 384 ? 13.230  19.256  -12.640 1.00 59.92  ? 384  ASP A CG  1 
ATOM   2915 O OD1 . ASP A 1 384 ? 12.963  18.696  -13.724 1.00 62.55  ? 384  ASP A OD1 1 
ATOM   2916 O OD2 . ASP A 1 384 ? 12.362  19.782  -11.917 1.00 64.98  ? 384  ASP A OD2 1 
ATOM   2917 N N   . TRP A 1 385 ? 15.425  17.875  -15.393 1.00 57.56  ? 385  TRP A N   1 
ATOM   2918 C CA  . TRP A 1 385 ? 15.578  18.193  -16.818 1.00 58.43  ? 385  TRP A CA  1 
ATOM   2919 C C   . TRP A 1 385 ? 14.405  18.985  -17.408 1.00 60.17  ? 385  TRP A C   1 
ATOM   2920 O O   . TRP A 1 385 ? 14.472  19.431  -18.556 1.00 61.56  ? 385  TRP A O   1 
ATOM   2921 C CB  . TRP A 1 385 ? 15.954  16.942  -17.628 1.00 58.08  ? 385  TRP A CB  1 
ATOM   2922 C CG  . TRP A 1 385 ? 17.318  16.500  -17.244 1.00 56.00  ? 385  TRP A CG  1 
ATOM   2923 C CD1 . TRP A 1 385 ? 17.653  15.490  -16.387 1.00 54.80  ? 385  TRP A CD1 1 
ATOM   2924 C CD2 . TRP A 1 385 ? 18.539  17.117  -17.629 1.00 54.31  ? 385  TRP A CD2 1 
ATOM   2925 N NE1 . TRP A 1 385 ? 19.011  15.420  -16.249 1.00 53.85  ? 385  TRP A NE1 1 
ATOM   2926 C CE2 . TRP A 1 385 ? 19.582  16.415  -16.992 1.00 53.41  ? 385  TRP A CE2 1 
ATOM   2927 C CE3 . TRP A 1 385 ? 18.856  18.202  -18.449 1.00 55.66  ? 385  TRP A CE3 1 
ATOM   2928 C CZ2 . TRP A 1 385 ? 20.919  16.762  -17.147 1.00 54.18  ? 385  TRP A CZ2 1 
ATOM   2929 C CZ3 . TRP A 1 385 ? 20.193  18.543  -18.615 1.00 55.45  ? 385  TRP A CZ3 1 
ATOM   2930 C CH2 . TRP A 1 385 ? 21.205  17.819  -17.974 1.00 55.05  ? 385  TRP A CH2 1 
ATOM   2931 N N   . LEU A 1 386 ? 13.357  19.184  -16.616 1.00 61.08  ? 386  LEU A N   1 
ATOM   2932 C CA  . LEU A 1 386 ? 12.308  20.150  -16.951 1.00 62.99  ? 386  LEU A CA  1 
ATOM   2933 C C   . LEU A 1 386 ? 12.713  21.581  -16.608 1.00 62.83  ? 386  LEU A C   1 
ATOM   2934 O O   . LEU A 1 386 ? 12.268  22.532  -17.261 1.00 64.32  ? 386  LEU A O   1 
ATOM   2935 C CB  . LEU A 1 386 ? 10.997  19.828  -16.223 1.00 63.52  ? 386  LEU A CB  1 
ATOM   2936 C CG  . LEU A 1 386 ? 9.938   19.056  -17.011 1.00 66.19  ? 386  LEU A CG  1 
ATOM   2937 C CD1 . LEU A 1 386 ? 8.706   18.863  -16.144 1.00 66.56  ? 386  LEU A CD1 1 
ATOM   2938 C CD2 . LEU A 1 386 ? 9.586   19.780  -18.305 1.00 68.36  ? 386  LEU A CD2 1 
ATOM   2939 N N   . HIS A 1 387 ? 13.530  21.732  -15.574 1.00 61.90  ? 387  HIS A N   1 
ATOM   2940 C CA  . HIS A 1 387 ? 13.957  23.045  -15.101 1.00 61.71  ? 387  HIS A CA  1 
ATOM   2941 C C   . HIS A 1 387 ? 15.442  23.024  -14.767 1.00 60.13  ? 387  HIS A C   1 
ATOM   2942 O O   . HIS A 1 387 ? 15.819  23.295  -13.634 1.00 59.41  ? 387  HIS A O   1 
ATOM   2943 C CB  . HIS A 1 387 ? 13.157  23.432  -13.848 1.00 61.98  ? 387  HIS A CB  1 
ATOM   2944 C CG  . HIS A 1 387 ? 11.671  23.386  -14.036 1.00 63.87  ? 387  HIS A CG  1 
ATOM   2945 N ND1 . HIS A 1 387 ? 10.885  22.376  -13.517 1.00 64.69  ? 387  HIS A ND1 1 
ATOM   2946 C CD2 . HIS A 1 387 ? 10.829  24.225  -14.683 1.00 66.51  ? 387  HIS A CD2 1 
ATOM   2947 C CE1 . HIS A 1 387 ? 9.622   22.596  -13.839 1.00 66.66  ? 387  HIS A CE1 1 
ATOM   2948 N NE2 . HIS A 1 387 ? 9.559   23.711  -14.548 1.00 67.47  ? 387  HIS A NE2 1 
ATOM   2949 N N   . PRO A 1 388 ? 16.296  22.716  -15.760 1.00 59.96  ? 388  PRO A N   1 
ATOM   2950 C CA  . PRO A 1 388 ? 17.709  22.472  -15.478 1.00 58.64  ? 388  PRO A CA  1 
ATOM   2951 C C   . PRO A 1 388 ? 18.500  23.701  -14.988 1.00 58.03  ? 388  PRO A C   1 
ATOM   2952 O O   . PRO A 1 388 ? 19.610  23.539  -14.500 1.00 56.97  ? 388  PRO A O   1 
ATOM   2953 C CB  . PRO A 1 388 ? 18.247  21.971  -16.822 1.00 59.01  ? 388  PRO A CB  1 
ATOM   2954 C CG  . PRO A 1 388 ? 17.326  22.549  -17.837 1.00 60.61  ? 388  PRO A CG  1 
ATOM   2955 C CD  . PRO A 1 388 ? 15.989  22.576  -17.196 1.00 61.05  ? 388  PRO A CD  1 
ATOM   2956 N N   . GLU A 1 389 ? 17.925  24.898  -15.113 1.00 58.52  ? 389  GLU A N   1 
ATOM   2957 C CA  . GLU A 1 389 ? 18.605  26.136  -14.754 1.00 58.65  ? 389  GLU A CA  1 
ATOM   2958 C C   . GLU A 1 389 ? 17.948  26.839  -13.568 1.00 57.17  ? 389  GLU A C   1 
ATOM   2959 O O   . GLU A 1 389 ? 18.387  27.925  -13.179 1.00 56.73  ? 389  GLU A O   1 
ATOM   2960 C CB  . GLU A 1 389 ? 18.563  27.118  -15.930 1.00 60.92  ? 389  GLU A CB  1 
ATOM   2961 C CG  . GLU A 1 389 ? 18.986  26.575  -17.279 1.00 64.69  ? 389  GLU A CG  1 
ATOM   2962 C CD  . GLU A 1 389 ? 20.447  26.825  -17.568 1.00 68.94  ? 389  GLU A CD  1 
ATOM   2963 O OE1 . GLU A 1 389 ? 21.292  26.619  -16.670 1.00 70.74  ? 389  GLU A OE1 1 
ATOM   2964 O OE2 . GLU A 1 389 ? 20.741  27.244  -18.706 1.00 73.27  ? 389  GLU A OE2 1 
ATOM   2965 N N   . ASP A 1 390 ? 16.896  26.251  -13.009 1.00 55.80  ? 390  ASP A N   1 
ATOM   2966 C CA  . ASP A 1 390 ? 16.168  26.904  -11.928 1.00 54.93  ? 390  ASP A CA  1 
ATOM   2967 C C   . ASP A 1 390 ? 17.000  26.927  -10.654 1.00 52.77  ? 390  ASP A C   1 
ATOM   2968 O O   . ASP A 1 390 ? 17.322  25.878  -10.123 1.00 51.99  ? 390  ASP A O   1 
ATOM   2969 C CB  . ASP A 1 390 ? 14.838  26.231  -11.618 1.00 55.08  ? 390  ASP A CB  1 
ATOM   2970 C CG  . ASP A 1 390 ? 14.058  26.995  -10.560 1.00 55.74  ? 390  ASP A CG  1 
ATOM   2971 O OD1 . ASP A 1 390 ? 13.476  28.035  -10.882 1.00 58.73  ? 390  ASP A OD1 1 
ATOM   2972 O OD2 . ASP A 1 390 ? 14.062  26.603  -9.391  1.00 56.35  ? 390  ASP A OD2 1 
ATOM   2973 N N   . PRO A 1 391 ? 17.323  28.130  -10.149 1.00 52.42  ? 391  PRO A N   1 
ATOM   2974 C CA  . PRO A 1 391 ? 18.236  28.261  -9.018  1.00 50.85  ? 391  PRO A CA  1 
ATOM   2975 C C   . PRO A 1 391 ? 17.720  27.667  -7.703  1.00 50.05  ? 391  PRO A C   1 
ATOM   2976 O O   . PRO A 1 391 ? 18.529  27.213  -6.880  1.00 49.28  ? 391  PRO A O   1 
ATOM   2977 C CB  . PRO A 1 391 ? 18.410  29.780  -8.874  1.00 51.30  ? 391  PRO A CB  1 
ATOM   2978 C CG  . PRO A 1 391 ? 17.885  30.374  -10.110 1.00 53.46  ? 391  PRO A CG  1 
ATOM   2979 C CD  . PRO A 1 391 ? 16.839  29.447  -10.603 1.00 53.19  ? 391  PRO A CD  1 
ATOM   2980 N N   . THR A 1 392 ? 16.401  27.676  -7.492  1.00 50.08  ? 392  THR A N   1 
ATOM   2981 C CA  . THR A 1 392 ? 15.817  27.063  -6.292  1.00 49.58  ? 392  THR A CA  1 
ATOM   2982 C C   . THR A 1 392 ? 16.010  25.547  -6.344  1.00 48.71  ? 392  THR A C   1 
ATOM   2983 O O   . THR A 1 392 ? 16.453  24.951  -5.354  1.00 47.86  ? 392  THR A O   1 
ATOM   2984 C CB  . THR A 1 392 ? 14.303  27.408  -6.124  1.00 50.75  ? 392  THR A CB  1 
ATOM   2985 O OG1 . THR A 1 392 ? 14.136  28.829  -6.110  1.00 51.68  ? 392  THR A OG1 1 
ATOM   2986 C CG2 . THR A 1 392 ? 13.750  26.844  -4.824  1.00 50.20  ? 392  THR A CG2 1 
ATOM   2987 N N   . HIS A 1 393 ? 15.699  24.917  -7.486  1.00 49.41  ? 393  HIS A N   1 
ATOM   2988 C CA  A HIS A 1 393 ? 15.924  23.472  -7.573  0.60 49.26  ? 393  HIS A CA  1 
ATOM   2989 C CA  B HIS A 1 393 ? 15.919  23.476  -7.669  0.40 49.12  ? 393  HIS A CA  1 
ATOM   2990 C C   . HIS A 1 393 ? 17.397  23.139  -7.448  1.00 47.91  ? 393  HIS A C   1 
ATOM   2991 O O   . HIS A 1 393 ? 17.739  22.168  -6.793  1.00 47.96  ? 393  HIS A O   1 
ATOM   2992 C CB  A HIS A 1 393 ? 15.407  22.819  -8.850  0.60 50.39  ? 393  HIS A CB  1 
ATOM   2993 C CB  B HIS A 1 393 ? 15.516  23.030  -9.092  0.40 50.06  ? 393  HIS A CB  1 
ATOM   2994 C CG  A HIS A 1 393 ? 15.827  21.384  -8.967  0.60 51.09  ? 393  HIS A CG  1 
ATOM   2995 C CG  B HIS A 1 393 ? 14.044  22.787  -9.283  0.40 51.21  ? 393  HIS A CG  1 
ATOM   2996 N ND1 A HIS A 1 393 ? 15.159  20.357  -8.333  0.60 52.78  ? 393  HIS A ND1 1 
ATOM   2997 N ND1 B HIS A 1 393 ? 13.472  21.540  -9.144  0.40 52.34  ? 393  HIS A ND1 1 
ATOM   2998 C CD2 A HIS A 1 393 ? 16.906  20.818  -9.561  0.50 51.99  ? 393  HIS A CD2 1 
ATOM   2999 C CD2 B HIS A 1 393 ? 13.040  23.617  -9.654  0.40 52.29  ? 393  HIS A CD2 1 
ATOM   3000 C CE1 A HIS A 1 393 ? 15.780  19.216  -8.575  0.60 52.67  ? 393  HIS A CE1 1 
ATOM   3001 C CE1 B HIS A 1 393 ? 12.176  21.619  -9.392  0.40 52.71  ? 393  HIS A CE1 1 
ATOM   3002 N NE2 A HIS A 1 393 ? 16.845  19.469  -9.318  0.60 51.76  ? 393  HIS A NE2 1 
ATOM   3003 N NE2 B HIS A 1 393 ? 11.889  22.868  -9.707  0.40 52.74  ? 393  HIS A NE2 1 
ATOM   3004 N N   . LEU A 1 394 ? 18.271  23.935  -8.055  1.00 47.94  ? 394  LEU A N   1 
ATOM   3005 C CA  . LEU A 1 394 ? 19.708  23.657  -8.005  1.00 46.76  ? 394  LEU A CA  1 
ATOM   3006 C C   . LEU A 1 394 ? 20.225  23.748  -6.565  1.00 46.20  ? 394  LEU A C   1 
ATOM   3007 O O   . LEU A 1 394 ? 20.976  22.887  -6.116  1.00 45.88  ? 394  LEU A O   1 
ATOM   3008 C CB  . LEU A 1 394 ? 20.478  24.590  -8.953  1.00 46.90  ? 394  LEU A CB  1 
ATOM   3009 C CG  . LEU A 1 394 ? 20.229  24.347  -10.456 1.00 48.25  ? 394  LEU A CG  1 
ATOM   3010 C CD1 . LEU A 1 394 ? 20.641  25.541  -11.336 1.00 48.81  ? 394  LEU A CD1 1 
ATOM   3011 C CD2 . LEU A 1 394 ? 20.903  23.058  -10.939 1.00 47.21  ? 394  LEU A CD2 1 
ATOM   3012 N N   . ARG A 1 395 ? 19.810  24.778  -5.831  1.00 46.74  ? 395  ARG A N   1 
ATOM   3013 C CA  . ARG A 1 395 ? 20.166  24.889  -4.417  1.00 45.88  ? 395  ARG A CA  1 
ATOM   3014 C C   . ARG A 1 395 ? 19.764  23.634  -3.661  1.00 45.98  ? 395  ARG A C   1 
ATOM   3015 O O   . ARG A 1 395 ? 20.577  23.019  -2.967  1.00 46.11  ? 395  ARG A O   1 
ATOM   3016 C CB  . ARG A 1 395 ? 19.469  26.079  -3.795  1.00 46.13  ? 395  ARG A CB  1 
ATOM   3017 C CG  . ARG A 1 395 ? 19.746  26.288  -2.311  1.00 45.41  ? 395  ARG A CG  1 
ATOM   3018 C CD  . ARG A 1 395 ? 18.770  27.297  -1.744  1.00 45.58  ? 395  ARG A CD  1 
ATOM   3019 N NE  . ARG A 1 395 ? 17.450  26.699  -1.611  1.00 44.20  ? 395  ARG A NE  1 
ATOM   3020 C CZ  . ARG A 1 395 ? 16.327  27.371  -1.426  1.00 45.63  ? 395  ARG A CZ  1 
ATOM   3021 N NH1 . ARG A 1 395 ? 16.331  28.696  -1.340  1.00 47.25  ? 395  ARG A NH1 1 
ATOM   3022 N NH2 . ARG A 1 395 ? 15.177  26.711  -1.321  1.00 46.57  ? 395  ARG A NH2 1 
ATOM   3023 N N   . ASP A 1 396 ? 18.491  23.273  -3.787  1.00 47.11  ? 396  ASP A N   1 
ATOM   3024 C CA  . ASP A 1 396 ? 17.924  22.139  -3.070  1.00 46.79  ? 396  ASP A CA  1 
ATOM   3025 C C   . ASP A 1 396 ? 18.572  20.828  -3.498  1.00 46.24  ? 396  ASP A C   1 
ATOM   3026 O O   . ASP A 1 396 ? 18.744  19.936  -2.674  1.00 45.51  ? 396  ASP A O   1 
ATOM   3027 C CB  . ASP A 1 396 ? 16.411  22.066  -3.283  1.00 48.17  ? 396  ASP A CB  1 
ATOM   3028 C CG  . ASP A 1 396 ? 15.648  23.226  -2.628  1.00 48.84  ? 396  ASP A CG  1 
ATOM   3029 O OD1 . ASP A 1 396 ? 16.190  23.884  -1.726  1.00 48.96  ? 396  ASP A OD1 1 
ATOM   3030 O OD2 . ASP A 1 396 ? 14.483  23.454  -3.012  1.00 52.50  ? 396  ASP A OD2 1 
ATOM   3031 N N   . ALA A 1 397 ? 18.925  20.715  -4.776  1.00 46.27  ? 397  ALA A N   1 
ATOM   3032 C CA  . ALA A 1 397 ? 19.646  19.536  -5.288  1.00 46.26  ? 397  ALA A CA  1 
ATOM   3033 C C   . ALA A 1 397 ? 21.068  19.456  -4.751  1.00 45.88  ? 397  ALA A C   1 
ATOM   3034 O O   . ALA A 1 397 ? 21.560  18.365  -4.473  1.00 45.91  ? 397  ALA A O   1 
ATOM   3035 C CB  . ALA A 1 397 ? 19.665  19.516  -6.817  1.00 46.31  ? 397  ALA A CB  1 
ATOM   3036 N N   . MET A 1 398 ? 21.738  20.594  -4.609  1.00 45.98  ? 398  MET A N   1 
ATOM   3037 C CA  . MET A 1 398 ? 23.072  20.597  -4.009  1.00 45.82  ? 398  MET A CA  1 
ATOM   3038 C C   . MET A 1 398 ? 22.991  20.000  -2.603  1.00 45.42  ? 398  MET A C   1 
ATOM   3039 O O   . MET A 1 398 ? 23.780  19.140  -2.239  1.00 44.60  ? 398  MET A O   1 
ATOM   3040 C CB  . MET A 1 398 ? 23.642  22.025  -3.971  1.00 46.04  ? 398  MET A CB  1 
ATOM   3041 C CG  . MET A 1 398 ? 25.137  22.114  -3.643  1.00 45.88  ? 398  MET A CG  1 
ATOM   3042 S SD  . MET A 1 398 ? 26.203  21.266  -4.812  1.00 48.28  ? 398  MET A SD  1 
ATOM   3043 C CE  . MET A 1 398 ? 26.659  19.789  -3.898  1.00 47.55  ? 398  MET A CE  1 
ATOM   3044 N N   . SER A 1 399 ? 22.000  20.446  -1.831  1.00 45.79  ? 399  SER A N   1 
ATOM   3045 C CA  . SER A 1 399 ? 21.787  19.950  -0.473  1.00 45.20  ? 399  SER A CA  1 
ATOM   3046 C C   . SER A 1 399 ? 21.544  18.458  -0.478  1.00 45.10  ? 399  SER A C   1 
ATOM   3047 O O   . SER A 1 399 ? 22.145  17.733  0.298   1.00 44.88  ? 399  SER A O   1 
ATOM   3048 C CB  . SER A 1 399 ? 20.605  20.674  0.187   1.00 45.61  ? 399  SER A CB  1 
ATOM   3049 O OG  . SER A 1 399 ? 20.332  20.155  1.476   1.00 45.55  ? 399  SER A OG  1 
ATOM   3050 N N   . ALA A 1 400 ? 20.644  18.005  -1.346  1.00 45.79  ? 400  ALA A N   1 
ATOM   3051 C CA  . ALA A 1 400 ? 20.320  16.578  -1.473  1.00 45.36  ? 400  ALA A CA  1 
ATOM   3052 C C   . ALA A 1 400 ? 21.535  15.717  -1.834  1.00 44.96  ? 400  ALA A C   1 
ATOM   3053 O O   . ALA A 1 400 ? 21.711  14.617  -1.311  1.00 44.65  ? 400  ALA A O   1 
ATOM   3054 C CB  . ALA A 1 400 ? 19.229  16.374  -2.512  1.00 46.15  ? 400  ALA A CB  1 
ATOM   3055 N N   . VAL A 1 401 ? 22.346  16.183  -2.769  1.00 44.49  ? 401  VAL A N   1 
ATOM   3056 C CA  . VAL A 1 401 ? 23.554  15.455  -3.135  1.00 44.47  ? 401  VAL A CA  1 
ATOM   3057 C C   . VAL A 1 401 ? 24.370  15.122  -1.880  1.00 44.15  ? 401  VAL A C   1 
ATOM   3058 O O   . VAL A 1 401 ? 24.745  13.965  -1.651  1.00 44.18  ? 401  VAL A O   1 
ATOM   3059 C CB  . VAL A 1 401 ? 24.420  16.292  -4.134  1.00 44.73  ? 401  VAL A CB  1 
ATOM   3060 C CG1 . VAL A 1 401 ? 25.851  15.762  -4.221  1.00 42.72  ? 401  VAL A CG1 1 
ATOM   3061 C CG2 . VAL A 1 401 ? 23.752  16.353  -5.521  1.00 44.29  ? 401  VAL A CG2 1 
ATOM   3062 N N   . VAL A 1 402 ? 24.634  16.153  -1.076  1.00 44.04  ? 402  VAL A N   1 
ATOM   3063 C CA  . VAL A 1 402 ? 25.542  16.051  0.057   1.00 43.50  ? 402  VAL A CA  1 
ATOM   3064 C C   . VAL A 1 402 ? 24.926  15.229  1.176   1.00 44.03  ? 402  VAL A C   1 
ATOM   3065 O O   . VAL A 1 402 ? 25.616  14.396  1.791   1.00 43.28  ? 402  VAL A O   1 
ATOM   3066 C CB  . VAL A 1 402 ? 25.955  17.435  0.562   1.00 43.48  ? 402  VAL A CB  1 
ATOM   3067 C CG1 . VAL A 1 402 ? 26.683  17.322  1.903   1.00 40.90  ? 402  VAL A CG1 1 
ATOM   3068 C CG2 . VAL A 1 402 ? 26.806  18.124  -0.494  1.00 41.72  ? 402  VAL A CG2 1 
ATOM   3069 N N   . GLY A 1 403 ? 23.629  15.436  1.414   1.00 44.11  ? 403  GLY A N   1 
ATOM   3070 C CA  . GLY A 1 403 ? 22.882  14.626  2.381   1.00 43.86  ? 403  GLY A CA  1 
ATOM   3071 C C   . GLY A 1 403 ? 22.804  13.144  2.021   1.00 44.66  ? 403  GLY A C   1 
ATOM   3072 O O   . GLY A 1 403 ? 23.076  12.271  2.863   1.00 44.10  ? 403  GLY A O   1 
ATOM   3073 N N   . ASP A 1 404 ? 22.430  12.855  0.773   1.00 44.89  ? 404  ASP A N   1 
ATOM   3074 C CA  . ASP A 1 404 ? 22.309  11.477  0.289   1.00 44.92  ? 404  ASP A CA  1 
ATOM   3075 C C   . ASP A 1 404 ? 23.631  10.736  0.274   1.00 44.77  ? 404  ASP A C   1 
ATOM   3076 O O   . ASP A 1 404 ? 23.720  9.585   0.703   1.00 45.42  ? 404  ASP A O   1 
ATOM   3077 C CB  . ASP A 1 404 ? 21.754  11.465  -1.131  1.00 45.74  ? 404  ASP A CB  1 
ATOM   3078 C CG  . ASP A 1 404 ? 20.328  11.930  -1.208  1.00 46.51  ? 404  ASP A CG  1 
ATOM   3079 O OD1 . ASP A 1 404 ? 19.678  12.072  -0.147  1.00 46.19  ? 404  ASP A OD1 1 
ATOM   3080 O OD2 . ASP A 1 404 ? 19.853  12.166  -2.342  1.00 49.49  ? 404  ASP A OD2 1 
ATOM   3081 N N   . HIS A 1 405 ? 24.653  11.383  -0.275  1.00 44.38  ? 405  HIS A N   1 
ATOM   3082 C CA  . HIS A 1 405 ? 25.981  10.782  -0.389  1.00 43.85  ? 405  HIS A CA  1 
ATOM   3083 C C   . HIS A 1 405 ? 26.532  10.423  0.981   1.00 43.71  ? 405  HIS A C   1 
ATOM   3084 O O   . HIS A 1 405 ? 27.049  9.331   1.189   1.00 43.86  ? 405  HIS A O   1 
ATOM   3085 C CB  . HIS A 1 405 ? 26.906  11.791  -1.082  1.00 44.05  ? 405  HIS A CB  1 
ATOM   3086 C CG  . HIS A 1 405 ? 28.343  11.387  -1.143  1.00 42.67  ? 405  HIS A CG  1 
ATOM   3087 N ND1 . HIS A 1 405 ? 28.754  10.128  -1.523  1.00 41.68  ? 405  HIS A ND1 1 
ATOM   3088 C CD2 . HIS A 1 405 ? 29.470  12.102  -0.922  1.00 42.16  ? 405  HIS A CD2 1 
ATOM   3089 C CE1 . HIS A 1 405 ? 30.075  10.079  -1.508  1.00 43.54  ? 405  HIS A CE1 1 
ATOM   3090 N NE2 . HIS A 1 405 ? 30.536  11.261  -1.138  1.00 40.72  ? 405  HIS A NE2 1 
ATOM   3091 N N   . ASN A 1 406 ? 26.417  11.358  1.916   1.00 43.30  ? 406  ASN A N   1 
ATOM   3092 C CA  . ASN A 1 406 ? 27.077  11.228  3.214   1.00 43.26  ? 406  ASN A CA  1 
ATOM   3093 C C   . ASN A 1 406 ? 26.275  10.599  4.336   1.00 42.73  ? 406  ASN A C   1 
ATOM   3094 O O   . ASN A 1 406 ? 26.880  10.042  5.240   1.00 42.63  ? 406  ASN A O   1 
ATOM   3095 C CB  . ASN A 1 406 ? 27.567  12.585  3.697   1.00 42.41  ? 406  ASN A CB  1 
ATOM   3096 C CG  . ASN A 1 406 ? 28.707  13.107  2.885   1.00 43.14  ? 406  ASN A CG  1 
ATOM   3097 O OD1 . ASN A 1 406 ? 29.791  12.525  2.872   1.00 42.61  ? 406  ASN A OD1 1 
ATOM   3098 N ND2 . ASN A 1 406 ? 28.488  14.232  2.217   1.00 41.11  ? 406  ASN A ND2 1 
ATOM   3099 N N   . VAL A 1 407 ? 24.944  10.711  4.304   1.00 43.36  ? 407  VAL A N   1 
ATOM   3100 C CA  . VAL A 1 407 ? 24.096  10.207  5.395   1.00 43.01  ? 407  VAL A CA  1 
ATOM   3101 C C   . VAL A 1 407 ? 23.000  9.283   4.910   1.00 44.09  ? 407  VAL A C   1 
ATOM   3102 O O   . VAL A 1 407 ? 22.971  8.105   5.305   1.00 44.36  ? 407  VAL A O   1 
ATOM   3103 C CB  . VAL A 1 407 ? 23.480  11.357  6.244   1.00 43.05  ? 407  VAL A CB  1 
ATOM   3104 C CG1 . VAL A 1 407 ? 22.687  10.797  7.435   1.00 41.24  ? 407  VAL A CG1 1 
ATOM   3105 C CG2 . VAL A 1 407 ? 24.576  12.314  6.759   1.00 41.11  ? 407  VAL A CG2 1 
ATOM   3106 N N   . VAL A 1 408 ? 22.101  9.779   4.054   1.00 44.40  ? 408  VAL A N   1 
ATOM   3107 C CA  . VAL A 1 408 ? 20.901  9.011   3.742   1.00 45.12  ? 408  VAL A CA  1 
ATOM   3108 C C   . VAL A 1 408 ? 21.257  7.658   3.112   1.00 46.10  ? 408  VAL A C   1 
ATOM   3109 O O   . VAL A 1 408 ? 20.755  6.630   3.553   1.00 46.58  ? 408  VAL A O   1 
ATOM   3110 C CB  . VAL A 1 408 ? 19.855  9.774   2.867   1.00 45.62  ? 408  VAL A CB  1 
ATOM   3111 C CG1 . VAL A 1 408 ? 18.621  8.892   2.652   1.00 45.79  ? 408  VAL A CG1 1 
ATOM   3112 C CG2 . VAL A 1 408 ? 19.445  11.071  3.506   1.00 42.88  ? 408  VAL A CG2 1 
ATOM   3113 N N   . CYS A 1 409 ? 22.141  7.635   2.111   1.00 46.21  ? 409  CYS A N   1 
ATOM   3114 C CA  . CYS A 1 409 ? 22.394  6.361   1.421   1.00 46.97  ? 409  CYS A CA  1 
ATOM   3115 C C   . CYS A 1 409 ? 23.276  5.380   2.202   1.00 46.46  ? 409  CYS A C   1 
ATOM   3116 O O   . CYS A 1 409 ? 23.039  4.175   2.146   1.00 47.25  ? 409  CYS A O   1 
ATOM   3117 C CB  . CYS A 1 409 ? 22.886  6.579   -0.007  1.00 47.27  ? 409  CYS A CB  1 
ATOM   3118 S SG  . CYS A 1 409 ? 21.636  7.416   -1.025  1.00 47.88  ? 409  CYS A SG  1 
ATOM   3119 N N   . PRO A 1 410 ? 24.291  5.879   2.912   1.00 45.39  ? 410  PRO A N   1 
ATOM   3120 C CA  . PRO A 1 410 ? 24.940  5.051   3.935   1.00 45.36  ? 410  PRO A CA  1 
ATOM   3121 C C   . PRO A 1 410 ? 24.003  4.420   4.973   1.00 45.81  ? 410  PRO A C   1 
ATOM   3122 O O   . PRO A 1 410 ? 24.187  3.261   5.335   1.00 45.74  ? 410  PRO A O   1 
ATOM   3123 C CB  . PRO A 1 410 ? 25.918  6.024   4.588   1.00 44.62  ? 410  PRO A CB  1 
ATOM   3124 C CG  . PRO A 1 410 ? 26.319  6.941   3.433   1.00 43.54  ? 410  PRO A CG  1 
ATOM   3125 C CD  . PRO A 1 410 ? 25.003  7.163   2.721   1.00 45.16  ? 410  PRO A CD  1 
ATOM   3126 N N   . VAL A 1 411 ? 23.016  5.170   5.448   1.00 45.81  ? 411  VAL A N   1 
ATOM   3127 C CA  . VAL A 1 411 ? 22.038  4.641   6.390   1.00 46.11  ? 411  VAL A CA  1 
ATOM   3128 C C   . VAL A 1 411 ? 21.167  3.567   5.733   1.00 47.88  ? 411  VAL A C   1 
ATOM   3129 O O   . VAL A 1 411 ? 20.980  2.491   6.291   1.00 48.94  ? 411  VAL A O   1 
ATOM   3130 C CB  . VAL A 1 411 ? 21.143  5.758   6.967   1.00 45.93  ? 411  VAL A CB  1 
ATOM   3131 C CG1 . VAL A 1 411 ? 19.914  5.148   7.663   1.00 46.00  ? 411  VAL A CG1 1 
ATOM   3132 C CG2 . VAL A 1 411 ? 21.940  6.637   7.923   1.00 42.72  ? 411  VAL A CG2 1 
ATOM   3133 N N   . ALA A 1 412 ? 20.649  3.867   4.540   1.00 48.64  ? 412  ALA A N   1 
ATOM   3134 C CA  . ALA A 1 412 ? 19.904  2.899   3.737   1.00 49.56  ? 412  ALA A CA  1 
ATOM   3135 C C   . ALA A 1 412 ? 20.708  1.614   3.569   1.00 50.59  ? 412  ALA A C   1 
ATOM   3136 O O   . ALA A 1 412 ? 20.201  0.518   3.780   1.00 51.18  ? 412  ALA A O   1 
ATOM   3137 C CB  . ALA A 1 412 ? 19.569  3.496   2.373   1.00 49.64  ? 412  ALA A CB  1 
ATOM   3138 N N   . GLN A 1 413 ? 21.973  1.754   3.200   1.00 50.47  ? 413  GLN A N   1 
ATOM   3139 C CA  . GLN A 1 413 ? 22.844  0.598   3.024   1.00 51.60  ? 413  GLN A CA  1 
ATOM   3140 C C   . GLN A 1 413 ? 22.997  -0.184  4.339   1.00 51.37  ? 413  GLN A C   1 
ATOM   3141 O O   . GLN A 1 413 ? 22.862  -1.401  4.361   1.00 51.55  ? 413  GLN A O   1 
ATOM   3142 C CB  . GLN A 1 413 ? 24.213  1.061   2.530   1.00 51.84  ? 413  GLN A CB  1 
ATOM   3143 C CG  . GLN A 1 413 ? 25.236  -0.032  2.363   1.00 55.22  ? 413  GLN A CG  1 
ATOM   3144 C CD  . GLN A 1 413 ? 25.399  -0.439  0.934   1.00 62.53  ? 413  GLN A CD  1 
ATOM   3145 O OE1 . GLN A 1 413 ? 24.520  -1.102  0.339   1.00 65.70  ? 413  GLN A OE1 1 
ATOM   3146 N NE2 . GLN A 1 413 ? 26.537  -0.033  0.343   1.00 66.91  ? 413  GLN A NE2 1 
ATOM   3147 N N   . LEU A 1 414 ? 23.300  0.521   5.428   1.00 50.20  ? 414  LEU A N   1 
ATOM   3148 C CA  . LEU A 1 414 ? 23.444  -0.126  6.732   1.00 50.29  ? 414  LEU A CA  1 
ATOM   3149 C C   . LEU A 1 414 ? 22.170  -0.883  7.148   1.00 51.19  ? 414  LEU A C   1 
ATOM   3150 O O   . LEU A 1 414 ? 22.252  -2.045  7.538   1.00 52.47  ? 414  LEU A O   1 
ATOM   3151 C CB  . LEU A 1 414 ? 23.814  0.889   7.810   1.00 48.95  ? 414  LEU A CB  1 
ATOM   3152 C CG  . LEU A 1 414 ? 24.117  0.313   9.201   1.00 48.99  ? 414  LEU A CG  1 
ATOM   3153 C CD1 . LEU A 1 414 ? 25.362  -0.567  9.168   1.00 49.19  ? 414  LEU A CD1 1 
ATOM   3154 C CD2 . LEU A 1 414 ? 24.276  1.438   10.205  1.00 48.24  ? 414  LEU A CD2 1 
ATOM   3155 N N   . ALA A 1 415 ? 21.016  -0.220  7.071   1.00 51.00  ? 415  ALA A N   1 
ATOM   3156 C CA  . ALA A 1 415 ? 19.736  -0.818  7.461   1.00 52.18  ? 415  ALA A CA  1 
ATOM   3157 C C   . ALA A 1 415 ? 19.438  -2.082  6.652   1.00 54.25  ? 415  ALA A C   1 
ATOM   3158 O O   . ALA A 1 415 ? 18.920  -3.069  7.185   1.00 55.61  ? 415  ALA A O   1 
ATOM   3159 C CB  . ALA A 1 415 ? 18.620  0.183   7.286   1.00 51.63  ? 415  ALA A CB  1 
ATOM   3160 N N   . GLY A 1 416 ? 19.765  -2.048  5.364   1.00 55.12  ? 416  GLY A N   1 
ATOM   3161 C CA  . GLY A 1 416 ? 19.567  -3.205  4.483   1.00 57.07  ? 416  GLY A CA  1 
ATOM   3162 C C   . GLY A 1 416 ? 20.469  -4.382  4.804   1.00 58.09  ? 416  GLY A C   1 
ATOM   3163 O O   . GLY A 1 416 ? 20.018  -5.527  4.836   1.00 59.62  ? 416  GLY A O   1 
ATOM   3164 N N   . ARG A 1 417 ? 21.750  -4.119  5.022   1.00 57.91  ? 417  ARG A N   1 
ATOM   3165 C CA  . ARG A 1 417 ? 22.688  -5.199  5.326   1.00 59.10  ? 417  ARG A CA  1 
ATOM   3166 C C   . ARG A 1 417 ? 22.383  -5.797  6.686   1.00 59.08  ? 417  ARG A C   1 
ATOM   3167 O O   . ARG A 1 417 ? 22.410  -7.010  6.852   1.00 60.27  ? 417  ARG A O   1 
ATOM   3168 C CB  . ARG A 1 417 ? 24.140  -4.713  5.328   1.00 58.75  ? 417  ARG A CB  1 
ATOM   3169 C CG  . ARG A 1 417 ? 24.666  -4.124  4.025   1.00 61.03  ? 417  ARG A CG  1 
ATOM   3170 C CD  . ARG A 1 417 ? 24.423  -4.993  2.800   1.00 67.01  ? 417  ARG A CD  1 
ATOM   3171 N NE  . ARG A 1 417 ? 25.070  -6.300  2.878   1.00 70.19  ? 417  ARG A NE  1 
ATOM   3172 C CZ  . ARG A 1 417 ? 25.363  -7.066  1.823   1.00 73.38  ? 417  ARG A CZ  1 
ATOM   3173 N NH1 . ARG A 1 417 ? 25.083  -6.656  0.581   1.00 73.89  ? 417  ARG A NH1 1 
ATOM   3174 N NH2 . ARG A 1 417 ? 25.963  -8.243  2.008   1.00 74.15  ? 417  ARG A NH2 1 
ATOM   3175 N N   . LEU A 1 418 ? 22.133  -4.934  7.663   1.00 58.03  ? 418  LEU A N   1 
ATOM   3176 C CA  . LEU A 1 418 ? 21.827  -5.369  9.030   1.00 58.08  ? 418  LEU A CA  1 
ATOM   3177 C C   . LEU A 1 418 ? 20.599  -6.290  9.042   1.00 59.59  ? 418  LEU A C   1 
ATOM   3178 O O   . LEU A 1 418 ? 20.657  -7.392  9.594   1.00 60.42  ? 418  LEU A O   1 
ATOM   3179 C CB  . LEU A 1 418 ? 21.646  -4.156  9.975   1.00 56.87  ? 418  LEU A CB  1 
ATOM   3180 C CG  . LEU A 1 418 ? 22.791  -3.696  10.916  1.00 55.75  ? 418  LEU A CG  1 
ATOM   3181 C CD1 . LEU A 1 418 ? 24.194  -4.053  10.440  1.00 55.12  ? 418  LEU A CD1 1 
ATOM   3182 C CD2 . LEU A 1 418 ? 22.689  -2.215  11.227  1.00 53.54  ? 418  LEU A CD2 1 
ATOM   3183 N N   . ALA A 1 419 ? 19.515  -5.858  8.403   1.00 59.92  ? 419  ALA A N   1 
ATOM   3184 C CA  . ALA A 1 419 ? 18.286  -6.660  8.330   1.00 61.63  ? 419  ALA A CA  1 
ATOM   3185 C C   . ALA A 1 419 ? 18.477  -7.976  7.560   1.00 63.79  ? 419  ALA A C   1 
ATOM   3186 O O   . ALA A 1 419 ? 17.920  -9.024  7.931   1.00 65.54  ? 419  ALA A O   1 
ATOM   3187 C CB  . ALA A 1 419 ? 17.169  -5.851  7.695   1.00 61.32  ? 419  ALA A CB  1 
ATOM   3188 N N   . ALA A 1 420 ? 19.245  -7.924  6.479   1.00 64.29  ? 420  ALA A N   1 
ATOM   3189 C CA  . ALA A 1 420 ? 19.512  -9.121  5.689   1.00 66.46  ? 420  ALA A CA  1 
ATOM   3190 C C   . ALA A 1 420 ? 20.329  -10.132 6.490   1.00 67.36  ? 420  ALA A C   1 
ATOM   3191 O O   . ALA A 1 420 ? 20.226  -11.333 6.258   1.00 69.20  ? 420  ALA A O   1 
ATOM   3192 C CB  . ALA A 1 420 ? 20.229  -8.764  4.380   1.00 66.27  ? 420  ALA A CB  1 
ATOM   3193 N N   . GLN A 1 421 ? 21.123  -9.648  7.441   1.00 66.41  ? 421  GLN A N   1 
ATOM   3194 C CA  . GLN A 1 421 ? 22.008  -10.520 8.211   1.00 67.19  ? 421  GLN A CA  1 
ATOM   3195 C C   . GLN A 1 421 ? 21.560  -10.757 9.664   1.00 66.12  ? 421  GLN A C   1 
ATOM   3196 O O   . GLN A 1 421 ? 22.371  -11.107 10.525  1.00 65.73  ? 421  GLN A O   1 
ATOM   3197 C CB  . GLN A 1 421 ? 23.440  -9.990  8.100   1.00 66.75  ? 421  GLN A CB  1 
ATOM   3198 C CG  . GLN A 1 421 ? 24.039  -10.313 6.705   1.00 70.74  ? 421  GLN A CG  1 
ATOM   3199 C CD  . GLN A 1 421 ? 24.759  -9.139  6.085   1.00 73.70  ? 421  GLN A CD  1 
ATOM   3200 O OE1 . GLN A 1 421 ? 24.551  -8.796  4.901   1.00 77.49  ? 421  GLN A OE1 1 
ATOM   3201 N NE2 . GLN A 1 421 ? 25.602  -8.495  6.880   1.00 74.79  ? 421  GLN A NE2 1 
ATOM   3202 N N   . GLY A 1 422 ? 20.258  -10.588 9.910   1.00 65.42  ? 422  GLY A N   1 
ATOM   3203 C CA  . GLY A 1 422 ? 19.612  -11.076 11.134  1.00 65.26  ? 422  GLY A CA  1 
ATOM   3204 C C   . GLY A 1 422 ? 19.122  -10.046 12.137  1.00 63.32  ? 422  GLY A C   1 
ATOM   3205 O O   . GLY A 1 422 ? 18.407  -10.395 13.078  1.00 63.77  ? 422  GLY A O   1 
ATOM   3206 N N   . ALA A 1 423 ? 19.489  -8.783  11.951  1.00 60.71  ? 423  ALA A N   1 
ATOM   3207 C CA  . ALA A 1 423 ? 19.173  -7.757  12.945  1.00 58.74  ? 423  ALA A CA  1 
ATOM   3208 C C   . ALA A 1 423 ? 17.701  -7.375  12.916  1.00 58.15  ? 423  ALA A C   1 
ATOM   3209 O O   . ALA A 1 423 ? 17.035  -7.510  11.887  1.00 58.62  ? 423  ALA A O   1 
ATOM   3210 C CB  . ALA A 1 423 ? 20.041  -6.536  12.741  1.00 56.75  ? 423  ALA A CB  1 
ATOM   3211 N N   . ARG A 1 424 ? 17.197  -6.922  14.062  1.00 56.95  ? 424  ARG A N   1 
ATOM   3212 C CA  . ARG A 1 424 ? 15.916  -6.249  14.108  1.00 56.76  ? 424  ARG A CA  1 
ATOM   3213 C C   . ARG A 1 424 ? 16.213  -4.776  13.949  1.00 54.52  ? 424  ARG A C   1 
ATOM   3214 O O   . ARG A 1 424 ? 16.925  -4.205  14.766  1.00 53.30  ? 424  ARG A O   1 
ATOM   3215 C CB  . ARG A 1 424 ? 15.176  -6.507  15.419  1.00 57.55  ? 424  ARG A CB  1 
ATOM   3216 C CG  A ARG A 1 424 ? 13.842  -5.765  15.521  0.50 58.88  ? 424  ARG A CG  1 
ATOM   3217 C CG  B ARG A 1 424 ? 13.826  -5.802  15.501  0.50 57.78  ? 424  ARG A CG  1 
ATOM   3218 C CD  A ARG A 1 424 ? 12.804  -6.552  16.306  0.50 62.06  ? 424  ARG A CD  1 
ATOM   3219 N NE  A ARG A 1 424 ? 12.182  -7.580  15.477  0.50 64.30  ? 424  ARG A NE  1 
ATOM   3220 N NE  B ARG A 1 424 ? 12.223  -5.905  18.832  0.50 75.23  ? 424  ARG A NE  1 
ATOM   3221 C CZ  A ARG A 1 424 ? 11.048  -8.210  15.772  0.50 66.22  ? 424  ARG A CZ  1 
ATOM   3222 C CZ  B ARG A 1 424 ? 12.751  -7.069  19.198  0.50 76.29  ? 424  ARG A CZ  1 
ATOM   3223 N NH1 A ARG A 1 424 ? 10.573  -9.128  14.940  0.50 67.75  ? 424  ARG A NH1 1 
ATOM   3224 N NH1 B ARG A 1 424 ? 13.006  -8.006  18.288  0.50 77.25  ? 424  ARG A NH1 1 
ATOM   3225 N NH2 A ARG A 1 424 ? 10.380  -7.923  16.885  0.50 67.17  ? 424  ARG A NH2 1 
ATOM   3226 N NH2 B ARG A 1 424 ? 13.015  -7.298  20.476  0.50 76.34  ? 424  ARG A NH2 1 
ATOM   3227 N N   . VAL A 1 425 ? 15.688  -4.172  12.884  1.00 53.89  ? 425  VAL A N   1 
ATOM   3228 C CA  . VAL A 1 425 ? 16.020  -2.786  12.543  1.00 52.01  ? 425  VAL A CA  1 
ATOM   3229 C C   . VAL A 1 425 ? 14.741  -1.959  12.532  1.00 51.67  ? 425  VAL A C   1 
ATOM   3230 O O   . VAL A 1 425 ? 13.738  -2.394  11.986  1.00 52.63  ? 425  VAL A O   1 
ATOM   3231 C CB  . VAL A 1 425 ? 16.709  -2.696  11.150  1.00 51.99  ? 425  VAL A CB  1 
ATOM   3232 C CG1 . VAL A 1 425 ? 17.008  -1.240  10.781  1.00 48.75  ? 425  VAL A CG1 1 
ATOM   3233 C CG2 . VAL A 1 425 ? 17.977  -3.554  11.107  1.00 51.46  ? 425  VAL A CG2 1 
ATOM   3234 N N   . TYR A 1 426 ? 14.788  -0.775  13.138  1.00 50.00  ? 426  TYR A N   1 
ATOM   3235 C CA  . TYR A 1 426 ? 13.693  0.200   13.060  1.00 49.63  ? 426  TYR A CA  1 
ATOM   3236 C C   . TYR A 1 426 ? 14.240  1.459   12.430  1.00 48.49  ? 426  TYR A C   1 
ATOM   3237 O O   . TYR A 1 426 ? 15.338  1.893   12.777  1.00 46.88  ? 426  TYR A O   1 
ATOM   3238 C CB  . TYR A 1 426 ? 13.118  0.501   14.444  1.00 49.15  ? 426  TYR A CB  1 
ATOM   3239 C CG  . TYR A 1 426 ? 12.386  -0.668  15.067  1.00 50.88  ? 426  TYR A CG  1 
ATOM   3240 C CD1 . TYR A 1 426 ? 13.034  -1.546  15.937  1.00 49.65  ? 426  TYR A CD1 1 
ATOM   3241 C CD2 . TYR A 1 426 ? 11.039  -0.896  14.791  1.00 50.82  ? 426  TYR A CD2 1 
ATOM   3242 C CE1 . TYR A 1 426 ? 12.351  -2.613  16.514  1.00 51.72  ? 426  TYR A CE1 1 
ATOM   3243 C CE2 . TYR A 1 426 ? 10.364  -1.954  15.356  1.00 52.86  ? 426  TYR A CE2 1 
ATOM   3244 C CZ  . TYR A 1 426 ? 11.017  -2.816  16.209  1.00 52.64  ? 426  TYR A CZ  1 
ATOM   3245 O OH  . TYR A 1 426 ? 10.317  -3.866  16.766  1.00 54.92  ? 426  TYR A OH  1 
ATOM   3246 N N   . ALA A 1 427 ? 13.505  2.041   11.483  1.00 48.69  ? 427  ALA A N   1 
ATOM   3247 C CA  . ALA A 1 427 ? 14.062  3.166   10.698  1.00 47.88  ? 427  ALA A CA  1 
ATOM   3248 C C   . ALA A 1 427 ? 13.118  4.348   10.696  1.00 47.80  ? 427  ALA A C   1 
ATOM   3249 O O   . ALA A 1 427 ? 11.910  4.162   10.644  1.00 49.26  ? 427  ALA A O   1 
ATOM   3250 C CB  . ALA A 1 427 ? 14.363  2.719   9.263   1.00 47.60  ? 427  ALA A CB  1 
ATOM   3251 N N   . TYR A 1 428 ? 13.657  5.561   10.753  1.00 47.06  ? 428  TYR A N   1 
ATOM   3252 C CA  . TYR A 1 428 ? 12.825  6.764   10.702  1.00 47.25  ? 428  TYR A CA  1 
ATOM   3253 C C   . TYR A 1 428 ? 13.394  7.837   9.770   1.00 47.08  ? 428  TYR A C   1 
ATOM   3254 O O   . TYR A 1 428 ? 14.587  7.824   9.427   1.00 45.77  ? 428  TYR A O   1 
ATOM   3255 C CB  . TYR A 1 428 ? 12.663  7.359   12.112  1.00 47.19  ? 428  TYR A CB  1 
ATOM   3256 C CG  . TYR A 1 428 ? 13.954  7.905   12.680  1.00 45.12  ? 428  TYR A CG  1 
ATOM   3257 C CD1 . TYR A 1 428 ? 14.366  9.193   12.411  1.00 43.39  ? 428  TYR A CD1 1 
ATOM   3258 C CD2 . TYR A 1 428 ? 14.767  7.106   13.475  1.00 45.89  ? 428  TYR A CD2 1 
ATOM   3259 C CE1 . TYR A 1 428 ? 15.583  9.688   12.915  1.00 44.53  ? 428  TYR A CE1 1 
ATOM   3260 C CE2 . TYR A 1 428 ? 15.968  7.574   13.983  1.00 44.20  ? 428  TYR A CE2 1 
ATOM   3261 C CZ  . TYR A 1 428 ? 16.373  8.868   13.702  1.00 43.87  ? 428  TYR A CZ  1 
ATOM   3262 O OH  . TYR A 1 428 ? 17.571  9.308   14.206  1.00 43.02  ? 428  TYR A OH  1 
ATOM   3263 N N   . ILE A 1 429 ? 12.525  8.765   9.375   1.00 47.40  ? 429  ILE A N   1 
ATOM   3264 C CA  . ILE A 1 429 ? 12.951  10.077  8.895   1.00 47.48  ? 429  ILE A CA  1 
ATOM   3265 C C   . ILE A 1 429 ? 12.299  11.133  9.792   1.00 47.96  ? 429  ILE A C   1 
ATOM   3266 O O   . ILE A 1 429 ? 11.077  11.119  10.002  1.00 48.56  ? 429  ILE A O   1 
ATOM   3267 C CB  . ILE A 1 429 ? 12.596  10.335  7.406   1.00 47.99  ? 429  ILE A CB  1 
ATOM   3268 C CG1 . ILE A 1 429 ? 13.141  11.697  6.955   1.00 47.63  ? 429  ILE A CG1 1 
ATOM   3269 C CG2 . ILE A 1 429 ? 11.092  10.286  7.196   1.00 49.63  ? 429  ILE A CG2 1 
ATOM   3270 C CD1 . ILE A 1 429 ? 12.916  12.014  5.498   1.00 48.18  ? 429  ILE A CD1 1 
ATOM   3271 N N   . PHE A 1 430 ? 13.126  12.040  10.313  1.00 47.51  ? 430  PHE A N   1 
ATOM   3272 C CA  . PHE A 1 430 ? 12.687  13.116  11.192  1.00 47.96  ? 430  PHE A CA  1 
ATOM   3273 C C   . PHE A 1 430 ? 12.471  14.375  10.380  1.00 48.39  ? 430  PHE A C   1 
ATOM   3274 O O   . PHE A 1 430 ? 13.404  14.883  9.769   1.00 48.08  ? 430  PHE A O   1 
ATOM   3275 C CB  . PHE A 1 430 ? 13.749  13.354  12.258  1.00 47.27  ? 430  PHE A CB  1 
ATOM   3276 C CG  . PHE A 1 430 ? 13.369  14.363  13.287  1.00 47.33  ? 430  PHE A CG  1 
ATOM   3277 C CD1 . PHE A 1 430 ? 13.630  15.705  13.092  1.00 47.55  ? 430  PHE A CD1 1 
ATOM   3278 C CD2 . PHE A 1 430 ? 12.795  13.970  14.482  1.00 49.48  ? 430  PHE A CD2 1 
ATOM   3279 C CE1 . PHE A 1 430 ? 13.285  16.634  14.054  1.00 47.99  ? 430  PHE A CE1 1 
ATOM   3280 C CE2 . PHE A 1 430 ? 12.473  14.907  15.454  1.00 48.69  ? 430  PHE A CE2 1 
ATOM   3281 C CZ  . PHE A 1 430 ? 12.704  16.232  15.227  1.00 47.47  ? 430  PHE A CZ  1 
ATOM   3282 N N   . GLU A 1 431 ? 11.253  14.894  10.409  1.00 49.85  ? 431  GLU A N   1 
ATOM   3283 C CA  . GLU A 1 431 ? 10.819  15.953  9.489   1.00 50.82  ? 431  GLU A CA  1 
ATOM   3284 C C   . GLU A 1 431 ? 10.267  17.204  10.151  1.00 51.19  ? 431  GLU A C   1 
ATOM   3285 O O   . GLU A 1 431 ? 9.714   18.059  9.457   1.00 52.24  ? 431  GLU A O   1 
ATOM   3286 C CB  . GLU A 1 431 ? 9.711   15.431  8.575   1.00 51.69  ? 431  GLU A CB  1 
ATOM   3287 C CG  . GLU A 1 431 ? 10.084  14.231  7.755   1.00 51.98  ? 431  GLU A CG  1 
ATOM   3288 C CD  . GLU A 1 431 ? 8.991   13.869  6.785   1.00 54.20  ? 431  GLU A CD  1 
ATOM   3289 O OE1 . GLU A 1 431 ? 7.796   13.817  7.207   1.00 53.59  ? 431  GLU A OE1 1 
ATOM   3290 O OE2 . GLU A 1 431 ? 9.336   13.664  5.596   1.00 56.20  ? 431  GLU A OE2 1 
ATOM   3291 N N   . HIS A 1 432 ? 10.396  17.338  11.465  1.00 51.10  ? 432  HIS A N   1 
ATOM   3292 C CA  . HIS A 1 432 ? 9.942   18.560  12.108  1.00 51.51  ? 432  HIS A CA  1 
ATOM   3293 C C   . HIS A 1 432 ? 11.053  19.596  12.297  1.00 50.87  ? 432  HIS A C   1 
ATOM   3294 O O   . HIS A 1 432 ? 12.098  19.317  12.906  1.00 50.21  ? 432  HIS A O   1 
ATOM   3295 C CB  . HIS A 1 432 ? 9.275   18.282  13.449  1.00 52.22  ? 432  HIS A CB  1 
ATOM   3296 C CG  . HIS A 1 432 ? 8.865   19.534  14.154  1.00 52.91  ? 432  HIS A CG  1 
ATOM   3297 N ND1 . HIS A 1 432 ? 7.796   20.295  13.740  1.00 53.76  ? 432  HIS A ND1 1 
ATOM   3298 C CD2 . HIS A 1 432 ? 9.427   20.204  15.187  1.00 52.40  ? 432  HIS A CD2 1 
ATOM   3299 C CE1 . HIS A 1 432 ? 7.695   21.363  14.511  1.00 55.26  ? 432  HIS A CE1 1 
ATOM   3300 N NE2 . HIS A 1 432 ? 8.671   21.331  15.398  1.00 53.41  ? 432  HIS A NE2 1 
ATOM   3301 N N   . ARG A 1 433 ? 10.803  20.796  11.785  1.00 51.12  ? 433  ARG A N   1 
ATOM   3302 C CA  . ARG A 1 433 ? 11.698  21.930  11.968  1.00 51.04  ? 433  ARG A CA  1 
ATOM   3303 C C   . ARG A 1 433 ? 11.382  22.669  13.260  1.00 51.71  ? 433  ARG A C   1 
ATOM   3304 O O   . ARG A 1 433 ? 10.291  23.209  13.404  1.00 52.36  ? 433  ARG A O   1 
ATOM   3305 C CB  . ARG A 1 433 ? 11.535  22.897  10.802  1.00 51.26  ? 433  ARG A CB  1 
ATOM   3306 C CG  . ARG A 1 433 ? 12.538  24.003  10.812  1.00 50.70  ? 433  ARG A CG  1 
ATOM   3307 C CD  . ARG A 1 433 ? 12.357  24.944  9.655   1.00 51.89  ? 433  ARG A CD  1 
ATOM   3308 N NE  . ARG A 1 433 ? 12.914  26.249  9.980   1.00 51.34  ? 433  ARG A NE  1 
ATOM   3309 C CZ  . ARG A 1 433 ? 14.122  26.673  9.630   1.00 53.42  ? 433  ARG A CZ  1 
ATOM   3310 N NH1 . ARG A 1 433 ? 14.953  25.920  8.899   1.00 55.05  ? 433  ARG A NH1 1 
ATOM   3311 N NH2 . ARG A 1 433 ? 14.508  27.883  10.009  1.00 53.98  ? 433  ARG A NH2 1 
ATOM   3312 N N   . ALA A 1 434 ? 12.332  22.704  14.201  1.00 51.42  ? 434  ALA A N   1 
ATOM   3313 C CA  . ALA A 1 434 ? 12.119  23.427  15.461  1.00 51.88  ? 434  ALA A CA  1 
ATOM   3314 C C   . ALA A 1 434 ? 11.626  24.845  15.165  1.00 52.83  ? 434  ALA A C   1 
ATOM   3315 O O   . ALA A 1 434 ? 12.207  25.545  14.340  1.00 52.47  ? 434  ALA A O   1 
ATOM   3316 C CB  . ALA A 1 434 ? 13.388  23.492  16.270  1.00 50.86  ? 434  ALA A CB  1 
ATOM   3317 N N   . SER A 1 435 ? 10.572  25.260  15.859  1.00 54.11  ? 435  SER A N   1 
ATOM   3318 C CA  . SER A 1 435 ? 10.034  26.616  15.741  1.00 55.38  ? 435  SER A CA  1 
ATOM   3319 C C   . SER A 1 435 ? 11.037  27.715  16.148  1.00 55.64  ? 435  SER A C   1 
ATOM   3320 O O   . SER A 1 435 ? 10.887  28.871  15.766  1.00 56.85  ? 435  SER A O   1 
ATOM   3321 C CB  . SER A 1 435 ? 8.785   26.739  16.606  1.00 56.46  ? 435  SER A CB  1 
ATOM   3322 O OG  . SER A 1 435 ? 9.121   26.602  17.977  1.00 56.18  ? 435  SER A OG  1 
ATOM   3323 N N   . THR A 1 436 ? 12.039  27.349  16.935  1.00 55.44  ? 436  THR A N   1 
ATOM   3324 C CA  . THR A 1 436 ? 13.041  28.279  17.435  1.00 55.74  ? 436  THR A CA  1 
ATOM   3325 C C   . THR A 1 436 ? 14.376  28.200  16.672  1.00 55.01  ? 436  THR A C   1 
ATOM   3326 O O   . THR A 1 436 ? 15.364  28.800  17.099  1.00 55.22  ? 436  THR A O   1 
ATOM   3327 C CB  . THR A 1 436 ? 13.317  27.971  18.916  1.00 56.05  ? 436  THR A CB  1 
ATOM   3328 O OG1 . THR A 1 436 ? 13.722  26.601  19.047  1.00 54.69  ? 436  THR A OG1 1 
ATOM   3329 C CG2 . THR A 1 436 ? 12.061  28.205  19.755  1.00 58.28  ? 436  THR A CG2 1 
ATOM   3330 N N   . LEU A 1 437 ? 14.410  27.479  15.549  1.00 54.42  ? 437  LEU A N   1 
ATOM   3331 C CA  . LEU A 1 437 ? 15.654  27.258  14.792  1.00 53.36  ? 437  LEU A CA  1 
ATOM   3332 C C   . LEU A 1 437 ? 16.146  28.587  14.230  1.00 52.86  ? 437  LEU A C   1 
ATOM   3333 O O   . LEU A 1 437 ? 15.362  29.334  13.694  1.00 53.50  ? 437  LEU A O   1 
ATOM   3334 C CB  . LEU A 1 437 ? 15.389  26.232  13.664  1.00 53.63  ? 437  LEU A CB  1 
ATOM   3335 C CG  . LEU A 1 437 ? 16.484  25.412  12.945  1.00 52.84  ? 437  LEU A CG  1 
ATOM   3336 C CD1 . LEU A 1 437 ? 17.761  25.295  13.726  1.00 52.73  ? 437  LEU A CD1 1 
ATOM   3337 C CD2 . LEU A 1 437 ? 15.968  24.012  12.588  1.00 52.55  ? 437  LEU A CD2 1 
ATOM   3338 N N   . THR A 1 438 ? 17.433  28.900  14.382  1.00 51.77  ? 438  THR A N   1 
ATOM   3339 C CA  . THR A 1 438 ? 17.965  30.204  13.945  1.00 51.54  ? 438  THR A CA  1 
ATOM   3340 C C   . THR A 1 438 ? 18.597  30.164  12.546  1.00 51.13  ? 438  THR A C   1 
ATOM   3341 O O   . THR A 1 438 ? 18.924  31.210  11.971  1.00 51.18  ? 438  THR A O   1 
ATOM   3342 C CB  . THR A 1 438 ? 19.013  30.751  14.941  1.00 51.49  ? 438  THR A CB  1 
ATOM   3343 O OG1 . THR A 1 438 ? 20.063  29.782  15.129  1.00 49.70  ? 438  THR A OG1 1 
ATOM   3344 C CG2 . THR A 1 438 ? 18.355  31.059  16.288  1.00 51.29  ? 438  THR A CG2 1 
ATOM   3345 N N   . TRP A 1 439 ? 18.806  28.963  12.014  1.00 50.00  ? 439  TRP A N   1 
ATOM   3346 C CA  . TRP A 1 439 ? 19.262  28.805  10.633  1.00 49.82  ? 439  TRP A CA  1 
ATOM   3347 C C   . TRP A 1 439 ? 18.113  29.174  9.714   1.00 50.40  ? 439  TRP A C   1 
ATOM   3348 O O   . TRP A 1 439 ? 16.955  29.088  10.127  1.00 52.26  ? 439  TRP A O   1 
ATOM   3349 C CB  . TRP A 1 439 ? 19.681  27.367  10.355  1.00 48.57  ? 439  TRP A CB  1 
ATOM   3350 C CG  . TRP A 1 439 ? 20.922  26.926  11.054  1.00 47.35  ? 439  TRP A CG  1 
ATOM   3351 C CD1 . TRP A 1 439 ? 20.992  26.144  12.144  1.00 47.19  ? 439  TRP A CD1 1 
ATOM   3352 C CD2 . TRP A 1 439 ? 22.280  27.220  10.681  1.00 47.37  ? 439  TRP A CD2 1 
ATOM   3353 N NE1 . TRP A 1 439 ? 22.303  25.929  12.495  1.00 46.73  ? 439  TRP A NE1 1 
ATOM   3354 C CE2 . TRP A 1 439 ? 23.111  26.582  11.608  1.00 46.20  ? 439  TRP A CE2 1 
ATOM   3355 C CE3 . TRP A 1 439 ? 22.865  27.979  9.660   1.00 47.09  ? 439  TRP A CE3 1 
ATOM   3356 C CZ2 . TRP A 1 439 ? 24.503  26.661  11.547  1.00 46.56  ? 439  TRP A CZ2 1 
ATOM   3357 C CZ3 . TRP A 1 439 ? 24.236  28.051  9.589   1.00 47.08  ? 439  TRP A CZ3 1 
ATOM   3358 C CH2 . TRP A 1 439 ? 25.049  27.404  10.533  1.00 46.93  ? 439  TRP A CH2 1 
ATOM   3359 N N   . PRO A 1 440 ? 18.413  29.604  8.474   1.00 50.45  ? 440  PRO A N   1 
ATOM   3360 C CA  . PRO A 1 440 ? 17.363  30.040  7.557   1.00 51.09  ? 440  PRO A CA  1 
ATOM   3361 C C   . PRO A 1 440 ? 16.445  28.916  7.132   1.00 51.30  ? 440  PRO A C   1 
ATOM   3362 O O   . PRO A 1 440 ? 16.826  27.743  7.215   1.00 50.35  ? 440  PRO A O   1 
ATOM   3363 C CB  . PRO A 1 440 ? 18.148  30.541  6.339   1.00 51.26  ? 440  PRO A CB  1 
ATOM   3364 C CG  . PRO A 1 440 ? 19.412  29.845  6.391   1.00 49.99  ? 440  PRO A CG  1 
ATOM   3365 C CD  . PRO A 1 440 ? 19.740  29.731  7.850   1.00 50.03  ? 440  PRO A CD  1 
ATOM   3366 N N   . LEU A 1 441 ? 15.264  29.285  6.644   1.00 51.82  ? 441  LEU A N   1 
ATOM   3367 C CA  . LEU A 1 441 ? 14.252  28.319  6.238   1.00 52.32  ? 441  LEU A CA  1 
ATOM   3368 C C   . LEU A 1 441 ? 14.688  27.428  5.090   1.00 51.47  ? 441  LEU A C   1 
ATOM   3369 O O   . LEU A 1 441 ? 14.257  26.270  5.014   1.00 51.57  ? 441  LEU A O   1 
ATOM   3370 C CB  . LEU A 1 441 ? 12.965  29.024  5.827   1.00 53.51  ? 441  LEU A CB  1 
ATOM   3371 C CG  . LEU A 1 441 ? 12.174  29.731  6.925   1.00 56.34  ? 441  LEU A CG  1 
ATOM   3372 C CD1 . LEU A 1 441 ? 11.144  30.688  6.304   1.00 58.53  ? 441  LEU A CD1 1 
ATOM   3373 C CD2 . LEU A 1 441 ? 11.495  28.722  7.846   1.00 57.84  ? 441  LEU A CD2 1 
ATOM   3374 N N   . TRP A 1 442 ? 15.514  27.952  4.186   1.00 50.49  ? 442  TRP A N   1 
ATOM   3375 C CA  . TRP A 1 442 ? 15.931  27.157  3.037   1.00 50.19  ? 442  TRP A CA  1 
ATOM   3376 C C   . TRP A 1 442 ? 16.669  25.878  3.446   1.00 48.81  ? 442  TRP A C   1 
ATOM   3377 O O   . TRP A 1 442 ? 16.643  24.901  2.698   1.00 48.63  ? 442  TRP A O   1 
ATOM   3378 C CB  . TRP A 1 442 ? 16.736  27.973  2.007   1.00 50.34  ? 442  TRP A CB  1 
ATOM   3379 C CG  . TRP A 1 442 ? 18.152  28.343  2.357   1.00 49.59  ? 442  TRP A CG  1 
ATOM   3380 C CD1 . TRP A 1 442 ? 18.602  29.578  2.740   1.00 50.46  ? 442  TRP A CD1 1 
ATOM   3381 C CD2 . TRP A 1 442 ? 19.306  27.506  2.280   1.00 48.73  ? 442  TRP A CD2 1 
ATOM   3382 N NE1 . TRP A 1 442 ? 19.959  29.546  2.942   1.00 50.86  ? 442  TRP A NE1 1 
ATOM   3383 C CE2 . TRP A 1 442 ? 20.414  28.283  2.676   1.00 47.81  ? 442  TRP A CE2 1 
ATOM   3384 C CE3 . TRP A 1 442 ? 19.508  26.161  1.944   1.00 48.63  ? 442  TRP A CE3 1 
ATOM   3385 C CZ2 . TRP A 1 442 ? 21.691  27.775  2.733   1.00 48.21  ? 442  TRP A CZ2 1 
ATOM   3386 C CZ3 . TRP A 1 442 ? 20.790  25.650  2.000   1.00 47.85  ? 442  TRP A CZ3 1 
ATOM   3387 C CH2 . TRP A 1 442 ? 21.866  26.453  2.397   1.00 48.66  ? 442  TRP A CH2 1 
ATOM   3388 N N   . MET A 1 443 ? 17.287  25.877  4.629   1.00 48.14  ? 443  MET A N   1 
ATOM   3389 C CA  . MET A 1 443 ? 18.032  24.705  5.128   1.00 47.49  ? 443  MET A CA  1 
ATOM   3390 C C   . MET A 1 443 ? 17.142  23.572  5.659   1.00 47.28  ? 443  MET A C   1 
ATOM   3391 O O   . MET A 1 443 ? 17.642  22.487  5.974   1.00 46.46  ? 443  MET A O   1 
ATOM   3392 C CB  . MET A 1 443 ? 19.029  25.132  6.199   1.00 46.92  ? 443  MET A CB  1 
ATOM   3393 C CG  . MET A 1 443 ? 20.152  26.045  5.655   1.00 46.77  ? 443  MET A CG  1 
ATOM   3394 S SD  . MET A 1 443 ? 21.410  26.412  6.893   1.00 48.33  ? 443  MET A SD  1 
ATOM   3395 C CE  A MET A 1 443 ? 21.804  24.758  7.400   0.50 47.47  ? 443  MET A CE  1 
ATOM   3396 C CE  B MET A 1 443 ? 22.694  27.200  5.925   0.50 46.76  ? 443  MET A CE  1 
ATOM   3397 N N   . GLY A 1 444 ? 15.842  23.829  5.768   1.00 47.60  ? 444  GLY A N   1 
ATOM   3398 C CA  . GLY A 1 444 ? 14.887  22.824  6.217   1.00 48.21  ? 444  GLY A CA  1 
ATOM   3399 C C   . GLY A 1 444 ? 15.101  22.324  7.639   1.00 47.44  ? 444  GLY A C   1 
ATOM   3400 O O   . GLY A 1 444 ? 15.144  23.115  8.579   1.00 47.55  ? 444  GLY A O   1 
ATOM   3401 N N   . VAL A 1 445 ? 15.182  21.004  7.781   1.00 46.68  ? 445  VAL A N   1 
ATOM   3402 C CA  . VAL A 1 445 ? 15.455  20.341  9.055   1.00 46.30  ? 445  VAL A CA  1 
ATOM   3403 C C   . VAL A 1 445 ? 16.901  19.871  8.947   1.00 45.64  ? 445  VAL A C   1 
ATOM   3404 O O   . VAL A 1 445 ? 17.159  18.791  8.388   1.00 45.98  ? 445  VAL A O   1 
ATOM   3405 C CB  . VAL A 1 445 ? 14.512  19.130  9.302   1.00 46.55  ? 445  VAL A CB  1 
ATOM   3406 C CG1 . VAL A 1 445 ? 14.769  18.524  10.696  1.00 45.43  ? 445  VAL A CG1 1 
ATOM   3407 C CG2 . VAL A 1 445 ? 13.052  19.535  9.133   1.00 47.64  ? 445  VAL A CG2 1 
ATOM   3408 N N   . PRO A 1 446 ? 17.847  20.699  9.420   1.00 44.80  ? 446  PRO A N   1 
ATOM   3409 C CA  . PRO A 1 446 ? 19.253  20.413  9.231   1.00 44.37  ? 446  PRO A CA  1 
ATOM   3410 C C   . PRO A 1 446 ? 19.813  19.339  10.153  1.00 44.37  ? 446  PRO A C   1 
ATOM   3411 O O   . PRO A 1 446 ? 19.222  18.989  11.186  1.00 44.83  ? 446  PRO A O   1 
ATOM   3412 C CB  . PRO A 1 446 ? 19.929  21.779  9.514   1.00 44.17  ? 446  PRO A CB  1 
ATOM   3413 C CG  . PRO A 1 446 ? 18.801  22.777  9.551   1.00 44.98  ? 446  PRO A CG  1 
ATOM   3414 C CD  . PRO A 1 446 ? 17.680  21.991  10.107  1.00 45.26  ? 446  PRO A CD  1 
ATOM   3415 N N   . HIS A 1 447 ? 20.955  18.820  9.733   1.00 44.35  ? 447  HIS A N   1 
ATOM   3416 C CA  . HIS A 1 447 ? 21.739  17.835  10.466  1.00 43.49  ? 447  HIS A CA  1 
ATOM   3417 C C   . HIS A 1 447 ? 21.910  18.304  11.914  1.00 43.39  ? 447  HIS A C   1 
ATOM   3418 O O   . HIS A 1 447 ? 22.413  19.390  12.161  1.00 42.64  ? 447  HIS A O   1 
ATOM   3419 C CB  . HIS A 1 447 ? 23.083  17.770  9.748   1.00 43.73  ? 447  HIS A CB  1 
ATOM   3420 C CG  . HIS A 1 447 ? 24.017  16.705  10.221  1.00 42.96  ? 447  HIS A CG  1 
ATOM   3421 N ND1 . HIS A 1 447 ? 23.784  15.363  10.014  1.00 45.34  ? 447  HIS A ND1 1 
ATOM   3422 C CD2 . HIS A 1 447 ? 25.262  16.796  10.748  1.00 43.75  ? 447  HIS A CD2 1 
ATOM   3423 C CE1 . HIS A 1 447 ? 24.818  14.668  10.460  1.00 43.87  ? 447  HIS A CE1 1 
ATOM   3424 N NE2 . HIS A 1 447 ? 25.732  15.516  10.900  1.00 44.05  ? 447  HIS A NE2 1 
ATOM   3425 N N   . GLY A 1 448 ? 21.460  17.488  12.863  1.00 43.59  ? 448  GLY A N   1 
ATOM   3426 C CA  . GLY A 1 448 ? 21.595  17.792  14.293  1.00 43.78  ? 448  GLY A CA  1 
ATOM   3427 C C   . GLY A 1 448 ? 20.346  18.275  15.008  1.00 43.64  ? 448  GLY A C   1 
ATOM   3428 O O   . GLY A 1 448 ? 20.310  18.305  16.243  1.00 43.76  ? 448  GLY A O   1 
ATOM   3429 N N   . TYR A 1 449 ? 19.308  18.638  14.260  1.00 43.59  ? 449  TYR A N   1 
ATOM   3430 C CA  . TYR A 1 449 ? 18.180  19.386  14.853  1.00 44.38  ? 449  TYR A CA  1 
ATOM   3431 C C   . TYR A 1 449 ? 16.987  18.525  15.288  1.00 44.41  ? 449  TYR A C   1 
ATOM   3432 O O   . TYR A 1 449 ? 15.914  19.035  15.600  1.00 44.26  ? 449  TYR A O   1 
ATOM   3433 C CB  . TYR A 1 449 ? 17.815  20.599  13.977  1.00 45.01  ? 449  TYR A CB  1 
ATOM   3434 C CG  . TYR A 1 449 ? 18.906  21.652  14.149  1.00 45.33  ? 449  TYR A CG  1 
ATOM   3435 C CD1 . TYR A 1 449 ? 20.025  21.677  13.330  1.00 46.17  ? 449  TYR A CD1 1 
ATOM   3436 C CD2 . TYR A 1 449 ? 18.859  22.553  15.201  1.00 46.05  ? 449  TYR A CD2 1 
ATOM   3437 C CE1 . TYR A 1 449 ? 21.058  22.602  13.537  1.00 45.41  ? 449  TYR A CE1 1 
ATOM   3438 C CE2 . TYR A 1 449 ? 19.889  23.471  15.416  1.00 46.61  ? 449  TYR A CE2 1 
ATOM   3439 C CZ  . TYR A 1 449 ? 20.976  23.485  14.584  1.00 45.39  ? 449  TYR A CZ  1 
ATOM   3440 O OH  . TYR A 1 449 ? 21.973  24.414  14.818  1.00 47.79  ? 449  TYR A OH  1 
ATOM   3441 N N   . GLU A 1 450 ? 17.221  17.217  15.352  1.00 43.91  ? 450  GLU A N   1 
ATOM   3442 C CA  . GLU A 1 450 ? 16.335  16.280  16.045  1.00 44.25  ? 450  GLU A CA  1 
ATOM   3443 C C   . GLU A 1 450 ? 16.750  16.074  17.516  1.00 44.54  ? 450  GLU A C   1 
ATOM   3444 O O   . GLU A 1 450 ? 15.932  15.728  18.344  1.00 45.03  ? 450  GLU A O   1 
ATOM   3445 C CB  . GLU A 1 450 ? 16.324  14.935  15.327  1.00 44.51  ? 450  GLU A CB  1 
ATOM   3446 C CG  . GLU A 1 450 ? 17.390  13.920  15.762  1.00 43.92  ? 450  GLU A CG  1 
ATOM   3447 C CD  . GLU A 1 450 ? 18.766  14.171  15.157  1.00 45.63  ? 450  GLU A CD  1 
ATOM   3448 O OE1 . GLU A 1 450 ? 19.060  15.318  14.743  1.00 46.67  ? 450  GLU A OE1 1 
ATOM   3449 O OE2 . GLU A 1 450 ? 19.570  13.206  15.084  1.00 44.51  ? 450  GLU A OE2 1 
ATOM   3450 N N   . ILE A 1 451 ? 18.030  16.288  17.819  1.00 44.39  ? 451  ILE A N   1 
ATOM   3451 C CA  . ILE A 1 451 ? 18.607  15.923  19.103  1.00 44.20  ? 451  ILE A CA  1 
ATOM   3452 C C   . ILE A 1 451 ? 17.866  16.601  20.274  1.00 44.99  ? 451  ILE A C   1 
ATOM   3453 O O   . ILE A 1 451 ? 17.464  15.929  21.241  1.00 44.49  ? 451  ILE A O   1 
ATOM   3454 C CB  . ILE A 1 451 ? 20.110  16.283  19.157  1.00 44.05  ? 451  ILE A CB  1 
ATOM   3455 C CG1 . ILE A 1 451 ? 20.902  15.482  18.112  1.00 42.63  ? 451  ILE A CG1 1 
ATOM   3456 C CG2 . ILE A 1 451 ? 20.688  16.016  20.566  1.00 44.37  ? 451  ILE A CG2 1 
ATOM   3457 C CD1 . ILE A 1 451 ? 22.308  15.992  17.894  1.00 41.60  ? 451  ILE A CD1 1 
ATOM   3458 N N   . GLU A 1 452 ? 17.692  17.917  20.177  1.00 45.06  ? 452  GLU A N   1 
ATOM   3459 C CA  . GLU A 1 452 ? 16.977  18.682  21.211  1.00 46.24  ? 452  GLU A CA  1 
ATOM   3460 C C   . GLU A 1 452 ? 15.579  18.130  21.491  1.00 46.65  ? 452  GLU A C   1 
ATOM   3461 O O   . GLU A 1 452 ? 15.082  18.285  22.593  1.00 47.97  ? 452  GLU A O   1 
ATOM   3462 C CB  . GLU A 1 452 ? 16.894  20.167  20.856  1.00 46.32  ? 452  GLU A CB  1 
ATOM   3463 C CG  . GLU A 1 452 ? 16.108  20.498  19.581  1.00 47.56  ? 452  GLU A CG  1 
ATOM   3464 C CD  . GLU A 1 452 ? 16.522  21.835  18.982  1.00 47.40  ? 452  GLU A CD  1 
ATOM   3465 O OE1 . GLU A 1 452 ? 15.709  22.770  18.999  1.00 50.11  ? 452  GLU A OE1 1 
ATOM   3466 O OE2 . GLU A 1 452 ? 17.665  21.961  18.507  1.00 46.25  ? 452  GLU A OE2 1 
ATOM   3467 N N   . PHE A 1 453 ? 14.960  17.468  20.516  1.00 46.64  ? 453  PHE A N   1 
ATOM   3468 C CA  . PHE A 1 453 ? 13.668  16.799  20.767  1.00 47.62  ? 453  PHE A CA  1 
ATOM   3469 C C   . PHE A 1 453 ? 13.777  15.433  21.465  1.00 47.37  ? 453  PHE A C   1 
ATOM   3470 O O   . PHE A 1 453 ? 12.963  15.111  22.330  1.00 48.09  ? 453  PHE A O   1 
ATOM   3471 C CB  . PHE A 1 453 ? 12.877  16.676  19.465  1.00 48.15  ? 453  PHE A CB  1 
ATOM   3472 C CG  . PHE A 1 453 ? 12.409  17.989  18.947  1.00 48.46  ? 453  PHE A CG  1 
ATOM   3473 C CD1 . PHE A 1 453 ? 11.222  18.527  19.385  1.00 49.63  ? 453  PHE A CD1 1 
ATOM   3474 C CD2 . PHE A 1 453 ? 13.189  18.716  18.057  1.00 48.66  ? 453  PHE A CD2 1 
ATOM   3475 C CE1 . PHE A 1 453 ? 10.807  19.772  18.932  1.00 50.62  ? 453  PHE A CE1 1 
ATOM   3476 C CE2 . PHE A 1 453 ? 12.759  19.949  17.589  1.00 49.14  ? 453  PHE A CE2 1 
ATOM   3477 C CZ  . PHE A 1 453 ? 11.577  20.476  18.041  1.00 49.84  ? 453  PHE A CZ  1 
ATOM   3478 N N   . ILE A 1 454 ? 14.774  14.639  21.097  1.00 46.01  ? 454  ILE A N   1 
ATOM   3479 C CA  . ILE A 1 454 ? 14.977  13.328  21.714  1.00 45.79  ? 454  ILE A CA  1 
ATOM   3480 C C   . ILE A 1 454 ? 15.322  13.511  23.194  1.00 45.93  ? 454  ILE A C   1 
ATOM   3481 O O   . ILE A 1 454 ? 14.887  12.727  24.035  1.00 46.81  ? 454  ILE A O   1 
ATOM   3482 C CB  . ILE A 1 454 ? 16.138  12.536  21.046  1.00 45.18  ? 454  ILE A CB  1 
ATOM   3483 C CG1 . ILE A 1 454 ? 15.945  12.392  19.524  1.00 45.51  ? 454  ILE A CG1 1 
ATOM   3484 C CG2 . ILE A 1 454 ? 16.324  11.169  21.697  1.00 44.20  ? 454  ILE A CG2 1 
ATOM   3485 C CD1 . ILE A 1 454 ? 14.807  11.587  19.152  1.00 48.58  ? 454  ILE A CD1 1 
ATOM   3486 N N   . PHE A 1 455 ? 16.119  14.534  23.503  1.00 45.10  ? 455  PHE A N   1 
ATOM   3487 C CA  . PHE A 1 455 ? 16.534  14.814  24.875  1.00 44.99  ? 455  PHE A CA  1 
ATOM   3488 C C   . PHE A 1 455 ? 15.476  15.561  25.693  1.00 46.36  ? 455  PHE A C   1 
ATOM   3489 O O   . PHE A 1 455 ? 15.632  15.707  26.913  1.00 47.12  ? 455  PHE A O   1 
ATOM   3490 C CB  . PHE A 1 455 ? 17.867  15.587  24.902  1.00 43.77  ? 455  PHE A CB  1 
ATOM   3491 C CG  . PHE A 1 455 ? 19.093  14.707  24.841  1.00 43.15  ? 455  PHE A CG  1 
ATOM   3492 C CD1 . PHE A 1 455 ? 19.596  14.266  23.623  1.00 43.39  ? 455  PHE A CD1 1 
ATOM   3493 C CD2 . PHE A 1 455 ? 19.770  14.348  26.000  1.00 43.48  ? 455  PHE A CD2 1 
ATOM   3494 C CE1 . PHE A 1 455 ? 20.754  13.453  23.564  1.00 41.90  ? 455  PHE A CE1 1 
ATOM   3495 C CE2 . PHE A 1 455 ? 20.935  13.548  25.939  1.00 41.47  ? 455  PHE A CE2 1 
ATOM   3496 C CZ  . PHE A 1 455 ? 21.407  13.105  24.721  1.00 40.46  ? 455  PHE A CZ  1 
ATOM   3497 N N   . GLY A 1 456 ? 14.412  16.028  25.043  1.00 47.22  ? 456  GLY A N   1 
ATOM   3498 C CA  . GLY A 1 456 ? 13.244  16.570  25.744  1.00 48.24  ? 456  GLY A CA  1 
ATOM   3499 C C   . GLY A 1 456 ? 13.333  18.026  26.170  1.00 48.73  ? 456  GLY A C   1 
ATOM   3500 O O   . GLY A 1 456 ? 12.595  18.471  27.054  1.00 49.59  ? 456  GLY A O   1 
ATOM   3501 N N   . LEU A 1 457 ? 14.187  18.798  25.516  1.00 48.09  ? 457  LEU A N   1 
ATOM   3502 C CA  . LEU A 1 457 ? 14.309  20.218  25.840  1.00 48.73  ? 457  LEU A CA  1 
ATOM   3503 C C   . LEU A 1 457 ? 13.001  21.000  25.769  1.00 49.89  ? 457  LEU A C   1 
ATOM   3504 O O   . LEU A 1 457 ? 12.790  21.875  26.601  1.00 50.98  ? 457  LEU A O   1 
ATOM   3505 C CB  . LEU A 1 457 ? 15.363  20.911  24.974  1.00 47.69  ? 457  LEU A CB  1 
ATOM   3506 C CG  . LEU A 1 457 ? 16.783  20.863  25.571  1.00 48.02  ? 457  LEU A CG  1 
ATOM   3507 C CD1 . LEU A 1 457 ? 17.271  19.421  25.646  1.00 45.07  ? 457  LEU A CD1 1 
ATOM   3508 C CD2 . LEU A 1 457 ? 17.754  21.751  24.798  1.00 45.65  ? 457  LEU A CD2 1 
ATOM   3509 N N   . PRO A 1 458 ? 12.138  20.729  24.768  1.00 50.58  ? 458  PRO A N   1 
ATOM   3510 C CA  . PRO A 1 458 ? 10.817  21.415  24.740  1.00 52.37  ? 458  PRO A CA  1 
ATOM   3511 C C   . PRO A 1 458 ? 9.967   21.300  26.000  1.00 54.35  ? 458  PRO A C   1 
ATOM   3512 O O   . PRO A 1 458 ? 9.003   22.071  26.154  1.00 56.09  ? 458  PRO A O   1 
ATOM   3513 C CB  . PRO A 1 458 ? 10.108  20.760  23.549  1.00 51.95  ? 458  PRO A CB  1 
ATOM   3514 C CG  . PRO A 1 458 ? 11.239  20.374  22.636  1.00 50.79  ? 458  PRO A CG  1 
ATOM   3515 C CD  . PRO A 1 458 ? 12.313  19.880  23.580  1.00 49.92  ? 458  PRO A CD  1 
ATOM   3516 N N   . LEU A 1 459 ? 10.298  20.350  26.882  1.00 55.06  ? 459  LEU A N   1 
ATOM   3517 C CA  . LEU A 1 459 ? 9.599   20.214  28.160  1.00 56.92  ? 459  LEU A CA  1 
ATOM   3518 C C   . LEU A 1 459 ? 9.890   21.373  29.103  1.00 57.89  ? 459  LEU A C   1 
ATOM   3519 O O   . LEU A 1 459 ? 9.178   21.557  30.085  1.00 58.94  ? 459  LEU A O   1 
ATOM   3520 C CB  . LEU A 1 459 ? 9.933   18.886  28.845  1.00 56.60  ? 459  LEU A CB  1 
ATOM   3521 C CG  . LEU A 1 459 ? 9.092   17.686  28.376  1.00 57.66  ? 459  LEU A CG  1 
ATOM   3522 C CD1 . LEU A 1 459 ? 9.222   17.450  26.874  1.00 57.65  ? 459  LEU A CD1 1 
ATOM   3523 C CD2 . LEU A 1 459 ? 9.523   16.461  29.129  1.00 57.46  ? 459  LEU A CD2 1 
ATOM   3524 N N   . ASP A 1 460 ? 10.936  22.140  28.806  1.00 58.20  ? 460  ASP A N   1 
ATOM   3525 C CA  . ASP A 1 460 ? 11.297  23.290  29.609  1.00 59.70  ? 460  ASP A CA  1 
ATOM   3526 C C   . ASP A 1 460 ? 10.581  24.501  29.050  1.00 61.28  ? 460  ASP A C   1 
ATOM   3527 O O   . ASP A 1 460 ? 10.906  24.958  27.956  1.00 60.85  ? 460  ASP A O   1 
ATOM   3528 C CB  . ASP A 1 460 ? 12.815  23.519  29.592  1.00 59.17  ? 460  ASP A CB  1 
ATOM   3529 C CG  . ASP A 1 460 ? 13.231  24.712  30.427  1.00 60.29  ? 460  ASP A CG  1 
ATOM   3530 O OD1 . ASP A 1 460 ? 12.342  25.437  30.914  1.00 65.00  ? 460  ASP A OD1 1 
ATOM   3531 O OD2 . ASP A 1 460 ? 14.440  24.933  30.600  1.00 60.83  ? 460  ASP A OD2 1 
ATOM   3532 N N   . PRO A 1 461 ? 9.616   25.045  29.808  1.00 63.56  ? 461  PRO A N   1 
ATOM   3533 C CA  . PRO A 1 461 ? 8.820   26.145  29.261  1.00 65.03  ? 461  PRO A CA  1 
ATOM   3534 C C   . PRO A 1 461 ? 9.639   27.401  28.964  1.00 65.22  ? 461  PRO A C   1 
ATOM   3535 O O   . PRO A 1 461 ? 9.290   28.156  28.056  1.00 65.84  ? 461  PRO A O   1 
ATOM   3536 C CB  . PRO A 1 461 ? 7.779   26.415  30.353  1.00 66.68  ? 461  PRO A CB  1 
ATOM   3537 C CG  . PRO A 1 461 ? 7.820   25.207  31.259  1.00 66.66  ? 461  PRO A CG  1 
ATOM   3538 C CD  . PRO A 1 461 ? 9.218   24.706  31.186  1.00 64.58  ? 461  PRO A CD  1 
ATOM   3539 N N   . SER A 1 462 ? 10.734  27.604  29.689  1.00 65.00  ? 462  SER A N   1 
ATOM   3540 C CA  . SER A 1 462 ? 11.566  28.790  29.497  1.00 65.26  ? 462  SER A CA  1 
ATOM   3541 C C   . SER A 1 462 ? 12.223  28.857  28.109  1.00 64.36  ? 462  SER A C   1 
ATOM   3542 O O   . SER A 1 462 ? 12.705  29.918  27.709  1.00 65.02  ? 462  SER A O   1 
ATOM   3543 C CB  . SER A 1 462 ? 12.643  28.869  30.584  1.00 65.25  ? 462  SER A CB  1 
ATOM   3544 O OG  . SER A 1 462 ? 13.691  27.950  30.318  1.00 64.41  ? 462  SER A OG  1 
ATOM   3545 N N   . LEU A 1 463 ? 12.233  27.737  27.379  1.00 63.30  ? 463  LEU A N   1 
ATOM   3546 C CA  . LEU A 1 463 ? 12.838  27.671  26.044  1.00 61.88  ? 463  LEU A CA  1 
ATOM   3547 C C   . LEU A 1 463 ? 11.909  28.043  24.883  1.00 61.80  ? 463  LEU A C   1 
ATOM   3548 O O   . LEU A 1 463 ? 12.349  28.090  23.739  1.00 61.28  ? 463  LEU A O   1 
ATOM   3549 C CB  . LEU A 1 463 ? 13.422  26.275  25.797  1.00 60.47  ? 463  LEU A CB  1 
ATOM   3550 C CG  . LEU A 1 463 ? 14.510  25.798  26.765  1.00 60.16  ? 463  LEU A CG  1 
ATOM   3551 C CD1 . LEU A 1 463 ? 14.996  24.417  26.338  1.00 56.01  ? 463  LEU A CD1 1 
ATOM   3552 C CD2 . LEU A 1 463 ? 15.683  26.804  26.861  1.00 59.28  ? 463  LEU A CD2 1 
ATOM   3553 N N   . ASN A 1 464 ? 10.635  28.291  25.151  1.00 62.81  ? 464  ASN A N   1 
ATOM   3554 C CA  . ASN A 1 464 ? 9.743   28.879  24.133  1.00 63.48  ? 464  ASN A CA  1 
ATOM   3555 C C   . ASN A 1 464 ? 9.366   27.965  22.952  1.00 61.57  ? 464  ASN A C   1 
ATOM   3556 O O   . ASN A 1 464 ? 8.981   28.458  21.895  1.00 61.33  ? 464  ASN A O   1 
ATOM   3557 C CB  . ASN A 1 464 ? 10.322  30.199  23.562  1.00 64.34  ? 464  ASN A CB  1 
ATOM   3558 C CG  . ASN A 1 464 ? 10.505  31.287  24.617  1.00 69.00  ? 464  ASN A CG  1 
ATOM   3559 O OD1 . ASN A 1 464 ? 9.805   31.313  25.637  1.00 70.61  ? 464  ASN A OD1 1 
ATOM   3560 N ND2 . ASN A 1 464 ? 11.449  32.207  24.353  1.00 77.04  ? 464  ASN A ND2 1 
ATOM   3561 N N   . TYR A 1 465 ? 9.466   26.647  23.109  1.00 59.66  ? 465  TYR A N   1 
ATOM   3562 C CA  . TYR A 1 465 ? 8.903   25.755  22.098  1.00 58.35  ? 465  TYR A CA  1 
ATOM   3563 C C   . TYR A 1 465 ? 7.390   25.827  22.226  1.00 59.13  ? 465  TYR A C   1 
ATOM   3564 O O   . TYR A 1 465 ? 6.881   26.330  23.220  1.00 60.17  ? 465  TYR A O   1 
ATOM   3565 C CB  . TYR A 1 465 ? 9.367   24.311  22.282  1.00 57.27  ? 465  TYR A CB  1 
ATOM   3566 C CG  . TYR A 1 465 ? 10.842  24.049  22.049  1.00 55.00  ? 465  TYR A CG  1 
ATOM   3567 C CD1 . TYR A 1 465 ? 11.304  23.648  20.803  1.00 54.56  ? 465  TYR A CD1 1 
ATOM   3568 C CD2 . TYR A 1 465 ? 11.764  24.168  23.081  1.00 54.64  ? 465  TYR A CD2 1 
ATOM   3569 C CE1 . TYR A 1 465 ? 12.643  23.377  20.586  1.00 53.49  ? 465  TYR A CE1 1 
ATOM   3570 C CE2 . TYR A 1 465 ? 13.111  23.904  22.880  1.00 54.40  ? 465  TYR A CE2 1 
ATOM   3571 C CZ  . TYR A 1 465 ? 13.546  23.506  21.633  1.00 53.59  ? 465  TYR A CZ  1 
ATOM   3572 O OH  . TYR A 1 465 ? 14.877  23.250  21.423  1.00 52.41  ? 465  TYR A OH  1 
ATOM   3573 N N   . THR A 1 466 ? 6.672   25.336  21.220  1.00 58.84  ? 466  THR A N   1 
ATOM   3574 C CA  . THR A 1 466 ? 5.212   25.301  21.263  1.00 59.88  ? 466  THR A CA  1 
ATOM   3575 C C   . THR A 1 466 ? 4.724   24.105  22.071  1.00 60.26  ? 466  THR A C   1 
ATOM   3576 O O   . THR A 1 466 ? 5.487   23.180  22.373  1.00 59.07  ? 466  THR A O   1 
ATOM   3577 C CB  . THR A 1 466 ? 4.600   25.161  19.862  1.00 60.16  ? 466  THR A CB  1 
ATOM   3578 O OG1 . THR A 1 466 ? 4.957   23.878  19.325  1.00 57.50  ? 466  THR A OG1 1 
ATOM   3579 C CG2 . THR A 1 466 ? 5.069   26.283  18.936  1.00 58.69  ? 466  THR A CG2 1 
ATOM   3580 N N   . THR A 1 467 ? 3.439   24.131  22.397  1.00 61.63  ? 467  THR A N   1 
ATOM   3581 C CA  . THR A 1 467 ? 2.768   23.044  23.101  1.00 62.65  ? 467  THR A CA  1 
ATOM   3582 C C   . THR A 1 467 ? 2.830   21.741  22.316  1.00 62.52  ? 467  THR A C   1 
ATOM   3583 O O   . THR A 1 467 ? 3.072   20.669  22.886  1.00 61.89  ? 467  THR A O   1 
ATOM   3584 C CB  . THR A 1 467 ? 1.288   23.422  23.391  1.00 64.42  ? 467  THR A CB  1 
ATOM   3585 O OG1 . THR A 1 467 ? 1.269   24.433  24.398  1.00 64.44  ? 467  THR A OG1 1 
ATOM   3586 C CG2 . THR A 1 467 ? 0.481   22.218  23.881  1.00 64.75  ? 467  THR A CG2 1 
ATOM   3587 N N   . GLU A 1 468 ? 2.630   21.852  21.005  1.00 63.04  ? 468  GLU A N   1 
ATOM   3588 C CA  . GLU A 1 468 ? 2.685   20.701  20.108  1.00 63.28  ? 468  GLU A CA  1 
ATOM   3589 C C   . GLU A 1 468 ? 4.104   20.139  20.082  1.00 61.05  ? 468  GLU A C   1 
ATOM   3590 O O   . GLU A 1 468 ? 4.298   18.928  20.012  1.00 60.42  ? 468  GLU A O   1 
ATOM   3591 C CB  . GLU A 1 468 ? 2.226   21.084  18.695  1.00 64.24  ? 468  GLU A CB  1 
ATOM   3592 C CG  . GLU A 1 468 ? 0.906   21.885  18.646  1.00 69.77  ? 468  GLU A CG  1 
ATOM   3593 C CD  . GLU A 1 468 ? 1.119   23.420  18.602  1.00 75.07  ? 468  GLU A CD  1 
ATOM   3594 O OE1 . GLU A 1 468 ? 0.825   24.108  19.623  1.00 76.40  ? 468  GLU A OE1 1 
ATOM   3595 O OE2 . GLU A 1 468 ? 1.587   23.926  17.539  1.00 79.04  ? 468  GLU A OE2 1 
ATOM   3596 N N   . GLU A 1 469 ? 5.091   21.027  20.161  1.00 59.68  ? 469  GLU A N   1 
ATOM   3597 C CA  . GLU A 1 469 ? 6.489   20.615  20.213  1.00 57.80  ? 469  GLU A CA  1 
ATOM   3598 C C   . GLU A 1 469 ? 6.817   19.848  21.507  1.00 57.61  ? 469  GLU A C   1 
ATOM   3599 O O   . GLU A 1 469 ? 7.532   18.842  21.479  1.00 56.35  ? 469  GLU A O   1 
ATOM   3600 C CB  . GLU A 1 469 ? 7.406   21.827  20.012  1.00 57.02  ? 469  GLU A CB  1 
ATOM   3601 C CG  . GLU A 1 469 ? 7.519   22.216  18.546  1.00 56.27  ? 469  GLU A CG  1 
ATOM   3602 C CD  . GLU A 1 469 ? 8.437   23.394  18.295  1.00 56.01  ? 469  GLU A CD  1 
ATOM   3603 O OE1 . GLU A 1 469 ? 8.411   24.375  19.061  1.00 54.29  ? 469  GLU A OE1 1 
ATOM   3604 O OE2 . GLU A 1 469 ? 9.198   23.337  17.319  1.00 55.14  ? 469  GLU A OE2 1 
ATOM   3605 N N   . ARG A 1 470 ? 6.257   20.309  22.621  1.00 58.67  ? 470  ARG A N   1 
ATOM   3606 C CA  . ARG A 1 470 ? 6.332   19.597  23.902  1.00 58.93  ? 470  ARG A CA  1 
ATOM   3607 C C   . ARG A 1 470 ? 5.748   18.173  23.823  1.00 58.57  ? 470  ARG A C   1 
ATOM   3608 O O   . ARG A 1 470 ? 6.394   17.213  24.249  1.00 56.71  ? 470  ARG A O   1 
ATOM   3609 C CB  . ARG A 1 470 ? 5.621   20.406  25.001  1.00 60.90  ? 470  ARG A CB  1 
ATOM   3610 C CG  . ARG A 1 470 ? 6.121   20.112  26.440  1.00 64.15  ? 470  ARG A CG  1 
ATOM   3611 C CD  . ARG A 1 470 ? 5.096   19.374  27.290  1.00 69.60  ? 470  ARG A CD  1 
ATOM   3612 N NE  . ARG A 1 470 ? 3.856   20.149  27.360  1.00 72.82  ? 470  ARG A NE  1 
ATOM   3613 C CZ  . ARG A 1 470 ? 2.626   19.643  27.445  1.00 75.22  ? 470  ARG A CZ  1 
ATOM   3614 N NH1 . ARG A 1 470 ? 2.419   18.327  27.506  1.00 75.08  ? 470  ARG A NH1 1 
ATOM   3615 N NH2 . ARG A 1 470 ? 1.584   20.475  27.476  1.00 77.08  ? 470  ARG A NH2 1 
ATOM   3616 N N   . ILE A 1 471 ? 4.535   18.047  23.283  1.00 59.13  ? 471  ILE A N   1 
ATOM   3617 C CA  . ILE A 1 471 ? 3.886   16.734  23.100  1.00 59.68  ? 471  ILE A CA  1 
ATOM   3618 C C   . ILE A 1 471 ? 4.707   15.833  22.173  1.00 57.81  ? 471  ILE A C   1 
ATOM   3619 O O   . ILE A 1 471 ? 4.850   14.640  22.421  1.00 57.33  ? 471  ILE A O   1 
ATOM   3620 C CB  . ILE A 1 471 ? 2.431   16.884  22.545  1.00 61.44  ? 471  ILE A CB  1 
ATOM   3621 C CG1 . ILE A 1 471 ? 1.545   17.628  23.544  1.00 64.21  ? 471  ILE A CG1 1 
ATOM   3622 C CG2 . ILE A 1 471 ? 1.788   15.513  22.223  1.00 61.79  ? 471  ILE A CG2 1 
ATOM   3623 C CD1 . ILE A 1 471 ? 1.400   16.913  24.877  1.00 67.27  ? 471  ILE A CD1 1 
ATOM   3624 N N   . PHE A 1 472 ? 5.272   16.429  21.124  1.00 56.72  ? 472  PHE A N   1 
ATOM   3625 C CA  . PHE A 1 472 ? 6.121   15.724  20.169  1.00 55.29  ? 472  PHE A CA  1 
ATOM   3626 C C   . PHE A 1 472 ? 7.374   15.183  20.855  1.00 54.20  ? 472  PHE A C   1 
ATOM   3627 O O   . PHE A 1 472 ? 7.691   14.005  20.718  1.00 54.26  ? 472  PHE A O   1 
ATOM   3628 C CB  . PHE A 1 472 ? 6.472   16.672  19.012  1.00 55.02  ? 472  PHE A CB  1 
ATOM   3629 C CG  . PHE A 1 472 ? 7.327   16.059  17.939  1.00 53.50  ? 472  PHE A CG  1 
ATOM   3630 C CD1 . PHE A 1 472 ? 7.020   14.818  17.403  1.00 54.02  ? 472  PHE A CD1 1 
ATOM   3631 C CD2 . PHE A 1 472 ? 8.430   16.746  17.446  1.00 53.13  ? 472  PHE A CD2 1 
ATOM   3632 C CE1 . PHE A 1 472 ? 7.820   14.261  16.408  1.00 53.76  ? 472  PHE A CE1 1 
ATOM   3633 C CE2 . PHE A 1 472 ? 9.222   16.207  16.457  1.00 51.92  ? 472  PHE A CE2 1 
ATOM   3634 C CZ  . PHE A 1 472 ? 8.916   14.958  15.935  1.00 52.96  ? 472  PHE A CZ  1 
ATOM   3635 N N   . ALA A 1 473 ? 8.067   16.028  21.615  1.00 53.38  ? 473  ALA A N   1 
ATOM   3636 C CA  . ALA A 1 473 ? 9.214   15.578  22.412  1.00 52.76  ? 473  ALA A CA  1 
ATOM   3637 C C   . ALA A 1 473 ? 8.867   14.388  23.332  1.00 53.05  ? 473  ALA A C   1 
ATOM   3638 O O   . ALA A 1 473 ? 9.605   13.402  23.404  1.00 52.01  ? 473  ALA A O   1 
ATOM   3639 C CB  . ALA A 1 473 ? 9.773   16.731  23.230  1.00 52.28  ? 473  ALA A CB  1 
ATOM   3640 N N   . GLN A 1 474 ? 7.740   14.479  24.024  1.00 54.10  ? 474  GLN A N   1 
ATOM   3641 C CA  . GLN A 1 474 ? 7.316   13.408  24.914  1.00 55.01  ? 474  GLN A CA  1 
ATOM   3642 C C   . GLN A 1 474 ? 7.141   12.080  24.187  1.00 54.44  ? 474  GLN A C   1 
ATOM   3643 O O   . GLN A 1 474 ? 7.504   11.047  24.730  1.00 54.46  ? 474  GLN A O   1 
ATOM   3644 C CB  . GLN A 1 474 ? 6.016   13.777  25.629  1.00 56.58  ? 474  GLN A CB  1 
ATOM   3645 C CG  . GLN A 1 474 ? 6.173   14.838  26.679  1.00 57.37  ? 474  GLN A CG  1 
ATOM   3646 C CD  . GLN A 1 474 ? 4.870   15.140  27.351  1.00 59.67  ? 474  GLN A CD  1 
ATOM   3647 O OE1 . GLN A 1 474 ? 4.059   15.916  26.843  1.00 64.60  ? 474  GLN A OE1 1 
ATOM   3648 N NE2 . GLN A 1 474 ? 4.637   14.504  28.489  1.00 62.57  ? 474  GLN A NE2 1 
ATOM   3649 N N   . ARG A 1 475 ? 6.579   12.096  22.980  1.00 54.74  ? 475  ARG A N   1 
ATOM   3650 C CA  . ARG A 1 475 ? 6.477   10.867  22.161  1.00 55.44  ? 475  ARG A CA  1 
ATOM   3651 C C   . ARG A 1 475 ? 7.853   10.288  21.808  1.00 54.22  ? 475  ARG A C   1 
ATOM   3652 O O   . ARG A 1 475 ? 8.058   9.079   21.889  1.00 53.95  ? 475  ARG A O   1 
ATOM   3653 C CB  . ARG A 1 475 ? 5.759   11.135  20.839  1.00 55.94  ? 475  ARG A CB  1 
ATOM   3654 C CG  . ARG A 1 475 ? 4.258   11.139  20.901  1.00 58.52  ? 475  ARG A CG  1 
ATOM   3655 C CD  . ARG A 1 475 ? 3.701   11.605  19.572  1.00 59.45  ? 475  ARG A CD  1 
ATOM   3656 N NE  . ARG A 1 475 ? 4.161   10.742  18.492  1.00 60.23  ? 475  ARG A NE  1 
ATOM   3657 C CZ  . ARG A 1 475 ? 4.333   11.114  17.226  1.00 58.90  ? 475  ARG A CZ  1 
ATOM   3658 N NH1 . ARG A 1 475 ? 4.082   12.359  16.824  1.00 57.97  ? 475  ARG A NH1 1 
ATOM   3659 N NH2 . ARG A 1 475 ? 4.771   10.216  16.354  1.00 58.73  ? 475  ARG A NH2 1 
ATOM   3660 N N   . LEU A 1 476 ? 8.770   11.156  21.377  1.00 52.69  ? 476  LEU A N   1 
ATOM   3661 C CA  . LEU A 1 476 ? 10.105  10.724  20.956  1.00 52.46  ? 476  LEU A CA  1 
ATOM   3662 C C   . LEU A 1 476 ? 10.875  10.077  22.103  1.00 52.49  ? 476  LEU A C   1 
ATOM   3663 O O   . LEU A 1 476 ? 11.447  9.010   21.939  1.00 52.45  ? 476  LEU A O   1 
ATOM   3664 C CB  . LEU A 1 476 ? 10.914  11.898  20.396  1.00 51.16  ? 476  LEU A CB  1 
ATOM   3665 C CG  . LEU A 1 476 ? 10.402  12.498  19.090  1.00 51.74  ? 476  LEU A CG  1 
ATOM   3666 C CD1 . LEU A 1 476 ? 11.194  13.735  18.719  1.00 50.94  ? 476  LEU A CD1 1 
ATOM   3667 C CD2 . LEU A 1 476 ? 10.453  11.477  17.978  1.00 52.26  ? 476  LEU A CD2 1 
ATOM   3668 N N   . MET A 1 477 ? 10.876  10.732  23.261  1.00 53.06  ? 477  MET A N   1 
ATOM   3669 C CA  . MET A 1 477 ? 11.505  10.180  24.457  1.00 53.46  ? 477  MET A CA  1 
ATOM   3670 C C   . MET A 1 477 ? 10.918  8.817   24.800  1.00 53.67  ? 477  MET A C   1 
ATOM   3671 O O   . MET A 1 477 ? 11.643  7.940   25.253  1.00 53.70  ? 477  MET A O   1 
ATOM   3672 C CB  . MET A 1 477 ? 11.337  11.126  25.643  1.00 53.75  ? 477  MET A CB  1 
ATOM   3673 C CG  . MET A 1 477 ? 12.003  12.495  25.486  1.00 53.07  ? 477  MET A CG  1 
ATOM   3674 S SD  . MET A 1 477 ? 11.491  13.587  26.838  1.00 57.49  ? 477  MET A SD  1 
ATOM   3675 C CE  . MET A 1 477 ? 12.715  13.083  27.995  1.00 53.95  ? 477  MET A CE  1 
ATOM   3676 N N   . LYS A 1 478 ? 9.616   8.644   24.573  1.00 54.22  ? 478  LYS A N   1 
ATOM   3677 C CA  . LYS A 1 478 ? 8.949   7.348   24.795  1.00 55.25  ? 478  LYS A CA  1 
ATOM   3678 C C   . LYS A 1 478 ? 9.443   6.287   23.814  1.00 53.69  ? 478  LYS A C   1 
ATOM   3679 O O   . LYS A 1 478 ? 9.779   5.176   24.216  1.00 53.55  ? 478  LYS A O   1 
ATOM   3680 C CB  . LYS A 1 478 ? 7.423   7.473   24.672  1.00 57.06  ? 478  LYS A CB  1 
ATOM   3681 C CG  . LYS A 1 478 ? 6.717   7.867   25.941  1.00 60.64  ? 478  LYS A CG  1 
ATOM   3682 C CD  . LYS A 1 478 ? 6.454   6.640   26.814  1.00 64.80  ? 478  LYS A CD  1 
ATOM   3683 C CE  . LYS A 1 478 ? 6.054   6.986   28.266  1.00 65.87  ? 478  LYS A CE  1 
ATOM   3684 N NZ  . LYS A 1 478 ? 6.520   5.903   29.239  1.00 66.70  ? 478  LYS A NZ  1 
ATOM   3685 N N   . TYR A 1 479 ? 9.467   6.629   22.529  1.00 52.17  ? 479  TYR A N   1 
ATOM   3686 C CA  . TYR A 1 479 ? 10.004  5.730   21.508  1.00 51.18  ? 479  TYR A CA  1 
ATOM   3687 C C   . TYR A 1 479 ? 11.430  5.279   21.846  1.00 50.09  ? 479  TYR A C   1 
ATOM   3688 O O   . TYR A 1 479 ? 11.723  4.086   21.790  1.00 50.28  ? 479  TYR A O   1 
ATOM   3689 C CB  . TYR A 1 479 ? 10.035  6.401   20.132  1.00 50.50  ? 479  TYR A CB  1 
ATOM   3690 C CG  . TYR A 1 479 ? 8.700   6.674   19.476  1.00 50.45  ? 479  TYR A CG  1 
ATOM   3691 C CD1 . TYR A 1 479 ? 7.656   5.755   19.535  1.00 51.86  ? 479  TYR A CD1 1 
ATOM   3692 C CD2 . TYR A 1 479 ? 8.507   7.838   18.756  1.00 48.44  ? 479  TYR A CD2 1 
ATOM   3693 C CE1 . TYR A 1 479 ? 6.453   6.010   18.909  1.00 51.89  ? 479  TYR A CE1 1 
ATOM   3694 C CE2 . TYR A 1 479 ? 7.318   8.104   18.135  1.00 51.52  ? 479  TYR A CE2 1 
ATOM   3695 C CZ  . TYR A 1 479 ? 6.290   7.193   18.218  1.00 52.01  ? 479  TYR A CZ  1 
ATOM   3696 O OH  . TYR A 1 479 ? 5.112   7.482   17.591  1.00 52.97  ? 479  TYR A OH  1 
ATOM   3697 N N   . TRP A 1 480 ? 12.296  6.235   22.189  1.00 48.37  ? 480  TRP A N   1 
ATOM   3698 C CA  . TRP A 1 480 ? 13.720  5.956   22.427  1.00 47.87  ? 480  TRP A CA  1 
ATOM   3699 C C   . TRP A 1 480 ? 13.931  5.110   23.687  1.00 48.48  ? 480  TRP A C   1 
ATOM   3700 O O   . TRP A 1 480 ? 14.756  4.187   23.700  1.00 48.21  ? 480  TRP A O   1 
ATOM   3701 C CB  . TRP A 1 480 ? 14.528  7.265   22.523  1.00 46.73  ? 480  TRP A CB  1 
ATOM   3702 C CG  . TRP A 1 480 ? 15.300  7.635   21.272  1.00 46.02  ? 480  TRP A CG  1 
ATOM   3703 C CD1 . TRP A 1 480 ? 16.647  7.785   21.167  1.00 44.13  ? 480  TRP A CD1 1 
ATOM   3704 C CD2 . TRP A 1 480 ? 14.766  7.906   19.965  1.00 45.47  ? 480  TRP A CD2 1 
ATOM   3705 N NE1 . TRP A 1 480 ? 16.991  8.114   19.877  1.00 43.83  ? 480  TRP A NE1 1 
ATOM   3706 C CE2 . TRP A 1 480 ? 15.855  8.201   19.121  1.00 43.62  ? 480  TRP A CE2 1 
ATOM   3707 C CE3 . TRP A 1 480 ? 13.477  7.925   19.429  1.00 46.19  ? 480  TRP A CE3 1 
ATOM   3708 C CZ2 . TRP A 1 480 ? 15.696  8.498   17.772  1.00 44.32  ? 480  TRP A CZ2 1 
ATOM   3709 C CZ3 . TRP A 1 480 ? 13.318  8.221   18.089  1.00 46.01  ? 480  TRP A CZ3 1 
ATOM   3710 C CH2 . TRP A 1 480 ? 14.421  8.509   17.275  1.00 45.52  ? 480  TRP A CH2 1 
ATOM   3711 N N   . THR A 1 481 ? 13.171  5.415   24.737  1.00 49.68  ? 481  THR A N   1 
ATOM   3712 C CA  . THR A 1 481 ? 13.293  4.694   25.998  1.00 50.05  ? 481  THR A CA  1 
ATOM   3713 C C   . THR A 1 481 ? 12.600  3.339   25.938  1.00 51.38  ? 481  THR A C   1 
ATOM   3714 O O   . THR A 1 481 ? 13.100  2.370   26.520  1.00 51.87  ? 481  THR A O   1 
ATOM   3715 C CB  . THR A 1 481 ? 12.804  5.531   27.201  1.00 50.28  ? 481  THR A CB  1 
ATOM   3716 O OG1 . THR A 1 481 ? 11.482  6.013   26.958  1.00 50.56  ? 481  THR A OG1 1 
ATOM   3717 C CG2 . THR A 1 481 ? 13.745  6.731   27.433  1.00 48.87  ? 481  THR A CG2 1 
ATOM   3718 N N   . ASN A 1 482 ? 11.484  3.238   25.219  1.00 52.39  ? 482  ASN A N   1 
ATOM   3719 C CA  . ASN A 1 482 ? 10.868  1.923   25.002  1.00 53.71  ? 482  ASN A CA  1 
ATOM   3720 C C   . ASN A 1 482 ? 11.832  1.001   24.258  1.00 53.74  ? 482  ASN A C   1 
ATOM   3721 O O   . ASN A 1 482 ? 11.953  -0.191  24.578  1.00 54.26  ? 482  ASN A O   1 
ATOM   3722 C CB  . ASN A 1 482 ? 9.571   2.037   24.210  1.00 54.76  ? 482  ASN A CB  1 
ATOM   3723 C CG  . ASN A 1 482 ? 8.425   2.592   25.030  1.00 56.17  ? 482  ASN A CG  1 
ATOM   3724 O OD1 . ASN A 1 482 ? 8.382   2.437   26.244  1.00 57.10  ? 482  ASN A OD1 1 
ATOM   3725 N ND2 . ASN A 1 482 ? 7.474   3.221   24.358  1.00 59.36  ? 482  ASN A ND2 1 
ATOM   3726 N N   . PHE A 1 483 ? 12.524  1.559   23.266  1.00 52.99  ? 483  PHE A N   1 
ATOM   3727 C CA  . PHE A 1 483 ? 13.533  0.807   22.539  1.00 52.93  ? 483  PHE A CA  1 
ATOM   3728 C C   . PHE A 1 483 ? 14.693  0.367   23.449  1.00 53.04  ? 483  PHE A C   1 
ATOM   3729 O O   . PHE A 1 483 ? 15.135  -0.786  23.403  1.00 53.29  ? 483  PHE A O   1 
ATOM   3730 C CB  . PHE A 1 483 ? 14.095  1.621   21.371  1.00 51.56  ? 483  PHE A CB  1 
ATOM   3731 C CG  . PHE A 1 483 ? 15.170  0.903   20.631  1.00 50.58  ? 483  PHE A CG  1 
ATOM   3732 C CD1 . PHE A 1 483 ? 14.850  -0.112  19.744  1.00 51.92  ? 483  PHE A CD1 1 
ATOM   3733 C CD2 . PHE A 1 483 ? 16.502  1.179   20.878  1.00 50.46  ? 483  PHE A CD2 1 
ATOM   3734 C CE1 . PHE A 1 483 ? 15.842  -0.809  19.081  1.00 52.11  ? 483  PHE A CE1 1 
ATOM   3735 C CE2 . PHE A 1 483 ? 17.498  0.493   20.221  1.00 50.55  ? 483  PHE A CE2 1 
ATOM   3736 C CZ  . PHE A 1 483 ? 17.169  -0.511  19.318  1.00 50.36  ? 483  PHE A CZ  1 
ATOM   3737 N N   . ALA A 1 484 ? 15.200  1.305   24.236  1.00 52.71  ? 484  ALA A N   1 
ATOM   3738 C CA  . ALA A 1 484 ? 16.186  1.005   25.263  1.00 53.24  ? 484  ALA A CA  1 
ATOM   3739 C C   . ALA A 1 484 ? 15.729  -0.133  26.173  1.00 54.84  ? 484  ALA A C   1 
ATOM   3740 O O   . ALA A 1 484 ? 16.496  -1.051  26.438  1.00 56.06  ? 484  ALA A O   1 
ATOM   3741 C CB  . ALA A 1 484 ? 16.486  2.247   26.091  1.00 51.96  ? 484  ALA A CB  1 
ATOM   3742 N N   . ARG A 1 485 ? 14.496  -0.069  26.661  1.00 56.15  ? 485  ARG A N   1 
ATOM   3743 C CA  . ARG A 1 485 ? 13.981  -1.081  27.596  1.00 58.37  ? 485  ARG A CA  1 
ATOM   3744 C C   . ARG A 1 485 ? 13.800  -2.466  26.982  1.00 58.40  ? 485  ARG A C   1 
ATOM   3745 O O   . ARG A 1 485 ? 14.065  -3.477  27.638  1.00 58.29  ? 485  ARG A O   1 
ATOM   3746 C CB  . ARG A 1 485 ? 12.612  -0.670  28.171  1.00 59.40  ? 485  ARG A CB  1 
ATOM   3747 C CG  . ARG A 1 485 ? 12.589  0.578   29.039  1.00 60.68  ? 485  ARG A CG  1 
ATOM   3748 C CD  . ARG A 1 485 ? 11.139  1.041   29.345  1.00 62.95  ? 485  ARG A CD  1 
ATOM   3749 N NE  . ARG A 1 485 ? 11.152  2.350   30.001  1.00 65.32  ? 485  ARG A NE  1 
ATOM   3750 C CZ  . ARG A 1 485 ? 10.649  3.488   29.508  1.00 67.75  ? 485  ARG A CZ  1 
ATOM   3751 N NH1 . ARG A 1 485 ? 10.019  3.540   28.328  1.00 68.98  ? 485  ARG A NH1 1 
ATOM   3752 N NH2 . ARG A 1 485 ? 10.763  4.604   30.228  1.00 67.41  ? 485  ARG A NH2 1 
ATOM   3753 N N   . THR A 1 486 ? 13.305  -2.505  25.743  1.00 58.18  ? 486  THR A N   1 
ATOM   3754 C CA  . THR A 1 486 ? 12.745  -3.748  25.174  1.00 58.98  ? 486  THR A CA  1 
ATOM   3755 C C   . THR A 1 486 ? 13.276  -4.135  23.791  1.00 58.91  ? 486  THR A C   1 
ATOM   3756 O O   . THR A 1 486 ? 13.067  -5.263  23.347  1.00 59.98  ? 486  THR A O   1 
ATOM   3757 C CB  . THR A 1 486 ? 11.205  -3.644  25.063  1.00 59.80  ? 486  THR A CB  1 
ATOM   3758 O OG1 . THR A 1 486 ? 10.849  -2.619  24.119  1.00 59.11  ? 486  THR A OG1 1 
ATOM   3759 C CG2 . THR A 1 486 ? 10.588  -3.314  26.405  1.00 59.26  ? 486  THR A CG2 1 
ATOM   3760 N N   . GLY A 1 487 ? 13.963  -3.217  23.114  1.00 57.63  ? 487  GLY A N   1 
ATOM   3761 C CA  . GLY A 1 487 ? 14.359  -3.418  21.719  1.00 57.53  ? 487  GLY A CA  1 
ATOM   3762 C C   . GLY A 1 487 ? 13.230  -3.171  20.729  1.00 58.15  ? 487  GLY A C   1 
ATOM   3763 O O   . GLY A 1 487 ? 13.319  -3.587  19.578  1.00 58.13  ? 487  GLY A O   1 
ATOM   3764 N N   . ASP A 1 488 ? 12.175  -2.493  21.179  1.00 58.60  ? 488  ASP A N   1 
ATOM   3765 C CA  . ASP A 1 488 ? 10.994  -2.210  20.364  1.00 59.90  ? 488  ASP A CA  1 
ATOM   3766 C C   . ASP A 1 488 ? 10.476  -0.835  20.785  1.00 59.83  ? 488  ASP A C   1 
ATOM   3767 O O   . ASP A 1 488 ? 10.113  -0.649  21.943  1.00 59.58  ? 488  ASP A O   1 
ATOM   3768 C CB  . ASP A 1 488 ? 9.923   -3.300  20.607  1.00 61.76  ? 488  ASP A CB  1 
ATOM   3769 C CG  . ASP A 1 488 ? 8.654   -3.103  19.777  1.00 62.83  ? 488  ASP A CG  1 
ATOM   3770 O OD1 . ASP A 1 488 ? 8.468   -2.052  19.144  1.00 64.87  ? 488  ASP A OD1 1 
ATOM   3771 O OD2 . ASP A 1 488 ? 7.818   -4.023  19.755  1.00 67.98  ? 488  ASP A OD2 1 
ATOM   3772 N N   . PRO A 1 489 ? 10.450  0.138   19.856  1.00 60.29  ? 489  PRO A N   1 
ATOM   3773 C CA  . PRO A 1 489 ? 10.051  1.497   20.243  1.00 60.68  ? 489  PRO A CA  1 
ATOM   3774 C C   . PRO A 1 489 ? 8.562   1.644   20.571  1.00 62.96  ? 489  PRO A C   1 
ATOM   3775 O O   . PRO A 1 489 ? 8.162   2.635   21.171  1.00 62.30  ? 489  PRO A O   1 
ATOM   3776 C CB  . PRO A 1 489 ? 10.420  2.328   19.003  1.00 60.04  ? 489  PRO A CB  1 
ATOM   3777 C CG  . PRO A 1 489 ? 10.298  1.353   17.864  1.00 60.05  ? 489  PRO A CG  1 
ATOM   3778 C CD  . PRO A 1 489 ? 10.770  0.049   18.416  1.00 60.04  ? 489  PRO A CD  1 
ATOM   3779 N N   . ASN A 1 490 ? 7.758   0.665   20.176  1.00 66.10  ? 490  ASN A N   1 
ATOM   3780 C CA  . ASN A 1 490 ? 6.311   0.707   20.389  1.00 69.22  ? 490  ASN A CA  1 
ATOM   3781 C C   . ASN A 1 490 ? 5.924   0.512   21.854  1.00 72.13  ? 490  ASN A C   1 
ATOM   3782 O O   . ASN A 1 490 ? 6.581   -0.231  22.589  1.00 71.82  ? 490  ASN A O   1 
ATOM   3783 C CB  . ASN A 1 490 ? 5.619   -0.366  19.537  1.00 70.13  ? 490  ASN A CB  1 
ATOM   3784 C CG  . ASN A 1 490 ? 5.753   -0.105  18.051  1.00 68.77  ? 490  ASN A CG  1 
ATOM   3785 O OD1 . ASN A 1 490 ? 5.187   0.855   17.529  1.00 68.08  ? 490  ASN A OD1 1 
ATOM   3786 N ND2 . ASN A 1 490 ? 6.508   -0.953  17.363  1.00 65.75  ? 490  ASN A ND2 1 
ATOM   3787 N N   . ASP A 1 491 ? 4.851   1.181   22.266  1.00 75.73  ? 491  ASP A N   1 
ATOM   3788 C CA  . ASP A 1 491 ? 4.340   1.044   23.629  1.00 79.11  ? 491  ASP A CA  1 
ATOM   3789 C C   . ASP A 1 491 ? 3.554   -0.261  23.713  1.00 82.32  ? 491  ASP A C   1 
ATOM   3790 O O   . ASP A 1 491 ? 2.601   -0.448  22.962  1.00 83.25  ? 491  ASP A O   1 
ATOM   3791 C CB  . ASP A 1 491 ? 3.447   2.235   24.018  1.00 80.00  ? 491  ASP A CB  1 
ATOM   3792 C CG  . ASP A 1 491 ? 3.495   2.540   25.523  1.00 81.98  ? 491  ASP A CG  1 
ATOM   3793 O OD1 . ASP A 1 491 ? 4.075   3.599   25.893  1.00 83.75  ? 491  ASP A OD1 1 
ATOM   3794 O OD2 . ASP A 1 491 ? 2.980   1.719   26.324  1.00 84.04  ? 491  ASP A OD2 1 
ATOM   3795 N N   . PRO A 1 492 ? 3.959   -1.168  24.617  1.00 84.95  ? 492  PRO A N   1 
ATOM   3796 C CA  . PRO A 1 492 ? 3.268   -2.458  24.714  1.00 88.13  ? 492  PRO A CA  1 
ATOM   3797 C C   . PRO A 1 492 ? 1.815   -2.323  25.171  1.00 91.21  ? 492  PRO A C   1 
ATOM   3798 O O   . PRO A 1 492 ? 1.006   -3.209  24.893  1.00 92.93  ? 492  PRO A O   1 
ATOM   3799 C CB  . PRO A 1 492 ? 4.095   -3.241  25.745  1.00 88.13  ? 492  PRO A CB  1 
ATOM   3800 C CG  . PRO A 1 492 ? 4.876   -2.205  26.504  1.00 86.12  ? 492  PRO A CG  1 
ATOM   3801 C CD  . PRO A 1 492 ? 5.059   -1.035  25.594  1.00 84.03  ? 492  PRO A CD  1 
ATOM   3802 N N   . ARG A 1 493 ? 1.493   -1.230  25.864  1.00 92.71  ? 493  ARG A N   1 
ATOM   3803 C CA  . ARG A 1 493 ? 0.101   -0.924  26.216  1.00 95.20  ? 493  ARG A CA  1 
ATOM   3804 C C   . ARG A 1 493 ? -0.674  -0.418  24.998  1.00 95.84  ? 493  ARG A C   1 
ATOM   3805 O O   . ARG A 1 493 ? -1.586  -1.088  24.491  1.00 97.72  ? 493  ARG A O   1 
ATOM   3806 C CB  . ARG A 1 493 ? 0.030   0.132   27.335  1.00 95.03  ? 493  ARG A CB  1 
ATOM   3807 C CG  . ARG A 1 493 ? -1.386  0.703   27.548  1.00 96.60  ? 493  ARG A CG  1 
ATOM   3808 C CD  . ARG A 1 493 ? -1.618  1.233   28.976  1.00 98.22  ? 493  ARG A CD  1 
ATOM   3809 N NE  . ARG A 1 493 ? -2.942  0.852   29.493  1.00 101.24 ? 493  ARG A NE  1 
ATOM   3810 C CZ  . ARG A 1 493 ? -3.205  -0.248  30.204  1.00 103.01 ? 493  ARG A CZ  1 
ATOM   3811 N NH1 . ARG A 1 493 ? -2.244  -1.117  30.518  1.00 102.52 ? 493  ARG A NH1 1 
ATOM   3812 N NH2 . ARG A 1 493 ? -4.451  -0.482  30.613  1.00 105.35 ? 493  ARG A NH2 1 
ATOM   3813 N N   . ASP A 1 494 ? -0.276  0.765   24.539  1.00 94.75  ? 494  ASP A N   1 
ATOM   3814 C CA  . ASP A 1 494 ? -1.033  1.559   23.577  1.00 95.08  ? 494  ASP A CA  1 
ATOM   3815 C C   . ASP A 1 494 ? -1.116  0.905   22.187  1.00 95.09  ? 494  ASP A C   1 
ATOM   3816 O O   . ASP A 1 494 ? -0.271  1.143   21.321  1.00 94.14  ? 494  ASP A O   1 
ATOM   3817 C CB  . ASP A 1 494 ? -0.387  2.952   23.495  1.00 93.77  ? 494  ASP A CB  1 
ATOM   3818 C CG  . ASP A 1 494 ? -1.184  3.938   22.666  1.00 94.75  ? 494  ASP A CG  1 
ATOM   3819 O OD1 . ASP A 1 494 ? -2.366  3.671   22.342  1.00 97.23  ? 494  ASP A OD1 1 
ATOM   3820 O OD2 . ASP A 1 494 ? -0.607  5.000   22.349  1.00 94.60  ? 494  ASP A OD2 1 
ATOM   3821 N N   . SER A 1 495 ? -2.143  0.083   21.983  1.00 96.45  ? 495  SER A N   1 
ATOM   3822 C CA  . SER A 1 495 ? -2.422  -0.494  20.659  1.00 96.47  ? 495  SER A CA  1 
ATOM   3823 C C   . SER A 1 495 ? -3.180  0.494   19.747  1.00 96.53  ? 495  SER A C   1 
ATOM   3824 O O   . SER A 1 495 ? -3.182  0.337   18.515  1.00 96.78  ? 495  SER A O   1 
ATOM   3825 C CB  . SER A 1 495 ? -3.215  -1.799  20.799  1.00 98.63  ? 495  SER A CB  1 
ATOM   3826 O OG  . SER A 1 495 ? -4.450  -1.578  21.456  1.00 100.36 ? 495  SER A OG  1 
ATOM   3827 N N   . LYS A 1 496 ? -3.815  1.502   20.358  1.00 95.94  ? 496  LYS A N   1 
ATOM   3828 C CA  . LYS A 1 496 ? -4.566  2.533   19.625  1.00 95.37  ? 496  LYS A CA  1 
ATOM   3829 C C   . LYS A 1 496 ? -3.674  3.465   18.778  1.00 92.85  ? 496  LYS A C   1 
ATOM   3830 O O   . LYS A 1 496 ? -4.080  3.890   17.692  1.00 93.19  ? 496  LYS A O   1 
ATOM   3831 C CB  . LYS A 1 496 ? -5.418  3.358   20.600  1.00 96.36  ? 496  LYS A CB  1 
ATOM   3832 N N   . SER A 1 497 ? -2.474  3.785   19.271  1.00 89.88  ? 497  SER A N   1 
ATOM   3833 C CA  . SER A 1 497 ? -1.508  4.590   18.502  1.00 87.39  ? 497  SER A CA  1 
ATOM   3834 C C   . SER A 1 497 ? -0.969  3.787   17.323  1.00 84.96  ? 497  SER A C   1 
ATOM   3835 O O   . SER A 1 497 ? -0.854  2.559   17.410  1.00 85.66  ? 497  SER A O   1 
ATOM   3836 C CB  . SER A 1 497 ? -0.320  5.032   19.366  1.00 85.80  ? 497  SER A CB  1 
ATOM   3837 O OG  . SER A 1 497 ? -0.651  6.123   20.210  1.00 86.73  ? 497  SER A OG  1 
ATOM   3838 N N   . PRO A 1 498 ? -0.603  4.473   16.228  1.00 81.72  ? 498  PRO A N   1 
ATOM   3839 C CA  . PRO A 1 498 ? -0.065  3.735   15.089  1.00 79.67  ? 498  PRO A CA  1 
ATOM   3840 C C   . PRO A 1 498 ? 1.267   3.070   15.447  1.00 76.21  ? 498  PRO A C   1 
ATOM   3841 O O   . PRO A 1 498 ? 2.036   3.618   16.245  1.00 74.46  ? 498  PRO A O   1 
ATOM   3842 C CB  . PRO A 1 498 ? 0.136   4.818   14.015  1.00 79.20  ? 498  PRO A CB  1 
ATOM   3843 C CG  . PRO A 1 498 ? -0.566  6.032   14.511  1.00 80.15  ? 498  PRO A CG  1 
ATOM   3844 C CD  . PRO A 1 498 ? -0.628  5.927   15.989  1.00 81.08  ? 498  PRO A CD  1 
ATOM   3845 N N   . GLN A 1 499 ? 1.514   1.901   14.861  1.00 73.94  ? 499  GLN A N   1 
ATOM   3846 C CA  . GLN A 1 499 ? 2.680   1.086   15.186  1.00 71.35  ? 499  GLN A CA  1 
ATOM   3847 C C   . GLN A 1 499 ? 3.848   1.356   14.235  1.00 67.98  ? 499  GLN A C   1 
ATOM   3848 O O   . GLN A 1 499 ? 3.655   1.720   13.080  1.00 67.72  ? 499  GLN A O   1 
ATOM   3849 C CB  . GLN A 1 499 ? 2.308   -0.404  15.168  1.00 72.85  ? 499  GLN A CB  1 
ATOM   3850 C CG  . GLN A 1 499 ? 1.225   -0.792  16.187  1.00 75.19  ? 499  GLN A CG  1 
ATOM   3851 C CD  . GLN A 1 499 ? 1.677   -0.605  17.640  1.00 75.77  ? 499  GLN A CD  1 
ATOM   3852 O OE1 . GLN A 1 499 ? 2.604   -1.272  18.113  1.00 75.60  ? 499  GLN A OE1 1 
ATOM   3853 N NE2 . GLN A 1 499 ? 1.015   0.305   18.353  1.00 76.56  ? 499  GLN A NE2 1 
ATOM   3854 N N   . TRP A 1 500 ? 5.057   1.185   14.760  1.00 64.50  ? 500  TRP A N   1 
ATOM   3855 C CA  . TRP A 1 500 ? 6.303   1.331   14.025  1.00 61.28  ? 500  TRP A CA  1 
ATOM   3856 C C   . TRP A 1 500 ? 6.776   -0.083  13.647  1.00 60.99  ? 500  TRP A C   1 
ATOM   3857 O O   . TRP A 1 500 ? 7.238   -0.834  14.510  1.00 60.15  ? 500  TRP A O   1 
ATOM   3858 C CB  . TRP A 1 500 ? 7.321   2.024   14.937  1.00 59.03  ? 500  TRP A CB  1 
ATOM   3859 C CG  . TRP A 1 500 ? 8.611   2.456   14.321  1.00 57.05  ? 500  TRP A CG  1 
ATOM   3860 C CD1 . TRP A 1 500 ? 9.191   1.986   13.177  1.00 56.43  ? 500  TRP A CD1 1 
ATOM   3861 C CD2 . TRP A 1 500 ? 9.522   3.431   14.860  1.00 54.81  ? 500  TRP A CD2 1 
ATOM   3862 N NE1 . TRP A 1 500 ? 10.393  2.625   12.962  1.00 54.77  ? 500  TRP A NE1 1 
ATOM   3863 C CE2 . TRP A 1 500 ? 10.614  3.515   13.981  1.00 54.01  ? 500  TRP A CE2 1 
ATOM   3864 C CE3 . TRP A 1 500 ? 9.507   4.248   15.999  1.00 54.06  ? 500  TRP A CE3 1 
ATOM   3865 C CZ2 . TRP A 1 500 ? 11.689  4.383   14.208  1.00 52.94  ? 500  TRP A CZ2 1 
ATOM   3866 C CZ3 . TRP A 1 500 ? 10.565  5.115   16.214  1.00 53.47  ? 500  TRP A CZ3 1 
ATOM   3867 C CH2 . TRP A 1 500 ? 11.641  5.170   15.331  1.00 52.58  ? 500  TRP A CH2 1 
ATOM   3868 N N   . PRO A 1 501 ? 6.650   -0.457  12.357  1.00 60.93  ? 501  PRO A N   1 
ATOM   3869 C CA  . PRO A 1 501 ? 7.050   -1.789  11.924  1.00 61.24  ? 501  PRO A CA  1 
ATOM   3870 C C   . PRO A 1 501 ? 8.553   -1.875  11.730  1.00 59.90  ? 501  PRO A C   1 
ATOM   3871 O O   . PRO A 1 501 ? 9.157   -0.886  11.365  1.00 58.11  ? 501  PRO A O   1 
ATOM   3872 C CB  . PRO A 1 501 ? 6.366   -1.929  10.568  1.00 62.37  ? 501  PRO A CB  1 
ATOM   3873 C CG  . PRO A 1 501 ? 6.265   -0.557  10.045  1.00 61.16  ? 501  PRO A CG  1 
ATOM   3874 C CD  . PRO A 1 501 ? 6.132   0.347   11.233  1.00 61.13  ? 501  PRO A CD  1 
ATOM   3875 N N   . PRO A 1 502 ? 9.150   -3.057  11.949  1.00 60.08  ? 502  PRO A N   1 
ATOM   3876 C CA  . PRO A 1 502 ? 10.568  -3.193  11.641  1.00 59.03  ? 502  PRO A CA  1 
ATOM   3877 C C   . PRO A 1 502 ? 10.869  -2.980  10.151  1.00 59.25  ? 502  PRO A C   1 
ATOM   3878 O O   . PRO A 1 502 ? 10.049  -3.318  9.289   1.00 60.00  ? 502  PRO A O   1 
ATOM   3879 C CB  . PRO A 1 502 ? 10.888  -4.638  12.037  1.00 60.08  ? 502  PRO A CB  1 
ATOM   3880 C CG  . PRO A 1 502 ? 9.791   -5.065  12.933  1.00 60.90  ? 502  PRO A CG  1 
ATOM   3881 C CD  . PRO A 1 502 ? 8.582   -4.297  12.500  1.00 61.39  ? 502  PRO A CD  1 
ATOM   3882 N N   . TYR A 1 503 ? 12.036  -2.410  9.871   1.00 58.20  ? 503  TYR A N   1 
ATOM   3883 C CA  . TYR A 1 503 ? 12.562  -2.327  8.518   1.00 58.52  ? 503  TYR A CA  1 
ATOM   3884 C C   . TYR A 1 503 ? 13.042  -3.692  8.051   1.00 59.43  ? 503  TYR A C   1 
ATOM   3885 O O   . TYR A 1 503 ? 13.814  -4.355  8.748   1.00 58.54  ? 503  TYR A O   1 
ATOM   3886 C CB  . TYR A 1 503 ? 13.740  -1.358  8.481   1.00 57.59  ? 503  TYR A CB  1 
ATOM   3887 C CG  . TYR A 1 503 ? 14.334  -1.171  7.109   1.00 57.96  ? 503  TYR A CG  1 
ATOM   3888 C CD1 . TYR A 1 503 ? 15.375  -1.987  6.665   1.00 58.92  ? 503  TYR A CD1 1 
ATOM   3889 C CD2 . TYR A 1 503 ? 13.863  -0.174  6.256   1.00 57.87  ? 503  TYR A CD2 1 
ATOM   3890 C CE1 . TYR A 1 503 ? 15.936  -1.816  5.410   1.00 59.27  ? 503  TYR A CE1 1 
ATOM   3891 C CE2 . TYR A 1 503 ? 14.409  0.010   5.010   1.00 58.69  ? 503  TYR A CE2 1 
ATOM   3892 C CZ  . TYR A 1 503 ? 15.452  -0.812  4.585   1.00 60.14  ? 503  TYR A CZ  1 
ATOM   3893 O OH  . TYR A 1 503 ? 15.998  -0.638  3.328   1.00 60.32  ? 503  TYR A OH  1 
ATOM   3894 N N   . THR A 1 504 ? 12.598  -4.093  6.863   1.00 60.77  ? 504  THR A N   1 
ATOM   3895 C CA  . THR A 1 504 ? 13.039  -5.342  6.249   1.00 62.33  ? 504  THR A CA  1 
ATOM   3896 C C   . THR A 1 504 ? 13.443  -5.097  4.805   1.00 63.09  ? 504  THR A C   1 
ATOM   3897 O O   . THR A 1 504 ? 13.062  -4.085  4.207   1.00 62.43  ? 504  THR A O   1 
ATOM   3898 C CB  . THR A 1 504 ? 11.910  -6.352  6.214   1.00 63.97  ? 504  THR A CB  1 
ATOM   3899 O OG1 . THR A 1 504 ? 10.805  -5.765  5.516   1.00 63.17  ? 504  THR A OG1 1 
ATOM   3900 C CG2 . THR A 1 504 ? 11.498  -6.733  7.625   1.00 64.14  ? 504  THR A CG2 1 
ATOM   3901 N N   . THR A 1 505 ? 14.185  -6.038  4.226   1.00 64.55  ? 505  THR A N   1 
ATOM   3902 C CA  . THR A 1 505 ? 14.545  -5.913  2.811   1.00 65.37  ? 505  THR A CA  1 
ATOM   3903 C C   . THR A 1 505 ? 13.319  -6.112  1.906   1.00 66.64  ? 505  THR A C   1 
ATOM   3904 O O   . THR A 1 505 ? 13.196  -5.465  0.871   1.00 66.97  ? 505  THR A O   1 
ATOM   3905 C CB  . THR A 1 505 ? 15.733  -6.825  2.423   1.00 65.95  ? 505  THR A CB  1 
ATOM   3906 O OG1 . THR A 1 505 ? 15.458  -8.171  2.798   1.00 67.74  ? 505  THR A OG1 1 
ATOM   3907 C CG2 . THR A 1 505 ? 17.020  -6.351  3.129   1.00 64.48  ? 505  THR A CG2 1 
ATOM   3908 N N   . ALA A 1 506 ? 12.388  -6.962  2.322   1.00 67.87  ? 506  ALA A N   1 
ATOM   3909 C CA  . ALA A 1 506 ? 11.176  -7.201  1.537   1.00 69.37  ? 506  ALA A CA  1 
ATOM   3910 C C   . ALA A 1 506 ? 10.289  -5.967  1.461   1.00 68.65  ? 506  ALA A C   1 
ATOM   3911 O O   . ALA A 1 506 ? 9.889   -5.562  0.371   1.00 69.68  ? 506  ALA A O   1 
ATOM   3912 C CB  . ALA A 1 506 ? 10.373  -8.398  2.100   1.00 71.38  ? 506  ALA A CB  1 
ATOM   3913 N N   . ALA A 1 507 ? 9.978   -5.369  2.609   1.00 67.16  ? 507  ALA A N   1 
ATOM   3914 C CA  . ALA A 1 507 ? 9.003   -4.279  2.659   1.00 66.27  ? 507  ALA A CA  1 
ATOM   3915 C C   . ALA A 1 507 ? 9.643   -2.894  2.780   1.00 64.00  ? 507  ALA A C   1 
ATOM   3916 O O   . ALA A 1 507 ? 9.024   -1.902  2.403   1.00 63.73  ? 507  ALA A O   1 
ATOM   3917 C CB  . ALA A 1 507 ? 8.003   -4.517  3.789   1.00 66.72  ? 507  ALA A CB  1 
ATOM   3918 N N   . GLN A 1 508 ? 10.861  -2.822  3.314   1.00 62.12  ? 508  GLN A N   1 
ATOM   3919 C CA  . GLN A 1 508 ? 11.603  -1.560  3.401   1.00 60.47  ? 508  GLN A CA  1 
ATOM   3920 C C   . GLN A 1 508 ? 10.830  -0.443  4.136   1.00 59.41  ? 508  GLN A C   1 
ATOM   3921 O O   . GLN A 1 508 ? 10.909  0.731   3.780   1.00 58.48  ? 508  GLN A O   1 
ATOM   3922 C CB  . GLN A 1 508 ? 12.030  -1.101  1.998   1.00 60.36  ? 508  GLN A CB  1 
ATOM   3923 C CG  . GLN A 1 508 ? 12.878  -2.113  1.223   1.00 60.95  ? 508  GLN A CG  1 
ATOM   3924 C CD  . GLN A 1 508 ? 13.321  -1.592  -0.143  1.00 61.41  ? 508  GLN A CD  1 
ATOM   3925 O OE1 . GLN A 1 508 ? 13.939  -0.533  -0.242  1.00 57.83  ? 508  GLN A OE1 1 
ATOM   3926 N NE2 . GLN A 1 508 ? 12.996  -2.338  -1.202  1.00 62.39  ? 508  GLN A NE2 1 
ATOM   3927 N N   . GLN A 1 509 ? 10.117  -0.818  5.192   1.00 59.62  ? 509  GLN A N   1 
ATOM   3928 C CA  . GLN A 1 509 ? 9.284   0.121   5.925   1.00 59.05  ? 509  GLN A CA  1 
ATOM   3929 C C   . GLN A 1 509 ? 10.067  0.980   6.918   1.00 57.32  ? 509  GLN A C   1 
ATOM   3930 O O   . GLN A 1 509 ? 11.016  0.527   7.556   1.00 57.16  ? 509  GLN A O   1 
ATOM   3931 C CB  . GLN A 1 509 ? 8.162   -0.617  6.652   1.00 60.32  ? 509  GLN A CB  1 
ATOM   3932 C CG  . GLN A 1 509 ? 7.185   -1.270  5.722   1.00 61.80  ? 509  GLN A CG  1 
ATOM   3933 C CD  . GLN A 1 509 ? 6.183   -2.109  6.455   1.00 63.48  ? 509  GLN A CD  1 
ATOM   3934 O OE1 . GLN A 1 509 ? 6.525   -3.160  6.995   1.00 64.83  ? 509  GLN A OE1 1 
ATOM   3935 N NE2 . GLN A 1 509 ? 4.930   -1.657  6.484   1.00 63.30  ? 509  GLN A NE2 1 
ATOM   3936 N N   . TYR A 1 510 ? 9.640   2.231   7.020   1.00 56.37  ? 510  TYR A N   1 
ATOM   3937 C CA  . TYR A 1 510 ? 10.173  3.194   7.962   1.00 54.83  ? 510  TYR A CA  1 
ATOM   3938 C C   . TYR A 1 510 ? 9.077   4.209   8.275   1.00 54.65  ? 510  TYR A C   1 
ATOM   3939 O O   . TYR A 1 510 ? 8.060   4.260   7.579   1.00 55.19  ? 510  TYR A O   1 
ATOM   3940 C CB  . TYR A 1 510 ? 11.402  3.887   7.387   1.00 53.70  ? 510  TYR A CB  1 
ATOM   3941 C CG  . TYR A 1 510 ? 11.141  4.809   6.218   1.00 53.87  ? 510  TYR A CG  1 
ATOM   3942 C CD1 . TYR A 1 510 ? 10.961  4.308   4.932   1.00 55.35  ? 510  TYR A CD1 1 
ATOM   3943 C CD2 . TYR A 1 510 ? 11.095  6.186   6.395   1.00 53.77  ? 510  TYR A CD2 1 
ATOM   3944 C CE1 . TYR A 1 510 ? 10.724  5.158   3.850   1.00 55.72  ? 510  TYR A CE1 1 
ATOM   3945 C CE2 . TYR A 1 510 ? 10.861  7.050   5.326   1.00 54.64  ? 510  TYR A CE2 1 
ATOM   3946 C CZ  . TYR A 1 510 ? 10.681  6.530   4.048   1.00 55.30  ? 510  TYR A CZ  1 
ATOM   3947 O OH  . TYR A 1 510 ? 10.448  7.385   2.980   1.00 54.54  ? 510  TYR A OH  1 
ATOM   3948 N N   . VAL A 1 511 ? 9.288   5.018   9.311   1.00 53.16  ? 511  VAL A N   1 
ATOM   3949 C CA  . VAL A 1 511 ? 8.248   5.935   9.779   1.00 53.05  ? 511  VAL A CA  1 
ATOM   3950 C C   . VAL A 1 511 ? 8.651   7.383   9.679   1.00 52.13  ? 511  VAL A C   1 
ATOM   3951 O O   . VAL A 1 511 ? 9.822   7.712   9.821   1.00 50.84  ? 511  VAL A O   1 
ATOM   3952 C CB  . VAL A 1 511 ? 7.814   5.631   11.240  1.00 53.36  ? 511  VAL A CB  1 
ATOM   3953 C CG1 . VAL A 1 511 ? 7.090   4.270   11.310  1.00 53.70  ? 511  VAL A CG1 1 
ATOM   3954 C CG2 . VAL A 1 511 ? 8.999   5.701   12.192  1.00 51.33  ? 511  VAL A CG2 1 
ATOM   3955 N N   . SER A 1 512 ? 7.673   8.252   9.444   1.00 53.10  ? 512  SER A N   1 
ATOM   3956 C CA  . SER A 1 512 ? 7.891   9.693   9.542   1.00 52.63  ? 512  SER A CA  1 
ATOM   3957 C C   . SER A 1 512 ? 7.715   10.137  10.989  1.00 52.76  ? 512  SER A C   1 
ATOM   3958 O O   . SER A 1 512 ? 6.690   9.826   11.628  1.00 53.53  ? 512  SER A O   1 
ATOM   3959 C CB  . SER A 1 512 ? 6.908   10.448  8.662   1.00 53.67  ? 512  SER A CB  1 
ATOM   3960 O OG  . SER A 1 512 ? 5.585   10.238  9.109   1.00 55.03  ? 512  SER A OG  1 
ATOM   3961 N N   . LEU A 1 513 ? 8.727   10.836  11.507  1.00 51.86  ? 513  LEU A N   1 
ATOM   3962 C CA  . LEU A 1 513 ? 8.651   11.466  12.816  1.00 51.81  ? 513  LEU A CA  1 
ATOM   3963 C C   . LEU A 1 513 ? 8.404   12.959  12.623  1.00 52.43  ? 513  LEU A C   1 
ATOM   3964 O O   . LEU A 1 513 ? 9.306   13.724  12.245  1.00 50.86  ? 513  LEU A O   1 
ATOM   3965 C CB  . LEU A 1 513 ? 9.934   11.240  13.615  1.00 50.47  ? 513  LEU A CB  1 
ATOM   3966 C CG  . LEU A 1 513 ? 10.246  9.804   14.042  1.00 50.29  ? 513  LEU A CG  1 
ATOM   3967 C CD1 . LEU A 1 513 ? 11.576  9.769   14.778  1.00 47.65  ? 513  LEU A CD1 1 
ATOM   3968 C CD2 . LEU A 1 513 ? 9.110   9.200   14.906  1.00 48.97  ? 513  LEU A CD2 1 
ATOM   3969 N N   . ASN A 1 514 ? 7.159   13.356  12.860  1.00 54.28  ? 514  ASN A N   1 
ATOM   3970 C CA  . ASN A 1 514 ? 6.759   14.759  12.808  1.00 55.20  ? 514  ASN A CA  1 
ATOM   3971 C C   . ASN A 1 514 ? 5.598   14.992  13.780  1.00 56.56  ? 514  ASN A C   1 
ATOM   3972 O O   . ASN A 1 514 ? 5.304   14.120  14.598  1.00 56.37  ? 514  ASN A O   1 
ATOM   3973 C CB  . ASN A 1 514 ? 6.449   15.189  11.356  1.00 55.43  ? 514  ASN A CB  1 
ATOM   3974 C CG  . ASN A 1 514 ? 5.447   14.271  10.650  1.00 57.78  ? 514  ASN A CG  1 
ATOM   3975 O OD1 . ASN A 1 514 ? 4.451   13.834  11.238  1.00 57.78  ? 514  ASN A OD1 1 
ATOM   3976 N ND2 . ASN A 1 514 ? 5.711   13.989  9.370   1.00 57.77  ? 514  ASN A ND2 1 
ATOM   3977 N N   . LEU A 1 515 ? 4.955   16.160  13.702  1.00 57.83  ? 515  LEU A N   1 
ATOM   3978 C CA  . LEU A 1 515 ? 3.848   16.505  14.610  1.00 59.00  ? 515  LEU A CA  1 
ATOM   3979 C C   . LEU A 1 515 ? 2.598   15.641  14.430  1.00 61.01  ? 515  LEU A C   1 
ATOM   3980 O O   . LEU A 1 515 ? 1.757   15.586  15.322  1.00 61.87  ? 515  LEU A O   1 
ATOM   3981 C CB  . LEU A 1 515 ? 3.459   17.984  14.453  1.00 59.30  ? 515  LEU A CB  1 
ATOM   3982 C CG  . LEU A 1 515 ? 4.522   19.030  14.790  1.00 58.45  ? 515  LEU A CG  1 
ATOM   3983 C CD1 . LEU A 1 515 ? 3.916   20.437  14.729  1.00 58.25  ? 515  LEU A CD1 1 
ATOM   3984 C CD2 . LEU A 1 515 ? 5.154   18.760  16.154  1.00 56.92  ? 515  LEU A CD2 1 
ATOM   3985 N N   . LYS A 1 516 ? 2.477   15.003  13.267  1.00 61.70  ? 516  LYS A N   1 
ATOM   3986 C CA  . LYS A 1 516 ? 1.384   14.096  12.964  1.00 63.52  ? 516  LYS A CA  1 
ATOM   3987 C C   . LYS A 1 516 ? 1.646   12.690  13.509  1.00 62.58  ? 516  LYS A C   1 
ATOM   3988 O O   . LYS A 1 516 ? 2.795   12.303  13.714  1.00 61.36  ? 516  LYS A O   1 
ATOM   3989 C CB  . LYS A 1 516 ? 1.179   14.043  11.448  1.00 64.06  ? 516  LYS A CB  1 
ATOM   3990 C CG  . LYS A 1 516 ? 0.590   15.346  10.875  1.00 66.65  ? 516  LYS A CG  1 
ATOM   3991 C CD  . LYS A 1 516 ? 0.741   15.475  9.349   1.00 67.81  ? 516  LYS A CD  1 
ATOM   3992 C CE  . LYS A 1 516 ? -0.084  14.423  8.592   1.00 73.15  ? 516  LYS A CE  1 
ATOM   3993 N NZ  . LYS A 1 516 ? 0.691   13.128  8.395   1.00 74.90  ? 516  LYS A NZ  1 
ATOM   3994 N N   . PRO A 1 517 ? 0.578   11.911  13.753  1.00 63.25  ? 517  PRO A N   1 
ATOM   3995 C CA  . PRO A 1 517 ? 0.788   10.528  14.171  1.00 63.06  ? 517  PRO A CA  1 
ATOM   3996 C C   . PRO A 1 517 ? 1.678   9.769   13.179  1.00 62.13  ? 517  PRO A C   1 
ATOM   3997 O O   . PRO A 1 517 ? 1.686   10.107  11.993  1.00 61.69  ? 517  PRO A O   1 
ATOM   3998 C CB  . PRO A 1 517 ? -0.634  9.946   14.187  1.00 65.01  ? 517  PRO A CB  1 
ATOM   3999 C CG  . PRO A 1 517 ? -1.531  11.106  14.335  1.00 65.65  ? 517  PRO A CG  1 
ATOM   4000 C CD  . PRO A 1 517 ? -0.855  12.253  13.659  1.00 65.08  ? 517  PRO A CD  1 
ATOM   4001 N N   . LEU A 1 518 ? 2.413   8.761   13.658  1.00 61.79  ? 518  LEU A N   1 
ATOM   4002 C CA  . LEU A 1 518 ? 3.349   7.997   12.806  1.00 61.23  ? 518  LEU A CA  1 
ATOM   4003 C C   . LEU A 1 518 ? 2.720   7.538   11.500  1.00 62.55  ? 518  LEU A C   1 
ATOM   4004 O O   . LEU A 1 518 ? 1.657   6.924   11.499  1.00 63.60  ? 518  LEU A O   1 
ATOM   4005 C CB  . LEU A 1 518 ? 3.850   6.726   13.493  1.00 61.15  ? 518  LEU A CB  1 
ATOM   4006 C CG  . LEU A 1 518 ? 4.919   6.724   14.562  1.00 60.16  ? 518  LEU A CG  1 
ATOM   4007 C CD1 . LEU A 1 518 ? 5.259   5.272   14.891  1.00 60.04  ? 518  LEU A CD1 1 
ATOM   4008 C CD2 . LEU A 1 518 ? 6.163   7.496   14.142  1.00 58.88  ? 518  LEU A CD2 1 
ATOM   4009 N N   . GLU A 1 519 ? 3.420   7.803   10.404  1.00 62.15  ? 519  GLU A N   1 
ATOM   4010 C CA  . GLU A 1 519 ? 3.031   7.341   9.088   1.00 63.53  ? 519  GLU A CA  1 
ATOM   4011 C C   . GLU A 1 519 ? 4.106   6.396   8.566   1.00 62.07  ? 519  GLU A C   1 
ATOM   4012 O O   . GLU A 1 519 ? 5.289   6.728   8.564   1.00 60.33  ? 519  GLU A O   1 
ATOM   4013 C CB  . GLU A 1 519 ? 2.871   8.553   8.169   1.00 63.76  ? 519  GLU A CB  1 
ATOM   4014 C CG  . GLU A 1 519 ? 2.775   8.254   6.687   1.00 66.10  ? 519  GLU A CG  1 
ATOM   4015 C CD  . GLU A 1 519 ? 2.433   9.501   5.880   1.00 66.69  ? 519  GLU A CD  1 
ATOM   4016 O OE1 . GLU A 1 519 ? 1.277   9.976   6.001   1.00 72.14  ? 519  GLU A OE1 1 
ATOM   4017 O OE2 . GLU A 1 519 ? 3.306   9.989   5.129   1.00 66.14  ? 519  GLU A OE2 1 
ATOM   4018 N N   . VAL A 1 520 ? 3.697   5.204   8.150   1.00 62.63  ? 520  VAL A N   1 
ATOM   4019 C CA  . VAL A 1 520 ? 4.621   4.212   7.613   1.00 62.15  ? 520  VAL A CA  1 
ATOM   4020 C C   . VAL A 1 520 ? 4.839   4.499   6.136   1.00 62.06  ? 520  VAL A C   1 
ATOM   4021 O O   . VAL A 1 520 ? 3.873   4.655   5.388   1.00 62.63  ? 520  VAL A O   1 
ATOM   4022 C CB  . VAL A 1 520 ? 4.076   2.783   7.805   1.00 63.97  ? 520  VAL A CB  1 
ATOM   4023 C CG1 . VAL A 1 520 ? 4.951   1.748   7.093   1.00 63.25  ? 520  VAL A CG1 1 
ATOM   4024 C CG2 . VAL A 1 520 ? 3.949   2.483   9.307   1.00 63.82  ? 520  VAL A CG2 1 
ATOM   4025 N N   . ARG A 1 521 ? 6.110   4.596   5.737   1.00 60.52  ? 521  ARG A N   1 
ATOM   4026 C CA  . ARG A 1 521 ? 6.497   4.794   4.336   1.00 60.67  ? 521  ARG A CA  1 
ATOM   4027 C C   . ARG A 1 521 ? 7.365   3.636   3.896   1.00 60.94  ? 521  ARG A C   1 
ATOM   4028 O O   . ARG A 1 521 ? 7.838   2.872   4.724   1.00 60.29  ? 521  ARG A O   1 
ATOM   4029 C CB  . ARG A 1 521 ? 7.246   6.121   4.162   1.00 59.03  ? 521  ARG A CB  1 
ATOM   4030 C CG  . ARG A 1 521 ? 6.380   7.308   4.482   1.00 58.72  ? 521  ARG A CG  1 
ATOM   4031 C CD  . ARG A 1 521 ? 7.117   8.608   4.407   1.00 58.49  ? 521  ARG A CD  1 
ATOM   4032 N NE  . ARG A 1 521 ? 6.312   9.702   4.951   1.00 58.24  ? 521  ARG A NE  1 
ATOM   4033 C CZ  . ARG A 1 521 ? 6.764   10.934  5.163   1.00 58.58  ? 521  ARG A CZ  1 
ATOM   4034 N NH1 . ARG A 1 521 ? 8.022   11.252  4.883   1.00 56.92  ? 521  ARG A NH1 1 
ATOM   4035 N NH2 . ARG A 1 521 ? 5.953   11.855  5.676   1.00 59.92  ? 521  ARG A NH2 1 
ATOM   4036 N N   . ARG A 1 522 ? 7.572   3.505   2.595   1.00 62.01  ? 522  ARG A N   1 
ATOM   4037 C CA  . ARG A 1 522 ? 8.326   2.380   2.057   1.00 63.63  ? 522  ARG A CA  1 
ATOM   4038 C C   . ARG A 1 522 ? 9.445   2.874   1.154   1.00 62.66  ? 522  ARG A C   1 
ATOM   4039 O O   . ARG A 1 522 ? 9.216   3.711   0.279   1.00 63.03  ? 522  ARG A O   1 
ATOM   4040 C CB  . ARG A 1 522 ? 7.397   1.428   1.284   1.00 65.13  ? 522  ARG A CB  1 
ATOM   4041 C CG  . ARG A 1 522 ? 6.515   0.542   2.188   1.00 67.92  ? 522  ARG A CG  1 
ATOM   4042 C CD  . ARG A 1 522 ? 5.802   -0.595  1.418   1.00 71.49  ? 522  ARG A CD  1 
ATOM   4043 N NE  . ARG A 1 522 ? 6.743   -1.395  0.617   1.00 75.87  ? 522  ARG A NE  1 
ATOM   4044 C CZ  . ARG A 1 522 ? 6.411   -2.341  -0.265  1.00 78.22  ? 522  ARG A CZ  1 
ATOM   4045 N NH1 . ARG A 1 522 ? 5.132   -2.659  -0.482  1.00 81.69  ? 522  ARG A NH1 1 
ATOM   4046 N NH2 . ARG A 1 522 ? 7.375   -2.979  -0.936  1.00 77.50  ? 522  ARG A NH2 1 
ATOM   4047 N N   . GLY A 1 523 ? 10.648  2.350   1.376   1.00 62.02  ? 523  GLY A N   1 
ATOM   4048 C CA  . GLY A 1 523 ? 11.801  2.665   0.551   1.00 61.67  ? 523  GLY A CA  1 
ATOM   4049 C C   . GLY A 1 523 ? 12.506  3.928   1.014   1.00 60.76  ? 523  GLY A C   1 
ATOM   4050 O O   . GLY A 1 523 ? 11.988  5.037   0.832   1.00 61.26  ? 523  GLY A O   1 
ATOM   4051 N N   . LEU A 1 524 ? 13.681  3.776   1.617   1.00 59.47  ? 524  LEU A N   1 
ATOM   4052 C CA  . LEU A 1 524 ? 14.466  4.943   2.014   1.00 58.25  ? 524  LEU A CA  1 
ATOM   4053 C C   . LEU A 1 524 ? 15.273  5.398   0.806   1.00 57.65  ? 524  LEU A C   1 
ATOM   4054 O O   . LEU A 1 524 ? 16.340  4.852   0.530   1.00 57.28  ? 524  LEU A O   1 
ATOM   4055 C CB  A LEU A 1 524 ? 15.415  4.583   3.165   0.50 57.57  ? 524  LEU A CB  1 
ATOM   4056 C CB  B LEU A 1 524 ? 15.372  4.638   3.210   0.50 57.54  ? 524  LEU A CB  1 
ATOM   4057 C CG  A LEU A 1 524 ? 14.832  4.399   4.571   0.50 57.92  ? 524  LEU A CG  1 
ATOM   4058 C CG  B LEU A 1 524 ? 16.049  5.866   3.845   0.50 56.67  ? 524  LEU A CG  1 
ATOM   4059 C CD1 A LEU A 1 524 ? 15.729  3.511   5.435   0.50 57.62  ? 524  LEU A CD1 1 
ATOM   4060 C CD1 B LEU A 1 524 ? 15.025  6.924   4.274   0.50 56.43  ? 524  LEU A CD1 1 
ATOM   4061 C CD2 A LEU A 1 524 ? 14.610  5.761   5.241   0.50 56.63  ? 524  LEU A CD2 1 
ATOM   4062 C CD2 B LEU A 1 524 ? 16.913  5.446   5.024   0.50 55.58  ? 524  LEU A CD2 1 
ATOM   4063 N N   . ARG A 1 525 ? 14.736  6.358   0.060   1.00 57.43  ? 525  ARG A N   1 
ATOM   4064 C CA  . ARG A 1 525 ? 15.375  6.838   -1.165  1.00 57.73  ? 525  ARG A CA  1 
ATOM   4065 C C   . ARG A 1 525 ? 15.824  5.714   -2.069  1.00 57.01  ? 525  ARG A C   1 
ATOM   4066 O O   . ARG A 1 525 ? 16.950  5.741   -2.568  1.00 56.33  ? 525  ARG A O   1 
ATOM   4067 C CB  . ARG A 1 525 ? 16.604  7.681   -0.822  1.00 57.36  ? 525  ARG A CB  1 
ATOM   4068 C CG  . ARG A 1 525 ? 16.264  9.019   -0.281  1.00 60.61  ? 525  ARG A CG  1 
ATOM   4069 C CD  . ARG A 1 525 ? 16.271  10.068  -1.339  1.00 65.04  ? 525  ARG A CD  1 
ATOM   4070 N NE  . ARG A 1 525 ? 16.813  11.290  -0.779  1.00 67.49  ? 525  ARG A NE  1 
ATOM   4071 C CZ  . ARG A 1 525 ? 16.169  12.090  0.064   1.00 68.53  ? 525  ARG A CZ  1 
ATOM   4072 N NH1 . ARG A 1 525 ? 14.926  11.815  0.443   1.00 69.98  ? 525  ARG A NH1 1 
ATOM   4073 N NH2 . ARG A 1 525 ? 16.774  13.190  0.510   1.00 67.66  ? 525  ARG A NH2 1 
ATOM   4074 N N   . ALA A 1 526 ? 14.942  4.744   -2.292  1.00 57.26  ? 526  ALA A N   1 
ATOM   4075 C CA  . ALA A 1 526 ? 15.307  3.508   -2.973  1.00 57.36  ? 526  ALA A CA  1 
ATOM   4076 C C   . ALA A 1 526 ? 16.010  3.725   -4.323  1.00 56.94  ? 526  ALA A C   1 
ATOM   4077 O O   . ALA A 1 526 ? 17.077  3.167   -4.533  1.00 56.47  ? 526  ALA A O   1 
ATOM   4078 C CB  . ALA A 1 526 ? 14.093  2.583   -3.117  1.00 58.43  ? 526  ALA A CB  1 
ATOM   4079 N N   . GLN A 1 527 ? 15.460  4.550   -5.215  1.00 57.01  ? 527  GLN A N   1 
ATOM   4080 C CA  . GLN A 1 527 ? 16.076  4.705   -6.545  1.00 57.38  ? 527  GLN A CA  1 
ATOM   4081 C C   . GLN A 1 527 ? 17.399  5.440   -6.483  1.00 55.88  ? 527  GLN A C   1 
ATOM   4082 O O   . GLN A 1 527 ? 18.388  4.982   -7.045  1.00 56.16  ? 527  GLN A O   1 
ATOM   4083 C CB  . GLN A 1 527 ? 15.156  5.410   -7.555  1.00 58.15  ? 527  GLN A CB  1 
ATOM   4084 C CG  . GLN A 1 527 ? 13.922  4.635   -7.963  1.00 60.61  ? 527  GLN A CG  1 
ATOM   4085 C CD  . GLN A 1 527 ? 14.207  3.245   -8.520  1.00 62.42  ? 527  GLN A CD  1 
ATOM   4086 O OE1 . GLN A 1 527 ? 13.746  2.246   -7.957  1.00 64.47  ? 527  GLN A OE1 1 
ATOM   4087 N NE2 . GLN A 1 527 ? 14.949  3.170   -9.632  1.00 61.52  ? 527  GLN A NE2 1 
ATOM   4088 N N   . THR A 1 528 ? 17.417  6.586   -5.813  1.00 54.67  ? 528  THR A N   1 
ATOM   4089 C CA  . THR A 1 528 ? 18.639  7.390   -5.716  1.00 53.54  ? 528  THR A CA  1 
ATOM   4090 C C   . THR A 1 528 ? 19.753  6.650   -4.957  1.00 52.78  ? 528  THR A C   1 
ATOM   4091 O O   . THR A 1 528 ? 20.911  6.725   -5.344  1.00 52.57  ? 528  THR A O   1 
ATOM   4092 C CB  . THR A 1 528 ? 18.365  8.778   -5.086  1.00 52.84  ? 528  THR A CB  1 
ATOM   4093 O OG1 . THR A 1 528 ? 17.582  9.555   -5.997  1.00 54.47  ? 528  THR A OG1 1 
ATOM   4094 C CG2 . THR A 1 528 ? 19.669  9.534   -4.789  1.00 51.91  ? 528  THR A CG2 1 
ATOM   4095 N N   . CYS A 1 529 ? 19.411  5.902   -3.913  1.00 52.57  ? 529  CYS A N   1 
ATOM   4096 C CA  . CYS A 1 529 ? 20.448  5.188   -3.171  1.00 52.30  ? 529  CYS A CA  1 
ATOM   4097 C C   . CYS A 1 529 ? 20.965  3.964   -3.938  1.00 53.39  ? 529  CYS A C   1 
ATOM   4098 O O   . CYS A 1 529 ? 22.094  3.526   -3.710  1.00 53.66  ? 529  CYS A O   1 
ATOM   4099 C CB  . CYS A 1 529 ? 19.998  4.874   -1.741  1.00 51.73  ? 529  CYS A CB  1 
ATOM   4100 S SG  . CYS A 1 529 ? 19.919  6.389   -0.671  1.00 51.47  ? 529  CYS A SG  1 
ATOM   4101 N N   . ALA A 1 530 ? 20.169  3.452   -4.880  1.00 54.26  ? 530  ALA A N   1 
ATOM   4102 C CA  . ALA A 1 530 ? 20.656  2.488   -5.865  1.00 55.01  ? 530  ALA A CA  1 
ATOM   4103 C C   . ALA A 1 530 ? 21.787  3.100   -6.678  1.00 54.70  ? 530  ALA A C   1 
ATOM   4104 O O   . ALA A 1 530 ? 22.777  2.435   -6.961  1.00 54.96  ? 530  ALA A O   1 
ATOM   4105 C CB  . ALA A 1 530 ? 19.524  2.024   -6.790  1.00 56.33  ? 530  ALA A CB  1 
ATOM   4106 N N   . PHE A 1 531 ? 21.650  4.375   -7.033  1.00 54.09  ? 531  PHE A N   1 
ATOM   4107 C CA  . PHE A 1 531 ? 22.697  5.081   -7.769  1.00 53.56  ? 531  PHE A CA  1 
ATOM   4108 C C   . PHE A 1 531 ? 24.001  5.144   -6.960  1.00 53.35  ? 531  PHE A C   1 
ATOM   4109 O O   . PHE A 1 531 ? 25.052  4.715   -7.436  1.00 53.75  ? 531  PHE A O   1 
ATOM   4110 C CB  . PHE A 1 531 ? 22.216  6.485   -8.158  1.00 52.98  ? 531  PHE A CB  1 
ATOM   4111 C CG  . PHE A 1 531 ? 23.312  7.396   -8.659  1.00 52.06  ? 531  PHE A CG  1 
ATOM   4112 C CD1 . PHE A 1 531 ? 23.795  7.276   -9.959  1.00 53.34  ? 531  PHE A CD1 1 
ATOM   4113 C CD2 . PHE A 1 531 ? 23.851  8.366   -7.836  1.00 51.24  ? 531  PHE A CD2 1 
ATOM   4114 C CE1 . PHE A 1 531 ? 24.791  8.096   -10.426 1.00 53.21  ? 531  PHE A CE1 1 
ATOM   4115 C CE2 . PHE A 1 531 ? 24.860  9.203   -8.297  1.00 52.66  ? 531  PHE A CE2 1 
ATOM   4116 C CZ  . PHE A 1 531 ? 25.325  9.066   -9.604  1.00 52.55  ? 531  PHE A CZ  1 
ATOM   4117 N N   . TRP A 1 532 ? 23.919  5.672   -5.741  1.00 52.59  ? 532  TRP A N   1 
ATOM   4118 C CA  . TRP A 1 532 ? 25.094  5.842   -4.875  1.00 52.39  ? 532  TRP A CA  1 
ATOM   4119 C C   . TRP A 1 532 ? 25.714  4.523   -4.402  1.00 53.53  ? 532  TRP A C   1 
ATOM   4120 O O   . TRP A 1 532 ? 26.939  4.419   -4.319  1.00 54.41  ? 532  TRP A O   1 
ATOM   4121 C CB  . TRP A 1 532 ? 24.745  6.678   -3.634  1.00 50.40  ? 532  TRP A CB  1 
ATOM   4122 C CG  . TRP A 1 532 ? 24.466  8.108   -3.914  1.00 49.36  ? 532  TRP A CG  1 
ATOM   4123 C CD1 . TRP A 1 532 ? 23.237  8.713   -3.971  1.00 49.28  ? 532  TRP A CD1 1 
ATOM   4124 C CD2 . TRP A 1 532 ? 25.428  9.137   -4.166  1.00 47.45  ? 532  TRP A CD2 1 
ATOM   4125 N NE1 . TRP A 1 532 ? 23.379  10.057  -4.231  1.00 48.30  ? 532  TRP A NE1 1 
ATOM   4126 C CE2 . TRP A 1 532 ? 24.715  10.341  -4.359  1.00 47.65  ? 532  TRP A CE2 1 
ATOM   4127 C CE3 . TRP A 1 532 ? 26.827  9.159   -4.251  1.00 48.40  ? 532  TRP A CE3 1 
ATOM   4128 C CZ2 . TRP A 1 532 ? 25.354  11.547  -4.644  1.00 47.29  ? 532  TRP A CZ2 1 
ATOM   4129 C CZ3 . TRP A 1 532 ? 27.460  10.359  -4.522  1.00 47.61  ? 532  TRP A CZ3 1 
ATOM   4130 C CH2 . TRP A 1 532 ? 26.727  11.535  -4.711  1.00 47.60  ? 532  TRP A CH2 1 
ATOM   4131 N N   . ASN A 1 533 ? 24.878  3.533   -4.092  1.00 54.60  ? 533  ASN A N   1 
ATOM   4132 C CA  . ASN A 1 533 ? 25.325  2.294   -3.429  1.00 55.27  ? 533  ASN A CA  1 
ATOM   4133 C C   . ASN A 1 533 ? 25.570  1.108   -4.340  1.00 57.43  ? 533  ASN A C   1 
ATOM   4134 O O   . ASN A 1 533 ? 26.256  0.171   -3.939  1.00 58.02  ? 533  ASN A O   1 
ATOM   4135 C CB  . ASN A 1 533 ? 24.301  1.848   -2.387  1.00 54.94  ? 533  ASN A CB  1 
ATOM   4136 C CG  . ASN A 1 533 ? 24.153  2.836   -1.253  1.00 52.99  ? 533  ASN A CG  1 
ATOM   4137 O OD1 . ASN A 1 533 ? 24.994  3.698   -1.070  1.00 53.42  ? 533  ASN A OD1 1 
ATOM   4138 N ND2 . ASN A 1 533 ? 23.087  2.707   -0.480  1.00 50.94  ? 533  ASN A ND2 1 
ATOM   4139 N N   . ARG A 1 534 ? 24.974  1.117   -5.531  1.00 58.90  ? 534  ARG A N   1 
ATOM   4140 C CA  . ARG A 1 534 ? 25.160  0.034   -6.492  1.00 61.31  ? 534  ARG A CA  1 
ATOM   4141 C C   . ARG A 1 534 ? 25.834  0.491   -7.773  1.00 62.11  ? 534  ARG A C   1 
ATOM   4142 O O   . ARG A 1 534 ? 26.681  -0.222  -8.296  1.00 63.02  ? 534  ARG A O   1 
ATOM   4143 C CB  . ARG A 1 534 ? 23.832  -0.646  -6.826  1.00 62.17  ? 534  ARG A CB  1 
ATOM   4144 C CG  . ARG A 1 534 ? 23.134  -1.283  -5.626  1.00 63.01  ? 534  ARG A CG  1 
ATOM   4145 C CD  . ARG A 1 534 ? 21.690  -1.629  -5.960  1.00 64.28  ? 534  ARG A CD  1 
ATOM   4146 N NE  . ARG A 1 534 ? 20.932  -2.154  -4.822  1.00 65.53  ? 534  ARG A NE  1 
ATOM   4147 C CZ  . ARG A 1 534 ? 20.858  -3.446  -4.488  1.00 66.50  ? 534  ARG A CZ  1 
ATOM   4148 N NH1 . ARG A 1 534 ? 21.490  -4.376  -5.193  1.00 66.43  ? 534  ARG A NH1 1 
ATOM   4149 N NH2 . ARG A 1 534 ? 20.125  -3.809  -3.439  1.00 66.84  ? 534  ARG A NH2 1 
ATOM   4150 N N   . PHE A 1 535 ? 25.482  1.667   -8.290  1.00 62.43  ? 535  PHE A N   1 
ATOM   4151 C CA  . PHE A 1 535 ? 26.061  2.087   -9.559  1.00 63.21  ? 535  PHE A CA  1 
ATOM   4152 C C   . PHE A 1 535 ? 27.430  2.722   -9.424  1.00 63.57  ? 535  PHE A C   1 
ATOM   4153 O O   . PHE A 1 535 ? 28.363  2.294   -10.090 1.00 64.24  ? 535  PHE A O   1 
ATOM   4154 C CB  . PHE A 1 535 ? 25.162  3.013   -10.367 1.00 62.46  ? 535  PHE A CB  1 
ATOM   4155 C CG  . PHE A 1 535 ? 25.795  3.437   -11.648 1.00 62.18  ? 535  PHE A CG  1 
ATOM   4156 C CD1 . PHE A 1 535 ? 26.021  2.510   -12.650 1.00 62.67  ? 535  PHE A CD1 1 
ATOM   4157 C CD2 . PHE A 1 535 ? 26.242  4.730   -11.825 1.00 60.18  ? 535  PHE A CD2 1 
ATOM   4158 C CE1 . PHE A 1 535 ? 26.641  2.879   -13.821 1.00 63.53  ? 535  PHE A CE1 1 
ATOM   4159 C CE2 . PHE A 1 535 ? 26.855  5.106   -13.001 1.00 61.13  ? 535  PHE A CE2 1 
ATOM   4160 C CZ  . PHE A 1 535 ? 27.061  4.184   -13.996 1.00 62.38  ? 535  PHE A CZ  1 
ATOM   4161 N N   . LEU A 1 536 ? 27.562  3.759   -8.611  1.00 63.89  ? 536  LEU A N   1 
ATOM   4162 C CA  . LEU A 1 536 ? 28.868  4.428   -8.505  1.00 64.97  ? 536  LEU A CA  1 
ATOM   4163 C C   . LEU A 1 536 ? 30.035  3.485   -8.145  1.00 66.73  ? 536  LEU A C   1 
ATOM   4164 O O   . LEU A 1 536 ? 31.104  3.586   -8.741  1.00 67.66  ? 536  LEU A O   1 
ATOM   4165 C CB  . LEU A 1 536 ? 28.819  5.622   -7.562  1.00 63.56  ? 536  LEU A CB  1 
ATOM   4166 C CG  . LEU A 1 536 ? 28.134  6.848   -8.151  1.00 63.66  ? 536  LEU A CG  1 
ATOM   4167 C CD1 . LEU A 1 536 ? 28.230  8.012   -7.186  1.00 62.25  ? 536  LEU A CD1 1 
ATOM   4168 C CD2 . LEU A 1 536 ? 28.730  7.223   -9.513  1.00 65.84  ? 536  LEU A CD2 1 
ATOM   4169 N N   . PRO A 1 537 ? 29.839  2.571   -7.180  1.00 68.23  ? 537  PRO A N   1 
ATOM   4170 C CA  . PRO A 1 537 ? 30.871  1.561   -6.922  1.00 70.05  ? 537  PRO A CA  1 
ATOM   4171 C C   . PRO A 1 537 ? 31.257  0.717   -8.146  1.00 72.76  ? 537  PRO A C   1 
ATOM   4172 O O   . PRO A 1 537 ? 32.442  0.441   -8.345  1.00 73.54  ? 537  PRO A O   1 
ATOM   4173 C CB  . PRO A 1 537 ? 30.229  0.673   -5.849  1.00 69.75  ? 537  PRO A CB  1 
ATOM   4174 C CG  . PRO A 1 537 ? 29.266  1.551   -5.171  1.00 68.44  ? 537  PRO A CG  1 
ATOM   4175 C CD  . PRO A 1 537 ? 28.708  2.433   -6.248  1.00 67.93  ? 537  PRO A CD  1 
ATOM   4176 N N   . LYS A 1 538 ? 30.272  0.300   -8.942  1.00 74.76  ? 538  LYS A N   1 
ATOM   4177 C CA  . LYS A 1 538 ? 30.546  -0.457  -10.167 1.00 77.24  ? 538  LYS A CA  1 
ATOM   4178 C C   . LYS A 1 538 ? 31.284  0.390   -11.202 1.00 77.69  ? 538  LYS A C   1 
ATOM   4179 O O   . LYS A 1 538 ? 32.090  -0.139  -11.967 1.00 79.30  ? 538  LYS A O   1 
ATOM   4180 C CB  . LYS A 1 538 ? 29.265  -1.035  -10.779 1.00 78.17  ? 538  LYS A CB  1 
ATOM   4181 C CG  . LYS A 1 538 ? 28.749  -2.277  -10.080 1.00 79.37  ? 538  LYS A CG  1 
ATOM   4182 C CD  . LYS A 1 538 ? 27.632  -2.915  -10.881 1.00 80.98  ? 538  LYS A CD  1 
ATOM   4183 C CE  . LYS A 1 538 ? 26.955  -4.070  -10.135 1.00 82.66  ? 538  LYS A CE  1 
ATOM   4184 N NZ  . LYS A 1 538 ? 25.766  -4.612  -10.890 1.00 84.32  ? 538  LYS A NZ  1 
ATOM   4185 N N   . LEU A 1 539 ? 31.014  1.690   -11.224 1.00 77.22  ? 539  LEU A N   1 
ATOM   4186 C CA  . LEU A 1 539 ? 31.737  2.610   -12.095 1.00 77.74  ? 539  LEU A CA  1 
ATOM   4187 C C   . LEU A 1 539 ? 33.198  2.626   -11.687 1.00 78.65  ? 539  LEU A C   1 
ATOM   4188 O O   . LEU A 1 539 ? 34.076  2.407   -12.520 1.00 79.74  ? 539  LEU A O   1 
ATOM   4189 C CB  . LEU A 1 539 ? 31.147  4.023   -12.011 1.00 76.59  ? 539  LEU A CB  1 
ATOM   4190 C CG  . LEU A 1 539 ? 31.658  5.130   -12.941 1.00 76.31  ? 539  LEU A CG  1 
ATOM   4191 C CD1 . LEU A 1 539 ? 31.711  4.678   -14.399 1.00 76.82  ? 539  LEU A CD1 1 
ATOM   4192 C CD2 . LEU A 1 539 ? 30.770  6.368   -12.807 1.00 75.09  ? 539  LEU A CD2 1 
ATOM   4193 N N   . LEU A 1 540 ? 33.434  2.857   -10.392 1.00 78.85  ? 540  LEU A N   1 
ATOM   4194 C CA  . LEU A 1 540 ? 34.781  2.892   -9.786  1.00 79.33  ? 540  LEU A CA  1 
ATOM   4195 C C   . LEU A 1 540 ? 35.699  1.758   -10.265 1.00 81.31  ? 540  LEU A C   1 
ATOM   4196 O O   . LEU A 1 540 ? 36.838  2.004   -10.662 1.00 81.93  ? 540  LEU A O   1 
ATOM   4197 C CB  . LEU A 1 540 ? 34.672  2.867   -8.249  1.00 78.40  ? 540  LEU A CB  1 
ATOM   4198 C CG  . LEU A 1 540 ? 35.926  3.187   -7.426  1.00 77.61  ? 540  LEU A CG  1 
ATOM   4199 C CD1 . LEU A 1 540 ? 36.465  4.582   -7.736  1.00 76.89  ? 540  LEU A CD1 1 
ATOM   4200 C CD2 . LEU A 1 540 ? 35.597  3.047   -5.948  1.00 76.86  ? 540  LEU A CD2 1 
ATOM   4201 N N   . SER A 1 541 ? 35.204  0.527   -10.229 1.00 82.82  ? 541  SER A N   1 
ATOM   4202 C CA  . SER A 1 541 ? 35.895  -0.598  -10.861 1.00 85.17  ? 541  SER A CA  1 
ATOM   4203 C C   . SER A 1 541 ? 36.015  -0.373  -12.391 1.00 86.66  ? 541  SER A C   1 
ATOM   4204 O O   . SER A 1 541 ? 35.282  -0.982  -13.191 1.00 87.91  ? 541  SER A O   1 
ATOM   4205 C CB  . SER A 1 541 ? 35.157  -1.903  -10.545 1.00 86.00  ? 541  SER A CB  1 
ATOM   4206 O OG  . SER A 1 541 ? 34.688  -1.900  -9.204  1.00 84.90  ? 541  SER A OG  1 
ATOM   4207 N N   . ALA A 1 542 ? 36.953  0.510   -12.768 1.00 86.72  ? 542  ALA A N   1 
ATOM   4208 C CA  . ALA A 1 542 ? 37.146  0.995   -14.148 1.00 87.14  ? 542  ALA A CA  1 
ATOM   4209 C C   . ALA A 1 542 ? 36.506  2.377   -14.350 1.00 86.08  ? 542  ALA A C   1 
ATOM   4210 O O   . ALA A 1 542 ? 37.062  3.412   -13.960 1.00 84.77  ? 542  ALA A O   1 
ATOM   4211 C CB  . ALA A 1 542 ? 36.607  -0.006  -15.168 1.00 88.69  ? 542  ALA A CB  1 
ATOM   4212 N N   . GLU B 1 4   ? -17.090 5.511   -69.780 1.00 92.70  ? 4    GLU B N   1 
ATOM   4213 C CA  . GLU B 1 4   ? -15.814 6.194   -69.390 1.00 90.69  ? 4    GLU B CA  1 
ATOM   4214 C C   . GLU B 1 4   ? -16.119 7.405   -68.493 1.00 90.13  ? 4    GLU B C   1 
ATOM   4215 O O   . GLU B 1 4   ? -16.723 8.386   -68.941 1.00 91.54  ? 4    GLU B O   1 
ATOM   4216 C CB  . GLU B 1 4   ? -15.048 6.628   -70.650 1.00 90.90  ? 4    GLU B CB  1 
ATOM   4217 C CG  . GLU B 1 4   ? -13.600 7.109   -70.434 1.00 89.62  ? 4    GLU B CG  1 
ATOM   4218 C CD  . GLU B 1 4   ? -12.582 5.966   -70.352 1.00 90.60  ? 4    GLU B CD  1 
ATOM   4219 O OE1 . GLU B 1 4   ? -12.668 5.168   -69.392 1.00 91.03  ? 4    GLU B OE1 1 
ATOM   4220 O OE2 . GLU B 1 4   ? -11.686 5.878   -71.236 1.00 90.70  ? 4    GLU B OE2 1 
ATOM   4221 N N   . ASP B 1 5   ? -15.712 7.321   -67.227 1.00 87.85  ? 5    ASP B N   1 
ATOM   4222 C CA  . ASP B 1 5   ? -15.967 8.378   -66.249 1.00 86.87  ? 5    ASP B CA  1 
ATOM   4223 C C   . ASP B 1 5   ? -14.836 9.406   -66.337 1.00 85.15  ? 5    ASP B C   1 
ATOM   4224 O O   . ASP B 1 5   ? -13.701 9.102   -65.965 1.00 83.49  ? 5    ASP B O   1 
ATOM   4225 C CB  . ASP B 1 5   ? -16.049 7.774   -64.839 1.00 85.95  ? 5    ASP B CB  1 
ATOM   4226 C CG  . ASP B 1 5   ? -16.614 8.740   -63.803 1.00 85.65  ? 5    ASP B CG  1 
ATOM   4227 O OD1 . ASP B 1 5   ? -16.991 8.268   -62.706 1.00 83.69  ? 5    ASP B OD1 1 
ATOM   4228 O OD2 . ASP B 1 5   ? -16.682 9.957   -64.074 1.00 85.27  ? 5    ASP B OD2 1 
ATOM   4229 N N   . PRO B 1 6   ? -15.131 10.625  -66.828 1.00 85.32  ? 6    PRO B N   1 
ATOM   4230 C CA  . PRO B 1 6   ? -14.069 11.620  -67.021 1.00 83.99  ? 6    PRO B CA  1 
ATOM   4231 C C   . PRO B 1 6   ? -13.356 12.066  -65.743 1.00 81.80  ? 6    PRO B C   1 
ATOM   4232 O O   . PRO B 1 6   ? -12.258 12.608  -65.824 1.00 80.77  ? 6    PRO B O   1 
ATOM   4233 C CB  . PRO B 1 6   ? -14.804 12.811  -67.655 1.00 85.99  ? 6    PRO B CB  1 
ATOM   4234 C CG  . PRO B 1 6   ? -16.222 12.635  -67.295 1.00 87.83  ? 6    PRO B CG  1 
ATOM   4235 C CD  . PRO B 1 6   ? -16.448 11.153  -67.228 1.00 87.68  ? 6    PRO B CD  1 
ATOM   4236 N N   . GLN B 1 7   ? -13.980 11.863  -64.585 1.00 80.98  ? 7    GLN B N   1 
ATOM   4237 C CA  . GLN B 1 7   ? -13.327 12.128  -63.304 1.00 78.99  ? 7    GLN B CA  1 
ATOM   4238 C C   . GLN B 1 7   ? -12.204 11.138  -63.042 1.00 76.15  ? 7    GLN B C   1 
ATOM   4239 O O   . GLN B 1 7   ? -11.299 11.427  -62.273 1.00 74.74  ? 7    GLN B O   1 
ATOM   4240 C CB  . GLN B 1 7   ? -14.337 12.061  -62.152 1.00 79.80  ? 7    GLN B CB  1 
ATOM   4241 C CG  . GLN B 1 7   ? -15.317 13.215  -62.112 1.00 82.22  ? 7    GLN B CG  1 
ATOM   4242 C CD  . GLN B 1 7   ? -14.644 14.537  -61.794 1.00 83.10  ? 7    GLN B CD  1 
ATOM   4243 O OE1 . GLN B 1 7   ? -13.880 14.642  -60.836 1.00 82.10  ? 7    GLN B OE1 1 
ATOM   4244 N NE2 . GLN B 1 7   ? -14.928 15.555  -62.595 1.00 85.09  ? 7    GLN B NE2 1 
ATOM   4245 N N   . LEU B 1 8   ? -12.276 9.972   -63.682 1.00 75.13  ? 8    LEU B N   1 
ATOM   4246 C CA  . LEU B 1 8   ? -11.281 8.920   -63.519 1.00 72.72  ? 8    LEU B CA  1 
ATOM   4247 C C   . LEU B 1 8   ? -10.237 8.894   -64.646 1.00 71.86  ? 8    LEU B C   1 
ATOM   4248 O O   . LEU B 1 8   ? -9.419  7.984   -64.704 1.00 70.67  ? 8    LEU B O   1 
ATOM   4249 C CB  . LEU B 1 8   ? -11.979 7.564   -63.425 1.00 72.88  ? 8    LEU B CB  1 
ATOM   4250 C CG  . LEU B 1 8   ? -13.104 7.454   -62.393 1.00 72.62  ? 8    LEU B CG  1 
ATOM   4251 C CD1 . LEU B 1 8   ? -13.782 6.095   -62.503 1.00 72.70  ? 8    LEU B CD1 1 
ATOM   4252 C CD2 . LEU B 1 8   ? -12.582 7.686   -60.990 1.00 69.85  ? 8    LEU B CD2 1 
ATOM   4253 N N   . LEU B 1 9   ? -10.257 9.891   -65.526 1.00 72.31  ? 9    LEU B N   1 
ATOM   4254 C CA  . LEU B 1 9   ? -9.255  10.015  -66.586 1.00 71.91  ? 9    LEU B CA  1 
ATOM   4255 C C   . LEU B 1 9   ? -8.361  11.219  -66.313 1.00 71.12  ? 9    LEU B C   1 
ATOM   4256 O O   . LEU B 1 9   ? -8.850  12.354  -66.242 1.00 71.77  ? 9    LEU B O   1 
ATOM   4257 C CB  . LEU B 1 9   ? -9.922  10.158  -67.958 1.00 73.48  ? 9    LEU B CB  1 
ATOM   4258 C CG  . LEU B 1 9   ? -10.092 8.863   -68.754 1.00 75.11  ? 9    LEU B CG  1 
ATOM   4259 C CD1 . LEU B 1 9   ? -11.007 9.105   -69.955 1.00 78.41  ? 9    LEU B CD1 1 
ATOM   4260 C CD2 . LEU B 1 9   ? -8.722  8.300   -69.207 1.00 73.66  ? 9    LEU B CD2 1 
ATOM   4261 N N   . VAL B 1 10  ? -7.062  10.967  -66.147 1.00 69.25  ? 10   VAL B N   1 
ATOM   4262 C CA  . VAL B 1 10  ? -6.085  12.024  -65.877 1.00 68.59  ? 10   VAL B CA  1 
ATOM   4263 C C   . VAL B 1 10  ? -4.898  11.923  -66.836 1.00 68.34  ? 10   VAL B C   1 
ATOM   4264 O O   . VAL B 1 10  ? -4.399  10.826  -67.088 1.00 67.94  ? 10   VAL B O   1 
ATOM   4265 C CB  . VAL B 1 10  ? -5.556  11.928  -64.433 1.00 67.15  ? 10   VAL B CB  1 
ATOM   4266 C CG1 . VAL B 1 10  ? -4.553  13.042  -64.144 1.00 66.21  ? 10   VAL B CG1 1 
ATOM   4267 C CG2 . VAL B 1 10  ? -6.700  11.992  -63.450 1.00 68.09  ? 10   VAL B CG2 1 
ATOM   4268 N N   . ARG B 1 11  ? -4.447  13.060  -67.362 1.00 68.93  ? 11   ARG B N   1 
ATOM   4269 C CA  . ARG B 1 11  ? -3.206  13.106  -68.121 1.00 68.86  ? 11   ARG B CA  1 
ATOM   4270 C C   . ARG B 1 11  ? -2.073  13.628  -67.239 1.00 67.33  ? 11   ARG B C   1 
ATOM   4271 O O   . ARG B 1 11  ? -2.119  14.756  -66.743 1.00 67.25  ? 11   ARG B O   1 
ATOM   4272 C CB  . ARG B 1 11  ? -3.335  13.949  -69.395 1.00 70.30  ? 11   ARG B CB  1 
ATOM   4273 C CG  . ARG B 1 11  ? -1.989  14.182  -70.119 1.00 70.73  ? 11   ARG B CG  1 
ATOM   4274 C CD  . ARG B 1 11  ? -2.128  14.389  -71.643 1.00 74.00  ? 11   ARG B CD  1 
ATOM   4275 N NE  . ARG B 1 11  ? -1.776  13.174  -72.408 1.00 76.88  ? 11   ARG B NE  1 
ATOM   4276 C CZ  . ARG B 1 11  ? -2.489  12.645  -73.405 1.00 78.78  ? 11   ARG B CZ  1 
ATOM   4277 N NH1 . ARG B 1 11  ? -3.630  13.194  -73.819 1.00 81.23  ? 11   ARG B NH1 1 
ATOM   4278 N NH2 . ARG B 1 11  ? -2.046  11.539  -74.000 1.00 79.43  ? 11   ARG B NH2 1 
ATOM   4279 N N   . VAL B 1 12  ? -1.065  12.779  -67.048 1.00 65.63  ? 12   VAL B N   1 
ATOM   4280 C CA  . VAL B 1 12  ? 0.171   13.147  -66.375 1.00 64.38  ? 12   VAL B CA  1 
ATOM   4281 C C   . VAL B 1 12  ? 1.262   13.295  -67.443 1.00 65.12  ? 12   VAL B C   1 
ATOM   4282 O O   . VAL B 1 12  ? 0.994   13.100  -68.630 1.00 65.46  ? 12   VAL B O   1 
ATOM   4283 C CB  . VAL B 1 12  ? 0.549   12.101  -65.301 1.00 63.12  ? 12   VAL B CB  1 
ATOM   4284 C CG1 . VAL B 1 12  ? -0.463  12.142  -64.149 1.00 62.27  ? 12   VAL B CG1 1 
ATOM   4285 C CG2 . VAL B 1 12  ? 0.632   10.699  -65.894 1.00 61.21  ? 12   VAL B CG2 1 
ATOM   4286 N N   . ARG B 1 13  ? 2.480   13.652  -67.040 1.00 65.04  ? 13   ARG B N   1 
ATOM   4287 C CA  . ARG B 1 13  ? 3.555   13.902  -68.008 1.00 66.28  ? 13   ARG B CA  1 
ATOM   4288 C C   . ARG B 1 13  ? 3.898   12.679  -68.838 1.00 65.03  ? 13   ARG B C   1 
ATOM   4289 O O   . ARG B 1 13  ? 4.240   12.808  -70.004 1.00 66.27  ? 13   ARG B O   1 
ATOM   4290 C CB  . ARG B 1 13  ? 4.816   14.448  -67.328 1.00 66.11  ? 13   ARG B CB  1 
ATOM   4291 C CG  . ARG B 1 13  ? 4.653   15.901  -66.887 1.00 68.47  ? 13   ARG B CG  1 
ATOM   4292 C CD  . ARG B 1 13  ? 5.962   16.576  -66.447 1.00 69.90  ? 13   ARG B CD  1 
ATOM   4293 N NE  . ARG B 1 13  ? 5.679   17.864  -65.792 1.00 73.58  ? 13   ARG B NE  1 
ATOM   4294 C CZ  . ARG B 1 13  ? 6.592   18.683  -65.256 1.00 76.43  ? 13   ARG B CZ  1 
ATOM   4295 N NH1 . ARG B 1 13  ? 7.890   18.376  -65.294 1.00 77.42  ? 13   ARG B NH1 1 
ATOM   4296 N NH2 . ARG B 1 13  ? 6.204   19.826  -64.679 1.00 76.48  ? 13   ARG B NH2 1 
ATOM   4297 N N   . GLY B 1 14  ? 3.790   11.496  -68.248 1.00 63.16  ? 14   GLY B N   1 
ATOM   4298 C CA  . GLY B 1 14  ? 4.141   10.265  -68.939 1.00 62.05  ? 14   GLY B CA  1 
ATOM   4299 C C   . GLY B 1 14  ? 3.066   9.737   -69.866 1.00 62.02  ? 14   GLY B C   1 
ATOM   4300 O O   . GLY B 1 14  ? 3.333   8.866   -70.683 1.00 61.07  ? 14   GLY B O   1 
ATOM   4301 N N   . GLY B 1 15  ? 1.849   10.259  -69.734 1.00 62.21  ? 15   GLY B N   1 
ATOM   4302 C CA  . GLY B 1 15  ? 0.718   9.810   -70.541 1.00 62.77  ? 15   GLY B CA  1 
ATOM   4303 C C   . GLY B 1 15  ? -0.580  9.776   -69.760 1.00 62.73  ? 15   GLY B C   1 
ATOM   4304 O O   . GLY B 1 15  ? -0.684  10.369  -68.687 1.00 61.63  ? 15   GLY B O   1 
ATOM   4305 N N   . GLN B 1 16  ? -1.560  9.049   -70.296 1.00 63.39  ? 16   GLN B N   1 
ATOM   4306 C CA  . GLN B 1 16  ? -2.913  9.004   -69.729 1.00 64.08  ? 16   GLN B CA  1 
ATOM   4307 C C   . GLN B 1 16  ? -3.112  7.848   -68.763 1.00 62.69  ? 16   GLN B C   1 
ATOM   4308 O O   . GLN B 1 16  ? -2.601  6.747   -68.978 1.00 61.68  ? 16   GLN B O   1 
ATOM   4309 C CB  . GLN B 1 16  ? -3.955  8.880   -70.832 1.00 65.35  ? 16   GLN B CB  1 
ATOM   4310 C CG  . GLN B 1 16  ? -4.201  10.145  -71.594 1.00 67.67  ? 16   GLN B CG  1 
ATOM   4311 C CD  . GLN B 1 16  ? -5.386  10.008  -72.522 1.00 69.95  ? 16   GLN B CD  1 
ATOM   4312 O OE1 . GLN B 1 16  ? -5.352  9.231   -73.483 1.00 73.66  ? 16   GLN B OE1 1 
ATOM   4313 N NE2 . GLN B 1 16  ? -6.454  10.750  -72.234 1.00 73.33  ? 16   GLN B NE2 1 
ATOM   4314 N N   . LEU B 1 17  ? -3.898  8.109   -67.722 1.00 62.38  ? 17   LEU B N   1 
ATOM   4315 C CA  . LEU B 1 17  ? -4.177  7.135   -66.677 1.00 62.03  ? 17   LEU B CA  1 
ATOM   4316 C C   . LEU B 1 17  ? -5.665  6.999   -66.547 1.00 63.18  ? 17   LEU B C   1 
ATOM   4317 O O   . LEU B 1 17  ? -6.390  7.971   -66.783 1.00 64.35  ? 17   LEU B O   1 
ATOM   4318 C CB  . LEU B 1 17  ? -3.647  7.634   -65.326 1.00 61.04  ? 17   LEU B CB  1 
ATOM   4319 C CG  . LEU B 1 17  ? -2.162  7.953   -65.224 1.00 60.18  ? 17   LEU B CG  1 
ATOM   4320 C CD1 . LEU B 1 17  ? -1.902  8.847   -64.022 1.00 58.28  ? 17   LEU B CD1 1 
ATOM   4321 C CD2 . LEU B 1 17  ? -1.371  6.647   -65.149 1.00 60.04  ? 17   LEU B CD2 1 
ATOM   4322 N N   . ARG B 1 18  ? -6.124  5.818   -66.143 1.00 63.53  ? 18   ARG B N   1 
ATOM   4323 C CA  . ARG B 1 18  ? -7.517  5.640   -65.744 1.00 64.79  ? 18   ARG B CA  1 
ATOM   4324 C C   . ARG B 1 18  ? -7.589  5.113   -64.326 1.00 63.34  ? 18   ARG B C   1 
ATOM   4325 O O   . ARG B 1 18  ? -7.035  4.060   -64.025 1.00 62.55  ? 18   ARG B O   1 
ATOM   4326 C CB  . ARG B 1 18  ? -8.274  4.688   -66.672 1.00 65.90  ? 18   ARG B CB  1 
ATOM   4327 C CG  . ARG B 1 18  ? -9.773  4.579   -66.303 1.00 67.89  ? 18   ARG B CG  1 
ATOM   4328 C CD  . ARG B 1 18  ? -10.609 4.098   -67.456 1.00 71.56  ? 18   ARG B CD  1 
ATOM   4329 N NE  . ARG B 1 18  ? -9.939  2.965   -68.086 1.00 75.76  ? 18   ARG B NE  1 
ATOM   4330 C CZ  . ARG B 1 18  ? -9.511  2.901   -69.347 1.00 76.66  ? 18   ARG B CZ  1 
ATOM   4331 N NH1 . ARG B 1 18  ? -9.710  3.890   -70.219 1.00 78.05  ? 18   ARG B NH1 1 
ATOM   4332 N NH2 . ARG B 1 18  ? -8.889  1.801   -69.742 1.00 77.57  ? 18   ARG B NH2 1 
ATOM   4333 N N   . GLY B 1 19  ? -8.294  5.843   -63.467 1.00 63.18  ? 19   GLY B N   1 
ATOM   4334 C CA  . GLY B 1 19  ? -8.461  5.447   -62.082 1.00 62.32  ? 19   GLY B CA  1 
ATOM   4335 C C   . GLY B 1 19  ? -9.729  4.661   -61.854 1.00 63.60  ? 19   GLY B C   1 
ATOM   4336 O O   . GLY B 1 19  ? -10.388 4.227   -62.805 1.00 64.24  ? 19   GLY B O   1 
ATOM   4337 N N   . ILE B 1 20  ? -10.076 4.500   -60.581 1.00 63.51  ? 20   ILE B N   1 
ATOM   4338 C CA  . ILE B 1 20  ? -11.234 3.715   -60.184 1.00 64.88  ? 20   ILE B CA  1 
ATOM   4339 C C   . ILE B 1 20  ? -11.978 4.447   -59.075 1.00 65.91  ? 20   ILE B C   1 
ATOM   4340 O O   . ILE B 1 20  ? -11.371 5.046   -58.184 1.00 64.83  ? 20   ILE B O   1 
ATOM   4341 C CB  . ILE B 1 20  ? -10.815 2.295   -59.729 1.00 64.58  ? 20   ILE B CB  1 
ATOM   4342 C CG1 . ILE B 1 20  ? -12.034 1.464   -59.306 1.00 65.75  ? 20   ILE B CG1 1 
ATOM   4343 C CG2 . ILE B 1 20  ? -9.799  2.368   -58.610 1.00 62.61  ? 20   ILE B CG2 1 
ATOM   4344 C CD1 . ILE B 1 20  ? -11.711 0.001   -59.012 1.00 65.21  ? 20   ILE B CD1 1 
ATOM   4345 N N   . ARG B 1 21  ? -13.297 4.406   -59.145 1.00 67.85  ? 21   ARG B N   1 
ATOM   4346 C CA  . ARG B 1 21  ? -14.138 5.032   -58.146 1.00 69.63  ? 21   ARG B CA  1 
ATOM   4347 C C   . ARG B 1 21  ? -14.292 4.063   -56.980 1.00 69.26  ? 21   ARG B C   1 
ATOM   4348 O O   . ARG B 1 21  ? -14.804 2.959   -57.148 1.00 69.97  ? 21   ARG B O   1 
ATOM   4349 C CB  . ARG B 1 21  ? -15.497 5.371   -58.764 1.00 71.53  ? 21   ARG B CB  1 
ATOM   4350 C CG  . ARG B 1 21  ? -16.498 5.995   -57.828 1.00 73.80  ? 21   ARG B CG  1 
ATOM   4351 C CD  . ARG B 1 21  ? -17.900 5.924   -58.434 1.00 77.46  ? 21   ARG B CD  1 
ATOM   4352 N NE  . ARG B 1 21  ? -18.897 6.330   -57.454 1.00 81.35  ? 21   ARG B NE  1 
ATOM   4353 C CZ  . ARG B 1 21  ? -20.142 6.676   -57.753 1.00 85.43  ? 21   ARG B CZ  1 
ATOM   4354 N NH1 . ARG B 1 21  ? -20.568 6.642   -59.018 1.00 88.92  ? 21   ARG B NH1 1 
ATOM   4355 N NH2 . ARG B 1 21  ? -20.975 7.045   -56.779 1.00 86.31  ? 21   ARG B NH2 1 
ATOM   4356 N N   . LEU B 1 22  ? -13.834 4.473   -55.802 1.00 68.51  ? 22   LEU B N   1 
ATOM   4357 C CA  . LEU B 1 22  ? -13.989 3.663   -54.600 1.00 68.83  ? 22   LEU B CA  1 
ATOM   4358 C C   . LEU B 1 22  ? -15.077 4.243   -53.713 1.00 70.18  ? 22   LEU B C   1 
ATOM   4359 O O   . LEU B 1 22  ? -15.386 5.426   -53.787 1.00 70.74  ? 22   LEU B O   1 
ATOM   4360 C CB  . LEU B 1 22  ? -12.678 3.578   -53.823 1.00 67.00  ? 22   LEU B CB  1 
ATOM   4361 C CG  . LEU B 1 22  ? -11.468 2.982   -54.549 1.00 66.07  ? 22   LEU B CG  1 
ATOM   4362 C CD1 . LEU B 1 22  ? -10.255 2.952   -53.618 1.00 64.54  ? 22   LEU B CD1 1 
ATOM   4363 C CD2 . LEU B 1 22  ? -11.775 1.598   -55.072 1.00 66.97  ? 22   LEU B CD2 1 
ATOM   4364 N N   . LYS B 1 23  ? -15.653 3.389   -52.876 1.00 71.42  ? 23   LYS B N   1 
ATOM   4365 C CA  . LYS B 1 23  ? -16.733 3.771   -51.974 1.00 73.12  ? 23   LYS B CA  1 
ATOM   4366 C C   . LYS B 1 23  ? -16.152 3.932   -50.579 1.00 71.84  ? 23   LYS B C   1 
ATOM   4367 O O   . LYS B 1 23  ? -15.619 2.981   -50.005 1.00 70.91  ? 23   LYS B O   1 
ATOM   4368 C CB  . LYS B 1 23  ? -17.835 2.700   -52.006 1.00 75.59  ? 23   LYS B CB  1 
ATOM   4369 C CG  . LYS B 1 23  ? -18.854 2.735   -50.872 1.00 78.46  ? 23   LYS B CG  1 
ATOM   4370 C CD  . LYS B 1 23  ? -19.894 3.853   -51.028 1.00 82.10  ? 23   LYS B CD  1 
ATOM   4371 C CE  . LYS B 1 23  ? -20.981 3.749   -49.950 1.00 83.39  ? 23   LYS B CE  1 
ATOM   4372 N NZ  . LYS B 1 23  ? -21.473 5.089   -49.514 1.00 85.52  ? 23   LYS B NZ  1 
ATOM   4373 N N   . ALA B 1 24  ? -16.216 5.152   -50.055 1.00 71.32  ? 24   ALA B N   1 
ATOM   4374 C CA  . ALA B 1 24  ? -15.934 5.395   -48.651 1.00 70.63  ? 24   ALA B CA  1 
ATOM   4375 C C   . ALA B 1 24  ? -17.303 5.470   -47.968 1.00 72.25  ? 24   ALA B C   1 
ATOM   4376 O O   . ALA B 1 24  ? -18.312 5.635   -48.649 1.00 73.93  ? 24   ALA B O   1 
ATOM   4377 C CB  . ALA B 1 24  ? -15.146 6.678   -48.475 1.00 69.26  ? 24   ALA B CB  1 
ATOM   4378 N N   . PRO B 1 25  ? -17.349 5.329   -46.629 1.00 72.13  ? 25   PRO B N   1 
ATOM   4379 C CA  . PRO B 1 25  ? -18.637 5.339   -45.918 1.00 73.74  ? 25   PRO B CA  1 
ATOM   4380 C C   . PRO B 1 25  ? -19.513 6.559   -46.214 1.00 74.62  ? 25   PRO B C   1 
ATOM   4381 O O   . PRO B 1 25  ? -20.726 6.428   -46.334 1.00 76.79  ? 25   PRO B O   1 
ATOM   4382 C CB  . PRO B 1 25  ? -18.218 5.328   -44.441 1.00 72.92  ? 25   PRO B CB  1 
ATOM   4383 C CG  . PRO B 1 25  ? -16.898 4.696   -44.432 1.00 71.29  ? 25   PRO B CG  1 
ATOM   4384 C CD  . PRO B 1 25  ? -16.221 5.139   -45.696 1.00 70.48  ? 25   PRO B CD  1 
ATOM   4385 N N   . GLY B 1 26  ? -18.895 7.728   -46.337 1.00 73.47  ? 26   GLY B N   1 
ATOM   4386 C CA  . GLY B 1 26  ? -19.622 8.976   -46.559 1.00 74.36  ? 26   GLY B CA  1 
ATOM   4387 C C   . GLY B 1 26  ? -19.839 9.324   -48.020 1.00 74.77  ? 26   GLY B C   1 
ATOM   4388 O O   . GLY B 1 26  ? -20.551 10.276  -48.329 1.00 75.76  ? 26   GLY B O   1 
ATOM   4389 N N   . GLY B 1 27  ? -19.216 8.570   -48.922 1.00 73.65  ? 27   GLY B N   1 
ATOM   4390 C CA  . GLY B 1 27  ? -19.357 8.824   -50.352 1.00 74.09  ? 27   GLY B CA  1 
ATOM   4391 C C   . GLY B 1 27  ? -18.206 8.296   -51.180 1.00 72.33  ? 27   GLY B C   1 
ATOM   4392 O O   . GLY B 1 27  ? -17.289 7.663   -50.647 1.00 71.33  ? 27   GLY B O   1 
ATOM   4393 N N   . PRO B 1 28  ? -18.243 8.553   -52.497 1.00 72.43  ? 28   PRO B N   1 
ATOM   4394 C CA  . PRO B 1 28  ? -17.195 8.083   -53.406 1.00 70.79  ? 28   PRO B CA  1 
ATOM   4395 C C   . PRO B 1 28  ? -15.873 8.839   -53.288 1.00 68.74  ? 28   PRO B C   1 
ATOM   4396 O O   . PRO B 1 28  ? -15.851 9.992   -52.865 1.00 68.88  ? 28   PRO B O   1 
ATOM   4397 C CB  . PRO B 1 28  ? -17.799 8.323   -54.786 1.00 72.09  ? 28   PRO B CB  1 
ATOM   4398 C CG  . PRO B 1 28  ? -18.747 9.476   -54.587 1.00 73.82  ? 28   PRO B CG  1 
ATOM   4399 C CD  . PRO B 1 28  ? -19.301 9.302   -53.206 1.00 74.14  ? 28   PRO B CD  1 
ATOM   4400 N N   . VAL B 1 29  ? -14.788 8.174   -53.672 1.00 66.91  ? 29   VAL B N   1 
ATOM   4401 C CA  . VAL B 1 29  ? -13.485 8.813   -53.855 1.00 65.18  ? 29   VAL B CA  1 
ATOM   4402 C C   . VAL B 1 29  ? -12.857 8.291   -55.142 1.00 64.39  ? 29   VAL B C   1 
ATOM   4403 O O   . VAL B 1 29  ? -13.196 7.202   -55.595 1.00 65.24  ? 29   VAL B O   1 
ATOM   4404 C CB  . VAL B 1 29  ? -12.527 8.531   -52.668 1.00 63.79  ? 29   VAL B CB  1 
ATOM   4405 C CG1 . VAL B 1 29  ? -13.120 9.060   -51.380 1.00 63.76  ? 29   VAL B CG1 1 
ATOM   4406 C CG2 . VAL B 1 29  ? -12.229 7.044   -52.545 1.00 63.24  ? 29   VAL B CG2 1 
ATOM   4407 N N   . SER B 1 30  ? -11.976 9.081   -55.744 1.00 63.20  ? 30   SER B N   1 
ATOM   4408 C CA  . SER B 1 30  ? -11.202 8.634   -56.909 1.00 62.53  ? 30   SER B CA  1 
ATOM   4409 C C   . SER B 1 30  ? -9.879  8.038   -56.449 1.00 60.48  ? 30   SER B C   1 
ATOM   4410 O O   . SER B 1 30  ? -9.189  8.623   -55.617 1.00 60.11  ? 30   SER B O   1 
ATOM   4411 C CB  . SER B 1 30  ? -10.911 9.800   -57.850 1.00 62.95  ? 30   SER B CB  1 
ATOM   4412 O OG  . SER B 1 30  ? -12.095 10.485  -58.234 1.00 64.28  ? 30   SER B OG  1 
ATOM   4413 N N   . ALA B 1 31  ? -9.523  6.878   -56.984 1.00 59.75  ? 31   ALA B N   1 
ATOM   4414 C CA  . ALA B 1 31  ? -8.247  6.242   -56.665 1.00 57.82  ? 31   ALA B CA  1 
ATOM   4415 C C   . ALA B 1 31  ? -7.513  5.966   -57.962 1.00 57.36  ? 31   ALA B C   1 
ATOM   4416 O O   . ALA B 1 31  ? -8.092  5.448   -58.913 1.00 58.10  ? 31   ALA B O   1 
ATOM   4417 C CB  . ALA B 1 31  ? -8.463  4.961   -55.894 1.00 57.49  ? 31   ALA B CB  1 
ATOM   4418 N N   . PHE B 1 32  ? -6.248  6.355   -57.999 1.00 56.06  ? 32   PHE B N   1 
ATOM   4419 C CA  . PHE B 1 32  ? -5.353  6.065   -59.105 1.00 55.63  ? 32   PHE B CA  1 
ATOM   4420 C C   . PHE B 1 32  ? -4.174  5.291   -58.520 1.00 53.99  ? 32   PHE B C   1 
ATOM   4421 O O   . PHE B 1 32  ? -3.297  5.864   -57.877 1.00 52.47  ? 32   PHE B O   1 
ATOM   4422 C CB  . PHE B 1 32  ? -4.906  7.368   -59.762 1.00 56.14  ? 32   PHE B CB  1 
ATOM   4423 C CG  . PHE B 1 32  ? -6.050  8.232   -60.206 1.00 58.21  ? 32   PHE B CG  1 
ATOM   4424 C CD1 . PHE B 1 32  ? -6.630  9.146   -59.333 1.00 58.99  ? 32   PHE B CD1 1 
ATOM   4425 C CD2 . PHE B 1 32  ? -6.560  8.122   -61.491 1.00 59.91  ? 32   PHE B CD2 1 
ATOM   4426 C CE1 . PHE B 1 32  ? -7.686  9.929   -59.739 1.00 60.48  ? 32   PHE B CE1 1 
ATOM   4427 C CE2 . PHE B 1 32  ? -7.615  8.913   -61.905 1.00 61.06  ? 32   PHE B CE2 1 
ATOM   4428 C CZ  . PHE B 1 32  ? -8.181  9.814   -61.030 1.00 61.01  ? 32   PHE B CZ  1 
ATOM   4429 N N   . LEU B 1 33  ? -4.195  3.980   -58.734 1.00 53.60  ? 33   LEU B N   1 
ATOM   4430 C CA  . LEU B 1 33  ? -3.347  3.028   -58.036 1.00 52.78  ? 33   LEU B CA  1 
ATOM   4431 C C   . LEU B 1 33  ? -2.366  2.340   -58.994 1.00 52.73  ? 33   LEU B C   1 
ATOM   4432 O O   . LEU B 1 33  ? -2.718  1.994   -60.112 1.00 54.10  ? 33   LEU B O   1 
ATOM   4433 C CB  . LEU B 1 33  ? -4.239  1.953   -57.385 1.00 53.15  ? 33   LEU B CB  1 
ATOM   4434 C CG  . LEU B 1 33  ? -5.373  2.432   -56.470 1.00 53.08  ? 33   LEU B CG  1 
ATOM   4435 C CD1 . LEU B 1 33  ? -6.181  1.265   -55.970 1.00 51.83  ? 33   LEU B CD1 1 
ATOM   4436 C CD2 . LEU B 1 33  ? -4.834  3.247   -55.285 1.00 50.42  ? 33   LEU B CD2 1 
ATOM   4437 N N   . GLY B 1 34  ? -1.145  2.112   -58.541 1.00 51.93  ? 34   GLY B N   1 
ATOM   4438 C CA  . GLY B 1 34  ? -0.136  1.415   -59.356 1.00 52.02  ? 34   GLY B CA  1 
ATOM   4439 C C   . GLY B 1 34  ? 0.438   2.236   -60.492 1.00 51.79  ? 34   GLY B C   1 
ATOM   4440 O O   . GLY B 1 34  ? 0.724   1.695   -61.548 1.00 52.84  ? 34   GLY B O   1 
ATOM   4441 N N   . ILE B 1 35  ? 0.622   3.536   -60.271 1.00 51.53  ? 35   ILE B N   1 
ATOM   4442 C CA  . ILE B 1 35  ? 1.191   4.436   -61.276 1.00 51.09  ? 35   ILE B CA  1 
ATOM   4443 C C   . ILE B 1 35  ? 2.717   4.336   -61.233 1.00 50.49  ? 35   ILE B C   1 
ATOM   4444 O O   . ILE B 1 35  ? 3.312   4.581   -60.189 1.00 49.79  ? 35   ILE B O   1 
ATOM   4445 C CB  . ILE B 1 35  ? 0.818   5.921   -60.996 1.00 51.23  ? 35   ILE B CB  1 
ATOM   4446 C CG1 . ILE B 1 35  ? -0.699  6.128   -60.901 1.00 51.89  ? 35   ILE B CG1 1 
ATOM   4447 C CG2 . ILE B 1 35  ? 1.368   6.838   -62.088 1.00 51.87  ? 35   ILE B CG2 1 
ATOM   4448 C CD1 . ILE B 1 35  ? -1.093  7.503   -60.392 1.00 51.30  ? 35   ILE B CD1 1 
ATOM   4449 N N   . PRO B 1 36  ? 3.363   3.992   -62.363 1.00 50.91  ? 36   PRO B N   1 
ATOM   4450 C CA  . PRO B 1 36  ? 4.818   3.883   -62.370 1.00 50.19  ? 36   PRO B CA  1 
ATOM   4451 C C   . PRO B 1 36  ? 5.497   5.253   -62.263 1.00 50.62  ? 36   PRO B C   1 
ATOM   4452 O O   . PRO B 1 36  ? 5.152   6.173   -63.026 1.00 51.59  ? 36   PRO B O   1 
ATOM   4453 C CB  . PRO B 1 36  ? 5.105   3.244   -63.725 1.00 50.79  ? 36   PRO B CB  1 
ATOM   4454 C CG  . PRO B 1 36  ? 3.969   3.659   -64.588 1.00 51.89  ? 36   PRO B CG  1 
ATOM   4455 C CD  . PRO B 1 36  ? 2.780   3.689   -63.685 1.00 51.93  ? 36   PRO B CD  1 
ATOM   4456 N N   . PHE B 1 37  ? 6.419   5.405   -61.310 1.00 49.78  ? 37   PHE B N   1 
ATOM   4457 C CA  . PHE B 1 37  ? 7.229   6.636   -61.198 1.00 49.60  ? 37   PHE B CA  1 
ATOM   4458 C C   . PHE B 1 37  ? 8.708   6.424   -61.552 1.00 49.55  ? 37   PHE B C   1 
ATOM   4459 O O   . PHE B 1 37  ? 9.473   7.378   -61.615 1.00 50.12  ? 37   PHE B O   1 
ATOM   4460 C CB  . PHE B 1 37  ? 7.077   7.277   -59.806 1.00 49.21  ? 37   PHE B CB  1 
ATOM   4461 C CG  . PHE B 1 37  ? 7.700   6.487   -58.687 1.00 48.62  ? 37   PHE B CG  1 
ATOM   4462 C CD1 . PHE B 1 37  ? 9.025   6.682   -58.339 1.00 48.66  ? 37   PHE B CD1 1 
ATOM   4463 C CD2 . PHE B 1 37  ? 6.954   5.578   -57.959 1.00 48.37  ? 37   PHE B CD2 1 
ATOM   4464 C CE1 . PHE B 1 37  ? 9.600   5.971   -57.302 1.00 48.43  ? 37   PHE B CE1 1 
ATOM   4465 C CE2 . PHE B 1 37  ? 7.530   4.853   -56.911 1.00 47.37  ? 37   PHE B CE2 1 
ATOM   4466 C CZ  . PHE B 1 37  ? 8.842   5.050   -56.586 1.00 47.92  ? 37   PHE B CZ  1 
ATOM   4467 N N   . ALA B 1 38  ? 9.098   5.178   -61.811 1.00 49.35  ? 38   ALA B N   1 
ATOM   4468 C CA  . ALA B 1 38  ? 10.470  4.851   -62.185 1.00 49.54  ? 38   ALA B CA  1 
ATOM   4469 C C   . ALA B 1 38  ? 10.494  3.698   -63.181 1.00 50.04  ? 38   ALA B C   1 
ATOM   4470 O O   . ALA B 1 38  ? 9.545   2.921   -63.272 1.00 49.53  ? 38   ALA B O   1 
ATOM   4471 C CB  . ALA B 1 38  ? 11.282  4.467   -60.940 1.00 48.80  ? 38   ALA B CB  1 
ATOM   4472 N N   . GLU B 1 39  ? 11.597  3.573   -63.908 1.00 50.82  ? 39   GLU B N   1 
ATOM   4473 C CA  . GLU B 1 39  ? 11.851  2.356   -64.665 1.00 51.57  ? 39   GLU B CA  1 
ATOM   4474 C C   . GLU B 1 39  ? 12.003  1.240   -63.647 1.00 51.26  ? 39   GLU B C   1 
ATOM   4475 O O   . GLU B 1 39  ? 12.587  1.468   -62.589 1.00 50.38  ? 39   GLU B O   1 
ATOM   4476 C CB  . GLU B 1 39  ? 13.135  2.476   -65.488 1.00 52.42  ? 39   GLU B CB  1 
ATOM   4477 C CG  . GLU B 1 39  ? 13.039  3.490   -66.615 1.00 52.89  ? 39   GLU B CG  1 
ATOM   4478 C CD  . GLU B 1 39  ? 12.113  3.030   -67.698 1.00 54.56  ? 39   GLU B CD  1 
ATOM   4479 O OE1 . GLU B 1 39  ? 12.587  2.284   -68.573 1.00 55.93  ? 39   GLU B OE1 1 
ATOM   4480 O OE2 . GLU B 1 39  ? 10.915  3.401   -67.668 1.00 52.96  ? 39   GLU B OE2 1 
ATOM   4481 N N   . PRO B 1 40  ? 11.453  0.043   -63.937 1.00 51.58  ? 40   PRO B N   1 
ATOM   4482 C CA  . PRO B 1 40  ? 11.671  -1.075  -63.023 1.00 51.52  ? 40   PRO B CA  1 
ATOM   4483 C C   . PRO B 1 40  ? 13.156  -1.301  -62.690 1.00 51.80  ? 40   PRO B C   1 
ATOM   4484 O O   . PRO B 1 40  ? 13.982  -1.381  -63.589 1.00 52.22  ? 40   PRO B O   1 
ATOM   4485 C CB  . PRO B 1 40  ? 11.065  -2.265  -63.763 1.00 52.11  ? 40   PRO B CB  1 
ATOM   4486 C CG  . PRO B 1 40  ? 10.062  -1.677  -64.678 1.00 52.32  ? 40   PRO B CG  1 
ATOM   4487 C CD  . PRO B 1 40  ? 10.572  -0.323  -65.059 1.00 52.33  ? 40   PRO B CD  1 
ATOM   4488 N N   . PRO B 1 41  ? 13.498  -1.372  -61.391 1.00 51.66  ? 41   PRO B N   1 
ATOM   4489 C CA  . PRO B 1 41  ? 14.899  -1.509  -60.994 1.00 52.11  ? 41   PRO B CA  1 
ATOM   4490 C C   . PRO B 1 41  ? 15.354  -2.959  -61.019 1.00 53.00  ? 41   PRO B C   1 
ATOM   4491 O O   . PRO B 1 41  ? 15.772  -3.507  -60.003 1.00 53.53  ? 41   PRO B O   1 
ATOM   4492 C CB  . PRO B 1 41  ? 14.908  -0.935  -59.582 1.00 51.45  ? 41   PRO B CB  1 
ATOM   4493 C CG  . PRO B 1 41  ? 13.534  -1.232  -59.052 1.00 50.68  ? 41   PRO B CG  1 
ATOM   4494 C CD  . PRO B 1 41  ? 12.603  -1.304  -60.224 1.00 51.10  ? 41   PRO B CD  1 
ATOM   4495 N N   . VAL B 1 42  ? 15.291  -3.562  -62.199 1.00 54.18  ? 42   VAL B N   1 
ATOM   4496 C CA  . VAL B 1 42  ? 15.545  -4.982  -62.365 1.00 54.81  ? 42   VAL B CA  1 
ATOM   4497 C C   . VAL B 1 42  ? 16.802  -5.228  -63.189 1.00 56.32  ? 42   VAL B C   1 
ATOM   4498 O O   . VAL B 1 42  ? 17.257  -4.357  -63.935 1.00 56.19  ? 42   VAL B O   1 
ATOM   4499 C CB  . VAL B 1 42  ? 14.345  -5.690  -63.028 1.00 55.26  ? 42   VAL B CB  1 
ATOM   4500 C CG1 . VAL B 1 42  ? 13.056  -5.477  -62.197 1.00 54.29  ? 42   VAL B CG1 1 
ATOM   4501 C CG2 . VAL B 1 42  ? 14.161  -5.217  -64.469 1.00 54.49  ? 42   VAL B CG2 1 
ATOM   4502 N N   . GLY B 1 43  ? 17.352  -6.430  -63.039 1.00 57.61  ? 43   GLY B N   1 
ATOM   4503 C CA  . GLY B 1 43  ? 18.574  -6.835  -63.725 1.00 59.12  ? 43   GLY B CA  1 
ATOM   4504 C C   . GLY B 1 43  ? 19.785  -5.998  -63.350 1.00 59.45  ? 43   GLY B C   1 
ATOM   4505 O O   . GLY B 1 43  ? 20.211  -5.977  -62.189 1.00 59.41  ? 43   GLY B O   1 
ATOM   4506 N N   . SER B 1 44  ? 20.335  -5.304  -64.348 1.00 60.13  ? 44   SER B N   1 
ATOM   4507 C CA  . SER B 1 44  ? 21.505  -4.446  -64.174 1.00 60.52  ? 44   SER B CA  1 
ATOM   4508 C C   . SER B 1 44  ? 21.192  -3.250  -63.299 1.00 59.22  ? 44   SER B C   1 
ATOM   4509 O O   . SER B 1 44  ? 22.101  -2.606  -62.785 1.00 59.16  ? 44   SER B O   1 
ATOM   4510 C CB  . SER B 1 44  ? 21.994  -3.922  -65.526 1.00 61.55  ? 44   SER B CB  1 
ATOM   4511 O OG  . SER B 1 44  ? 21.156  -2.859  -65.993 1.00 62.19  ? 44   SER B OG  1 
ATOM   4512 N N   . ARG B 1 45  ? 19.905  -2.940  -63.149 1.00 58.09  ? 45   ARG B N   1 
ATOM   4513 C CA  . ARG B 1 45  ? 19.478  -1.778  -62.362 1.00 56.86  ? 45   ARG B CA  1 
ATOM   4514 C C   . ARG B 1 45  ? 19.314  -2.089  -60.863 1.00 55.92  ? 45   ARG B C   1 
ATOM   4515 O O   . ARG B 1 45  ? 19.019  -1.197  -60.074 1.00 55.25  ? 45   ARG B O   1 
ATOM   4516 C CB  A ARG B 1 45  ? 18.158  -1.217  -62.907 0.50 56.26  ? 45   ARG B CB  1 
ATOM   4517 C CB  B ARG B 1 45  ? 18.213  -1.162  -62.970 0.50 56.59  ? 45   ARG B CB  1 
ATOM   4518 C CG  A ARG B 1 45  ? 18.169  -0.807  -64.387 0.50 56.57  ? 45   ARG B CG  1 
ATOM   4519 C CG  B ARG B 1 45  ? 18.531  -0.157  -64.087 0.50 57.67  ? 45   ARG B CG  1 
ATOM   4520 C CD  A ARG B 1 45  ? 16.999  0.139   -64.693 0.50 56.48  ? 45   ARG B CD  1 
ATOM   4521 C CD  B ARG B 1 45  ? 18.965  1.189   -63.487 0.50 59.26  ? 45   ARG B CD  1 
ATOM   4522 N NE  A ARG B 1 45  ? 16.776  0.333   -66.130 0.50 56.92  ? 45   ARG B NE  1 
ATOM   4523 N NE  B ARG B 1 45  ? 20.199  1.722   -64.063 0.50 60.97  ? 45   ARG B NE  1 
ATOM   4524 C CZ  A ARG B 1 45  ? 15.793  -0.214  -66.847 0.50 56.72  ? 45   ARG B CZ  1 
ATOM   4525 C CZ  B ARG B 1 45  ? 20.794  2.842   -63.651 0.50 61.23  ? 45   ARG B CZ  1 
ATOM   4526 N NH1 A ARG B 1 45  ? 14.878  -1.015  -66.301 0.50 54.45  ? 45   ARG B NH1 1 
ATOM   4527 N NH1 B ARG B 1 45  ? 20.271  3.572   -62.663 0.50 59.29  ? 45   ARG B NH1 1 
ATOM   4528 N NH2 A ARG B 1 45  ? 15.719  0.060   -68.146 0.50 59.19  ? 45   ARG B NH2 1 
ATOM   4529 N NH2 B ARG B 1 45  ? 21.924  3.236   -64.237 0.50 62.26  ? 45   ARG B NH2 1 
ATOM   4530 N N   . ARG B 1 46  ? 19.513  -3.346  -60.469 1.00 55.78  ? 46   ARG B N   1 
ATOM   4531 C CA  . ARG B 1 46  ? 19.461  -3.720  -59.054 1.00 55.24  ? 46   ARG B CA  1 
ATOM   4532 C C   . ARG B 1 46  ? 20.583  -3.009  -58.295 1.00 55.17  ? 46   ARG B C   1 
ATOM   4533 O O   . ARG B 1 46  ? 21.715  -2.956  -58.782 1.00 55.74  ? 46   ARG B O   1 
ATOM   4534 C CB  . ARG B 1 46  ? 19.603  -5.239  -58.881 1.00 55.95  ? 46   ARG B CB  1 
ATOM   4535 C CG  . ARG B 1 46  ? 19.553  -5.684  -57.425 1.00 55.82  ? 46   ARG B CG  1 
ATOM   4536 C CD  . ARG B 1 46  ? 19.943  -7.131  -57.275 1.00 56.24  ? 46   ARG B CD  1 
ATOM   4537 N NE  . ARG B 1 46  ? 18.841  -8.044  -57.536 1.00 55.29  ? 46   ARG B NE  1 
ATOM   4538 C CZ  . ARG B 1 46  ? 18.956  -9.371  -57.477 1.00 57.08  ? 46   ARG B CZ  1 
ATOM   4539 N NH1 . ARG B 1 46  ? 20.125  -9.930  -57.180 1.00 57.37  ? 46   ARG B NH1 1 
ATOM   4540 N NH2 . ARG B 1 46  ? 17.905  -10.140 -57.715 1.00 56.49  ? 46   ARG B NH2 1 
ATOM   4541 N N   . PHE B 1 47  ? 20.238  -2.457  -57.125 1.00 54.30  ? 47   PHE B N   1 
ATOM   4542 C CA  . PHE B 1 47  ? 21.140  -1.650  -56.272 1.00 54.17  ? 47   PHE B CA  1 
ATOM   4543 C C   . PHE B 1 47  ? 21.460  -0.262  -56.825 1.00 54.28  ? 47   PHE B C   1 
ATOM   4544 O O   . PHE B 1 47  ? 22.197  0.495   -56.196 1.00 54.63  ? 47   PHE B O   1 
ATOM   4545 C CB  . PHE B 1 47  ? 22.476  -2.365  -55.993 1.00 54.54  ? 47   PHE B CB  1 
ATOM   4546 C CG  . PHE B 1 47  ? 22.338  -3.792  -55.572 1.00 54.51  ? 47   PHE B CG  1 
ATOM   4547 C CD1 . PHE B 1 47  ? 21.525  -4.143  -54.496 1.00 52.63  ? 47   PHE B CD1 1 
ATOM   4548 C CD2 . PHE B 1 47  ? 23.049  -4.795  -56.232 1.00 55.17  ? 47   PHE B CD2 1 
ATOM   4549 C CE1 . PHE B 1 47  ? 21.403  -5.468  -54.097 1.00 53.77  ? 47   PHE B CE1 1 
ATOM   4550 C CE2 . PHE B 1 47  ? 22.933  -6.126  -55.841 1.00 55.19  ? 47   PHE B CE2 1 
ATOM   4551 C CZ  . PHE B 1 47  ? 22.122  -6.465  -54.766 1.00 55.20  ? 47   PHE B CZ  1 
ATOM   4552 N N   . MET B 1 48  ? 20.945  0.066   -58.002 1.00 54.64  ? 48   MET B N   1 
ATOM   4553 C CA  . MET B 1 48  ? 21.252  1.343   -58.648 1.00 55.29  ? 48   MET B CA  1 
ATOM   4554 C C   . MET B 1 48  ? 20.179  2.365   -58.346 1.00 54.13  ? 48   MET B C   1 
ATOM   4555 O O   . MET B 1 48  ? 19.028  2.000   -58.123 1.00 52.76  ? 48   MET B O   1 
ATOM   4556 C CB  . MET B 1 48  ? 21.354  1.159   -60.170 1.00 56.59  ? 48   MET B CB  1 
ATOM   4557 C CG  . MET B 1 48  ? 22.577  0.351   -60.638 1.00 60.25  ? 48   MET B CG  1 
ATOM   4558 S SD  . MET B 1 48  ? 24.051  1.376   -60.726 1.00 65.87  ? 48   MET B SD  1 
ATOM   4559 C CE  . MET B 1 48  ? 24.286  1.798   -59.024 1.00 65.97  ? 48   MET B CE  1 
ATOM   4560 N N   . PRO B 1 49  ? 20.546  3.657   -58.347 1.00 54.18  ? 49   PRO B N   1 
ATOM   4561 C CA  . PRO B 1 49  ? 19.545  4.711   -58.233 1.00 53.56  ? 49   PRO B CA  1 
ATOM   4562 C C   . PRO B 1 49  ? 18.402  4.543   -59.234 1.00 53.28  ? 49   PRO B C   1 
ATOM   4563 O O   . PRO B 1 49  ? 18.618  4.020   -60.321 1.00 53.72  ? 49   PRO B O   1 
ATOM   4564 C CB  . PRO B 1 49  ? 20.345  5.985   -58.547 1.00 54.09  ? 49   PRO B CB  1 
ATOM   4565 C CG  . PRO B 1 49  ? 21.700  5.676   -58.116 1.00 54.73  ? 49   PRO B CG  1 
ATOM   4566 C CD  . PRO B 1 49  ? 21.906  4.213   -58.429 1.00 54.97  ? 49   PRO B CD  1 
ATOM   4567 N N   . PRO B 1 50  ? 17.193  5.000   -58.875 1.00 52.90  ? 50   PRO B N   1 
ATOM   4568 C CA  . PRO B 1 50  ? 16.051  4.883   -59.791 1.00 52.87  ? 50   PRO B CA  1 
ATOM   4569 C C   . PRO B 1 50  ? 16.141  5.850   -60.967 1.00 54.02  ? 50   PRO B C   1 
ATOM   4570 O O   . PRO B 1 50  ? 16.625  6.956   -60.808 1.00 54.36  ? 50   PRO B O   1 
ATOM   4571 C CB  . PRO B 1 50  ? 14.863  5.234   -58.903 1.00 52.07  ? 50   PRO B CB  1 
ATOM   4572 C CG  . PRO B 1 50  ? 15.435  6.138   -57.864 1.00 51.79  ? 50   PRO B CG  1 
ATOM   4573 C CD  . PRO B 1 50  ? 16.818  5.640   -57.601 1.00 51.62  ? 50   PRO B CD  1 
ATOM   4574 N N   . GLU B 1 51  ? 15.703  5.423   -62.146 1.00 55.14  ? 51   GLU B N   1 
ATOM   4575 C CA  . GLU B 1 51  ? 15.632  6.300   -63.313 1.00 56.81  ? 51   GLU B CA  1 
ATOM   4576 C C   . GLU B 1 51  ? 14.162  6.661   -63.539 1.00 55.07  ? 51   GLU B C   1 
ATOM   4577 O O   . GLU B 1 51  ? 13.276  5.871   -63.252 1.00 53.46  ? 51   GLU B O   1 
ATOM   4578 C CB  . GLU B 1 51  ? 16.223  5.599   -64.544 1.00 57.75  ? 51   GLU B CB  1 
ATOM   4579 C CG  . GLU B 1 51  ? 17.695  5.206   -64.367 1.00 61.24  ? 51   GLU B CG  1 
ATOM   4580 C CD  . GLU B 1 51  ? 18.244  4.264   -65.463 1.00 64.07  ? 51   GLU B CD  1 
ATOM   4581 O OE1 . GLU B 1 51  ? 17.554  3.275   -65.858 1.00 70.62  ? 51   GLU B OE1 1 
ATOM   4582 O OE2 . GLU B 1 51  ? 19.411  4.494   -65.899 1.00 71.96  ? 51   GLU B OE2 1 
ATOM   4583 N N   . PRO B 1 52  ? 13.893  7.877   -64.030 1.00 55.38  ? 52   PRO B N   1 
ATOM   4584 C CA  . PRO B 1 52  ? 12.501  8.228   -64.334 1.00 54.74  ? 52   PRO B CA  1 
ATOM   4585 C C   . PRO B 1 52  ? 11.808  7.299   -65.345 1.00 54.26  ? 52   PRO B C   1 
ATOM   4586 O O   . PRO B 1 52  ? 12.416  6.839   -66.299 1.00 54.32  ? 52   PRO B O   1 
ATOM   4587 C CB  . PRO B 1 52  ? 12.602  9.649   -64.899 1.00 55.78  ? 52   PRO B CB  1 
ATOM   4588 C CG  . PRO B 1 52  ? 13.926  10.173  -64.440 1.00 56.86  ? 52   PRO B CG  1 
ATOM   4589 C CD  . PRO B 1 52  ? 14.829  8.986   -64.299 1.00 56.02  ? 52   PRO B CD  1 
ATOM   4590 N N   . LYS B 1 53  ? 10.526  7.050   -65.112 1.00 53.83  ? 53   LYS B N   1 
ATOM   4591 C CA  . LYS B 1 53  ? 9.700   6.207   -65.969 1.00 54.05  ? 53   LYS B CA  1 
ATOM   4592 C C   . LYS B 1 53  ? 9.557   6.824   -67.351 1.00 54.81  ? 53   LYS B C   1 
ATOM   4593 O O   . LYS B 1 53  ? 9.225   8.003   -67.470 1.00 54.93  ? 53   LYS B O   1 
ATOM   4594 C CB  . LYS B 1 53  ? 8.312   6.035   -65.337 1.00 53.69  ? 53   LYS B CB  1 
ATOM   4595 C CG  . LYS B 1 53  ? 7.281   5.278   -66.162 1.00 54.06  ? 53   LYS B CG  1 
ATOM   4596 C CD  . LYS B 1 53  ? 7.676   3.833   -66.377 1.00 54.33  ? 53   LYS B CD  1 
ATOM   4597 C CE  . LYS B 1 53  ? 6.616   3.049   -67.183 1.00 53.87  ? 53   LYS B CE  1 
ATOM   4598 N NZ  . LYS B 1 53  ? 6.726   3.305   -68.636 1.00 53.45  ? 53   LYS B NZ  1 
ATOM   4599 N N   . ARG B 1 54  ? 9.818   6.027   -68.390 1.00 54.88  ? 54   ARG B N   1 
ATOM   4600 C CA  . ARG B 1 54  ? 9.582   6.456   -69.765 1.00 55.57  ? 54   ARG B CA  1 
ATOM   4601 C C   . ARG B 1 54  ? 8.074   6.624   -70.027 1.00 55.93  ? 54   ARG B C   1 
ATOM   4602 O O   . ARG B 1 54  ? 7.260   5.918   -69.443 1.00 54.69  ? 54   ARG B O   1 
ATOM   4603 C CB  . ARG B 1 54  ? 10.157  5.442   -70.734 1.00 56.06  ? 54   ARG B CB  1 
ATOM   4604 C CG  . ARG B 1 54  ? 11.669  5.323   -70.707 1.00 56.04  ? 54   ARG B CG  1 
ATOM   4605 C CD  . ARG B 1 54  ? 12.147  4.149   -71.550 1.00 56.55  ? 54   ARG B CD  1 
ATOM   4606 N NE  . ARG B 1 54  ? 11.478  2.898   -71.180 1.00 56.39  ? 54   ARG B NE  1 
ATOM   4607 C CZ  . ARG B 1 54  ? 10.728  2.145   -71.990 1.00 56.39  ? 54   ARG B CZ  1 
ATOM   4608 N NH1 . ARG B 1 54  ? 10.179  1.039   -71.513 1.00 55.62  ? 54   ARG B NH1 1 
ATOM   4609 N NH2 . ARG B 1 54  ? 10.526  2.466   -73.264 1.00 56.86  ? 54   ARG B NH2 1 
ATOM   4610 N N   . PRO B 1 55  ? 7.695   7.570   -70.900 1.00 57.49  ? 55   PRO B N   1 
ATOM   4611 C CA  . PRO B 1 55  ? 6.277   7.765   -71.232 1.00 57.95  ? 55   PRO B CA  1 
ATOM   4612 C C   . PRO B 1 55  ? 5.659   6.548   -71.908 1.00 58.28  ? 55   PRO B C   1 
ATOM   4613 O O   . PRO B 1 55  ? 6.377   5.696   -72.434 1.00 58.86  ? 55   PRO B O   1 
ATOM   4614 C CB  . PRO B 1 55  ? 6.296   8.945   -72.209 1.00 59.35  ? 55   PRO B CB  1 
ATOM   4615 C CG  . PRO B 1 55  ? 7.604   9.628   -71.972 1.00 59.66  ? 55   PRO B CG  1 
ATOM   4616 C CD  . PRO B 1 55  ? 8.554   8.526   -71.622 1.00 58.84  ? 55   PRO B CD  1 
ATOM   4617 N N   . TRP B 1 56  ? 4.336   6.476   -71.888 1.00 58.38  ? 56   TRP B N   1 
ATOM   4618 C CA  . TRP B 1 56  ? 3.611   5.302   -72.359 1.00 58.51  ? 56   TRP B CA  1 
ATOM   4619 C C   . TRP B 1 56  ? 2.482   5.701   -73.292 1.00 59.52  ? 56   TRP B C   1 
ATOM   4620 O O   . TRP B 1 56  ? 1.973   6.819   -73.213 1.00 59.59  ? 56   TRP B O   1 
ATOM   4621 C CB  . TRP B 1 56  ? 3.045   4.534   -71.166 1.00 58.00  ? 56   TRP B CB  1 
ATOM   4622 C CG  . TRP B 1 56  ? 2.150   5.338   -70.280 1.00 57.58  ? 56   TRP B CG  1 
ATOM   4623 C CD1 . TRP B 1 56  ? 0.809   5.525   -70.433 1.00 58.46  ? 56   TRP B CD1 1 
ATOM   4624 C CD2 . TRP B 1 56  ? 2.521   6.056   -69.089 1.00 56.84  ? 56   TRP B CD2 1 
ATOM   4625 N NE1 . TRP B 1 56  ? 0.322   6.321   -69.423 1.00 58.37  ? 56   TRP B NE1 1 
ATOM   4626 C CE2 . TRP B 1 56  ? 1.353   6.658   -68.585 1.00 57.77  ? 56   TRP B CE2 1 
ATOM   4627 C CE3 . TRP B 1 56  ? 3.727   6.251   -68.406 1.00 56.60  ? 56   TRP B CE3 1 
ATOM   4628 C CZ2 . TRP B 1 56  ? 1.356   7.439   -67.430 1.00 56.89  ? 56   TRP B CZ2 1 
ATOM   4629 C CZ3 . TRP B 1 56  ? 3.730   7.033   -67.266 1.00 55.51  ? 56   TRP B CZ3 1 
ATOM   4630 C CH2 . TRP B 1 56  ? 2.553   7.605   -66.781 1.00 55.96  ? 56   TRP B CH2 1 
ATOM   4631 N N   . SER B 1 57  ? 2.095   4.769   -74.160 1.00 59.99  ? 57   SER B N   1 
ATOM   4632 C CA  . SER B 1 57  ? 1.038   4.985   -75.132 1.00 61.35  ? 57   SER B CA  1 
ATOM   4633 C C   . SER B 1 57  ? -0.320  4.705   -74.515 1.00 61.26  ? 57   SER B C   1 
ATOM   4634 O O   . SER B 1 57  ? -0.424  4.002   -73.516 1.00 60.23  ? 57   SER B O   1 
ATOM   4635 C CB  . SER B 1 57  ? 1.243   4.049   -76.332 1.00 62.53  ? 57   SER B CB  1 
ATOM   4636 O OG  . SER B 1 57  ? 1.069   2.692   -75.953 1.00 62.23  ? 57   SER B OG  1 
ATOM   4637 N N   . GLY B 1 58  ? -1.363  5.251   -75.122 1.00 62.31  ? 58   GLY B N   1 
ATOM   4638 C CA  . GLY B 1 58  ? -2.729  4.933   -74.726 1.00 62.81  ? 58   GLY B CA  1 
ATOM   4639 C C   . GLY B 1 58  ? -3.022  5.288   -73.281 1.00 61.91  ? 58   GLY B C   1 
ATOM   4640 O O   . GLY B 1 58  ? -2.403  6.199   -72.720 1.00 61.47  ? 58   GLY B O   1 
ATOM   4641 N N   . VAL B 1 59  ? -3.956  4.548   -72.682 1.00 61.94  ? 59   VAL B N   1 
ATOM   4642 C CA  . VAL B 1 59  ? -4.450  4.823   -71.334 1.00 61.65  ? 59   VAL B CA  1 
ATOM   4643 C C   . VAL B 1 59  ? -3.976  3.732   -70.386 1.00 60.63  ? 59   VAL B C   1 
ATOM   4644 O O   . VAL B 1 59  ? -4.362  2.578   -70.533 1.00 60.94  ? 59   VAL B O   1 
ATOM   4645 C CB  . VAL B 1 59  ? -6.004  4.880   -71.308 1.00 62.87  ? 59   VAL B CB  1 
ATOM   4646 C CG1 . VAL B 1 59  ? -6.509  5.254   -69.913 1.00 62.63  ? 59   VAL B CG1 1 
ATOM   4647 C CG2 . VAL B 1 59  ? -6.522  5.870   -72.347 1.00 63.75  ? 59   VAL B CG2 1 
ATOM   4648 N N   . LEU B 1 60  ? -3.135  4.102   -69.420 1.00 60.05  ? 60   LEU B N   1 
ATOM   4649 C CA  . LEU B 1 60  ? -2.588  3.143   -68.462 1.00 59.30  ? 60   LEU B CA  1 
ATOM   4650 C C   . LEU B 1 60  ? -3.602  2.850   -67.367 1.00 59.50  ? 60   LEU B C   1 
ATOM   4651 O O   . LEU B 1 60  ? -4.155  3.766   -66.747 1.00 59.79  ? 60   LEU B O   1 
ATOM   4652 C CB  . LEU B 1 60  ? -1.288  3.672   -67.853 1.00 58.35  ? 60   LEU B CB  1 
ATOM   4653 C CG  . LEU B 1 60  ? -0.449  2.704   -67.016 1.00 57.71  ? 60   LEU B CG  1 
ATOM   4654 C CD1 . LEU B 1 60  ? -0.058  1.456   -67.824 1.00 60.00  ? 60   LEU B CD1 1 
ATOM   4655 C CD2 . LEU B 1 60  ? 0.792   3.394   -66.537 1.00 57.30  ? 60   LEU B CD2 1 
ATOM   4656 N N   . ASP B 1 61  ? -3.839  1.564   -67.140 1.00 60.00  ? 61   ASP B N   1 
ATOM   4657 C CA  . ASP B 1 61  ? -4.816  1.081   -66.166 1.00 60.53  ? 61   ASP B CA  1 
ATOM   4658 C C   . ASP B 1 61  ? -4.286  1.290   -64.748 1.00 59.28  ? 61   ASP B C   1 
ATOM   4659 O O   . ASP B 1 61  ? -3.356  0.595   -64.328 1.00 58.83  ? 61   ASP B O   1 
ATOM   4660 C CB  . ASP B 1 61  ? -5.102  -0.406  -66.439 1.00 61.71  ? 61   ASP B CB  1 
ATOM   4661 C CG  . ASP B 1 61  ? -5.849  -1.100  -65.306 1.00 64.37  ? 61   ASP B CG  1 
ATOM   4662 O OD1 . ASP B 1 61  ? -5.565  -2.299  -65.055 1.00 66.57  ? 61   ASP B OD1 1 
ATOM   4663 O OD2 . ASP B 1 61  ? -6.724  -0.465  -64.678 1.00 67.53  ? 61   ASP B OD2 1 
ATOM   4664 N N   . ALA B 1 62  ? -4.862  2.260   -64.025 1.00 58.66  ? 62   ALA B N   1 
ATOM   4665 C CA  . ALA B 1 62  ? -4.441  2.576   -62.648 1.00 57.37  ? 62   ALA B CA  1 
ATOM   4666 C C   . ALA B 1 62  ? -5.590  2.315   -61.660 1.00 57.36  ? 62   ALA B C   1 
ATOM   4667 O O   . ALA B 1 62  ? -5.962  3.184   -60.855 1.00 56.17  ? 62   ALA B O   1 
ATOM   4668 C CB  . ALA B 1 62  ? -3.941  4.030   -62.548 1.00 56.56  ? 62   ALA B CB  1 
ATOM   4669 N N   . THR B 1 63  ? -6.147  1.105   -61.744 1.00 57.68  ? 63   THR B N   1 
ATOM   4670 C CA  . THR B 1 63  ? -7.319  0.715   -60.967 1.00 58.28  ? 63   THR B CA  1 
ATOM   4671 C C   . THR B 1 63  ? -6.993  -0.255  -59.834 1.00 57.87  ? 63   THR B C   1 
ATOM   4672 O O   . THR B 1 63  ? -7.862  -0.534  -58.999 1.00 58.66  ? 63   THR B O   1 
ATOM   4673 C CB  . THR B 1 63  ? -8.403  0.039   -61.869 1.00 59.87  ? 63   THR B CB  1 
ATOM   4674 O OG1 . THR B 1 63  ? -7.882  -1.177  -62.433 1.00 59.72  ? 63   THR B OG1 1 
ATOM   4675 C CG2 . THR B 1 63  ? -8.880  0.980   -63.003 1.00 59.58  ? 63   THR B CG2 1 
ATOM   4676 N N   . THR B 1 64  ? -5.771  -0.790  -59.820 1.00 56.54  ? 64   THR B N   1 
ATOM   4677 C CA  . THR B 1 64  ? -5.370  -1.792  -58.830 1.00 56.14  ? 64   THR B CA  1 
ATOM   4678 C C   . THR B 1 64  ? -3.984  -1.484  -58.257 1.00 55.00  ? 64   THR B C   1 
ATOM   4679 O O   . THR B 1 64  ? -3.167  -0.807  -58.894 1.00 54.50  ? 64   THR B O   1 
ATOM   4680 C CB  . THR B 1 64  ? -5.380  -3.238  -59.419 1.00 56.79  ? 64   THR B CB  1 
ATOM   4681 O OG1 . THR B 1 64  ? -4.485  -3.328  -60.524 1.00 56.47  ? 64   THR B OG1 1 
ATOM   4682 C CG2 . THR B 1 64  ? -6.777  -3.629  -59.915 1.00 58.79  ? 64   THR B CG2 1 
ATOM   4683 N N   . PHE B 1 65  ? -3.739  -1.966  -57.039 1.00 54.63  ? 65   PHE B N   1 
ATOM   4684 C CA  . PHE B 1 65  ? -2.430  -1.833  -56.411 1.00 53.84  ? 65   PHE B CA  1 
ATOM   4685 C C   . PHE B 1 65  ? -1.440  -2.691  -57.185 1.00 53.51  ? 65   PHE B C   1 
ATOM   4686 O O   . PHE B 1 65  ? -1.786  -3.759  -57.670 1.00 54.71  ? 65   PHE B O   1 
ATOM   4687 C CB  . PHE B 1 65  ? -2.454  -2.299  -54.949 1.00 53.39  ? 65   PHE B CB  1 
ATOM   4688 C CG  . PHE B 1 65  ? -3.080  -1.318  -53.995 1.00 53.06  ? 65   PHE B CG  1 
ATOM   4689 C CD1 . PHE B 1 65  ? -2.521  -0.060  -53.799 1.00 52.27  ? 65   PHE B CD1 1 
ATOM   4690 C CD2 . PHE B 1 65  ? -4.210  -1.665  -53.262 1.00 53.31  ? 65   PHE B CD2 1 
ATOM   4691 C CE1 . PHE B 1 65  ? -3.079  0.839   -52.914 1.00 50.26  ? 65   PHE B CE1 1 
ATOM   4692 C CE2 . PHE B 1 65  ? -4.776  -0.764  -52.371 1.00 53.30  ? 65   PHE B CE2 1 
ATOM   4693 C CZ  . PHE B 1 65  ? -4.204  0.487   -52.198 1.00 52.90  ? 65   PHE B CZ  1 
ATOM   4694 N N   . GLN B 1 66  ? -0.211  -2.219  -57.282 1.00 52.71  ? 66   GLN B N   1 
ATOM   4695 C CA  . GLN B 1 66  ? 0.859   -2.974  -57.926 1.00 52.41  ? 66   GLN B CA  1 
ATOM   4696 C C   . GLN B 1 66  ? 1.557   -3.919  -56.942 1.00 51.91  ? 66   GLN B C   1 
ATOM   4697 O O   . GLN B 1 66  ? 1.161   -4.026  -55.776 1.00 51.06  ? 66   GLN B O   1 
ATOM   4698 C CB  . GLN B 1 66  ? 1.869   -2.004  -58.573 1.00 52.14  ? 66   GLN B CB  1 
ATOM   4699 C CG  . GLN B 1 66  ? 1.594   -1.761  -60.062 1.00 53.27  ? 66   GLN B CG  1 
ATOM   4700 C CD  . GLN B 1 66  ? 2.026   -2.926  -60.935 1.00 55.61  ? 66   GLN B CD  1 
ATOM   4701 O OE1 . GLN B 1 66  ? 2.665   -3.880  -60.459 1.00 56.05  ? 66   GLN B OE1 1 
ATOM   4702 N NE2 . GLN B 1 66  ? 1.673   -2.865  -62.216 1.00 54.24  ? 66   GLN B NE2 1 
ATOM   4703 N N   . ASN B 1 67  ? 2.585   -4.610  -57.432 1.00 51.76  ? 67   ASN B N   1 
ATOM   4704 C CA  . ASN B 1 67  ? 3.366   -5.546  -56.628 1.00 52.09  ? 67   ASN B CA  1 
ATOM   4705 C C   . ASN B 1 67  ? 4.091   -4.881  -55.468 1.00 51.08  ? 67   ASN B C   1 
ATOM   4706 O O   . ASN B 1 67  ? 4.416   -3.699  -55.515 1.00 50.92  ? 67   ASN B O   1 
ATOM   4707 C CB  . ASN B 1 67  ? 4.391   -6.258  -57.508 1.00 52.22  ? 67   ASN B CB  1 
ATOM   4708 C CG  . ASN B 1 67  ? 3.736   -7.105  -58.589 1.00 55.15  ? 67   ASN B CG  1 
ATOM   4709 O OD1 . ASN B 1 67  ? 2.742   -7.790  -58.335 1.00 57.36  ? 67   ASN B OD1 1 
ATOM   4710 N ND2 . ASN B 1 67  ? 4.281   -7.055  -59.798 1.00 55.35  ? 67   ASN B ND2 1 
ATOM   4711 N N   . VAL B 1 68  ? 4.354   -5.667  -54.438 1.00 51.10  ? 68   VAL B N   1 
ATOM   4712 C CA  . VAL B 1 68  ? 5.125   -5.233  -53.287 1.00 50.22  ? 68   VAL B CA  1 
ATOM   4713 C C   . VAL B 1 68  ? 6.624   -5.441  -53.557 1.00 50.46  ? 68   VAL B C   1 
ATOM   4714 O O   . VAL B 1 68  ? 7.017   -6.442  -54.133 1.00 51.09  ? 68   VAL B O   1 
ATOM   4715 C CB  . VAL B 1 68  ? 4.679   -6.021  -52.043 1.00 50.55  ? 68   VAL B CB  1 
ATOM   4716 C CG1 . VAL B 1 68  ? 5.596   -5.728  -50.843 1.00 49.38  ? 68   VAL B CG1 1 
ATOM   4717 C CG2 . VAL B 1 68  ? 3.229   -5.687  -51.726 1.00 49.98  ? 68   VAL B CG2 1 
ATOM   4718 N N   . CYS B 1 69  ? 7.457   -4.488  -53.158 1.00 50.11  ? 69   CYS B N   1 
ATOM   4719 C CA  . CYS B 1 69  ? 8.894   -4.630  -53.336 1.00 50.64  ? 69   CYS B CA  1 
ATOM   4720 C C   . CYS B 1 69  ? 9.373   -5.880  -52.621 1.00 51.04  ? 69   CYS B C   1 
ATOM   4721 O O   . CYS B 1 69  ? 8.919   -6.187  -51.520 1.00 51.00  ? 69   CYS B O   1 
ATOM   4722 C CB  . CYS B 1 69  ? 9.626   -3.403  -52.808 1.00 50.25  ? 69   CYS B CB  1 
ATOM   4723 S SG  . CYS B 1 69  ? 9.381   -1.926  -53.820 1.00 51.90  ? 69   CYS B SG  1 
ATOM   4724 N N   . TYR B 1 70  ? 10.288  -6.603  -53.257 1.00 51.74  ? 70   TYR B N   1 
ATOM   4725 C CA  . TYR B 1 70  ? 10.711  -7.908  -52.747 1.00 52.30  ? 70   TYR B CA  1 
ATOM   4726 C C   . TYR B 1 70  ? 11.257  -7.788  -51.324 1.00 52.17  ? 70   TYR B C   1 
ATOM   4727 O O   . TYR B 1 70  ? 12.071  -6.915  -51.024 1.00 50.91  ? 70   TYR B O   1 
ATOM   4728 C CB  . TYR B 1 70  ? 11.716  -8.602  -53.692 1.00 52.76  ? 70   TYR B CB  1 
ATOM   4729 C CG  . TYR B 1 70  ? 11.632  -10.098 -53.542 1.00 53.99  ? 70   TYR B CG  1 
ATOM   4730 C CD1 . TYR B 1 70  ? 10.811  -10.856 -54.360 1.00 54.34  ? 70   TYR B CD1 1 
ATOM   4731 C CD2 . TYR B 1 70  ? 12.330  -10.747 -52.528 1.00 54.72  ? 70   TYR B CD2 1 
ATOM   4732 C CE1 . TYR B 1 70  ? 10.701  -12.245 -54.185 1.00 55.82  ? 70   TYR B CE1 1 
ATOM   4733 C CE2 . TYR B 1 70  ? 12.225  -12.110 -52.342 1.00 55.70  ? 70   TYR B CE2 1 
ATOM   4734 C CZ  . TYR B 1 70  ? 11.407  -12.855 -53.171 1.00 55.56  ? 70   TYR B CZ  1 
ATOM   4735 O OH  . TYR B 1 70  ? 11.309  -14.203 -52.980 1.00 57.06  ? 70   TYR B OH  1 
ATOM   4736 N N   . GLN B 1 71  ? 10.789  -8.664  -50.439 1.00 53.34  ? 71   GLN B N   1 
ATOM   4737 C CA  . GLN B 1 71  ? 11.099  -8.526  -49.020 1.00 53.38  ? 71   GLN B CA  1 
ATOM   4738 C C   . GLN B 1 71  ? 10.889  -9.799  -48.227 1.00 55.12  ? 71   GLN B C   1 
ATOM   4739 O O   . GLN B 1 71  ? 10.194  -10.714 -48.663 1.00 55.13  ? 71   GLN B O   1 
ATOM   4740 C CB  . GLN B 1 71  ? 10.249  -7.414  -48.391 1.00 52.46  ? 71   GLN B CB  1 
ATOM   4741 C CG  . GLN B 1 71  ? 8.754   -7.697  -48.330 1.00 51.40  ? 71   GLN B CG  1 
ATOM   4742 C CD  . GLN B 1 71  ? 7.953   -6.461  -47.923 1.00 51.34  ? 71   GLN B CD  1 
ATOM   4743 O OE1 . GLN B 1 71  ? 7.378   -6.405  -46.828 1.00 50.16  ? 71   GLN B OE1 1 
ATOM   4744 N NE2 . GLN B 1 71  ? 7.927   -5.459  -48.794 1.00 48.94  ? 71   GLN B NE2 1 
ATOM   4745 N N   . TYR B 1 72  ? 11.498  -9.804  -47.047 1.00 56.18  ? 72   TYR B N   1 
ATOM   4746 C CA  . TYR B 1 72  ? 11.285  -10.816 -46.034 1.00 57.87  ? 72   TYR B CA  1 
ATOM   4747 C C   . TYR B 1 72  ? 9.837   -10.793 -45.600 1.00 58.30  ? 72   TYR B C   1 
ATOM   4748 O O   . TYR B 1 72  ? 9.257   -9.721  -45.392 1.00 57.48  ? 72   TYR B O   1 
ATOM   4749 C CB  . TYR B 1 72  ? 12.197  -10.534 -44.832 1.00 58.30  ? 72   TYR B CB  1 
ATOM   4750 C CG  . TYR B 1 72  ? 11.992  -11.466 -43.655 1.00 59.81  ? 72   TYR B CG  1 
ATOM   4751 C CD1 . TYR B 1 72  ? 11.249  -11.063 -42.544 1.00 60.27  ? 72   TYR B CD1 1 
ATOM   4752 C CD2 . TYR B 1 72  ? 12.533  -12.746 -43.651 1.00 60.79  ? 72   TYR B CD2 1 
ATOM   4753 C CE1 . TYR B 1 72  ? 11.053  -11.904 -41.460 1.00 61.03  ? 72   TYR B CE1 1 
ATOM   4754 C CE2 . TYR B 1 72  ? 12.343  -13.598 -42.570 1.00 62.59  ? 72   TYR B CE2 1 
ATOM   4755 C CZ  . TYR B 1 72  ? 11.604  -13.169 -41.476 1.00 62.09  ? 72   TYR B CZ  1 
ATOM   4756 O OH  . TYR B 1 72  ? 11.409  -14.001 -40.394 1.00 63.81  ? 72   TYR B OH  1 
ATOM   4757 N N   . VAL B 1 73  ? 9.261   -11.985 -45.474 1.00 60.05  ? 73   VAL B N   1 
ATOM   4758 C CA  . VAL B 1 73  ? 7.899   -12.164 -44.983 1.00 60.90  ? 73   VAL B CA  1 
ATOM   4759 C C   . VAL B 1 73  ? 7.958   -12.803 -43.598 1.00 61.99  ? 73   VAL B C   1 
ATOM   4760 O O   . VAL B 1 73  ? 8.602   -13.840 -43.405 1.00 62.40  ? 73   VAL B O   1 
ATOM   4761 C CB  . VAL B 1 73  ? 7.074   -13.078 -45.914 1.00 61.90  ? 73   VAL B CB  1 
ATOM   4762 C CG1 . VAL B 1 73  ? 5.649   -13.238 -45.391 1.00 62.62  ? 73   VAL B CG1 1 
ATOM   4763 C CG2 . VAL B 1 73  ? 7.071   -12.531 -47.334 1.00 61.82  ? 73   VAL B CG2 1 
ATOM   4764 N N   . ASP B 1 74  ? 7.274   -12.182 -42.644 1.00 62.08  ? 74   ASP B N   1 
ATOM   4765 C CA  . ASP B 1 74  ? 7.295   -12.637 -41.259 1.00 63.76  ? 74   ASP B CA  1 
ATOM   4766 C C   . ASP B 1 74  ? 6.646   -14.014 -41.114 1.00 65.58  ? 74   ASP B C   1 
ATOM   4767 O O   . ASP B 1 74  ? 5.642   -14.295 -41.751 1.00 66.06  ? 74   ASP B O   1 
ATOM   4768 C CB  . ASP B 1 74  ? 6.563   -11.639 -40.362 1.00 63.24  ? 74   ASP B CB  1 
ATOM   4769 C CG  . ASP B 1 74  ? 6.937   -11.789 -38.911 1.00 64.50  ? 74   ASP B CG  1 
ATOM   4770 O OD1 . ASP B 1 74  ? 6.243   -12.527 -38.176 1.00 66.53  ? 74   ASP B OD1 1 
ATOM   4771 O OD2 . ASP B 1 74  ? 7.947   -11.182 -38.520 1.00 65.63  ? 74   ASP B OD2 1 
ATOM   4772 N N   . THR B 1 75  ? 7.230   -14.858 -40.271 1.00 67.22  ? 75   THR B N   1 
ATOM   4773 C CA  . THR B 1 75  ? 6.729   -16.213 -40.052 1.00 69.68  ? 75   THR B CA  1 
ATOM   4774 C C   . THR B 1 75  ? 6.486   -16.541 -38.570 1.00 70.59  ? 75   THR B C   1 
ATOM   4775 O O   . THR B 1 75  ? 6.095   -17.661 -38.246 1.00 72.42  ? 75   THR B O   1 
ATOM   4776 C CB  . THR B 1 75  ? 7.718   -17.249 -40.634 1.00 71.03  ? 75   THR B CB  1 
ATOM   4777 O OG1 . THR B 1 75  ? 8.990   -17.126 -39.977 1.00 71.85  ? 75   THR B OG1 1 
ATOM   4778 C CG2 . THR B 1 75  ? 7.893   -17.045 -42.146 1.00 70.53  ? 75   THR B CG2 1 
ATOM   4779 N N   . LEU B 1 76  ? 6.685   -15.569 -37.679 1.00 69.72  ? 76   LEU B N   1 
ATOM   4780 C CA  . LEU B 1 76  ? 6.634   -15.832 -36.237 1.00 70.33  ? 76   LEU B CA  1 
ATOM   4781 C C   . LEU B 1 76  ? 5.303   -16.448 -35.804 1.00 71.48  ? 76   LEU B C   1 
ATOM   4782 O O   . LEU B 1 76  ? 5.287   -17.406 -35.042 1.00 73.24  ? 76   LEU B O   1 
ATOM   4783 C CB  . LEU B 1 76  ? 6.898   -14.550 -35.430 1.00 68.93  ? 76   LEU B CB  1 
ATOM   4784 C CG  . LEU B 1 76  ? 7.062   -14.752 -33.914 1.00 69.81  ? 76   LEU B CG  1 
ATOM   4785 C CD1 . LEU B 1 76  ? 8.280   -15.632 -33.606 1.00 70.68  ? 76   LEU B CD1 1 
ATOM   4786 C CD2 . LEU B 1 76  ? 7.148   -13.421 -33.179 1.00 67.66  ? 76   LEU B CD2 1 
ATOM   4787 N N   . TYR B 1 77  ? 4.202   -15.895 -36.304 1.00 70.82  ? 77   TYR B N   1 
ATOM   4788 C CA  . TYR B 1 77  ? 2.859   -16.327 -35.927 1.00 71.60  ? 77   TYR B CA  1 
ATOM   4789 C C   . TYR B 1 77  ? 1.996   -16.492 -37.179 1.00 71.67  ? 77   TYR B C   1 
ATOM   4790 O O   . TYR B 1 77  ? 1.199   -15.611 -37.506 1.00 70.46  ? 77   TYR B O   1 
ATOM   4791 C CB  . TYR B 1 77  ? 2.217   -15.296 -34.991 1.00 70.85  ? 77   TYR B CB  1 
ATOM   4792 C CG  . TYR B 1 77  ? 2.898   -15.144 -33.656 1.00 70.63  ? 77   TYR B CG  1 
ATOM   4793 C CD1 . TYR B 1 77  ? 3.037   -16.228 -32.801 1.00 72.11  ? 77   TYR B CD1 1 
ATOM   4794 C CD2 . TYR B 1 77  ? 3.381   -13.909 -33.233 1.00 70.03  ? 77   TYR B CD2 1 
ATOM   4795 C CE1 . TYR B 1 77  ? 3.651   -16.096 -31.563 1.00 72.62  ? 77   TYR B CE1 1 
ATOM   4796 C CE2 . TYR B 1 77  ? 3.995   -13.760 -31.989 1.00 69.82  ? 77   TYR B CE2 1 
ATOM   4797 C CZ  . TYR B 1 77  ? 4.125   -14.854 -31.161 1.00 71.18  ? 77   TYR B CZ  1 
ATOM   4798 O OH  . TYR B 1 77  ? 4.731   -14.726 -29.932 1.00 71.28  ? 77   TYR B OH  1 
ATOM   4799 N N   . PRO B 1 78  ? 2.156   -17.619 -37.891 1.00 72.94  ? 78   PRO B N   1 
ATOM   4800 C CA  . PRO B 1 78  ? 1.407   -17.847 -39.142 1.00 73.16  ? 78   PRO B CA  1 
ATOM   4801 C C   . PRO B 1 78  ? -0.107  -17.760 -38.952 1.00 73.61  ? 78   PRO B C   1 
ATOM   4802 O O   . PRO B 1 78  ? -0.655  -18.425 -38.075 1.00 75.18  ? 78   PRO B O   1 
ATOM   4803 C CB  . PRO B 1 78  ? 1.823   -19.266 -39.552 1.00 74.85  ? 78   PRO B CB  1 
ATOM   4804 C CG  . PRO B 1 78  ? 3.130   -19.512 -38.842 1.00 74.95  ? 78   PRO B CG  1 
ATOM   4805 C CD  . PRO B 1 78  ? 3.045   -18.749 -37.559 1.00 74.28  ? 78   PRO B CD  1 
ATOM   4806 N N   . GLY B 1 79  ? -0.769  -16.929 -39.752 1.00 72.64  ? 79   GLY B N   1 
ATOM   4807 C CA  . GLY B 1 79  ? -2.228  -16.778 -39.686 1.00 73.00  ? 79   GLY B CA  1 
ATOM   4808 C C   . GLY B 1 79  ? -2.729  -15.767 -38.661 1.00 72.04  ? 79   GLY B C   1 
ATOM   4809 O O   . GLY B 1 79  ? -3.926  -15.490 -38.595 1.00 72.47  ? 79   GLY B O   1 
ATOM   4810 N N   . PHE B 1 80  ? -1.819  -15.212 -37.866 1.00 70.45  ? 80   PHE B N   1 
ATOM   4811 C CA  . PHE B 1 80  ? -2.173  -14.271 -36.808 1.00 69.48  ? 80   PHE B CA  1 
ATOM   4812 C C   . PHE B 1 80  ? -2.289  -12.864 -37.400 1.00 67.60  ? 80   PHE B C   1 
ATOM   4813 O O   . PHE B 1 80  ? -1.355  -12.366 -38.013 1.00 66.31  ? 80   PHE B O   1 
ATOM   4814 C CB  . PHE B 1 80  ? -1.118  -14.326 -35.689 1.00 69.20  ? 80   PHE B CB  1 
ATOM   4815 C CG  . PHE B 1 80  ? -1.289  -13.275 -34.627 1.00 67.78  ? 80   PHE B CG  1 
ATOM   4816 C CD1 . PHE B 1 80  ? -2.449  -13.215 -33.874 1.00 68.38  ? 80   PHE B CD1 1 
ATOM   4817 C CD2 . PHE B 1 80  ? -0.286  -12.354 -34.379 1.00 66.64  ? 80   PHE B CD2 1 
ATOM   4818 C CE1 . PHE B 1 80  ? -2.615  -12.246 -32.900 1.00 68.18  ? 80   PHE B CE1 1 
ATOM   4819 C CE2 . PHE B 1 80  ? -0.442  -11.382 -33.400 1.00 65.84  ? 80   PHE B CE2 1 
ATOM   4820 C CZ  . PHE B 1 80  ? -1.612  -11.328 -32.661 1.00 66.77  ? 80   PHE B CZ  1 
ATOM   4821 N N   . GLU B 1 81  ? -3.442  -12.233 -37.217 1.00 67.69  ? 81   GLU B N   1 
ATOM   4822 C CA  . GLU B 1 81  ? -3.697  -10.902 -37.773 1.00 66.82  ? 81   GLU B CA  1 
ATOM   4823 C C   . GLU B 1 81  ? -2.684  -9.849  -37.344 1.00 64.72  ? 81   GLU B C   1 
ATOM   4824 O O   . GLU B 1 81  ? -2.325  -8.994  -38.139 1.00 63.83  ? 81   GLU B O   1 
ATOM   4825 C CB  . GLU B 1 81  ? -5.098  -10.419 -37.391 1.00 67.45  ? 81   GLU B CB  1 
ATOM   4826 C CG  . GLU B 1 81  ? -5.352  -8.945  -37.695 1.00 67.54  ? 81   GLU B CG  1 
ATOM   4827 C CD  . GLU B 1 81  ? -6.791  -8.528  -37.448 1.00 69.15  ? 81   GLU B CD  1 
ATOM   4828 O OE1 . GLU B 1 81  ? -7.026  -7.664  -36.564 1.00 71.05  ? 81   GLU B OE1 1 
ATOM   4829 O OE2 . GLU B 1 81  ? -7.686  -9.076  -38.132 1.00 73.95  ? 81   GLU B OE2 1 
ATOM   4830 N N   . GLY B 1 82  ? -2.256  -9.892  -36.084 1.00 64.27  ? 82   GLY B N   1 
ATOM   4831 C CA  . GLY B 1 82  ? -1.386  -8.858  -35.525 1.00 62.47  ? 82   GLY B CA  1 
ATOM   4832 C C   . GLY B 1 82  ? -0.056  -8.749  -36.241 1.00 61.01  ? 82   GLY B C   1 
ATOM   4833 O O   . GLY B 1 82  ? 0.518   -7.671  -36.299 1.00 59.29  ? 82   GLY B O   1 
ATOM   4834 N N   . THR B 1 83  ? 0.431   -9.874  -36.777 1.00 61.14  ? 83   THR B N   1 
ATOM   4835 C CA  . THR B 1 83  ? 1.640   -9.887  -37.598 1.00 59.83  ? 83   THR B CA  1 
ATOM   4836 C C   . THR B 1 83  ? 1.330   -9.821  -39.106 1.00 59.88  ? 83   THR B C   1 
ATOM   4837 O O   . THR B 1 83  ? 2.025   -9.120  -39.864 1.00 58.58  ? 83   THR B O   1 
ATOM   4838 C CB  . THR B 1 83  ? 2.511   -11.136 -37.315 1.00 60.81  ? 83   THR B CB  1 
ATOM   4839 O OG1 . THR B 1 83  ? 1.704   -12.327 -37.356 1.00 61.19  ? 83   THR B OG1 1 
ATOM   4840 C CG2 . THR B 1 83  ? 3.202   -11.014 -35.973 1.00 59.08  ? 83   THR B CG2 1 
ATOM   4841 N N   . GLU B 1 84  ? 0.289   -10.541 -39.526 1.00 60.77  ? 84   GLU B N   1 
ATOM   4842 C CA  . GLU B 1 84  ? -0.041  -10.689 -40.947 1.00 61.27  ? 84   GLU B CA  1 
ATOM   4843 C C   . GLU B 1 84  ? -0.594  -9.416  -41.570 1.00 59.91  ? 84   GLU B C   1 
ATOM   4844 O O   . GLU B 1 84  ? -0.526  -9.248  -42.783 1.00 59.35  ? 84   GLU B O   1 
ATOM   4845 C CB  . GLU B 1 84  ? -1.066  -11.808 -41.154 1.00 63.27  ? 84   GLU B CB  1 
ATOM   4846 C CG  . GLU B 1 84  ? -0.571  -13.216 -40.820 1.00 66.71  ? 84   GLU B CG  1 
ATOM   4847 C CD  . GLU B 1 84  ? 0.318   -13.836 -41.887 1.00 69.79  ? 84   GLU B CD  1 
ATOM   4848 O OE1 . GLU B 1 84  ? 0.660   -13.146 -42.890 1.00 71.05  ? 84   GLU B OE1 1 
ATOM   4849 O OE2 . GLU B 1 84  ? 0.683   -15.026 -41.700 1.00 71.19  ? 84   GLU B OE2 1 
ATOM   4850 N N   . MET B 1 85  ? -1.156  -8.533  -40.750 1.00 59.10  ? 85   MET B N   1 
ATOM   4851 C CA  . MET B 1 85  ? -1.663  -7.253  -41.241 1.00 58.35  ? 85   MET B CA  1 
ATOM   4852 C C   . MET B 1 85  ? -0.543  -6.353  -41.784 1.00 56.82  ? 85   MET B C   1 
ATOM   4853 O O   . MET B 1 85  ? -0.831  -5.369  -42.476 1.00 55.62  ? 85   MET B O   1 
ATOM   4854 C CB  . MET B 1 85  ? -2.429  -6.503  -40.145 1.00 58.41  ? 85   MET B CB  1 
ATOM   4855 C CG  . MET B 1 85  ? -1.601  -6.134  -38.921 1.00 58.23  ? 85   MET B CG  1 
ATOM   4856 S SD  . MET B 1 85  ? -2.558  -5.314  -37.630 1.00 58.71  ? 85   MET B SD  1 
ATOM   4857 C CE  . MET B 1 85  ? -2.642  -3.655  -38.306 1.00 52.40  ? 85   MET B CE  1 
ATOM   4858 N N   . TRP B 1 86  ? 0.709   -6.695  -41.453 1.00 56.13  ? 86   TRP B N   1 
ATOM   4859 C CA  . TRP B 1 86  ? 1.892   -5.967  -41.915 1.00 54.99  ? 86   TRP B CA  1 
ATOM   4860 C C   . TRP B 1 86  ? 2.630   -6.664  -43.059 1.00 54.77  ? 86   TRP B C   1 
ATOM   4861 O O   . TRP B 1 86  ? 3.531   -6.068  -43.663 1.00 53.44  ? 86   TRP B O   1 
ATOM   4862 C CB  . TRP B 1 86  ? 2.878   -5.784  -40.757 1.00 54.45  ? 86   TRP B CB  1 
ATOM   4863 C CG  . TRP B 1 86  ? 2.276   -5.157  -39.567 1.00 54.55  ? 86   TRP B CG  1 
ATOM   4864 C CD1 . TRP B 1 86  ? 2.057   -5.750  -38.367 1.00 54.82  ? 86   TRP B CD1 1 
ATOM   4865 C CD2 . TRP B 1 86  ? 1.789   -3.817  -39.456 1.00 52.74  ? 86   TRP B CD2 1 
ATOM   4866 N NE1 . TRP B 1 86  ? 1.468   -4.863  -37.506 1.00 55.18  ? 86   TRP B NE1 1 
ATOM   4867 C CE2 . TRP B 1 86  ? 1.299   -3.663  -38.146 1.00 53.97  ? 86   TRP B CE2 1 
ATOM   4868 C CE3 . TRP B 1 86  ? 1.722   -2.730  -40.335 1.00 53.02  ? 86   TRP B CE3 1 
ATOM   4869 C CZ2 . TRP B 1 86  ? 0.745   -2.464  -37.687 1.00 52.40  ? 86   TRP B CZ2 1 
ATOM   4870 C CZ3 . TRP B 1 86  ? 1.168   -1.538  -39.886 1.00 52.16  ? 86   TRP B CZ3 1 
ATOM   4871 C CH2 . TRP B 1 86  ? 0.681   -1.417  -38.574 1.00 52.61  ? 86   TRP B CH2 1 
ATOM   4872 N N   . ASN B 1 87  ? 2.271   -7.920  -43.318 1.00 55.44  ? 87   ASN B N   1 
ATOM   4873 C CA  . ASN B 1 87  ? 2.891   -8.725  -44.377 1.00 56.05  ? 87   ASN B CA  1 
ATOM   4874 C C   . ASN B 1 87  ? 2.381   -8.317  -45.763 1.00 55.51  ? 87   ASN B C   1 
ATOM   4875 O O   . ASN B 1 87  ? 1.299   -7.731  -45.882 1.00 55.04  ? 87   ASN B O   1 
ATOM   4876 C CB  . ASN B 1 87  ? 2.626   -10.229 -44.164 1.00 57.54  ? 87   ASN B CB  1 
ATOM   4877 C CG  . ASN B 1 87  ? 3.652   -10.906 -43.242 1.00 59.03  ? 87   ASN B CG  1 
ATOM   4878 O OD1 . ASN B 1 87  ? 4.736   -10.382 -42.991 1.00 59.35  ? 87   ASN B OD1 1 
ATOM   4879 N ND2 . ASN B 1 87  ? 3.311   -12.103 -42.767 1.00 60.98  ? 87   ASN B ND2 1 
ATOM   4880 N N   . PRO B 1 88  ? 3.165   -8.618  -46.817 1.00 55.26  ? 88   PRO B N   1 
ATOM   4881 C CA  . PRO B 1 88  ? 2.772   -8.226  -48.168 1.00 55.06  ? 88   PRO B CA  1 
ATOM   4882 C C   . PRO B 1 88  ? 1.403   -8.786  -48.524 1.00 55.52  ? 88   PRO B C   1 
ATOM   4883 O O   . PRO B 1 88  ? 1.137   -9.950  -48.230 1.00 56.00  ? 88   PRO B O   1 
ATOM   4884 C CB  . PRO B 1 88  ? 3.855   -8.871  -49.050 1.00 55.25  ? 88   PRO B CB  1 
ATOM   4885 C CG  . PRO B 1 88  ? 5.024   -9.010  -48.166 1.00 55.15  ? 88   PRO B CG  1 
ATOM   4886 C CD  . PRO B 1 88  ? 4.455   -9.334  -46.820 1.00 55.69  ? 88   PRO B CD  1 
ATOM   4887 N N   . ASN B 1 89  ? 0.555   -7.953  -49.126 1.00 55.26  ? 89   ASN B N   1 
ATOM   4888 C CA  . ASN B 1 89  ? -0.785  -8.358  -49.534 1.00 56.28  ? 89   ASN B CA  1 
ATOM   4889 C C   . ASN B 1 89  ? -0.980  -8.334  -51.052 1.00 56.87  ? 89   ASN B C   1 
ATOM   4890 O O   . ASN B 1 89  ? -2.101  -8.447  -51.537 1.00 57.94  ? 89   ASN B O   1 
ATOM   4891 C CB  . ASN B 1 89  ? -1.852  -7.518  -48.827 1.00 56.24  ? 89   ASN B CB  1 
ATOM   4892 C CG  . ASN B 1 89  ? -1.808  -6.054  -49.218 1.00 55.23  ? 89   ASN B CG  1 
ATOM   4893 O OD1 . ASN B 1 89  ? -0.797  -5.569  -49.713 1.00 54.15  ? 89   ASN B OD1 1 
ATOM   4894 N ND2 . ASN B 1 89  ? -2.912  -5.347  -49.000 1.00 53.05  ? 89   ASN B ND2 1 
ATOM   4895 N N   . ARG B 1 90  ? 0.115   -8.178  -51.792 1.00 56.51  ? 90   ARG B N   1 
ATOM   4896 C CA  . ARG B 1 90  ? 0.148   -8.406  -53.238 1.00 56.69  ? 90   ARG B CA  1 
ATOM   4897 C C   . ARG B 1 90  ? 1.423   -9.178  -53.533 1.00 56.83  ? 90   ARG B C   1 
ATOM   4898 O O   . ARG B 1 90  ? 2.285   -9.286  -52.670 1.00 56.61  ? 90   ARG B O   1 
ATOM   4899 C CB  . ARG B 1 90  ? 0.149   -7.092  -54.016 1.00 55.88  ? 90   ARG B CB  1 
ATOM   4900 C CG  . ARG B 1 90  ? -1.096  -6.242  -53.841 1.00 56.20  ? 90   ARG B CG  1 
ATOM   4901 C CD  . ARG B 1 90  ? -2.312  -6.932  -54.428 1.00 57.78  ? 90   ARG B CD  1 
ATOM   4902 N NE  . ARG B 1 90  ? -3.514  -6.115  -54.360 1.00 58.79  ? 90   ARG B NE  1 
ATOM   4903 C CZ  . ARG B 1 90  ? -4.249  -5.930  -53.264 1.00 59.23  ? 90   ARG B CZ  1 
ATOM   4904 N NH1 . ARG B 1 90  ? -3.900  -6.466  -52.103 1.00 59.35  ? 90   ARG B NH1 1 
ATOM   4905 N NH2 . ARG B 1 90  ? -5.337  -5.182  -53.334 1.00 59.90  ? 90   ARG B NH2 1 
ATOM   4906 N N   . GLU B 1 91  ? 1.536   -9.715  -54.743 1.00 57.34  ? 91   GLU B N   1 
ATOM   4907 C CA  . GLU B 1 91  ? 2.705   -10.494 -55.130 1.00 58.01  ? 91   GLU B CA  1 
ATOM   4908 C C   . GLU B 1 91  ? 3.987   -9.687  -54.959 1.00 55.83  ? 91   GLU B C   1 
ATOM   4909 O O   . GLU B 1 91  ? 4.001   -8.489  -55.198 1.00 54.87  ? 91   GLU B O   1 
ATOM   4910 C CB  . GLU B 1 91  ? 2.588   -10.961 -56.581 1.00 58.99  ? 91   GLU B CB  1 
ATOM   4911 C CG  . GLU B 1 91  ? 1.514   -12.022 -56.802 1.00 64.48  ? 91   GLU B CG  1 
ATOM   4912 C CD  . GLU B 1 91  ? 1.894   -13.394 -56.250 1.00 69.60  ? 91   GLU B CD  1 
ATOM   4913 O OE1 . GLU B 1 91  ? 3.087   -13.608 -55.919 1.00 71.72  ? 91   GLU B OE1 1 
ATOM   4914 O OE2 . GLU B 1 91  ? 0.991   -14.262 -56.156 1.00 74.09  ? 91   GLU B OE2 1 
ATOM   4915 N N   . LEU B 1 92  ? 5.052   -10.366 -54.548 1.00 55.17  ? 92   LEU B N   1 
ATOM   4916 C CA  . LEU B 1 92  ? 6.362   -9.759  -54.401 1.00 54.07  ? 92   LEU B CA  1 
ATOM   4917 C C   . LEU B 1 92  ? 7.044   -9.608  -55.760 1.00 53.73  ? 92   LEU B C   1 
ATOM   4918 O O   . LEU B 1 92  ? 6.992   -10.504 -56.574 1.00 53.78  ? 92   LEU B O   1 
ATOM   4919 C CB  . LEU B 1 92  ? 7.240   -10.639 -53.507 1.00 54.81  ? 92   LEU B CB  1 
ATOM   4920 C CG  . LEU B 1 92  ? 6.926   -10.732 -52.016 1.00 54.45  ? 92   LEU B CG  1 
ATOM   4921 C CD1 . LEU B 1 92  ? 7.921   -11.664 -51.328 1.00 53.81  ? 92   LEU B CD1 1 
ATOM   4922 C CD2 . LEU B 1 92  ? 6.977   -9.373  -51.399 1.00 53.28  ? 92   LEU B CD2 1 
ATOM   4923 N N   . SER B 1 93  ? 7.707   -8.479  -55.993 1.00 52.63  ? 93   SER B N   1 
ATOM   4924 C CA  . SER B 1 93  ? 8.481   -8.304  -57.220 1.00 52.65  ? 93   SER B CA  1 
ATOM   4925 C C   . SER B 1 93  ? 9.524   -7.221  -57.034 1.00 51.81  ? 93   SER B C   1 
ATOM   4926 O O   . SER B 1 93  ? 9.315   -6.305  -56.258 1.00 51.48  ? 93   SER B O   1 
ATOM   4927 C CB  . SER B 1 93  ? 7.556   -7.956  -58.398 1.00 52.74  ? 93   SER B CB  1 
ATOM   4928 O OG  . SER B 1 93  ? 8.277   -7.816  -59.616 1.00 52.05  ? 93   SER B OG  1 
ATOM   4929 N N   . GLU B 1 94  ? 10.647  -7.330  -57.738 1.00 52.26  ? 94   GLU B N   1 
ATOM   4930 C CA  . GLU B 1 94  ? 11.618  -6.228  -57.793 1.00 51.91  ? 94   GLU B CA  1 
ATOM   4931 C C   . GLU B 1 94  ? 11.099  -5.080  -58.645 1.00 51.20  ? 94   GLU B C   1 
ATOM   4932 O O   . GLU B 1 94  ? 11.529  -3.939  -58.495 1.00 51.38  ? 94   GLU B O   1 
ATOM   4933 C CB  . GLU B 1 94  ? 12.961  -6.715  -58.317 1.00 52.73  ? 94   GLU B CB  1 
ATOM   4934 C CG  . GLU B 1 94  ? 13.680  -7.602  -57.306 1.00 53.68  ? 94   GLU B CG  1 
ATOM   4935 C CD  . GLU B 1 94  ? 15.039  -8.026  -57.769 1.00 54.42  ? 94   GLU B CD  1 
ATOM   4936 O OE1 . GLU B 1 94  ? 15.947  -7.164  -57.807 1.00 55.90  ? 94   GLU B OE1 1 
ATOM   4937 O OE2 . GLU B 1 94  ? 15.198  -9.225  -58.086 1.00 57.74  ? 94   GLU B OE2 1 
ATOM   4938 N N   . ASP B 1 95  ? 10.166  -5.407  -59.530 1.00 51.24  ? 95   ASP B N   1 
ATOM   4939 C CA  . ASP B 1 95  ? 9.436   -4.443  -60.314 1.00 50.90  ? 95   ASP B CA  1 
ATOM   4940 C C   . ASP B 1 95  ? 8.310   -3.920  -59.432 1.00 50.39  ? 95   ASP B C   1 
ATOM   4941 O O   . ASP B 1 95  ? 7.206   -4.447  -59.446 1.00 50.59  ? 95   ASP B O   1 
ATOM   4942 C CB  . ASP B 1 95  ? 8.910   -5.148  -61.563 1.00 51.64  ? 95   ASP B CB  1 
ATOM   4943 C CG  . ASP B 1 95  ? 8.131   -4.240  -62.495 1.00 51.58  ? 95   ASP B CG  1 
ATOM   4944 O OD1 . ASP B 1 95  ? 7.870   -3.072  -62.174 1.00 49.86  ? 95   ASP B OD1 1 
ATOM   4945 O OD2 . ASP B 1 95  ? 7.762   -4.738  -63.572 1.00 53.70  ? 95   ASP B OD2 1 
ATOM   4946 N N   . CYS B 1 96  ? 8.606   -2.891  -58.641 1.00 49.52  ? 96   CYS B N   1 
ATOM   4947 C CA  . CYS B 1 96  ? 7.671   -2.422  -57.617 1.00 48.97  ? 96   CYS B CA  1 
ATOM   4948 C C   . CYS B 1 96  ? 7.606   -0.901  -57.454 1.00 48.34  ? 96   CYS B C   1 
ATOM   4949 O O   . CYS B 1 96  ? 6.958   -0.405  -56.537 1.00 47.78  ? 96   CYS B O   1 
ATOM   4950 C CB  . CYS B 1 96  ? 8.074   -3.042  -56.286 1.00 49.01  ? 96   CYS B CB  1 
ATOM   4951 S SG  . CYS B 1 96  ? 9.730   -2.547  -55.735 1.00 50.02  ? 96   CYS B SG  1 
ATOM   4952 N N   . LEU B 1 97  ? 8.236   -0.152  -58.344 1.00 48.32  ? 97   LEU B N   1 
ATOM   4953 C CA  . LEU B 1 97  ? 8.327   1.282   -58.144 1.00 47.91  ? 97   LEU B CA  1 
ATOM   4954 C C   . LEU B 1 97  ? 7.096   1.991   -58.731 1.00 48.57  ? 97   LEU B C   1 
ATOM   4955 O O   . LEU B 1 97  ? 7.125   2.569   -59.830 1.00 48.73  ? 97   LEU B O   1 
ATOM   4956 C CB  . LEU B 1 97  ? 9.647   1.809   -58.689 1.00 48.13  ? 97   LEU B CB  1 
ATOM   4957 C CG  . LEU B 1 97  ? 10.890  1.361   -57.897 1.00 47.64  ? 97   LEU B CG  1 
ATOM   4958 C CD1 . LEU B 1 97  ? 12.103  2.158   -58.343 1.00 46.09  ? 97   LEU B CD1 1 
ATOM   4959 C CD2 . LEU B 1 97  ? 10.679  1.492   -56.367 1.00 46.92  ? 97   LEU B CD2 1 
ATOM   4960 N N   . TYR B 1 98  ? 6.013   1.918   -57.954 1.00 48.58  ? 98   TYR B N   1 
ATOM   4961 C CA  . TYR B 1 98  ? 4.716   2.483   -58.308 1.00 48.95  ? 98   TYR B CA  1 
ATOM   4962 C C   . TYR B 1 98  ? 4.173   3.272   -57.123 1.00 48.73  ? 98   TYR B C   1 
ATOM   4963 O O   . TYR B 1 98  ? 4.504   2.989   -55.963 1.00 48.54  ? 98   TYR B O   1 
ATOM   4964 C CB  . TYR B 1 98  ? 3.724   1.363   -58.685 1.00 49.76  ? 98   TYR B CB  1 
ATOM   4965 C CG  . TYR B 1 98  ? 4.209   0.521   -59.848 1.00 50.80  ? 98   TYR B CG  1 
ATOM   4966 C CD1 . TYR B 1 98  ? 3.848   0.827   -61.154 1.00 51.59  ? 98   TYR B CD1 1 
ATOM   4967 C CD2 . TYR B 1 98  ? 5.063   -0.555  -59.643 1.00 51.27  ? 98   TYR B CD2 1 
ATOM   4968 C CE1 . TYR B 1 98  ? 4.311   0.073   -62.223 1.00 52.37  ? 98   TYR B CE1 1 
ATOM   4969 C CE2 . TYR B 1 98  ? 5.538   -1.310  -60.705 1.00 52.05  ? 98   TYR B CE2 1 
ATOM   4970 C CZ  . TYR B 1 98  ? 5.167   -0.986  -61.996 1.00 52.43  ? 98   TYR B CZ  1 
ATOM   4971 O OH  . TYR B 1 98  ? 5.638   -1.726  -63.064 1.00 52.79  ? 98   TYR B OH  1 
ATOM   4972 N N   . LEU B 1 99  ? 3.305   4.235   -57.414 1.00 48.94  ? 99   LEU B N   1 
ATOM   4973 C CA  . LEU B 1 99  ? 2.643   5.009   -56.379 1.00 48.40  ? 99   LEU B CA  1 
ATOM   4974 C C   . LEU B 1 99  ? 1.138   5.076   -56.587 1.00 48.97  ? 99   LEU B C   1 
ATOM   4975 O O   . LEU B 1 99  ? 0.617   4.698   -57.643 1.00 49.88  ? 99   LEU B O   1 
ATOM   4976 C CB  . LEU B 1 99  ? 3.271   6.412   -56.266 1.00 48.08  ? 99   LEU B CB  1 
ATOM   4977 C CG  . LEU B 1 99  ? 3.267   7.324   -57.499 1.00 48.91  ? 99   LEU B CG  1 
ATOM   4978 C CD1 . LEU B 1 99  ? 1.904   7.969   -57.712 1.00 47.80  ? 99   LEU B CD1 1 
ATOM   4979 C CD2 . LEU B 1 99  ? 4.342   8.395   -57.366 1.00 48.40  ? 99   LEU B CD2 1 
ATOM   4980 N N   . ASN B 1 100 ? 0.457   5.522   -55.532 1.00 48.60  ? 100  ASN B N   1 
ATOM   4981 C CA  . ASN B 1 100 ? -1.000  5.534   -55.425 1.00 48.96  ? 100  ASN B CA  1 
ATOM   4982 C C   . ASN B 1 100 ? -1.460  6.921   -55.014 1.00 49.31  ? 100  ASN B C   1 
ATOM   4983 O O   . ASN B 1 100 ? -0.845  7.519   -54.136 1.00 49.17  ? 100  ASN B O   1 
ATOM   4984 C CB  . ASN B 1 100 ? -1.444  4.563   -54.340 1.00 48.64  ? 100  ASN B CB  1 
ATOM   4985 C CG  . ASN B 1 100 ? -0.811  3.196   -54.481 1.00 47.53  ? 100  ASN B CG  1 
ATOM   4986 O OD1 . ASN B 1 100 ? -0.884  2.574   -55.536 1.00 45.56  ? 100  ASN B OD1 1 
ATOM   4987 N ND2 . ASN B 1 100 ? -0.180  2.726   -53.420 1.00 47.91  ? 100  ASN B ND2 1 
ATOM   4988 N N   . VAL B 1 101 ? -2.536  7.408   -55.633 1.00 50.59  ? 101  VAL B N   1 
ATOM   4989 C CA  . VAL B 1 101 ? -3.156  8.691   -55.311 1.00 50.83  ? 101  VAL B CA  1 
ATOM   4990 C C   . VAL B 1 101 ? -4.658  8.503   -55.052 1.00 52.50  ? 101  VAL B C   1 
ATOM   4991 O O   . VAL B 1 101 ? -5.361  7.933   -55.882 1.00 52.69  ? 101  VAL B O   1 
ATOM   4992 C CB  . VAL B 1 101 ? -2.995  9.687   -56.476 1.00 51.35  ? 101  VAL B CB  1 
ATOM   4993 C CG1 . VAL B 1 101 ? -3.654  11.038  -56.145 1.00 51.36  ? 101  VAL B CG1 1 
ATOM   4994 C CG2 . VAL B 1 101 ? -1.532  9.863   -56.837 1.00 49.73  ? 101  VAL B CG2 1 
ATOM   4995 N N   . TRP B 1 102 ? -5.141  8.974   -53.898 1.00 53.21  ? 102  TRP B N   1 
ATOM   4996 C CA  . TRP B 1 102 ? -6.574  9.111   -53.651 1.00 54.91  ? 102  TRP B CA  1 
ATOM   4997 C C   . TRP B 1 102 ? -6.930  10.589  -53.662 1.00 56.65  ? 102  TRP B C   1 
ATOM   4998 O O   . TRP B 1 102 ? -6.216  11.404  -53.064 1.00 55.63  ? 102  TRP B O   1 
ATOM   4999 C CB  . TRP B 1 102 ? -6.976  8.560   -52.283 1.00 54.51  ? 102  TRP B CB  1 
ATOM   5000 C CG  . TRP B 1 102 ? -6.892  7.086   -52.107 1.00 53.55  ? 102  TRP B CG  1 
ATOM   5001 C CD1 . TRP B 1 102 ? -7.910  6.179   -52.220 1.00 54.66  ? 102  TRP B CD1 1 
ATOM   5002 C CD2 . TRP B 1 102 ? -5.734  6.348   -51.746 1.00 52.24  ? 102  TRP B CD2 1 
ATOM   5003 N NE1 . TRP B 1 102 ? -7.444  4.909   -51.955 1.00 54.01  ? 102  TRP B NE1 1 
ATOM   5004 C CE2 . TRP B 1 102 ? -6.106  4.990   -51.669 1.00 52.49  ? 102  TRP B CE2 1 
ATOM   5005 C CE3 . TRP B 1 102 ? -4.407  6.701   -51.479 1.00 52.08  ? 102  TRP B CE3 1 
ATOM   5006 C CZ2 . TRP B 1 102 ? -5.205  3.991   -51.326 1.00 51.74  ? 102  TRP B CZ2 1 
ATOM   5007 C CZ3 . TRP B 1 102 ? -3.510  5.702   -51.150 1.00 51.01  ? 102  TRP B CZ3 1 
ATOM   5008 C CH2 . TRP B 1 102 ? -3.919  4.365   -51.067 1.00 51.29  ? 102  TRP B CH2 1 
ATOM   5009 N N   . THR B 1 103 ? -8.039  10.929  -54.317 1.00 58.99  ? 103  THR B N   1 
ATOM   5010 C CA  . THR B 1 103 ? -8.587  12.285  -54.254 1.00 60.91  ? 103  THR B CA  1 
ATOM   5011 C C   . THR B 1 103 ? -10.093 12.206  -54.022 1.00 63.00  ? 103  THR B C   1 
ATOM   5012 O O   . THR B 1 103 ? -10.677 11.128  -54.151 1.00 63.36  ? 103  THR B O   1 
ATOM   5013 C CB  . THR B 1 103 ? -8.354  13.092  -55.556 1.00 61.38  ? 103  THR B CB  1 
ATOM   5014 O OG1 . THR B 1 103 ? -9.329  12.714  -56.534 1.00 63.98  ? 103  THR B OG1 1 
ATOM   5015 C CG2 . THR B 1 103 ? -6.967  12.859  -56.104 1.00 60.79  ? 103  THR B CG2 1 
ATOM   5016 N N   . PRO B 1 104 ? -10.717 13.340  -53.641 1.00 64.79  ? 104  PRO B N   1 
ATOM   5017 C CA  . PRO B 1 104 ? -12.166 13.466  -53.608 1.00 67.06  ? 104  PRO B CA  1 
ATOM   5018 C C   . PRO B 1 104 ? -12.796 13.204  -54.965 1.00 68.82  ? 104  PRO B C   1 
ATOM   5019 O O   . PRO B 1 104 ? -12.131 13.344  -55.983 1.00 68.59  ? 104  PRO B O   1 
ATOM   5020 C CB  . PRO B 1 104 ? -12.380 14.933  -53.216 1.00 67.76  ? 104  PRO B CB  1 
ATOM   5021 C CG  . PRO B 1 104 ? -11.170 15.310  -52.490 1.00 65.95  ? 104  PRO B CG  1 
ATOM   5022 C CD  . PRO B 1 104 ? -10.060 14.565  -53.152 1.00 64.53  ? 104  PRO B CD  1 
ATOM   5023 N N   . TYR B 1 105 ? -14.069 12.821  -54.952 1.00 71.19  ? 105  TYR B N   1 
ATOM   5024 C CA  . TYR B 1 105 ? -14.859 12.614  -56.152 1.00 73.36  ? 105  TYR B CA  1 
ATOM   5025 C C   . TYR B 1 105 ? -16.106 13.478  -56.007 1.00 76.61  ? 105  TYR B C   1 
ATOM   5026 O O   . TYR B 1 105 ? -16.873 13.285  -55.060 1.00 77.33  ? 105  TYR B O   1 
ATOM   5027 C CB  . TYR B 1 105 ? -15.248 11.140  -56.275 1.00 73.26  ? 105  TYR B CB  1 
ATOM   5028 C CG  . TYR B 1 105 ? -16.051 10.807  -57.516 1.00 74.48  ? 105  TYR B CG  1 
ATOM   5029 C CD1 . TYR B 1 105 ? -15.474 10.127  -58.577 1.00 74.01  ? 105  TYR B CD1 1 
ATOM   5030 C CD2 . TYR B 1 105 ? -17.390 11.173  -57.627 1.00 76.76  ? 105  TYR B CD2 1 
ATOM   5031 C CE1 . TYR B 1 105 ? -16.202 9.818   -59.714 1.00 75.64  ? 105  TYR B CE1 1 
ATOM   5032 C CE2 . TYR B 1 105 ? -18.128 10.868  -58.763 1.00 78.31  ? 105  TYR B CE2 1 
ATOM   5033 C CZ  . TYR B 1 105 ? -17.528 10.190  -59.803 1.00 77.35  ? 105  TYR B CZ  1 
ATOM   5034 O OH  . TYR B 1 105 ? -18.252 9.882   -60.933 1.00 78.52  ? 105  TYR B OH  1 
ATOM   5035 N N   . PRO B 1 106 ? -16.314 14.450  -56.919 1.00 79.16  ? 106  PRO B N   1 
ATOM   5036 C CA  . PRO B 1 106 ? -15.485 14.807  -58.072 1.00 79.53  ? 106  PRO B CA  1 
ATOM   5037 C C   . PRO B 1 106 ? -14.176 15.430  -57.615 1.00 78.82  ? 106  PRO B C   1 
ATOM   5038 O O   . PRO B 1 106 ? -14.072 15.857  -56.463 1.00 78.60  ? 106  PRO B O   1 
ATOM   5039 C CB  . PRO B 1 106 ? -16.346 15.841  -58.814 1.00 81.63  ? 106  PRO B CB  1 
ATOM   5040 C CG  . PRO B 1 106 ? -17.175 16.455  -57.764 1.00 82.15  ? 106  PRO B CG  1 
ATOM   5041 C CD  . PRO B 1 106 ? -17.480 15.347  -56.797 1.00 81.25  ? 106  PRO B CD  1 
ATOM   5042 N N   . ARG B 1 107 ? -13.186 15.489  -58.499 1.00 78.98  ? 107  ARG B N   1 
ATOM   5043 C CA  . ARG B 1 107 ? -11.871 15.960  -58.090 1.00 78.44  ? 107  ARG B CA  1 
ATOM   5044 C C   . ARG B 1 107 ? -11.913 17.428  -57.679 1.00 78.88  ? 107  ARG B C   1 
ATOM   5045 O O   . ARG B 1 107 ? -12.755 18.179  -58.153 1.00 80.76  ? 107  ARG B O   1 
ATOM   5046 C CB  . ARG B 1 107 ? -10.801 15.681  -59.160 1.00 77.91  ? 107  ARG B CB  1 
ATOM   5047 C CG  . ARG B 1 107 ? -10.625 16.703  -60.290 1.00 79.65  ? 107  ARG B CG  1 
ATOM   5048 C CD  . ARG B 1 107 ? -9.320  16.381  -61.054 1.00 79.33  ? 107  ARG B CD  1 
ATOM   5049 N NE  . ARG B 1 107 ? -9.280  14.969  -61.478 1.00 79.89  ? 107  ARG B NE  1 
ATOM   5050 C CZ  . ARG B 1 107 ? -9.347  14.533  -62.739 1.00 80.72  ? 107  ARG B CZ  1 
ATOM   5051 N NH1 . ARG B 1 107 ? -9.326  13.228  -62.977 1.00 81.43  ? 107  ARG B NH1 1 
ATOM   5052 N NH2 . ARG B 1 107 ? -9.416  15.369  -63.768 1.00 81.30  ? 107  ARG B NH2 1 
ATOM   5053 N N   . PRO B 1 108 ? -11.013 17.833  -56.772 1.00 77.86  ? 108  PRO B N   1 
ATOM   5054 C CA  . PRO B 1 108 ? -11.077 19.176  -56.211 1.00 78.51  ? 108  PRO B CA  1 
ATOM   5055 C C   . PRO B 1 108 ? -11.129 20.289  -57.256 1.00 80.05  ? 108  PRO B C   1 
ATOM   5056 O O   . PRO B 1 108 ? -10.368 20.275  -58.221 1.00 79.75  ? 108  PRO B O   1 
ATOM   5057 C CB  . PRO B 1 108 ? -9.786  19.266  -55.396 1.00 76.81  ? 108  PRO B CB  1 
ATOM   5058 C CG  . PRO B 1 108 ? -9.489  17.873  -55.023 1.00 75.29  ? 108  PRO B CG  1 
ATOM   5059 C CD  . PRO B 1 108 ? -9.887  17.065  -56.209 1.00 75.74  ? 108  PRO B CD  1 
ATOM   5060 N N   . ALA B 1 109 ? -12.027 21.246  -57.043 1.00 81.90  ? 109  ALA B N   1 
ATOM   5061 C CA  . ALA B 1 109 ? -12.161 22.406  -57.924 1.00 83.61  ? 109  ALA B CA  1 
ATOM   5062 C C   . ALA B 1 109 ? -10.986 23.390  -57.799 1.00 83.10  ? 109  ALA B C   1 
ATOM   5063 O O   . ALA B 1 109 ? -10.746 24.204  -58.705 1.00 84.50  ? 109  ALA B O   1 
ATOM   5064 C CB  . ALA B 1 109 ? -13.482 23.132  -57.631 1.00 85.64  ? 109  ALA B CB  1 
ATOM   5065 N N   . SER B 1 110 ? -10.275 23.328  -56.674 1.00 81.21  ? 110  SER B N   1 
ATOM   5066 C CA  . SER B 1 110 ? -9.173  24.239  -56.392 1.00 80.16  ? 110  SER B CA  1 
ATOM   5067 C C   . SER B 1 110 ? -8.001  23.452  -55.811 1.00 77.15  ? 110  SER B C   1 
ATOM   5068 O O   . SER B 1 110 ? -8.201  22.357  -55.291 1.00 76.01  ? 110  SER B O   1 
ATOM   5069 C CB  . SER B 1 110 ? -9.637  25.314  -55.411 1.00 81.38  ? 110  SER B CB  1 
ATOM   5070 O OG  . SER B 1 110 ? -10.344 24.724  -54.335 1.00 81.67  ? 110  SER B OG  1 
ATOM   5071 N N   . PRO B 1 111 ? -6.774  24.003  -55.904 1.00 75.49  ? 111  PRO B N   1 
ATOM   5072 C CA  . PRO B 1 111 ? -5.576  23.296  -55.446 1.00 72.90  ? 111  PRO B CA  1 
ATOM   5073 C C   . PRO B 1 111 ? -5.663  22.859  -53.983 1.00 70.96  ? 111  PRO B C   1 
ATOM   5074 O O   . PRO B 1 111 ? -5.893  23.687  -53.107 1.00 71.57  ? 111  PRO B O   1 
ATOM   5075 C CB  . PRO B 1 111 ? -4.463  24.330  -55.641 1.00 73.26  ? 111  PRO B CB  1 
ATOM   5076 C CG  . PRO B 1 111 ? -4.966  25.234  -56.697 1.00 75.14  ? 111  PRO B CG  1 
ATOM   5077 C CD  . PRO B 1 111 ? -6.437  25.327  -56.461 1.00 76.75  ? 111  PRO B CD  1 
ATOM   5078 N N   . THR B 1 112 ? -5.472  21.565  -53.742 1.00 68.47  ? 112  THR B N   1 
ATOM   5079 C CA  . THR B 1 112 ? -5.717  20.963  -52.437 1.00 66.70  ? 112  THR B CA  1 
ATOM   5080 C C   . THR B 1 112 ? -4.428  20.453  -51.796 1.00 64.29  ? 112  THR B C   1 
ATOM   5081 O O   . THR B 1 112 ? -3.611  19.827  -52.469 1.00 63.49  ? 112  THR B O   1 
ATOM   5082 C CB  . THR B 1 112 ? -6.683  19.795  -52.582 1.00 66.68  ? 112  THR B CB  1 
ATOM   5083 O OG1 . THR B 1 112 ? -7.895  20.273  -53.172 1.00 68.96  ? 112  THR B OG1 1 
ATOM   5084 C CG2 . THR B 1 112 ? -6.990  19.166  -51.241 1.00 65.85  ? 112  THR B CG2 1 
ATOM   5085 N N   . PRO B 1 113 ? -4.240  20.715  -50.491 1.00 62.73  ? 113  PRO B N   1 
ATOM   5086 C CA  . PRO B 1 113 ? -3.075  20.201  -49.778 1.00 60.82  ? 113  PRO B CA  1 
ATOM   5087 C C   . PRO B 1 113 ? -2.895  18.705  -49.945 1.00 58.57  ? 113  PRO B C   1 
ATOM   5088 O O   . PRO B 1 113 ? -3.871  17.953  -49.900 1.00 58.81  ? 113  PRO B O   1 
ATOM   5089 C CB  . PRO B 1 113 ? -3.382  20.545  -48.319 1.00 60.78  ? 113  PRO B CB  1 
ATOM   5090 C CG  . PRO B 1 113 ? -4.216  21.749  -48.410 1.00 62.84  ? 113  PRO B CG  1 
ATOM   5091 C CD  . PRO B 1 113 ? -5.084  21.540  -49.610 1.00 63.92  ? 113  PRO B CD  1 
ATOM   5092 N N   . VAL B 1 114 ? -1.646  18.300  -50.148 1.00 56.67  ? 114  VAL B N   1 
ATOM   5093 C CA  . VAL B 1 114 ? -1.281  16.910  -50.393 1.00 54.39  ? 114  VAL B CA  1 
ATOM   5094 C C   . VAL B 1 114 ? -0.568  16.320  -49.182 1.00 53.04  ? 114  VAL B C   1 
ATOM   5095 O O   . VAL B 1 114 ? 0.299   16.953  -48.593 1.00 52.43  ? 114  VAL B O   1 
ATOM   5096 C CB  . VAL B 1 114 ? -0.331  16.797  -51.620 1.00 54.58  ? 114  VAL B CB  1 
ATOM   5097 C CG1 . VAL B 1 114 ? 0.046   15.335  -51.905 1.00 50.63  ? 114  VAL B CG1 1 
ATOM   5098 C CG2 . VAL B 1 114 ? -0.983  17.445  -52.847 1.00 54.91  ? 114  VAL B CG2 1 
ATOM   5099 N N   . LEU B 1 115 ? -0.941  15.099  -48.814 1.00 52.24  ? 115  LEU B N   1 
ATOM   5100 C CA  . LEU B 1 115 ? -0.224  14.345  -47.803 1.00 51.00  ? 115  LEU B CA  1 
ATOM   5101 C C   . LEU B 1 115 ? 0.440   13.178  -48.508 1.00 49.97  ? 115  LEU B C   1 
ATOM   5102 O O   . LEU B 1 115 ? -0.245  12.439  -49.234 1.00 50.40  ? 115  LEU B O   1 
ATOM   5103 C CB  . LEU B 1 115 ? -1.199  13.821  -46.746 1.00 52.03  ? 115  LEU B CB  1 
ATOM   5104 C CG  . LEU B 1 115 ? -1.683  14.731  -45.598 1.00 53.28  ? 115  LEU B CG  1 
ATOM   5105 C CD1 . LEU B 1 115 ? -2.806  14.059  -44.890 1.00 55.76  ? 115  LEU B CD1 1 
ATOM   5106 C CD2 . LEU B 1 115 ? -0.569  14.971  -44.608 1.00 53.84  ? 115  LEU B CD2 1 
ATOM   5107 N N   . ILE B 1 116 ? 1.750   13.008  -48.308 1.00 48.29  ? 116  ILE B N   1 
ATOM   5108 C CA  . ILE B 1 116 ? 2.489   11.870  -48.858 1.00 47.35  ? 116  ILE B CA  1 
ATOM   5109 C C   . ILE B 1 116 ? 2.925   10.923  -47.744 1.00 46.54  ? 116  ILE B C   1 
ATOM   5110 O O   . ILE B 1 116 ? 3.732   11.291  -46.878 1.00 46.14  ? 116  ILE B O   1 
ATOM   5111 C CB  . ILE B 1 116 ? 3.751   12.305  -49.645 1.00 47.19  ? 116  ILE B CB  1 
ATOM   5112 C CG1 . ILE B 1 116 ? 3.388   13.302  -50.739 1.00 48.12  ? 116  ILE B CG1 1 
ATOM   5113 C CG2 . ILE B 1 116 ? 4.463   11.082  -50.259 1.00 46.41  ? 116  ILE B CG2 1 
ATOM   5114 C CD1 . ILE B 1 116 ? 4.580   13.843  -51.535 1.00 48.16  ? 116  ILE B CD1 1 
ATOM   5115 N N   . TRP B 1 117 ? 2.400   9.700   -47.784 1.00 46.32  ? 117  TRP B N   1 
ATOM   5116 C CA  . TRP B 1 117 ? 2.701   8.671   -46.800 1.00 45.79  ? 117  TRP B CA  1 
ATOM   5117 C C   . TRP B 1 117 ? 3.920   7.842   -47.206 1.00 45.52  ? 117  TRP B C   1 
ATOM   5118 O O   . TRP B 1 117 ? 3.990   7.331   -48.332 1.00 45.35  ? 117  TRP B O   1 
ATOM   5119 C CB  . TRP B 1 117 ? 1.507   7.728   -46.648 1.00 46.47  ? 117  TRP B CB  1 
ATOM   5120 C CG  . TRP B 1 117 ? 1.749   6.588   -45.729 1.00 45.77  ? 117  TRP B CG  1 
ATOM   5121 C CD1 . TRP B 1 117 ? 1.914   5.277   -46.071 1.00 46.53  ? 117  TRP B CD1 1 
ATOM   5122 C CD2 . TRP B 1 117 ? 1.873   6.650   -44.309 1.00 45.86  ? 117  TRP B CD2 1 
ATOM   5123 N NE1 . TRP B 1 117 ? 2.124   4.515   -44.948 1.00 46.59  ? 117  TRP B NE1 1 
ATOM   5124 C CE2 . TRP B 1 117 ? 2.107   5.336   -43.851 1.00 47.05  ? 117  TRP B CE2 1 
ATOM   5125 C CE3 . TRP B 1 117 ? 1.801   7.687   -43.374 1.00 47.00  ? 117  TRP B CE3 1 
ATOM   5126 C CZ2 . TRP B 1 117 ? 2.267   5.035   -42.496 1.00 46.01  ? 117  TRP B CZ2 1 
ATOM   5127 C CZ3 . TRP B 1 117 ? 1.966   7.387   -42.029 1.00 46.23  ? 117  TRP B CZ3 1 
ATOM   5128 C CH2 . TRP B 1 117 ? 2.185   6.065   -41.605 1.00 46.58  ? 117  TRP B CH2 1 
ATOM   5129 N N   . ILE B 1 118 ? 4.856   7.702   -46.266 1.00 45.40  ? 118  ILE B N   1 
ATOM   5130 C CA  . ILE B 1 118 ? 6.015   6.816   -46.400 1.00 44.56  ? 118  ILE B CA  1 
ATOM   5131 C C   . ILE B 1 118 ? 5.911   5.709   -45.339 1.00 44.92  ? 118  ILE B C   1 
ATOM   5132 O O   . ILE B 1 118 ? 6.031   5.957   -44.146 1.00 44.94  ? 118  ILE B O   1 
ATOM   5133 C CB  . ILE B 1 118 ? 7.340   7.571   -46.214 1.00 43.95  ? 118  ILE B CB  1 
ATOM   5134 C CG1 . ILE B 1 118 ? 7.408   8.775   -47.146 1.00 45.31  ? 118  ILE B CG1 1 
ATOM   5135 C CG2 . ILE B 1 118 ? 8.514   6.655   -46.480 1.00 42.23  ? 118  ILE B CG2 1 
ATOM   5136 C CD1 . ILE B 1 118 ? 8.660   9.646   -46.959 1.00 42.93  ? 118  ILE B CD1 1 
ATOM   5137 N N   . TYR B 1 119 ? 5.677   4.484   -45.772 1.00 46.06  ? 119  TYR B N   1 
ATOM   5138 C CA  . TYR B 1 119 ? 5.507   3.375   -44.830 1.00 46.48  ? 119  TYR B CA  1 
ATOM   5139 C C   . TYR B 1 119 ? 6.796   3.007   -44.105 1.00 46.47  ? 119  TYR B C   1 
ATOM   5140 O O   . TYR B 1 119 ? 7.884   3.290   -44.589 1.00 47.00  ? 119  TYR B O   1 
ATOM   5141 C CB  . TYR B 1 119 ? 4.946   2.137   -45.520 1.00 46.88  ? 119  TYR B CB  1 
ATOM   5142 C CG  . TYR B 1 119 ? 5.756   1.580   -46.668 1.00 47.05  ? 119  TYR B CG  1 
ATOM   5143 C CD1 . TYR B 1 119 ? 6.936   0.894   -46.453 1.00 46.57  ? 119  TYR B CD1 1 
ATOM   5144 C CD2 . TYR B 1 119 ? 5.302   1.690   -47.974 1.00 48.19  ? 119  TYR B CD2 1 
ATOM   5145 C CE1 . TYR B 1 119 ? 7.672   0.367   -47.512 1.00 47.36  ? 119  TYR B CE1 1 
ATOM   5146 C CE2 . TYR B 1 119 ? 6.029   1.161   -49.039 1.00 48.13  ? 119  TYR B CE2 1 
ATOM   5147 C CZ  . TYR B 1 119 ? 7.213   0.500   -48.808 1.00 47.45  ? 119  TYR B CZ  1 
ATOM   5148 O OH  . TYR B 1 119 ? 7.938   -0.047  -49.869 1.00 47.48  ? 119  TYR B OH  1 
ATOM   5149 N N   . GLY B 1 120 ? 6.637   2.375   -42.941 1.00 46.67  ? 120  GLY B N   1 
ATOM   5150 C CA  . GLY B 1 120 ? 7.729   1.749   -42.206 1.00 46.36  ? 120  GLY B CA  1 
ATOM   5151 C C   . GLY B 1 120 ? 7.784   0.240   -42.398 1.00 46.60  ? 120  GLY B C   1 
ATOM   5152 O O   . GLY B 1 120 ? 7.083   -0.306  -43.250 1.00 47.29  ? 120  GLY B O   1 
ATOM   5153 N N   . GLY B 1 121 ? 8.604   -0.413  -41.572 1.00 46.54  ? 121  GLY B N   1 
ATOM   5154 C CA  . GLY B 1 121 ? 8.985   -1.818  -41.725 1.00 47.43  ? 121  GLY B CA  1 
ATOM   5155 C C   . GLY B 1 121 ? 10.481  -2.108  -41.605 1.00 47.70  ? 121  GLY B C   1 
ATOM   5156 O O   . GLY B 1 121 ? 10.979  -3.089  -42.179 1.00 48.69  ? 121  GLY B O   1 
ATOM   5157 N N   . GLY B 1 122 ? 11.196  -1.285  -40.839 1.00 47.36  ? 122  GLY B N   1 
ATOM   5158 C CA  . GLY B 1 122 ? 12.613  -1.499  -40.532 1.00 47.92  ? 122  GLY B CA  1 
ATOM   5159 C C   . GLY B 1 122 ? 13.556  -1.305  -41.703 1.00 48.03  ? 122  GLY B C   1 
ATOM   5160 O O   . GLY B 1 122 ? 14.703  -1.749  -41.663 1.00 49.36  ? 122  GLY B O   1 
ATOM   5161 N N   . PHE B 1 123 ? 13.075  -0.647  -42.751 1.00 47.51  ? 123  PHE B N   1 
ATOM   5162 C CA  . PHE B 1 123 ? 13.777  -0.583  -44.033 1.00 47.56  ? 123  PHE B CA  1 
ATOM   5163 C C   . PHE B 1 123 ? 13.969  -1.956  -44.706 1.00 48.52  ? 123  PHE B C   1 
ATOM   5164 O O   . PHE B 1 123 ? 14.700  -2.039  -45.699 1.00 48.90  ? 123  PHE B O   1 
ATOM   5165 C CB  . PHE B 1 123 ? 15.134  0.122   -43.897 1.00 47.20  ? 123  PHE B CB  1 
ATOM   5166 C CG  . PHE B 1 123 ? 15.035  1.568   -43.506 1.00 46.38  ? 123  PHE B CG  1 
ATOM   5167 C CD1 . PHE B 1 123 ? 14.622  2.522   -44.432 1.00 46.08  ? 123  PHE B CD1 1 
ATOM   5168 C CD2 . PHE B 1 123 ? 15.388  1.987   -42.235 1.00 45.81  ? 123  PHE B CD2 1 
ATOM   5169 C CE1 . PHE B 1 123 ? 14.539  3.867   -44.088 1.00 44.33  ? 123  PHE B CE1 1 
ATOM   5170 C CE2 . PHE B 1 123 ? 15.314  3.339   -41.882 1.00 47.41  ? 123  PHE B CE2 1 
ATOM   5171 C CZ  . PHE B 1 123 ? 14.870  4.273   -42.810 1.00 45.36  ? 123  PHE B CZ  1 
ATOM   5172 N N   . TYR B 1 124 ? 13.303  -3.005  -44.190 1.00 48.58  ? 124  TYR B N   1 
ATOM   5173 C CA  . TYR B 1 124 ? 13.387  -4.362  -44.741 1.00 49.16  ? 124  TYR B CA  1 
ATOM   5174 C C   . TYR B 1 124 ? 12.034  -4.882  -45.252 1.00 49.08  ? 124  TYR B C   1 
ATOM   5175 O O   . TYR B 1 124 ? 11.974  -5.961  -45.838 1.00 48.96  ? 124  TYR B O   1 
ATOM   5176 C CB  . TYR B 1 124 ? 13.975  -5.369  -43.713 1.00 50.25  ? 124  TYR B CB  1 
ATOM   5177 C CG  . TYR B 1 124 ? 13.043  -5.761  -42.583 1.00 50.44  ? 124  TYR B CG  1 
ATOM   5178 C CD1 . TYR B 1 124 ? 12.064  -6.720  -42.765 1.00 52.49  ? 124  TYR B CD1 1 
ATOM   5179 C CD2 . TYR B 1 124 ? 13.130  -5.157  -41.339 1.00 52.23  ? 124  TYR B CD2 1 
ATOM   5180 C CE1 . TYR B 1 124 ? 11.188  -7.063  -41.751 1.00 52.57  ? 124  TYR B CE1 1 
ATOM   5181 C CE2 . TYR B 1 124 ? 12.259  -5.502  -40.311 1.00 52.41  ? 124  TYR B CE2 1 
ATOM   5182 C CZ  . TYR B 1 124 ? 11.291  -6.461  -40.529 1.00 51.44  ? 124  TYR B CZ  1 
ATOM   5183 O OH  . TYR B 1 124 ? 10.426  -6.815  -39.517 1.00 52.05  ? 124  TYR B OH  1 
ATOM   5184 N N   . SER B 1 125 ? 10.961  -4.119  -45.029 1.00 48.31  ? 125  SER B N   1 
ATOM   5185 C CA  . SER B 1 125 ? 9.612   -4.582  -45.322 1.00 47.87  ? 125  SER B CA  1 
ATOM   5186 C C   . SER B 1 125 ? 8.672   -3.406  -45.512 1.00 47.18  ? 125  SER B C   1 
ATOM   5187 O O   . SER B 1 125 ? 9.078   -2.247  -45.363 1.00 46.46  ? 125  SER B O   1 
ATOM   5188 C CB  . SER B 1 125 ? 9.099   -5.478  -44.189 1.00 48.44  ? 125  SER B CB  1 
ATOM   5189 O OG  . SER B 1 125 ? 9.077   -4.782  -42.957 1.00 48.31  ? 125  SER B OG  1 
ATOM   5190 N N   . GLY B 1 126 ? 7.421   -3.715  -45.854 1.00 47.03  ? 126  GLY B N   1 
ATOM   5191 C CA  . GLY B 1 126 ? 6.384   -2.712  -46.006 1.00 47.04  ? 126  GLY B CA  1 
ATOM   5192 C C   . GLY B 1 126 ? 5.832   -2.616  -47.407 1.00 47.32  ? 126  GLY B C   1 
ATOM   5193 O O   . GLY B 1 126 ? 6.420   -3.131  -48.372 1.00 48.19  ? 126  GLY B O   1 
ATOM   5194 N N   . ALA B 1 127 ? 4.671   -1.975  -47.502 1.00 47.33  ? 127  ALA B N   1 
ATOM   5195 C CA  . ALA B 1 127 ? 3.976   -1.776  -48.763 1.00 47.62  ? 127  ALA B CA  1 
ATOM   5196 C C   . ALA B 1 127 ? 2.909   -0.698  -48.594 1.00 47.97  ? 127  ALA B C   1 
ATOM   5197 O O   . ALA B 1 127 ? 2.298   -0.592  -47.537 1.00 48.09  ? 127  ALA B O   1 
ATOM   5198 C CB  . ALA B 1 127 ? 3.342   -3.075  -49.208 1.00 48.29  ? 127  ALA B CB  1 
ATOM   5199 N N   . ALA B 1 128 ? 2.670   0.074   -49.648 1.00 48.14  ? 128  ALA B N   1 
ATOM   5200 C CA  . ALA B 1 128 ? 1.671   1.125   -49.631 1.00 48.48  ? 128  ALA B CA  1 
ATOM   5201 C C   . ALA B 1 128 ? 0.245   0.571   -49.805 1.00 49.68  ? 128  ALA B C   1 
ATOM   5202 O O   . ALA B 1 128 ? -0.730  1.309   -49.637 1.00 50.27  ? 128  ALA B O   1 
ATOM   5203 C CB  . ALA B 1 128 ? 1.995   2.171   -50.697 1.00 48.37  ? 128  ALA B CB  1 
ATOM   5204 N N   . SER B 1 129 ? 0.128   -0.728  -50.098 1.00 50.24  ? 129  SER B N   1 
ATOM   5205 C CA  . SER B 1 129 ? -1.164  -1.384  -50.302 1.00 51.35  ? 129  SER B CA  1 
ATOM   5206 C C   . SER B 1 129 ? -1.806  -2.000  -49.046 1.00 52.39  ? 129  SER B C   1 
ATOM   5207 O O   . SER B 1 129 ? -2.862  -2.652  -49.144 1.00 53.67  ? 129  SER B O   1 
ATOM   5208 C CB  . SER B 1 129 ? -1.014  -2.484  -51.366 1.00 52.27  ? 129  SER B CB  1 
ATOM   5209 O OG  . SER B 1 129 ? 0.085   -3.340  -51.088 1.00 50.47  ? 129  SER B OG  1 
ATOM   5210 N N   . LEU B 1 130 ? -1.185  -1.829  -47.880 1.00 51.82  ? 130  LEU B N   1 
ATOM   5211 C CA  . LEU B 1 130 ? -1.717  -2.437  -46.654 1.00 52.30  ? 130  LEU B CA  1 
ATOM   5212 C C   . LEU B 1 130 ? -3.019  -1.735  -46.284 1.00 52.84  ? 130  LEU B C   1 
ATOM   5213 O O   . LEU B 1 130 ? -3.174  -0.544  -46.556 1.00 52.43  ? 130  LEU B O   1 
ATOM   5214 C CB  . LEU B 1 130 ? -0.706  -2.365  -45.504 1.00 51.37  ? 130  LEU B CB  1 
ATOM   5215 C CG  . LEU B 1 130 ? 0.671   -3.023  -45.712 1.00 50.72  ? 130  LEU B CG  1 
ATOM   5216 C CD1 . LEU B 1 130 ? 1.479   -2.952  -44.435 1.00 48.97  ? 130  LEU B CD1 1 
ATOM   5217 C CD2 . LEU B 1 130 ? 0.566   -4.473  -46.172 1.00 50.49  ? 130  LEU B CD2 1 
ATOM   5218 N N   . ASP B 1 131 ? -3.965  -2.479  -45.706 1.00 54.01  ? 131  ASP B N   1 
ATOM   5219 C CA  . ASP B 1 131 ? -5.292  -1.927  -45.382 1.00 55.04  ? 131  ASP B CA  1 
ATOM   5220 C C   . ASP B 1 131 ? -5.214  -0.699  -44.476 1.00 54.12  ? 131  ASP B C   1 
ATOM   5221 O O   . ASP B 1 131 ? -6.040  0.197   -44.585 1.00 54.64  ? 131  ASP B O   1 
ATOM   5222 C CB  . ASP B 1 131 ? -6.177  -2.958  -44.676 1.00 56.49  ? 131  ASP B CB  1 
ATOM   5223 C CG  . ASP B 1 131 ? -6.668  -4.073  -45.595 1.00 58.79  ? 131  ASP B CG  1 
ATOM   5224 O OD1 . ASP B 1 131 ? -6.324  -4.108  -46.804 1.00 58.20  ? 131  ASP B OD1 1 
ATOM   5225 O OD2 . ASP B 1 131 ? -7.420  -4.932  -45.073 1.00 62.45  ? 131  ASP B OD2 1 
ATOM   5226 N N   . VAL B 1 132 ? -4.237  -0.664  -43.575 1.00 53.41  ? 132  VAL B N   1 
ATOM   5227 C CA  . VAL B 1 132 ? -4.112  0.451   -42.618 1.00 52.57  ? 132  VAL B CA  1 
ATOM   5228 C C   . VAL B 1 132 ? -3.615  1.755   -43.255 1.00 51.67  ? 132  VAL B C   1 
ATOM   5229 O O   . VAL B 1 132 ? -3.700  2.818   -42.623 1.00 51.53  ? 132  VAL B O   1 
ATOM   5230 C CB  . VAL B 1 132 ? -3.251  0.065   -41.377 1.00 52.30  ? 132  VAL B CB  1 
ATOM   5231 C CG1 . VAL B 1 132 ? -4.038  -0.883  -40.477 1.00 53.03  ? 132  VAL B CG1 1 
ATOM   5232 C CG2 . VAL B 1 132 ? -1.924  -0.578  -41.781 1.00 51.95  ? 132  VAL B CG2 1 
ATOM   5233 N N   . TYR B 1 133 ? -3.129  1.685   -44.499 1.00 51.29  ? 133  TYR B N   1 
ATOM   5234 C CA  . TYR B 1 133 ? -2.648  2.871   -45.225 1.00 50.93  ? 133  TYR B CA  1 
ATOM   5235 C C   . TYR B 1 133 ? -3.640  3.332   -46.283 1.00 51.92  ? 133  TYR B C   1 
ATOM   5236 O O   . TYR B 1 133 ? -3.305  4.129   -47.154 1.00 51.80  ? 133  TYR B O   1 
ATOM   5237 C CB  . TYR B 1 133 ? -1.295  2.611   -45.886 1.00 49.85  ? 133  TYR B CB  1 
ATOM   5238 C CG  . TYR B 1 133 ? -0.227  2.024   -44.987 1.00 48.27  ? 133  TYR B CG  1 
ATOM   5239 C CD1 . TYR B 1 133 ? -0.124  2.382   -43.651 1.00 48.58  ? 133  TYR B CD1 1 
ATOM   5240 C CD2 . TYR B 1 133 ? 0.703   1.123   -45.490 1.00 46.98  ? 133  TYR B CD2 1 
ATOM   5241 C CE1 . TYR B 1 133 ? 0.874   1.840   -42.837 1.00 47.99  ? 133  TYR B CE1 1 
ATOM   5242 C CE2 . TYR B 1 133 ? 1.692   0.575   -44.682 1.00 47.85  ? 133  TYR B CE2 1 
ATOM   5243 C CZ  . TYR B 1 133 ? 1.779   0.946   -43.360 1.00 47.40  ? 133  TYR B CZ  1 
ATOM   5244 O OH  . TYR B 1 133 ? 2.757   0.401   -42.559 1.00 46.57  ? 133  TYR B OH  1 
ATOM   5245 N N   . ASP B 1 134 ? -4.869  2.844   -46.166 1.00 53.52  ? 134  ASP B N   1 
ATOM   5246 C CA  . ASP B 1 134 ? -5.965  3.137   -47.078 1.00 54.64  ? 134  ASP B CA  1 
ATOM   5247 C C   . ASP B 1 134 ? -6.328  4.616   -47.022 1.00 55.22  ? 134  ASP B C   1 
ATOM   5248 O O   . ASP B 1 134 ? -6.912  5.078   -46.047 1.00 56.03  ? 134  ASP B O   1 
ATOM   5249 C CB  . ASP B 1 134 ? -7.149  2.260   -46.664 1.00 55.98  ? 134  ASP B CB  1 
ATOM   5250 C CG  . ASP B 1 134 ? -8.351  2.387   -47.569 1.00 57.07  ? 134  ASP B CG  1 
ATOM   5251 O OD1 . ASP B 1 134 ? -8.413  3.296   -48.419 1.00 57.28  ? 134  ASP B OD1 1 
ATOM   5252 O OD2 . ASP B 1 134 ? -9.253  1.543   -47.407 1.00 58.89  ? 134  ASP B OD2 1 
ATOM   5253 N N   . GLY B 1 135 ? -5.991  5.349   -48.081 1.00 55.34  ? 135  GLY B N   1 
ATOM   5254 C CA  . GLY B 1 135 ? -6.148  6.805   -48.111 1.00 55.56  ? 135  GLY B CA  1 
ATOM   5255 C C   . GLY B 1 135 ? -7.537  7.361   -48.397 1.00 56.92  ? 135  GLY B C   1 
ATOM   5256 O O   . GLY B 1 135 ? -7.693  8.574   -48.504 1.00 57.08  ? 135  GLY B O   1 
ATOM   5257 N N   . ARG B 1 136 ? -8.550  6.503   -48.509 1.00 58.02  ? 136  ARG B N   1 
ATOM   5258 C CA  . ARG B 1 136 ? -9.866  6.957   -48.943 1.00 59.66  ? 136  ARG B CA  1 
ATOM   5259 C C   . ARG B 1 136 ? -10.662 7.742   -47.900 1.00 60.25  ? 136  ARG B C   1 
ATOM   5260 O O   . ARG B 1 136 ? -11.523 8.547   -48.263 1.00 61.09  ? 136  ARG B O   1 
ATOM   5261 C CB  . ARG B 1 136 ? -10.712 5.783   -49.427 1.00 60.95  ? 136  ARG B CB  1 
ATOM   5262 C CG  . ARG B 1 136 ? -11.297 4.921   -48.322 1.00 62.21  ? 136  ARG B CG  1 
ATOM   5263 C CD  . ARG B 1 136 ? -11.148 3.459   -48.653 1.00 64.16  ? 136  ARG B CD  1 
ATOM   5264 N NE  . ARG B 1 136 ? -12.253 2.914   -49.392 1.00 66.11  ? 136  ARG B NE  1 
ATOM   5265 C CZ  . ARG B 1 136 ? -12.194 1.878   -50.230 1.00 65.91  ? 136  ARG B CZ  1 
ATOM   5266 N NH1 . ARG B 1 136 ? -11.054 1.245   -50.512 1.00 63.94  ? 136  ARG B NH1 1 
ATOM   5267 N NH2 . ARG B 1 136 ? -13.314 1.482   -50.808 1.00 67.49  ? 136  ARG B NH2 1 
ATOM   5268 N N   . PHE B 1 137 ? -10.404 7.486   -46.619 1.00 59.52  ? 137  PHE B N   1 
ATOM   5269 C CA  . PHE B 1 137 ? -11.178 8.108   -45.544 1.00 60.03  ? 137  PHE B CA  1 
ATOM   5270 C C   . PHE B 1 137 ? -10.771 9.569   -45.432 1.00 59.04  ? 137  PHE B C   1 
ATOM   5271 O O   . PHE B 1 137 ? -11.621 10.465  -45.382 1.00 59.34  ? 137  PHE B O   1 
ATOM   5272 C CB  . PHE B 1 137 ? -10.937 7.378   -44.222 1.00 59.84  ? 137  PHE B CB  1 
ATOM   5273 C CG  . PHE B 1 137 ? -11.272 5.918   -44.275 1.00 60.33  ? 137  PHE B CG  1 
ATOM   5274 C CD1 . PHE B 1 137 ? -12.586 5.496   -44.205 1.00 62.38  ? 137  PHE B CD1 1 
ATOM   5275 C CD2 . PHE B 1 137 ? -10.276 4.968   -44.407 1.00 59.82  ? 137  PHE B CD2 1 
ATOM   5276 C CE1 . PHE B 1 137 ? -12.904 4.140   -44.262 1.00 63.34  ? 137  PHE B CE1 1 
ATOM   5277 C CE2 . PHE B 1 137 ? -10.584 3.614   -44.459 1.00 60.32  ? 137  PHE B CE2 1 
ATOM   5278 C CZ  . PHE B 1 137 ? -11.898 3.201   -44.392 1.00 61.54  ? 137  PHE B CZ  1 
ATOM   5279 N N   . LEU B 1 138 ? -9.460  9.785   -45.421 1.00 57.09  ? 138  LEU B N   1 
ATOM   5280 C CA  . LEU B 1 138 ? -8.860  11.124  -45.441 1.00 56.71  ? 138  LEU B CA  1 
ATOM   5281 C C   . LEU B 1 138 ? -9.278  11.899  -46.692 1.00 57.61  ? 138  LEU B C   1 
ATOM   5282 O O   . LEU B 1 138 ? -9.675  13.071  -46.613 1.00 58.39  ? 138  LEU B O   1 
ATOM   5283 C CB  . LEU B 1 138 ? -7.330  11.015  -45.369 1.00 55.30  ? 138  LEU B CB  1 
ATOM   5284 C CG  . LEU B 1 138 ? -6.711  10.745  -43.992 1.00 53.83  ? 138  LEU B CG  1 
ATOM   5285 C CD1 . LEU B 1 138 ? -5.262  10.223  -44.111 1.00 50.17  ? 138  LEU B CD1 1 
ATOM   5286 C CD2 . LEU B 1 138 ? -6.776  12.018  -43.127 1.00 52.42  ? 138  LEU B CD2 1 
ATOM   5287 N N   . ALA B 1 139 ? -9.214  11.231  -47.843 1.00 57.28  ? 139  ALA B N   1 
ATOM   5288 C CA  . ALA B 1 139 ? -9.684  11.812  -49.099 1.00 58.10  ? 139  ALA B CA  1 
ATOM   5289 C C   . ALA B 1 139 ? -11.141 12.279  -48.996 1.00 59.64  ? 139  ALA B C   1 
ATOM   5290 O O   . ALA B 1 139 ? -11.444 13.443  -49.245 1.00 60.52  ? 139  ALA B O   1 
ATOM   5291 C CB  . ALA B 1 139 ? -9.530  10.803  -50.250 1.00 57.47  ? 139  ALA B CB  1 
ATOM   5292 N N   . GLN B 1 140 ? -12.031 11.370  -48.610 1.00 60.22  ? 140  GLN B N   1 
ATOM   5293 C CA  . GLN B 1 140 ? -13.461 11.654  -48.604 1.00 61.87  ? 140  GLN B CA  1 
ATOM   5294 C C   . GLN B 1 140 ? -13.855 12.640  -47.509 1.00 62.40  ? 140  GLN B C   1 
ATOM   5295 O O   . GLN B 1 140 ? -14.571 13.599  -47.771 1.00 64.53  ? 140  GLN B O   1 
ATOM   5296 C CB  . GLN B 1 140 ? -14.266 10.361  -48.437 1.00 62.50  ? 140  GLN B CB  1 
ATOM   5297 C CG  . GLN B 1 140 ? -15.706 10.453  -48.944 1.00 63.97  ? 140  GLN B CG  1 
ATOM   5298 C CD  . GLN B 1 140 ? -16.655 11.116  -47.959 1.00 66.10  ? 140  GLN B CD  1 
ATOM   5299 O OE1 . GLN B 1 140 ? -16.493 11.004  -46.737 1.00 65.74  ? 140  GLN B OE1 1 
ATOM   5300 N NE2 . GLN B 1 140 ? -17.667 11.797  -48.487 1.00 67.01  ? 140  GLN B NE2 1 
ATOM   5301 N N   . VAL B 1 141 ? -13.401 12.394  -46.285 1.00 61.54  ? 141  VAL B N   1 
ATOM   5302 C CA  . VAL B 1 141 ? -13.860 13.150  -45.130 1.00 61.85  ? 141  VAL B CA  1 
ATOM   5303 C C   . VAL B 1 141 ? -13.191 14.514  -45.058 1.00 61.62  ? 141  VAL B C   1 
ATOM   5304 O O   . VAL B 1 141 ? -13.864 15.525  -44.847 1.00 62.34  ? 141  VAL B O   1 
ATOM   5305 C CB  . VAL B 1 141 ? -13.622 12.377  -43.823 1.00 61.19  ? 141  VAL B CB  1 
ATOM   5306 C CG1 . VAL B 1 141 ? -14.017 13.224  -42.614 1.00 60.93  ? 141  VAL B CG1 1 
ATOM   5307 C CG2 . VAL B 1 141 ? -14.404 11.059  -43.848 1.00 61.76  ? 141  VAL B CG2 1 
ATOM   5308 N N   . GLU B 1 142 ? -11.875 14.549  -45.247 1.00 60.35  ? 142  GLU B N   1 
ATOM   5309 C CA  . GLU B 1 142 ? -11.120 15.798  -45.113 1.00 60.11  ? 142  GLU B CA  1 
ATOM   5310 C C   . GLU B 1 142 ? -10.789 16.499  -46.432 1.00 60.55  ? 142  GLU B C   1 
ATOM   5311 O O   . GLU B 1 142 ? -10.204 17.584  -46.420 1.00 60.59  ? 142  GLU B O   1 
ATOM   5312 C CB  . GLU B 1 142 ? -9.850  15.560  -44.301 1.00 58.53  ? 142  GLU B CB  1 
ATOM   5313 C CG  . GLU B 1 142 ? -10.114 15.249  -42.840 1.00 59.55  ? 142  GLU B CG  1 
ATOM   5314 C CD  . GLU B 1 142 ? -10.780 16.395  -42.087 1.00 63.89  ? 142  GLU B CD  1 
ATOM   5315 O OE1 . GLU B 1 142 ? -10.616 17.584  -42.486 1.00 64.97  ? 142  GLU B OE1 1 
ATOM   5316 O OE2 . GLU B 1 142 ? -11.483 16.102  -41.091 1.00 65.90  ? 142  GLU B OE2 1 
ATOM   5317 N N   . GLY B 1 143 ? -11.178 15.908  -47.562 1.00 61.17  ? 143  GLY B N   1 
ATOM   5318 C CA  . GLY B 1 143 ? -10.925 16.520  -48.878 1.00 61.74  ? 143  GLY B CA  1 
ATOM   5319 C C   . GLY B 1 143 ? -9.455  16.499  -49.284 1.00 60.40  ? 143  GLY B C   1 
ATOM   5320 O O   . GLY B 1 143 ? -9.029  17.245  -50.174 1.00 61.09  ? 143  GLY B O   1 
ATOM   5321 N N   . ALA B 1 144 ? -8.679  15.638  -48.634 1.00 58.89  ? 144  ALA B N   1 
ATOM   5322 C CA  . ALA B 1 144 ? -7.242  15.586  -48.843 1.00 56.98  ? 144  ALA B CA  1 
ATOM   5323 C C   . ALA B 1 144 ? -6.908  14.855  -50.137 1.00 56.62  ? 144  ALA B C   1 
ATOM   5324 O O   . ALA B 1 144 ? -7.635  13.949  -50.548 1.00 56.70  ? 144  ALA B O   1 
ATOM   5325 C CB  . ALA B 1 144 ? -6.577  14.891  -47.670 1.00 55.81  ? 144  ALA B CB  1 
ATOM   5326 N N   . VAL B 1 145 ? -5.815  15.274  -50.778 1.00 55.85  ? 145  VAL B N   1 
ATOM   5327 C CA  . VAL B 1 145 ? -5.183  14.490  -51.819 1.00 55.07  ? 145  VAL B CA  1 
ATOM   5328 C C   . VAL B 1 145 ? -4.088  13.705  -51.118 1.00 54.11  ? 145  VAL B C   1 
ATOM   5329 O O   . VAL B 1 145 ? -3.179  14.287  -50.533 1.00 53.82  ? 145  VAL B O   1 
ATOM   5330 C CB  . VAL B 1 145 ? -4.577  15.367  -52.941 1.00 55.42  ? 145  VAL B CB  1 
ATOM   5331 C CG1 . VAL B 1 145 ? -3.710  14.516  -53.881 1.00 52.44  ? 145  VAL B CG1 1 
ATOM   5332 C CG2 . VAL B 1 145 ? -5.687  16.076  -53.719 1.00 55.20  ? 145  VAL B CG2 1 
ATOM   5333 N N   . LEU B 1 146 ? -4.190  12.387  -51.154 1.00 53.80  ? 146  LEU B N   1 
ATOM   5334 C CA  . LEU B 1 146 ? -3.255  11.537  -50.446 1.00 52.88  ? 146  LEU B CA  1 
ATOM   5335 C C   . LEU B 1 146 ? -2.453  10.695  -51.421 1.00 52.13  ? 146  LEU B C   1 
ATOM   5336 O O   . LEU B 1 146 ? -3.029  10.038  -52.307 1.00 52.39  ? 146  LEU B O   1 
ATOM   5337 C CB  . LEU B 1 146 ? -3.998  10.635  -49.453 1.00 53.37  ? 146  LEU B CB  1 
ATOM   5338 C CG  . LEU B 1 146 ? -3.031  10.000  -48.430 1.00 54.63  ? 146  LEU B CG  1 
ATOM   5339 C CD1 . LEU B 1 146 ? -3.536  10.148  -47.018 1.00 54.60  ? 146  LEU B CD1 1 
ATOM   5340 C CD2 . LEU B 1 146 ? -2.706  8.523   -48.791 1.00 55.46  ? 146  LEU B CD2 1 
ATOM   5341 N N   . VAL B 1 147 ? -1.126  10.710  -51.259 1.00 50.84  ? 147  VAL B N   1 
ATOM   5342 C CA  . VAL B 1 147 ? -0.232  9.917   -52.099 1.00 49.73  ? 147  VAL B CA  1 
ATOM   5343 C C   . VAL B 1 147 ? 0.546   8.928   -51.231 1.00 49.46  ? 147  VAL B C   1 
ATOM   5344 O O   . VAL B 1 147 ? 0.891   9.240   -50.088 1.00 49.00  ? 147  VAL B O   1 
ATOM   5345 C CB  . VAL B 1 147 ? 0.782   10.811  -52.847 1.00 50.18  ? 147  VAL B CB  1 
ATOM   5346 C CG1 . VAL B 1 147 ? 1.689   9.971   -53.761 1.00 47.75  ? 147  VAL B CG1 1 
ATOM   5347 C CG2 . VAL B 1 147 ? 0.081   11.927  -53.632 1.00 48.11  ? 147  VAL B CG2 1 
ATOM   5348 N N   . SER B 1 148 ? 0.809   7.737   -51.771 1.00 49.41  ? 148  SER B N   1 
ATOM   5349 C CA  . SER B 1 148 ? 1.738   6.782   -51.154 1.00 48.34  ? 148  SER B CA  1 
ATOM   5350 C C   . SER B 1 148 ? 2.536   6.056   -52.231 1.00 48.18  ? 148  SER B C   1 
ATOM   5351 O O   . SER B 1 148 ? 2.014   5.764   -53.315 1.00 48.85  ? 148  SER B O   1 
ATOM   5352 C CB  . SER B 1 148 ? 0.985   5.781   -50.265 1.00 48.29  ? 148  SER B CB  1 
ATOM   5353 O OG  . SER B 1 148 ? 0.128   4.933   -51.005 1.00 48.54  ? 148  SER B OG  1 
ATOM   5354 N N   . MET B 1 149 ? 3.806   5.786   -51.942 1.00 47.54  ? 149  MET B N   1 
ATOM   5355 C CA  . MET B 1 149 ? 4.699   5.101   -52.883 1.00 47.44  ? 149  MET B CA  1 
ATOM   5356 C C   . MET B 1 149 ? 5.305   3.854   -52.279 1.00 47.29  ? 149  MET B C   1 
ATOM   5357 O O   . MET B 1 149 ? 5.483   3.763   -51.065 1.00 46.60  ? 149  MET B O   1 
ATOM   5358 C CB  . MET B 1 149 ? 5.818   6.026   -53.367 1.00 47.22  ? 149  MET B CB  1 
ATOM   5359 C CG  . MET B 1 149 ? 7.078   6.123   -52.479 1.00 47.39  ? 149  MET B CG  1 
ATOM   5360 S SD  . MET B 1 149 ? 6.893   6.778   -50.794 1.00 46.61  ? 149  MET B SD  1 
ATOM   5361 C CE  . MET B 1 149 ? 6.683   8.526   -51.149 1.00 46.10  ? 149  MET B CE  1 
ATOM   5362 N N   . ASN B 1 150 ? 5.581   2.882   -53.146 1.00 47.77  ? 150  ASN B N   1 
ATOM   5363 C CA  . ASN B 1 150 ? 6.451   1.764   -52.821 1.00 47.86  ? 150  ASN B CA  1 
ATOM   5364 C C   . ASN B 1 150 ? 7.887   2.225   -53.051 1.00 47.67  ? 150  ASN B C   1 
ATOM   5365 O O   . ASN B 1 150 ? 8.183   2.892   -54.048 1.00 47.74  ? 150  ASN B O   1 
ATOM   5366 C CB  . ASN B 1 150 ? 6.161   0.554   -53.713 1.00 48.60  ? 150  ASN B CB  1 
ATOM   5367 C CG  . ASN B 1 150 ? 4.998   -0.295  -53.213 1.00 50.93  ? 150  ASN B CG  1 
ATOM   5368 O OD1 . ASN B 1 150 ? 4.349   0.038   -52.222 1.00 53.56  ? 150  ASN B OD1 1 
ATOM   5369 N ND2 . ASN B 1 150 ? 4.733   -1.410  -53.908 1.00 51.96  ? 150  ASN B ND2 1 
ATOM   5370 N N   . TYR B 1 151 ? 8.764   1.888   -52.111 1.00 47.14  ? 151  TYR B N   1 
ATOM   5371 C CA  . TYR B 1 151 ? 10.175  2.128   -52.249 1.00 46.63  ? 151  TYR B CA  1 
ATOM   5372 C C   . TYR B 1 151 ? 10.905  0.829   -51.911 1.00 46.95  ? 151  TYR B C   1 
ATOM   5373 O O   . TYR B 1 151 ? 10.398  0.001   -51.144 1.00 47.47  ? 151  TYR B O   1 
ATOM   5374 C CB  . TYR B 1 151 ? 10.630  3.277   -51.343 1.00 46.54  ? 151  TYR B CB  1 
ATOM   5375 C CG  . TYR B 1 151 ? 10.497  3.039   -49.851 1.00 46.29  ? 151  TYR B CG  1 
ATOM   5376 C CD1 . TYR B 1 151 ? 9.347   3.420   -49.168 1.00 46.73  ? 151  TYR B CD1 1 
ATOM   5377 C CD2 . TYR B 1 151 ? 11.535  2.458   -49.112 1.00 46.11  ? 151  TYR B CD2 1 
ATOM   5378 C CE1 . TYR B 1 151 ? 9.220   3.214   -47.788 1.00 45.68  ? 151  TYR B CE1 1 
ATOM   5379 C CE2 . TYR B 1 151 ? 11.408  2.233   -47.731 1.00 44.58  ? 151  TYR B CE2 1 
ATOM   5380 C CZ  . TYR B 1 151 ? 10.251  2.632   -47.075 1.00 46.08  ? 151  TYR B CZ  1 
ATOM   5381 O OH  . TYR B 1 151 ? 10.106  2.451   -45.702 1.00 46.03  ? 151  TYR B OH  1 
ATOM   5382 N N   . ARG B 1 152 ? 12.088  0.651   -52.487 1.00 46.98  ? 152  ARG B N   1 
ATOM   5383 C CA  . ARG B 1 152 ? 12.854  -0.587  -52.300 1.00 47.15  ? 152  ARG B CA  1 
ATOM   5384 C C   . ARG B 1 152 ? 13.375  -0.742  -50.868 1.00 46.49  ? 152  ARG B C   1 
ATOM   5385 O O   . ARG B 1 152 ? 13.794  0.224   -50.252 1.00 45.79  ? 152  ARG B O   1 
ATOM   5386 C CB  . ARG B 1 152 ? 14.032  -0.656  -53.275 1.00 47.50  ? 152  ARG B CB  1 
ATOM   5387 C CG  . ARG B 1 152 ? 13.663  -1.072  -54.672 1.00 47.96  ? 152  ARG B CG  1 
ATOM   5388 C CD  . ARG B 1 152 ? 14.884  -0.967  -55.578 1.00 48.01  ? 152  ARG B CD  1 
ATOM   5389 N NE  . ARG B 1 152 ? 15.150  0.430   -55.924 1.00 47.81  ? 152  ARG B NE  1 
ATOM   5390 C CZ  . ARG B 1 152 ? 16.201  0.844   -56.625 1.00 48.42  ? 152  ARG B CZ  1 
ATOM   5391 N NH1 . ARG B 1 152 ? 17.097  -0.032  -57.074 1.00 47.60  ? 152  ARG B NH1 1 
ATOM   5392 N NH2 . ARG B 1 152 ? 16.334  2.138   -56.905 1.00 47.33  ? 152  ARG B NH2 1 
ATOM   5393 N N   . VAL B 1 153 ? 13.371  -1.984  -50.374 1.00 46.34  ? 153  VAL B N   1 
ATOM   5394 C CA  . VAL B 1 153 ? 13.725  -2.284  -49.000 1.00 45.76  ? 153  VAL B CA  1 
ATOM   5395 C C   . VAL B 1 153 ? 14.733  -3.431  -48.981 1.00 47.09  ? 153  VAL B C   1 
ATOM   5396 O O   . VAL B 1 153 ? 15.014  -4.050  -50.025 1.00 47.46  ? 153  VAL B O   1 
ATOM   5397 C CB  . VAL B 1 153 ? 12.460  -2.629  -48.165 1.00 46.19  ? 153  VAL B CB  1 
ATOM   5398 C CG1 . VAL B 1 153 ? 11.524  -1.396  -48.066 1.00 43.58  ? 153  VAL B CG1 1 
ATOM   5399 C CG2 . VAL B 1 153 ? 11.711  -3.853  -48.738 1.00 45.25  ? 153  VAL B CG2 1 
ATOM   5400 N N   . GLY B 1 154 ? 15.311  -3.692  -47.813 1.00 47.03  ? 154  GLY B N   1 
ATOM   5401 C CA  . GLY B 1 154 ? 16.294  -4.782  -47.676 1.00 48.37  ? 154  GLY B CA  1 
ATOM   5402 C C   . GLY B 1 154 ? 17.514  -4.517  -48.528 1.00 48.76  ? 154  GLY B C   1 
ATOM   5403 O O   . GLY B 1 154 ? 17.830  -3.364  -48.819 1.00 48.00  ? 154  GLY B O   1 
ATOM   5404 N N   . THR B 1 155 ? 18.191  -5.584  -48.950 1.00 50.19  ? 155  THR B N   1 
ATOM   5405 C CA  . THR B 1 155 ? 19.360  -5.459  -49.836 1.00 50.73  ? 155  THR B CA  1 
ATOM   5406 C C   . THR B 1 155 ? 19.021  -4.650  -51.105 1.00 50.50  ? 155  THR B C   1 
ATOM   5407 O O   . THR B 1 155 ? 19.797  -3.802  -51.546 1.00 50.05  ? 155  THR B O   1 
ATOM   5408 C CB  . THR B 1 155 ? 19.864  -6.837  -50.269 1.00 52.22  ? 155  THR B CB  1 
ATOM   5409 O OG1 . THR B 1 155 ? 18.787  -7.551  -50.873 1.00 50.93  ? 155  THR B OG1 1 
ATOM   5410 C CG2 . THR B 1 155 ? 20.404  -7.641  -49.067 1.00 52.64  ? 155  THR B CG2 1 
ATOM   5411 N N   . PHE B 1 156 ? 17.832  -4.876  -51.653 1.00 50.17  ? 156  PHE B N   1 
ATOM   5412 C CA  . PHE B 1 156 ? 17.444  -4.240  -52.917 1.00 50.02  ? 156  PHE B CA  1 
ATOM   5413 C C   . PHE B 1 156 ? 17.394  -2.732  -52.791 1.00 49.19  ? 156  PHE B C   1 
ATOM   5414 O O   . PHE B 1 156 ? 17.694  -2.016  -53.743 1.00 49.20  ? 156  PHE B O   1 
ATOM   5415 C CB  . PHE B 1 156 ? 16.110  -4.794  -53.413 1.00 49.81  ? 156  PHE B CB  1 
ATOM   5416 C CG  . PHE B 1 156 ? 16.064  -6.284  -53.389 1.00 51.09  ? 156  PHE B CG  1 
ATOM   5417 C CD1 . PHE B 1 156 ? 16.690  -7.023  -54.386 1.00 51.57  ? 156  PHE B CD1 1 
ATOM   5418 C CD2 . PHE B 1 156 ? 15.491  -6.952  -52.322 1.00 50.73  ? 156  PHE B CD2 1 
ATOM   5419 C CE1 . PHE B 1 156 ? 16.700  -8.400  -54.333 1.00 52.33  ? 156  PHE B CE1 1 
ATOM   5420 C CE2 . PHE B 1 156 ? 15.501  -8.326  -52.267 1.00 52.05  ? 156  PHE B CE2 1 
ATOM   5421 C CZ  . PHE B 1 156 ? 16.106  -9.051  -53.274 1.00 52.37  ? 156  PHE B CZ  1 
ATOM   5422 N N   . GLY B 1 157 ? 17.051  -2.246  -51.609 1.00 48.80  ? 157  GLY B N   1 
ATOM   5423 C CA  . GLY B 1 157 ? 16.912  -0.803  -51.401 1.00 48.22  ? 157  GLY B CA  1 
ATOM   5424 C C   . GLY B 1 157 ? 18.115  -0.157  -50.734 1.00 48.16  ? 157  GLY B C   1 
ATOM   5425 O O   . GLY B 1 157 ? 18.344  1.027   -50.909 1.00 47.95  ? 157  GLY B O   1 
ATOM   5426 N N   . PHE B 1 158 ? 18.866  -0.933  -49.957 1.00 48.70  ? 158  PHE B N   1 
ATOM   5427 C CA  . PHE B 1 158 ? 19.864  -0.374  -49.038 1.00 49.32  ? 158  PHE B CA  1 
ATOM   5428 C C   . PHE B 1 158 ? 21.215  -1.074  -48.933 1.00 50.56  ? 158  PHE B C   1 
ATOM   5429 O O   . PHE B 1 158 ? 22.104  -0.599  -48.196 1.00 51.04  ? 158  PHE B O   1 
ATOM   5430 C CB  . PHE B 1 158 ? 19.219  -0.208  -47.655 1.00 48.50  ? 158  PHE B CB  1 
ATOM   5431 C CG  . PHE B 1 158 ? 18.155  0.846   -47.650 1.00 47.37  ? 158  PHE B CG  1 
ATOM   5432 C CD1 . PHE B 1 158 ? 18.504  2.190   -47.706 1.00 47.20  ? 158  PHE B CD1 1 
ATOM   5433 C CD2 . PHE B 1 158 ? 16.826  0.507   -47.697 1.00 45.53  ? 158  PHE B CD2 1 
ATOM   5434 C CE1 . PHE B 1 158 ? 17.545  3.164   -47.763 1.00 46.02  ? 158  PHE B CE1 1 
ATOM   5435 C CE2 . PHE B 1 158 ? 15.863  1.477   -47.765 1.00 45.46  ? 158  PHE B CE2 1 
ATOM   5436 C CZ  . PHE B 1 158 ? 16.218  2.805   -47.795 1.00 45.09  ? 158  PHE B CZ  1 
ATOM   5437 N N   . LEU B 1 159 ? 21.418  -2.161  -49.677 1.00 51.60  ? 159  LEU B N   1 
ATOM   5438 C CA  . LEU B 1 159 ? 22.761  -2.751  -49.735 1.00 52.66  ? 159  LEU B CA  1 
ATOM   5439 C C   . LEU B 1 159 ? 23.705  -1.750  -50.382 1.00 53.43  ? 159  LEU B C   1 
ATOM   5440 O O   . LEU B 1 159 ? 23.412  -1.224  -51.458 1.00 53.79  ? 159  LEU B O   1 
ATOM   5441 C CB  . LEU B 1 159 ? 22.778  -4.058  -50.515 1.00 53.30  ? 159  LEU B CB  1 
ATOM   5442 C CG  . LEU B 1 159 ? 24.158  -4.729  -50.625 1.00 54.82  ? 159  LEU B CG  1 
ATOM   5443 C CD1 . LEU B 1 159 ? 24.045  -6.240  -50.542 1.00 54.57  ? 159  LEU B CD1 1 
ATOM   5444 C CD2 . LEU B 1 159 ? 24.856  -4.316  -51.917 1.00 54.37  ? 159  LEU B CD2 1 
ATOM   5445 N N   . ALA B 1 160 ? 24.840  -1.502  -49.732 1.00 54.29  ? 160  ALA B N   1 
ATOM   5446 C CA  . ALA B 1 160 ? 25.791  -0.481  -50.160 1.00 54.87  ? 160  ALA B CA  1 
ATOM   5447 C C   . ALA B 1 160 ? 27.219  -0.996  -50.088 1.00 56.92  ? 160  ALA B C   1 
ATOM   5448 O O   . ALA B 1 160 ? 27.605  -1.668  -49.123 1.00 57.68  ? 160  ALA B O   1 
ATOM   5449 C CB  . ALA B 1 160 ? 25.663  0.756   -49.289 1.00 54.06  ? 160  ALA B CB  1 
ATOM   5450 N N   . LEU B 1 161 ? 27.983  -0.690  -51.130 1.00 58.16  ? 161  LEU B N   1 
ATOM   5451 C CA  . LEU B 1 161 ? 29.431  -0.743  -51.098 1.00 60.37  ? 161  LEU B CA  1 
ATOM   5452 C C   . LEU B 1 161 ? 29.842  0.709   -51.293 1.00 60.89  ? 161  LEU B C   1 
ATOM   5453 O O   . LEU B 1 161 ? 30.020  1.158   -52.421 1.00 61.27  ? 161  LEU B O   1 
ATOM   5454 C CB  . LEU B 1 161 ? 29.965  -1.639  -52.206 1.00 61.39  ? 161  LEU B CB  1 
ATOM   5455 C CG  . LEU B 1 161 ? 29.720  -3.125  -51.913 1.00 62.69  ? 161  LEU B CG  1 
ATOM   5456 C CD1 . LEU B 1 161 ? 29.763  -3.918  -53.173 1.00 65.14  ? 161  LEU B CD1 1 
ATOM   5457 C CD2 . LEU B 1 161 ? 30.735  -3.687  -50.914 1.00 63.91  ? 161  LEU B CD2 1 
ATOM   5458 N N   . PRO B 1 162 ? 29.930  1.471   -50.190 1.00 61.20  ? 162  PRO B N   1 
ATOM   5459 C CA  . PRO B 1 162 ? 30.079  2.921   -50.289 1.00 61.45  ? 162  PRO B CA  1 
ATOM   5460 C C   . PRO B 1 162 ? 31.260  3.362   -51.139 1.00 63.02  ? 162  PRO B C   1 
ATOM   5461 O O   . PRO B 1 162 ? 32.347  2.800   -51.032 1.00 64.57  ? 162  PRO B O   1 
ATOM   5462 C CB  . PRO B 1 162 ? 30.266  3.336   -48.835 1.00 61.43  ? 162  PRO B CB  1 
ATOM   5463 C CG  . PRO B 1 162 ? 29.516  2.309   -48.084 1.00 60.36  ? 162  PRO B CG  1 
ATOM   5464 C CD  . PRO B 1 162 ? 29.870  1.044   -48.782 1.00 60.93  ? 162  PRO B CD  1 
ATOM   5465 N N   . GLY B 1 163 ? 31.028  4.348   -51.998 1.00 63.16  ? 163  GLY B N   1 
ATOM   5466 C CA  . GLY B 1 163 ? 32.045  4.808   -52.940 1.00 64.83  ? 163  GLY B CA  1 
ATOM   5467 C C   . GLY B 1 163 ? 32.008  4.081   -54.270 1.00 65.54  ? 163  GLY B C   1 
ATOM   5468 O O   . GLY B 1 163 ? 32.694  4.482   -55.207 1.00 66.36  ? 163  GLY B O   1 
ATOM   5469 N N   . SER B 1 164 ? 31.202  3.020   -54.368 1.00 65.31  ? 164  SER B N   1 
ATOM   5470 C CA  . SER B 1 164 ? 31.058  2.271   -55.619 1.00 65.78  ? 164  SER B CA  1 
ATOM   5471 C C   . SER B 1 164 ? 30.070  2.955   -56.550 1.00 65.61  ? 164  SER B C   1 
ATOM   5472 O O   . SER B 1 164 ? 29.177  3.679   -56.103 1.00 64.46  ? 164  SER B O   1 
ATOM   5473 C CB  . SER B 1 164 ? 30.596  0.835   -55.354 1.00 65.46  ? 164  SER B CB  1 
ATOM   5474 O OG  . SER B 1 164 ? 29.240  0.798   -54.927 1.00 62.79  ? 164  SER B OG  1 
ATOM   5475 N N   . ARG B 1 165 ? 30.234  2.706   -57.845 1.00 66.92  ? 165  ARG B N   1 
ATOM   5476 C CA  . ARG B 1 165 ? 29.316  3.201   -58.862 1.00 67.27  ? 165  ARG B CA  1 
ATOM   5477 C C   . ARG B 1 165 ? 28.051  2.350   -58.856 1.00 65.22  ? 165  ARG B C   1 
ATOM   5478 O O   . ARG B 1 165 ? 26.944  2.861   -59.038 1.00 64.13  ? 165  ARG B O   1 
ATOM   5479 C CB  . ARG B 1 165 ? 29.969  3.129   -60.252 1.00 68.86  ? 165  ARG B CB  1 
ATOM   5480 C CG  . ARG B 1 165 ? 29.369  4.085   -61.286 1.00 70.67  ? 165  ARG B CG  1 
ATOM   5481 C CD  . ARG B 1 165 ? 29.490  3.571   -62.743 1.00 72.56  ? 165  ARG B CD  1 
ATOM   5482 N NE  . ARG B 1 165 ? 28.189  3.084   -63.238 1.00 75.54  ? 165  ARG B NE  1 
ATOM   5483 C CZ  . ARG B 1 165 ? 27.885  1.817   -63.547 1.00 76.54  ? 165  ARG B CZ  1 
ATOM   5484 N NH1 . ARG B 1 165 ? 28.787  0.832   -63.459 1.00 79.04  ? 165  ARG B NH1 1 
ATOM   5485 N NH2 . ARG B 1 165 ? 26.658  1.531   -63.968 1.00 74.89  ? 165  ARG B NH2 1 
ATOM   5486 N N   . GLU B 1 166 ? 28.225  1.055   -58.606 1.00 64.42  ? 166  GLU B N   1 
ATOM   5487 C CA  . GLU B 1 166 ? 27.183  0.072   -58.861 1.00 63.17  ? 166  GLU B CA  1 
ATOM   5488 C C   . GLU B 1 166 ? 26.272  -0.232  -57.663 1.00 61.49  ? 166  GLU B C   1 
ATOM   5489 O O   . GLU B 1 166 ? 25.220  -0.861  -57.835 1.00 60.85  ? 166  GLU B O   1 
ATOM   5490 C CB  . GLU B 1 166 ? 27.820  -1.227  -59.369 1.00 64.69  ? 166  GLU B CB  1 
ATOM   5491 C CG  . GLU B 1 166 ? 28.775  -1.036  -60.567 1.00 67.13  ? 166  GLU B CG  1 
ATOM   5492 C CD  . GLU B 1 166 ? 30.242  -0.802  -60.161 1.00 71.49  ? 166  GLU B CD  1 
ATOM   5493 O OE1 . GLU B 1 166 ? 30.517  -0.373  -59.007 1.00 71.18  ? 166  GLU B OE1 1 
ATOM   5494 O OE2 . GLU B 1 166 ? 31.129  -1.051  -61.018 1.00 75.99  ? 166  GLU B OE2 1 
ATOM   5495 N N   . ALA B 1 167 ? 26.681  0.176   -56.462 1.00 60.28  ? 167  ALA B N   1 
ATOM   5496 C CA  . ALA B 1 167 ? 25.860  0.007   -55.254 1.00 59.06  ? 167  ALA B CA  1 
ATOM   5497 C C   . ALA B 1 167 ? 26.189  1.112   -54.263 1.00 57.93  ? 167  ALA B C   1 
ATOM   5498 O O   . ALA B 1 167 ? 26.765  0.850   -53.218 1.00 58.11  ? 167  ALA B O   1 
ATOM   5499 C CB  . ALA B 1 167 ? 26.085  -1.356  -54.629 1.00 58.89  ? 167  ALA B CB  1 
ATOM   5500 N N   . PRO B 1 168 ? 25.837  2.362   -54.603 1.00 57.36  ? 168  PRO B N   1 
ATOM   5501 C CA  . PRO B 1 168 ? 26.268  3.540   -53.820 1.00 57.17  ? 168  PRO B CA  1 
ATOM   5502 C C   . PRO B 1 168 ? 25.551  3.715   -52.481 1.00 55.94  ? 168  PRO B C   1 
ATOM   5503 O O   . PRO B 1 168 ? 25.994  4.513   -51.647 1.00 55.44  ? 168  PRO B O   1 
ATOM   5504 C CB  . PRO B 1 168 ? 25.938  4.708   -54.751 1.00 57.18  ? 168  PRO B CB  1 
ATOM   5505 C CG  . PRO B 1 168 ? 24.744  4.211   -55.545 1.00 56.75  ? 168  PRO B CG  1 
ATOM   5506 C CD  . PRO B 1 168 ? 25.009  2.743   -55.762 1.00 56.94  ? 168  PRO B CD  1 
ATOM   5507 N N   . GLY B 1 169 ? 24.455  2.975   -52.290 1.00 54.70  ? 169  GLY B N   1 
ATOM   5508 C CA  . GLY B 1 169 ? 23.685  3.023   -51.055 1.00 53.76  ? 169  GLY B CA  1 
ATOM   5509 C C   . GLY B 1 169 ? 22.530  4.000   -51.149 1.00 52.44  ? 169  GLY B C   1 
ATOM   5510 O O   . GLY B 1 169 ? 22.479  4.819   -52.069 1.00 53.09  ? 169  GLY B O   1 
ATOM   5511 N N   . ASN B 1 170 ? 21.605  3.895   -50.196 1.00 51.05  ? 170  ASN B N   1 
ATOM   5512 C CA  . ASN B 1 170 ? 20.473  4.823   -50.046 1.00 49.98  ? 170  ASN B CA  1 
ATOM   5513 C C   . ASN B 1 170 ? 19.467  4.883   -51.214 1.00 49.26  ? 170  ASN B C   1 
ATOM   5514 O O   . ASN B 1 170 ? 18.659  5.812   -51.292 1.00 48.44  ? 170  ASN B O   1 
ATOM   5515 C CB  . ASN B 1 170 ? 20.977  6.249   -49.707 1.00 50.42  ? 170  ASN B CB  1 
ATOM   5516 C CG  . ASN B 1 170 ? 21.699  6.328   -48.348 1.00 50.90  ? 170  ASN B CG  1 
ATOM   5517 O OD1 . ASN B 1 170 ? 21.315  5.673   -47.387 1.00 53.62  ? 170  ASN B OD1 1 
ATOM   5518 N ND2 . ASN B 1 170 ? 22.720  7.159   -48.270 1.00 51.30  ? 170  ASN B ND2 1 
ATOM   5519 N N   . VAL B 1 171 ? 19.449  3.874   -52.077 1.00 49.29  ? 171  VAL B N   1 
ATOM   5520 C CA  . VAL B 1 171 ? 18.621  3.958   -53.279 1.00 48.97  ? 171  VAL B CA  1 
ATOM   5521 C C   . VAL B 1 171 ? 17.111  3.905   -52.991 1.00 48.48  ? 171  VAL B C   1 
ATOM   5522 O O   . VAL B 1 171 ? 16.325  4.483   -53.742 1.00 48.89  ? 171  VAL B O   1 
ATOM   5523 C CB  . VAL B 1 171 ? 19.027  2.935   -54.378 1.00 49.31  ? 171  VAL B CB  1 
ATOM   5524 C CG1 . VAL B 1 171 ? 20.483  3.143   -54.784 1.00 48.43  ? 171  VAL B CG1 1 
ATOM   5525 C CG2 . VAL B 1 171 ? 18.746  1.509   -53.952 1.00 48.68  ? 171  VAL B CG2 1 
ATOM   5526 N N   . GLY B 1 172 ? 16.708  3.223   -51.916 1.00 48.10  ? 172  GLY B N   1 
ATOM   5527 C CA  . GLY B 1 172 ? 15.305  3.242   -51.472 1.00 47.06  ? 172  GLY B CA  1 
ATOM   5528 C C   . GLY B 1 172 ? 14.846  4.640   -51.066 1.00 47.00  ? 172  GLY B C   1 
ATOM   5529 O O   . GLY B 1 172 ? 13.673  4.994   -51.205 1.00 47.02  ? 172  GLY B O   1 
ATOM   5530 N N   . LEU B 1 173 ? 15.769  5.441   -50.536 1.00 46.74  ? 173  LEU B N   1 
ATOM   5531 C CA  . LEU B 1 173 ? 15.472  6.827   -50.203 1.00 46.00  ? 173  LEU B CA  1 
ATOM   5532 C C   . LEU B 1 173 ? 15.383  7.650   -51.476 1.00 46.34  ? 173  LEU B C   1 
ATOM   5533 O O   . LEU B 1 173 ? 14.577  8.572   -51.564 1.00 45.71  ? 173  LEU B O   1 
ATOM   5534 C CB  . LEU B 1 173 ? 16.550  7.411   -49.279 1.00 46.22  ? 173  LEU B CB  1 
ATOM   5535 C CG  . LEU B 1 173 ? 16.578  6.943   -47.811 1.00 45.47  ? 173  LEU B CG  1 
ATOM   5536 C CD1 . LEU B 1 173 ? 17.849  7.432   -47.134 1.00 45.81  ? 173  LEU B CD1 1 
ATOM   5537 C CD2 . LEU B 1 173 ? 15.383  7.451   -47.067 1.00 42.43  ? 173  LEU B CD2 1 
ATOM   5538 N N   . LEU B 1 174 ? 16.214  7.310   -52.461 1.00 46.51  ? 174  LEU B N   1 
ATOM   5539 C CA  . LEU B 1 174 ? 16.148  7.948   -53.763 1.00 47.04  ? 174  LEU B CA  1 
ATOM   5540 C C   . LEU B 1 174 ? 14.854  7.579   -54.510 1.00 46.96  ? 174  LEU B C   1 
ATOM   5541 O O   . LEU B 1 174 ? 14.321  8.396   -55.254 1.00 47.04  ? 174  LEU B O   1 
ATOM   5542 C CB  . LEU B 1 174 ? 17.376  7.589   -54.594 1.00 47.95  ? 174  LEU B CB  1 
ATOM   5543 C CG  . LEU B 1 174 ? 18.715  8.193   -54.114 1.00 47.92  ? 174  LEU B CG  1 
ATOM   5544 C CD1 . LEU B 1 174 ? 19.857  7.707   -55.005 1.00 47.36  ? 174  LEU B CD1 1 
ATOM   5545 C CD2 . LEU B 1 174 ? 18.664  9.703   -54.098 1.00 45.71  ? 174  LEU B CD2 1 
ATOM   5546 N N   . ASP B 1 175 ? 14.355  6.355   -54.313 1.00 46.59  ? 175  ASP B N   1 
ATOM   5547 C CA  . ASP B 1 175 ? 13.015  5.983   -54.808 1.00 46.56  ? 175  ASP B CA  1 
ATOM   5548 C C   . ASP B 1 175 ? 11.969  6.926   -54.229 1.00 46.49  ? 175  ASP B C   1 
ATOM   5549 O O   . ASP B 1 175 ? 11.136  7.479   -54.955 1.00 47.07  ? 175  ASP B O   1 
ATOM   5550 C CB  . ASP B 1 175 ? 12.646  4.555   -54.408 1.00 46.00  ? 175  ASP B CB  1 
ATOM   5551 C CG  . ASP B 1 175 ? 13.553  3.517   -55.023 1.00 47.64  ? 175  ASP B CG  1 
ATOM   5552 O OD1 . ASP B 1 175 ? 14.278  3.841   -55.994 1.00 47.73  ? 175  ASP B OD1 1 
ATOM   5553 O OD2 . ASP B 1 175 ? 13.534  2.359   -54.539 1.00 48.67  ? 175  ASP B OD2 1 
ATOM   5554 N N   . GLN B 1 176 ? 12.002  7.100   -52.912 1.00 46.18  ? 176  GLN B N   1 
ATOM   5555 C CA  . GLN B 1 176 ? 11.056  7.993   -52.251 1.00 46.05  ? 176  GLN B CA  1 
ATOM   5556 C C   . GLN B 1 176 ? 11.142  9.407   -52.821 1.00 46.95  ? 176  GLN B C   1 
ATOM   5557 O O   . GLN B 1 176 ? 10.131  10.021  -53.126 1.00 47.25  ? 176  GLN B O   1 
ATOM   5558 C CB  . GLN B 1 176 ? 11.316  8.045   -50.750 1.00 45.69  ? 176  GLN B CB  1 
ATOM   5559 C CG  . GLN B 1 176 ? 11.125  6.714   -50.000 1.00 44.77  ? 176  GLN B CG  1 
ATOM   5560 C CD  . GLN B 1 176 ? 11.569  6.832   -48.563 1.00 44.97  ? 176  GLN B CD  1 
ATOM   5561 O OE1 . GLN B 1 176 ? 11.791  7.942   -48.085 1.00 47.58  ? 176  GLN B OE1 1 
ATOM   5562 N NE2 . GLN B 1 176 ? 11.698  5.701   -47.862 1.00 44.25  ? 176  GLN B NE2 1 
ATOM   5563 N N   . ARG B 1 177 ? 12.358  9.914   -52.956 1.00 47.50  ? 177  ARG B N   1 
ATOM   5564 C CA  . ARG B 1 177 ? 12.586  11.240  -53.503 1.00 48.64  ? 177  ARG B CA  1 
ATOM   5565 C C   . ARG B 1 177 ? 12.046  11.391  -54.929 1.00 49.02  ? 177  ARG B C   1 
ATOM   5566 O O   . ARG B 1 177 ? 11.481  12.418  -55.278 1.00 48.92  ? 177  ARG B O   1 
ATOM   5567 C CB  . ARG B 1 177 ? 14.086  11.552  -53.501 1.00 48.82  ? 177  ARG B CB  1 
ATOM   5568 C CG  . ARG B 1 177 ? 14.426  12.909  -54.110 1.00 50.59  ? 177  ARG B CG  1 
ATOM   5569 C CD  . ARG B 1 177 ? 15.913  13.161  -54.082 1.00 51.73  ? 177  ARG B CD  1 
ATOM   5570 N NE  . ARG B 1 177 ? 16.316  13.674  -52.783 1.00 54.07  ? 177  ARG B NE  1 
ATOM   5571 C CZ  . ARG B 1 177 ? 17.568  13.679  -52.327 1.00 55.98  ? 177  ARG B CZ  1 
ATOM   5572 N NH1 . ARG B 1 177 ? 18.554  13.208  -53.072 1.00 57.38  ? 177  ARG B NH1 1 
ATOM   5573 N NH2 . ARG B 1 177 ? 17.842  14.180  -51.128 1.00 55.04  ? 177  ARG B NH2 1 
ATOM   5574 N N   . LEU B 1 178 ? 12.261  10.380  -55.761 1.00 49.19  ? 178  LEU B N   1 
ATOM   5575 C CA  . LEU B 1 178 ? 11.742  10.416  -57.124 1.00 49.64  ? 178  LEU B CA  1 
ATOM   5576 C C   . LEU B 1 178 ? 10.215  10.521  -57.116 1.00 49.26  ? 178  LEU B C   1 
ATOM   5577 O O   . LEU B 1 178 ? 9.645   11.238  -57.925 1.00 49.54  ? 178  LEU B O   1 
ATOM   5578 C CB  . LEU B 1 178 ? 12.215  9.201   -57.926 1.00 49.81  ? 178  LEU B CB  1 
ATOM   5579 C CG  . LEU B 1 178 ? 11.890  9.195   -59.429 1.00 50.94  ? 178  LEU B CG  1 
ATOM   5580 C CD1 . LEU B 1 178 ? 12.417  10.476  -60.119 1.00 51.29  ? 178  LEU B CD1 1 
ATOM   5581 C CD2 . LEU B 1 178 ? 12.468  7.928   -60.093 1.00 50.13  ? 178  LEU B CD2 1 
ATOM   5582 N N   . ALA B 1 179 ? 9.558   9.821   -56.195 1.00 48.69  ? 179  ALA B N   1 
ATOM   5583 C CA  . ALA B 1 179 ? 8.092   9.921   -56.047 1.00 48.66  ? 179  ALA B CA  1 
ATOM   5584 C C   . ALA B 1 179 ? 7.677   11.335  -55.625 1.00 49.48  ? 179  ALA B C   1 
ATOM   5585 O O   . ALA B 1 179 ? 6.634   11.844  -56.044 1.00 50.35  ? 179  ALA B O   1 
ATOM   5586 C CB  . ALA B 1 179 ? 7.578   8.886   -55.044 1.00 47.25  ? 179  ALA B CB  1 
ATOM   5587 N N   . LEU B 1 180 ? 8.486   11.955  -54.770 1.00 49.54  ? 180  LEU B N   1 
ATOM   5588 C CA  . LEU B 1 180 ? 8.281   13.341  -54.353 1.00 50.06  ? 180  LEU B CA  1 
ATOM   5589 C C   . LEU B 1 180 ? 8.399   14.289  -55.547 1.00 51.46  ? 180  LEU B C   1 
ATOM   5590 O O   . LEU B 1 180 ? 7.628   15.247  -55.673 1.00 51.42  ? 180  LEU B O   1 
ATOM   5591 C CB  . LEU B 1 180 ? 9.301   13.731  -53.272 1.00 49.58  ? 180  LEU B CB  1 
ATOM   5592 C CG  . LEU B 1 180 ? 8.914   13.567  -51.800 1.00 49.92  ? 180  LEU B CG  1 
ATOM   5593 C CD1 . LEU B 1 180 ? 8.189   12.250  -51.520 1.00 48.34  ? 180  LEU B CD1 1 
ATOM   5594 C CD2 . LEU B 1 180 ? 10.141  13.748  -50.889 1.00 48.56  ? 180  LEU B CD2 1 
ATOM   5595 N N   . GLN B 1 181 ? 9.396   14.040  -56.401 1.00 52.37  ? 181  GLN B N   1 
ATOM   5596 C CA  . GLN B 1 181 ? 9.570   14.824  -57.636 1.00 53.25  ? 181  GLN B CA  1 
ATOM   5597 C C   . GLN B 1 181 ? 8.369   14.595  -58.562 1.00 53.32  ? 181  GLN B C   1 
ATOM   5598 O O   . GLN B 1 181 ? 7.817   15.546  -59.110 1.00 53.81  ? 181  GLN B O   1 
ATOM   5599 C CB  A GLN B 1 181 ? 10.899  14.460  -58.325 0.50 53.47  ? 181  GLN B CB  1 
ATOM   5600 C CB  B GLN B 1 181 ? 10.889  14.465  -58.339 0.50 53.66  ? 181  GLN B CB  1 
ATOM   5601 C CG  A GLN B 1 181 ? 12.141  14.889  -57.522 0.50 53.51  ? 181  GLN B CG  1 
ATOM   5602 C CG  B GLN B 1 181 ? 11.234  15.320  -59.571 0.50 55.14  ? 181  GLN B CG  1 
ATOM   5603 C CD  A GLN B 1 181 ? 13.465  14.290  -58.013 0.50 53.77  ? 181  GLN B CD  1 
ATOM   5604 C CD  B GLN B 1 181 ? 11.631  16.748  -59.223 0.50 58.00  ? 181  GLN B CD  1 
ATOM   5605 O OE1 A GLN B 1 181 ? 13.493  13.291  -58.734 0.50 53.00  ? 181  GLN B OE1 1 
ATOM   5606 O OE1 B GLN B 1 181 ? 12.698  16.990  -58.642 0.50 59.08  ? 181  GLN B OE1 1 
ATOM   5607 N NE2 A GLN B 1 181 ? 14.573  14.899  -57.592 0.50 53.21  ? 181  GLN B NE2 1 
ATOM   5608 N NE2 B GLN B 1 181 ? 10.778  17.706  -59.590 0.50 59.27  ? 181  GLN B NE2 1 
ATOM   5609 N N   . TRP B 1 182 ? 7.938   13.341  -58.688 1.00 52.30  ? 182  TRP B N   1 
ATOM   5610 C CA  . TRP B 1 182 ? 6.734   13.011  -59.445 1.00 52.64  ? 182  TRP B CA  1 
ATOM   5611 C C   . TRP B 1 182 ? 5.525   13.849  -59.010 1.00 53.50  ? 182  TRP B C   1 
ATOM   5612 O O   . TRP B 1 182 ? 4.801   14.381  -59.851 1.00 54.24  ? 182  TRP B O   1 
ATOM   5613 C CB  . TRP B 1 182 ? 6.414   11.510  -59.338 1.00 52.03  ? 182  TRP B CB  1 
ATOM   5614 C CG  . TRP B 1 182 ? 5.323   11.081  -60.255 1.00 52.30  ? 182  TRP B CG  1 
ATOM   5615 C CD1 . TRP B 1 182 ? 5.468   10.550  -61.498 1.00 52.86  ? 182  TRP B CD1 1 
ATOM   5616 C CD2 . TRP B 1 182 ? 3.909   11.166  -60.017 1.00 52.54  ? 182  TRP B CD2 1 
ATOM   5617 N NE1 . TRP B 1 182 ? 4.235   10.294  -62.050 1.00 53.33  ? 182  TRP B NE1 1 
ATOM   5618 C CE2 . TRP B 1 182 ? 3.263   10.658  -61.161 1.00 53.25  ? 182  TRP B CE2 1 
ATOM   5619 C CE3 . TRP B 1 182 ? 3.129   11.609  -58.945 1.00 53.06  ? 182  TRP B CE3 1 
ATOM   5620 C CZ2 . TRP B 1 182 ? 1.875   10.587  -61.270 1.00 53.78  ? 182  TRP B CZ2 1 
ATOM   5621 C CZ3 . TRP B 1 182 ? 1.742   11.537  -59.053 1.00 53.11  ? 182  TRP B CZ3 1 
ATOM   5622 C CH2 . TRP B 1 182 ? 1.133   11.025  -60.211 1.00 53.46  ? 182  TRP B CH2 1 
ATOM   5623 N N   . VAL B 1 183 ? 5.321   13.977  -57.699 1.00 53.40  ? 183  VAL B N   1 
ATOM   5624 C CA  . VAL B 1 183 ? 4.199   14.747  -57.151 1.00 53.71  ? 183  VAL B CA  1 
ATOM   5625 C C   . VAL B 1 183 ? 4.312   16.239  -57.508 1.00 55.24  ? 183  VAL B C   1 
ATOM   5626 O O   . VAL B 1 183 ? 3.341   16.854  -57.922 1.00 55.73  ? 183  VAL B O   1 
ATOM   5627 C CB  . VAL B 1 183 ? 4.076   14.524  -55.608 1.00 53.22  ? 183  VAL B CB  1 
ATOM   5628 C CG1 . VAL B 1 183 ? 3.171   15.558  -54.948 1.00 52.13  ? 183  VAL B CG1 1 
ATOM   5629 C CG2 . VAL B 1 183 ? 3.597   13.090  -55.314 1.00 51.49  ? 183  VAL B CG2 1 
ATOM   5630 N N   . GLN B 1 184 ? 5.498   16.820  -57.374 1.00 56.07  ? 184  GLN B N   1 
ATOM   5631 C CA  . GLN B 1 184 ? 5.689   18.210  -57.782 1.00 57.81  ? 184  GLN B CA  1 
ATOM   5632 C C   . GLN B 1 184 ? 5.306   18.415  -59.237 1.00 59.49  ? 184  GLN B C   1 
ATOM   5633 O O   . GLN B 1 184 ? 4.642   19.397  -59.572 1.00 60.86  ? 184  GLN B O   1 
ATOM   5634 C CB  . GLN B 1 184 ? 7.132   18.642  -57.574 1.00 57.65  ? 184  GLN B CB  1 
ATOM   5635 C CG  . GLN B 1 184 ? 7.466   18.855  -56.134 1.00 58.11  ? 184  GLN B CG  1 
ATOM   5636 C CD  . GLN B 1 184 ? 6.710   20.038  -55.554 1.00 58.02  ? 184  GLN B CD  1 
ATOM   5637 O OE1 . GLN B 1 184 ? 6.914   21.163  -55.986 1.00 61.30  ? 184  GLN B OE1 1 
ATOM   5638 N NE2 . GLN B 1 184 ? 5.817   19.781  -54.601 1.00 55.25  ? 184  GLN B NE2 1 
ATOM   5639 N N   . GLU B 1 185 ? 5.717   17.481  -60.093 1.00 59.91  ? 185  GLU B N   1 
ATOM   5640 C CA  . GLU B 1 185 ? 5.478   17.585  -61.539 1.00 61.71  ? 185  GLU B CA  1 
ATOM   5641 C C   . GLU B 1 185 ? 4.040   17.302  -61.962 1.00 61.31  ? 185  GLU B C   1 
ATOM   5642 O O   . GLU B 1 185 ? 3.561   17.882  -62.948 1.00 62.83  ? 185  GLU B O   1 
ATOM   5643 C CB  . GLU B 1 185 ? 6.419   16.644  -62.303 1.00 61.32  ? 185  GLU B CB  1 
ATOM   5644 C CG  . GLU B 1 185 ? 7.852   17.124  -62.278 1.00 63.55  ? 185  GLU B CG  1 
ATOM   5645 C CD  . GLU B 1 185 ? 8.868   16.094  -62.770 1.00 65.06  ? 185  GLU B CD  1 
ATOM   5646 O OE1 . GLU B 1 185 ? 8.472   14.959  -63.174 1.00 70.84  ? 185  GLU B OE1 1 
ATOM   5647 O OE2 . GLU B 1 185 ? 10.083  16.430  -62.720 1.00 70.36  ? 185  GLU B OE2 1 
ATOM   5648 N N   . ASN B 1 186 ? 3.356   16.416  -61.236 1.00 59.65  ? 186  ASN B N   1 
ATOM   5649 C CA  . ASN B 1 186 ? 2.090   15.853  -61.706 1.00 59.13  ? 186  ASN B CA  1 
ATOM   5650 C C   . ASN B 1 186 ? 0.857   16.035  -60.835 1.00 58.21  ? 186  ASN B C   1 
ATOM   5651 O O   . ASN B 1 186 ? -0.253  15.857  -61.319 1.00 58.81  ? 186  ASN B O   1 
ATOM   5652 C CB  . ASN B 1 186 ? 2.284   14.360  -61.947 1.00 58.67  ? 186  ASN B CB  1 
ATOM   5653 C CG  . ASN B 1 186 ? 3.244   14.086  -63.065 1.00 59.05  ? 186  ASN B CG  1 
ATOM   5654 O OD1 . ASN B 1 186 ? 2.955   14.397  -64.213 1.00 61.61  ? 186  ASN B OD1 1 
ATOM   5655 N ND2 . ASN B 1 186 ? 4.399   13.507  -62.742 1.00 59.07  ? 186  ASN B ND2 1 
ATOM   5656 N N   . ILE B 1 187 ? 1.024   16.362  -59.562 1.00 56.60  ? 187  ILE B N   1 
ATOM   5657 C CA  . ILE B 1 187 ? -0.103  16.276  -58.635 1.00 55.84  ? 187  ILE B CA  1 
ATOM   5658 C C   . ILE B 1 187 ? -1.191  17.309  -58.953 1.00 57.20  ? 187  ILE B C   1 
ATOM   5659 O O   . ILE B 1 187 ? -2.359  17.071  -58.668 1.00 57.28  ? 187  ILE B O   1 
ATOM   5660 C CB  . ILE B 1 187 ? 0.349   16.365  -57.143 1.00 54.51  ? 187  ILE B CB  1 
ATOM   5661 C CG1 . ILE B 1 187 ? -0.639  15.612  -56.244 1.00 53.61  ? 187  ILE B CG1 1 
ATOM   5662 C CG2 . ILE B 1 187 ? 0.530   17.811  -56.692 1.00 54.42  ? 187  ILE B CG2 1 
ATOM   5663 C CD1 . ILE B 1 187 ? -0.732  14.108  -56.540 1.00 50.76  ? 187  ILE B CD1 1 
ATOM   5664 N N   . ALA B 1 188 ? -0.809  18.434  -59.564 1.00 57.90  ? 188  ALA B N   1 
ATOM   5665 C CA  . ALA B 1 188 ? -1.776  19.441  -59.995 1.00 59.53  ? 188  ALA B CA  1 
ATOM   5666 C C   . ALA B 1 188 ? -2.853  18.868  -60.919 1.00 60.64  ? 188  ALA B C   1 
ATOM   5667 O O   . ALA B 1 188 ? -3.979  19.373  -60.930 1.00 61.82  ? 188  ALA B O   1 
ATOM   5668 C CB  . ALA B 1 188 ? -1.070  20.616  -60.666 1.00 60.33  ? 188  ALA B CB  1 
ATOM   5669 N N   . ALA B 1 189 ? -2.525  17.819  -61.682 1.00 60.19  ? 189  ALA B N   1 
ATOM   5670 C CA  . ALA B 1 189 ? -3.497  17.194  -62.588 1.00 61.07  ? 189  ALA B CA  1 
ATOM   5671 C C   . ALA B 1 189 ? -4.615  16.473  -61.834 1.00 61.23  ? 189  ALA B C   1 
ATOM   5672 O O   . ALA B 1 189 ? -5.683  16.220  -62.394 1.00 62.29  ? 189  ALA B O   1 
ATOM   5673 C CB  . ALA B 1 189 ? -2.801  16.235  -63.566 1.00 60.46  ? 189  ALA B CB  1 
ATOM   5674 N N   . PHE B 1 190 ? -4.382  16.162  -60.563 1.00 60.35  ? 190  PHE B N   1 
ATOM   5675 C CA  . PHE B 1 190 ? -5.380  15.494  -59.727 1.00 60.50  ? 190  PHE B CA  1 
ATOM   5676 C C   . PHE B 1 190 ? -6.110  16.472  -58.816 1.00 61.71  ? 190  PHE B C   1 
ATOM   5677 O O   . PHE B 1 190 ? -6.968  16.056  -58.030 1.00 61.74  ? 190  PHE B O   1 
ATOM   5678 C CB  . PHE B 1 190 ? -4.704  14.438  -58.856 1.00 59.06  ? 190  PHE B CB  1 
ATOM   5679 C CG  . PHE B 1 190 ? -3.987  13.372  -59.635 1.00 58.04  ? 190  PHE B CG  1 
ATOM   5680 C CD1 . PHE B 1 190 ? -2.727  13.606  -60.157 1.00 57.23  ? 190  PHE B CD1 1 
ATOM   5681 C CD2 . PHE B 1 190 ? -4.566  12.123  -59.827 1.00 58.51  ? 190  PHE B CD2 1 
ATOM   5682 C CE1 . PHE B 1 190 ? -2.059  12.624  -60.859 1.00 56.52  ? 190  PHE B CE1 1 
ATOM   5683 C CE2 . PHE B 1 190 ? -3.895  11.127  -60.537 1.00 56.84  ? 190  PHE B CE2 1 
ATOM   5684 C CZ  . PHE B 1 190 ? -2.646  11.380  -61.051 1.00 56.54  ? 190  PHE B CZ  1 
ATOM   5685 N N   . GLY B 1 191 ? -5.752  17.758  -58.906 1.00 62.53  ? 191  GLY B N   1 
ATOM   5686 C CA  . GLY B 1 191 ? -6.303  18.799  -58.036 1.00 63.22  ? 191  GLY B CA  1 
ATOM   5687 C C   . GLY B 1 191 ? -5.444  19.079  -56.810 1.00 62.27  ? 191  GLY B C   1 
ATOM   5688 O O   . GLY B 1 191 ? -5.789  19.931  -55.981 1.00 62.77  ? 191  GLY B O   1 
ATOM   5689 N N   . GLY B 1 192 ? -4.322  18.374  -56.692 1.00 60.60  ? 192  GLY B N   1 
ATOM   5690 C CA  . GLY B 1 192 ? -3.396  18.585  -55.579 1.00 59.72  ? 192  GLY B CA  1 
ATOM   5691 C C   . GLY B 1 192 ? -2.595  19.865  -55.733 1.00 60.12  ? 192  GLY B C   1 
ATOM   5692 O O   . GLY B 1 192 ? -2.379  20.330  -56.848 1.00 61.11  ? 192  GLY B O   1 
ATOM   5693 N N   . ASP B 1 193 ? -2.151  20.423  -54.607 1.00 59.88  ? 193  ASP B N   1 
ATOM   5694 C CA  . ASP B 1 193 ? -1.359  21.651  -54.564 1.00 60.55  ? 193  ASP B CA  1 
ATOM   5695 C C   . ASP B 1 193 ? 0.122   21.330  -54.339 1.00 59.66  ? 193  ASP B C   1 
ATOM   5696 O O   . ASP B 1 193 ? 0.515   21.016  -53.219 1.00 58.41  ? 193  ASP B O   1 
ATOM   5697 C CB  . ASP B 1 193 ? -1.862  22.542  -53.421 1.00 61.36  ? 193  ASP B CB  1 
ATOM   5698 C CG  . ASP B 1 193 ? -1.250  23.943  -53.438 1.00 63.54  ? 193  ASP B CG  1 
ATOM   5699 O OD1 . ASP B 1 193 ? -0.384  24.218  -54.306 1.00 65.47  ? 193  ASP B OD1 1 
ATOM   5700 O OD2 . ASP B 1 193 ? -1.648  24.771  -52.576 1.00 64.58  ? 193  ASP B OD2 1 
ATOM   5701 N N   . PRO B 1 194 ? 0.958   21.432  -55.392 1.00 60.12  ? 194  PRO B N   1 
ATOM   5702 C CA  . PRO B 1 194 ? 2.377   21.147  -55.205 1.00 59.65  ? 194  PRO B CA  1 
ATOM   5703 C C   . PRO B 1 194 ? 3.110   22.101  -54.250 1.00 59.79  ? 194  PRO B C   1 
ATOM   5704 O O   . PRO B 1 194 ? 4.196   21.769  -53.780 1.00 58.74  ? 194  PRO B O   1 
ATOM   5705 C CB  . PRO B 1 194 ? 2.950   21.240  -56.627 1.00 60.22  ? 194  PRO B CB  1 
ATOM   5706 C CG  . PRO B 1 194 ? 1.990   22.056  -57.391 1.00 61.56  ? 194  PRO B CG  1 
ATOM   5707 C CD  . PRO B 1 194 ? 0.649   21.803  -56.787 1.00 61.63  ? 194  PRO B CD  1 
ATOM   5708 N N   . MET B 1 195 ? 2.522   23.261  -53.960 1.00 61.15  ? 195  MET B N   1 
ATOM   5709 C CA  . MET B 1 195 ? 3.113   24.221  -53.022 1.00 62.40  ? 195  MET B CA  1 
ATOM   5710 C C   . MET B 1 195 ? 2.667   23.992  -51.582 1.00 60.80  ? 195  MET B C   1 
ATOM   5711 O O   . MET B 1 195 ? 2.952   24.811  -50.709 1.00 61.10  ? 195  MET B O   1 
ATOM   5712 C CB  . MET B 1 195 ? 2.782   25.649  -53.446 1.00 63.94  ? 195  MET B CB  1 
ATOM   5713 C CG  . MET B 1 195 ? 3.213   25.937  -54.866 1.00 66.27  ? 195  MET B CG  1 
ATOM   5714 S SD  . MET B 1 195 ? 3.307   27.682  -55.241 1.00 72.69  ? 195  MET B SD  1 
ATOM   5715 C CE  . MET B 1 195 ? 1.708   28.315  -54.683 1.00 73.88  ? 195  MET B CE  1 
ATOM   5716 N N   . SER B 1 196 ? 1.972   22.880  -51.341 1.00 59.46  ? 196  SER B N   1 
ATOM   5717 C CA  . SER B 1 196 ? 1.582   22.473  -49.994 1.00 58.30  ? 196  SER B CA  1 
ATOM   5718 C C   . SER B 1 196 ? 1.575   20.959  -49.892 1.00 56.08  ? 196  SER B C   1 
ATOM   5719 O O   . SER B 1 196 ? 0.545   20.306  -50.047 1.00 56.08  ? 196  SER B O   1 
ATOM   5720 C CB  . SER B 1 196 ? 0.214   23.040  -49.619 1.00 59.49  ? 196  SER B CB  1 
ATOM   5721 O OG  . SER B 1 196 ? -0.159  22.583  -48.332 1.00 60.06  ? 196  SER B OG  1 
ATOM   5722 N N   . VAL B 1 197 ? 2.752   20.418  -49.616 1.00 54.04  ? 197  VAL B N   1 
ATOM   5723 C CA  . VAL B 1 197 ? 2.978   18.996  -49.530 1.00 52.09  ? 197  VAL B CA  1 
ATOM   5724 C C   . VAL B 1 197 ? 3.500   18.680  -48.143 1.00 51.00  ? 197  VAL B C   1 
ATOM   5725 O O   . VAL B 1 197 ? 4.492   19.258  -47.687 1.00 50.95  ? 197  VAL B O   1 
ATOM   5726 C CB  . VAL B 1 197 ? 3.998   18.522  -50.578 1.00 51.97  ? 197  VAL B CB  1 
ATOM   5727 C CG1 . VAL B 1 197 ? 4.388   17.044  -50.336 1.00 49.98  ? 197  VAL B CG1 1 
ATOM   5728 C CG2 . VAL B 1 197 ? 3.443   18.730  -51.981 1.00 51.73  ? 197  VAL B CG2 1 
ATOM   5729 N N   . THR B 1 198 ? 2.822   17.759  -47.475 1.00 49.66  ? 198  THR B N   1 
ATOM   5730 C CA  . THR B 1 198 ? 3.202   17.342  -46.153 1.00 48.13  ? 198  THR B CA  1 
ATOM   5731 C C   . THR B 1 198 ? 3.613   15.892  -46.223 1.00 47.42  ? 198  THR B C   1 
ATOM   5732 O O   . THR B 1 198 ? 2.828   15.036  -46.678 1.00 47.94  ? 198  THR B O   1 
ATOM   5733 C CB  . THR B 1 198 ? 2.031   17.517  -45.188 1.00 48.41  ? 198  THR B CB  1 
ATOM   5734 O OG1 . THR B 1 198 ? 1.638   18.904  -45.183 1.00 49.98  ? 198  THR B OG1 1 
ATOM   5735 C CG2 . THR B 1 198 ? 2.397   17.073  -43.770 1.00 44.99  ? 198  THR B CG2 1 
ATOM   5736 N N   . LEU B 1 199 ? 4.838   15.596  -45.795 1.00 46.18  ? 199  LEU B N   1 
ATOM   5737 C CA  . LEU B 1 199 ? 5.267   14.199  -45.688 1.00 45.77  ? 199  LEU B CA  1 
ATOM   5738 C C   . LEU B 1 199 ? 4.813   13.661  -44.350 1.00 45.54  ? 199  LEU B C   1 
ATOM   5739 O O   . LEU B 1 199 ? 4.896   14.349  -43.353 1.00 46.14  ? 199  LEU B O   1 
ATOM   5740 C CB  . LEU B 1 199 ? 6.790   14.069  -45.764 1.00 45.38  ? 199  LEU B CB  1 
ATOM   5741 C CG  . LEU B 1 199 ? 7.506   14.675  -46.968 1.00 46.62  ? 199  LEU B CG  1 
ATOM   5742 C CD1 . LEU B 1 199 ? 8.973   14.322  -46.876 1.00 44.87  ? 199  LEU B CD1 1 
ATOM   5743 C CD2 . LEU B 1 199 ? 6.879   14.198  -48.290 1.00 45.50  ? 199  LEU B CD2 1 
ATOM   5744 N N   . PHE B 1 200 ? 4.332   12.437  -44.315 1.00 45.40  ? 200  PHE B N   1 
ATOM   5745 C CA  . PHE B 1 200 ? 4.131   11.764  -43.050 1.00 45.41  ? 200  PHE B CA  1 
ATOM   5746 C C   . PHE B 1 200 ? 4.500   10.299  -43.163 1.00 44.82  ? 200  PHE B C   1 
ATOM   5747 O O   . PHE B 1 200 ? 4.407   9.716   -44.223 1.00 44.18  ? 200  PHE B O   1 
ATOM   5748 C CB  . PHE B 1 200 ? 2.735   12.030  -42.435 1.00 46.10  ? 200  PHE B CB  1 
ATOM   5749 C CG  . PHE B 1 200 ? 1.563   11.356  -43.112 1.00 47.89  ? 200  PHE B CG  1 
ATOM   5750 C CD1 . PHE B 1 200 ? 1.373   11.398  -44.484 1.00 48.03  ? 200  PHE B CD1 1 
ATOM   5751 C CD2 . PHE B 1 200 ? 0.565   10.768  -42.324 1.00 49.14  ? 200  PHE B CD2 1 
ATOM   5752 C CE1 . PHE B 1 200 ? 0.231   10.806  -45.061 1.00 48.89  ? 200  PHE B CE1 1 
ATOM   5753 C CE2 . PHE B 1 200 ? -0.554  10.196  -42.888 1.00 49.48  ? 200  PHE B CE2 1 
ATOM   5754 C CZ  . PHE B 1 200 ? -0.716  10.209  -44.262 1.00 49.03  ? 200  PHE B CZ  1 
ATOM   5755 N N   . GLY B 1 201 ? 4.995   9.731   -42.077 1.00 44.69  ? 201  GLY B N   1 
ATOM   5756 C CA  . GLY B 1 201 ? 5.307   8.312   -42.050 1.00 44.72  ? 201  GLY B CA  1 
ATOM   5757 C C   . GLY B 1 201 ? 5.476   7.805   -40.635 1.00 44.92  ? 201  GLY B C   1 
ATOM   5758 O O   . GLY B 1 201 ? 5.587   8.613   -39.711 1.00 44.58  ? 201  GLY B O   1 
ATOM   5759 N N   . GLU B 1 202 ? 5.520   6.471   -40.484 1.00 44.90  ? 202  GLU B N   1 
ATOM   5760 C CA  . GLU B 1 202 ? 5.670   5.826   -39.192 1.00 44.99  ? 202  GLU B CA  1 
ATOM   5761 C C   . GLU B 1 202 ? 6.892   4.895   -39.168 1.00 44.98  ? 202  GLU B C   1 
ATOM   5762 O O   . GLU B 1 202 ? 7.212   4.251   -40.164 1.00 45.06  ? 202  GLU B O   1 
ATOM   5763 C CB  . GLU B 1 202 ? 4.397   5.069   -38.843 1.00 45.66  ? 202  GLU B CB  1 
ATOM   5764 C CG  . GLU B 1 202 ? 4.345   4.469   -37.435 1.00 46.82  ? 202  GLU B CG  1 
ATOM   5765 C CD  . GLU B 1 202 ? 4.871   3.036   -37.345 1.00 49.36  ? 202  GLU B CD  1 
ATOM   5766 O OE1 . GLU B 1 202 ? 5.158   2.436   -38.386 1.00 49.04  ? 202  GLU B OE1 1 
ATOM   5767 O OE2 . GLU B 1 202 ? 5.002   2.505   -36.222 1.00 51.82  ? 202  GLU B OE2 1 
ATOM   5768 N N   . ALA B 1 203 ? 7.581   4.859   -38.029 1.00 44.66  ? 203  ALA B N   1 
ATOM   5769 C CA  . ALA B 1 203 ? 8.772   4.009   -37.823 1.00 45.33  ? 203  ALA B CA  1 
ATOM   5770 C C   . ALA B 1 203 ? 9.863   4.292   -38.876 1.00 45.41  ? 203  ALA B C   1 
ATOM   5771 O O   . ALA B 1 203 ? 10.278  5.445   -38.998 1.00 45.77  ? 203  ALA B O   1 
ATOM   5772 C CB  . ALA B 1 203 ? 8.380   2.549   -37.747 1.00 44.17  ? 203  ALA B CB  1 
ATOM   5773 N N   . ALA B 1 204 ? 10.326  3.292   -39.635 1.00 45.71  ? 204  ALA B N   1 
ATOM   5774 C CA  . ALA B 1 204 ? 11.318  3.544   -40.696 1.00 45.39  ? 204  ALA B CA  1 
ATOM   5775 C C   . ALA B 1 204 ? 10.824  4.602   -41.683 1.00 45.58  ? 204  ALA B C   1 
ATOM   5776 O O   . ALA B 1 204 ? 11.628  5.319   -42.289 1.00 45.33  ? 204  ALA B O   1 
ATOM   5777 C CB  . ALA B 1 204 ? 11.698  2.249   -41.431 1.00 46.34  ? 204  ALA B CB  1 
ATOM   5778 N N   . GLY B 1 205 ? 9.504   4.730   -41.827 1.00 45.45  ? 205  GLY B N   1 
ATOM   5779 C CA  . GLY B 1 205 ? 8.941   5.761   -42.680 1.00 45.64  ? 205  GLY B CA  1 
ATOM   5780 C C   . GLY B 1 205 ? 9.152   7.145   -42.095 1.00 45.44  ? 205  GLY B C   1 
ATOM   5781 O O   . GLY B 1 205 ? 9.395   8.108   -42.817 1.00 46.51  ? 205  GLY B O   1 
ATOM   5782 N N   . ALA B 1 206 ? 9.040   7.244   -40.776 1.00 45.11  ? 206  ALA B N   1 
ATOM   5783 C CA  . ALA B 1 206 ? 9.280   8.492   -40.056 1.00 44.45  ? 206  ALA B CA  1 
ATOM   5784 C C   . ALA B 1 206 ? 10.765  8.825   -40.120 1.00 44.04  ? 206  ALA B C   1 
ATOM   5785 O O   . ALA B 1 206 ? 11.142  9.984   -40.340 1.00 43.41  ? 206  ALA B O   1 
ATOM   5786 C CB  . ALA B 1 206 ? 8.794   8.376   -38.607 1.00 44.04  ? 206  ALA B CB  1 
ATOM   5787 N N   . ALA B 1 207 ? 11.614  7.812   -39.954 1.00 43.53  ? 207  ALA B N   1 
ATOM   5788 C CA  . ALA B 1 207 ? 13.055  8.015   -40.122 1.00 43.85  ? 207  ALA B CA  1 
ATOM   5789 C C   . ALA B 1 207 ? 13.367  8.556   -41.519 1.00 44.10  ? 207  ALA B C   1 
ATOM   5790 O O   . ALA B 1 207 ? 14.191  9.467   -41.676 1.00 43.39  ? 207  ALA B O   1 
ATOM   5791 C CB  . ALA B 1 207 ? 13.831  6.716   -39.840 1.00 43.79  ? 207  ALA B CB  1 
ATOM   5792 N N   . SER B 1 208 ? 12.651  8.020   -42.515 1.00 44.40  ? 208  SER B N   1 
ATOM   5793 C CA  . SER B 1 208 ? 12.775  8.434   -43.921 1.00 44.54  ? 208  SER B CA  1 
ATOM   5794 C C   . SER B 1 208 ? 12.418  9.914   -44.121 1.00 44.83  ? 208  SER B C   1 
ATOM   5795 O O   . SER B 1 208 ? 13.187  10.679  -44.711 1.00 45.05  ? 208  SER B O   1 
ATOM   5796 C CB  . SER B 1 208 ? 11.893  7.545   -44.801 1.00 44.90  ? 208  SER B CB  1 
ATOM   5797 O OG  . SER B 1 208 ? 12.403  6.217   -44.867 1.00 45.26  ? 208  SER B OG  1 
ATOM   5798 N N   . VAL B 1 209 ? 11.261  10.316  -43.616 1.00 44.70  ? 209  VAL B N   1 
ATOM   5799 C CA  . VAL B 1 209 ? 10.874  11.731  -43.585 1.00 44.85  ? 209  VAL B CA  1 
ATOM   5800 C C   . VAL B 1 209 ? 11.985  12.601  -42.984 1.00 45.70  ? 209  VAL B C   1 
ATOM   5801 O O   . VAL B 1 209 ? 12.352  13.633  -43.545 1.00 46.35  ? 209  VAL B O   1 
ATOM   5802 C CB  . VAL B 1 209 ? 9.552   11.924  -42.785 1.00 44.79  ? 209  VAL B CB  1 
ATOM   5803 C CG1 . VAL B 1 209 ? 9.204   13.417  -42.591 1.00 44.35  ? 209  VAL B CG1 1 
ATOM   5804 C CG2 . VAL B 1 209 ? 8.410   11.174  -43.468 1.00 43.54  ? 209  VAL B CG2 1 
ATOM   5805 N N   . GLY B 1 210 ? 12.527  12.173  -41.845 1.00 46.06  ? 210  GLY B N   1 
ATOM   5806 C CA  . GLY B 1 210 ? 13.637  12.875  -41.216 1.00 46.85  ? 210  GLY B CA  1 
ATOM   5807 C C   . GLY B 1 210 ? 14.852  13.004  -42.117 1.00 47.66  ? 210  GLY B C   1 
ATOM   5808 O O   . GLY B 1 210 ? 15.499  14.052  -42.152 1.00 47.65  ? 210  GLY B O   1 
ATOM   5809 N N   . MET B 1 211 ? 15.164  11.940  -42.851 1.00 48.07  ? 211  MET B N   1 
ATOM   5810 C CA  . MET B 1 211 ? 16.270  11.974  -43.810 1.00 49.94  ? 211  MET B CA  1 
ATOM   5811 C C   . MET B 1 211 ? 16.026  12.945  -44.971 1.00 49.41  ? 211  MET B C   1 
ATOM   5812 O O   . MET B 1 211 ? 16.953  13.628  -45.407 1.00 50.42  ? 211  MET B O   1 
ATOM   5813 C CB  . MET B 1 211 ? 16.613  10.552  -44.274 1.00 50.10  ? 211  MET B CB  1 
ATOM   5814 C CG  . MET B 1 211 ? 17.519  9.877   -43.222 1.00 51.97  ? 211  MET B CG  1 
ATOM   5815 S SD  . MET B 1 211 ? 17.538  8.113   -43.311 1.00 54.64  ? 211  MET B SD  1 
ATOM   5816 C CE  . MET B 1 211 ? 17.877  7.681   -41.599 1.00 53.23  ? 211  MET B CE  1 
ATOM   5817 N N   . HIS B 1 212 ? 14.780  13.077  -45.416 1.00 48.40  ? 212  HIS B N   1 
ATOM   5818 C CA  . HIS B 1 212 ? 14.450  14.108  -46.394 1.00 48.67  ? 212  HIS B CA  1 
ATOM   5819 C C   . HIS B 1 212 ? 14.588  15.523  -45.812 1.00 49.49  ? 212  HIS B C   1 
ATOM   5820 O O   . HIS B 1 212 ? 15.043  16.426  -46.508 1.00 50.90  ? 212  HIS B O   1 
ATOM   5821 C CB  . HIS B 1 212 ? 13.070  13.873  -46.994 1.00 48.32  ? 212  HIS B CB  1 
ATOM   5822 C CG  . HIS B 1 212 ? 12.989  12.623  -47.811 1.00 47.89  ? 212  HIS B CG  1 
ATOM   5823 N ND1 . HIS B 1 212 ? 13.695  12.455  -48.983 1.00 47.76  ? 212  HIS B ND1 1 
ATOM   5824 C CD2 . HIS B 1 212 ? 12.317  11.466  -47.604 1.00 47.22  ? 212  HIS B CD2 1 
ATOM   5825 C CE1 . HIS B 1 212 ? 13.452  11.249  -49.466 1.00 48.60  ? 212  HIS B CE1 1 
ATOM   5826 N NE2 . HIS B 1 212 ? 12.619  10.629  -48.648 1.00 47.60  ? 212  HIS B NE2 1 
ATOM   5827 N N   . ILE B 1 213 ? 14.224  15.716  -44.546 1.00 49.00  ? 213  ILE B N   1 
ATOM   5828 C CA  . ILE B 1 213 ? 14.463  16.997  -43.859 1.00 49.14  ? 213  ILE B CA  1 
ATOM   5829 C C   . ILE B 1 213 ? 15.966  17.335  -43.835 1.00 50.15  ? 213  ILE B C   1 
ATOM   5830 O O   . ILE B 1 213 ? 16.352  18.501  -43.965 1.00 50.73  ? 213  ILE B O   1 
ATOM   5831 C CB  . ILE B 1 213 ? 13.912  16.975  -42.397 1.00 48.72  ? 213  ILE B CB  1 
ATOM   5832 C CG1 . ILE B 1 213 ? 12.370  16.988  -42.386 1.00 48.89  ? 213  ILE B CG1 1 
ATOM   5833 C CG2 . ILE B 1 213 ? 14.471  18.144  -41.587 1.00 48.28  ? 213  ILE B CG2 1 
ATOM   5834 C CD1 . ILE B 1 213 ? 11.708  16.562  -41.034 1.00 47.92  ? 213  ILE B CD1 1 
ATOM   5835 N N   . LEU B 1 214 ? 16.802  16.308  -43.681 1.00 50.33  ? 214  LEU B N   1 
ATOM   5836 C CA  . LEU B 1 214 ? 18.252  16.470  -43.545 1.00 51.30  ? 214  LEU B CA  1 
ATOM   5837 C C   . LEU B 1 214 ? 19.070  16.400  -44.845 1.00 52.47  ? 214  LEU B C   1 
ATOM   5838 O O   . LEU B 1 214 ? 20.307  16.501  -44.805 1.00 53.25  ? 214  LEU B O   1 
ATOM   5839 C CB  . LEU B 1 214 ? 18.792  15.432  -42.553 1.00 50.84  ? 214  LEU B CB  1 
ATOM   5840 C CG  . LEU B 1 214 ? 18.265  15.542  -41.114 1.00 50.74  ? 214  LEU B CG  1 
ATOM   5841 C CD1 . LEU B 1 214 ? 18.837  14.405  -40.274 1.00 50.87  ? 214  LEU B CD1 1 
ATOM   5842 C CD2 . LEU B 1 214 ? 18.560  16.923  -40.479 1.00 49.91  ? 214  LEU B CD2 1 
ATOM   5843 N N   . SER B 1 215 ? 18.404  16.240  -45.988 1.00 53.10  ? 215  SER B N   1 
ATOM   5844 C CA  . SER B 1 215 ? 19.088  16.130  -47.274 1.00 54.14  ? 215  SER B CA  1 
ATOM   5845 C C   . SER B 1 215 ? 18.574  17.232  -48.185 1.00 55.28  ? 215  SER B C   1 
ATOM   5846 O O   . SER B 1 215 ? 17.398  17.244  -48.524 1.00 54.53  ? 215  SER B O   1 
ATOM   5847 C CB  . SER B 1 215 ? 18.833  14.766  -47.907 1.00 53.60  ? 215  SER B CB  1 
ATOM   5848 O OG  . SER B 1 215 ? 19.703  14.581  -49.017 1.00 55.28  ? 215  SER B OG  1 
ATOM   5849 N N   . LEU B 1 216 ? 19.459  18.154  -48.577 1.00 57.06  ? 216  LEU B N   1 
ATOM   5850 C CA  . LEU B 1 216 ? 19.039  19.396  -49.259 1.00 58.09  ? 216  LEU B CA  1 
ATOM   5851 C C   . LEU B 1 216 ? 18.208  19.185  -50.533 1.00 58.09  ? 216  LEU B C   1 
ATOM   5852 O O   . LEU B 1 216 ? 17.216  19.887  -50.732 1.00 58.56  ? 216  LEU B O   1 
ATOM   5853 C CB  A LEU B 1 216 ? 20.244  20.293  -49.563 0.50 59.66  ? 216  LEU B CB  1 
ATOM   5854 C CB  B LEU B 1 216 ? 20.251  20.277  -49.585 0.50 59.52  ? 216  LEU B CB  1 
ATOM   5855 C CG  A LEU B 1 216 ? 21.168  20.700  -48.403 0.50 60.51  ? 216  LEU B CG  1 
ATOM   5856 C CG  B LEU B 1 216 ? 19.958  21.688  -50.117 0.50 60.53  ? 216  LEU B CG  1 
ATOM   5857 C CD1 A LEU B 1 216 ? 22.018  21.907  -48.826 0.50 62.83  ? 216  LEU B CD1 1 
ATOM   5858 C CD1 B LEU B 1 216 ? 19.435  22.588  -49.001 0.50 60.03  ? 216  LEU B CD1 1 
ATOM   5859 C CD2 A LEU B 1 216 ? 20.408  21.006  -47.110 0.50 59.89  ? 216  LEU B CD2 1 
ATOM   5860 C CD2 B LEU B 1 216 ? 21.201  22.290  -50.767 0.50 61.94  ? 216  LEU B CD2 1 
ATOM   5861 N N   . PRO B 1 217 ? 18.603  18.248  -51.413 1.00 57.88  ? 217  PRO B N   1 
ATOM   5862 C CA  . PRO B 1 217 ? 17.803  18.074  -52.630 1.00 57.94  ? 217  PRO B CA  1 
ATOM   5863 C C   . PRO B 1 217 ? 16.313  17.751  -52.401 1.00 57.36  ? 217  PRO B C   1 
ATOM   5864 O O   . PRO B 1 217 ? 15.473  18.089  -53.247 1.00 58.06  ? 217  PRO B O   1 
ATOM   5865 C CB  . PRO B 1 217 ? 18.508  16.922  -53.345 1.00 57.76  ? 217  PRO B CB  1 
ATOM   5866 C CG  . PRO B 1 217 ? 19.891  16.954  -52.838 1.00 58.04  ? 217  PRO B CG  1 
ATOM   5867 C CD  . PRO B 1 217 ? 19.771  17.351  -51.409 1.00 58.24  ? 217  PRO B CD  1 
ATOM   5868 N N   . SER B 1 218 ? 15.993  17.113  -51.274 1.00 56.62  ? 218  SER B N   1 
ATOM   5869 C CA  . SER B 1 218 ? 14.608  16.783  -50.923 1.00 55.75  ? 218  SER B CA  1 
ATOM   5870 C C   . SER B 1 218 ? 13.830  17.988  -50.418 1.00 56.40  ? 218  SER B C   1 
ATOM   5871 O O   . SER B 1 218 ? 12.615  18.019  -50.526 1.00 55.92  ? 218  SER B O   1 
ATOM   5872 C CB  . SER B 1 218 ? 14.567  15.704  -49.842 1.00 54.84  ? 218  SER B CB  1 
ATOM   5873 O OG  . SER B 1 218 ? 15.003  14.451  -50.318 1.00 52.69  ? 218  SER B OG  1 
ATOM   5874 N N   . ARG B 1 219 ? 14.529  18.971  -49.858 1.00 57.77  ? 219  ARG B N   1 
ATOM   5875 C CA  . ARG B 1 219 ? 13.880  20.074  -49.165 1.00 58.80  ? 219  ARG B CA  1 
ATOM   5876 C C   . ARG B 1 219 ? 13.031  20.963  -50.068 1.00 59.21  ? 219  ARG B C   1 
ATOM   5877 O O   . ARG B 1 219 ? 12.098  21.620  -49.596 1.00 59.92  ? 219  ARG B O   1 
ATOM   5878 C CB  . ARG B 1 219 ? 14.913  20.923  -48.403 1.00 60.20  ? 219  ARG B CB  1 
ATOM   5879 C CG  . ARG B 1 219 ? 15.446  20.274  -47.127 1.00 61.85  ? 219  ARG B CG  1 
ATOM   5880 C CD  . ARG B 1 219 ? 14.367  20.108  -46.036 1.00 65.55  ? 219  ARG B CD  1 
ATOM   5881 N NE  . ARG B 1 219 ? 13.817  21.376  -45.552 1.00 68.77  ? 219  ARG B NE  1 
ATOM   5882 C CZ  . ARG B 1 219 ? 14.335  22.112  -44.567 1.00 71.30  ? 219  ARG B CZ  1 
ATOM   5883 N NH1 . ARG B 1 219 ? 15.445  21.730  -43.941 1.00 72.38  ? 219  ARG B NH1 1 
ATOM   5884 N NH2 . ARG B 1 219 ? 13.747  23.258  -44.216 1.00 72.02  ? 219  ARG B NH2 1 
ATOM   5885 N N   . SER B 1 220 ? 13.336  20.990  -51.356 1.00 59.29  ? 220  SER B N   1 
ATOM   5886 C CA  . SER B 1 220 ? 12.523  21.747  -52.300 1.00 59.88  ? 220  SER B CA  1 
ATOM   5887 C C   . SER B 1 220 ? 11.256  20.988  -52.729 1.00 58.70  ? 220  SER B C   1 
ATOM   5888 O O   . SER B 1 220 ? 10.453  21.517  -53.513 1.00 59.31  ? 220  SER B O   1 
ATOM   5889 C CB  . SER B 1 220 ? 13.353  22.091  -53.532 1.00 61.27  ? 220  SER B CB  1 
ATOM   5890 O OG  . SER B 1 220 ? 13.714  20.910  -54.240 1.00 62.32  ? 220  SER B OG  1 
ATOM   5891 N N   . LEU B 1 221 ? 11.074  19.767  -52.214 1.00 56.43  ? 221  LEU B N   1 
ATOM   5892 C CA  . LEU B 1 221 ? 9.986   18.889  -52.634 1.00 55.28  ? 221  LEU B CA  1 
ATOM   5893 C C   . LEU B 1 221 ? 8.862   18.776  -51.605 1.00 54.71  ? 221  LEU B C   1 
ATOM   5894 O O   . LEU B 1 221 ? 7.876   18.097  -51.856 1.00 54.28  ? 221  LEU B O   1 
ATOM   5895 C CB  . LEU B 1 221 ? 10.524  17.480  -52.919 1.00 54.24  ? 221  LEU B CB  1 
ATOM   5896 C CG  . LEU B 1 221 ? 11.689  17.335  -53.891 1.00 54.10  ? 221  LEU B CG  1 
ATOM   5897 C CD1 . LEU B 1 221 ? 12.074  15.864  -54.050 1.00 51.90  ? 221  LEU B CD1 1 
ATOM   5898 C CD2 . LEU B 1 221 ? 11.314  17.946  -55.224 1.00 55.32  ? 221  LEU B CD2 1 
ATOM   5899 N N   . PHE B 1 222 ? 9.006   19.417  -50.451 1.00 54.64  ? 222  PHE B N   1 
ATOM   5900 C CA  . PHE B 1 222 ? 7.934   19.418  -49.453 1.00 54.64  ? 222  PHE B CA  1 
ATOM   5901 C C   . PHE B 1 222 ? 8.062   20.597  -48.495 1.00 55.08  ? 222  PHE B C   1 
ATOM   5902 O O   . PHE B 1 222 ? 9.077   21.298  -48.481 1.00 55.28  ? 222  PHE B O   1 
ATOM   5903 C CB  . PHE B 1 222 ? 7.918   18.098  -48.670 1.00 53.64  ? 222  PHE B CB  1 
ATOM   5904 C CG  . PHE B 1 222 ? 9.111   17.910  -47.781 1.00 53.81  ? 222  PHE B CG  1 
ATOM   5905 C CD1 . PHE B 1 222 ? 10.338  17.523  -48.316 1.00 53.15  ? 222  PHE B CD1 1 
ATOM   5906 C CD2 . PHE B 1 222 ? 9.015   18.137  -46.400 1.00 54.45  ? 222  PHE B CD2 1 
ATOM   5907 C CE1 . PHE B 1 222 ? 11.447  17.367  -47.495 1.00 53.24  ? 222  PHE B CE1 1 
ATOM   5908 C CE2 . PHE B 1 222 ? 10.116  17.966  -45.573 1.00 52.68  ? 222  PHE B CE2 1 
ATOM   5909 C CZ  . PHE B 1 222 ? 11.330  17.588  -46.118 1.00 53.25  ? 222  PHE B CZ  1 
ATOM   5910 N N   . HIS B 1 223 ? 7.019   20.799  -47.694 1.00 55.19  ? 223  HIS B N   1 
ATOM   5911 C CA  . HIS B 1 223 ? 6.914   21.979  -46.847 1.00 56.25  ? 223  HIS B CA  1 
ATOM   5912 C C   . HIS B 1 223 ? 6.770   21.699  -45.352 1.00 55.58  ? 223  HIS B C   1 
ATOM   5913 O O   . HIS B 1 223 ? 7.150   22.535  -44.536 1.00 56.59  ? 223  HIS B O   1 
ATOM   5914 C CB  . HIS B 1 223 ? 5.764   22.851  -47.346 1.00 57.52  ? 223  HIS B CB  1 
ATOM   5915 C CG  . HIS B 1 223 ? 5.719   22.964  -48.836 1.00 58.56  ? 223  HIS B CG  1 
ATOM   5916 N ND1 . HIS B 1 223 ? 6.129   24.090  -49.513 1.00 61.07  ? 223  HIS B ND1 1 
ATOM   5917 C CD2 . HIS B 1 223 ? 5.350   22.069  -49.782 1.00 57.90  ? 223  HIS B CD2 1 
ATOM   5918 C CE1 . HIS B 1 223 ? 6.001   23.885  -50.813 1.00 61.63  ? 223  HIS B CE1 1 
ATOM   5919 N NE2 . HIS B 1 223 ? 5.537   22.662  -51.001 1.00 59.72  ? 223  HIS B NE2 1 
ATOM   5920 N N   . ARG B 1 224 ? 6.226   20.539  -44.996 1.00 54.67  ? 224  ARG B N   1 
ATOM   5921 C CA  . ARG B 1 224 ? 6.026   20.145  -43.603 1.00 54.18  ? 224  ARG B CA  1 
ATOM   5922 C C   . ARG B 1 224 ? 6.240   18.639  -43.459 1.00 52.07  ? 224  ARG B C   1 
ATOM   5923 O O   . ARG B 1 224 ? 6.174   17.914  -44.452 1.00 51.77  ? 224  ARG B O   1 
ATOM   5924 C CB  . ARG B 1 224 ? 4.599   20.476  -43.195 1.00 54.90  ? 224  ARG B CB  1 
ATOM   5925 C CG  . ARG B 1 224 ? 4.349   21.921  -43.091 1.00 57.84  ? 224  ARG B CG  1 
ATOM   5926 C CD  . ARG B 1 224 ? 2.886   22.243  -42.834 1.00 58.97  ? 224  ARG B CD  1 
ATOM   5927 N NE  . ARG B 1 224 ? 2.159   22.323  -44.085 1.00 62.21  ? 224  ARG B NE  1 
ATOM   5928 C CZ  . ARG B 1 224 ? 2.310   23.287  -44.989 1.00 63.42  ? 224  ARG B CZ  1 
ATOM   5929 N NH1 . ARG B 1 224 ? 3.173   24.282  -44.804 1.00 64.04  ? 224  ARG B NH1 1 
ATOM   5930 N NH2 . ARG B 1 224 ? 1.598   23.236  -46.105 1.00 64.31  ? 224  ARG B NH2 1 
ATOM   5931 N N   . ALA B 1 225 ? 6.482   18.178  -42.230 1.00 50.38  ? 225  ALA B N   1 
ATOM   5932 C CA  . ALA B 1 225 ? 6.751   16.758  -41.968 1.00 48.90  ? 225  ALA B CA  1 
ATOM   5933 C C   . ALA B 1 225 ? 6.072   16.266  -40.698 1.00 47.71  ? 225  ALA B C   1 
ATOM   5934 O O   . ALA B 1 225 ? 5.911   17.017  -39.734 1.00 47.84  ? 225  ALA B O   1 
ATOM   5935 C CB  . ALA B 1 225 ? 8.260   16.525  -41.879 1.00 48.40  ? 225  ALA B CB  1 
ATOM   5936 N N   . VAL B 1 226 ? 5.669   15.004  -40.723 1.00 47.07  ? 226  VAL B N   1 
ATOM   5937 C CA  . VAL B 1 226 ? 5.149   14.291  -39.567 1.00 46.24  ? 226  VAL B CA  1 
ATOM   5938 C C   . VAL B 1 226 ? 5.978   13.019  -39.375 1.00 45.90  ? 226  VAL B C   1 
ATOM   5939 O O   . VAL B 1 226 ? 6.109   12.202  -40.297 1.00 45.25  ? 226  VAL B O   1 
ATOM   5940 C CB  . VAL B 1 226 ? 3.683   13.872  -39.749 1.00 46.74  ? 226  VAL B CB  1 
ATOM   5941 C CG1 . VAL B 1 226 ? 3.168   13.177  -38.489 1.00 45.44  ? 226  VAL B CG1 1 
ATOM   5942 C CG2 . VAL B 1 226 ? 2.790   15.079  -40.132 1.00 47.05  ? 226  VAL B CG2 1 
ATOM   5943 N N   . LEU B 1 227 ? 6.537   12.866  -38.174 1.00 45.55  ? 227  LEU B N   1 
ATOM   5944 C CA  . LEU B 1 227 ? 7.356   11.714  -37.831 1.00 44.92  ? 227  LEU B CA  1 
ATOM   5945 C C   . LEU B 1 227 ? 6.673   10.984  -36.702 1.00 44.88  ? 227  LEU B C   1 
ATOM   5946 O O   . LEU B 1 227 ? 6.744   11.413  -35.556 1.00 44.27  ? 227  LEU B O   1 
ATOM   5947 C CB  . LEU B 1 227 ? 8.772   12.131  -37.408 1.00 44.95  ? 227  LEU B CB  1 
ATOM   5948 C CG  . LEU B 1 227 ? 9.665   12.704  -38.520 1.00 45.25  ? 227  LEU B CG  1 
ATOM   5949 C CD1 . LEU B 1 227 ? 9.335   14.189  -38.785 1.00 43.67  ? 227  LEU B CD1 1 
ATOM   5950 C CD2 . LEU B 1 227 ? 11.150  12.524  -38.172 1.00 44.55  ? 227  LEU B CD2 1 
ATOM   5951 N N   . GLN B 1 228 ? 6.017   9.866   -37.041 1.00 44.82  ? 228  GLN B N   1 
ATOM   5952 C CA  . GLN B 1 228 ? 5.331   9.030   -36.061 1.00 44.65  ? 228  GLN B CA  1 
ATOM   5953 C C   . GLN B 1 228 ? 6.248   7.869   -35.662 1.00 44.25  ? 228  GLN B C   1 
ATOM   5954 O O   . GLN B 1 228 ? 6.547   7.013   -36.479 1.00 43.18  ? 228  GLN B O   1 
ATOM   5955 C CB  . GLN B 1 228 ? 4.027   8.469   -36.658 1.00 45.04  ? 228  GLN B CB  1 
ATOM   5956 C CG  . GLN B 1 228 ? 3.078   9.526   -37.223 1.00 45.38  ? 228  GLN B CG  1 
ATOM   5957 C CD  . GLN B 1 228 ? 1.904   8.959   -38.020 1.00 46.08  ? 228  GLN B CD  1 
ATOM   5958 O OE1 . GLN B 1 228 ? 1.383   9.639   -38.904 1.00 46.67  ? 228  GLN B OE1 1 
ATOM   5959 N NE2 . GLN B 1 228 ? 1.496   7.714   -37.733 1.00 46.06  ? 228  GLN B NE2 1 
ATOM   5960 N N   . SER B 1 229 ? 6.703   7.850   -34.413 1.00 44.16  ? 229  SER B N   1 
ATOM   5961 C CA  . SER B 1 229 ? 7.423   6.684   -33.856 1.00 44.24  ? 229  SER B CA  1 
ATOM   5962 C C   . SER B 1 229 ? 8.710   6.313   -34.601 1.00 44.01  ? 229  SER B C   1 
ATOM   5963 O O   . SER B 1 229 ? 9.024   5.139   -34.775 1.00 44.39  ? 229  SER B O   1 
ATOM   5964 C CB  . SER B 1 229 ? 6.487   5.466   -33.757 1.00 44.86  ? 229  SER B CB  1 
ATOM   5965 O OG  . SER B 1 229 ? 5.328   5.790   -32.993 1.00 44.58  ? 229  SER B OG  1 
ATOM   5966 N N   . GLY B 1 230 ? 9.481   7.318   -34.991 1.00 43.52  ? 230  GLY B N   1 
ATOM   5967 C CA  . GLY B 1 230 ? 10.731  7.077   -35.702 1.00 43.26  ? 230  GLY B CA  1 
ATOM   5968 C C   . GLY B 1 230 ? 11.451  8.372   -35.982 1.00 43.11  ? 230  GLY B C   1 
ATOM   5969 O O   . GLY B 1 230 ? 10.829  9.421   -36.032 1.00 42.41  ? 230  GLY B O   1 
ATOM   5970 N N   . THR B 1 231 ? 12.762  8.275   -36.189 1.00 43.68  ? 231  THR B N   1 
ATOM   5971 C CA  . THR B 1 231 ? 13.637  9.414   -36.318 1.00 44.36  ? 231  THR B CA  1 
ATOM   5972 C C   . THR B 1 231 ? 14.862  9.030   -37.144 1.00 44.86  ? 231  THR B C   1 
ATOM   5973 O O   . THR B 1 231 ? 15.250  7.861   -37.181 1.00 44.61  ? 231  THR B O   1 
ATOM   5974 C CB  . THR B 1 231 ? 14.131  9.927   -34.906 1.00 45.15  ? 231  THR B CB  1 
ATOM   5975 O OG1 . THR B 1 231 ? 14.782  8.868   -34.204 1.00 46.57  ? 231  THR B OG1 1 
ATOM   5976 C CG2 . THR B 1 231 ? 12.985  10.476  -34.037 1.00 43.94  ? 231  THR B CG2 1 
ATOM   5977 N N   . PRO B 1 232 ? 15.485  10.011  -37.810 1.00 45.31  ? 232  PRO B N   1 
ATOM   5978 C CA  . PRO B 1 232 ? 16.705  9.707   -38.552 1.00 46.46  ? 232  PRO B CA  1 
ATOM   5979 C C   . PRO B 1 232 ? 17.887  9.448   -37.615 1.00 47.57  ? 232  PRO B C   1 
ATOM   5980 O O   . PRO B 1 232 ? 18.699  8.559   -37.872 1.00 48.89  ? 232  PRO B O   1 
ATOM   5981 C CB  . PRO B 1 232 ? 16.908  10.950  -39.424 1.00 46.53  ? 232  PRO B CB  1 
ATOM   5982 C CG  . PRO B 1 232 ? 16.239  12.055  -38.672 1.00 46.51  ? 232  PRO B CG  1 
ATOM   5983 C CD  . PRO B 1 232 ? 15.100  11.426  -37.915 1.00 45.88  ? 232  PRO B CD  1 
ATOM   5984 N N   . ASN B 1 233 ? 17.981  10.227  -36.540 1.00 48.32  ? 233  ASN B N   1 
ATOM   5985 C CA  . ASN B 1 233 ? 18.911  9.943   -35.450 1.00 49.01  ? 233  ASN B CA  1 
ATOM   5986 C C   . ASN B 1 233 ? 18.501  8.665   -34.715 1.00 49.42  ? 233  ASN B C   1 
ATOM   5987 O O   . ASN B 1 233 ? 17.409  8.126   -34.935 1.00 49.66  ? 233  ASN B O   1 
ATOM   5988 C CB  . ASN B 1 233 ? 18.976  11.124  -34.469 1.00 48.86  ? 233  ASN B CB  1 
ATOM   5989 C CG  . ASN B 1 233 ? 17.607  11.514  -33.920 1.00 47.72  ? 233  ASN B CG  1 
ATOM   5990 O OD1 . ASN B 1 233 ? 16.722  11.866  -34.680 1.00 47.29  ? 233  ASN B OD1 1 
ATOM   5991 N ND2 . ASN B 1 233 ? 17.436  11.455  -32.594 1.00 45.88  ? 233  ASN B ND2 1 
ATOM   5992 N N   . GLY B 1 234 ? 19.364  8.188   -33.827 1.00 50.41  ? 234  GLY B N   1 
ATOM   5993 C CA  . GLY B 1 234 ? 19.056  7.001   -33.030 1.00 50.51  ? 234  GLY B CA  1 
ATOM   5994 C C   . GLY B 1 234 ? 19.855  5.789   -33.477 1.00 51.10  ? 234  GLY B C   1 
ATOM   5995 O O   . GLY B 1 234 ? 20.604  5.852   -34.452 1.00 51.97  ? 234  GLY B O   1 
ATOM   5996 N N   . PRO B 1 235 ? 19.717  4.677   -32.751 1.00 50.98  ? 235  PRO B N   1 
ATOM   5997 C CA  . PRO B 1 235 ? 20.640  3.542   -32.916 1.00 51.66  ? 235  PRO B CA  1 
ATOM   5998 C C   . PRO B 1 235 ? 20.415  2.561   -34.097 1.00 51.47  ? 235  PRO B C   1 
ATOM   5999 O O   . PRO B 1 235 ? 21.306  1.745   -34.380 1.00 52.45  ? 235  PRO B O   1 
ATOM   6000 C CB  . PRO B 1 235 ? 20.498  2.810   -31.583 1.00 52.17  ? 235  PRO B CB  1 
ATOM   6001 C CG  . PRO B 1 235 ? 19.071  3.085   -31.175 1.00 51.49  ? 235  PRO B CG  1 
ATOM   6002 C CD  . PRO B 1 235 ? 18.730  4.450   -31.682 1.00 50.24  ? 235  PRO B CD  1 
ATOM   6003 N N   . TRP B 1 236 ? 19.267  2.640   -34.766 1.00 50.26  ? 236  TRP B N   1 
ATOM   6004 C CA  . TRP B 1 236 ? 18.883  1.646   -35.775 1.00 49.98  ? 236  TRP B CA  1 
ATOM   6005 C C   . TRP B 1 236 ? 18.685  2.202   -37.200 1.00 49.31  ? 236  TRP B C   1 
ATOM   6006 O O   . TRP B 1 236 ? 18.748  1.440   -38.168 1.00 48.65  ? 236  TRP B O   1 
ATOM   6007 C CB  . TRP B 1 236 ? 17.599  0.936   -35.334 1.00 50.19  ? 236  TRP B CB  1 
ATOM   6008 C CG  . TRP B 1 236 ? 16.439  1.868   -35.111 1.00 50.03  ? 236  TRP B CG  1 
ATOM   6009 C CD1 . TRP B 1 236 ? 16.062  2.420   -33.929 1.00 50.25  ? 236  TRP B CD1 1 
ATOM   6010 C CD2 . TRP B 1 236 ? 15.508  2.353   -36.094 1.00 50.46  ? 236  TRP B CD2 1 
ATOM   6011 N NE1 . TRP B 1 236 ? 14.970  3.220   -34.106 1.00 50.58  ? 236  TRP B NE1 1 
ATOM   6012 C CE2 . TRP B 1 236 ? 14.603  3.197   -35.424 1.00 50.12  ? 236  TRP B CE2 1 
ATOM   6013 C CE3 . TRP B 1 236 ? 15.351  2.153   -37.474 1.00 50.82  ? 236  TRP B CE3 1 
ATOM   6014 C CZ2 . TRP B 1 236 ? 13.555  3.846   -36.079 1.00 49.37  ? 236  TRP B CZ2 1 
ATOM   6015 C CZ3 . TRP B 1 236 ? 14.303  2.802   -38.129 1.00 49.36  ? 236  TRP B CZ3 1 
ATOM   6016 C CH2 . TRP B 1 236 ? 13.421  3.630   -37.428 1.00 49.42  ? 236  TRP B CH2 1 
ATOM   6017 N N   . ALA B 1 237 ? 18.420  3.508   -37.324 1.00 48.39  ? 237  ALA B N   1 
ATOM   6018 C CA  . ALA B 1 237 ? 17.997  4.105   -38.601 1.00 47.85  ? 237  ALA B CA  1 
ATOM   6019 C C   . ALA B 1 237 ? 19.122  4.257   -39.608 1.00 47.96  ? 237  ALA B C   1 
ATOM   6020 O O   . ALA B 1 237 ? 18.859  4.308   -40.805 1.00 47.76  ? 237  ALA B O   1 
ATOM   6021 C CB  . ALA B 1 237 ? 17.329  5.464   -38.371 1.00 47.07  ? 237  ALA B CB  1 
ATOM   6022 N N   . THR B 1 238 ? 20.369  4.341   -39.141 1.00 48.51  ? 238  THR B N   1 
ATOM   6023 C CA  . THR B 1 238 ? 21.508  4.468   -40.043 1.00 49.05  ? 238  THR B CA  1 
ATOM   6024 C C   . THR B 1 238 ? 22.686  3.591   -39.624 1.00 49.92  ? 238  THR B C   1 
ATOM   6025 O O   . THR B 1 238 ? 22.762  3.147   -38.476 1.00 49.91  ? 238  THR B O   1 
ATOM   6026 C CB  . THR B 1 238 ? 22.021  5.922   -40.112 1.00 49.61  ? 238  THR B CB  1 
ATOM   6027 O OG1 . THR B 1 238 ? 22.529  6.315   -38.826 1.00 50.33  ? 238  THR B OG1 1 
ATOM   6028 C CG2 . THR B 1 238 ? 20.918  6.878   -40.555 1.00 47.38  ? 238  THR B CG2 1 
ATOM   6029 N N   . VAL B 1 239 ? 23.586  3.341   -40.579 1.00 50.49  ? 239  VAL B N   1 
ATOM   6030 C CA  . VAL B 1 239 ? 24.888  2.716   -40.313 1.00 51.54  ? 239  VAL B CA  1 
ATOM   6031 C C   . VAL B 1 239 ? 25.987  3.572   -40.930 1.00 52.57  ? 239  VAL B C   1 
ATOM   6032 O O   . VAL B 1 239 ? 25.742  4.371   -41.844 1.00 51.89  ? 239  VAL B O   1 
ATOM   6033 C CB  . VAL B 1 239 ? 24.997  1.264   -40.884 1.00 51.98  ? 239  VAL B CB  1 
ATOM   6034 C CG1 . VAL B 1 239 ? 24.051  0.312   -40.161 1.00 51.48  ? 239  VAL B CG1 1 
ATOM   6035 C CG2 . VAL B 1 239 ? 24.734  1.228   -42.392 1.00 51.50  ? 239  VAL B CG2 1 
ATOM   6036 N N   . SER B 1 240 ? 27.205  3.395   -40.429 1.00 54.31  ? 240  SER B N   1 
ATOM   6037 C CA  . SER B 1 240 ? 28.378  4.005   -41.034 1.00 55.54  ? 240  SER B CA  1 
ATOM   6038 C C   . SER B 1 240 ? 28.697  3.323   -42.364 1.00 56.59  ? 240  SER B C   1 
ATOM   6039 O O   . SER B 1 240 ? 28.245  2.207   -42.628 1.00 56.34  ? 240  SER B O   1 
ATOM   6040 C CB  . SER B 1 240 ? 29.572  3.850   -40.101 1.00 56.80  ? 240  SER B CB  1 
ATOM   6041 O OG  . SER B 1 240 ? 29.955  2.488   -40.042 1.00 57.23  ? 240  SER B OG  1 
ATOM   6042 N N   . ALA B 1 241 ? 29.498  3.997   -43.184 1.00 57.92  ? 241  ALA B N   1 
ATOM   6043 C CA  . ALA B 1 241 ? 29.998  3.448   -44.443 1.00 59.00  ? 241  ALA B CA  1 
ATOM   6044 C C   . ALA B 1 241 ? 30.789  2.157   -44.245 1.00 60.58  ? 241  ALA B C   1 
ATOM   6045 O O   . ALA B 1 241 ? 30.650  1.214   -45.028 1.00 61.36  ? 241  ALA B O   1 
ATOM   6046 C CB  . ALA B 1 241 ? 30.861  4.480   -45.154 1.00 59.76  ? 241  ALA B CB  1 
ATOM   6047 N N   . GLY B 1 242 ? 31.611  2.113   -43.200 1.00 61.60  ? 242  GLY B N   1 
ATOM   6048 C CA  . GLY B 1 242 ? 32.370  0.913   -42.864 1.00 62.74  ? 242  GLY B CA  1 
ATOM   6049 C C   . GLY B 1 242 ? 31.486  -0.266  -42.501 1.00 62.10  ? 242  GLY B C   1 
ATOM   6050 O O   . GLY B 1 242 ? 31.727  -1.382  -42.940 1.00 62.47  ? 242  GLY B O   1 
ATOM   6051 N N   . GLU B 1 243 ? 30.444  -0.025  -41.713 1.00 61.20  ? 243  GLU B N   1 
ATOM   6052 C CA  . GLU B 1 243 ? 29.552  -1.110  -41.291 1.00 60.44  ? 243  GLU B CA  1 
ATOM   6053 C C   . GLU B 1 243 ? 28.655  -1.587  -42.437 1.00 59.71  ? 243  GLU B C   1 
ATOM   6054 O O   . GLU B 1 243 ? 28.368  -2.780  -42.528 1.00 60.26  ? 243  GLU B O   1 
ATOM   6055 C CB  . GLU B 1 243 ? 28.737  -0.694  -40.059 1.00 59.66  ? 243  GLU B CB  1 
ATOM   6056 C CG  . GLU B 1 243 ? 27.679  -1.698  -39.585 1.00 59.80  ? 243  GLU B CG  1 
ATOM   6057 C CD  . GLU B 1 243 ? 28.245  -3.007  -39.026 1.00 61.24  ? 243  GLU B CD  1 
ATOM   6058 O OE1 . GLU B 1 243 ? 27.424  -3.877  -38.669 1.00 61.83  ? 243  GLU B OE1 1 
ATOM   6059 O OE2 . GLU B 1 243 ? 29.480  -3.180  -38.937 1.00 60.62  ? 243  GLU B OE2 1 
ATOM   6060 N N   . ALA B 1 244 ? 28.221  -0.680  -43.310 1.00 58.57  ? 244  ALA B N   1 
ATOM   6061 C CA  . ALA B 1 244 ? 27.446  -1.083  -44.508 1.00 57.98  ? 244  ALA B CA  1 
ATOM   6062 C C   . ALA B 1 244 ? 28.276  -1.979  -45.438 1.00 58.99  ? 244  ALA B C   1 
ATOM   6063 O O   . ALA B 1 244 ? 27.767  -2.961  -45.978 1.00 59.27  ? 244  ALA B O   1 
ATOM   6064 C CB  . ALA B 1 244 ? 26.928  0.138   -45.268 1.00 56.66  ? 244  ALA B CB  1 
ATOM   6065 N N   . ARG B 1 245 ? 29.552  -1.638  -45.599 1.00 59.65  ? 245  ARG B N   1 
ATOM   6066 C CA  . ARG B 1 245 ? 30.468  -2.392  -46.431 1.00 61.21  ? 245  ARG B CA  1 
ATOM   6067 C C   . ARG B 1 245 ? 30.716  -3.789  -45.868 1.00 62.08  ? 245  ARG B C   1 
ATOM   6068 O O   . ARG B 1 245 ? 30.729  -4.772  -46.615 1.00 62.72  ? 245  ARG B O   1 
ATOM   6069 C CB  . ARG B 1 245 ? 31.802  -1.646  -46.548 1.00 62.41  ? 245  ARG B CB  1 
ATOM   6070 C CG  . ARG B 1 245 ? 32.857  -2.384  -47.346 1.00 64.52  ? 245  ARG B CG  1 
ATOM   6071 C CD  . ARG B 1 245 ? 34.010  -1.474  -47.705 1.00 65.57  ? 245  ARG B CD  1 
ATOM   6072 N NE  . ARG B 1 245 ? 33.629  -0.537  -48.757 1.00 64.80  ? 245  ARG B NE  1 
ATOM   6073 C CZ  . ARG B 1 245 ? 33.643  -0.808  -50.057 1.00 65.27  ? 245  ARG B CZ  1 
ATOM   6074 N NH1 . ARG B 1 245 ? 33.281  0.134   -50.919 1.00 64.75  ? 245  ARG B NH1 1 
ATOM   6075 N NH2 . ARG B 1 245 ? 34.015  -2.002  -50.504 1.00 66.77  ? 245  ARG B NH2 1 
ATOM   6076 N N   . ARG B 1 246 ? 30.940  -3.866  -44.559 1.00 62.03  ? 246  ARG B N   1 
ATOM   6077 C CA  . ARG B 1 246 ? 31.073  -5.140  -43.874 1.00 62.94  ? 246  ARG B CA  1 
ATOM   6078 C C   . ARG B 1 246 ? 29.862  -6.026  -44.140 1.00 61.83  ? 246  ARG B C   1 
ATOM   6079 O O   . ARG B 1 246 ? 30.005  -7.197  -44.486 1.00 61.99  ? 246  ARG B O   1 
ATOM   6080 C CB  . ARG B 1 246 ? 31.219  -4.927  -42.366 1.00 63.38  ? 246  ARG B CB  1 
ATOM   6081 C CG  . ARG B 1 246 ? 31.572  -6.209  -41.609 1.00 65.24  ? 246  ARG B CG  1 
ATOM   6082 C CD  . ARG B 1 246 ? 31.497  -6.041  -40.106 1.00 65.29  ? 246  ARG B CD  1 
ATOM   6083 N NE  . ARG B 1 246 ? 30.130  -5.893  -39.606 1.00 65.44  ? 246  ARG B NE  1 
ATOM   6084 C CZ  . ARG B 1 246 ? 29.261  -6.889  -39.422 1.00 65.44  ? 246  ARG B CZ  1 
ATOM   6085 N NH1 . ARG B 1 246 ? 29.558  -8.148  -39.733 1.00 66.79  ? 246  ARG B NH1 1 
ATOM   6086 N NH2 . ARG B 1 246 ? 28.062  -6.612  -38.930 1.00 63.98  ? 246  ARG B NH2 1 
ATOM   6087 N N   . ARG B 1 247 ? 28.667  -5.462  -43.972 1.00 59.95  ? 247  ARG B N   1 
ATOM   6088 C CA  . ARG B 1 247 ? 27.448  -6.243  -44.104 1.00 59.23  ? 247  ARG B CA  1 
ATOM   6089 C C   . ARG B 1 247 ? 27.243  -6.726  -45.536 1.00 59.07  ? 247  ARG B C   1 
ATOM   6090 O O   . ARG B 1 247 ? 26.887  -7.881  -45.761 1.00 60.16  ? 247  ARG B O   1 
ATOM   6091 C CB  . ARG B 1 247 ? 26.228  -5.454  -43.604 1.00 57.71  ? 247  ARG B CB  1 
ATOM   6092 C CG  . ARG B 1 247 ? 26.227  -5.230  -42.084 1.00 57.75  ? 247  ARG B CG  1 
ATOM   6093 C CD  . ARG B 1 247 ? 24.995  -4.455  -41.613 1.00 56.18  ? 247  ARG B CD  1 
ATOM   6094 N NE  . ARG B 1 247 ? 25.105  -4.043  -40.214 1.00 56.21  ? 247  ARG B NE  1 
ATOM   6095 C CZ  . ARG B 1 247 ? 24.133  -3.453  -39.516 1.00 55.99  ? 247  ARG B CZ  1 
ATOM   6096 N NH1 . ARG B 1 247 ? 22.943  -3.217  -40.050 1.00 55.63  ? 247  ARG B NH1 1 
ATOM   6097 N NH2 . ARG B 1 247 ? 24.340  -3.122  -38.247 1.00 56.49  ? 247  ARG B NH2 1 
ATOM   6098 N N   . ALA B 1 248 ? 27.479  -5.849  -46.502 1.00 58.58  ? 248  ALA B N   1 
ATOM   6099 C CA  . ALA B 1 248 ? 27.303  -6.197  -47.906 1.00 58.50  ? 248  ALA B CA  1 
ATOM   6100 C C   . ALA B 1 248 ? 28.303  -7.266  -48.297 1.00 60.20  ? 248  ALA B C   1 
ATOM   6101 O O   . ALA B 1 248 ? 27.962  -8.203  -49.018 1.00 60.65  ? 248  ALA B O   1 
ATOM   6102 C CB  . ALA B 1 248 ? 27.456  -4.959  -48.793 1.00 57.74  ? 248  ALA B CB  1 
ATOM   6103 N N   . THR B 1 249 ? 29.534  -7.119  -47.808 1.00 61.40  ? 249  THR B N   1 
ATOM   6104 C CA  . THR B 1 249 ? 30.615  -8.059  -48.077 1.00 63.06  ? 249  THR B CA  1 
ATOM   6105 C C   . THR B 1 249 ? 30.359  -9.436  -47.458 1.00 64.09  ? 249  THR B C   1 
ATOM   6106 O O   . THR B 1 249 ? 30.637  -10.466 -48.078 1.00 65.09  ? 249  THR B O   1 
ATOM   6107 C CB  . THR B 1 249 ? 31.958  -7.508  -47.550 1.00 64.17  ? 249  THR B CB  1 
ATOM   6108 O OG1 . THR B 1 249 ? 32.240  -6.252  -48.179 1.00 63.56  ? 249  THR B OG1 1 
ATOM   6109 C CG2 . THR B 1 249 ? 33.102  -8.479  -47.835 1.00 66.12  ? 249  THR B CG2 1 
ATOM   6110 N N   . LEU B 1 250 ? 29.847  -9.459  -46.233 1.00 63.73  ? 250  LEU B N   1 
ATOM   6111 C CA  . LEU B 1 250 ? 29.482  -10.726 -45.589 1.00 64.61  ? 250  LEU B CA  1 
ATOM   6112 C C   . LEU B 1 250 ? 28.331  -11.406 -46.345 1.00 64.85  ? 250  LEU B C   1 
ATOM   6113 O O   . LEU B 1 250 ? 28.399  -12.598 -46.633 1.00 65.80  ? 250  LEU B O   1 
ATOM   6114 C CB  . LEU B 1 250 ? 29.122  -10.504 -44.110 1.00 63.99  ? 250  LEU B CB  1 
ATOM   6115 C CG  . LEU B 1 250 ? 28.619  -11.711 -43.314 1.00 64.30  ? 250  LEU B CG  1 
ATOM   6116 C CD1 . LEU B 1 250 ? 29.589  -12.889 -43.433 1.00 64.64  ? 250  LEU B CD1 1 
ATOM   6117 C CD2 . LEU B 1 250 ? 28.394  -11.328 -41.857 1.00 62.94  ? 250  LEU B CD2 1 
ATOM   6118 N N   . LEU B 1 251 ? 27.287  -10.646 -46.682 1.00 64.32  ? 251  LEU B N   1 
ATOM   6119 C CA  . LEU B 1 251 ? 26.157  -11.201 -47.445 1.00 64.42  ? 251  LEU B CA  1 
ATOM   6120 C C   . LEU B 1 251 ? 26.631  -11.858 -48.744 1.00 65.98  ? 251  LEU B C   1 
ATOM   6121 O O   . LEU B 1 251 ? 26.271  -13.001 -49.046 1.00 66.41  ? 251  LEU B O   1 
ATOM   6122 C CB  . LEU B 1 251 ? 25.126  -10.123 -47.768 1.00 62.89  ? 251  LEU B CB  1 
ATOM   6123 C CG  . LEU B 1 251 ? 23.878  -10.626 -48.515 1.00 62.93  ? 251  LEU B CG  1 
ATOM   6124 C CD1 . LEU B 1 251 ? 22.832  -11.130 -47.519 1.00 64.82  ? 251  LEU B CD1 1 
ATOM   6125 C CD2 . LEU B 1 251 ? 23.306  -9.531  -49.381 1.00 62.75  ? 251  LEU B CD2 1 
ATOM   6126 N N   . ALA B 1 252 ? 27.436  -11.120 -49.506 1.00 66.83  ? 252  ALA B N   1 
ATOM   6127 C CA  . ALA B 1 252 ? 28.050  -11.636 -50.720 1.00 68.33  ? 252  ALA B CA  1 
ATOM   6128 C C   . ALA B 1 252 ? 28.720  -12.973 -50.433 1.00 71.03  ? 252  ALA B C   1 
ATOM   6129 O O   . ALA B 1 252 ? 28.488  -13.965 -51.131 1.00 71.84  ? 252  ALA B O   1 
ATOM   6130 C CB  . ALA B 1 252 ? 29.057  -10.641 -51.253 1.00 68.38  ? 252  ALA B CB  1 
ATOM   6131 N N   . ARG B 1 253 ? 29.533  -13.006 -49.385 1.00 72.68  ? 253  ARG B N   1 
ATOM   6132 C CA  . ARG B 1 253 ? 30.213  -14.240 -48.992 1.00 75.68  ? 253  ARG B CA  1 
ATOM   6133 C C   . ARG B 1 253 ? 29.219  -15.382 -48.781 1.00 75.27  ? 253  ARG B C   1 
ATOM   6134 O O   . ARG B 1 253 ? 29.428  -16.499 -49.245 1.00 76.55  ? 253  ARG B O   1 
ATOM   6135 C CB  . ARG B 1 253 ? 31.017  -14.026 -47.711 1.00 76.16  ? 253  ARG B CB  1 
ATOM   6136 C CG  . ARG B 1 253 ? 32.145  -15.026 -47.523 1.00 80.37  ? 253  ARG B CG  1 
ATOM   6137 C CD  . ARG B 1 253 ? 32.437  -15.291 -46.039 1.00 82.97  ? 253  ARG B CD  1 
ATOM   6138 N NE  . ARG B 1 253 ? 31.823  -16.542 -45.570 1.00 87.64  ? 253  ARG B NE  1 
ATOM   6139 C CZ  . ARG B 1 253 ? 31.430  -16.792 -44.315 1.00 88.82  ? 253  ARG B CZ  1 
ATOM   6140 N NH1 . ARG B 1 253 ? 31.560  -15.877 -43.346 1.00 88.55  ? 253  ARG B NH1 1 
ATOM   6141 N NH2 . ARG B 1 253 ? 30.889  -17.977 -44.030 1.00 89.50  ? 253  ARG B NH2 1 
ATOM   6142 N N   . LEU B 1 254 ? 28.131  -15.086 -48.086 1.00 74.02  ? 254  LEU B N   1 
ATOM   6143 C CA  . LEU B 1 254 ? 27.149  -16.101 -47.730 1.00 74.37  ? 254  LEU B CA  1 
ATOM   6144 C C   . LEU B 1 254 ? 26.399  -16.662 -48.937 1.00 74.45  ? 254  LEU B C   1 
ATOM   6145 O O   . LEU B 1 254 ? 25.922  -17.797 -48.893 1.00 75.48  ? 254  LEU B O   1 
ATOM   6146 C CB  . LEU B 1 254 ? 26.151  -15.530 -46.724 1.00 72.83  ? 254  LEU B CB  1 
ATOM   6147 C CG  . LEU B 1 254 ? 26.738  -15.165 -45.358 1.00 72.98  ? 254  LEU B CG  1 
ATOM   6148 C CD1 . LEU B 1 254 ? 25.724  -14.367 -44.549 1.00 69.17  ? 254  LEU B CD1 1 
ATOM   6149 C CD2 . LEU B 1 254 ? 27.177  -16.431 -44.626 1.00 74.60  ? 254  LEU B CD2 1 
ATOM   6150 N N   . VAL B 1 255 ? 26.300  -15.867 -50.003 1.00 73.47  ? 255  VAL B N   1 
ATOM   6151 C CA  . VAL B 1 255 ? 25.632  -16.289 -51.235 1.00 73.67  ? 255  VAL B CA  1 
ATOM   6152 C C   . VAL B 1 255 ? 26.633  -16.701 -52.324 1.00 75.39  ? 255  VAL B C   1 
ATOM   6153 O O   . VAL B 1 255 ? 26.248  -16.863 -53.471 1.00 75.44  ? 255  VAL B O   1 
ATOM   6154 C CB  . VAL B 1 255 ? 24.657  -15.185 -51.784 1.00 71.27  ? 255  VAL B CB  1 
ATOM   6155 C CG1 . VAL B 1 255 ? 23.581  -14.884 -50.764 1.00 69.68  ? 255  VAL B CG1 1 
ATOM   6156 C CG2 . VAL B 1 255 ? 25.409  -13.917 -52.161 1.00 69.30  ? 255  VAL B CG2 1 
ATOM   6157 N N   . GLY B 1 256 ? 27.906  -16.873 -51.966 1.00 77.35  ? 256  GLY B N   1 
ATOM   6158 C CA  . GLY B 1 256 ? 28.921  -17.368 -52.904 1.00 79.18  ? 256  GLY B CA  1 
ATOM   6159 C C   . GLY B 1 256 ? 29.598  -16.338 -53.803 1.00 79.54  ? 256  GLY B C   1 
ATOM   6160 O O   . GLY B 1 256 ? 30.231  -16.701 -54.794 1.00 81.22  ? 256  GLY B O   1 
ATOM   6161 N N   . CYS B 1 257 ? 29.486  -15.060 -53.461 1.00 78.75  ? 257  CYS B N   1 
ATOM   6162 C CA  . CYS B 1 257 ? 30.137  -13.982 -54.212 1.00 79.18  ? 257  CYS B CA  1 
ATOM   6163 C C   . CYS B 1 257 ? 31.279  -13.401 -53.388 1.00 80.15  ? 257  CYS B C   1 
ATOM   6164 O O   . CYS B 1 257 ? 32.342  -13.078 -53.924 1.00 81.85  ? 257  CYS B O   1 
ATOM   6165 C CB  . CYS B 1 257 ? 29.145  -12.854 -54.537 1.00 77.06  ? 257  CYS B CB  1 
ATOM   6166 S SG  . CYS B 1 257 ? 27.702  -13.303 -55.568 1.00 77.19  ? 257  CYS B SG  1 
ATOM   6167 N N   . ASN B 1 265 ? 37.409  -6.255  -55.388 1.00 86.51  ? 265  ASN B N   1 
ATOM   6168 C CA  . ASN B 1 265 ? 36.806  -5.429  -56.431 1.00 85.35  ? 265  ASN B CA  1 
ATOM   6169 C C   . ASN B 1 265 ? 35.276  -5.349  -56.294 1.00 82.60  ? 265  ASN B C   1 
ATOM   6170 O O   . ASN B 1 265 ? 34.577  -6.360  -56.437 1.00 82.14  ? 265  ASN B O   1 
ATOM   6171 C CB  . ASN B 1 265 ? 37.200  -5.987  -57.797 1.00 87.05  ? 265  ASN B CB  1 
ATOM   6172 C CG  . ASN B 1 265 ? 36.802  -5.081  -58.947 1.00 87.42  ? 265  ASN B CG  1 
ATOM   6173 O OD1 . ASN B 1 265 ? 35.625  -4.795  -59.142 1.00 88.37  ? 265  ASN B OD1 1 
ATOM   6174 N ND2 . ASN B 1 265 ? 37.786  -4.653  -59.737 1.00 90.97  ? 265  ASN B ND2 1 
ATOM   6175 N N   . ASP B 1 266 ? 34.769  -4.143  -56.030 1.00 80.45  ? 266  ASP B N   1 
ATOM   6176 C CA  . ASP B 1 266 ? 33.325  -3.911  -55.881 1.00 77.79  ? 266  ASP B CA  1 
ATOM   6177 C C   . ASP B 1 266 ? 32.536  -4.317  -57.120 1.00 76.86  ? 266  ASP B C   1 
ATOM   6178 O O   . ASP B 1 266 ? 31.506  -4.983  -57.006 1.00 75.72  ? 266  ASP B O   1 
ATOM   6179 C CB  . ASP B 1 266 ? 33.027  -2.436  -55.574 1.00 76.58  ? 266  ASP B CB  1 
ATOM   6180 C CG  . ASP B 1 266 ? 33.488  -2.011  -54.188 1.00 76.13  ? 266  ASP B CG  1 
ATOM   6181 O OD1 . ASP B 1 266 ? 33.777  -2.890  -53.346 1.00 76.08  ? 266  ASP B OD1 1 
ATOM   6182 O OD2 . ASP B 1 266 ? 33.571  -0.787  -53.951 1.00 74.13  ? 266  ASP B OD2 1 
ATOM   6183 N N   . THR B 1 267 ? 33.021  -3.911  -58.292 1.00 77.12  ? 267  THR B N   1 
ATOM   6184 C CA  . THR B 1 267 ? 32.322  -4.164  -59.553 1.00 76.54  ? 267  THR B CA  1 
ATOM   6185 C C   . THR B 1 267 ? 32.000  -5.644  -59.719 1.00 76.50  ? 267  THR B C   1 
ATOM   6186 O O   . THR B 1 267 ? 30.867  -6.012  -60.040 1.00 75.51  ? 267  THR B O   1 
ATOM   6187 C CB  . THR B 1 267 ? 33.136  -3.668  -60.766 1.00 77.82  ? 267  THR B CB  1 
ATOM   6188 O OG1 . THR B 1 267 ? 33.426  -2.275  -60.600 1.00 78.30  ? 267  THR B OG1 1 
ATOM   6189 C CG2 . THR B 1 267 ? 32.361  -3.869  -62.069 1.00 77.52  ? 267  THR B CG2 1 
ATOM   6190 N N   . GLU B 1 268 ? 32.996  -6.484  -59.469 1.00 77.53  ? 268  GLU B N   1 
ATOM   6191 C CA  . GLU B 1 268 ? 32.827  -7.928  -59.576 1.00 78.18  ? 268  GLU B CA  1 
ATOM   6192 C C   . GLU B 1 268 ? 31.896  -8.472  -58.499 1.00 76.01  ? 268  GLU B C   1 
ATOM   6193 O O   . GLU B 1 268 ? 31.095  -9.378  -58.761 1.00 75.57  ? 268  GLU B O   1 
ATOM   6194 C CB  . GLU B 1 268 ? 34.187  -8.639  -59.501 1.00 80.18  ? 268  GLU B CB  1 
ATOM   6195 C CG  . GLU B 1 268 ? 35.040  -8.441  -60.746 1.00 82.53  ? 268  GLU B CG  1 
ATOM   6196 C CD  . GLU B 1 268 ? 36.295  -9.320  -60.755 1.00 85.84  ? 268  GLU B CD  1 
ATOM   6197 O OE1 . GLU B 1 268 ? 36.785  -9.635  -61.866 1.00 90.17  ? 268  GLU B OE1 1 
ATOM   6198 O OE2 . GLU B 1 268 ? 36.793  -9.695  -59.659 1.00 89.18  ? 268  GLU B OE2 1 
ATOM   6199 N N   . LEU B 1 269 ? 32.009  -7.925  -57.292 1.00 74.40  ? 269  LEU B N   1 
ATOM   6200 C CA  . LEU B 1 269 ? 31.199  -8.382  -56.176 1.00 72.84  ? 269  LEU B CA  1 
ATOM   6201 C C   . LEU B 1 269 ? 29.733  -8.043  -56.446 1.00 70.33  ? 269  LEU B C   1 
ATOM   6202 O O   . LEU B 1 269 ? 28.862  -8.899  -56.309 1.00 69.40  ? 269  LEU B O   1 
ATOM   6203 C CB  . LEU B 1 269 ? 31.687  -7.773  -54.857 1.00 72.70  ? 269  LEU B CB  1 
ATOM   6204 C CG  . LEU B 1 269 ? 30.907  -8.197  -53.604 1.00 72.42  ? 269  LEU B CG  1 
ATOM   6205 C CD1 . LEU B 1 269 ? 31.807  -8.261  -52.383 1.00 73.02  ? 269  LEU B CD1 1 
ATOM   6206 C CD2 . LEU B 1 269 ? 29.733  -7.258  -53.360 1.00 71.26  ? 269  LEU B CD2 1 
ATOM   6207 N N   . ILE B 1 270 ? 29.480  -6.810  -56.870 1.00 68.93  ? 270  ILE B N   1 
ATOM   6208 C CA  . ILE B 1 270 ? 28.115  -6.359  -57.142 1.00 67.22  ? 270  ILE B CA  1 
ATOM   6209 C C   . ILE B 1 270 ? 27.544  -7.076  -58.364 1.00 67.25  ? 270  ILE B C   1 
ATOM   6210 O O   . ILE B 1 270 ? 26.377  -7.450  -58.366 1.00 66.03  ? 270  ILE B O   1 
ATOM   6211 C CB  . ILE B 1 270 ? 28.042  -4.833  -57.326 1.00 66.52  ? 270  ILE B CB  1 
ATOM   6212 C CG1 . ILE B 1 270 ? 28.470  -4.130  -56.031 1.00 67.09  ? 270  ILE B CG1 1 
ATOM   6213 C CG2 . ILE B 1 270 ? 26.620  -4.397  -57.701 1.00 64.58  ? 270  ILE B CG2 1 
ATOM   6214 C CD1 . ILE B 1 270 ? 29.176  -2.797  -56.250 1.00 68.26  ? 270  ILE B CD1 1 
ATOM   6215 N N   . ALA B 1 271 ? 28.372  -7.294  -59.386 1.00 68.43  ? 271  ALA B N   1 
ATOM   6216 C CA  . ALA B 1 271 ? 27.934  -8.020  -60.579 1.00 68.78  ? 271  ALA B CA  1 
ATOM   6217 C C   . ALA B 1 271 ? 27.430  -9.433  -60.239 1.00 69.03  ? 271  ALA B C   1 
ATOM   6218 O O   . ALA B 1 271 ? 26.399  -9.867  -60.749 1.00 68.44  ? 271  ALA B O   1 
ATOM   6219 C CB  . ALA B 1 271 ? 29.051  -8.074  -61.608 1.00 70.25  ? 271  ALA B CB  1 
ATOM   6220 N N   . CYS B 1 272 ? 28.145  -10.131 -59.362 1.00 70.09  ? 272  CYS B N   1 
ATOM   6221 C CA  . CYS B 1 272 ? 27.753  -11.477 -58.943 1.00 70.48  ? 272  CYS B CA  1 
ATOM   6222 C C   . CYS B 1 272 ? 26.477  -11.470 -58.107 1.00 68.36  ? 272  CYS B C   1 
ATOM   6223 O O   . CYS B 1 272 ? 25.627  -12.347 -58.261 1.00 68.37  ? 272  CYS B O   1 
ATOM   6224 C CB  . CYS B 1 272 ? 28.897  -12.164 -58.178 1.00 72.47  ? 272  CYS B CB  1 
ATOM   6225 S SG  . CYS B 1 272 ? 28.486  -13.784 -57.433 1.00 74.84  ? 272  CYS B SG  1 
ATOM   6226 N N   . LEU B 1 273 ? 26.340  -10.484 -57.224 1.00 66.53  ? 273  LEU B N   1 
ATOM   6227 C CA  . LEU B 1 273 ? 25.108  -10.318 -56.452 1.00 64.51  ? 273  LEU B CA  1 
ATOM   6228 C C   . LEU B 1 273 ? 23.894  -10.083 -57.358 1.00 63.28  ? 273  LEU B C   1 
ATOM   6229 O O   . LEU B 1 273 ? 22.788  -10.535 -57.052 1.00 62.91  ? 273  LEU B O   1 
ATOM   6230 C CB  . LEU B 1 273 ? 25.223  -9.154  -55.461 1.00 63.38  ? 273  LEU B CB  1 
ATOM   6231 C CG  . LEU B 1 273 ? 25.993  -9.339  -54.157 1.00 63.49  ? 273  LEU B CG  1 
ATOM   6232 C CD1 . LEU B 1 273 ? 25.869  -8.060  -53.346 1.00 61.95  ? 273  LEU B CD1 1 
ATOM   6233 C CD2 . LEU B 1 273 ? 25.489  -10.533 -53.349 1.00 62.36  ? 273  LEU B CD2 1 
ATOM   6234 N N   . ARG B 1 274 ? 24.098  -9.376  -58.466 1.00 62.62  ? 274  ARG B N   1 
ATOM   6235 C CA  . ARG B 1 274 ? 23.012  -9.113  -59.416 1.00 61.65  ? 274  ARG B CA  1 
ATOM   6236 C C   . ARG B 1 274 ? 22.527  -10.370 -60.143 1.00 61.81  ? 274  ARG B C   1 
ATOM   6237 O O   . ARG B 1 274 ? 21.429  -10.385 -60.686 1.00 61.52  ? 274  ARG B O   1 
ATOM   6238 C CB  . ARG B 1 274 ? 23.419  -8.028  -60.419 1.00 61.45  ? 274  ARG B CB  1 
ATOM   6239 C CG  . ARG B 1 274 ? 23.457  -6.625  -59.808 1.00 60.64  ? 274  ARG B CG  1 
ATOM   6240 C CD  . ARG B 1 274 ? 23.400  -5.528  -60.858 1.00 60.89  ? 274  ARG B CD  1 
ATOM   6241 N NE  . ARG B 1 274 ? 24.401  -5.763  -61.890 1.00 64.46  ? 274  ARG B NE  1 
ATOM   6242 C CZ  . ARG B 1 274 ? 25.621  -5.227  -61.924 1.00 66.01  ? 274  ARG B CZ  1 
ATOM   6243 N NH1 . ARG B 1 274 ? 26.029  -4.366  -60.991 1.00 65.53  ? 274  ARG B NH1 1 
ATOM   6244 N NH2 . ARG B 1 274 ? 26.438  -5.548  -62.917 1.00 65.69  ? 274  ARG B NH2 1 
ATOM   6245 N N   . THR B 1 275 ? 23.328  -11.428 -60.148 1.00 62.50  ? 275  THR B N   1 
ATOM   6246 C CA  . THR B 1 275 ? 22.903  -12.675 -60.764 1.00 63.12  ? 275  THR B CA  1 
ATOM   6247 C C   . THR B 1 275 ? 22.002  -13.489 -59.848 1.00 63.08  ? 275  THR B C   1 
ATOM   6248 O O   . THR B 1 275 ? 21.327  -14.411 -60.298 1.00 64.20  ? 275  THR B O   1 
ATOM   6249 C CB  . THR B 1 275 ? 24.110  -13.559 -61.184 1.00 64.78  ? 275  THR B CB  1 
ATOM   6250 O OG1 . THR B 1 275 ? 24.854  -13.950 -60.022 1.00 64.58  ? 275  THR B OG1 1 
ATOM   6251 C CG2 . THR B 1 275 ? 25.017  -12.802 -62.154 1.00 64.53  ? 275  THR B CG2 1 
ATOM   6252 N N   . ARG B 1 276 ? 21.997  -13.170 -58.562 1.00 62.51  ? 276  ARG B N   1 
ATOM   6253 C CA  . ARG B 1 276 ? 21.368  -14.048 -57.587 1.00 62.79  ? 276  ARG B CA  1 
ATOM   6254 C C   . ARG B 1 276 ? 19.862  -13.852 -57.564 1.00 61.30  ? 276  ARG B C   1 
ATOM   6255 O O   . ARG B 1 276 ? 19.404  -12.718 -57.531 1.00 60.37  ? 276  ARG B O   1 
ATOM   6256 C CB  . ARG B 1 276 ? 21.958  -13.795 -56.192 1.00 63.00  ? 276  ARG B CB  1 
ATOM   6257 C CG  . ARG B 1 276 ? 23.389  -14.258 -56.050 1.00 65.11  ? 276  ARG B CG  1 
ATOM   6258 C CD  . ARG B 1 276 ? 23.470  -15.779 -56.077 1.00 68.24  ? 276  ARG B CD  1 
ATOM   6259 N NE  . ARG B 1 276 ? 24.829  -16.273 -55.879 1.00 70.28  ? 276  ARG B NE  1 
ATOM   6260 C CZ  . ARG B 1 276 ? 25.753  -16.359 -56.836 1.00 72.31  ? 276  ARG B CZ  1 
ATOM   6261 N NH1 . ARG B 1 276 ? 25.483  -15.979 -58.080 1.00 73.59  ? 276  ARG B NH1 1 
ATOM   6262 N NH2 . ARG B 1 276 ? 26.960  -16.841 -56.548 1.00 73.20  ? 276  ARG B NH2 1 
ATOM   6263 N N   . PRO B 1 277 ? 19.086  -14.951 -57.586 1.00 61.36  ? 277  PRO B N   1 
ATOM   6264 C CA  . PRO B 1 277 ? 17.656  -14.840 -57.320 1.00 60.51  ? 277  PRO B CA  1 
ATOM   6265 C C   . PRO B 1 277 ? 17.368  -14.005 -56.072 1.00 59.34  ? 277  PRO B C   1 
ATOM   6266 O O   . PRO B 1 277 ? 18.144  -14.020 -55.120 1.00 59.32  ? 277  PRO B O   1 
ATOM   6267 C CB  . PRO B 1 277 ? 17.224  -16.294 -57.134 1.00 61.87  ? 277  PRO B CB  1 
ATOM   6268 C CG  . PRO B 1 277 ? 18.143  -17.056 -58.015 1.00 62.91  ? 277  PRO B CG  1 
ATOM   6269 C CD  . PRO B 1 277 ? 19.468  -16.340 -57.906 1.00 63.25  ? 277  PRO B CD  1 
ATOM   6270 N N   . ALA B 1 278 ? 16.269  -13.260 -56.106 1.00 58.49  ? 278  ALA B N   1 
ATOM   6271 C CA  . ALA B 1 278 ? 15.924  -12.327 -55.037 1.00 57.56  ? 278  ALA B CA  1 
ATOM   6272 C C   . ALA B 1 278 ? 15.846  -13.023 -53.672 1.00 58.24  ? 278  ALA B C   1 
ATOM   6273 O O   . ALA B 1 278 ? 16.317  -12.487 -52.665 1.00 57.52  ? 278  ALA B O   1 
ATOM   6274 C CB  . ALA B 1 278 ? 14.606  -11.639 -55.360 1.00 56.56  ? 278  ALA B CB  1 
ATOM   6275 N N   . GLN B 1 279 ? 15.251  -14.215 -53.640 1.00 59.42  ? 279  GLN B N   1 
ATOM   6276 C CA  . GLN B 1 279 ? 15.050  -14.923 -52.378 1.00 60.27  ? 279  GLN B CA  1 
ATOM   6277 C C   . GLN B 1 279 ? 16.359  -15.407 -51.787 1.00 61.34  ? 279  GLN B C   1 
ATOM   6278 O O   . GLN B 1 279 ? 16.447  -15.594 -50.582 1.00 61.41  ? 279  GLN B O   1 
ATOM   6279 C CB  . GLN B 1 279 ? 14.084  -16.108 -52.540 1.00 61.38  ? 279  GLN B CB  1 
ATOM   6280 C CG  . GLN B 1 279 ? 13.581  -16.695 -51.206 1.00 61.55  ? 279  GLN B CG  1 
ATOM   6281 C CD  . GLN B 1 279 ? 13.056  -15.639 -50.244 1.00 61.33  ? 279  GLN B CD  1 
ATOM   6282 O OE1 . GLN B 1 279 ? 12.277  -14.764 -50.625 1.00 60.14  ? 279  GLN B OE1 1 
ATOM   6283 N NE2 . GLN B 1 279 ? 13.498  -15.707 -48.994 1.00 61.22  ? 279  GLN B NE2 1 
ATOM   6284 N N   . ASP B 1 280 ? 17.360  -15.635 -52.636 1.00 62.80  ? 280  ASP B N   1 
ATOM   6285 C CA  . ASP B 1 280 ? 18.699  -16.026 -52.178 1.00 64.16  ? 280  ASP B CA  1 
ATOM   6286 C C   . ASP B 1 280 ? 19.311  -14.935 -51.301 1.00 63.29  ? 280  ASP B C   1 
ATOM   6287 O O   . ASP B 1 280 ? 20.032  -15.236 -50.351 1.00 64.01  ? 280  ASP B O   1 
ATOM   6288 C CB  . ASP B 1 280 ? 19.638  -16.287 -53.361 1.00 65.16  ? 280  ASP B CB  1 
ATOM   6289 C CG  . ASP B 1 280 ? 19.408  -17.651 -54.026 1.00 67.97  ? 280  ASP B CG  1 
ATOM   6290 O OD1 . ASP B 1 280 ? 18.324  -18.265 -53.851 1.00 69.24  ? 280  ASP B OD1 1 
ATOM   6291 O OD2 . ASP B 1 280 ? 20.337  -18.100 -54.734 1.00 69.53  ? 280  ASP B OD2 1 
ATOM   6292 N N   . LEU B 1 281 ? 19.032  -13.675 -51.643 1.00 61.97  ? 281  LEU B N   1 
ATOM   6293 C CA  . LEU B 1 281 ? 19.531  -12.520 -50.884 1.00 61.10  ? 281  LEU B CA  1 
ATOM   6294 C C   . LEU B 1 281 ? 18.768  -12.385 -49.577 1.00 60.40  ? 281  LEU B C   1 
ATOM   6295 O O   . LEU B 1 281 ? 19.360  -12.218 -48.509 1.00 60.32  ? 281  LEU B O   1 
ATOM   6296 C CB  . LEU B 1 281 ? 19.395  -11.227 -51.714 1.00 60.24  ? 281  LEU B CB  1 
ATOM   6297 C CG  . LEU B 1 281 ? 20.579  -10.825 -52.617 1.00 60.67  ? 281  LEU B CG  1 
ATOM   6298 C CD1 . LEU B 1 281 ? 21.201  -11.984 -53.256 1.00 61.84  ? 281  LEU B CD1 1 
ATOM   6299 C CD2 . LEU B 1 281 ? 20.163  -9.797  -53.665 1.00 59.77  ? 281  LEU B CD2 1 
ATOM   6300 N N   . VAL B 1 282 ? 17.443  -12.443 -49.673 1.00 59.84  ? 282  VAL B N   1 
ATOM   6301 C CA  . VAL B 1 282 ? 16.584  -12.389 -48.502 1.00 59.24  ? 282  VAL B CA  1 
ATOM   6302 C C   . VAL B 1 282 ? 16.879  -13.542 -47.521 1.00 60.67  ? 282  VAL B C   1 
ATOM   6303 O O   . VAL B 1 282 ? 16.909  -13.327 -46.311 1.00 60.29  ? 282  VAL B O   1 
ATOM   6304 C CB  . VAL B 1 282 ? 15.094  -12.383 -48.902 1.00 58.47  ? 282  VAL B CB  1 
ATOM   6305 C CG1 . VAL B 1 282 ? 14.206  -12.560 -47.685 1.00 57.85  ? 282  VAL B CG1 1 
ATOM   6306 C CG2 . VAL B 1 282 ? 14.742  -11.089 -49.665 1.00 56.16  ? 282  VAL B CG2 1 
ATOM   6307 N N   . ASP B 1 283 ? 17.118  -14.752 -48.033 1.00 62.40  ? 283  ASP B N   1 
ATOM   6308 C CA  . ASP B 1 283 ? 17.439  -15.899 -47.171 1.00 64.05  ? 283  ASP B CA  1 
ATOM   6309 C C   . ASP B 1 283 ? 18.575  -15.605 -46.165 1.00 64.63  ? 283  ASP B C   1 
ATOM   6310 O O   . ASP B 1 283 ? 18.591  -16.170 -45.065 1.00 65.41  ? 283  ASP B O   1 
ATOM   6311 C CB  . ASP B 1 283 ? 17.803  -17.139 -48.002 1.00 65.82  ? 283  ASP B CB  1 
ATOM   6312 C CG  . ASP B 1 283 ? 16.573  -17.907 -48.533 1.00 66.43  ? 283  ASP B CG  1 
ATOM   6313 O OD1 . ASP B 1 283 ? 15.429  -17.653 -48.109 1.00 65.14  ? 283  ASP B OD1 1 
ATOM   6314 O OD2 . ASP B 1 283 ? 16.773  -18.801 -49.379 1.00 68.62  ? 283  ASP B OD2 1 
ATOM   6315 N N   . HIS B 1 284 ? 19.518  -14.739 -46.538 1.00 64.43  ? 284  HIS B N   1 
ATOM   6316 C CA  . HIS B 1 284 ? 20.667  -14.425 -45.684 1.00 65.09  ? 284  HIS B CA  1 
ATOM   6317 C C   . HIS B 1 284 ? 20.653  -13.018 -45.102 1.00 64.67  ? 284  HIS B C   1 
ATOM   6318 O O   . HIS B 1 284 ? 21.636  -12.576 -44.515 1.00 65.40  ? 284  HIS B O   1 
ATOM   6319 C CB  . HIS B 1 284 ? 21.957  -14.621 -46.471 1.00 66.56  ? 284  HIS B CB  1 
ATOM   6320 C CG  . HIS B 1 284 ? 22.309  -16.053 -46.691 1.00 67.32  ? 284  HIS B CG  1 
ATOM   6321 N ND1 . HIS B 1 284 ? 22.727  -16.877 -45.667 1.00 69.56  ? 284  HIS B ND1 1 
ATOM   6322 C CD2 . HIS B 1 284 ? 22.304  -16.813 -47.811 1.00 69.01  ? 284  HIS B CD2 1 
ATOM   6323 C CE1 . HIS B 1 284 ? 22.968  -18.085 -46.149 1.00 70.31  ? 284  HIS B CE1 1 
ATOM   6324 N NE2 . HIS B 1 284 ? 22.721  -18.072 -47.448 1.00 70.17  ? 284  HIS B NE2 1 
ATOM   6325 N N   . GLU B 1 285 ? 19.535  -12.322 -45.232 1.00 63.92  ? 285  GLU B N   1 
ATOM   6326 C CA  . GLU B 1 285 ? 19.453  -10.926 -44.817 1.00 63.22  ? 285  GLU B CA  1 
ATOM   6327 C C   . GLU B 1 285 ? 19.747  -10.724 -43.326 1.00 63.53  ? 285  GLU B C   1 
ATOM   6328 O O   . GLU B 1 285 ? 20.422  -9.763  -42.936 1.00 63.08  ? 285  GLU B O   1 
ATOM   6329 C CB  . GLU B 1 285 ? 18.068  -10.373 -45.139 1.00 61.89  ? 285  GLU B CB  1 
ATOM   6330 C CG  . GLU B 1 285 ? 17.993  -8.873  -44.988 1.00 61.69  ? 285  GLU B CG  1 
ATOM   6331 C CD  . GLU B 1 285 ? 16.604  -8.322  -45.218 1.00 60.60  ? 285  GLU B CD  1 
ATOM   6332 O OE1 . GLU B 1 285 ? 15.888  -8.872  -46.084 1.00 57.77  ? 285  GLU B OE1 1 
ATOM   6333 O OE2 . GLU B 1 285 ? 16.262  -7.316  -44.531 1.00 62.05  ? 285  GLU B OE2 1 
ATOM   6334 N N   . TRP B 1 286 ? 19.230  -11.629 -42.503 1.00 64.55  ? 286  TRP B N   1 
ATOM   6335 C CA  . TRP B 1 286 ? 19.321  -11.500 -41.058 1.00 64.82  ? 286  TRP B CA  1 
ATOM   6336 C C   . TRP B 1 286 ? 20.625  -12.059 -40.496 1.00 65.99  ? 286  TRP B C   1 
ATOM   6337 O O   . TRP B 1 286 ? 20.858  -11.971 -39.299 1.00 66.88  ? 286  TRP B O   1 
ATOM   6338 C CB  . TRP B 1 286 ? 18.117  -12.177 -40.398 1.00 65.30  ? 286  TRP B CB  1 
ATOM   6339 C CG  . TRP B 1 286 ? 16.850  -11.478 -40.712 1.00 64.56  ? 286  TRP B CG  1 
ATOM   6340 C CD1 . TRP B 1 286 ? 15.904  -11.852 -41.621 1.00 64.73  ? 286  TRP B CD1 1 
ATOM   6341 C CD2 . TRP B 1 286 ? 16.399  -10.237 -40.149 1.00 64.04  ? 286  TRP B CD2 1 
ATOM   6342 N NE1 . TRP B 1 286 ? 14.882  -10.927 -41.644 1.00 63.87  ? 286  TRP B NE1 1 
ATOM   6343 C CE2 . TRP B 1 286 ? 15.163  -9.931  -40.746 1.00 62.98  ? 286  TRP B CE2 1 
ATOM   6344 C CE3 . TRP B 1 286 ? 16.919  -9.362  -39.185 1.00 63.45  ? 286  TRP B CE3 1 
ATOM   6345 C CZ2 . TRP B 1 286 ? 14.442  -8.787  -40.416 1.00 62.57  ? 286  TRP B CZ2 1 
ATOM   6346 C CZ3 . TRP B 1 286 ? 16.202  -8.238  -38.854 1.00 62.32  ? 286  TRP B CZ3 1 
ATOM   6347 C CH2 . TRP B 1 286 ? 14.973  -7.957  -39.464 1.00 61.54  ? 286  TRP B CH2 1 
ATOM   6348 N N   . HIS B 1 287 ? 21.488  -12.599 -41.349 1.00 66.60  ? 287  HIS B N   1 
ATOM   6349 C CA  . HIS B 1 287 ? 22.712  -13.250 -40.885 1.00 68.05  ? 287  HIS B CA  1 
ATOM   6350 C C   . HIS B 1 287 ? 23.934  -12.340 -40.796 1.00 67.61  ? 287  HIS B C   1 
ATOM   6351 O O   . HIS B 1 287 ? 25.016  -12.813 -40.445 1.00 69.04  ? 287  HIS B O   1 
ATOM   6352 C CB  . HIS B 1 287 ? 23.062  -14.424 -41.806 1.00 69.65  ? 287  HIS B CB  1 
ATOM   6353 C CG  . HIS B 1 287 ? 22.040  -15.512 -41.810 1.00 70.98  ? 287  HIS B CG  1 
ATOM   6354 N ND1 . HIS B 1 287 ? 21.918  -16.412 -42.847 1.00 72.46  ? 287  HIS B ND1 1 
ATOM   6355 C CD2 . HIS B 1 287 ? 21.090  -15.844 -40.906 1.00 72.15  ? 287  HIS B CD2 1 
ATOM   6356 C CE1 . HIS B 1 287 ? 20.937  -17.255 -42.578 1.00 73.46  ? 287  HIS B CE1 1 
ATOM   6357 N NE2 . HIS B 1 287 ? 20.419  -16.932 -41.406 1.00 73.30  ? 287  HIS B NE2 1 
ATOM   6358 N N   . VAL B 1 288 ? 23.779  -11.060 -41.127 1.00 66.01  ? 288  VAL B N   1 
ATOM   6359 C CA  . VAL B 1 288 ? 24.916  -10.138 -41.196 1.00 65.67  ? 288  VAL B CA  1 
ATOM   6360 C C   . VAL B 1 288 ? 24.956  -9.139  -40.043 1.00 65.07  ? 288  VAL B C   1 
ATOM   6361 O O   . VAL B 1 288 ? 25.925  -8.395  -39.917 1.00 64.72  ? 288  VAL B O   1 
ATOM   6362 C CB  . VAL B 1 288 ? 24.972  -9.368  -42.548 1.00 64.99  ? 288  VAL B CB  1 
ATOM   6363 C CG1 . VAL B 1 288 ? 25.156  -10.333 -43.705 1.00 65.44  ? 288  VAL B CG1 1 
ATOM   6364 C CG2 . VAL B 1 288 ? 23.746  -8.494  -42.743 1.00 62.72  ? 288  VAL B CG2 1 
ATOM   6365 N N   . LEU B 1 289 ? 23.917  -9.117  -39.208 1.00 64.59  ? 289  LEU B N   1 
ATOM   6366 C CA  . LEU B 1 289 ? 23.922  -8.277  -38.008 1.00 64.65  ? 289  LEU B CA  1 
ATOM   6367 C C   . LEU B 1 289 ? 25.046  -8.698  -37.048 1.00 66.27  ? 289  LEU B C   1 
ATOM   6368 O O   . LEU B 1 289 ? 25.269  -9.901  -36.851 1.00 67.42  ? 289  LEU B O   1 
ATOM   6369 C CB  . LEU B 1 289 ? 22.578  -8.344  -37.286 1.00 63.67  ? 289  LEU B CB  1 
ATOM   6370 C CG  . LEU B 1 289 ? 21.447  -7.538  -37.906 1.00 61.96  ? 289  LEU B CG  1 
ATOM   6371 C CD1 . LEU B 1 289 ? 20.149  -7.847  -37.177 1.00 61.43  ? 289  LEU B CD1 1 
ATOM   6372 C CD2 . LEU B 1 289 ? 21.774  -6.049  -37.866 1.00 60.29  ? 289  LEU B CD2 1 
ATOM   6373 N N   . PRO B 1 290 ? 25.752  -7.712  -36.451 1.00 66.48  ? 290  PRO B N   1 
ATOM   6374 C CA  . PRO B 1 290 ? 26.927  -7.974  -35.604 1.00 68.37  ? 290  PRO B CA  1 
ATOM   6375 C C   . PRO B 1 290 ? 26.656  -8.677  -34.254 1.00 69.35  ? 290  PRO B C   1 
ATOM   6376 O O   . PRO B 1 290 ? 27.521  -9.403  -33.772 1.00 71.07  ? 290  PRO B O   1 
ATOM   6377 C CB  . PRO B 1 290 ? 27.531  -6.576  -35.391 1.00 67.85  ? 290  PRO B CB  1 
ATOM   6378 C CG  . PRO B 1 290 ? 26.411  -5.635  -35.588 1.00 65.99  ? 290  PRO B CG  1 
ATOM   6379 C CD  . PRO B 1 290 ? 25.476  -6.270  -36.577 1.00 65.43  ? 290  PRO B CD  1 
ATOM   6380 N N   . GLN B 1 291 ? 25.488  -8.459  -33.654 1.00 68.66  ? 291  GLN B N   1 
ATOM   6381 C CA  . GLN B 1 291 ? 25.119  -9.140  -32.414 1.00 69.55  ? 291  GLN B CA  1 
ATOM   6382 C C   . GLN B 1 291 ? 23.687  -9.675  -32.477 1.00 68.88  ? 291  GLN B C   1 
ATOM   6383 O O   . GLN B 1 291 ? 22.925  -9.349  -33.394 1.00 67.36  ? 291  GLN B O   1 
ATOM   6384 C CB  . GLN B 1 291 ? 25.284  -8.206  -31.202 1.00 69.93  ? 291  GLN B CB  1 
ATOM   6385 C CG  . GLN B 1 291 ? 26.690  -7.555  -31.056 1.00 72.45  ? 291  GLN B CG  1 
ATOM   6386 C CD  . GLN B 1 291 ? 26.768  -6.186  -31.734 1.00 74.98  ? 291  GLN B CD  1 
ATOM   6387 O OE1 . GLN B 1 291 ? 27.814  -5.536  -31.762 1.00 77.85  ? 291  GLN B OE1 1 
ATOM   6388 N NE2 . GLN B 1 291 ? 25.644  -5.740  -32.275 1.00 76.48  ? 291  GLN B NE2 1 
ATOM   6389 N N   . GLU B 1 292 ? 23.329  -10.517 -31.512 1.00 69.76  ? 292  GLU B N   1 
ATOM   6390 C CA  . GLU B 1 292 ? 21.943  -10.950 -31.365 1.00 69.83  ? 292  GLU B CA  1 
ATOM   6391 C C   . GLU B 1 292 ? 21.170  -9.761  -30.820 1.00 67.62  ? 292  GLU B C   1 
ATOM   6392 O O   . GLU B 1 292 ? 21.536  -9.202  -29.795 1.00 67.71  ? 292  GLU B O   1 
ATOM   6393 C CB  . GLU B 1 292 ? 21.806  -12.139 -30.404 1.00 71.99  ? 292  GLU B CB  1 
ATOM   6394 C CG  . GLU B 1 292 ? 20.552  -12.985 -30.697 1.00 74.89  ? 292  GLU B CG  1 
ATOM   6395 C CD  . GLU B 1 292 ? 19.830  -13.459 -29.442 1.00 79.56  ? 292  GLU B CD  1 
ATOM   6396 O OE1 . GLU B 1 292 ? 20.508  -13.987 -28.515 1.00 82.50  ? 292  GLU B OE1 1 
ATOM   6397 O OE2 . GLU B 1 292 ? 18.574  -13.303 -29.401 1.00 81.73  ? 292  GLU B OE2 1 
ATOM   6398 N N   . SER B 1 293 ? 20.110  -9.364  -31.507 1.00 65.64  ? 293  SER B N   1 
ATOM   6399 C CA  . SER B 1 293 ? 19.461  -8.117  -31.182 1.00 63.37  ? 293  SER B CA  1 
ATOM   6400 C C   . SER B 1 293 ? 18.015  -8.088  -31.606 1.00 61.84  ? 293  SER B C   1 
ATOM   6401 O O   . SER B 1 293 ? 17.562  -8.922  -32.384 1.00 62.31  ? 293  SER B O   1 
ATOM   6402 C CB  . SER B 1 293 ? 20.214  -6.964  -31.849 1.00 62.80  ? 293  SER B CB  1 
ATOM   6403 O OG  . SER B 1 293 ? 20.488  -7.230  -33.211 1.00 63.58  ? 293  SER B OG  1 
ATOM   6404 N N   . ILE B 1 294 ? 17.300  -7.103  -31.077 1.00 59.81  ? 294  ILE B N   1 
ATOM   6405 C CA  . ILE B 1 294 ? 15.983  -6.740  -31.559 1.00 58.12  ? 294  ILE B CA  1 
ATOM   6406 C C   . ILE B 1 294 ? 15.995  -5.246  -31.881 1.00 56.17  ? 294  ILE B C   1 
ATOM   6407 O O   . ILE B 1 294 ? 16.842  -4.507  -31.376 1.00 55.80  ? 294  ILE B O   1 
ATOM   6408 C CB  . ILE B 1 294 ? 14.877  -7.086  -30.534 1.00 58.32  ? 294  ILE B CB  1 
ATOM   6409 C CG1 . ILE B 1 294 ? 15.127  -6.402  -29.185 1.00 58.21  ? 294  ILE B CG1 1 
ATOM   6410 C CG2 . ILE B 1 294 ? 14.788  -8.606  -30.361 1.00 59.69  ? 294  ILE B CG2 1 
ATOM   6411 C CD1 . ILE B 1 294 ? 13.960  -6.527  -28.212 1.00 58.61  ? 294  ILE B CD1 1 
ATOM   6412 N N   . PHE B 1 295 ? 15.060  -4.824  -32.730 1.00 54.69  ? 295  PHE B N   1 
ATOM   6413 C CA  . PHE B 1 295 ? 14.986  -3.449  -33.222 1.00 53.34  ? 295  PHE B CA  1 
ATOM   6414 C C   . PHE B 1 295 ? 16.292  -3.102  -33.928 1.00 53.26  ? 295  PHE B C   1 
ATOM   6415 O O   . PHE B 1 295 ? 16.786  -1.988  -33.803 1.00 52.89  ? 295  PHE B O   1 
ATOM   6416 C CB  . PHE B 1 295 ? 14.696  -2.466  -32.070 1.00 52.77  ? 295  PHE B CB  1 
ATOM   6417 C CG  . PHE B 1 295 ? 13.721  -1.369  -32.419 1.00 51.65  ? 295  PHE B CG  1 
ATOM   6418 C CD1 . PHE B 1 295 ? 13.918  -0.559  -33.530 1.00 51.19  ? 295  PHE B CD1 1 
ATOM   6419 C CD2 . PHE B 1 295 ? 12.614  -1.133  -31.621 1.00 51.80  ? 295  PHE B CD2 1 
ATOM   6420 C CE1 . PHE B 1 295 ? 13.022  0.450   -33.851 1.00 49.87  ? 295  PHE B CE1 1 
ATOM   6421 C CE2 . PHE B 1 295 ? 11.717  -0.117  -31.937 1.00 51.74  ? 295  PHE B CE2 1 
ATOM   6422 C CZ  . PHE B 1 295 ? 11.932  0.677   -33.060 1.00 49.78  ? 295  PHE B CZ  1 
ATOM   6423 N N   . ARG B 1 296 ? 16.856  -4.081  -34.644 1.00 53.44  ? 296  ARG B N   1 
ATOM   6424 C CA  . ARG B 1 296 ? 18.018  -3.867  -35.489 1.00 53.40  ? 296  ARG B CA  1 
ATOM   6425 C C   . ARG B 1 296 ? 17.795  -4.507  -36.843 1.00 53.10  ? 296  ARG B C   1 
ATOM   6426 O O   . ARG B 1 296 ? 17.288  -5.620  -36.931 1.00 53.76  ? 296  ARG B O   1 
ATOM   6427 C CB  . ARG B 1 296 ? 19.273  -4.438  -34.849 1.00 54.65  ? 296  ARG B CB  1 
ATOM   6428 C CG  . ARG B 1 296 ? 19.748  -3.668  -33.624 1.00 55.08  ? 296  ARG B CG  1 
ATOM   6429 C CD  . ARG B 1 296 ? 20.166  -2.272  -33.963 1.00 54.36  ? 296  ARG B CD  1 
ATOM   6430 N NE  . ARG B 1 296 ? 20.741  -1.619  -32.804 1.00 55.31  ? 296  ARG B NE  1 
ATOM   6431 C CZ  . ARG B 1 296 ? 20.035  -1.073  -31.819 1.00 55.48  ? 296  ARG B CZ  1 
ATOM   6432 N NH1 . ARG B 1 296 ? 18.709  -1.058  -31.853 1.00 54.36  ? 296  ARG B NH1 1 
ATOM   6433 N NH2 . ARG B 1 296 ? 20.661  -0.504  -30.797 1.00 55.90  ? 296  ARG B NH2 1 
ATOM   6434 N N   . PHE B 1 297 ? 18.188  -3.786  -37.892 1.00 52.37  ? 297  PHE B N   1 
ATOM   6435 C CA  . PHE B 1 297 ? 17.863  -4.137  -39.277 1.00 51.87  ? 297  PHE B CA  1 
ATOM   6436 C C   . PHE B 1 297 ? 19.137  -4.073  -40.123 1.00 52.25  ? 297  PHE B C   1 
ATOM   6437 O O   . PHE B 1 297 ? 19.931  -3.130  -40.017 1.00 52.06  ? 297  PHE B O   1 
ATOM   6438 C CB  . PHE B 1 297 ? 16.778  -3.175  -39.784 1.00 50.81  ? 297  PHE B CB  1 
ATOM   6439 C CG  . PHE B 1 297 ? 15.697  -2.930  -38.771 1.00 49.82  ? 297  PHE B CG  1 
ATOM   6440 C CD1 . PHE B 1 297 ? 14.866  -3.971  -38.366 1.00 50.88  ? 297  PHE B CD1 1 
ATOM   6441 C CD2 . PHE B 1 297 ? 15.534  -1.688  -38.185 1.00 49.51  ? 297  PHE B CD2 1 
ATOM   6442 C CE1 . PHE B 1 297 ? 13.867  -3.764  -37.414 1.00 50.46  ? 297  PHE B CE1 1 
ATOM   6443 C CE2 . PHE B 1 297 ? 14.543  -1.474  -37.217 1.00 48.53  ? 297  PHE B CE2 1 
ATOM   6444 C CZ  . PHE B 1 297 ? 13.712  -2.510  -36.839 1.00 49.65  ? 297  PHE B CZ  1 
ATOM   6445 N N   . SER B 1 298 ? 19.346  -5.106  -40.929 1.00 52.75  ? 298  SER B N   1 
ATOM   6446 C CA  . SER B 1 298 ? 20.618  -5.318  -41.620 1.00 53.47  ? 298  SER B CA  1 
ATOM   6447 C C   . SER B 1 298 ? 20.955  -4.271  -42.672 1.00 52.95  ? 298  SER B C   1 
ATOM   6448 O O   . SER B 1 298 ? 22.112  -3.824  -42.767 1.00 54.12  ? 298  SER B O   1 
ATOM   6449 C CB  . SER B 1 298 ? 20.615  -6.693  -42.280 1.00 54.70  ? 298  SER B CB  1 
ATOM   6450 O OG  . SER B 1 298 ? 20.576  -7.717  -41.303 1.00 54.98  ? 298  SER B OG  1 
ATOM   6451 N N   . PHE B 1 299 ? 19.961  -3.892  -43.473 1.00 51.36  ? 299  PHE B N   1 
ATOM   6452 C CA  . PHE B 1 299 ? 20.196  -2.998  -44.604 1.00 50.27  ? 299  PHE B CA  1 
ATOM   6453 C C   . PHE B 1 299 ? 19.328  -1.747  -44.490 1.00 48.98  ? 299  PHE B C   1 
ATOM   6454 O O   . PHE B 1 299 ? 18.125  -1.777  -44.749 1.00 47.72  ? 299  PHE B O   1 
ATOM   6455 C CB  . PHE B 1 299 ? 20.017  -3.769  -45.916 1.00 50.38  ? 299  PHE B CB  1 
ATOM   6456 C CG  . PHE B 1 299 ? 21.045  -4.869  -46.088 1.00 50.73  ? 299  PHE B CG  1 
ATOM   6457 C CD1 . PHE B 1 299 ? 22.332  -4.565  -46.502 1.00 50.86  ? 299  PHE B CD1 1 
ATOM   6458 C CD2 . PHE B 1 299 ? 20.741  -6.184  -45.757 1.00 50.89  ? 299  PHE B CD2 1 
ATOM   6459 C CE1 . PHE B 1 299 ? 23.310  -5.556  -46.617 1.00 52.33  ? 299  PHE B CE1 1 
ATOM   6460 C CE2 . PHE B 1 299 ? 21.705  -7.188  -45.871 1.00 52.42  ? 299  PHE B CE2 1 
ATOM   6461 C CZ  . PHE B 1 299 ? 22.994  -6.871  -46.303 1.00 52.78  ? 299  PHE B CZ  1 
ATOM   6462 N N   . VAL B 1 300 ? 19.977  -0.666  -44.056 1.00 48.71  ? 300  VAL B N   1 
ATOM   6463 C CA  . VAL B 1 300 ? 19.335  0.596   -43.725 1.00 48.13  ? 300  VAL B CA  1 
ATOM   6464 C C   . VAL B 1 300 ? 20.121  1.748   -44.366 1.00 48.58  ? 300  VAL B C   1 
ATOM   6465 O O   . VAL B 1 300 ? 21.221  1.534   -44.894 1.00 49.31  ? 300  VAL B O   1 
ATOM   6466 C CB  . VAL B 1 300 ? 19.278  0.769   -42.176 1.00 48.04  ? 300  VAL B CB  1 
ATOM   6467 C CG1 . VAL B 1 300 ? 18.588  -0.439  -41.518 1.00 47.90  ? 300  VAL B CG1 1 
ATOM   6468 C CG2 . VAL B 1 300 ? 20.664  0.935   -41.610 1.00 48.51  ? 300  VAL B CG2 1 
ATOM   6469 N N   . PRO B 1 301 ? 19.561  2.976   -44.351 1.00 48.05  ? 301  PRO B N   1 
ATOM   6470 C CA  . PRO B 1 301 ? 20.285  4.127   -44.878 1.00 48.35  ? 301  PRO B CA  1 
ATOM   6471 C C   . PRO B 1 301 ? 21.707  4.241   -44.337 1.00 49.47  ? 301  PRO B C   1 
ATOM   6472 O O   . PRO B 1 301 ? 21.941  3.912   -43.175 1.00 49.90  ? 301  PRO B O   1 
ATOM   6473 C CB  . PRO B 1 301 ? 19.439  5.303   -44.418 1.00 47.69  ? 301  PRO B CB  1 
ATOM   6474 C CG  . PRO B 1 301 ? 18.070  4.775   -44.417 1.00 47.22  ? 301  PRO B CG  1 
ATOM   6475 C CD  . PRO B 1 301 ? 18.200  3.349   -43.926 1.00 47.69  ? 301  PRO B CD  1 
ATOM   6476 N N   . VAL B 1 302 ? 22.642  4.694   -45.177 1.00 49.91  ? 302  VAL B N   1 
ATOM   6477 C CA  . VAL B 1 302 ? 24.060  4.711   -44.822 1.00 50.87  ? 302  VAL B CA  1 
ATOM   6478 C C   . VAL B 1 302 ? 24.593  6.136   -44.836 1.00 51.79  ? 302  VAL B C   1 
ATOM   6479 O O   . VAL B 1 302 ? 24.217  6.932   -45.685 1.00 51.94  ? 302  VAL B O   1 
ATOM   6480 C CB  . VAL B 1 302 ? 24.902  3.823   -45.786 1.00 51.36  ? 302  VAL B CB  1 
ATOM   6481 C CG1 . VAL B 1 302 ? 24.695  4.229   -47.244 1.00 51.63  ? 302  VAL B CG1 1 
ATOM   6482 C CG2 . VAL B 1 302 ? 26.393  3.862   -45.425 1.00 52.28  ? 302  VAL B CG2 1 
ATOM   6483 N N   . VAL B 1 303 ? 25.491  6.458   -43.913 1.00 53.24  ? 303  VAL B N   1 
ATOM   6484 C CA  . VAL B 1 303 ? 26.092  7.787   -43.900 1.00 54.03  ? 303  VAL B CA  1 
ATOM   6485 C C   . VAL B 1 303 ? 27.155  7.808   -44.993 1.00 55.74  ? 303  VAL B C   1 
ATOM   6486 O O   . VAL B 1 303 ? 28.307  7.410   -44.793 1.00 57.06  ? 303  VAL B O   1 
ATOM   6487 C CB  . VAL B 1 303 ? 26.612  8.162   -42.493 1.00 54.76  ? 303  VAL B CB  1 
ATOM   6488 C CG1 . VAL B 1 303 ? 27.224  9.555   -42.468 1.00 54.49  ? 303  VAL B CG1 1 
ATOM   6489 C CG2 . VAL B 1 303 ? 25.461  8.088   -41.490 1.00 52.77  ? 303  VAL B CG2 1 
ATOM   6490 N N   . ASP B 1 304 ? 26.726  8.245   -46.173 1.00 56.34  ? 304  ASP B N   1 
ATOM   6491 C CA  . ASP B 1 304 ? 27.537  8.172   -47.394 1.00 57.88  ? 304  ASP B CA  1 
ATOM   6492 C C   . ASP B 1 304 ? 28.320  9.445   -47.694 1.00 59.14  ? 304  ASP B C   1 
ATOM   6493 O O   . ASP B 1 304 ? 29.203  9.430   -48.535 1.00 60.37  ? 304  ASP B O   1 
ATOM   6494 C CB  . ASP B 1 304 ? 26.670  7.810   -48.613 1.00 57.33  ? 304  ASP B CB  1 
ATOM   6495 C CG  . ASP B 1 304 ? 25.456  8.718   -48.783 1.00 56.86  ? 304  ASP B CG  1 
ATOM   6496 O OD1 . ASP B 1 304 ? 25.184  9.560   -47.900 1.00 58.88  ? 304  ASP B OD1 1 
ATOM   6497 O OD2 . ASP B 1 304 ? 24.751  8.577   -49.802 1.00 56.31  ? 304  ASP B OD2 1 
ATOM   6498 N N   . GLY B 1 305 ? 27.982  10.540  -47.020 1.00 59.29  ? 305  GLY B N   1 
ATOM   6499 C CA  . GLY B 1 305 ? 28.543  11.845  -47.338 1.00 60.29  ? 305  GLY B CA  1 
ATOM   6500 C C   . GLY B 1 305 ? 27.924  12.438  -48.592 1.00 60.62  ? 305  GLY B C   1 
ATOM   6501 O O   . GLY B 1 305 ? 28.483  13.370  -49.168 1.00 61.87  ? 305  GLY B O   1 
ATOM   6502 N N   . ASP B 1 306 ? 26.764  11.918  -49.001 1.00 59.83  ? 306  ASP B N   1 
ATOM   6503 C CA  . ASP B 1 306 ? 26.067  12.382  -50.206 1.00 59.54  ? 306  ASP B CA  1 
ATOM   6504 C C   . ASP B 1 306 ? 24.589  12.638  -49.879 1.00 57.99  ? 306  ASP B C   1 
ATOM   6505 O O   . ASP B 1 306 ? 24.223  13.773  -49.593 1.00 57.65  ? 306  ASP B O   1 
ATOM   6506 C CB  . ASP B 1 306 ? 26.232  11.387  -51.368 1.00 60.02  ? 306  ASP B CB  1 
ATOM   6507 C CG  . ASP B 1 306 ? 25.564  11.866  -52.653 1.00 61.31  ? 306  ASP B CG  1 
ATOM   6508 O OD1 . ASP B 1 306 ? 25.326  13.091  -52.781 1.00 65.98  ? 306  ASP B OD1 1 
ATOM   6509 O OD2 . ASP B 1 306 ? 25.287  11.026  -53.546 1.00 63.82  ? 306  ASP B OD2 1 
ATOM   6510 N N   . PHE B 1 307 ? 23.738  11.610  -49.893 1.00 56.85  ? 307  PHE B N   1 
ATOM   6511 C CA  . PHE B 1 307 ? 22.344  11.817  -49.452 1.00 55.49  ? 307  PHE B CA  1 
ATOM   6512 C C   . PHE B 1 307 ? 22.368  12.396  -48.035 1.00 55.28  ? 307  PHE B C   1 
ATOM   6513 O O   . PHE B 1 307 ? 21.680  13.369  -47.732 1.00 54.75  ? 307  PHE B O   1 
ATOM   6514 C CB  . PHE B 1 307 ? 21.530  10.522  -49.490 1.00 54.36  ? 307  PHE B CB  1 
ATOM   6515 C CG  . PHE B 1 307 ? 20.043  10.738  -49.331 1.00 52.65  ? 307  PHE B CG  1 
ATOM   6516 C CD1 . PHE B 1 307 ? 19.503  11.087  -48.101 1.00 51.06  ? 307  PHE B CD1 1 
ATOM   6517 C CD2 . PHE B 1 307 ? 19.187  10.599  -50.417 1.00 52.63  ? 307  PHE B CD2 1 
ATOM   6518 C CE1 . PHE B 1 307 ? 18.134  11.301  -47.951 1.00 50.78  ? 307  PHE B CE1 1 
ATOM   6519 C CE2 . PHE B 1 307 ? 17.823  10.795  -50.272 1.00 51.84  ? 307  PHE B CE2 1 
ATOM   6520 C CZ  . PHE B 1 307 ? 17.298  11.149  -49.034 1.00 51.12  ? 307  PHE B CZ  1 
ATOM   6521 N N   . LEU B 1 308 ? 23.182  11.771  -47.185 1.00 55.71  ? 308  LEU B N   1 
ATOM   6522 C CA  . LEU B 1 308 ? 23.454  12.232  -45.840 1.00 55.60  ? 308  LEU B CA  1 
ATOM   6523 C C   . LEU B 1 308 ? 24.899  12.726  -45.800 1.00 57.14  ? 308  LEU B C   1 
ATOM   6524 O O   . LEU B 1 308 ? 25.828  11.921  -45.811 1.00 56.94  ? 308  LEU B O   1 
ATOM   6525 C CB  . LEU B 1 308 ? 23.259  11.083  -44.841 1.00 54.83  ? 308  LEU B CB  1 
ATOM   6526 C CG  . LEU B 1 308 ? 21.839  10.523  -44.651 1.00 54.38  ? 308  LEU B CG  1 
ATOM   6527 C CD1 . LEU B 1 308 ? 21.854  9.306   -43.711 1.00 52.24  ? 308  LEU B CD1 1 
ATOM   6528 C CD2 . LEU B 1 308 ? 20.882  11.606  -44.138 1.00 53.09  ? 308  LEU B CD2 1 
ATOM   6529 N N   . SER B 1 309 ? 25.072  14.047  -45.756 1.00 58.25  ? 309  SER B N   1 
ATOM   6530 C CA  . SER B 1 309 ? 26.398  14.681  -45.782 1.00 60.23  ? 309  SER B CA  1 
ATOM   6531 C C   . SER B 1 309 ? 27.223  14.438  -44.515 1.00 60.76  ? 309  SER B C   1 
ATOM   6532 O O   . SER B 1 309 ? 28.450  14.529  -44.543 1.00 62.62  ? 309  SER B O   1 
ATOM   6533 C CB  . SER B 1 309 ? 26.242  16.184  -46.006 1.00 60.84  ? 309  SER B CB  1 
ATOM   6534 O OG  . SER B 1 309 ? 25.433  16.759  -44.985 1.00 62.02  ? 309  SER B OG  1 
ATOM   6535 N N   . ASP B 1 310 ? 26.541  14.151  -43.412 1.00 60.13  ? 310  ASP B N   1 
ATOM   6536 C CA  . ASP B 1 310 ? 27.162  13.773  -42.150 1.00 60.52  ? 310  ASP B CA  1 
ATOM   6537 C C   . ASP B 1 310 ? 26.148  12.909  -41.405 1.00 59.49  ? 310  ASP B C   1 
ATOM   6538 O O   . ASP B 1 310 ? 25.071  12.644  -41.935 1.00 58.40  ? 310  ASP B O   1 
ATOM   6539 C CB  . ASP B 1 310 ? 27.499  15.034  -41.349 1.00 61.61  ? 310  ASP B CB  1 
ATOM   6540 C CG  . ASP B 1 310 ? 28.639  14.836  -40.364 1.00 63.24  ? 310  ASP B CG  1 
ATOM   6541 O OD1 . ASP B 1 310 ? 28.941  13.691  -39.983 1.00 64.28  ? 310  ASP B OD1 1 
ATOM   6542 O OD2 . ASP B 1 310 ? 29.236  15.850  -39.959 1.00 67.03  ? 310  ASP B OD2 1 
ATOM   6543 N N   . THR B 1 311 ? 26.465  12.475  -40.187 1.00 59.92  ? 311  THR B N   1 
ATOM   6544 C CA  . THR B 1 311 ? 25.515  11.687  -39.395 1.00 59.46  ? 311  THR B CA  1 
ATOM   6545 C C   . THR B 1 311 ? 24.268  12.528  -39.094 1.00 59.32  ? 311  THR B C   1 
ATOM   6546 O O   . THR B 1 311 ? 24.354  13.752  -39.001 1.00 59.94  ? 311  THR B O   1 
ATOM   6547 C CB  . THR B 1 311 ? 26.122  11.197  -38.060 1.00 59.93  ? 311  THR B CB  1 
ATOM   6548 O OG1 . THR B 1 311 ? 26.436  12.322  -37.241 1.00 60.50  ? 311  THR B OG1 1 
ATOM   6549 C CG2 . THR B 1 311 ? 27.382  10.357  -38.282 1.00 59.79  ? 311  THR B CG2 1 
ATOM   6550 N N   . PRO B 1 312 ? 23.096  11.886  -38.973 1.00 59.36  ? 312  PRO B N   1 
ATOM   6551 C CA  . PRO B 1 312 ? 21.899  12.640  -38.567 1.00 59.31  ? 312  PRO B CA  1 
ATOM   6552 C C   . PRO B 1 312 ? 22.063  13.405  -37.248 1.00 60.34  ? 312  PRO B C   1 
ATOM   6553 O O   . PRO B 1 312 ? 21.527  14.512  -37.116 1.00 59.62  ? 312  PRO B O   1 
ATOM   6554 C CB  . PRO B 1 312 ? 20.831  11.556  -38.440 1.00 58.60  ? 312  PRO B CB  1 
ATOM   6555 C CG  . PRO B 1 312 ? 21.295  10.472  -39.350 1.00 58.20  ? 312  PRO B CG  1 
ATOM   6556 C CD  . PRO B 1 312 ? 22.786  10.472  -39.233 1.00 58.49  ? 312  PRO B CD  1 
ATOM   6557 N N   . GLU B 1 313 ? 22.801  12.824  -36.299 1.00 62.09  ? 313  GLU B N   1 
ATOM   6558 C CA  . GLU B 1 313 ? 23.153  13.513  -35.046 1.00 63.60  ? 313  GLU B CA  1 
ATOM   6559 C C   . GLU B 1 313 ? 23.817  14.854  -35.334 1.00 63.85  ? 313  GLU B C   1 
ATOM   6560 O O   . GLU B 1 313 ? 23.381  15.893  -34.838 1.00 64.13  ? 313  GLU B O   1 
ATOM   6561 C CB  . GLU B 1 313 ? 24.095  12.662  -34.172 1.00 64.27  ? 313  GLU B CB  1 
ATOM   6562 C CG  . GLU B 1 313 ? 24.506  13.382  -32.869 1.00 65.84  ? 313  GLU B CG  1 
ATOM   6563 C CD  . GLU B 1 313 ? 25.335  12.529  -31.895 1.00 68.58  ? 313  GLU B CD  1 
ATOM   6564 O OE1 . GLU B 1 313 ? 24.834  12.252  -30.771 1.00 73.93  ? 313  GLU B OE1 1 
ATOM   6565 O OE2 . GLU B 1 313 ? 26.492  12.171  -32.233 1.00 73.08  ? 313  GLU B OE2 1 
ATOM   6566 N N   . ALA B 1 314 ? 24.877  14.819  -36.131 1.00 64.62  ? 314  ALA B N   1 
ATOM   6567 C CA  . ALA B 1 314 ? 25.598  16.033  -36.519 1.00 65.75  ? 314  ALA B CA  1 
ATOM   6568 C C   . ALA B 1 314 ? 24.687  17.000  -37.259 1.00 65.60  ? 314  ALA B C   1 
ATOM   6569 O O   . ALA B 1 314 ? 24.666  18.195  -36.965 1.00 66.35  ? 314  ALA B O   1 
ATOM   6570 C CB  . ALA B 1 314 ? 26.810  15.688  -37.385 1.00 66.20  ? 314  ALA B CB  1 
ATOM   6571 N N   . LEU B 1 315 ? 23.936  16.478  -38.223 1.00 65.14  ? 315  LEU B N   1 
ATOM   6572 C CA  . LEU B 1 315 ? 23.061  17.307  -39.044 1.00 65.18  ? 315  LEU B CA  1 
ATOM   6573 C C   . LEU B 1 315 ? 21.911  17.957  -38.251 1.00 65.39  ? 315  LEU B C   1 
ATOM   6574 O O   . LEU B 1 315 ? 21.536  19.107  -38.529 1.00 65.72  ? 315  LEU B O   1 
ATOM   6575 C CB  . LEU B 1 315 ? 22.516  16.493  -40.219 1.00 64.34  ? 315  LEU B CB  1 
ATOM   6576 C CG  . LEU B 1 315 ? 23.548  16.055  -41.255 1.00 64.21  ? 315  LEU B CG  1 
ATOM   6577 C CD1 . LEU B 1 315 ? 22.904  15.138  -42.292 1.00 60.96  ? 315  LEU B CD1 1 
ATOM   6578 C CD2 . LEU B 1 315 ? 24.191  17.293  -41.905 1.00 64.97  ? 315  LEU B CD2 1 
ATOM   6579 N N   . ILE B 1 316 ? 21.353  17.253  -37.270 1.00 65.46  ? 316  ILE B N   1 
ATOM   6580 C CA  . ILE B 1 316 ? 20.282  17.863  -36.474 1.00 66.17  ? 316  ILE B CA  1 
ATOM   6581 C C   . ILE B 1 316 ? 20.841  18.902  -35.499 1.00 67.75  ? 316  ILE B C   1 
ATOM   6582 O O   . ILE B 1 316 ? 20.176  19.892  -35.219 1.00 67.86  ? 316  ILE B O   1 
ATOM   6583 C CB  . ILE B 1 316 ? 19.351  16.840  -35.740 1.00 65.22  ? 316  ILE B CB  1 
ATOM   6584 C CG1 . ILE B 1 316 ? 20.044  16.159  -34.562 1.00 66.04  ? 316  ILE B CG1 1 
ATOM   6585 C CG2 . ILE B 1 316 ? 18.797  15.789  -36.711 1.00 63.78  ? 316  ILE B CG2 1 
ATOM   6586 C CD1 . ILE B 1 316 ? 19.113  15.252  -33.762 1.00 64.84  ? 316  ILE B CD1 1 
ATOM   6587 N N   . ASN B 1 317 ? 22.059  18.689  -35.005 1.00 69.53  ? 317  ASN B N   1 
ATOM   6588 C CA  . ASN B 1 317 ? 22.684  19.646  -34.079 1.00 71.32  ? 317  ASN B CA  1 
ATOM   6589 C C   . ASN B 1 317 ? 23.042  20.974  -34.752 1.00 72.74  ? 317  ASN B C   1 
ATOM   6590 O O   . ASN B 1 317 ? 22.942  22.022  -34.129 1.00 73.91  ? 317  ASN B O   1 
ATOM   6591 C CB  . ASN B 1 317 ? 23.944  19.064  -33.415 1.00 72.07  ? 317  ASN B CB  1 
ATOM   6592 C CG  . ASN B 1 317 ? 23.653  17.853  -32.520 1.00 72.59  ? 317  ASN B CG  1 
ATOM   6593 O OD1 . ASN B 1 317 ? 22.503  17.482  -32.291 1.00 74.80  ? 317  ASN B OD1 1 
ATOM   6594 N ND2 . ASN B 1 317 ? 24.714  17.223  -32.023 1.00 74.32  ? 317  ASN B ND2 1 
ATOM   6595 N N   . THR B 1 318 ? 23.448  20.936  -36.018 1.00 73.35  ? 318  THR B N   1 
ATOM   6596 C CA  . THR B 1 318 ? 23.966  22.125  -36.694 1.00 74.64  ? 318  THR B CA  1 
ATOM   6597 C C   . THR B 1 318 ? 23.030  22.712  -37.752 1.00 74.51  ? 318  THR B C   1 
ATOM   6598 O O   . THR B 1 318 ? 23.361  23.720  -38.369 1.00 75.86  ? 318  THR B O   1 
ATOM   6599 C CB  . THR B 1 318 ? 25.327  21.821  -37.369 1.00 75.70  ? 318  THR B CB  1 
ATOM   6600 O OG1 . THR B 1 318 ? 25.145  20.891  -38.448 1.00 74.80  ? 318  THR B OG1 1 
ATOM   6601 C CG2 . THR B 1 318 ? 26.312  21.244  -36.350 1.00 76.52  ? 318  THR B CG2 1 
ATOM   6602 N N   . GLY B 1 319 ? 21.875  22.094  -37.977 1.00 73.35  ? 319  GLY B N   1 
ATOM   6603 C CA  . GLY B 1 319 ? 20.965  22.544  -39.040 1.00 73.07  ? 319  GLY B CA  1 
ATOM   6604 C C   . GLY B 1 319 ? 20.191  23.815  -38.713 1.00 73.43  ? 319  GLY B C   1 
ATOM   6605 O O   . GLY B 1 319 ? 19.966  24.132  -37.548 1.00 73.32  ? 319  GLY B O   1 
ATOM   6606 N N   . ASP B 1 320 ? 19.801  24.548  -39.753 1.00 74.09  ? 320  ASP B N   1 
ATOM   6607 C CA  . ASP B 1 320 ? 18.885  25.682  -39.620 1.00 74.48  ? 320  ASP B CA  1 
ATOM   6608 C C   . ASP B 1 320 ? 17.517  25.214  -40.102 1.00 73.04  ? 320  ASP B C   1 
ATOM   6609 O O   . ASP B 1 320 ? 17.352  24.885  -41.280 1.00 72.58  ? 320  ASP B O   1 
ATOM   6610 C CB  . ASP B 1 320 ? 19.353  26.870  -40.464 1.00 76.30  ? 320  ASP B CB  1 
ATOM   6611 C CG  . ASP B 1 320 ? 18.443  28.105  -40.330 1.00 77.72  ? 320  ASP B CG  1 
ATOM   6612 O OD1 . ASP B 1 320 ? 17.468  28.083  -39.541 1.00 78.05  ? 320  ASP B OD1 1 
ATOM   6613 O OD2 . ASP B 1 320 ? 18.724  29.115  -41.020 1.00 81.47  ? 320  ASP B OD2 1 
ATOM   6614 N N   . PHE B 1 321 ? 16.546  25.199  -39.187 1.00 71.95  ? 321  PHE B N   1 
ATOM   6615 C CA  . PHE B 1 321 ? 15.217  24.643  -39.462 1.00 70.33  ? 321  PHE B CA  1 
ATOM   6616 C C   . PHE B 1 321 ? 14.112  25.689  -39.344 1.00 70.80  ? 321  PHE B C   1 
ATOM   6617 O O   . PHE B 1 321 ? 12.959  25.356  -39.115 1.00 69.81  ? 321  PHE B O   1 
ATOM   6618 C CB  . PHE B 1 321 ? 14.969  23.456  -38.531 1.00 68.69  ? 321  PHE B CB  1 
ATOM   6619 C CG  . PHE B 1 321 ? 15.958  22.338  -38.717 1.00 67.51  ? 321  PHE B CG  1 
ATOM   6620 C CD1 . PHE B 1 321 ? 15.999  21.621  -39.910 1.00 66.96  ? 321  PHE B CD1 1 
ATOM   6621 C CD2 . PHE B 1 321 ? 16.863  22.013  -37.718 1.00 67.38  ? 321  PHE B CD2 1 
ATOM   6622 C CE1 . PHE B 1 321 ? 16.916  20.596  -40.098 1.00 65.93  ? 321  PHE B CE1 1 
ATOM   6623 C CE2 . PHE B 1 321 ? 17.782  20.987  -37.905 1.00 67.31  ? 321  PHE B CE2 1 
ATOM   6624 C CZ  . PHE B 1 321 ? 17.804  20.279  -39.099 1.00 66.05  ? 321  PHE B CZ  1 
ATOM   6625 N N   . GLN B 1 322 ? 14.470  26.950  -39.566 1.00 72.25  ? 322  GLN B N   1 
ATOM   6626 C CA  . GLN B 1 322 ? 13.559  28.079  -39.347 1.00 73.45  ? 322  GLN B CA  1 
ATOM   6627 C C   . GLN B 1 322 ? 12.262  28.033  -40.155 1.00 72.73  ? 322  GLN B C   1 
ATOM   6628 O O   . GLN B 1 322 ? 11.209  28.429  -39.650 1.00 73.24  ? 322  GLN B O   1 
ATOM   6629 C CB  . GLN B 1 322 ? 14.275  29.404  -39.609 1.00 75.04  ? 322  GLN B CB  1 
ATOM   6630 C CG  . GLN B 1 322 ? 15.079  29.898  -38.417 1.00 76.85  ? 322  GLN B CG  1 
ATOM   6631 C CD  . GLN B 1 322 ? 15.977  31.083  -38.756 1.00 78.82  ? 322  GLN B CD  1 
ATOM   6632 O OE1 . GLN B 1 322 ? 15.900  32.128  -38.115 1.00 82.43  ? 322  GLN B OE1 1 
ATOM   6633 N NE2 . GLN B 1 322 ? 16.833  30.920  -39.764 1.00 80.66  ? 322  GLN B NE2 1 
ATOM   6634 N N   . ASP B 1 323 ? 12.318  27.549  -41.393 1.00 71.78  ? 323  ASP B N   1 
ATOM   6635 C CA  . ASP B 1 323 ? 11.116  27.544  -42.246 1.00 71.29  ? 323  ASP B CA  1 
ATOM   6636 C C   . ASP B 1 323 ? 10.381  26.198  -42.220 1.00 68.17  ? 323  ASP B C   1 
ATOM   6637 O O   . ASP B 1 323 ? 9.633   25.876  -43.143 1.00 68.22  ? 323  ASP B O   1 
ATOM   6638 C CB  . ASP B 1 323 ? 11.474  27.958  -43.687 1.00 72.62  ? 323  ASP B CB  1 
ATOM   6639 C CG  . ASP B 1 323 ? 11.707  29.483  -43.840 1.00 76.90  ? 323  ASP B CG  1 
ATOM   6640 O OD1 . ASP B 1 323 ? 11.366  30.282  -42.921 1.00 79.88  ? 323  ASP B OD1 1 
ATOM   6641 O OD2 . ASP B 1 323 ? 12.229  29.885  -44.911 1.00 81.37  ? 323  ASP B OD2 1 
ATOM   6642 N N   . LEU B 1 324 ? 10.571  25.434  -41.146 1.00 65.06  ? 324  LEU B N   1 
ATOM   6643 C CA  . LEU B 1 324 ? 10.044  24.079  -41.048 1.00 62.01  ? 324  LEU B CA  1 
ATOM   6644 C C   . LEU B 1 324 ? 8.998   23.948  -39.944 1.00 59.63  ? 324  LEU B C   1 
ATOM   6645 O O   . LEU B 1 324 ? 9.183   24.475  -38.847 1.00 59.31  ? 324  LEU B O   1 
ATOM   6646 C CB  . LEU B 1 324 ? 11.191  23.109  -40.761 1.00 61.54  ? 324  LEU B CB  1 
ATOM   6647 C CG  . LEU B 1 324 ? 10.877  21.616  -40.907 1.00 60.48  ? 324  LEU B CG  1 
ATOM   6648 C CD1 . LEU B 1 324 ? 10.598  21.270  -42.356 1.00 61.04  ? 324  LEU B CD1 1 
ATOM   6649 C CD2 . LEU B 1 324 ? 12.018  20.794  -40.359 1.00 60.37  ? 324  LEU B CD2 1 
ATOM   6650 N N   . GLN B 1 325 ? 7.907   23.244  -40.246 1.00 56.98  ? 325  GLN B N   1 
ATOM   6651 C CA  . GLN B 1 325 ? 6.951   22.823  -39.233 1.00 55.35  ? 325  GLN B CA  1 
ATOM   6652 C C   . GLN B 1 325 ? 6.924   21.312  -39.190 1.00 53.19  ? 325  GLN B C   1 
ATOM   6653 O O   . GLN B 1 325 ? 6.811   20.675  -40.236 1.00 51.73  ? 325  GLN B O   1 
ATOM   6654 C CB  . GLN B 1 325 ? 5.542   23.336  -39.511 1.00 55.89  ? 325  GLN B CB  1 
ATOM   6655 C CG  . GLN B 1 325 ? 5.424   24.846  -39.690 1.00 57.61  ? 325  GLN B CG  1 
ATOM   6656 C CD  . GLN B 1 325 ? 5.382   25.257  -41.133 1.00 59.58  ? 325  GLN B CD  1 
ATOM   6657 O OE1 . GLN B 1 325 ? 4.652   24.684  -41.931 1.00 59.96  ? 325  GLN B OE1 1 
ATOM   6658 N NE2 . GLN B 1 325 ? 6.174   26.259  -41.485 1.00 64.12  ? 325  GLN B NE2 1 
ATOM   6659 N N   . VAL B 1 326 ? 7.015   20.759  -37.977 1.00 52.03  ? 326  VAL B N   1 
ATOM   6660 C CA  . VAL B 1 326 ? 7.078   19.314  -37.760 1.00 51.29  ? 326  VAL B CA  1 
ATOM   6661 C C   . VAL B 1 326 ? 6.130   18.855  -36.650 1.00 50.55  ? 326  VAL B C   1 
ATOM   6662 O O   . VAL B 1 326 ? 6.058   19.460  -35.585 1.00 50.88  ? 326  VAL B O   1 
ATOM   6663 C CB  . VAL B 1 326 ? 8.513   18.838  -37.396 1.00 51.21  ? 326  VAL B CB  1 
ATOM   6664 C CG1 . VAL B 1 326 ? 8.608   17.314  -37.469 1.00 51.03  ? 326  VAL B CG1 1 
ATOM   6665 C CG2 . VAL B 1 326 ? 9.546   19.441  -38.322 1.00 52.08  ? 326  VAL B CG2 1 
ATOM   6666 N N   . LEU B 1 327 ? 5.424   17.764  -36.916 1.00 49.82  ? 327  LEU B N   1 
ATOM   6667 C CA  . LEU B 1 327 ? 4.615   17.046  -35.929 1.00 49.43  ? 327  LEU B CA  1 
ATOM   6668 C C   . LEU B 1 327 ? 5.290   15.702  -35.617 1.00 48.29  ? 327  LEU B C   1 
ATOM   6669 O O   . LEU B 1 327 ? 5.485   14.895  -36.519 1.00 47.55  ? 327  LEU B O   1 
ATOM   6670 C CB  . LEU B 1 327 ? 3.209   16.806  -36.490 1.00 49.74  ? 327  LEU B CB  1 
ATOM   6671 C CG  . LEU B 1 327 ? 2.212   15.960  -35.696 1.00 50.34  ? 327  LEU B CG  1 
ATOM   6672 C CD1 . LEU B 1 327 ? 1.914   16.619  -34.365 1.00 52.44  ? 327  LEU B CD1 1 
ATOM   6673 C CD2 . LEU B 1 327 ? 0.925   15.782  -36.502 1.00 50.22  ? 327  LEU B CD2 1 
ATOM   6674 N N   . VAL B 1 328 ? 5.631   15.470  -34.349 1.00 47.39  ? 328  VAL B N   1 
ATOM   6675 C CA  . VAL B 1 328 ? 6.338   14.270  -33.939 1.00 47.29  ? 328  VAL B CA  1 
ATOM   6676 C C   . VAL B 1 328 ? 5.641   13.616  -32.753 1.00 47.38  ? 328  VAL B C   1 
ATOM   6677 O O   . VAL B 1 328 ? 5.009   14.297  -31.949 1.00 48.36  ? 328  VAL B O   1 
ATOM   6678 C CB  . VAL B 1 328 ? 7.821   14.576  -33.558 1.00 47.44  ? 328  VAL B CB  1 
ATOM   6679 C CG1 . VAL B 1 328 ? 8.540   15.251  -34.712 1.00 48.53  ? 328  VAL B CG1 1 
ATOM   6680 C CG2 . VAL B 1 328 ? 7.897   15.481  -32.349 1.00 47.58  ? 328  VAL B CG2 1 
ATOM   6681 N N   . GLY B 1 329 ? 5.741   12.296  -32.642 1.00 46.50  ? 329  GLY B N   1 
ATOM   6682 C CA  . GLY B 1 329 ? 5.270   11.645  -31.448 1.00 46.49  ? 329  GLY B CA  1 
ATOM   6683 C C   . GLY B 1 329 ? 5.526   10.169  -31.383 1.00 46.03  ? 329  GLY B C   1 
ATOM   6684 O O   . GLY B 1 329 ? 6.169   9.599   -32.252 1.00 45.94  ? 329  GLY B O   1 
ATOM   6685 N N   . VAL B 1 330 ? 4.974   9.555   -30.345 1.00 46.20  ? 330  VAL B N   1 
ATOM   6686 C CA  . VAL B 1 330 ? 5.202   8.165   -30.027 1.00 45.93  ? 330  VAL B CA  1 
ATOM   6687 C C   . VAL B 1 330 ? 3.919   7.545   -29.498 1.00 47.35  ? 330  VAL B C   1 
ATOM   6688 O O   . VAL B 1 330 ? 3.005   8.260   -29.075 1.00 47.79  ? 330  VAL B O   1 
ATOM   6689 C CB  . VAL B 1 330 ? 6.281   8.038   -28.938 1.00 46.31  ? 330  VAL B CB  1 
ATOM   6690 C CG1 . VAL B 1 330 ? 7.596   8.658   -29.405 1.00 44.36  ? 330  VAL B CG1 1 
ATOM   6691 C CG2 . VAL B 1 330 ? 5.811   8.695   -27.612 1.00 45.61  ? 330  VAL B CG2 1 
ATOM   6692 N N   . VAL B 1 331 ? 3.849   6.216   -29.526 1.00 47.70  ? 331  VAL B N   1 
ATOM   6693 C CA  . VAL B 1 331 ? 2.779   5.491   -28.850 1.00 49.08  ? 331  VAL B CA  1 
ATOM   6694 C C   . VAL B 1 331 ? 3.219   5.129   -27.441 1.00 50.30  ? 331  VAL B C   1 
ATOM   6695 O O   . VAL B 1 331 ? 4.398   5.233   -27.092 1.00 49.70  ? 331  VAL B O   1 
ATOM   6696 C CB  . VAL B 1 331 ? 2.363   4.201   -29.603 1.00 49.07  ? 331  VAL B CB  1 
ATOM   6697 C CG1 . VAL B 1 331 ? 1.815   4.562   -30.976 1.00 47.86  ? 331  VAL B CG1 1 
ATOM   6698 C CG2 . VAL B 1 331 ? 3.531   3.214   -29.697 1.00 47.83  ? 331  VAL B CG2 1 
ATOM   6699 N N   . LYS B 1 332 ? 2.259   4.676   -26.647 1.00 51.84  ? 332  LYS B N   1 
ATOM   6700 C CA  . LYS B 1 332 ? 2.485   4.447   -25.227 1.00 53.27  ? 332  LYS B CA  1 
ATOM   6701 C C   . LYS B 1 332 ? 3.460   3.312   -24.963 1.00 52.81  ? 332  LYS B C   1 
ATOM   6702 O O   . LYS B 1 332 ? 4.257   3.389   -24.028 1.00 53.44  ? 332  LYS B O   1 
ATOM   6703 C CB  . LYS B 1 332 ? 1.161   4.171   -24.521 1.00 54.13  ? 332  LYS B CB  1 
ATOM   6704 C CG  . LYS B 1 332 ? 1.214   4.333   -23.006 1.00 55.70  ? 332  LYS B CG  1 
ATOM   6705 C CD  . LYS B 1 332 ? -0.205  4.203   -22.425 1.00 58.00  ? 332  LYS B CD  1 
ATOM   6706 C CE  . LYS B 1 332 ? -0.197  4.010   -20.910 1.00 60.97  ? 332  LYS B CE  1 
ATOM   6707 N NZ  . LYS B 1 332 ? 0.400   5.207   -20.254 1.00 64.61  ? 332  LYS B NZ  1 
ATOM   6708 N N   . ASP B 1 333 ? 3.416   2.271   -25.786 1.00 52.67  ? 333  ASP B N   1 
ATOM   6709 C CA  . ASP B 1 333 ? 4.251   1.080   -25.564 1.00 52.84  ? 333  ASP B CA  1 
ATOM   6710 C C   . ASP B 1 333 ? 5.094   0.679   -26.771 1.00 51.72  ? 333  ASP B C   1 
ATOM   6711 O O   . ASP B 1 333 ? 4.980   -0.416  -27.279 1.00 52.52  ? 333  ASP B O   1 
ATOM   6712 C CB  . ASP B 1 333 ? 3.360   -0.065  -25.086 1.00 54.08  ? 333  ASP B CB  1 
ATOM   6713 C CG  . ASP B 1 333 ? 2.620   0.293   -23.828 1.00 55.03  ? 333  ASP B CG  1 
ATOM   6714 O OD1 . ASP B 1 333 ? 1.421   0.665   -23.910 1.00 54.52  ? 333  ASP B OD1 1 
ATOM   6715 O OD2 . ASP B 1 333 ? 3.265   0.250   -22.759 1.00 54.88  ? 333  ASP B OD2 1 
ATOM   6716 N N   . GLU B 1 334 ? 5.992   1.573   -27.172 1.00 51.02  ? 334  GLU B N   1 
ATOM   6717 C CA  . GLU B 1 334 ? 6.833   1.393   -28.346 1.00 50.10  ? 334  GLU B CA  1 
ATOM   6718 C C   . GLU B 1 334 ? 7.632   0.080   -28.365 1.00 50.52  ? 334  GLU B C   1 
ATOM   6719 O O   . GLU B 1 334 ? 7.853   -0.491  -29.428 1.00 50.50  ? 334  GLU B O   1 
ATOM   6720 C CB  . GLU B 1 334 ? 7.828   2.551   -28.468 1.00 49.65  ? 334  GLU B CB  1 
ATOM   6721 C CG  . GLU B 1 334 ? 7.224   3.927   -28.828 1.00 49.44  ? 334  GLU B CG  1 
ATOM   6722 C CD  . GLU B 1 334 ? 6.694   4.026   -30.269 1.00 50.15  ? 334  GLU B CD  1 
ATOM   6723 O OE1 . GLU B 1 334 ? 6.979   3.116   -31.085 1.00 48.38  ? 334  GLU B OE1 1 
ATOM   6724 O OE2 . GLU B 1 334 ? 6.004   5.036   -30.590 1.00 49.57  ? 334  GLU B OE2 1 
ATOM   6725 N N   . GLY B 1 335 ? 8.086   -0.393  -27.213 1.00 50.91  ? 335  GLY B N   1 
ATOM   6726 C CA  . GLY B 1 335 ? 9.029   -1.524  -27.188 1.00 51.70  ? 335  GLY B CA  1 
ATOM   6727 C C   . GLY B 1 335 ? 8.442   -2.932  -27.174 1.00 52.51  ? 335  GLY B C   1 
ATOM   6728 O O   . GLY B 1 335 ? 9.136   -3.889  -27.510 1.00 53.04  ? 335  GLY B O   1 
ATOM   6729 N N   . SER B 1 336 ? 7.176   -3.057  -26.788 1.00 53.37  ? 336  SER B N   1 
ATOM   6730 C CA  . SER B 1 336 ? 6.571   -4.361  -26.455 1.00 55.21  ? 336  SER B CA  1 
ATOM   6731 C C   . SER B 1 336 ? 6.543   -5.360  -27.615 1.00 56.54  ? 336  SER B C   1 
ATOM   6732 O O   . SER B 1 336 ? 6.823   -6.552  -27.432 1.00 57.88  ? 336  SER B O   1 
ATOM   6733 C CB  . SER B 1 336 ? 5.143   -4.168  -25.908 1.00 55.44  ? 336  SER B CB  1 
ATOM   6734 O OG  . SER B 1 336 ? 4.274   -3.577  -26.862 1.00 53.90  ? 336  SER B OG  1 
ATOM   6735 N N   . TYR B 1 337 ? 6.186   -4.861  -28.794 1.00 56.71  ? 337  TYR B N   1 
ATOM   6736 C CA  . TYR B 1 337 ? 6.121   -5.649  -30.019 1.00 58.16  ? 337  TYR B CA  1 
ATOM   6737 C C   . TYR B 1 337 ? 7.380   -6.468  -30.259 1.00 58.12  ? 337  TYR B C   1 
ATOM   6738 O O   . TYR B 1 337 ? 7.310   -7.637  -30.638 1.00 59.17  ? 337  TYR B O   1 
ATOM   6739 C CB  . TYR B 1 337 ? 5.925   -4.691  -31.208 1.00 58.67  ? 337  TYR B CB  1 
ATOM   6740 C CG  . TYR B 1 337 ? 5.564   -5.340  -32.513 1.00 60.29  ? 337  TYR B CG  1 
ATOM   6741 C CD1 . TYR B 1 337 ? 4.240   -5.365  -32.935 1.00 62.50  ? 337  TYR B CD1 1 
ATOM   6742 C CD2 . TYR B 1 337 ? 6.535   -5.910  -33.342 1.00 61.99  ? 337  TYR B CD2 1 
ATOM   6743 C CE1 . TYR B 1 337 ? 3.874   -5.955  -34.142 1.00 62.68  ? 337  TYR B CE1 1 
ATOM   6744 C CE2 . TYR B 1 337 ? 6.175   -6.518  -34.565 1.00 62.44  ? 337  TYR B CE2 1 
ATOM   6745 C CZ  . TYR B 1 337 ? 4.835   -6.523  -34.952 1.00 62.08  ? 337  TYR B CZ  1 
ATOM   6746 O OH  . TYR B 1 337 ? 4.418   -7.093  -36.139 1.00 63.41  ? 337  TYR B OH  1 
ATOM   6747 N N   . PHE B 1 338 ? 8.529   -5.837  -30.050 1.00 57.01  ? 338  PHE B N   1 
ATOM   6748 C CA  . PHE B 1 338 ? 9.816   -6.387  -30.469 1.00 56.95  ? 338  PHE B CA  1 
ATOM   6749 C C   . PHE B 1 338 ? 10.355  -7.461  -29.556 1.00 57.46  ? 338  PHE B C   1 
ATOM   6750 O O   . PHE B 1 338 ? 11.261  -8.190  -29.941 1.00 57.71  ? 338  PHE B O   1 
ATOM   6751 C CB  . PHE B 1 338 ? 10.853  -5.268  -30.553 1.00 56.40  ? 338  PHE B CB  1 
ATOM   6752 C CG  . PHE B 1 338 ? 10.534  -4.242  -31.582 1.00 55.87  ? 338  PHE B CG  1 
ATOM   6753 C CD1 . PHE B 1 338 ? 9.733   -3.147  -31.265 1.00 55.78  ? 338  PHE B CD1 1 
ATOM   6754 C CD2 . PHE B 1 338 ? 11.012  -4.378  -32.878 1.00 54.91  ? 338  PHE B CD2 1 
ATOM   6755 C CE1 . PHE B 1 338 ? 9.425   -2.210  -32.220 1.00 55.24  ? 338  PHE B CE1 1 
ATOM   6756 C CE2 . PHE B 1 338 ? 10.708  -3.437  -33.842 1.00 54.55  ? 338  PHE B CE2 1 
ATOM   6757 C CZ  . PHE B 1 338 ? 9.922   -2.353  -33.519 1.00 54.11  ? 338  PHE B CZ  1 
ATOM   6758 N N   . LEU B 1 339 ? 9.806   -7.550  -28.350 1.00 57.78  ? 339  LEU B N   1 
ATOM   6759 C CA  . LEU B 1 339 ? 10.329  -8.444  -27.323 1.00 59.02  ? 339  LEU B CA  1 
ATOM   6760 C C   . LEU B 1 339 ? 10.073  -9.903  -27.656 1.00 60.69  ? 339  LEU B C   1 
ATOM   6761 O O   . LEU B 1 339 ? 10.880  -10.758 -27.317 1.00 61.77  ? 339  LEU B O   1 
ATOM   6762 C CB  . LEU B 1 339 ? 9.719   -8.100  -25.955 1.00 59.19  ? 339  LEU B CB  1 
ATOM   6763 C CG  . LEU B 1 339 ? 10.004  -6.702  -25.390 1.00 56.97  ? 339  LEU B CG  1 
ATOM   6764 C CD1 . LEU B 1 339 ? 9.362   -6.551  -24.028 1.00 55.64  ? 339  LEU B CD1 1 
ATOM   6765 C CD2 . LEU B 1 339 ? 11.492  -6.443  -25.316 1.00 56.10  ? 339  LEU B CD2 1 
ATOM   6766 N N   . VAL B 1 340 ? 8.955   -10.178 -28.326 1.00 61.49  ? 340  VAL B N   1 
ATOM   6767 C CA  . VAL B 1 340 ? 8.600   -11.544 -28.748 1.00 63.71  ? 340  VAL B CA  1 
ATOM   6768 C C   . VAL B 1 340 ? 9.445   -12.078 -29.919 1.00 64.13  ? 340  VAL B C   1 
ATOM   6769 O O   . VAL B 1 340 ? 9.346   -13.241 -30.263 1.00 65.88  ? 340  VAL B O   1 
ATOM   6770 C CB  . VAL B 1 340 ? 7.089   -11.648 -29.093 1.00 63.65  ? 340  VAL B CB  1 
ATOM   6771 C CG1 . VAL B 1 340 ? 6.262   -11.333 -27.860 1.00 64.21  ? 340  VAL B CG1 1 
ATOM   6772 C CG2 . VAL B 1 340 ? 6.701   -10.698 -30.236 1.00 61.94  ? 340  VAL B CG2 1 
ATOM   6773 N N   . TYR B 1 341 ? 10.289  -11.228 -30.500 1.00 63.94  ? 341  TYR B N   1 
ATOM   6774 C CA  . TYR B 1 341 ? 11.154  -11.592 -31.621 1.00 64.46  ? 341  TYR B CA  1 
ATOM   6775 C C   . TYR B 1 341 ? 12.610  -11.843 -31.221 1.00 65.87  ? 341  TYR B C   1 
ATOM   6776 O O   . TYR B 1 341 ? 13.501  -11.779 -32.072 1.00 66.46  ? 341  TYR B O   1 
ATOM   6777 C CB  . TYR B 1 341 ? 11.147  -10.465 -32.661 1.00 63.31  ? 341  TYR B CB  1 
ATOM   6778 C CG  . TYR B 1 341 ? 9.918   -10.435 -33.517 1.00 63.61  ? 341  TYR B CG  1 
ATOM   6779 C CD1 . TYR B 1 341 ? 8.846   -9.601  -33.209 1.00 62.46  ? 341  TYR B CD1 1 
ATOM   6780 C CD2 . TYR B 1 341 ? 9.822   -11.248 -34.639 1.00 63.60  ? 341  TYR B CD2 1 
ATOM   6781 C CE1 . TYR B 1 341 ? 7.703   -9.583  -34.007 1.00 62.85  ? 341  TYR B CE1 1 
ATOM   6782 C CE2 . TYR B 1 341 ? 8.697   -11.229 -35.444 1.00 64.37  ? 341  TYR B CE2 1 
ATOM   6783 C CZ  . TYR B 1 341 ? 7.639   -10.392 -35.133 1.00 63.43  ? 341  TYR B CZ  1 
ATOM   6784 O OH  . TYR B 1 341 ? 6.520   -10.391 -35.938 1.00 63.84  ? 341  TYR B OH  1 
ATOM   6785 N N   . GLY B 1 342 ? 12.887  -12.114 -29.955 1.00 67.03  ? 342  GLY B N   1 
ATOM   6786 C CA  . GLY B 1 342 ? 14.288  -12.289 -29.565 1.00 67.76  ? 342  GLY B CA  1 
ATOM   6787 C C   . GLY B 1 342 ? 14.641  -12.436 -28.103 1.00 68.25  ? 342  GLY B C   1 
ATOM   6788 O O   . GLY B 1 342 ? 15.692  -13.013 -27.788 1.00 70.20  ? 342  GLY B O   1 
ATOM   6789 N N   . VAL B 1 343 ? 13.800  -11.914 -27.213 1.00 67.30  ? 343  VAL B N   1 
ATOM   6790 C CA  . VAL B 1 343 ? 14.080  -11.963 -25.774 1.00 67.53  ? 343  VAL B CA  1 
ATOM   6791 C C   . VAL B 1 343 ? 13.411  -13.172 -25.126 1.00 68.60  ? 343  VAL B C   1 
ATOM   6792 O O   . VAL B 1 343 ? 12.185  -13.262 -25.104 1.00 68.24  ? 343  VAL B O   1 
ATOM   6793 C CB  . VAL B 1 343 ? 13.612  -10.681 -25.052 1.00 66.31  ? 343  VAL B CB  1 
ATOM   6794 C CG1 . VAL B 1 343 ? 14.072  -10.698 -23.594 1.00 66.20  ? 343  VAL B CG1 1 
ATOM   6795 C CG2 . VAL B 1 343 ? 14.140  -9.450  -25.777 1.00 64.67  ? 343  VAL B CG2 1 
ATOM   6796 N N   . PRO B 1 344 ? 14.214  -14.109 -24.598 1.00 70.03  ? 344  PRO B N   1 
ATOM   6797 C CA  . PRO B 1 344 ? 13.599  -15.266 -23.947 1.00 71.60  ? 344  PRO B CA  1 
ATOM   6798 C C   . PRO B 1 344 ? 12.674  -14.864 -22.797 1.00 71.32  ? 344  PRO B C   1 
ATOM   6799 O O   . PRO B 1 344 ? 13.004  -13.951 -22.026 1.00 70.17  ? 344  PRO B O   1 
ATOM   6800 C CB  . PRO B 1 344 ? 14.803  -16.070 -23.435 1.00 73.16  ? 344  PRO B CB  1 
ATOM   6801 C CG  . PRO B 1 344 ? 15.939  -15.659 -24.324 1.00 72.52  ? 344  PRO B CG  1 
ATOM   6802 C CD  . PRO B 1 344 ? 15.686  -14.195 -24.593 1.00 70.73  ? 344  PRO B CD  1 
ATOM   6803 N N   . GLY B 1 345 ? 11.526  -15.538 -22.714 1.00 71.67  ? 345  GLY B N   1 
ATOM   6804 C CA  . GLY B 1 345 ? 10.511  -15.270 -21.697 1.00 71.62  ? 345  GLY B CA  1 
ATOM   6805 C C   . GLY B 1 345 ? 9.281   -14.553 -22.232 1.00 70.35  ? 345  GLY B C   1 
ATOM   6806 O O   . GLY B 1 345 ? 8.241   -14.504 -21.556 1.00 70.79  ? 345  GLY B O   1 
ATOM   6807 N N   . PHE B 1 346 ? 9.386   -14.002 -23.444 1.00 68.78  ? 346  PHE B N   1 
ATOM   6808 C CA  . PHE B 1 346 ? 8.314   -13.176 -24.017 1.00 67.34  ? 346  PHE B CA  1 
ATOM   6809 C C   . PHE B 1 346 ? 7.565   -13.902 -25.123 1.00 68.06  ? 346  PHE B C   1 
ATOM   6810 O O   . PHE B 1 346 ? 8.178   -14.584 -25.951 1.00 68.80  ? 346  PHE B O   1 
ATOM   6811 C CB  . PHE B 1 346 ? 8.886   -11.860 -24.535 1.00 65.09  ? 346  PHE B CB  1 
ATOM   6812 C CG  . PHE B 1 346 ? 9.321   -10.940 -23.440 1.00 64.23  ? 346  PHE B CG  1 
ATOM   6813 C CD1 . PHE B 1 346 ? 10.596  -11.013 -22.923 1.00 64.01  ? 346  PHE B CD1 1 
ATOM   6814 C CD2 . PHE B 1 346 ? 8.436   -10.029 -22.893 1.00 63.79  ? 346  PHE B CD2 1 
ATOM   6815 C CE1 . PHE B 1 346 ? 10.989  -10.190 -21.896 1.00 63.33  ? 346  PHE B CE1 1 
ATOM   6816 C CE2 . PHE B 1 346 ? 8.828   -9.199  -21.875 1.00 63.61  ? 346  PHE B CE2 1 
ATOM   6817 C CZ  . PHE B 1 346 ? 10.109  -9.280  -21.375 1.00 63.60  ? 346  PHE B CZ  1 
ATOM   6818 N N   . SER B 1 347 ? 6.240   -13.749 -25.116 1.00 68.06  ? 347  SER B N   1 
ATOM   6819 C CA  . SER B 1 347 ? 5.360   -14.376 -26.093 1.00 68.73  ? 347  SER B CA  1 
ATOM   6820 C C   . SER B 1 347 ? 4.011   -13.685 -26.082 1.00 68.13  ? 347  SER B C   1 
ATOM   6821 O O   . SER B 1 347 ? 3.586   -13.185 -25.046 1.00 68.15  ? 347  SER B O   1 
ATOM   6822 C CB  . SER B 1 347 ? 5.173   -15.863 -25.765 1.00 70.97  ? 347  SER B CB  1 
ATOM   6823 O OG  . SER B 1 347 ? 4.033   -16.410 -26.428 1.00 72.48  ? 347  SER B OG  1 
ATOM   6824 N N   . LYS B 1 348 ? 3.337   -13.670 -27.229 1.00 67.90  ? 348  LYS B N   1 
ATOM   6825 C CA  . LYS B 1 348 ? 1.989   -13.114 -27.323 1.00 68.07  ? 348  LYS B CA  1 
ATOM   6826 C C   . LYS B 1 348 ? 0.970   -14.001 -26.611 1.00 70.22  ? 348  LYS B C   1 
ATOM   6827 O O   . LYS B 1 348 ? -0.123  -13.540 -26.269 1.00 70.40  ? 348  LYS B O   1 
ATOM   6828 C CB  . LYS B 1 348 ? 1.559   -12.957 -28.792 1.00 67.61  ? 348  LYS B CB  1 
ATOM   6829 C CG  . LYS B 1 348 ? 0.951   -14.233 -29.420 1.00 69.28  ? 348  LYS B CG  1 
ATOM   6830 C CD  . LYS B 1 348 ? 0.444   -14.004 -30.830 1.00 68.79  ? 348  LYS B CD  1 
ATOM   6831 C CE  . LYS B 1 348 ? -0.348  -15.194 -31.345 1.00 70.71  ? 348  LYS B CE  1 
ATOM   6832 N NZ  . LYS B 1 348 ? -1.631  -15.411 -30.596 1.00 72.76  ? 348  LYS B NZ  1 
ATOM   6833 N N   . ASP B 1 349 ? 1.315   -15.278 -26.427 1.00 71.98  ? 349  ASP B N   1 
ATOM   6834 C CA  . ASP B 1 349 ? 0.358   -16.290 -25.969 1.00 74.37  ? 349  ASP B CA  1 
ATOM   6835 C C   . ASP B 1 349 ? 0.338   -16.507 -24.457 1.00 75.78  ? 349  ASP B C   1 
ATOM   6836 O O   . ASP B 1 349 ? -0.377  -17.392 -23.971 1.00 77.96  ? 349  ASP B O   1 
ATOM   6837 C CB  . ASP B 1 349 ? 0.644   -17.620 -26.668 1.00 75.69  ? 349  ASP B CB  1 
ATOM   6838 C CG  . ASP B 1 349 ? 0.426   -17.546 -28.165 1.00 75.56  ? 349  ASP B CG  1 
ATOM   6839 O OD1 . ASP B 1 349 ? -0.532  -16.857 -28.580 1.00 74.65  ? 349  ASP B OD1 1 
ATOM   6840 O OD2 . ASP B 1 349 ? 1.206   -18.177 -28.920 1.00 76.37  ? 349  ASP B OD2 1 
ATOM   6841 N N   . ASN B 1 350 ? 1.127   -15.729 -23.717 1.00 74.95  ? 350  ASN B N   1 
ATOM   6842 C CA  . ASN B 1 350 ? 1.038   -15.706 -22.253 1.00 75.74  ? 350  ASN B CA  1 
ATOM   6843 C C   . ASN B 1 350 ? 1.364   -14.309 -21.708 1.00 74.31  ? 350  ASN B C   1 
ATOM   6844 O O   . ASN B 1 350 ? 1.565   -13.368 -22.482 1.00 72.49  ? 350  ASN B O   1 
ATOM   6845 C CB  . ASN B 1 350 ? 1.918   -16.808 -21.631 1.00 77.15  ? 350  ASN B CB  1 
ATOM   6846 C CG  . ASN B 1 350 ? 3.407   -16.575 -21.835 1.00 76.09  ? 350  ASN B CG  1 
ATOM   6847 O OD1 . ASN B 1 350 ? 3.880   -15.443 -21.821 1.00 74.46  ? 350  ASN B OD1 1 
ATOM   6848 N ND2 . ASN B 1 350 ? 4.155   -17.658 -22.012 1.00 76.52  ? 350  ASN B ND2 1 
ATOM   6849 N N   . GLU B 1 351 ? 1.418   -14.180 -20.386 1.00 74.93  ? 351  GLU B N   1 
ATOM   6850 C CA  . GLU B 1 351 ? 1.596   -12.881 -19.728 1.00 74.01  ? 351  GLU B CA  1 
ATOM   6851 C C   . GLU B 1 351 ? 3.038   -12.375 -19.729 1.00 72.12  ? 351  GLU B C   1 
ATOM   6852 O O   . GLU B 1 351 ? 3.290   -11.237 -19.353 1.00 70.92  ? 351  GLU B O   1 
ATOM   6853 C CB  . GLU B 1 351 ? 1.116   -12.972 -18.281 1.00 75.81  ? 351  GLU B CB  1 
ATOM   6854 C CG  . GLU B 1 351 ? -0.356  -13.331 -18.122 1.00 79.48  ? 351  GLU B CG  1 
ATOM   6855 C CD  . GLU B 1 351 ? -1.210  -12.115 -17.823 1.00 82.85  ? 351  GLU B CD  1 
ATOM   6856 O OE1 . GLU B 1 351 ? -1.735  -12.028 -16.678 1.00 85.52  ? 351  GLU B OE1 1 
ATOM   6857 O OE2 . GLU B 1 351 ? -1.318  -11.234 -18.721 1.00 83.97  ? 351  GLU B OE2 1 
ATOM   6858 N N   . SER B 1 352 ? 3.979   -13.228 -20.120 1.00 72.06  ? 352  SER B N   1 
ATOM   6859 C CA  . SER B 1 352 ? 5.390   -12.866 -20.219 1.00 71.06  ? 352  SER B CA  1 
ATOM   6860 C C   . SER B 1 352 ? 5.962   -12.263 -18.929 1.00 70.70  ? 352  SER B C   1 
ATOM   6861 O O   . SER B 1 352 ? 6.751   -11.320 -18.966 1.00 69.40  ? 352  SER B O   1 
ATOM   6862 C CB  . SER B 1 352 ? 5.607   -11.928 -21.406 1.00 69.37  ? 352  SER B CB  1 
ATOM   6863 O OG  . SER B 1 352 ? 5.205   -12.566 -22.604 1.00 69.98  ? 352  SER B OG  1 
ATOM   6864 N N   . LEU B 1 353 ? 5.565   -12.826 -17.792 1.00 71.90  ? 353  LEU B N   1 
ATOM   6865 C CA  . LEU B 1 353 ? 6.116   -12.437 -16.502 1.00 72.07  ? 353  LEU B CA  1 
ATOM   6866 C C   . LEU B 1 353 ? 7.512   -13.037 -16.390 1.00 72.58  ? 353  LEU B C   1 
ATOM   6867 O O   . LEU B 1 353 ? 7.670   -14.248 -16.402 1.00 74.17  ? 353  LEU B O   1 
ATOM   6868 C CB  . LEU B 1 353 ? 5.208   -12.922 -15.367 1.00 73.62  ? 353  LEU B CB  1 
ATOM   6869 C CG  . LEU B 1 353 ? 3.765   -12.381 -15.373 1.00 73.75  ? 353  LEU B CG  1 
ATOM   6870 C CD1 . LEU B 1 353 ? 2.961   -12.991 -14.227 1.00 75.61  ? 353  LEU B CD1 1 
ATOM   6871 C CD2 . LEU B 1 353 ? 3.709   -10.848 -15.302 1.00 71.49  ? 353  LEU B CD2 1 
ATOM   6872 N N   . ILE B 1 354 ? 8.529   -12.190 -16.293 1.00 71.67  ? 354  ILE B N   1 
ATOM   6873 C CA  . ILE B 1 354 ? 9.915   -12.658 -16.405 1.00 72.04  ? 354  ILE B CA  1 
ATOM   6874 C C   . ILE B 1 354 ? 10.692  -12.543 -15.102 1.00 73.07  ? 354  ILE B C   1 
ATOM   6875 O O   . ILE B 1 354 ? 10.314  -11.797 -14.192 1.00 72.96  ? 354  ILE B O   1 
ATOM   6876 C CB  . ILE B 1 354 ? 10.682  -11.931 -17.542 1.00 70.47  ? 354  ILE B CB  1 
ATOM   6877 C CG1 . ILE B 1 354 ? 10.652  -10.406 -17.350 1.00 68.60  ? 354  ILE B CG1 1 
ATOM   6878 C CG2 . ILE B 1 354 ? 10.088  -12.329 -18.902 1.00 69.55  ? 354  ILE B CG2 1 
ATOM   6879 C CD1 . ILE B 1 354 ? 11.737  -9.667  -18.102 1.00 67.26  ? 354  ILE B CD1 1 
ATOM   6880 N N   . SER B 1 355 ? 11.779  -13.306 -15.023 1.00 74.12  ? 355  SER B N   1 
ATOM   6881 C CA  . SER B 1 355 ? 12.681  -13.242 -13.886 1.00 74.86  ? 355  SER B CA  1 
ATOM   6882 C C   . SER B 1 355 ? 13.636  -12.070 -14.037 1.00 73.39  ? 355  SER B C   1 
ATOM   6883 O O   . SER B 1 355 ? 13.776  -11.494 -15.121 1.00 71.96  ? 355  SER B O   1 
ATOM   6884 C CB  . SER B 1 355 ? 13.499  -14.527 -13.784 1.00 76.88  ? 355  SER B CB  1 
ATOM   6885 O OG  . SER B 1 355 ? 14.454  -14.599 -14.831 1.00 76.90  ? 355  SER B OG  1 
ATOM   6886 N N   . ARG B 1 356 ? 14.313  -11.739 -12.947 1.00 73.68  ? 356  ARG B N   1 
ATOM   6887 C CA  . ARG B 1 356 ? 15.359  -10.738 -12.992 1.00 72.81  ? 356  ARG B CA  1 
ATOM   6888 C C   . ARG B 1 356 ? 16.481  -11.167 -13.939 1.00 72.74  ? 356  ARG B C   1 
ATOM   6889 O O   . ARG B 1 356 ? 16.963  -10.358 -14.735 1.00 71.93  ? 356  ARG B O   1 
ATOM   6890 C CB  . ARG B 1 356 ? 15.909  -10.467 -11.595 1.00 73.75  ? 356  ARG B CB  1 
ATOM   6891 C CG  . ARG B 1 356 ? 16.881  -9.314  -11.576 1.00 73.00  ? 356  ARG B CG  1 
ATOM   6892 C CD  . ARG B 1 356 ? 17.082  -8.743  -10.192 1.00 73.85  ? 356  ARG B CD  1 
ATOM   6893 N NE  . ARG B 1 356 ? 18.004  -7.613  -10.260 1.00 73.64  ? 356  ARG B NE  1 
ATOM   6894 C CZ  . ARG B 1 356 ? 17.683  -6.405  -10.722 1.00 72.07  ? 356  ARG B CZ  1 
ATOM   6895 N NH1 . ARG B 1 356 ? 16.451  -6.146  -11.145 1.00 70.93  ? 356  ARG B NH1 1 
ATOM   6896 N NH2 . ARG B 1 356 ? 18.602  -5.445  -10.756 1.00 72.28  ? 356  ARG B NH2 1 
ATOM   6897 N N   . ALA B 1 357 ? 16.876  -12.437 -13.865 1.00 73.72  ? 357  ALA B N   1 
ATOM   6898 C CA  . ALA B 1 357 ? 17.887  -12.988 -14.769 1.00 73.90  ? 357  ALA B CA  1 
ATOM   6899 C C   . ALA B 1 357 ? 17.502  -12.764 -16.227 1.00 71.87  ? 357  ALA B C   1 
ATOM   6900 O O   . ALA B 1 357 ? 18.327  -12.333 -17.029 1.00 71.11  ? 357  ALA B O   1 
ATOM   6901 C CB  . ALA B 1 357 ? 18.104  -14.489 -14.498 1.00 75.77  ? 357  ALA B CB  1 
ATOM   6902 N N   . GLN B 1 358 ? 16.239  -13.041 -16.549 1.00 71.15  ? 358  GLN B N   1 
ATOM   6903 C CA  . GLN B 1 358 ? 15.704  -12.825 -17.897 1.00 69.47  ? 358  GLN B CA  1 
ATOM   6904 C C   . GLN B 1 358 ? 15.681  -11.345 -18.279 1.00 67.12  ? 358  GLN B C   1 
ATOM   6905 O O   . GLN B 1 358 ? 15.814  -11.009 -19.461 1.00 65.76  ? 358  GLN B O   1 
ATOM   6906 C CB  . GLN B 1 358 ? 14.298  -13.429 -18.031 1.00 69.79  ? 358  GLN B CB  1 
ATOM   6907 C CG  . GLN B 1 358 ? 14.295  -14.959 -18.199 1.00 71.97  ? 358  GLN B CG  1 
ATOM   6908 C CD  . GLN B 1 358 ? 12.911  -15.584 -18.040 1.00 72.61  ? 358  GLN B CD  1 
ATOM   6909 O OE1 . GLN B 1 358 ? 12.121  -15.154 -17.198 1.00 73.54  ? 358  GLN B OE1 1 
ATOM   6910 N NE2 . GLN B 1 358 ? 12.625  -16.622 -18.834 1.00 72.93  ? 358  GLN B NE2 1 
ATOM   6911 N N   . PHE B 1 359 ? 15.517  -10.462 -17.294 1.00 66.15  ? 359  PHE B N   1 
ATOM   6912 C CA  . PHE B 1 359 ? 15.585  -9.023  -17.550 1.00 64.31  ? 359  PHE B CA  1 
ATOM   6913 C C   . PHE B 1 359 ? 17.004  -8.630  -17.963 1.00 64.31  ? 359  PHE B C   1 
ATOM   6914 O O   . PHE B 1 359 ? 17.183  -7.912  -18.950 1.00 62.90  ? 359  PHE B O   1 
ATOM   6915 C CB  . PHE B 1 359 ? 15.107  -8.219  -16.330 1.00 63.79  ? 359  PHE B CB  1 
ATOM   6916 C CG  . PHE B 1 359 ? 15.203  -6.716  -16.495 1.00 62.10  ? 359  PHE B CG  1 
ATOM   6917 C CD1 . PHE B 1 359 ? 15.918  -5.947  -15.585 1.00 61.60  ? 359  PHE B CD1 1 
ATOM   6918 C CD2 . PHE B 1 359 ? 14.570  -6.073  -17.548 1.00 60.22  ? 359  PHE B CD2 1 
ATOM   6919 C CE1 . PHE B 1 359 ? 16.007  -4.568  -15.724 1.00 59.92  ? 359  PHE B CE1 1 
ATOM   6920 C CE2 . PHE B 1 359 ? 14.656  -4.693  -17.697 1.00 60.09  ? 359  PHE B CE2 1 
ATOM   6921 C CZ  . PHE B 1 359 ? 15.379  -3.936  -16.783 1.00 58.97  ? 359  PHE B CZ  1 
ATOM   6922 N N   . LEU B 1 360 ? 18.008  -9.117  -17.230 1.00 65.97  ? 360  LEU B N   1 
ATOM   6923 C CA  . LEU B 1 360 ? 19.404  -8.759  -17.519 1.00 66.53  ? 360  LEU B CA  1 
ATOM   6924 C C   . LEU B 1 360 ? 19.843  -9.316  -18.875 1.00 66.35  ? 360  LEU B C   1 
ATOM   6925 O O   . LEU B 1 360 ? 20.595  -8.672  -19.608 1.00 65.55  ? 360  LEU B O   1 
ATOM   6926 C CB  . LEU B 1 360 ? 20.368  -9.254  -16.424 1.00 68.60  ? 360  LEU B CB  1 
ATOM   6927 C CG  . LEU B 1 360 ? 20.084  -9.050  -14.919 1.00 70.31  ? 360  LEU B CG  1 
ATOM   6928 C CD1 . LEU B 1 360 ? 21.391  -9.140  -14.119 1.00 72.84  ? 360  LEU B CD1 1 
ATOM   6929 C CD2 . LEU B 1 360 ? 19.361  -7.754  -14.577 1.00 68.21  ? 360  LEU B CD2 1 
ATOM   6930 N N   . ALA B 1 361 ? 19.368  -10.518 -19.200 1.00 67.20  ? 361  ALA B N   1 
ATOM   6931 C CA  . ALA B 1 361 ? 19.647  -11.144 -20.491 1.00 67.02  ? 361  ALA B CA  1 
ATOM   6932 C C   . ALA B 1 361 ? 19.028  -10.334 -21.621 1.00 64.96  ? 361  ALA B C   1 
ATOM   6933 O O   . ALA B 1 361 ? 19.680  -10.042 -22.629 1.00 64.38  ? 361  ALA B O   1 
ATOM   6934 C CB  . ALA B 1 361 ? 19.115  -12.585 -20.508 1.00 68.50  ? 361  ALA B CB  1 
ATOM   6935 N N   . GLY B 1 362 ? 17.766  -9.963  -21.440 1.00 63.83  ? 362  GLY B N   1 
ATOM   6936 C CA  . GLY B 1 362 ? 17.045  -9.154  -22.418 1.00 62.14  ? 362  GLY B CA  1 
ATOM   6937 C C   . GLY B 1 362 ? 17.672  -7.795  -22.707 1.00 60.70  ? 362  GLY B C   1 
ATOM   6938 O O   . GLY B 1 362 ? 17.668  -7.349  -23.847 1.00 59.65  ? 362  GLY B O   1 
ATOM   6939 N N   . VAL B 1 363 ? 18.214  -7.134  -21.687 1.00 60.91  ? 363  VAL B N   1 
ATOM   6940 C CA  . VAL B 1 363 ? 18.863  -5.826  -21.887 1.00 59.94  ? 363  VAL B CA  1 
ATOM   6941 C C   . VAL B 1 363 ? 20.041  -5.915  -22.872 1.00 60.48  ? 363  VAL B C   1 
ATOM   6942 O O   . VAL B 1 363 ? 20.251  -5.003  -23.668 1.00 59.58  ? 363  VAL B O   1 
ATOM   6943 C CB  . VAL B 1 363 ? 19.329  -5.178  -20.546 1.00 60.23  ? 363  VAL B CB  1 
ATOM   6944 C CG1 . VAL B 1 363 ? 20.315  -4.024  -20.794 1.00 58.66  ? 363  VAL B CG1 1 
ATOM   6945 C CG2 . VAL B 1 363 ? 18.133  -4.683  -19.749 1.00 59.17  ? 363  VAL B CG2 1 
ATOM   6946 N N   . ARG B 1 364 ? 20.796  -7.007  -22.819 1.00 61.91  ? 364  ARG B N   1 
ATOM   6947 C CA  . ARG B 1 364 ? 21.901  -7.211  -23.753 1.00 63.05  ? 364  ARG B CA  1 
ATOM   6948 C C   . ARG B 1 364 ? 21.409  -7.368  -25.197 1.00 62.11  ? 364  ARG B C   1 
ATOM   6949 O O   . ARG B 1 364 ? 22.118  -7.027  -26.140 1.00 62.44  ? 364  ARG B O   1 
ATOM   6950 C CB  . ARG B 1 364 ? 22.716  -8.458  -23.392 1.00 64.73  ? 364  ARG B CB  1 
ATOM   6951 C CG  . ARG B 1 364 ? 23.143  -8.581  -21.945 1.00 67.57  ? 364  ARG B CG  1 
ATOM   6952 C CD  . ARG B 1 364 ? 23.691  -7.291  -21.344 1.00 69.29  ? 364  ARG B CD  1 
ATOM   6953 N NE  . ARG B 1 364 ? 24.844  -6.746  -22.070 1.00 69.96  ? 364  ARG B NE  1 
ATOM   6954 C CZ  . ARG B 1 364 ? 26.124  -6.955  -21.758 1.00 71.25  ? 364  ARG B CZ  1 
ATOM   6955 N NH1 . ARG B 1 364 ? 26.480  -7.725  -20.728 1.00 73.03  ? 364  ARG B NH1 1 
ATOM   6956 N NH2 . ARG B 1 364 ? 27.063  -6.383  -22.496 1.00 71.83  ? 364  ARG B NH2 1 
ATOM   6957 N N   . ILE B 1 365 ? 20.210  -7.909  -25.360 1.00 61.55  ? 365  ILE B N   1 
ATOM   6958 C CA  . ILE B 1 365 ? 19.625  -8.127  -26.672 1.00 60.68  ? 365  ILE B CA  1 
ATOM   6959 C C   . ILE B 1 365 ? 18.919  -6.849  -27.137 1.00 59.46  ? 365  ILE B C   1 
ATOM   6960 O O   . ILE B 1 365 ? 18.930  -6.523  -28.324 1.00 58.57  ? 365  ILE B O   1 
ATOM   6961 C CB  . ILE B 1 365 ? 18.653  -9.341  -26.636 1.00 61.14  ? 365  ILE B CB  1 
ATOM   6962 C CG1 . ILE B 1 365 ? 19.445  -10.626 -26.348 1.00 62.59  ? 365  ILE B CG1 1 
ATOM   6963 C CG2 . ILE B 1 365 ? 17.860  -9.458  -27.944 1.00 59.31  ? 365  ILE B CG2 1 
ATOM   6964 C CD1 . ILE B 1 365 ? 18.591  -11.829 -26.025 1.00 63.56  ? 365  ILE B CD1 1 
ATOM   6965 N N   . GLY B 1 366 ? 18.324  -6.124  -26.188 1.00 59.47  ? 366  GLY B N   1 
ATOM   6966 C CA  . GLY B 1 366 ? 17.604  -4.876  -26.472 1.00 58.32  ? 366  GLY B CA  1 
ATOM   6967 C C   . GLY B 1 366 ? 18.501  -3.655  -26.586 1.00 58.18  ? 366  GLY B C   1 
ATOM   6968 O O   . GLY B 1 366 ? 18.105  -2.634  -27.166 1.00 57.82  ? 366  GLY B O   1 
ATOM   6969 N N   . VAL B 1 367 ? 19.702  -3.749  -26.022 1.00 58.86  ? 367  VAL B N   1 
ATOM   6970 C CA  . VAL B 1 367 ? 20.702  -2.693  -26.135 1.00 58.60  ? 367  VAL B CA  1 
ATOM   6971 C C   . VAL B 1 367 ? 22.018  -3.362  -26.553 1.00 60.02  ? 367  VAL B C   1 
ATOM   6972 O O   . VAL B 1 367 ? 22.985  -3.384  -25.799 1.00 60.29  ? 367  VAL B O   1 
ATOM   6973 C CB  . VAL B 1 367 ? 20.840  -1.904  -24.812 1.00 58.52  ? 367  VAL B CB  1 
ATOM   6974 C CG1 . VAL B 1 367 ? 21.500  -0.558  -25.061 1.00 57.40  ? 367  VAL B CG1 1 
ATOM   6975 C CG2 . VAL B 1 367 ? 19.463  -1.705  -24.160 1.00 57.48  ? 367  VAL B CG2 1 
ATOM   6976 N N   . PRO B 1 368 ? 22.044  -3.914  -27.779 1.00 60.63  ? 368  PRO B N   1 
ATOM   6977 C CA  . PRO B 1 368 ? 23.084  -4.849  -28.218 1.00 62.08  ? 368  PRO B CA  1 
ATOM   6978 C C   . PRO B 1 368 ? 24.461  -4.226  -28.379 1.00 62.75  ? 368  PRO B C   1 
ATOM   6979 O O   . PRO B 1 368 ? 25.448  -4.944  -28.374 1.00 64.19  ? 368  PRO B O   1 
ATOM   6980 C CB  . PRO B 1 368 ? 22.554  -5.353  -29.563 1.00 61.83  ? 368  PRO B CB  1 
ATOM   6981 C CG  . PRO B 1 368 ? 21.708  -4.228  -30.068 1.00 60.41  ? 368  PRO B CG  1 
ATOM   6982 C CD  . PRO B 1 368 ? 21.062  -3.649  -28.850 1.00 59.70  ? 368  PRO B CD  1 
ATOM   6983 N N   . GLN B 1 369 ? 24.518  -2.906  -28.506 1.00 62.27  ? 369  GLN B N   1 
ATOM   6984 C CA  . GLN B 1 369 ? 25.782  -2.187  -28.629 1.00 63.19  ? 369  GLN B CA  1 
ATOM   6985 C C   . GLN B 1 369 ? 26.351  -1.797  -27.264 1.00 63.85  ? 369  GLN B C   1 
ATOM   6986 O O   . GLN B 1 369 ? 27.493  -1.355  -27.184 1.00 65.06  ? 369  GLN B O   1 
ATOM   6987 C CB  . GLN B 1 369 ? 25.618  -0.954  -29.544 1.00 62.46  ? 369  GLN B CB  1 
ATOM   6988 C CG  . GLN B 1 369 ? 25.697  -1.284  -31.085 1.00 62.57  ? 369  GLN B CG  1 
ATOM   6989 C CD  . GLN B 1 369 ? 24.476  -2.053  -31.634 1.00 62.93  ? 369  GLN B CD  1 
ATOM   6990 O OE1 . GLN B 1 369 ? 23.371  -1.508  -31.748 1.00 59.44  ? 369  GLN B OE1 1 
ATOM   6991 N NE2 . GLN B 1 369 ? 24.687  -3.321  -31.992 1.00 63.14  ? 369  GLN B NE2 1 
ATOM   6992 N N   . ALA B 1 370 ? 25.582  -2.013  -26.193 1.00 63.39  ? 370  ALA B N   1 
ATOM   6993 C CA  . ALA B 1 370 ? 25.988  -1.616  -24.841 1.00 63.66  ? 370  ALA B CA  1 
ATOM   6994 C C   . ALA B 1 370 ? 27.104  -2.483  -24.282 1.00 65.37  ? 370  ALA B C   1 
ATOM   6995 O O   . ALA B 1 370 ? 27.060  -3.709  -24.388 1.00 65.90  ? 370  ALA B O   1 
ATOM   6996 C CB  . ALA B 1 370 ? 24.793  -1.651  -23.895 1.00 62.98  ? 370  ALA B CB  1 
ATOM   6997 N N   . SER B 1 371 ? 28.093  -1.842  -23.661 1.00 66.02  ? 371  SER B N   1 
ATOM   6998 C CA  . SER B 1 371 ? 29.125  -2.559  -22.916 1.00 67.81  ? 371  SER B CA  1 
ATOM   6999 C C   . SER B 1 371 ? 28.538  -3.172  -21.646 1.00 68.16  ? 371  SER B C   1 
ATOM   7000 O O   . SER B 1 371 ? 27.394  -2.892  -21.291 1.00 67.07  ? 371  SER B O   1 
ATOM   7001 C CB  . SER B 1 371 ? 30.267  -1.612  -22.545 1.00 68.63  ? 371  SER B CB  1 
ATOM   7002 O OG  . SER B 1 371 ? 29.847  -0.644  -21.601 1.00 68.43  ? 371  SER B OG  1 
ATOM   7003 N N   . ASP B 1 372 ? 29.323  -4.000  -20.959 1.00 69.80  ? 372  ASP B N   1 
ATOM   7004 C CA  . ASP B 1 372 ? 28.892  -4.586  -19.686 1.00 70.36  ? 372  ASP B CA  1 
ATOM   7005 C C   . ASP B 1 372 ? 28.446  -3.498  -18.716 1.00 69.36  ? 372  ASP B C   1 
ATOM   7006 O O   . ASP B 1 372 ? 27.391  -3.619  -18.088 1.00 68.83  ? 372  ASP B O   1 
ATOM   7007 C CB  . ASP B 1 372 ? 30.014  -5.403  -19.031 1.00 72.75  ? 372  ASP B CB  1 
ATOM   7008 C CG  . ASP B 1 372 ? 30.318  -6.698  -19.769 1.00 74.66  ? 372  ASP B CG  1 
ATOM   7009 O OD1 . ASP B 1 372 ? 29.629  -7.007  -20.760 1.00 75.13  ? 372  ASP B OD1 1 
ATOM   7010 O OD2 . ASP B 1 372 ? 31.260  -7.413  -19.352 1.00 79.46  ? 372  ASP B OD2 1 
ATOM   7011 N N   . LEU B 1 373 ? 29.253  -2.445  -18.598 1.00 68.92  ? 373  LEU B N   1 
ATOM   7012 C CA  . LEU B 1 373 ? 28.983  -1.357  -17.656 1.00 67.98  ? 373  LEU B CA  1 
ATOM   7013 C C   . LEU B 1 373 ? 27.753  -0.556  -18.049 1.00 65.74  ? 373  LEU B C   1 
ATOM   7014 O O   . LEU B 1 373 ? 26.943  -0.212  -17.192 1.00 64.89  ? 373  LEU B O   1 
ATOM   7015 C CB  . LEU B 1 373 ? 30.183  -0.416  -17.554 1.00 68.73  ? 373  LEU B CB  1 
ATOM   7016 C CG  . LEU B 1 373 ? 30.107  0.697   -16.498 1.00 68.99  ? 373  LEU B CG  1 
ATOM   7017 C CD1 . LEU B 1 373 ? 29.889  0.124   -15.094 1.00 69.21  ? 373  LEU B CD1 1 
ATOM   7018 C CD2 . LEU B 1 373 ? 31.373  1.570   -16.545 1.00 69.20  ? 373  LEU B CD2 1 
ATOM   7019 N N   . ALA B 1 374 ? 27.631  -0.251  -19.342 1.00 64.50  ? 374  ALA B N   1 
ATOM   7020 C CA  . ALA B 1 374 ? 26.489  0.505   -19.848 1.00 62.69  ? 374  ALA B CA  1 
ATOM   7021 C C   . ALA B 1 374 ? 25.203  -0.277  -19.619 1.00 61.78  ? 374  ALA B C   1 
ATOM   7022 O O   . ALA B 1 374 ? 24.194  0.299   -19.225 1.00 60.70  ? 374  ALA B O   1 
ATOM   7023 C CB  . ALA B 1 374 ? 26.664  0.852   -21.333 1.00 61.81  ? 374  ALA B CB  1 
ATOM   7024 N N   . ALA B 1 375 ? 25.258  -1.586  -19.859 1.00 62.33  ? 375  ALA B N   1 
ATOM   7025 C CA  . ALA B 1 375 ? 24.114  -2.474  -19.652 1.00 62.34  ? 375  ALA B CA  1 
ATOM   7026 C C   . ALA B 1 375 ? 23.757  -2.510  -18.177 1.00 62.80  ? 375  ALA B C   1 
ATOM   7027 O O   . ALA B 1 375 ? 22.585  -2.541  -17.811 1.00 62.26  ? 375  ALA B O   1 
ATOM   7028 C CB  . ALA B 1 375 ? 24.424  -3.899  -20.163 1.00 63.24  ? 375  ALA B CB  1 
ATOM   7029 N N   . GLU B 1 376 ? 24.785  -2.488  -17.336 1.00 63.96  ? 376  GLU B N   1 
ATOM   7030 C CA  . GLU B 1 376 ? 24.602  -2.455  -15.893 1.00 64.58  ? 376  GLU B CA  1 
ATOM   7031 C C   . GLU B 1 376 ? 23.857  -1.183  -15.471 1.00 62.27  ? 376  GLU B C   1 
ATOM   7032 O O   . GLU B 1 376 ? 22.934  -1.242  -14.664 1.00 62.11  ? 376  GLU B O   1 
ATOM   7033 C CB  . GLU B 1 376 ? 25.957  -2.533  -15.194 1.00 66.71  ? 376  GLU B CB  1 
ATOM   7034 C CG  . GLU B 1 376 ? 25.919  -3.218  -13.864 1.00 71.20  ? 376  GLU B CG  1 
ATOM   7035 C CD  . GLU B 1 376 ? 26.051  -4.727  -13.983 1.00 76.25  ? 376  GLU B CD  1 
ATOM   7036 O OE1 . GLU B 1 376 ? 25.140  -5.357  -14.566 1.00 78.59  ? 376  GLU B OE1 1 
ATOM   7037 O OE2 . GLU B 1 376 ? 27.063  -5.281  -13.486 1.00 80.43  ? 376  GLU B OE2 1 
ATOM   7038 N N   . ALA B 1 377 ? 24.252  -0.042  -16.030 1.00 60.29  ? 377  ALA B N   1 
ATOM   7039 C CA  . ALA B 1 377 ? 23.556  1.225   -15.783 1.00 58.40  ? 377  ALA B CA  1 
ATOM   7040 C C   . ALA B 1 377 ? 22.096  1.182   -16.228 1.00 56.65  ? 377  ALA B C   1 
ATOM   7041 O O   . ALA B 1 377 ? 21.234  1.752   -15.555 1.00 55.48  ? 377  ALA B O   1 
ATOM   7042 C CB  . ALA B 1 377 ? 24.276  2.376   -16.483 1.00 57.68  ? 377  ALA B CB  1 
ATOM   7043 N N   . VAL B 1 378 ? 21.817  0.538   -17.368 1.00 55.68  ? 378  VAL B N   1 
ATOM   7044 C CA  . VAL B 1 378 ? 20.432  0.411   -17.852 1.00 54.55  ? 378  VAL B CA  1 
ATOM   7045 C C   . VAL B 1 378 ? 19.618  -0.395  -16.840 1.00 55.10  ? 378  VAL B C   1 
ATOM   7046 O O   . VAL B 1 378 ? 18.542  0.027   -16.422 1.00 54.18  ? 378  VAL B O   1 
ATOM   7047 C CB  . VAL B 1 378 ? 20.335  -0.225  -19.277 1.00 54.13  ? 378  VAL B CB  1 
ATOM   7048 C CG1 . VAL B 1 378 ? 18.898  -0.579  -19.631 1.00 52.58  ? 378  VAL B CG1 1 
ATOM   7049 C CG2 . VAL B 1 378 ? 20.908  0.721   -20.340 1.00 53.10  ? 378  VAL B CG2 1 
ATOM   7050 N N   . VAL B 1 379 ? 20.146  -1.536  -16.417 1.00 56.45  ? 379  VAL B N   1 
ATOM   7051 C CA  . VAL B 1 379 ? 19.455  -2.368  -15.434 1.00 57.38  ? 379  VAL B CA  1 
ATOM   7052 C C   . VAL B 1 379 ? 19.233  -1.617  -14.109 1.00 58.25  ? 379  VAL B C   1 
ATOM   7053 O O   . VAL B 1 379 ? 18.164  -1.706  -13.513 1.00 58.22  ? 379  VAL B O   1 
ATOM   7054 C CB  . VAL B 1 379 ? 20.215  -3.687  -15.174 1.00 59.06  ? 379  VAL B CB  1 
ATOM   7055 C CG1 . VAL B 1 379 ? 19.675  -4.398  -13.925 1.00 58.98  ? 379  VAL B CG1 1 
ATOM   7056 C CG2 . VAL B 1 379 ? 20.121  -4.602  -16.405 1.00 59.09  ? 379  VAL B CG2 1 
ATOM   7057 N N   . LEU B 1 380 ? 20.230  -0.873  -13.646 1.00 59.07  ? 380  LEU B N   1 
ATOM   7058 C CA  . LEU B 1 380 ? 20.080  -0.175  -12.380 1.00 59.74  ? 380  LEU B CA  1 
ATOM   7059 C C   . LEU B 1 380 ? 19.065  0.965   -12.479 1.00 58.55  ? 380  LEU B C   1 
ATOM   7060 O O   . LEU B 1 380 ? 18.313  1.208   -11.546 1.00 58.78  ? 380  LEU B O   1 
ATOM   7061 C CB  . LEU B 1 380 ? 21.435  0.305   -11.848 1.00 61.02  ? 380  LEU B CB  1 
ATOM   7062 C CG  . LEU B 1 380 ? 22.459  -0.798  -11.484 1.00 63.77  ? 380  LEU B CG  1 
ATOM   7063 C CD1 . LEU B 1 380 ? 23.688  -0.194  -10.836 1.00 66.03  ? 380  LEU B CD1 1 
ATOM   7064 C CD2 . LEU B 1 380 ? 21.897  -1.884  -10.572 1.00 66.04  ? 380  LEU B CD2 1 
ATOM   7065 N N   . HIS B 1 381 ? 19.025  1.642   -13.618 1.00 57.61  ? 381  HIS B N   1 
ATOM   7066 C CA  . HIS B 1 381 ? 18.086  2.749   -13.839 1.00 56.59  ? 381  HIS B CA  1 
ATOM   7067 C C   . HIS B 1 381 ? 16.623  2.263   -13.973 1.00 55.78  ? 381  HIS B C   1 
ATOM   7068 O O   . HIS B 1 381 ? 15.699  2.916   -13.512 1.00 55.32  ? 381  HIS B O   1 
ATOM   7069 C CB  . HIS B 1 381 ? 18.507  3.549   -15.092 1.00 56.03  ? 381  HIS B CB  1 
ATOM   7070 C CG  . HIS B 1 381 ? 17.571  4.663   -15.443 1.00 56.06  ? 381  HIS B CG  1 
ATOM   7071 N ND1 . HIS B 1 381 ? 17.769  5.960   -15.020 1.00 58.39  ? 381  HIS B ND1 1 
ATOM   7072 C CD2 . HIS B 1 381 ? 16.426  4.673   -16.168 1.00 55.52  ? 381  HIS B CD2 1 
ATOM   7073 C CE1 . HIS B 1 381 ? 16.781  6.720   -15.466 1.00 57.85  ? 381  HIS B CE1 1 
ATOM   7074 N NE2 . HIS B 1 381 ? 15.955  5.965   -16.168 1.00 56.41  ? 381  HIS B NE2 1 
ATOM   7075 N N   . TYR B 1 382 ? 16.423  1.118   -14.608 1.00 55.56  ? 382  TYR B N   1 
ATOM   7076 C CA  . TYR B 1 382 ? 15.082  0.631   -14.909 1.00 55.14  ? 382  TYR B CA  1 
ATOM   7077 C C   . TYR B 1 382 ? 14.505  -0.312  -13.850 1.00 56.30  ? 382  TYR B C   1 
ATOM   7078 O O   . TYR B 1 382 ? 13.292  -0.559  -13.835 1.00 56.24  ? 382  TYR B O   1 
ATOM   7079 C CB  . TYR B 1 382 ? 15.066  -0.039  -16.289 1.00 54.54  ? 382  TYR B CB  1 
ATOM   7080 C CG  . TYR B 1 382 ? 14.921  0.957   -17.416 1.00 53.12  ? 382  TYR B CG  1 
ATOM   7081 C CD1 . TYR B 1 382 ? 16.035  1.528   -18.023 1.00 51.88  ? 382  TYR B CD1 1 
ATOM   7082 C CD2 . TYR B 1 382 ? 13.667  1.341   -17.857 1.00 52.26  ? 382  TYR B CD2 1 
ATOM   7083 C CE1 . TYR B 1 382 ? 15.899  2.446   -19.062 1.00 51.37  ? 382  TYR B CE1 1 
ATOM   7084 C CE2 . TYR B 1 382 ? 13.515  2.250   -18.892 1.00 52.28  ? 382  TYR B CE2 1 
ATOM   7085 C CZ  . TYR B 1 382 ? 14.637  2.801   -19.499 1.00 51.20  ? 382  TYR B CZ  1 
ATOM   7086 O OH  . TYR B 1 382 ? 14.471  3.709   -20.531 1.00 50.04  ? 382  TYR B OH  1 
ATOM   7087 N N   . THR B 1 383 ? 15.359  -0.846  -12.978 1.00 57.31  ? 383  THR B N   1 
ATOM   7088 C CA  . THR B 1 383 ? 14.878  -1.605  -11.840 1.00 58.25  ? 383  THR B CA  1 
ATOM   7089 C C   . THR B 1 383 ? 14.094  -0.685  -10.896 1.00 58.82  ? 383  THR B C   1 
ATOM   7090 O O   . THR B 1 383 ? 14.516  0.445   -10.605 1.00 57.91  ? 383  THR B O   1 
ATOM   7091 C CB  . THR B 1 383 ? 16.033  -2.286  -11.101 1.00 59.50  ? 383  THR B CB  1 
ATOM   7092 O OG1 . THR B 1 383 ? 16.678  -3.190  -11.999 1.00 58.80  ? 383  THR B OG1 1 
ATOM   7093 C CG2 . THR B 1 383 ? 15.533  -3.055  -9.881  1.00 60.15  ? 383  THR B CG2 1 
ATOM   7094 N N   . ASP B 1 384 ? 12.929  -1.164  -10.465 1.00 59.73  ? 384  ASP B N   1 
ATOM   7095 C CA  . ASP B 1 384 ? 12.194  -0.564  -9.360  1.00 60.95  ? 384  ASP B CA  1 
ATOM   7096 C C   . ASP B 1 384 ? 12.746  -1.179  -8.076  1.00 62.40  ? 384  ASP B C   1 
ATOM   7097 O O   . ASP B 1 384 ? 12.462  -2.334  -7.751  1.00 63.32  ? 384  ASP B O   1 
ATOM   7098 C CB  . ASP B 1 384 ? 10.691  -0.840  -9.490  1.00 61.37  ? 384  ASP B CB  1 
ATOM   7099 C CG  . ASP B 1 384 ? 9.855   -0.062  -8.482  1.00 63.39  ? 384  ASP B CG  1 
ATOM   7100 O OD1 . ASP B 1 384 ? 10.385  0.327   -7.423  1.00 64.56  ? 384  ASP B OD1 1 
ATOM   7101 O OD2 . ASP B 1 384 ? 8.652   0.156   -8.753  1.00 66.61  ? 384  ASP B OD2 1 
ATOM   7102 N N   . TRP B 1 385 ? 13.534  -0.401  -7.342  1.00 62.92  ? 385  TRP B N   1 
ATOM   7103 C CA  . TRP B 1 385 ? 14.244  -0.931  -6.180  1.00 64.65  ? 385  TRP B CA  1 
ATOM   7104 C C   . TRP B 1 385 ? 13.340  -1.226  -4.973  1.00 66.82  ? 385  TRP B C   1 
ATOM   7105 O O   . TRP B 1 385 ? 13.768  -1.908  -4.040  1.00 68.71  ? 385  TRP B O   1 
ATOM   7106 C CB  . TRP B 1 385 ? 15.464  -0.049  -5.847  1.00 63.79  ? 385  TRP B CB  1 
ATOM   7107 C CG  . TRP B 1 385 ? 16.466  -0.201  -6.921  1.00 62.17  ? 385  TRP B CG  1 
ATOM   7108 C CD1 . TRP B 1 385 ? 16.700  0.656   -7.958  1.00 60.24  ? 385  TRP B CD1 1 
ATOM   7109 C CD2 . TRP B 1 385 ? 17.297  -1.342  -7.143  1.00 62.11  ? 385  TRP B CD2 1 
ATOM   7110 N NE1 . TRP B 1 385 ? 17.655  0.134   -8.790  1.00 60.90  ? 385  TRP B NE1 1 
ATOM   7111 C CE2 . TRP B 1 385 ? 18.035  -1.098  -8.318  1.00 61.54  ? 385  TRP B CE2 1 
ATOM   7112 C CE3 . TRP B 1 385 ? 17.497  -2.547  -6.455  1.00 64.14  ? 385  TRP B CE3 1 
ATOM   7113 C CZ2 . TRP B 1 385 ? 18.965  -2.014  -8.826  1.00 62.07  ? 385  TRP B CZ2 1 
ATOM   7114 C CZ3 . TRP B 1 385 ? 18.423  -3.460  -6.961  1.00 64.89  ? 385  TRP B CZ3 1 
ATOM   7115 C CH2 . TRP B 1 385 ? 19.146  -3.181  -8.134  1.00 63.92  ? 385  TRP B CH2 1 
ATOM   7116 N N   . LEU B 1 386 ? 12.092  -0.765  -5.014  1.00 67.57  ? 386  LEU B N   1 
ATOM   7117 C CA  . LEU B 1 386 ? 11.059  -1.266  -4.092  1.00 70.08  ? 386  LEU B CA  1 
ATOM   7118 C C   . LEU B 1 386 ? 10.566  -2.681  -4.447  1.00 71.15  ? 386  LEU B C   1 
ATOM   7119 O O   . LEU B 1 386 ? 10.194  -3.448  -3.561  1.00 72.99  ? 386  LEU B O   1 
ATOM   7120 C CB  . LEU B 1 386 ? 9.862   -0.319  -4.074  1.00 69.80  ? 386  LEU B CB  1 
ATOM   7121 C CG  . LEU B 1 386 ? 10.051  0.901   -3.184  1.00 71.17  ? 386  LEU B CG  1 
ATOM   7122 C CD1 . LEU B 1 386 ? 9.208   2.095   -3.683  1.00 72.27  ? 386  LEU B CD1 1 
ATOM   7123 C CD2 . LEU B 1 386 ? 9.727   0.513   -1.740  1.00 73.76  ? 386  LEU B CD2 1 
ATOM   7124 N N   . HIS B 1 387 ? 10.557  -3.002  -5.743  1.00 70.78  ? 387  HIS B N   1 
ATOM   7125 C CA  . HIS B 1 387 ? 10.046  -4.281  -6.256  1.00 71.73  ? 387  HIS B CA  1 
ATOM   7126 C C   . HIS B 1 387 ? 11.013  -4.861  -7.289  1.00 71.50  ? 387  HIS B C   1 
ATOM   7127 O O   . HIS B 1 387 ? 10.617  -5.126  -8.423  1.00 71.02  ? 387  HIS B O   1 
ATOM   7128 C CB  . HIS B 1 387 ? 8.662   -4.075  -6.903  1.00 71.30  ? 387  HIS B CB  1 
ATOM   7129 C CG  . HIS B 1 387 ? 7.677   -3.378  -6.014  1.00 72.38  ? 387  HIS B CG  1 
ATOM   7130 N ND1 . HIS B 1 387 ? 7.378   -2.037  -6.143  1.00 72.34  ? 387  HIS B ND1 1 
ATOM   7131 C CD2 . HIS B 1 387 ? 6.944   -3.828  -4.968  1.00 74.91  ? 387  HIS B CD2 1 
ATOM   7132 C CE1 . HIS B 1 387 ? 6.500   -1.692  -5.217  1.00 73.23  ? 387  HIS B CE1 1 
ATOM   7133 N NE2 . HIS B 1 387 ? 6.219   -2.760  -4.491  1.00 74.95  ? 387  HIS B NE2 1 
ATOM   7134 N N   . PRO B 1 388 ? 12.288  -5.062  -6.902  1.00 72.10  ? 388  PRO B N   1 
ATOM   7135 C CA  . PRO B 1 388 ? 13.345  -5.408  -7.859  1.00 71.93  ? 388  PRO B CA  1 
ATOM   7136 C C   . PRO B 1 388 ? 13.245  -6.786  -8.503  1.00 72.55  ? 388  PRO B C   1 
ATOM   7137 O O   . PRO B 1 388 ? 13.918  -7.032  -9.498  1.00 72.43  ? 388  PRO B O   1 
ATOM   7138 C CB  . PRO B 1 388 ? 14.617  -5.333  -7.012  1.00 72.85  ? 388  PRO B CB  1 
ATOM   7139 C CG  . PRO B 1 388 ? 14.156  -5.635  -5.638  1.00 74.14  ? 388  PRO B CG  1 
ATOM   7140 C CD  . PRO B 1 388 ? 12.816  -4.973  -5.531  1.00 73.34  ? 388  PRO B CD  1 
ATOM   7141 N N   . GLU B 1 389 ? 12.438  -7.681  -7.944  1.00 73.56  ? 389  GLU B N   1 
ATOM   7142 C CA  . GLU B 1 389 ? 12.274  -9.010  -8.525  1.00 74.40  ? 389  GLU B CA  1 
ATOM   7143 C C   . GLU B 1 389 ? 10.846  -9.297  -8.980  1.00 73.45  ? 389  GLU B C   1 
ATOM   7144 O O   . GLU B 1 389 ? 10.529  -10.436 -9.338  1.00 74.46  ? 389  GLU B O   1 
ATOM   7145 C CB  . GLU B 1 389 ? 12.741  -10.080 -7.530  1.00 76.84  ? 389  GLU B CB  1 
ATOM   7146 C CG  . GLU B 1 389 ? 14.146  -9.829  -6.980  1.00 78.72  ? 389  GLU B CG  1 
ATOM   7147 C CD  . GLU B 1 389 ? 14.904  -11.114 -6.709  1.00 83.60  ? 389  GLU B CD  1 
ATOM   7148 O OE1 . GLU B 1 389 ? 15.345  -11.756 -7.694  1.00 85.16  ? 389  GLU B OE1 1 
ATOM   7149 O OE2 . GLU B 1 389 ? 15.059  -11.477 -5.514  1.00 85.82  ? 389  GLU B OE2 1 
ATOM   7150 N N   . ASP B 1 390 ? 9.992   -8.275  -8.985  1.00 71.44  ? 390  ASP B N   1 
ATOM   7151 C CA  . ASP B 1 390 ? 8.602   -8.449  -9.410  1.00 70.71  ? 390  ASP B CA  1 
ATOM   7152 C C   . ASP B 1 390 ? 8.498   -8.647  -10.924 1.00 69.33  ? 390  ASP B C   1 
ATOM   7153 O O   . ASP B 1 390 ? 8.837   -7.739  -11.688 1.00 67.75  ? 390  ASP B O   1 
ATOM   7154 C CB  . ASP B 1 390 ? 7.758   -7.246  -9.018  1.00 70.04  ? 390  ASP B CB  1 
ATOM   7155 C CG  . ASP B 1 390 ? 6.309   -7.418  -9.413  1.00 70.30  ? 390  ASP B CG  1 
ATOM   7156 O OD1 . ASP B 1 390 ? 5.679   -8.367  -8.906  1.00 72.01  ? 390  ASP B OD1 1 
ATOM   7157 O OD2 . ASP B 1 390 ? 5.806   -6.625  -10.235 1.00 67.81  ? 390  ASP B OD2 1 
ATOM   7158 N N   . PRO B 1 391 ? 8.020   -9.826  -11.364 1.00 69.93  ? 391  PRO B N   1 
ATOM   7159 C CA  . PRO B 1 391 ? 7.950   -10.137 -12.798 1.00 69.10  ? 391  PRO B CA  1 
ATOM   7160 C C   . PRO B 1 391 ? 7.136   -9.174  -13.675 1.00 66.98  ? 391  PRO B C   1 
ATOM   7161 O O   . PRO B 1 391 ? 7.474   -8.983  -14.841 1.00 65.43  ? 391  PRO B O   1 
ATOM   7162 C CB  . PRO B 1 391 ? 7.316   -11.530 -12.809 1.00 70.71  ? 391  PRO B CB  1 
ATOM   7163 C CG  . PRO B 1 391 ? 7.681   -12.113 -11.504 1.00 72.44  ? 391  PRO B CG  1 
ATOM   7164 C CD  . PRO B 1 391 ? 7.547   -10.970 -10.558 1.00 71.78  ? 391  PRO B CD  1 
ATOM   7165 N N   . THR B 1 392 ? 6.070   -8.595  -13.128 1.00 66.75  ? 392  THR B N   1 
ATOM   7166 C CA  . THR B 1 392 ? 5.257   -7.620  -13.870 1.00 65.30  ? 392  THR B CA  1 
ATOM   7167 C C   . THR B 1 392 ? 6.063   -6.347  -14.141 1.00 63.49  ? 392  THR B C   1 
ATOM   7168 O O   . THR B 1 392 ? 6.097   -5.860  -15.278 1.00 61.76  ? 392  THR B O   1 
ATOM   7169 C CB  . THR B 1 392 ? 3.940   -7.280  -13.121 1.00 65.74  ? 392  THR B CB  1 
ATOM   7170 O OG1 . THR B 1 392 ? 3.123   -8.456  -13.039 1.00 67.99  ? 392  THR B OG1 1 
ATOM   7171 C CG2 . THR B 1 392 ? 3.166   -6.200  -13.842 1.00 64.41  ? 392  THR B CG2 1 
ATOM   7172 N N   . HIS B 1 393 ? 6.721   -5.830  -13.100 1.00 63.43  ? 393  HIS B N   1 
ATOM   7173 C CA  . HIS B 1 393 ? 7.593   -4.655  -13.244 1.00 62.64  ? 393  HIS B CA  1 
ATOM   7174 C C   . HIS B 1 393 ? 8.725   -4.945  -14.228 1.00 61.43  ? 393  HIS B C   1 
ATOM   7175 O O   . HIS B 1 393 ? 9.013   -4.131  -15.086 1.00 59.81  ? 393  HIS B O   1 
ATOM   7176 C CB  . HIS B 1 393 ? 8.211   -4.222  -11.904 1.00 63.45  ? 393  HIS B CB  1 
ATOM   7177 C CG  . HIS B 1 393 ? 7.255   -3.565  -10.954 1.00 65.79  ? 393  HIS B CG  1 
ATOM   7178 N ND1 . HIS B 1 393 ? 6.285   -4.264  -10.266 1.00 68.66  ? 393  HIS B ND1 1 
ATOM   7179 C CD2 . HIS B 1 393 ? 7.166   -2.282  -10.523 1.00 66.90  ? 393  HIS B CD2 1 
ATOM   7180 C CE1 . HIS B 1 393 ? 5.622   -3.437  -9.475  1.00 68.99  ? 393  HIS B CE1 1 
ATOM   7181 N NE2 . HIS B 1 393 ? 6.140   -2.229  -9.607  1.00 68.01  ? 393  HIS B NE2 1 
ATOM   7182 N N   . LEU B 1 394 ? 9.366   -6.105  -14.093 1.00 62.41  ? 394  LEU B N   1 
ATOM   7183 C CA  . LEU B 1 394 ? 10.527  -6.442  -14.930 1.00 62.22  ? 394  LEU B CA  1 
ATOM   7184 C C   . LEU B 1 394 ? 10.174  -6.615  -16.406 1.00 61.41  ? 394  LEU B C   1 
ATOM   7185 O O   . LEU B 1 394 ? 10.951  -6.232  -17.282 1.00 60.59  ? 394  LEU B O   1 
ATOM   7186 C CB  . LEU B 1 394 ? 11.218  -7.701  -14.417 1.00 63.60  ? 394  LEU B CB  1 
ATOM   7187 C CG  . LEU B 1 394 ? 11.948  -7.570  -13.084 1.00 64.92  ? 394  LEU B CG  1 
ATOM   7188 C CD1 . LEU B 1 394 ? 12.360  -8.970  -12.583 1.00 66.01  ? 394  LEU B CD1 1 
ATOM   7189 C CD2 . LEU B 1 394 ? 13.158  -6.613  -13.195 1.00 62.96  ? 394  LEU B CD2 1 
ATOM   7190 N N   . ARG B 1 395 ? 9.013   -7.208  -16.667 1.00 61.83  ? 395  ARG B N   1 
ATOM   7191 C CA  . ARG B 1 395 ? 8.487   -7.338  -18.027 1.00 61.15  ? 395  ARG B CA  1 
ATOM   7192 C C   . ARG B 1 395 ? 8.210   -5.948  -18.624 1.00 59.57  ? 395  ARG B C   1 
ATOM   7193 O O   . ARG B 1 395 ? 8.669   -5.638  -19.730 1.00 58.39  ? 395  ARG B O   1 
ATOM   7194 C CB  . ARG B 1 395 ? 7.235   -8.226  -18.016 1.00 62.34  ? 395  ARG B CB  1 
ATOM   7195 C CG  . ARG B 1 395 ? 6.406   -8.250  -19.307 1.00 62.24  ? 395  ARG B CG  1 
ATOM   7196 C CD  . ARG B 1 395 ? 5.126   -7.468  -19.129 1.00 63.76  ? 395  ARG B CD  1 
ATOM   7197 N NE  . ARG B 1 395 ? 4.014   -8.305  -18.729 1.00 65.07  ? 395  ARG B NE  1 
ATOM   7198 C CZ  . ARG B 1 395 ? 2.901   -7.874  -18.133 1.00 65.37  ? 395  ARG B CZ  1 
ATOM   7199 N NH1 . ARG B 1 395 ? 2.712   -6.604  -17.825 1.00 62.35  ? 395  ARG B NH1 1 
ATOM   7200 N NH2 . ARG B 1 395 ? 1.949   -8.747  -17.838 1.00 68.60  ? 395  ARG B NH2 1 
ATOM   7201 N N   . ASP B 1 396 ? 7.507   -5.103  -17.871 1.00 59.10  ? 396  ASP B N   1 
ATOM   7202 C CA  . ASP B 1 396 ? 7.176   -3.755  -18.337 1.00 58.20  ? 396  ASP B CA  1 
ATOM   7203 C C   . ASP B 1 396 ? 8.425   -2.875  -18.485 1.00 56.88  ? 396  ASP B C   1 
ATOM   7204 O O   . ASP B 1 396 ? 8.496   -2.058  -19.399 1.00 55.99  ? 396  ASP B O   1 
ATOM   7205 C CB  . ASP B 1 396 ? 6.132   -3.092  -17.426 1.00 58.54  ? 396  ASP B CB  1 
ATOM   7206 C CG  . ASP B 1 396 ? 4.744   -3.718  -17.564 1.00 60.74  ? 396  ASP B CG  1 
ATOM   7207 O OD1 . ASP B 1 396 ? 4.492   -4.425  -18.568 1.00 62.64  ? 396  ASP B OD1 1 
ATOM   7208 O OD2 . ASP B 1 396 ? 3.892   -3.502  -16.670 1.00 63.39  ? 396  ASP B OD2 1 
ATOM   7209 N N   . ALA B 1 397 ? 9.408   -3.069  -17.609 1.00 57.12  ? 397  ALA B N   1 
ATOM   7210 C CA  . ALA B 1 397 ? 10.698  -2.366  -17.705 1.00 56.49  ? 397  ALA B CA  1 
ATOM   7211 C C   . ALA B 1 397 ? 11.471  -2.753  -18.973 1.00 56.14  ? 397  ALA B C   1 
ATOM   7212 O O   . ALA B 1 397 ? 12.089  -1.902  -19.611 1.00 55.59  ? 397  ALA B O   1 
ATOM   7213 C CB  . ALA B 1 397 ? 11.551  -2.631  -16.454 1.00 57.07  ? 397  ALA B CB  1 
ATOM   7214 N N   . MET B 1 398 ? 11.423  -4.031  -19.340 1.00 56.72  ? 398  MET B N   1 
ATOM   7215 C CA  . MET B 1 398 ? 12.061  -4.525  -20.568 1.00 56.38  ? 398  MET B CA  1 
ATOM   7216 C C   . MET B 1 398 ? 11.468  -3.820  -21.798 1.00 55.08  ? 398  MET B C   1 
ATOM   7217 O O   . MET B 1 398 ? 12.197  -3.338  -22.670 1.00 53.94  ? 398  MET B O   1 
ATOM   7218 C CB  . MET B 1 398 ? 11.870  -6.050  -20.661 1.00 57.66  ? 398  MET B CB  1 
ATOM   7219 C CG  . MET B 1 398 ? 12.724  -6.794  -21.691 1.00 58.48  ? 398  MET B CG  1 
ATOM   7220 S SD  . MET B 1 398 ? 14.502  -6.613  -21.488 1.00 61.04  ? 398  MET B SD  1 
ATOM   7221 C CE  . MET B 1 398 ? 14.833  -5.253  -22.610 1.00 59.62  ? 398  MET B CE  1 
ATOM   7222 N N   . SER B 1 399 ? 10.141  -3.744  -21.856 1.00 54.54  ? 399  SER B N   1 
ATOM   7223 C CA  . SER B 1 399 ? 9.479   -3.007  -22.917 1.00 53.24  ? 399  SER B CA  1 
ATOM   7224 C C   . SER B 1 399 ? 9.931   -1.542  -22.951 1.00 52.32  ? 399  SER B C   1 
ATOM   7225 O O   . SER B 1 399 ? 10.246  -1.003  -24.021 1.00 50.93  ? 399  SER B O   1 
ATOM   7226 C CB  . SER B 1 399 ? 7.968   -3.070  -22.743 1.00 53.85  ? 399  SER B CB  1 
ATOM   7227 O OG  . SER B 1 399 ? 7.331   -2.105  -23.549 1.00 53.12  ? 399  SER B OG  1 
ATOM   7228 N N   . ALA B 1 400 ? 9.957   -0.907  -21.775 1.00 51.75  ? 400  ALA B N   1 
ATOM   7229 C CA  . ALA B 1 400 ? 10.380  0.485   -21.658 1.00 50.53  ? 400  ALA B CA  1 
ATOM   7230 C C   . ALA B 1 400 ? 11.800  0.697   -22.159 1.00 50.20  ? 400  ALA B C   1 
ATOM   7231 O O   . ALA B 1 400 ? 12.058  1.671   -22.854 1.00 49.97  ? 400  ALA B O   1 
ATOM   7232 C CB  . ALA B 1 400 ? 10.246  0.976   -20.209 1.00 50.64  ? 400  ALA B CB  1 
ATOM   7233 N N   . VAL B 1 401 ? 12.723  -0.193  -21.803 1.00 50.89  ? 401  VAL B N   1 
ATOM   7234 C CA  . VAL B 1 401 ? 14.120  -0.054  -22.233 1.00 50.89  ? 401  VAL B CA  1 
ATOM   7235 C C   . VAL B 1 401 ? 14.197  0.009   -23.759 1.00 50.46  ? 401  VAL B C   1 
ATOM   7236 O O   . VAL B 1 401 ? 14.855  0.875   -24.333 1.00 49.37  ? 401  VAL B O   1 
ATOM   7237 C CB  . VAL B 1 401 ? 15.019  -1.225  -21.736 1.00 51.91  ? 401  VAL B CB  1 
ATOM   7238 C CG1 . VAL B 1 401 ? 16.381  -1.197  -22.436 1.00 51.78  ? 401  VAL B CG1 1 
ATOM   7239 C CG2 . VAL B 1 401 ? 15.220  -1.164  -20.221 1.00 51.77  ? 401  VAL B CG2 1 
ATOM   7240 N N   . VAL B 1 402 ? 13.511  -0.928  -24.403 1.00 50.97  ? 402  VAL B N   1 
ATOM   7241 C CA  . VAL B 1 402 ? 13.550  -1.059  -25.852 1.00 50.24  ? 402  VAL B CA  1 
ATOM   7242 C C   . VAL B 1 402 ? 12.827  0.111   -26.521 1.00 49.67  ? 402  VAL B C   1 
ATOM   7243 O O   . VAL B 1 402 ? 13.330  0.682   -27.483 1.00 49.39  ? 402  VAL B O   1 
ATOM   7244 C CB  . VAL B 1 402 ? 12.975  -2.418  -26.289 1.00 51.05  ? 402  VAL B CB  1 
ATOM   7245 C CG1 . VAL B 1 402 ? 12.756  -2.462  -27.810 1.00 49.89  ? 402  VAL B CG1 1 
ATOM   7246 C CG2 . VAL B 1 402 ? 13.911  -3.553  -25.836 1.00 50.81  ? 402  VAL B CG2 1 
ATOM   7247 N N   . GLY B 1 403 ? 11.666  0.483   -25.994 1.00 49.64  ? 403  GLY B N   1 
ATOM   7248 C CA  . GLY B 1 403 ? 10.931  1.626   -26.515 1.00 49.05  ? 403  GLY B CA  1 
ATOM   7249 C C   . GLY B 1 403 ? 11.680  2.941   -26.376 1.00 48.82  ? 403  GLY B C   1 
ATOM   7250 O O   . GLY B 1 403 ? 11.661  3.758   -27.295 1.00 48.76  ? 403  GLY B O   1 
ATOM   7251 N N   . ASP B 1 404 ? 12.338  3.146   -25.231 1.00 49.23  ? 404  ASP B N   1 
ATOM   7252 C CA  . ASP B 1 404 ? 12.995  4.415   -24.933 1.00 48.99  ? 404  ASP B CA  1 
ATOM   7253 C C   . ASP B 1 404 ? 14.297  4.582   -25.707 1.00 48.96  ? 404  ASP B C   1 
ATOM   7254 O O   . ASP B 1 404 ? 14.577  5.647   -26.247 1.00 48.85  ? 404  ASP B O   1 
ATOM   7255 C CB  . ASP B 1 404 ? 13.284  4.541   -23.433 1.00 49.80  ? 404  ASP B CB  1 
ATOM   7256 C CG  . ASP B 1 404 ? 12.023  4.657   -22.584 1.00 49.39  ? 404  ASP B CG  1 
ATOM   7257 O OD1 . ASP B 1 404 ? 10.948  4.969   -23.127 1.00 49.36  ? 404  ASP B OD1 1 
ATOM   7258 O OD2 . ASP B 1 404 ? 12.118  4.446   -21.353 1.00 48.49  ? 404  ASP B OD2 1 
ATOM   7259 N N   . HIS B 1 405 ? 15.097  3.525   -25.728 1.00 49.57  ? 405  HIS B N   1 
ATOM   7260 C CA  . HIS B 1 405 ? 16.372  3.493   -26.455 1.00 49.38  ? 405  HIS B CA  1 
ATOM   7261 C C   . HIS B 1 405 ? 16.161  3.741   -27.955 1.00 48.80  ? 405  HIS B C   1 
ATOM   7262 O O   . HIS B 1 405 ? 16.889  4.518   -28.585 1.00 48.42  ? 405  HIS B O   1 
ATOM   7263 C CB  . HIS B 1 405 ? 17.036  2.132   -26.202 1.00 49.92  ? 405  HIS B CB  1 
ATOM   7264 C CG  . HIS B 1 405 ? 18.276  1.873   -27.002 1.00 49.90  ? 405  HIS B CG  1 
ATOM   7265 N ND1 . HIS B 1 405 ? 19.343  2.743   -27.034 1.00 50.28  ? 405  HIS B ND1 1 
ATOM   7266 C CD2 . HIS B 1 405 ? 18.646  0.801   -27.743 1.00 50.31  ? 405  HIS B CD2 1 
ATOM   7267 C CE1 . HIS B 1 405 ? 20.303  2.234   -27.788 1.00 51.13  ? 405  HIS B CE1 1 
ATOM   7268 N NE2 . HIS B 1 405 ? 19.907  1.054   -28.227 1.00 51.36  ? 405  HIS B NE2 1 
ATOM   7269 N N   . ASN B 1 406 ? 15.149  3.086   -28.516 1.00 48.46  ? 406  ASN B N   1 
ATOM   7270 C CA  . ASN B 1 406 ? 14.950  3.086   -29.968 1.00 48.09  ? 406  ASN B CA  1 
ATOM   7271 C C   . ASN B 1 406 ? 14.028  4.190   -30.511 1.00 47.69  ? 406  ASN B C   1 
ATOM   7272 O O   . ASN B 1 406 ? 14.249  4.672   -31.634 1.00 48.02  ? 406  ASN B O   1 
ATOM   7273 C CB  . ASN B 1 406 ? 14.466  1.715   -30.404 1.00 47.78  ? 406  ASN B CB  1 
ATOM   7274 C CG  . ASN B 1 406 ? 15.529  0.656   -30.212 1.00 48.50  ? 406  ASN B CG  1 
ATOM   7275 O OD1 . ASN B 1 406 ? 16.566  0.705   -30.870 1.00 46.55  ? 406  ASN B OD1 1 
ATOM   7276 N ND2 . ASN B 1 406 ? 15.280  -0.306  -29.315 1.00 46.63  ? 406  ASN B ND2 1 
ATOM   7277 N N   . VAL B 1 407 ? 13.021  4.598   -29.738 1.00 47.13  ? 407  VAL B N   1 
ATOM   7278 C CA  . VAL B 1 407 ? 12.047  5.588   -30.230 1.00 46.64  ? 407  VAL B CA  1 
ATOM   7279 C C   . VAL B 1 407 ? 11.842  6.823   -29.350 1.00 46.84  ? 407  VAL B C   1 
ATOM   7280 O O   . VAL B 1 407 ? 12.013  7.946   -29.819 1.00 47.07  ? 407  VAL B O   1 
ATOM   7281 C CB  . VAL B 1 407 ? 10.663  4.926   -30.500 1.00 46.85  ? 407  VAL B CB  1 
ATOM   7282 C CG1 . VAL B 1 407 ? 9.703   5.918   -31.172 1.00 45.78  ? 407  VAL B CG1 1 
ATOM   7283 C CG2 . VAL B 1 407 ? 10.827  3.652   -31.352 1.00 46.01  ? 407  VAL B CG2 1 
ATOM   7284 N N   . VAL B 1 408 ? 11.455  6.643   -28.089 1.00 47.30  ? 408  VAL B N   1 
ATOM   7285 C CA  . VAL B 1 408 ? 11.029  7.788   -27.292 1.00 46.48  ? 408  VAL B CA  1 
ATOM   7286 C C   . VAL B 1 408 ? 12.167  8.805   -27.102 1.00 47.35  ? 408  VAL B C   1 
ATOM   7287 O O   . VAL B 1 408 ? 11.970  10.007  -27.293 1.00 46.85  ? 408  VAL B O   1 
ATOM   7288 C CB  . VAL B 1 408 ? 10.434  7.375   -25.928 1.00 47.18  ? 408  VAL B CB  1 
ATOM   7289 C CG1 . VAL B 1 408 ? 9.929   8.616   -25.160 1.00 45.23  ? 408  VAL B CG1 1 
ATOM   7290 C CG2 . VAL B 1 408 ? 9.302   6.313   -26.114 1.00 44.52  ? 408  VAL B CG2 1 
ATOM   7291 N N   . CYS B 1 409 ? 13.354  8.335   -26.739 1.00 47.98  ? 409  CYS B N   1 
ATOM   7292 C CA  . CYS B 1 409 ? 14.440  9.257   -26.439 1.00 48.71  ? 409  CYS B CA  1 
ATOM   7293 C C   . CYS B 1 409 ? 15.086  9.871   -27.695 1.00 48.91  ? 409  CYS B C   1 
ATOM   7294 O O   . CYS B 1 409 ? 15.462  11.066  -27.685 1.00 49.37  ? 409  CYS B O   1 
ATOM   7295 C CB  . CYS B 1 409 ? 15.460  8.595   -25.506 1.00 49.56  ? 409  CYS B CB  1 
ATOM   7296 S SG  . CYS B 1 409 ? 14.770  8.251   -23.856 1.00 50.43  ? 409  CYS B SG  1 
ATOM   7297 N N   . PRO B 1 410 ? 15.260  9.071   -28.763 1.00 48.40  ? 410  PRO B N   1 
ATOM   7298 C CA  . PRO B 1 410 ? 15.486  9.684   -30.077 1.00 48.29  ? 410  PRO B CA  1 
ATOM   7299 C C   . PRO B 1 410 ? 14.447  10.747  -30.500 1.00 47.40  ? 410  PRO B C   1 
ATOM   7300 O O   . PRO B 1 410 ? 14.838  11.789  -31.018 1.00 46.57  ? 410  PRO B O   1 
ATOM   7301 C CB  . PRO B 1 410 ? 15.483  8.476   -31.018 1.00 48.53  ? 410  PRO B CB  1 
ATOM   7302 C CG  . PRO B 1 410 ? 16.068  7.391   -30.165 1.00 48.32  ? 410  PRO B CG  1 
ATOM   7303 C CD  . PRO B 1 410 ? 15.411  7.608   -28.821 1.00 48.23  ? 410  PRO B CD  1 
ATOM   7304 N N   . VAL B 1 411 ? 13.159  10.510  -30.267 1.00 46.90  ? 411  VAL B N   1 
ATOM   7305 C CA  . VAL B 1 411 ? 12.131  11.520  -30.608 1.00 47.23  ? 411  VAL B CA  1 
ATOM   7306 C C   . VAL B 1 411 ? 12.326  12.801  -29.779 1.00 48.07  ? 411  VAL B C   1 
ATOM   7307 O O   . VAL B 1 411 ? 12.344  13.905  -30.329 1.00 48.13  ? 411  VAL B O   1 
ATOM   7308 C CB  . VAL B 1 411 ? 10.684  10.968  -30.467 1.00 46.82  ? 411  VAL B CB  1 
ATOM   7309 C CG1 . VAL B 1 411 ? 9.667   12.095  -30.402 1.00 47.33  ? 411  VAL B CG1 1 
ATOM   7310 C CG2 . VAL B 1 411 ? 10.357  10.017  -31.623 1.00 44.74  ? 411  VAL B CG2 1 
ATOM   7311 N N   . ALA B 1 412 ? 12.506  12.640  -28.466 1.00 49.12  ? 412  ALA B N   1 
ATOM   7312 C CA  . ALA B 1 412 ? 12.760  13.765  -27.547 1.00 49.72  ? 412  ALA B CA  1 
ATOM   7313 C C   . ALA B 1 412 ? 13.971  14.580  -27.984 1.00 50.30  ? 412  ALA B C   1 
ATOM   7314 O O   . ALA B 1 412 ? 13.927  15.813  -28.005 1.00 50.88  ? 412  ALA B O   1 
ATOM   7315 C CB  . ALA B 1 412 ? 12.968  13.243  -26.119 1.00 50.41  ? 412  ALA B CB  1 
ATOM   7316 N N   . GLN B 1 413 ? 15.042  13.884  -28.347 1.00 50.85  ? 413  GLN B N   1 
ATOM   7317 C CA  . GLN B 1 413 ? 16.257  14.530  -28.827 1.00 51.25  ? 413  GLN B CA  1 
ATOM   7318 C C   . GLN B 1 413 ? 16.002  15.352  -30.092 1.00 50.56  ? 413  GLN B C   1 
ATOM   7319 O O   . GLN B 1 413 ? 16.398  16.508  -30.180 1.00 50.34  ? 413  GLN B O   1 
ATOM   7320 C CB  . GLN B 1 413 ? 17.346  13.487  -29.092 1.00 52.11  ? 413  GLN B CB  1 
ATOM   7321 C CG  . GLN B 1 413 ? 18.602  14.061  -29.780 1.00 54.67  ? 413  GLN B CG  1 
ATOM   7322 C CD  . GLN B 1 413 ? 19.785  14.163  -28.876 1.00 62.36  ? 413  GLN B CD  1 
ATOM   7323 O OE1 . GLN B 1 413 ? 20.106  15.247  -28.358 1.00 68.18  ? 413  GLN B OE1 1 
ATOM   7324 N NE2 . GLN B 1 413 ? 20.464  13.032  -28.671 1.00 65.80  ? 413  GLN B NE2 1 
ATOM   7325 N N   . LEU B 1 414 ? 15.333  14.749  -31.066 1.00 49.83  ? 414  LEU B N   1 
ATOM   7326 C CA  . LEU B 1 414 ? 15.016  15.433  -32.312 1.00 49.57  ? 414  LEU B CA  1 
ATOM   7327 C C   . LEU B 1 414 ? 14.110  16.631  -32.061 1.00 49.88  ? 414  LEU B C   1 
ATOM   7328 O O   . LEU B 1 414 ? 14.341  17.707  -32.591 1.00 50.41  ? 414  LEU B O   1 
ATOM   7329 C CB  . LEU B 1 414 ? 14.335  14.475  -33.282 1.00 49.28  ? 414  LEU B CB  1 
ATOM   7330 C CG  . LEU B 1 414 ? 13.998  15.036  -34.671 1.00 49.40  ? 414  LEU B CG  1 
ATOM   7331 C CD1 . LEU B 1 414 ? 15.295  15.288  -35.439 1.00 50.27  ? 414  LEU B CD1 1 
ATOM   7332 C CD2 . LEU B 1 414 ? 13.097  14.113  -35.419 1.00 47.95  ? 414  LEU B CD2 1 
ATOM   7333 N N   . ALA B 1 415 ? 13.076  16.434  -31.253 1.00 49.75  ? 415  ALA B N   1 
ATOM   7334 C CA  . ALA B 1 415 ? 12.110  17.487  -30.987 1.00 50.25  ? 415  ALA B CA  1 
ATOM   7335 C C   . ALA B 1 415 ? 12.835  18.685  -30.399 1.00 51.72  ? 415  ALA B C   1 
ATOM   7336 O O   . ALA B 1 415 ? 12.612  19.814  -30.822 1.00 52.03  ? 415  ALA B O   1 
ATOM   7337 C CB  . ALA B 1 415 ? 11.015  16.990  -30.050 1.00 49.79  ? 415  ALA B CB  1 
ATOM   7338 N N   . GLY B 1 416 ? 13.740  18.420  -29.462 1.00 52.87  ? 416  GLY B N   1 
ATOM   7339 C CA  . GLY B 1 416 ? 14.514  19.461  -28.801 1.00 54.57  ? 416  GLY B CA  1 
ATOM   7340 C C   . GLY B 1 416 ? 15.441  20.233  -29.714 1.00 55.84  ? 416  GLY B C   1 
ATOM   7341 O O   . GLY B 1 416 ? 15.515  21.462  -29.638 1.00 56.89  ? 416  GLY B O   1 
ATOM   7342 N N   . ARG B 1 417 ? 16.159  19.516  -30.575 1.00 56.44  ? 417  ARG B N   1 
ATOM   7343 C CA  . ARG B 1 417 ? 17.104  20.155  -31.489 1.00 57.59  ? 417  ARG B CA  1 
ATOM   7344 C C   . ARG B 1 417 ? 16.364  20.979  -32.533 1.00 57.54  ? 417  ARG B C   1 
ATOM   7345 O O   . ARG B 1 417 ? 16.758  22.096  -32.825 1.00 58.48  ? 417  ARG B O   1 
ATOM   7346 C CB  . ARG B 1 417 ? 17.993  19.122  -32.195 1.00 57.74  ? 417  ARG B CB  1 
ATOM   7347 C CG  . ARG B 1 417 ? 18.879  18.270  -31.307 1.00 60.16  ? 417  ARG B CG  1 
ATOM   7348 C CD  . ARG B 1 417 ? 19.733  19.044  -30.312 1.00 65.06  ? 417  ARG B CD  1 
ATOM   7349 N NE  . ARG B 1 417 ? 20.699  19.925  -30.955 1.00 68.99  ? 417  ARG B NE  1 
ATOM   7350 C CZ  . ARG B 1 417 ? 21.865  20.314  -30.419 1.00 72.25  ? 417  ARG B CZ  1 
ATOM   7351 N NH1 . ARG B 1 417 ? 22.253  19.895  -29.209 1.00 73.95  ? 417  ARG B NH1 1 
ATOM   7352 N NH2 . ARG B 1 417 ? 22.666  21.125  -31.106 1.00 72.56  ? 417  ARG B NH2 1 
ATOM   7353 N N   . LEU B 1 418 ? 15.299  20.425  -33.104 1.00 57.04  ? 418  LEU B N   1 
ATOM   7354 C CA  . LEU B 1 418 ? 14.539  21.149  -34.126 1.00 57.27  ? 418  LEU B CA  1 
ATOM   7355 C C   . LEU B 1 418 ? 13.944  22.433  -33.548 1.00 57.94  ? 418  LEU B C   1 
ATOM   7356 O O   . LEU B 1 418 ? 13.965  23.468  -34.200 1.00 58.74  ? 418  LEU B O   1 
ATOM   7357 C CB  . LEU B 1 418 ? 13.431  20.279  -34.728 1.00 56.28  ? 418  LEU B CB  1 
ATOM   7358 C CG  . LEU B 1 418 ? 13.813  19.021  -35.521 1.00 55.66  ? 418  LEU B CG  1 
ATOM   7359 C CD1 . LEU B 1 418 ? 12.549  18.265  -35.906 1.00 54.69  ? 418  LEU B CD1 1 
ATOM   7360 C CD2 . LEU B 1 418 ? 14.631  19.324  -36.749 1.00 56.14  ? 418  LEU B CD2 1 
ATOM   7361 N N   . ALA B 1 419 ? 13.424  22.358  -32.327 1.00 57.93  ? 419  ALA B N   1 
ATOM   7362 C CA  . ALA B 1 419 ? 12.870  23.526  -31.646 1.00 59.27  ? 419  ALA B CA  1 
ATOM   7363 C C   . ALA B 1 419 ? 13.955  24.567  -31.390 1.00 60.81  ? 419  ALA B C   1 
ATOM   7364 O O   . ALA B 1 419 ? 13.784  25.751  -31.708 1.00 62.25  ? 419  ALA B O   1 
ATOM   7365 C CB  . ALA B 1 419 ? 12.209  23.117  -30.336 1.00 58.53  ? 419  ALA B CB  1 
ATOM   7366 N N   . ALA B 1 420 ? 15.079  24.116  -30.829 1.00 61.23  ? 420  ALA B N   1 
ATOM   7367 C CA  . ALA B 1 420 ? 16.206  25.002  -30.513 1.00 62.35  ? 420  ALA B CA  1 
ATOM   7368 C C   . ALA B 1 420 ? 16.743  25.706  -31.751 1.00 63.22  ? 420  ALA B C   1 
ATOM   7369 O O   . ALA B 1 420 ? 17.277  26.805  -31.654 1.00 64.52  ? 420  ALA B O   1 
ATOM   7370 C CB  . ALA B 1 420 ? 17.330  24.221  -29.832 1.00 61.98  ? 420  ALA B CB  1 
ATOM   7371 N N   . GLN B 1 421 ? 16.601  25.070  -32.909 1.00 62.85  ? 421  GLN B N   1 
ATOM   7372 C CA  . GLN B 1 421 ? 17.140  25.615  -34.145 1.00 63.87  ? 421  GLN B CA  1 
ATOM   7373 C C   . GLN B 1 421 ? 16.098  26.192  -35.111 1.00 63.00  ? 421  GLN B C   1 
ATOM   7374 O O   . GLN B 1 421 ? 16.342  26.291  -36.313 1.00 62.98  ? 421  GLN B O   1 
ATOM   7375 C CB  . GLN B 1 421 ? 18.062  24.585  -34.791 1.00 64.01  ? 421  GLN B CB  1 
ATOM   7376 C CG  . GLN B 1 421 ? 19.425  24.591  -34.068 1.00 67.64  ? 421  GLN B CG  1 
ATOM   7377 C CD  . GLN B 1 421 ? 19.968  23.211  -33.857 1.00 69.88  ? 421  GLN B CD  1 
ATOM   7378 O OE1 . GLN B 1 421 ? 20.283  22.810  -32.724 1.00 71.94  ? 421  GLN B OE1 1 
ATOM   7379 N NE2 . GLN B 1 421 ? 20.070  22.460  -34.943 1.00 70.09  ? 421  GLN B NE2 1 
ATOM   7380 N N   . GLY B 1 422 ? 14.961  26.609  -34.554 1.00 62.21  ? 422  GLY B N   1 
ATOM   7381 C CA  . GLY B 1 422 ? 14.037  27.503  -35.238 1.00 62.21  ? 422  GLY B CA  1 
ATOM   7382 C C   . GLY B 1 422 ? 12.785  26.871  -35.800 1.00 60.91  ? 422  GLY B C   1 
ATOM   7383 O O   . GLY B 1 422 ? 11.924  27.579  -36.320 1.00 61.68  ? 422  GLY B O   1 
ATOM   7384 N N   . ALA B 1 423 ? 12.664  25.551  -35.694 1.00 58.85  ? 423  ALA B N   1 
ATOM   7385 C CA  . ALA B 1 423 ? 11.502  24.855  -36.243 1.00 57.50  ? 423  ALA B CA  1 
ATOM   7386 C C   . ALA B 1 423 ? 10.268  25.050  -35.365 1.00 56.96  ? 423  ALA B C   1 
ATOM   7387 O O   . ALA B 1 423 ? 10.375  25.258  -34.159 1.00 57.72  ? 423  ALA B O   1 
ATOM   7388 C CB  . ALA B 1 423 ? 11.797  23.360  -36.418 1.00 56.20  ? 423  ALA B CB  1 
ATOM   7389 N N   . ARG B 1 424 ? 9.097   25.006  -35.982 1.00 55.93  ? 424  ARG B N   1 
ATOM   7390 C CA  . ARG B 1 424 ? 7.849   24.927  -35.240 1.00 55.63  ? 424  ARG B CA  1 
ATOM   7391 C C   . ARG B 1 424 ? 7.562   23.442  -35.012 1.00 52.83  ? 424  ARG B C   1 
ATOM   7392 O O   . ARG B 1 424 ? 7.397   22.694  -35.974 1.00 51.62  ? 424  ARG B O   1 
ATOM   7393 C CB  . ARG B 1 424 ? 6.720   25.590  -36.030 1.00 56.40  ? 424  ARG B CB  1 
ATOM   7394 C CG  . ARG B 1 424 ? 5.344   25.442  -35.416 1.00 58.38  ? 424  ARG B CG  1 
ATOM   7395 C CD  . ARG B 1 424 ? 4.334   26.370  -36.117 1.00 60.21  ? 424  ARG B CD  1 
ATOM   7396 N NE  . ARG B 1 424 ? 4.497   27.760  -35.666 1.00 63.31  ? 424  ARG B NE  1 
ATOM   7397 C CZ  . ARG B 1 424 ? 3.930   28.276  -34.580 1.00 63.45  ? 424  ARG B CZ  1 
ATOM   7398 N NH1 . ARG B 1 424 ? 4.137   29.539  -34.268 1.00 66.57  ? 424  ARG B NH1 1 
ATOM   7399 N NH2 . ARG B 1 424 ? 3.141   27.546  -33.815 1.00 64.35  ? 424  ARG B NH2 1 
ATOM   7400 N N   . VAL B 1 425 ? 7.538   23.019  -33.750 1.00 50.84  ? 425  VAL B N   1 
ATOM   7401 C CA  . VAL B 1 425 ? 7.378   21.605  -33.407 1.00 48.81  ? 425  VAL B CA  1 
ATOM   7402 C C   . VAL B 1 425 ? 6.125   21.359  -32.556 1.00 48.26  ? 425  VAL B C   1 
ATOM   7403 O O   . VAL B 1 425 ? 5.857   22.102  -31.623 1.00 47.88  ? 425  VAL B O   1 
ATOM   7404 C CB  . VAL B 1 425 ? 8.637   21.068  -32.644 1.00 48.93  ? 425  VAL B CB  1 
ATOM   7405 C CG1 . VAL B 1 425 ? 8.521   19.553  -32.385 1.00 46.54  ? 425  VAL B CG1 1 
ATOM   7406 C CG2 . VAL B 1 425 ? 9.941   21.399  -33.414 1.00 46.92  ? 425  VAL B CG2 1 
ATOM   7407 N N   . TYR B 1 426 ? 5.372   20.315  -32.889 1.00 47.51  ? 426  TYR B N   1 
ATOM   7408 C CA  . TYR B 1 426 ? 4.263   19.825  -32.059 1.00 47.47  ? 426  TYR B CA  1 
ATOM   7409 C C   . TYR B 1 426 ? 4.497   18.355  -31.734 1.00 46.78  ? 426  TYR B C   1 
ATOM   7410 O O   . TYR B 1 426 ? 4.833   17.585  -32.633 1.00 46.27  ? 426  TYR B O   1 
ATOM   7411 C CB  . TYR B 1 426 ? 2.926   19.951  -32.793 1.00 47.64  ? 426  TYR B CB  1 
ATOM   7412 C CG  . TYR B 1 426 ? 2.505   21.362  -33.087 1.00 48.07  ? 426  TYR B CG  1 
ATOM   7413 C CD1 . TYR B 1 426 ? 2.896   21.998  -34.265 1.00 48.88  ? 426  TYR B CD1 1 
ATOM   7414 C CD2 . TYR B 1 426 ? 1.712   22.063  -32.195 1.00 48.30  ? 426  TYR B CD2 1 
ATOM   7415 C CE1 . TYR B 1 426 ? 2.514   23.322  -34.532 1.00 49.54  ? 426  TYR B CE1 1 
ATOM   7416 C CE2 . TYR B 1 426 ? 1.321   23.372  -32.452 1.00 49.53  ? 426  TYR B CE2 1 
ATOM   7417 C CZ  . TYR B 1 426 ? 1.725   23.992  -33.617 1.00 50.59  ? 426  TYR B CZ  1 
ATOM   7418 O OH  . TYR B 1 426 ? 1.322   25.276  -33.851 1.00 52.16  ? 426  TYR B OH  1 
ATOM   7419 N N   . ALA B 1 427 ? 4.285   17.966  -30.471 1.00 46.84  ? 427  ALA B N   1 
ATOM   7420 C CA  . ALA B 1 427 ? 4.569   16.607  -30.015 1.00 46.63  ? 427  ALA B CA  1 
ATOM   7421 C C   . ALA B 1 427 ? 3.371   15.960  -29.345 1.00 47.12  ? 427  ALA B C   1 
ATOM   7422 O O   . ALA B 1 427 ? 2.579   16.636  -28.701 1.00 46.71  ? 427  ALA B O   1 
ATOM   7423 C CB  . ALA B 1 427 ? 5.756   16.609  -29.064 1.00 46.33  ? 427  ALA B CB  1 
ATOM   7424 N N   . TYR B 1 428 ? 3.272   14.634  -29.475 1.00 47.14  ? 428  TYR B N   1 
ATOM   7425 C CA  . TYR B 1 428 ? 2.174   13.871  -28.874 1.00 47.64  ? 428  TYR B CA  1 
ATOM   7426 C C   . TYR B 1 428 ? 2.657   12.542  -28.306 1.00 47.33  ? 428  TYR B C   1 
ATOM   7427 O O   . TYR B 1 428 ? 3.727   12.036  -28.677 1.00 47.05  ? 428  TYR B O   1 
ATOM   7428 C CB  . TYR B 1 428 ? 1.046   13.602  -29.900 1.00 48.12  ? 428  TYR B CB  1 
ATOM   7429 C CG  . TYR B 1 428 ? 1.455   12.641  -31.010 1.00 47.86  ? 428  TYR B CG  1 
ATOM   7430 C CD1 . TYR B 1 428 ? 1.366   11.261  -30.836 1.00 47.55  ? 428  TYR B CD1 1 
ATOM   7431 C CD2 . TYR B 1 428 ? 1.947   13.119  -32.219 1.00 47.27  ? 428  TYR B CD2 1 
ATOM   7432 C CE1 . TYR B 1 428 ? 1.770   10.373  -31.840 1.00 46.82  ? 428  TYR B CE1 1 
ATOM   7433 C CE2 . TYR B 1 428 ? 2.343   12.254  -33.220 1.00 47.45  ? 428  TYR B CE2 1 
ATOM   7434 C CZ  . TYR B 1 428 ? 2.256   10.879  -33.028 1.00 46.84  ? 428  TYR B CZ  1 
ATOM   7435 O OH  . TYR B 1 428 ? 2.670   10.025  -34.029 1.00 45.79  ? 428  TYR B OH  1 
ATOM   7436 N N   . ILE B 1 429 ? 1.856   11.992  -27.395 1.00 47.79  ? 429  ILE B N   1 
ATOM   7437 C CA  . ILE B 1 429 ? 1.934   10.579  -27.034 1.00 48.17  ? 429  ILE B CA  1 
ATOM   7438 C C   . ILE B 1 429 ? 0.553   9.985   -27.310 1.00 48.75  ? 429  ILE B C   1 
ATOM   7439 O O   . ILE B 1 429 ? -0.468  10.567  -26.933 1.00 50.60  ? 429  ILE B O   1 
ATOM   7440 C CB  . ILE B 1 429 ? 2.353   10.354  -25.572 1.00 48.41  ? 429  ILE B CB  1 
ATOM   7441 C CG1 . ILE B 1 429 ? 2.371   8.849   -25.264 1.00 48.82  ? 429  ILE B CG1 1 
ATOM   7442 C CG2 . ILE B 1 429 ? 1.406   11.092  -24.602 1.00 48.38  ? 429  ILE B CG2 1 
ATOM   7443 C CD1 . ILE B 1 429 ? 3.231   8.485   -24.072 1.00 49.75  ? 429  ILE B CD1 1 
ATOM   7444 N N   . PHE B 1 430 ? 0.520   8.867   -28.014 1.00 48.03  ? 430  PHE B N   1 
ATOM   7445 C CA  . PHE B 1 430 ? -0.727  8.239   -28.410 1.00 48.86  ? 430  PHE B CA  1 
ATOM   7446 C C   . PHE B 1 430 ? -1.019  7.102   -27.433 1.00 49.63  ? 430  PHE B C   1 
ATOM   7447 O O   . PHE B 1 430 ? -0.227  6.172   -27.324 1.00 49.29  ? 430  PHE B O   1 
ATOM   7448 C CB  . PHE B 1 430 ? -0.608  7.734   -29.842 1.00 48.58  ? 430  PHE B CB  1 
ATOM   7449 C CG  . PHE B 1 430 ? -1.860  7.146   -30.384 1.00 49.27  ? 430  PHE B CG  1 
ATOM   7450 C CD1 . PHE B 1 430 ? -2.139  5.803   -30.212 1.00 50.64  ? 430  PHE B CD1 1 
ATOM   7451 C CD2 . PHE B 1 430 ? -2.765  7.929   -31.072 1.00 50.61  ? 430  PHE B CD2 1 
ATOM   7452 C CE1 . PHE B 1 430 ? -3.320  5.242   -30.730 1.00 52.20  ? 430  PHE B CE1 1 
ATOM   7453 C CE2 . PHE B 1 430 ? -3.936  7.382   -31.579 1.00 51.72  ? 430  PHE B CE2 1 
ATOM   7454 C CZ  . PHE B 1 430 ? -4.211  6.032   -31.409 1.00 51.56  ? 430  PHE B CZ  1 
ATOM   7455 N N   . GLU B 1 431 ? -2.138  7.184   -26.716 1.00 50.81  ? 431  GLU B N   1 
ATOM   7456 C CA  . GLU B 1 431 ? -2.361  6.308   -25.561 1.00 52.69  ? 431  GLU B CA  1 
ATOM   7457 C C   . GLU B 1 431 ? -3.592  5.422   -25.635 1.00 54.18  ? 431  GLU B C   1 
ATOM   7458 O O   . GLU B 1 431 ? -3.915  4.756   -24.656 1.00 54.97  ? 431  GLU B O   1 
ATOM   7459 C CB  . GLU B 1 431 ? -2.480  7.129   -24.283 1.00 53.10  ? 431  GLU B CB  1 
ATOM   7460 C CG  . GLU B 1 431 ? -1.294  8.004   -23.975 1.00 53.15  ? 431  GLU B CG  1 
ATOM   7461 C CD  . GLU B 1 431 ? -1.422  8.620   -22.618 1.00 53.56  ? 431  GLU B CD  1 
ATOM   7462 O OE1 . GLU B 1 431 ? -2.521  9.145   -22.287 1.00 56.88  ? 431  GLU B OE1 1 
ATOM   7463 O OE2 . GLU B 1 431 ? -0.438  8.540   -21.867 1.00 53.87  ? 431  GLU B OE2 1 
ATOM   7464 N N   . HIS B 1 432 ? -4.280  5.417   -26.771 1.00 55.23  ? 432  HIS B N   1 
ATOM   7465 C CA  . HIS B 1 432 ? -5.472  4.601   -26.928 1.00 56.32  ? 432  HIS B CA  1 
ATOM   7466 C C   . HIS B 1 432 ? -5.145  3.254   -27.580 1.00 56.61  ? 432  HIS B C   1 
ATOM   7467 O O   . HIS B 1 432 ? -4.569  3.204   -28.665 1.00 55.83  ? 432  HIS B O   1 
ATOM   7468 C CB  . HIS B 1 432 ? -6.533  5.317   -27.759 1.00 57.02  ? 432  HIS B CB  1 
ATOM   7469 C CG  . HIS B 1 432 ? -7.719  4.457   -28.038 1.00 58.16  ? 432  HIS B CG  1 
ATOM   7470 N ND1 . HIS B 1 432 ? -8.568  4.033   -27.042 1.00 59.74  ? 432  HIS B ND1 1 
ATOM   7471 C CD2 . HIS B 1 432 ? -8.147  3.867   -29.178 1.00 59.38  ? 432  HIS B CD2 1 
ATOM   7472 C CE1 . HIS B 1 432 ? -9.496  3.249   -27.564 1.00 62.38  ? 432  HIS B CE1 1 
ATOM   7473 N NE2 . HIS B 1 432 ? -9.262  3.130   -28.859 1.00 61.53  ? 432  HIS B NE2 1 
ATOM   7474 N N   . ARG B 1 433 ? -5.531  2.174   -26.906 1.00 57.83  ? 433  ARG B N   1 
ATOM   7475 C CA  . ARG B 1 433 ? -5.401  0.824   -27.431 1.00 58.41  ? 433  ARG B CA  1 
ATOM   7476 C C   . ARG B 1 433 ? -6.673  0.484   -28.206 1.00 59.80  ? 433  ARG B C   1 
ATOM   7477 O O   . ARG B 1 433 ? -7.778  0.562   -27.665 1.00 61.14  ? 433  ARG B O   1 
ATOM   7478 C CB  . ARG B 1 433 ? -5.224  -0.150  -26.277 1.00 59.07  ? 433  ARG B CB  1 
ATOM   7479 C CG  . ARG B 1 433 ? -5.105  -1.608  -26.686 1.00 60.38  ? 433  ARG B CG  1 
ATOM   7480 C CD  . ARG B 1 433 ? -5.067  -2.507  -25.462 1.00 61.13  ? 433  ARG B CD  1 
ATOM   7481 N NE  . ARG B 1 433 ? -5.364  -3.897  -25.803 1.00 62.74  ? 433  ARG B NE  1 
ATOM   7482 C CZ  . ARG B 1 433 ? -4.452  -4.831  -26.067 1.00 63.25  ? 433  ARG B CZ  1 
ATOM   7483 N NH1 . ARG B 1 433 ? -3.150  -4.563  -26.019 1.00 61.24  ? 433  ARG B NH1 1 
ATOM   7484 N NH2 . ARG B 1 433 ? -4.849  -6.063  -26.372 1.00 63.34  ? 433  ARG B NH2 1 
ATOM   7485 N N   . ALA B 1 434 ? -6.517  0.103   -29.468 1.00 59.66  ? 434  ALA B N   1 
ATOM   7486 C CA  . ALA B 1 434 ? -7.653  -0.263  -30.302 1.00 60.90  ? 434  ALA B CA  1 
ATOM   7487 C C   . ALA B 1 434 ? -8.439  -1.411  -29.664 1.00 62.63  ? 434  ALA B C   1 
ATOM   7488 O O   . ALA B 1 434 ? -7.851  -2.382  -29.194 1.00 63.16  ? 434  ALA B O   1 
ATOM   7489 C CB  . ALA B 1 434 ? -7.172  -0.651  -31.684 1.00 60.17  ? 434  ALA B CB  1 
ATOM   7490 N N   . SER B 1 435 ? -9.764  -1.285  -29.643 1.00 63.96  ? 435  SER B N   1 
ATOM   7491 C CA  . SER B 1 435 ? -10.642 -2.295  -29.052 1.00 65.59  ? 435  SER B CA  1 
ATOM   7492 C C   . SER B 1 435 ? -10.591 -3.633  -29.787 1.00 66.28  ? 435  SER B C   1 
ATOM   7493 O O   . SER B 1 435 ? -10.867 -4.678  -29.206 1.00 67.07  ? 435  SER B O   1 
ATOM   7494 C CB  . SER B 1 435 ? -12.096 -1.791  -29.017 1.00 67.02  ? 435  SER B CB  1 
ATOM   7495 O OG  . SER B 1 435 ? -12.603 -1.548  -30.320 1.00 66.83  ? 435  SER B OG  1 
ATOM   7496 N N   . THR B 1 436 ? -10.231 -3.587  -31.064 1.00 65.70  ? 436  THR B N   1 
ATOM   7497 C CA  . THR B 1 436 ? -10.138 -4.775  -31.898 1.00 66.51  ? 436  THR B CA  1 
ATOM   7498 C C   . THR B 1 436 ? -8.710  -5.361  -32.006 1.00 65.07  ? 436  THR B C   1 
ATOM   7499 O O   . THR B 1 436 ? -8.482  -6.289  -32.770 1.00 64.99  ? 436  THR B O   1 
ATOM   7500 C CB  . THR B 1 436 ? -10.709 -4.454  -33.296 1.00 66.86  ? 436  THR B CB  1 
ATOM   7501 O OG1 . THR B 1 436 ? -10.060 -3.290  -33.817 1.00 67.34  ? 436  THR B OG1 1 
ATOM   7502 C CG2 . THR B 1 436 ? -12.212 -4.181  -33.201 1.00 68.50  ? 436  THR B CG2 1 
ATOM   7503 N N   . LEU B 1 437 ? -7.772  -4.848  -31.208 1.00 64.09  ? 437  LEU B N   1 
ATOM   7504 C CA  . LEU B 1 437 ? -6.371  -5.310  -31.229 1.00 63.16  ? 437  LEU B CA  1 
ATOM   7505 C C   . LEU B 1 437 ? -6.240  -6.787  -30.854 1.00 64.14  ? 437  LEU B C   1 
ATOM   7506 O O   . LEU B 1 437 ? -6.867  -7.241  -29.895 1.00 65.72  ? 437  LEU B O   1 
ATOM   7507 C CB  . LEU B 1 437 ? -5.523  -4.454  -30.281 1.00 62.29  ? 437  LEU B CB  1 
ATOM   7508 C CG  . LEU B 1 437 ? -3.997  -4.540  -30.363 1.00 61.21  ? 437  LEU B CG  1 
ATOM   7509 C CD1 . LEU B 1 437 ? -3.497  -4.340  -31.768 1.00 59.70  ? 437  LEU B CD1 1 
ATOM   7510 C CD2 . LEU B 1 437 ? -3.388  -3.496  -29.453 1.00 60.56  ? 437  LEU B CD2 1 
ATOM   7511 N N   . THR B 1 438 ? -5.440  -7.530  -31.625 1.00 63.51  ? 438  THR B N   1 
ATOM   7512 C CA  . THR B 1 438 ? -5.276  -8.985  -31.436 1.00 64.13  ? 438  THR B CA  1 
ATOM   7513 C C   . THR B 1 438 ? -4.026  -9.376  -30.634 1.00 63.45  ? 438  THR B C   1 
ATOM   7514 O O   . THR B 1 438 ? -3.886  -10.525 -30.220 1.00 64.12  ? 438  THR B O   1 
ATOM   7515 C CB  . THR B 1 438 ? -5.209  -9.736  -32.786 1.00 64.37  ? 438  THR B CB  1 
ATOM   7516 O OG1 . THR B 1 438 ? -4.155  -9.188  -33.587 1.00 61.73  ? 438  THR B OG1 1 
ATOM   7517 C CG2 . THR B 1 438 ? -6.539  -9.657  -33.530 1.00 64.85  ? 438  THR B CG2 1 
ATOM   7518 N N   . TRP B 1 439 ? -3.101  -8.438  -30.438 1.00 61.59  ? 439  TRP B N   1 
ATOM   7519 C CA  . TRP B 1 439 ? -1.989  -8.667  -29.518 1.00 60.94  ? 439  TRP B CA  1 
ATOM   7520 C C   . TRP B 1 439 ? -2.512  -8.649  -28.084 1.00 61.91  ? 439  TRP B C   1 
ATOM   7521 O O   . TRP B 1 439 ? -3.551  -8.034  -27.819 1.00 62.28  ? 439  TRP B O   1 
ATOM   7522 C CB  . TRP B 1 439 ? -0.936  -7.582  -29.679 1.00 59.20  ? 439  TRP B CB  1 
ATOM   7523 C CG  . TRP B 1 439 ? -0.227  -7.605  -30.977 1.00 57.74  ? 439  TRP B CG  1 
ATOM   7524 C CD1 . TRP B 1 439 ? -0.439  -6.782  -32.033 1.00 56.61  ? 439  TRP B CD1 1 
ATOM   7525 C CD2 . TRP B 1 439 ? 0.843   -8.485  -31.355 1.00 58.54  ? 439  TRP B CD2 1 
ATOM   7526 N NE1 . TRP B 1 439 ? 0.421   -7.096  -33.052 1.00 56.46  ? 439  TRP B NE1 1 
ATOM   7527 C CE2 . TRP B 1 439 ? 1.226   -8.131  -32.659 1.00 57.06  ? 439  TRP B CE2 1 
ATOM   7528 C CE3 . TRP B 1 439 ? 1.515   -9.536  -30.714 1.00 58.42  ? 439  TRP B CE3 1 
ATOM   7529 C CZ2 . TRP B 1 439 ? 2.247   -8.791  -33.343 1.00 57.66  ? 439  TRP B CZ2 1 
ATOM   7530 C CZ3 . TRP B 1 439 ? 2.533   -10.179 -31.385 1.00 58.57  ? 439  TRP B CZ3 1 
ATOM   7531 C CH2 . TRP B 1 439 ? 2.889   -9.812  -32.688 1.00 57.84  ? 439  TRP B CH2 1 
ATOM   7532 N N   . PRO B 1 440 ? -1.796  -9.299  -27.147 1.00 62.35  ? 440  PRO B N   1 
ATOM   7533 C CA  . PRO B 1 440 ? -2.262  -9.349  -25.757 1.00 63.31  ? 440  PRO B CA  1 
ATOM   7534 C C   . PRO B 1 440 ? -2.245  -8.017  -25.011 1.00 62.66  ? 440  PRO B C   1 
ATOM   7535 O O   . PRO B 1 440 ? -1.530  -7.081  -25.395 1.00 60.80  ? 440  PRO B O   1 
ATOM   7536 C CB  . PRO B 1 440 ? -1.281  -10.320 -25.096 1.00 64.16  ? 440  PRO B CB  1 
ATOM   7537 C CG  . PRO B 1 440 ? -0.061  -10.213 -25.892 1.00 62.72  ? 440  PRO B CG  1 
ATOM   7538 C CD  . PRO B 1 440 ? -0.528  -10.027 -27.311 1.00 62.28  ? 440  PRO B CD  1 
ATOM   7539 N N   . LEU B 1 441 ? -3.029  -7.957  -23.940 1.00 63.63  ? 441  LEU B N   1 
ATOM   7540 C CA  . LEU B 1 441 ? -3.138  -6.763  -23.121 1.00 63.53  ? 441  LEU B CA  1 
ATOM   7541 C C   . LEU B 1 441 ? -1.800  -6.260  -22.600 1.00 62.35  ? 441  LEU B C   1 
ATOM   7542 O O   . LEU B 1 441 ? -1.590  -5.043  -22.507 1.00 61.12  ? 441  LEU B O   1 
ATOM   7543 C CB  . LEU B 1 441 ? -4.090  -7.008  -21.941 1.00 65.47  ? 441  LEU B CB  1 
ATOM   7544 C CG  . LEU B 1 441 ? -5.576  -6.962  -22.308 1.00 67.52  ? 441  LEU B CG  1 
ATOM   7545 C CD1 . LEU B 1 441 ? -6.437  -7.573  -21.202 1.00 70.14  ? 441  LEU B CD1 1 
ATOM   7546 C CD2 . LEU B 1 441 ? -5.987  -5.515  -22.600 1.00 67.78  ? 441  LEU B CD2 1 
ATOM   7547 N N   . TRP B 1 442 ? -0.895  -7.175  -22.259 1.00 62.63  ? 442  TRP B N   1 
ATOM   7548 C CA  . TRP B 1 442 ? 0.379   -6.768  -21.651 1.00 62.03  ? 442  TRP B CA  1 
ATOM   7549 C C   . TRP B 1 442 ? 1.224   -5.886  -22.571 1.00 60.50  ? 442  TRP B C   1 
ATOM   7550 O O   . TRP B 1 442 ? 2.013   -5.069  -22.087 1.00 59.74  ? 442  TRP B O   1 
ATOM   7551 C CB  . TRP B 1 442 ? 1.185   -7.971  -21.121 1.00 63.11  ? 442  TRP B CB  1 
ATOM   7552 C CG  . TRP B 1 442 ? 1.864   -8.844  -22.139 1.00 63.08  ? 442  TRP B CG  1 
ATOM   7553 C CD1 . TRP B 1 442 ? 1.447   -10.070 -22.576 1.00 64.60  ? 442  TRP B CD1 1 
ATOM   7554 C CD2 . TRP B 1 442 ? 3.106   -8.580  -22.813 1.00 62.11  ? 442  TRP B CD2 1 
ATOM   7555 N NE1 . TRP B 1 442 ? 2.341   -10.576 -23.491 1.00 64.19  ? 442  TRP B NE1 1 
ATOM   7556 C CE2 . TRP B 1 442 ? 3.365   -9.680  -23.656 1.00 63.33  ? 442  TRP B CE2 1 
ATOM   7557 C CE3 . TRP B 1 442 ? 4.015   -7.517  -22.794 1.00 61.15  ? 442  TRP B CE3 1 
ATOM   7558 C CZ2 . TRP B 1 442 ? 4.495   -9.747  -24.475 1.00 62.30  ? 442  TRP B CZ2 1 
ATOM   7559 C CZ3 . TRP B 1 442 ? 5.138   -7.585  -23.611 1.00 60.63  ? 442  TRP B CZ3 1 
ATOM   7560 C CH2 . TRP B 1 442 ? 5.364   -8.696  -24.439 1.00 61.09  ? 442  TRP B CH2 1 
ATOM   7561 N N   . MET B 1 443 ? 1.055   -6.040  -23.882 1.00 59.94  ? 443  MET B N   1 
ATOM   7562 C CA  . MET B 1 443 ? 1.789   -5.222  -24.854 1.00 59.14  ? 443  MET B CA  1 
ATOM   7563 C C   . MET B 1 443 ? 1.275   -3.783  -24.932 1.00 57.55  ? 443  MET B C   1 
ATOM   7564 O O   . MET B 1 443 ? 1.945   -2.914  -25.494 1.00 56.83  ? 443  MET B O   1 
ATOM   7565 C CB  . MET B 1 443 ? 1.747   -5.872  -26.244 1.00 59.02  ? 443  MET B CB  1 
ATOM   7566 C CG  . MET B 1 443 ? 2.492   -7.190  -26.310 1.00 60.70  ? 443  MET B CG  1 
ATOM   7567 S SD  . MET B 1 443 ? 2.682   -7.831  -27.993 1.00 61.79  ? 443  MET B SD  1 
ATOM   7568 C CE  . MET B 1 443 ? 3.853   -9.161  -27.724 1.00 62.78  ? 443  MET B CE  1 
ATOM   7569 N N   . GLY B 1 444 ? 0.082   -3.539  -24.388 1.00 57.87  ? 444  GLY B N   1 
ATOM   7570 C CA  . GLY B 1 444 ? -0.472  -2.185  -24.298 1.00 56.52  ? 444  GLY B CA  1 
ATOM   7571 C C   . GLY B 1 444 ? -0.859  -1.586  -25.646 1.00 55.27  ? 444  GLY B C   1 
ATOM   7572 O O   . GLY B 1 444 ? -1.603  -2.202  -26.413 1.00 54.30  ? 444  GLY B O   1 
ATOM   7573 N N   . VAL B 1 445 ? -0.382  -0.363  -25.907 1.00 53.51  ? 445  VAL B N   1 
ATOM   7574 C CA  . VAL B 1 445 ? -0.535  0.298   -27.211 1.00 52.42  ? 445  VAL B CA  1 
ATOM   7575 C C   . VAL B 1 445 ? 0.769   0.141   -27.991 1.00 51.69  ? 445  VAL B C   1 
ATOM   7576 O O   . VAL B 1 445 ? 1.683   0.940   -27.813 1.00 50.37  ? 445  VAL B O   1 
ATOM   7577 C CB  . VAL B 1 445 ? -0.827  1.824   -27.044 1.00 52.33  ? 445  VAL B CB  1 
ATOM   7578 C CG1 . VAL B 1 445 ? -1.092  2.482   -28.412 1.00 50.72  ? 445  VAL B CG1 1 
ATOM   7579 C CG2 . VAL B 1 445 ? -1.981  2.061   -26.067 1.00 51.41  ? 445  VAL B CG2 1 
ATOM   7580 N N   . PRO B 1 446 ? 0.882   -0.911  -28.831 1.00 51.87  ? 446  PRO B N   1 
ATOM   7581 C CA  . PRO B 1 446 ? 2.185   -1.186  -29.410 1.00 51.42  ? 446  PRO B CA  1 
ATOM   7582 C C   . PRO B 1 446 ? 2.527   -0.339  -30.622 1.00 50.98  ? 446  PRO B C   1 
ATOM   7583 O O   . PRO B 1 446 ? 1.648   0.265   -31.243 1.00 50.95  ? 446  PRO B O   1 
ATOM   7584 C CB  . PRO B 1 446 ? 2.088   -2.666  -29.832 1.00 52.17  ? 446  PRO B CB  1 
ATOM   7585 C CG  . PRO B 1 446 ? 0.713   -3.128  -29.422 1.00 53.20  ? 446  PRO B CG  1 
ATOM   7586 C CD  . PRO B 1 446 ? -0.108  -1.901  -29.282 1.00 52.80  ? 446  PRO B CD  1 
ATOM   7587 N N   . HIS B 1 447 ? 3.818   -0.338  -30.931 1.00 50.47  ? 447  HIS B N   1 
ATOM   7588 C CA  . HIS B 1 447 ? 4.387   0.259   -32.125 1.00 50.36  ? 447  HIS B CA  1 
ATOM   7589 C C   . HIS B 1 447 ? 3.542   -0.102  -33.359 1.00 50.58  ? 447  HIS B C   1 
ATOM   7590 O O   . HIS B 1 447 ? 3.375   -1.280  -33.689 1.00 51.42  ? 447  HIS B O   1 
ATOM   7591 C CB  . HIS B 1 447 ? 5.814   -0.292  -32.252 1.00 50.44  ? 447  HIS B CB  1 
ATOM   7592 C CG  . HIS B 1 447 ? 6.652   0.335   -33.321 1.00 51.08  ? 447  HIS B CG  1 
ATOM   7593 N ND1 . HIS B 1 447 ? 7.136   1.625   -33.233 1.00 50.91  ? 447  HIS B ND1 1 
ATOM   7594 C CD2 . HIS B 1 447 ? 7.173   -0.186  -34.459 1.00 51.53  ? 447  HIS B CD2 1 
ATOM   7595 C CE1 . HIS B 1 447 ? 7.883   1.883   -34.295 1.00 50.98  ? 447  HIS B CE1 1 
ATOM   7596 N NE2 . HIS B 1 447 ? 7.930   0.795   -35.048 1.00 51.69  ? 447  HIS B NE2 1 
ATOM   7597 N N   . GLY B 1 448 ? 2.988   0.928   -34.005 1.00 49.65  ? 448  GLY B N   1 
ATOM   7598 C CA  . GLY B 1 448 ? 2.242   0.782   -35.238 1.00 49.34  ? 448  GLY B CA  1 
ATOM   7599 C C   . GLY B 1 448 ? 0.748   0.980   -35.097 1.00 49.76  ? 448  GLY B C   1 
ATOM   7600 O O   . GLY B 1 448 ? 0.069   1.151   -36.100 1.00 50.16  ? 448  GLY B O   1 
ATOM   7601 N N   . TYR B 1 449 ? 0.219   0.985   -33.874 1.00 49.78  ? 449  TYR B N   1 
ATOM   7602 C CA  . TYR B 1 449 ? -1.235  0.873   -33.693 1.00 50.69  ? 449  TYR B CA  1 
ATOM   7603 C C   . TYR B 1 449 ? -2.011  2.191   -33.522 1.00 50.69  ? 449  TYR B C   1 
ATOM   7604 O O   . TYR B 1 449 ? -3.200  2.189   -33.212 1.00 50.78  ? 449  TYR B O   1 
ATOM   7605 C CB  . TYR B 1 449 ? -1.545  -0.182  -32.620 1.00 51.49  ? 449  TYR B CB  1 
ATOM   7606 C CG  . TYR B 1 449 ? -1.246  -1.529  -33.195 1.00 51.39  ? 449  TYR B CG  1 
ATOM   7607 C CD1 . TYR B 1 449 ? 0.019   -2.090  -33.100 1.00 51.24  ? 449  TYR B CD1 1 
ATOM   7608 C CD2 . TYR B 1 449 ? -2.199  -2.189  -33.949 1.00 52.00  ? 449  TYR B CD2 1 
ATOM   7609 C CE1 . TYR B 1 449 ? 0.301   -3.322  -33.691 1.00 51.09  ? 449  TYR B CE1 1 
ATOM   7610 C CE2 . TYR B 1 449 ? -1.931  -3.399  -34.530 1.00 52.72  ? 449  TYR B CE2 1 
ATOM   7611 C CZ  . TYR B 1 449 ? -0.689  -3.959  -34.409 1.00 52.29  ? 449  TYR B CZ  1 
ATOM   7612 O OH  . TYR B 1 449 ? -0.474  -5.174  -35.018 1.00 53.06  ? 449  TYR B OH  1 
ATOM   7613 N N   . GLU B 1 450 ? -1.344  3.299   -33.818 1.00 49.50  ? 450  GLU B N   1 
ATOM   7614 C CA  . GLU B 1 450 ? -2.014  4.581   -34.021 1.00 49.66  ? 450  GLU B CA  1 
ATOM   7615 C C   . GLU B 1 450 ? -2.425  4.772   -35.492 1.00 49.81  ? 450  GLU B C   1 
ATOM   7616 O O   . GLU B 1 450 ? -3.302  5.586   -35.802 1.00 50.11  ? 450  GLU B O   1 
ATOM   7617 C CB  . GLU B 1 450 ? -1.088  5.727   -33.590 1.00 49.02  ? 450  GLU B CB  1 
ATOM   7618 C CG  . GLU B 1 450 ? -0.103  6.235   -34.645 1.00 48.71  ? 450  GLU B CG  1 
ATOM   7619 C CD  . GLU B 1 450 ? 1.105   5.339   -34.885 1.00 48.72  ? 450  GLU B CD  1 
ATOM   7620 O OE1 . GLU B 1 450 ? 1.057   4.119   -34.601 1.00 49.18  ? 450  GLU B OE1 1 
ATOM   7621 O OE2 . GLU B 1 450 ? 2.114   5.871   -35.392 1.00 47.10  ? 450  GLU B OE2 1 
ATOM   7622 N N   . ILE B 1 451 ? -1.793  4.021   -36.393 1.00 49.52  ? 451  ILE B N   1 
ATOM   7623 C CA  . ILE B 1 451 ? -1.897  4.305   -37.823 1.00 49.61  ? 451  ILE B CA  1 
ATOM   7624 C C   . ILE B 1 451 ? -3.325  4.124   -38.321 1.00 51.08  ? 451  ILE B C   1 
ATOM   7625 O O   . ILE B 1 451 ? -3.838  4.968   -39.049 1.00 51.58  ? 451  ILE B O   1 
ATOM   7626 C CB  . ILE B 1 451 ? -0.951  3.423   -38.672 1.00 49.37  ? 451  ILE B CB  1 
ATOM   7627 C CG1 . ILE B 1 451 ? 0.519   3.633   -38.263 1.00 48.27  ? 451  ILE B CG1 1 
ATOM   7628 C CG2 . ILE B 1 451 ? -1.105  3.748   -40.167 1.00 48.55  ? 451  ILE B CG2 1 
ATOM   7629 C CD1 . ILE B 1 451 ? 1.471   2.580   -38.831 1.00 47.57  ? 451  ILE B CD1 1 
ATOM   7630 N N   . GLU B 1 452 ? -3.959  3.019   -37.939 1.00 52.07  ? 452  GLU B N   1 
ATOM   7631 C CA  . GLU B 1 452 ? -5.343  2.755   -38.336 1.00 53.62  ? 452  GLU B CA  1 
ATOM   7632 C C   . GLU B 1 452 ? -6.315  3.877   -37.918 1.00 54.30  ? 452  GLU B C   1 
ATOM   7633 O O   . GLU B 1 452 ? -7.322  4.097   -38.592 1.00 55.55  ? 452  GLU B O   1 
ATOM   7634 C CB  . GLU B 1 452 ? -5.816  1.406   -37.790 1.00 54.30  ? 452  GLU B CB  1 
ATOM   7635 C CG  . GLU B 1 452 ? -5.801  1.269   -36.259 1.00 55.34  ? 452  GLU B CG  1 
ATOM   7636 C CD  . GLU B 1 452 ? -5.825  -0.195  -35.821 1.00 56.48  ? 452  GLU B CD  1 
ATOM   7637 O OE1 . GLU B 1 452 ? -6.905  -0.668  -35.375 1.00 58.02  ? 452  GLU B OE1 1 
ATOM   7638 O OE2 . GLU B 1 452 ? -4.771  -0.868  -35.947 1.00 55.40  ? 452  GLU B OE2 1 
ATOM   7639 N N   . PHE B 1 453 ? -6.003  4.583   -36.828 1.00 53.94  ? 453  PHE B N   1 
ATOM   7640 C CA  . PHE B 1 453 ? -6.808  5.722   -36.381 1.00 54.26  ? 453  PHE B CA  1 
ATOM   7641 C C   . PHE B 1 453 ? -6.544  6.989   -37.184 1.00 53.95  ? 453  PHE B C   1 
ATOM   7642 O O   . PHE B 1 453 ? -7.482  7.697   -37.540 1.00 54.62  ? 453  PHE B O   1 
ATOM   7643 C CB  . PHE B 1 453 ? -6.601  5.978   -34.883 1.00 54.41  ? 453  PHE B CB  1 
ATOM   7644 C CG  . PHE B 1 453 ? -7.118  4.876   -34.028 1.00 55.08  ? 453  PHE B CG  1 
ATOM   7645 C CD1 . PHE B 1 453 ? -8.461  4.819   -33.694 1.00 57.39  ? 453  PHE B CD1 1 
ATOM   7646 C CD2 . PHE B 1 453 ? -6.279  3.854   -33.609 1.00 55.01  ? 453  PHE B CD2 1 
ATOM   7647 C CE1 . PHE B 1 453 ? -8.958  3.775   -32.932 1.00 58.16  ? 453  PHE B CE1 1 
ATOM   7648 C CE2 . PHE B 1 453 ? -6.760  2.813   -32.847 1.00 56.20  ? 453  PHE B CE2 1 
ATOM   7649 C CZ  . PHE B 1 453 ? -8.106  2.769   -32.511 1.00 57.49  ? 453  PHE B CZ  1 
ATOM   7650 N N   . ILE B 1 454 ? -5.276  7.280   -37.467 1.00 53.01  ? 454  ILE B N   1 
ATOM   7651 C CA  . ILE B 1 454 ? -4.931  8.455   -38.265 1.00 52.98  ? 454  ILE B CA  1 
ATOM   7652 C C   . ILE B 1 454 ? -5.496  8.325   -39.677 1.00 53.37  ? 454  ILE B C   1 
ATOM   7653 O O   . ILE B 1 454 ? -5.992  9.305   -40.240 1.00 52.99  ? 454  ILE B O   1 
ATOM   7654 C CB  . ILE B 1 454 ? -3.407  8.674   -38.374 1.00 52.09  ? 454  ILE B CB  1 
ATOM   7655 C CG1 . ILE B 1 454 ? -2.786  8.856   -36.989 1.00 52.60  ? 454  ILE B CG1 1 
ATOM   7656 C CG2 . ILE B 1 454 ? -3.104  9.882   -39.258 1.00 51.40  ? 454  ILE B CG2 1 
ATOM   7657 C CD1 . ILE B 1 454 ? -3.365  9.993   -36.219 1.00 54.72  ? 454  ILE B CD1 1 
ATOM   7658 N N   . PHE B 1 455 ? -5.419  7.116   -40.241 1.00 53.27  ? 455  PHE B N   1 
ATOM   7659 C CA  . PHE B 1 455 ? -5.972  6.862   -41.587 1.00 53.80  ? 455  PHE B CA  1 
ATOM   7660 C C   . PHE B 1 455 ? -7.499  6.778   -41.628 1.00 55.04  ? 455  PHE B C   1 
ATOM   7661 O O   . PHE B 1 455 ? -8.087  6.793   -42.712 1.00 55.78  ? 455  PHE B O   1 
ATOM   7662 C CB  . PHE B 1 455 ? -5.317  5.636   -42.249 1.00 53.05  ? 455  PHE B CB  1 
ATOM   7663 C CG  . PHE B 1 455 ? -4.033  5.959   -42.960 1.00 51.53  ? 455  PHE B CG  1 
ATOM   7664 C CD1 . PHE B 1 455 ? -2.823  5.943   -42.288 1.00 51.25  ? 455  PHE B CD1 1 
ATOM   7665 C CD2 . PHE B 1 455 ? -4.040  6.318   -44.289 1.00 51.39  ? 455  PHE B CD2 1 
ATOM   7666 C CE1 . PHE B 1 455 ? -1.651  6.251   -42.943 1.00 50.48  ? 455  PHE B CE1 1 
ATOM   7667 C CE2 . PHE B 1 455 ? -2.879  6.635   -44.946 1.00 50.05  ? 455  PHE B CE2 1 
ATOM   7668 C CZ  . PHE B 1 455 ? -1.684  6.590   -44.285 1.00 50.29  ? 455  PHE B CZ  1 
ATOM   7669 N N   . GLY B 1 456 ? -8.137  6.690   -40.462 1.00 55.87  ? 456  GLY B N   1 
ATOM   7670 C CA  . GLY B 1 456 ? -9.593  6.852   -40.362 1.00 57.11  ? 456  GLY B CA  1 
ATOM   7671 C C   . GLY B 1 456 ? -10.411 5.587   -40.523 1.00 58.40  ? 456  GLY B C   1 
ATOM   7672 O O   . GLY B 1 456 ? -11.613 5.651   -40.785 1.00 59.60  ? 456  GLY B O   1 
ATOM   7673 N N   . LEU B 1 457 ? -9.775  4.434   -40.334 1.00 58.38  ? 457  LEU B N   1 
ATOM   7674 C CA  . LEU B 1 457 ? -10.439 3.148   -40.539 1.00 59.81  ? 457  LEU B CA  1 
ATOM   7675 C C   . LEU B 1 457 ? -11.683 2.939   -39.671 1.00 61.40  ? 457  LEU B C   1 
ATOM   7676 O O   . LEU B 1 457 ? -12.660 2.369   -40.145 1.00 63.39  ? 457  LEU B O   1 
ATOM   7677 C CB  . LEU B 1 457 ? -9.460  1.987   -40.354 1.00 59.02  ? 457  LEU B CB  1 
ATOM   7678 C CG  . LEU B 1 457 ? -8.691  1.567   -41.610 1.00 58.80  ? 457  LEU B CG  1 
ATOM   7679 C CD1 . LEU B 1 457 ? -7.756  2.681   -42.087 1.00 57.13  ? 457  LEU B CD1 1 
ATOM   7680 C CD2 . LEU B 1 457 ? -7.927  0.276   -41.337 1.00 58.15  ? 457  LEU B CD2 1 
ATOM   7681 N N   . PRO B 1 458 ? -11.657 3.372   -38.399 1.00 61.63  ? 458  PRO B N   1 
ATOM   7682 C CA  . PRO B 1 458 ? -12.879 3.260   -37.571 1.00 63.30  ? 458  PRO B CA  1 
ATOM   7683 C C   . PRO B 1 458 ? -14.156 3.897   -38.134 1.00 65.29  ? 458  PRO B C   1 
ATOM   7684 O O   . PRO B 1 458 ? -15.254 3.583   -37.649 1.00 66.86  ? 458  PRO B O   1 
ATOM   7685 C CB  . PRO B 1 458 ? -12.471 3.922   -36.250 1.00 62.93  ? 458  PRO B CB  1 
ATOM   7686 C CG  . PRO B 1 458 ? -10.965 3.772   -36.207 1.00 60.85  ? 458  PRO B CG  1 
ATOM   7687 C CD  . PRO B 1 458 ? -10.513 3.886   -37.621 1.00 60.43  ? 458  PRO B CD  1 
ATOM   7688 N N   . LEU B 1 459 ? -14.029 4.755   -39.146 1.00 65.34  ? 459  LEU B N   1 
ATOM   7689 C CA  . LEU B 1 459 ? -15.200 5.311   -39.832 1.00 67.19  ? 459  LEU B CA  1 
ATOM   7690 C C   . LEU B 1 459 ? -15.953 4.261   -40.669 1.00 68.64  ? 459  LEU B C   1 
ATOM   7691 O O   . LEU B 1 459 ? -17.095 4.488   -41.060 1.00 70.29  ? 459  LEU B O   1 
ATOM   7692 C CB  . LEU B 1 459 ? -14.811 6.508   -40.708 1.00 66.65  ? 459  LEU B CB  1 
ATOM   7693 C CG  . LEU B 1 459 ? -14.483 7.855   -40.045 1.00 66.04  ? 459  LEU B CG  1 
ATOM   7694 C CD1 . LEU B 1 459 ? -13.309 7.775   -39.083 1.00 63.70  ? 459  LEU B CD1 1 
ATOM   7695 C CD2 . LEU B 1 459 ? -14.192 8.874   -41.131 1.00 65.80  ? 459  LEU B CD2 1 
ATOM   7696 N N   . ASP B 1 460 ? -15.313 3.128   -40.949 1.00 68.67  ? 460  ASP B N   1 
ATOM   7697 C CA  . ASP B 1 460 ? -15.975 2.000   -41.607 1.00 69.98  ? 460  ASP B CA  1 
ATOM   7698 C C   . ASP B 1 460 ? -16.662 1.124   -40.546 1.00 71.70  ? 460  ASP B C   1 
ATOM   7699 O O   . ASP B 1 460 ? -15.984 0.449   -39.770 1.00 70.75  ? 460  ASP B O   1 
ATOM   7700 C CB  . ASP B 1 460 ? -14.958 1.173   -42.401 1.00 68.85  ? 460  ASP B CB  1 
ATOM   7701 C CG  . ASP B 1 460 ? -15.595 -0.008  -43.150 1.00 70.31  ? 460  ASP B CG  1 
ATOM   7702 O OD1 . ASP B 1 460 ? -16.845 -0.137  -43.180 1.00 73.05  ? 460  ASP B OD1 1 
ATOM   7703 O OD2 . ASP B 1 460 ? -14.833 -0.819  -43.719 1.00 70.12  ? 460  ASP B OD2 1 
ATOM   7704 N N   . PRO B 1 461 ? -18.014 1.097   -40.532 1.00 74.52  ? 461  PRO B N   1 
ATOM   7705 C CA  . PRO B 1 461 ? -18.696 0.343   -39.467 1.00 76.12  ? 461  PRO B CA  1 
ATOM   7706 C C   . PRO B 1 461 ? -18.460 -1.173  -39.551 1.00 76.56  ? 461  PRO B C   1 
ATOM   7707 O O   . PRO B 1 461 ? -18.579 -1.871  -38.538 1.00 77.42  ? 461  PRO B O   1 
ATOM   7708 C CB  . PRO B 1 461 ? -20.191 0.668   -39.673 1.00 78.33  ? 461  PRO B CB  1 
ATOM   7709 C CG  . PRO B 1 461 ? -20.265 1.700   -40.747 1.00 78.22  ? 461  PRO B CG  1 
ATOM   7710 C CD  . PRO B 1 461 ? -18.966 1.686   -41.494 1.00 75.91  ? 461  PRO B CD  1 
ATOM   7711 N N   . SER B 1 462 ? -18.123 -1.673  -40.739 1.00 76.12  ? 462  SER B N   1 
ATOM   7712 C CA  . SER B 1 462 ? -17.862 -3.097  -40.924 1.00 76.49  ? 462  SER B CA  1 
ATOM   7713 C C   . SER B 1 462 ? -16.663 -3.602  -40.112 1.00 75.06  ? 462  SER B C   1 
ATOM   7714 O O   . SER B 1 462 ? -16.545 -4.807  -39.885 1.00 75.98  ? 462  SER B O   1 
ATOM   7715 C CB  . SER B 1 462 ? -17.652 -3.420  -42.412 1.00 76.41  ? 462  SER B CB  1 
ATOM   7716 O OG  . SER B 1 462 ? -16.373 -3.005  -42.871 1.00 74.42  ? 462  SER B OG  1 
ATOM   7717 N N   . LEU B 1 463 ? -15.789 -2.692  -39.675 1.00 73.17  ? 463  LEU B N   1 
ATOM   7718 C CA  . LEU B 1 463 ? -14.577 -3.061  -38.939 1.00 71.66  ? 463  LEU B CA  1 
ATOM   7719 C C   . LEU B 1 463 ? -14.778 -3.169  -37.424 1.00 72.14  ? 463  LEU B C   1 
ATOM   7720 O O   . LEU B 1 463 ? -13.861 -3.565  -36.707 1.00 71.62  ? 463  LEU B O   1 
ATOM   7721 C CB  . LEU B 1 463 ? -13.441 -2.070  -39.247 1.00 69.62  ? 463  LEU B CB  1 
ATOM   7722 C CG  . LEU B 1 463 ? -13.026 -1.920  -40.720 1.00 68.57  ? 463  LEU B CG  1 
ATOM   7723 C CD1 . LEU B 1 463 ? -11.916 -0.894  -40.873 1.00 64.65  ? 463  LEU B CD1 1 
ATOM   7724 C CD2 . LEU B 1 463 ? -12.599 -3.264  -41.319 1.00 69.50  ? 463  LEU B CD2 1 
ATOM   7725 N N   . ASN B 1 464 ? -15.958 -2.806  -36.932 1.00 73.46  ? 464  ASN B N   1 
ATOM   7726 C CA  . ASN B 1 464 ? -16.357 -3.111  -35.546 1.00 74.30  ? 464  ASN B CA  1 
ATOM   7727 C C   . ASN B 1 464 ? -15.616 -2.346  -34.444 1.00 72.62  ? 464  ASN B C   1 
ATOM   7728 O O   . ASN B 1 464 ? -15.513 -2.825  -33.312 1.00 73.20  ? 464  ASN B O   1 
ATOM   7729 C CB  . ASN B 1 464 ? -16.272 -4.630  -35.273 1.00 75.41  ? 464  ASN B CB  1 
ATOM   7730 C CG  . ASN B 1 464 ? -17.130 -5.448  -36.230 1.00 77.60  ? 464  ASN B CG  1 
ATOM   7731 O OD1 . ASN B 1 464 ? -18.275 -5.092  -36.512 1.00 79.33  ? 464  ASN B OD1 1 
ATOM   7732 N ND2 . ASN B 1 464 ? -16.580 -6.551  -36.725 1.00 79.36  ? 464  ASN B ND2 1 
ATOM   7733 N N   . TYR B 1 465 ? -15.119 -1.156  -34.767 1.00 70.56  ? 465  TYR B N   1 
ATOM   7734 C CA  . TYR B 1 465 ? -14.655 -0.217  -33.747 1.00 69.03  ? 465  TYR B CA  1 
ATOM   7735 C C   . TYR B 1 465 ? -15.867 0.380   -33.035 1.00 70.26  ? 465  TYR B C   1 
ATOM   7736 O O   . TYR B 1 465 ? -16.985 0.329   -33.555 1.00 71.25  ? 465  TYR B O   1 
ATOM   7737 C CB  . TYR B 1 465 ? -13.851 0.926   -34.377 1.00 67.51  ? 465  TYR B CB  1 
ATOM   7738 C CG  . TYR B 1 465 ? -12.544 0.534   -35.035 1.00 65.26  ? 465  TYR B CG  1 
ATOM   7739 C CD1 . TYR B 1 465 ? -11.354 0.508   -34.310 1.00 64.82  ? 465  TYR B CD1 1 
ATOM   7740 C CD2 . TYR B 1 465 ? -12.494 0.217   -36.381 1.00 64.56  ? 465  TYR B CD2 1 
ATOM   7741 C CE1 . TYR B 1 465 ? -10.156 0.158   -34.911 1.00 62.92  ? 465  TYR B CE1 1 
ATOM   7742 C CE2 . TYR B 1 465 ? -11.301 -0.125  -36.997 1.00 64.07  ? 465  TYR B CE2 1 
ATOM   7743 C CZ  . TYR B 1 465 ? -10.135 -0.150  -36.257 1.00 63.00  ? 465  TYR B CZ  1 
ATOM   7744 O OH  . TYR B 1 465 ? -8.951  -0.484  -36.865 1.00 61.82  ? 465  TYR B OH  1 
ATOM   7745 N N   . THR B 1 466 ? -15.641 0.969   -31.863 1.00 69.59  ? 466  THR B N   1 
ATOM   7746 C CA  . THR B 1 466 ? -16.719 1.590   -31.095 1.00 70.93  ? 466  THR B CA  1 
ATOM   7747 C C   . THR B 1 466 ? -17.052 2.968   -31.662 1.00 71.00  ? 466  THR B C   1 
ATOM   7748 O O   . THR B 1 466 ? -16.286 3.517   -32.451 1.00 69.69  ? 466  THR B O   1 
ATOM   7749 C CB  . THR B 1 466 ? -16.354 1.740   -29.603 1.00 70.62  ? 466  THR B CB  1 
ATOM   7750 O OG1 . THR B 1 466 ? -15.362 2.761   -29.443 1.00 69.23  ? 466  THR B OG1 1 
ATOM   7751 C CG2 . THR B 1 466 ? -15.837 0.422   -29.029 1.00 70.28  ? 466  THR B CG2 1 
ATOM   7752 N N   . THR B 1 467 ? -18.203 3.513   -31.264 1.00 72.63  ? 467  THR B N   1 
ATOM   7753 C CA  . THR B 1 467 ? -18.596 4.883   -31.621 1.00 72.95  ? 467  THR B CA  1 
ATOM   7754 C C   . THR B 1 467 ? -17.564 5.906   -31.149 1.00 71.29  ? 467  THR B C   1 
ATOM   7755 O O   . THR B 1 467 ? -17.314 6.911   -31.814 1.00 70.43  ? 467  THR B O   1 
ATOM   7756 C CB  . THR B 1 467 ? -19.950 5.251   -30.991 1.00 75.12  ? 467  THR B CB  1 
ATOM   7757 O OG1 . THR B 1 467 ? -20.968 4.411   -31.538 1.00 77.32  ? 467  THR B OG1 1 
ATOM   7758 C CG2 . THR B 1 467 ? -20.315 6.708   -31.262 1.00 75.70  ? 467  THR B CG2 1 
ATOM   7759 N N   . GLU B 1 468 ? -16.976 5.630   -29.992 1.00 70.86  ? 468  GLU B N   1 
ATOM   7760 C CA  . GLU B 1 468 ? -15.993 6.504   -29.378 1.00 69.74  ? 468  GLU B CA  1 
ATOM   7761 C C   . GLU B 1 468 ? -14.691 6.504   -30.193 1.00 67.22  ? 468  GLU B C   1 
ATOM   7762 O O   . GLU B 1 468 ? -14.015 7.527   -30.312 1.00 66.03  ? 468  GLU B O   1 
ATOM   7763 C CB  . GLU B 1 468 ? -15.719 6.052   -27.932 1.00 70.40  ? 468  GLU B CB  1 
ATOM   7764 C CG  . GLU B 1 468 ? -16.912 6.209   -26.953 1.00 74.76  ? 468  GLU B CG  1 
ATOM   7765 C CD  . GLU B 1 468 ? -17.969 5.084   -27.060 1.00 79.72  ? 468  GLU B CD  1 
ATOM   7766 O OE1 . GLU B 1 468 ? -19.132 5.322   -26.663 1.00 83.88  ? 468  GLU B OE1 1 
ATOM   7767 O OE2 . GLU B 1 468 ? -17.651 3.967   -27.542 1.00 81.46  ? 468  GLU B OE2 1 
ATOM   7768 N N   . GLU B 1 469 ? -14.351 5.344   -30.746 1.00 66.11  ? 469  GLU B N   1 
ATOM   7769 C CA  . GLU B 1 469 ? -13.178 5.208   -31.598 1.00 63.95  ? 469  GLU B CA  1 
ATOM   7770 C C   . GLU B 1 469 ? -13.378 5.898   -32.943 1.00 63.58  ? 469  GLU B C   1 
ATOM   7771 O O   . GLU B 1 469 ? -12.438 6.453   -33.500 1.00 62.06  ? 469  GLU B O   1 
ATOM   7772 C CB  . GLU B 1 469 ? -12.822 3.736   -31.780 1.00 63.46  ? 469  GLU B CB  1 
ATOM   7773 C CG  . GLU B 1 469 ? -12.059 3.186   -30.589 1.00 62.99  ? 469  GLU B CG  1 
ATOM   7774 C CD  . GLU B 1 469 ? -11.844 1.685   -30.640 1.00 63.58  ? 469  GLU B CD  1 
ATOM   7775 O OE1 . GLU B 1 469 ? -12.707 0.965   -31.182 1.00 64.96  ? 469  GLU B OE1 1 
ATOM   7776 O OE2 . GLU B 1 469 ? -10.813 1.221   -30.115 1.00 63.39  ? 469  GLU B OE2 1 
ATOM   7777 N N   . ARG B 1 470 ? -14.604 5.881   -33.451 1.00 64.86  ? 470  ARG B N   1 
ATOM   7778 C CA  . ARG B 1 470 ? -14.925 6.598   -34.681 1.00 65.15  ? 470  ARG B CA  1 
ATOM   7779 C C   . ARG B 1 470 ? -14.765 8.105   -34.468 1.00 64.12  ? 470  ARG B C   1 
ATOM   7780 O O   . ARG B 1 470 ? -14.114 8.785   -35.250 1.00 63.29  ? 470  ARG B O   1 
ATOM   7781 C CB  . ARG B 1 470 ? -16.341 6.244   -35.134 1.00 67.35  ? 470  ARG B CB  1 
ATOM   7782 C CG  . ARG B 1 470 ? -16.685 6.661   -36.555 1.00 70.38  ? 470  ARG B CG  1 
ATOM   7783 C CD  . ARG B 1 470 ? -17.603 7.883   -36.583 1.00 75.71  ? 470  ARG B CD  1 
ATOM   7784 N NE  . ARG B 1 470 ? -18.967 7.564   -36.137 1.00 78.92  ? 470  ARG B NE  1 
ATOM   7785 C CZ  . ARG B 1 470 ? -19.768 8.390   -35.457 1.00 81.41  ? 470  ARG B CZ  1 
ATOM   7786 N NH1 . ARG B 1 470 ? -19.373 9.620   -35.112 1.00 81.58  ? 470  ARG B NH1 1 
ATOM   7787 N NH2 . ARG B 1 470 ? -20.981 7.981   -35.104 1.00 83.61  ? 470  ARG B NH2 1 
ATOM   7788 N N   . ILE B 1 471 ? -15.339 8.613   -33.384 1.00 64.25  ? 471  ILE B N   1 
ATOM   7789 C CA  . ILE B 1 471 ? -15.206 10.027  -33.007 1.00 63.80  ? 471  ILE B CA  1 
ATOM   7790 C C   . ILE B 1 471 ? -13.736 10.440  -32.796 1.00 61.80  ? 471  ILE B C   1 
ATOM   7791 O O   . ILE B 1 471 ? -13.332 11.516  -33.222 1.00 61.51  ? 471  ILE B O   1 
ATOM   7792 C CB  . ILE B 1 471 ? -16.064 10.347  -31.742 1.00 65.05  ? 471  ILE B CB  1 
ATOM   7793 C CG1 . ILE B 1 471 ? -17.560 10.305  -32.106 1.00 67.49  ? 471  ILE B CG1 1 
ATOM   7794 C CG2 . ILE B 1 471 ? -15.707 11.715  -31.149 1.00 64.71  ? 471  ILE B CG2 1 
ATOM   7795 C CD1 . ILE B 1 471 ? -18.490 10.488  -30.915 1.00 68.97  ? 471  ILE B CD1 1 
ATOM   7796 N N   . PHE B 1 472 ? -12.952 9.569   -32.164 1.00 60.63  ? 472  PHE B N   1 
ATOM   7797 C CA  . PHE B 1 472 ? -11.515 9.791   -31.924 1.00 58.92  ? 472  PHE B CA  1 
ATOM   7798 C C   . PHE B 1 472 ? -10.729 9.844   -33.245 1.00 58.16  ? 472  PHE B C   1 
ATOM   7799 O O   . PHE B 1 472 ? -9.872  10.713  -33.435 1.00 57.01  ? 472  PHE B O   1 
ATOM   7800 C CB  . PHE B 1 472 ? -11.010 8.669   -31.003 1.00 58.27  ? 472  PHE B CB  1 
ATOM   7801 C CG  . PHE B 1 472 ? -9.532  8.709   -30.677 1.00 56.19  ? 472  PHE B CG  1 
ATOM   7802 C CD1 . PHE B 1 472 ? -8.931  9.856   -30.197 1.00 54.31  ? 472  PHE B CD1 1 
ATOM   7803 C CD2 . PHE B 1 472 ? -8.766  7.552   -30.787 1.00 54.92  ? 472  PHE B CD2 1 
ATOM   7804 C CE1 . PHE B 1 472 ? -7.588  9.876   -29.871 1.00 53.02  ? 472  PHE B CE1 1 
ATOM   7805 C CE2 . PHE B 1 472 ? -7.416  7.555   -30.461 1.00 54.67  ? 472  PHE B CE2 1 
ATOM   7806 C CZ  . PHE B 1 472 ? -6.823  8.723   -29.996 1.00 53.57  ? 472  PHE B CZ  1 
ATOM   7807 N N   . ALA B 1 473 ? -11.027 8.919   -34.156 1.00 58.62  ? 473  ALA B N   1 
ATOM   7808 C CA  . ALA B 1 473 ? -10.400 8.901   -35.482 1.00 58.22  ? 473  ALA B CA  1 
ATOM   7809 C C   . ALA B 1 473 ? -10.681 10.198  -36.248 1.00 59.08  ? 473  ALA B C   1 
ATOM   7810 O O   . ALA B 1 473 ? -9.786  10.751  -36.889 1.00 57.90  ? 473  ALA B O   1 
ATOM   7811 C CB  . ALA B 1 473 ? -10.889 7.696   -36.284 1.00 58.66  ? 473  ALA B CB  1 
ATOM   7812 N N   . GLN B 1 474 ? -11.927 10.671  -36.185 1.00 60.98  ? 474  GLN B N   1 
ATOM   7813 C CA  . GLN B 1 474 ? -12.310 11.934  -36.821 1.00 62.49  ? 474  GLN B CA  1 
ATOM   7814 C C   . GLN B 1 474 ? -11.512 13.129  -36.259 1.00 61.88  ? 474  GLN B C   1 
ATOM   7815 O O   . GLN B 1 474 ? -11.166 14.041  -37.001 1.00 61.65  ? 474  GLN B O   1 
ATOM   7816 C CB  . GLN B 1 474 ? -13.835 12.176  -36.690 1.00 64.26  ? 474  GLN B CB  1 
ATOM   7817 C CG  . GLN B 1 474 ? -14.695 11.209  -37.530 1.00 65.79  ? 474  GLN B CG  1 
ATOM   7818 C CD  . GLN B 1 474 ? -16.221 11.389  -37.367 1.00 68.33  ? 474  GLN B CD  1 
ATOM   7819 O OE1 . GLN B 1 474 ? -16.729 11.612  -36.271 1.00 70.29  ? 474  GLN B OE1 1 
ATOM   7820 N NE2 . GLN B 1 474 ? -16.945 11.273  -38.473 1.00 71.86  ? 474  GLN B NE2 1 
ATOM   7821 N N   . ARG B 1 475 ? -11.229 13.116  -34.952 1.00 62.06  ? 475  ARG B N   1 
ATOM   7822 C CA  . ARG B 1 475 ? -10.398 14.148  -34.320 1.00 61.64  ? 475  ARG B CA  1 
ATOM   7823 C C   . ARG B 1 475 ? -8.969  14.084  -34.845 1.00 59.55  ? 475  ARG B C   1 
ATOM   7824 O O   . ARG B 1 475 ? -8.371  15.108  -35.156 1.00 59.11  ? 475  ARG B O   1 
ATOM   7825 C CB  . ARG B 1 475 ? -10.333 13.979  -32.793 1.00 61.85  ? 475  ARG B CB  1 
ATOM   7826 C CG  . ARG B 1 475 ? -11.594 14.343  -32.006 1.00 64.97  ? 475  ARG B CG  1 
ATOM   7827 C CD  . ARG B 1 475 ? -11.433 13.999  -30.490 1.00 64.50  ? 475  ARG B CD  1 
ATOM   7828 N NE  . ARG B 1 475 ? -10.159 14.501  -29.966 1.00 63.50  ? 475  ARG B NE  1 
ATOM   7829 C CZ  . ARG B 1 475 ? -9.454  13.952  -28.974 1.00 62.37  ? 475  ARG B CZ  1 
ATOM   7830 N NH1 . ARG B 1 475 ? -9.872  12.862  -28.345 1.00 61.55  ? 475  ARG B NH1 1 
ATOM   7831 N NH2 . ARG B 1 475 ? -8.299  14.502  -28.618 1.00 61.79  ? 475  ARG B NH2 1 
ATOM   7832 N N   . LEU B 1 476 ? -8.423  12.875  -34.908 1.00 58.37  ? 476  LEU B N   1 
ATOM   7833 C CA  . LEU B 1 476 ? -7.047  12.673  -35.356 1.00 57.02  ? 476  LEU B CA  1 
ATOM   7834 C C   . LEU B 1 476 ? -6.840  13.079  -36.818 1.00 56.65  ? 476  LEU B C   1 
ATOM   7835 O O   . LEU B 1 476 ? -5.889  13.795  -37.141 1.00 55.56  ? 476  LEU B O   1 
ATOM   7836 C CB  . LEU B 1 476 ? -6.615  11.222  -35.134 1.00 56.62  ? 476  LEU B CB  1 
ATOM   7837 C CG  . LEU B 1 476 ? -6.499  10.747  -33.681 1.00 56.73  ? 476  LEU B CG  1 
ATOM   7838 C CD1 . LEU B 1 476 ? -6.148  9.273   -33.648 1.00 57.76  ? 476  LEU B CD1 1 
ATOM   7839 C CD2 . LEU B 1 476 ? -5.478  11.541  -32.922 1.00 57.49  ? 476  LEU B CD2 1 
ATOM   7840 N N   . MET B 1 477 ? -7.729  12.618  -37.691 1.00 57.27  ? 477  MET B N   1 
ATOM   7841 C CA  . MET B 1 477 ? -7.736  13.032  -39.089 1.00 58.18  ? 477  MET B CA  1 
ATOM   7842 C C   . MET B 1 477 ? -7.777  14.550  -39.226 1.00 58.19  ? 477  MET B C   1 
ATOM   7843 O O   . MET B 1 477 ? -7.174  15.105  -40.138 1.00 57.86  ? 477  MET B O   1 
ATOM   7844 C CB  . MET B 1 477 ? -8.948  12.435  -39.817 1.00 59.55  ? 477  MET B CB  1 
ATOM   7845 C CG  . MET B 1 477 ? -8.919  10.906  -40.033 1.00 60.59  ? 477  MET B CG  1 
ATOM   7846 S SD  . MET B 1 477 ? -10.509 10.324  -40.693 1.00 63.88  ? 477  MET B SD  1 
ATOM   7847 C CE  . MET B 1 477 ? -10.264 10.715  -42.409 1.00 63.38  ? 477  MET B CE  1 
ATOM   7848 N N   . LYS B 1 478 ? -8.511  15.218  -38.333 1.00 58.99  ? 478  LYS B N   1 
ATOM   7849 C CA  . LYS B 1 478 ? -8.574  16.684  -38.315 1.00 59.42  ? 478  LYS B CA  1 
ATOM   7850 C C   . LYS B 1 478 ? -7.247  17.324  -37.900 1.00 57.61  ? 478  LYS B C   1 
ATOM   7851 O O   . LYS B 1 478 ? -6.824  18.302  -38.526 1.00 56.73  ? 478  LYS B O   1 
ATOM   7852 C CB  . LYS B 1 478 ? -9.684  17.185  -37.385 1.00 61.41  ? 478  LYS B CB  1 
ATOM   7853 C CG  . LYS B 1 478 ? -10.924 17.681  -38.093 1.00 65.25  ? 478  LYS B CG  1 
ATOM   7854 C CD  . LYS B 1 478 ? -10.747 19.105  -38.637 1.00 67.63  ? 478  LYS B CD  1 
ATOM   7855 C CE  . LYS B 1 478 ? -12.022 19.585  -39.366 1.00 69.08  ? 478  LYS B CE  1 
ATOM   7856 N NZ  . LYS B 1 478 ? -12.206 18.988  -40.742 1.00 68.80  ? 478  LYS B NZ  1 
ATOM   7857 N N   . TYR B 1 479 ? -6.613  16.803  -36.843 1.00 55.75  ? 479  TYR B N   1 
ATOM   7858 C CA  . TYR B 1 479 ? -5.320  17.348  -36.396 1.00 54.59  ? 479  TYR B CA  1 
ATOM   7859 C C   . TYR B 1 479 ? -4.306  17.244  -37.530 1.00 53.26  ? 479  TYR B C   1 
ATOM   7860 O O   . TYR B 1 479 ? -3.613  18.217  -37.858 1.00 52.83  ? 479  TYR B O   1 
ATOM   7861 C CB  . TYR B 1 479 ? -4.750  16.605  -35.173 1.00 54.19  ? 479  TYR B CB  1 
ATOM   7862 C CG  . TYR B 1 479 ? -5.515  16.759  -33.875 1.00 55.44  ? 479  TYR B CG  1 
ATOM   7863 C CD1 . TYR B 1 479 ? -5.932  17.998  -33.423 1.00 56.39  ? 479  TYR B CD1 1 
ATOM   7864 C CD2 . TYR B 1 479 ? -5.776  15.653  -33.073 1.00 56.22  ? 479  TYR B CD2 1 
ATOM   7865 C CE1 . TYR B 1 479 ? -6.632  18.123  -32.223 1.00 57.31  ? 479  TYR B CE1 1 
ATOM   7866 C CE2 . TYR B 1 479 ? -6.465  15.769  -31.883 1.00 56.59  ? 479  TYR B CE2 1 
ATOM   7867 C CZ  . TYR B 1 479 ? -6.890  17.005  -31.469 1.00 56.68  ? 479  TYR B CZ  1 
ATOM   7868 O OH  . TYR B 1 479 ? -7.572  17.110  -30.294 1.00 59.06  ? 479  TYR B OH  1 
ATOM   7869 N N   . TRP B 1 480 ? -4.229  16.056  -38.117 1.00 51.85  ? 480  TRP B N   1 
ATOM   7870 C CA  . TRP B 1 480 ? -3.235  15.759  -39.153 1.00 51.09  ? 480  TRP B CA  1 
ATOM   7871 C C   . TRP B 1 480 ? -3.428  16.592  -40.413 1.00 51.27  ? 480  TRP B C   1 
ATOM   7872 O O   . TRP B 1 480 ? -2.443  17.102  -40.989 1.00 50.79  ? 480  TRP B O   1 
ATOM   7873 C CB  . TRP B 1 480 ? -3.235  14.253  -39.499 1.00 50.72  ? 480  TRP B CB  1 
ATOM   7874 C CG  . TRP B 1 480 ? -2.122  13.449  -38.849 1.00 49.43  ? 480  TRP B CG  1 
ATOM   7875 C CD1 . TRP B 1 480 ? -1.106  12.788  -39.493 1.00 49.58  ? 480  TRP B CD1 1 
ATOM   7876 C CD2 . TRP B 1 480 ? -1.910  13.234  -37.452 1.00 49.56  ? 480  TRP B CD2 1 
ATOM   7877 N NE1 . TRP B 1 480 ? -0.283  12.169  -38.582 1.00 48.70  ? 480  TRP B NE1 1 
ATOM   7878 C CE2 . TRP B 1 480 ? -0.749  12.428  -37.322 1.00 49.29  ? 480  TRP B CE2 1 
ATOM   7879 C CE3 . TRP B 1 480 ? -2.592  13.630  -36.291 1.00 50.47  ? 480  TRP B CE3 1 
ATOM   7880 C CZ2 . TRP B 1 480 ? -0.255  12.025  -36.086 1.00 47.90  ? 480  TRP B CZ2 1 
ATOM   7881 C CZ3 . TRP B 1 480 ? -2.095  13.227  -35.056 1.00 49.84  ? 480  TRP B CZ3 1 
ATOM   7882 C CH2 . TRP B 1 480 ? -0.937  12.433  -34.966 1.00 48.98  ? 480  TRP B CH2 1 
ATOM   7883 N N   . THR B 1 481 ? -4.680  16.723  -40.854 1.00 52.09  ? 481  THR B N   1 
ATOM   7884 C CA  . THR B 1 481 ? -4.976  17.468  -42.065 1.00 52.73  ? 481  THR B CA  1 
ATOM   7885 C C   . THR B 1 481 ? -4.927  18.973  -41.791 1.00 53.83  ? 481  THR B C   1 
ATOM   7886 O O   . THR B 1 481 ? -4.596  19.747  -42.681 1.00 54.54  ? 481  THR B O   1 
ATOM   7887 C CB  . THR B 1 481 ? -6.342  17.069  -42.684 1.00 54.19  ? 481  THR B CB  1 
ATOM   7888 O OG1 . THR B 1 481 ? -7.374  17.199  -41.701 1.00 55.84  ? 481  THR B OG1 1 
ATOM   7889 C CG2 . THR B 1 481 ? -6.328  15.634  -43.222 1.00 51.63  ? 481  THR B CG2 1 
ATOM   7890 N N   . ASN B 1 482 ? -5.237  19.402  -40.570 1.00 54.50  ? 482  ASN B N   1 
ATOM   7891 C CA  . ASN B 1 482 ? -5.076  20.825  -40.211 1.00 55.52  ? 482  ASN B CA  1 
ATOM   7892 C C   . ASN B 1 482 ? -3.604  21.163  -40.210 1.00 54.58  ? 482  ASN B C   1 
ATOM   7893 O O   . ASN B 1 482 ? -3.213  22.213  -40.705 1.00 55.10  ? 482  ASN B O   1 
ATOM   7894 C CB  . ASN B 1 482 ? -5.649  21.164  -38.840 1.00 56.07  ? 482  ASN B CB  1 
ATOM   7895 C CG  . ASN B 1 482 ? -7.148  21.336  -38.846 1.00 58.36  ? 482  ASN B CG  1 
ATOM   7896 O OD1 . ASN B 1 482 ? -7.763  21.626  -39.866 1.00 62.16  ? 482  ASN B OD1 1 
ATOM   7897 N ND2 . ASN B 1 482 ? -7.743  21.173  -37.681 1.00 60.28  ? 482  ASN B ND2 1 
ATOM   7898 N N   . PHE B 1 483 ? -2.797  20.268  -39.645 1.00 53.50  ? 483  PHE B N   1 
ATOM   7899 C CA  . PHE B 1 483 ? -1.353  20.398  -39.746 1.00 53.11  ? 483  PHE B CA  1 
ATOM   7900 C C   . PHE B 1 483 ? -0.898  20.496  -41.218 1.00 53.30  ? 483  PHE B C   1 
ATOM   7901 O O   . PHE B 1 483 ? -0.084  21.358  -41.567 1.00 53.40  ? 483  PHE B O   1 
ATOM   7902 C CB  . PHE B 1 483 ? -0.625  19.239  -39.048 1.00 51.67  ? 483  PHE B CB  1 
ATOM   7903 C CG  . PHE B 1 483 ? 0.871   19.390  -39.085 1.00 51.35  ? 483  PHE B CG  1 
ATOM   7904 C CD1 . PHE B 1 483 ? 1.497   20.360  -38.312 1.00 52.33  ? 483  PHE B CD1 1 
ATOM   7905 C CD2 . PHE B 1 483 ? 1.642   18.626  -39.944 1.00 51.62  ? 483  PHE B CD2 1 
ATOM   7906 C CE1 . PHE B 1 483 ? 2.873   20.533  -38.367 1.00 52.32  ? 483  PHE B CE1 1 
ATOM   7907 C CE2 . PHE B 1 483 ? 3.018   18.787  -39.998 1.00 50.60  ? 483  PHE B CE2 1 
ATOM   7908 C CZ  . PHE B 1 483 ? 3.633   19.744  -39.213 1.00 50.21  ? 483  PHE B CZ  1 
ATOM   7909 N N   . ALA B 1 484 ? -1.438  19.624  -42.070 1.00 53.65  ? 484  ALA B N   1 
ATOM   7910 C CA  . ALA B 1 484 ? -1.152  19.649  -43.512 1.00 53.97  ? 484  ALA B CA  1 
ATOM   7911 C C   . ALA B 1 484 ? -1.493  20.994  -44.145 1.00 55.86  ? 484  ALA B C   1 
ATOM   7912 O O   . ALA B 1 484 ? -0.717  21.523  -44.940 1.00 55.98  ? 484  ALA B O   1 
ATOM   7913 C CB  . ALA B 1 484 ? -1.902  18.499  -44.241 1.00 53.81  ? 484  ALA B CB  1 
ATOM   7914 N N   . ARG B 1 485 ? -2.645  21.550  -43.771 1.00 57.50  ? 485  ARG B N   1 
ATOM   7915 C CA  . ARG B 1 485 ? -3.129  22.801  -44.343 1.00 59.68  ? 485  ARG B CA  1 
ATOM   7916 C C   . ARG B 1 485 ? -2.320  23.997  -43.861 1.00 59.76  ? 485  ARG B C   1 
ATOM   7917 O O   . ARG B 1 485 ? -2.050  24.902  -44.649 1.00 60.54  ? 485  ARG B O   1 
ATOM   7918 C CB  . ARG B 1 485 ? -4.618  23.020  -44.016 1.00 60.64  ? 485  ARG B CB  1 
ATOM   7919 C CG  . ARG B 1 485 ? -5.573  22.090  -44.764 1.00 62.71  ? 485  ARG B CG  1 
ATOM   7920 C CD  . ARG B 1 485 ? -7.079  22.348  -44.456 1.00 64.72  ? 485  ARG B CD  1 
ATOM   7921 N NE  . ARG B 1 485 ? -7.556  21.574  -43.304 1.00 67.48  ? 485  ARG B NE  1 
ATOM   7922 C CZ  . ARG B 1 485 ? -8.153  20.371  -43.340 1.00 68.19  ? 485  ARG B CZ  1 
ATOM   7923 N NH1 . ARG B 1 485 ? -8.406  19.742  -44.485 1.00 68.45  ? 485  ARG B NH1 1 
ATOM   7924 N NH2 . ARG B 1 485 ? -8.522  19.790  -42.201 1.00 67.70  ? 485  ARG B NH2 1 
ATOM   7925 N N   . THR B 1 486 ? -1.936  24.008  -42.580 1.00 59.02  ? 486  THR B N   1 
ATOM   7926 C CA  . THR B 1 486 ? -1.377  25.223  -41.958 1.00 59.35  ? 486  THR B CA  1 
ATOM   7927 C C   . THR B 1 486 ? -0.045  25.082  -41.200 1.00 58.23  ? 486  THR B C   1 
ATOM   7928 O O   . THR B 1 486 ? 0.558   26.088  -40.843 1.00 59.15  ? 486  THR B O   1 
ATOM   7929 C CB  . THR B 1 486 ? -2.385  25.826  -40.962 1.00 60.43  ? 486  THR B CB  1 
ATOM   7930 O OG1 . THR B 1 486 ? -2.576  24.917  -39.864 1.00 60.12  ? 486  THR B OG1 1 
ATOM   7931 C CG2 . THR B 1 486 ? -3.732  26.118  -41.658 1.00 60.80  ? 486  THR B CG2 1 
ATOM   7932 N N   . GLY B 1 487 ? 0.419   23.860  -40.956 1.00 56.57  ? 487  GLY B N   1 
ATOM   7933 C CA  . GLY B 1 487 ? 1.561   23.642  -40.059 1.00 55.47  ? 487  GLY B CA  1 
ATOM   7934 C C   . GLY B 1 487 ? 1.200   23.782  -38.589 1.00 55.43  ? 487  GLY B C   1 
ATOM   7935 O O   . GLY B 1 487 ? 2.078   23.958  -37.751 1.00 54.99  ? 487  GLY B O   1 
ATOM   7936 N N   . ASP B 1 488 ? -0.096  23.687  -38.289 1.00 55.78  ? 488  ASP B N   1 
ATOM   7937 C CA  . ASP B 1 488 ? -0.630  23.840  -36.944 1.00 55.98  ? 488  ASP B CA  1 
ATOM   7938 C C   . ASP B 1 488 ? -1.819  22.899  -36.845 1.00 56.55  ? 488  ASP B C   1 
ATOM   7939 O O   . ASP B 1 488 ? -2.776  23.068  -37.580 1.00 56.19  ? 488  ASP B O   1 
ATOM   7940 C CB  . ASP B 1 488 ? -1.070  25.293  -36.723 1.00 56.94  ? 488  ASP B CB  1 
ATOM   7941 C CG  . ASP B 1 488 ? -1.520  25.578  -35.294 1.00 56.82  ? 488  ASP B CG  1 
ATOM   7942 O OD1 . ASP B 1 488 ? -1.817  24.645  -34.527 1.00 53.34  ? 488  ASP B OD1 1 
ATOM   7943 O OD2 . ASP B 1 488 ? -1.589  26.771  -34.933 1.00 58.65  ? 488  ASP B OD2 1 
ATOM   7944 N N   . PRO B 1 489 ? -1.761  21.905  -35.939 1.00 57.44  ? 489  PRO B N   1 
ATOM   7945 C CA  . PRO B 1 489 ? -2.831  20.912  -35.863 1.00 58.70  ? 489  PRO B CA  1 
ATOM   7946 C C   . PRO B 1 489 ? -4.132  21.407  -35.229 1.00 61.44  ? 489  PRO B C   1 
ATOM   7947 O O   . PRO B 1 489 ? -5.131  20.713  -35.311 1.00 62.07  ? 489  PRO B O   1 
ATOM   7948 C CB  . PRO B 1 489 ? -2.218  19.799  -35.005 1.00 57.42  ? 489  PRO B CB  1 
ATOM   7949 C CG  . PRO B 1 489 ? -1.231  20.476  -34.155 1.00 57.03  ? 489  PRO B CG  1 
ATOM   7950 C CD  . PRO B 1 489 ? -0.701  21.642  -34.948 1.00 56.71  ? 489  PRO B CD  1 
ATOM   7951 N N   . ASN B 1 490 ? -4.126  22.580  -34.604 1.00 64.21  ? 490  ASN B N   1 
ATOM   7952 C CA  . ASN B 1 490 ? -5.331  23.114  -33.954 1.00 67.43  ? 490  ASN B CA  1 
ATOM   7953 C C   . ASN B 1 490 ? -6.391  23.557  -34.966 1.00 69.92  ? 490  ASN B C   1 
ATOM   7954 O O   . ASN B 1 490 ? -6.045  24.029  -36.042 1.00 70.13  ? 490  ASN B O   1 
ATOM   7955 C CB  . ASN B 1 490 ? -4.952  24.298  -33.054 1.00 67.09  ? 490  ASN B CB  1 
ATOM   7956 C CG  . ASN B 1 490 ? -4.071  23.888  -31.893 1.00 63.96  ? 490  ASN B CG  1 
ATOM   7957 O OD1 . ASN B 1 490 ? -4.541  23.296  -30.927 1.00 60.50  ? 490  ASN B OD1 1 
ATOM   7958 N ND2 . ASN B 1 490 ? -2.790  24.208  -31.977 1.00 58.75  ? 490  ASN B ND2 1 
ATOM   7959 N N   . ASP B 1 491 ? -7.675  23.425  -34.612 1.00 73.27  ? 491  ASP B N   1 
ATOM   7960 C CA  . ASP B 1 491 ? -8.783  23.838  -35.502 1.00 76.21  ? 491  ASP B CA  1 
ATOM   7961 C C   . ASP B 1 491 ? -8.902  25.374  -35.562 1.00 78.80  ? 491  ASP B C   1 
ATOM   7962 O O   . ASP B 1 491 ? -9.193  25.990  -34.538 1.00 80.08  ? 491  ASP B O   1 
ATOM   7963 C CB  . ASP B 1 491 ? -10.119 23.216  -35.049 1.00 77.67  ? 491  ASP B CB  1 
ATOM   7964 C CG  . ASP B 1 491 ? -11.062 22.915  -36.228 1.00 80.60  ? 491  ASP B CG  1 
ATOM   7965 O OD1 . ASP B 1 491 ? -11.391 23.843  -37.004 1.00 83.21  ? 491  ASP B OD1 1 
ATOM   7966 O OD2 . ASP B 1 491 ? -11.467 21.739  -36.386 1.00 83.01  ? 491  ASP B OD2 1 
ATOM   7967 N N   . PRO B 1 492 ? -8.700  25.991  -36.760 1.00 80.72  ? 492  PRO B N   1 
ATOM   7968 C CA  . PRO B 1 492 ? -8.532  27.470  -36.892 1.00 82.37  ? 492  PRO B CA  1 
ATOM   7969 C C   . PRO B 1 492 ? -9.757  28.286  -36.497 1.00 85.67  ? 492  PRO B C   1 
ATOM   7970 O O   . PRO B 1 492 ? -9.627  29.351  -35.884 1.00 86.91  ? 492  PRO B O   1 
ATOM   7971 C CB  . PRO B 1 492 ? -8.237  27.686  -38.389 1.00 82.77  ? 492  PRO B CB  1 
ATOM   7972 C CG  . PRO B 1 492 ? -8.006  26.319  -38.976 1.00 81.21  ? 492  PRO B CG  1 
ATOM   7973 C CD  . PRO B 1 492 ? -8.658  25.317  -38.076 1.00 80.32  ? 492  PRO B CD  1 
ATOM   7974 N N   . ARG B 1 493 ? -10.928 27.815  -36.911 1.00 87.61  ? 493  ARG B N   1 
ATOM   7975 C CA  . ARG B 1 493 ? -12.192 28.238  -36.316 1.00 90.04  ? 493  ARG B CA  1 
ATOM   7976 C C   . ARG B 1 493 ? -12.536 27.096  -35.366 1.00 89.93  ? 493  ARG B C   1 
ATOM   7977 O O   . ARG B 1 493 ? -12.159 25.950  -35.632 1.00 88.71  ? 493  ARG B O   1 
ATOM   7978 C CB  . ARG B 1 493 ? -13.273 28.435  -37.385 1.00 91.58  ? 493  ARG B CB  1 
ATOM   7979 N N   . ASP B 1 494 ? -13.246 27.407  -34.281 1.00 91.67  ? 494  ASP B N   1 
ATOM   7980 C CA  . ASP B 1 494 ? -13.396 26.520  -33.106 1.00 91.20  ? 494  ASP B CA  1 
ATOM   7981 C C   . ASP B 1 494 ? -12.495 27.024  -31.981 1.00 90.53  ? 494  ASP B C   1 
ATOM   7982 O O   . ASP B 1 494 ? -11.270 26.876  -32.031 1.00 88.67  ? 494  ASP B O   1 
ATOM   7983 C CB  . ASP B 1 494 ? -13.060 25.041  -33.385 1.00 89.55  ? 494  ASP B CB  1 
ATOM   7984 C CG  . ASP B 1 494 ? -13.104 24.185  -32.125 1.00 89.43  ? 494  ASP B CG  1 
ATOM   7985 O OD1 . ASP B 1 494 ? -14.208 24.007  -31.555 1.00 91.74  ? 494  ASP B OD1 1 
ATOM   7986 O OD2 . ASP B 1 494 ? -12.029 23.699  -31.700 1.00 89.73  ? 494  ASP B OD2 1 
ATOM   7987 N N   . SER B 1 495 ? -13.120 27.619  -30.972 1.00 91.93  ? 495  SER B N   1 
ATOM   7988 C CA  . SER B 1 495 ? -12.421 28.054  -29.775 1.00 91.60  ? 495  SER B CA  1 
ATOM   7989 C C   . SER B 1 495 ? -12.061 26.849  -28.884 1.00 90.20  ? 495  SER B C   1 
ATOM   7990 O O   . SER B 1 495 ? -11.486 25.843  -29.350 1.00 89.09  ? 495  SER B O   1 
ATOM   7991 C CB  . SER B 1 495 ? -13.281 29.074  -29.017 1.00 93.75  ? 495  SER B CB  1 
ATOM   7992 O OG  . SER B 1 495 ? -12.821 29.267  -27.684 1.00 93.21  ? 495  SER B OG  1 
ATOM   7993 N N   . LYS B 1 496 ? -12.396 26.977  -27.602 1.00 90.36  ? 496  LYS B N   1 
ATOM   7994 C CA  . LYS B 1 496 ? -12.175 25.950  -26.593 1.00 88.89  ? 496  LYS B CA  1 
ATOM   7995 C C   . LYS B 1 496 ? -10.686 25.715  -26.255 1.00 86.00  ? 496  LYS B C   1 
ATOM   7996 O O   . LYS B 1 496 ? -9.879  25.276  -27.095 1.00 84.50  ? 496  LYS B O   1 
ATOM   7997 C CB  . LYS B 1 496 ? -12.876 24.629  -26.966 1.00 89.11  ? 496  LYS B CB  1 
ATOM   7998 C CG  . LYS B 1 496 ? -13.412 23.859  -25.742 1.00 90.38  ? 496  LYS B CG  1 
ATOM   7999 C CD  . LYS B 1 496 ? -13.124 22.350  -25.822 1.00 90.02  ? 496  LYS B CD  1 
ATOM   8000 C CE  . LYS B 1 496 ? -13.356 21.658  -24.474 1.00 90.01  ? 496  LYS B CE  1 
ATOM   8001 N NZ  . LYS B 1 496 ? -12.830 20.251  -24.454 1.00 88.82  ? 496  LYS B NZ  1 
ATOM   8002 N N   . SER B 1 497 ? -10.350 26.060  -25.012 1.00 84.66  ? 497  SER B N   1 
ATOM   8003 C CA  . SER B 1 497 ? -9.205  25.499  -24.310 1.00 81.93  ? 497  SER B CA  1 
ATOM   8004 C C   . SER B 1 497 ? -9.564  24.034  -23.982 1.00 79.78  ? 497  SER B C   1 
ATOM   8005 O O   . SER B 1 497 ? -10.670 23.778  -23.467 1.00 80.82  ? 497  SER B O   1 
ATOM   8006 C CB  . SER B 1 497 ? -8.950  26.283  -23.015 1.00 82.64  ? 497  SER B CB  1 
ATOM   8007 O OG  . SER B 1 497 ? -7.860  25.750  -22.280 1.00 81.76  ? 497  SER B OG  1 
ATOM   8008 N N   . PRO B 1 498 ? -8.620  23.082  -24.200 1.00 75.89  ? 498  PRO B N   1 
ATOM   8009 C CA  . PRO B 1 498 ? -7.191  23.290  -24.346 1.00 72.95  ? 498  PRO B CA  1 
ATOM   8010 C C   . PRO B 1 498 ? -6.700  23.191  -25.797 1.00 70.03  ? 498  PRO B C   1 
ATOM   8011 O O   . PRO B 1 498 ? -7.092  22.294  -26.543 1.00 69.50  ? 498  PRO B O   1 
ATOM   8012 C CB  . PRO B 1 498 ? -6.617  22.136  -23.511 1.00 72.17  ? 498  PRO B CB  1 
ATOM   8013 C CG  . PRO B 1 498 ? -7.685  21.009  -23.677 1.00 73.30  ? 498  PRO B CG  1 
ATOM   8014 C CD  . PRO B 1 498 ? -8.922  21.642  -24.300 1.00 75.26  ? 498  PRO B CD  1 
ATOM   8015 N N   . GLN B 1 499 ? -5.829  24.119  -26.171 1.00 67.20  ? 499  GLN B N   1 
ATOM   8016 C CA  . GLN B 1 499 ? -5.136  24.069  -27.446 1.00 64.04  ? 499  GLN B CA  1 
ATOM   8017 C C   . GLN B 1 499 ? -3.911  23.159  -27.329 1.00 60.14  ? 499  GLN B C   1 
ATOM   8018 O O   . GLN B 1 499 ? -3.439  22.857  -26.241 1.00 59.01  ? 499  GLN B O   1 
ATOM   8019 C CB  . GLN B 1 499 ? -4.720  25.487  -27.873 1.00 64.78  ? 499  GLN B CB  1 
ATOM   8020 C CG  . GLN B 1 499 ? -5.890  26.440  -28.137 1.00 66.49  ? 499  GLN B CG  1 
ATOM   8021 C CD  . GLN B 1 499 ? -6.493  26.293  -29.534 1.00 68.02  ? 499  GLN B CD  1 
ATOM   8022 O OE1 . GLN B 1 499 ? -5.854  26.609  -30.544 1.00 68.03  ? 499  GLN B OE1 1 
ATOM   8023 N NE2 . GLN B 1 499 ? -7.743  25.843  -29.593 1.00 69.77  ? 499  GLN B NE2 1 
ATOM   8024 N N   . TRP B 1 500 ? -3.417  22.721  -28.475 1.00 57.13  ? 500  TRP B N   1 
ATOM   8025 C CA  . TRP B 1 500 ? -2.187  21.951  -28.577 1.00 54.28  ? 500  TRP B CA  1 
ATOM   8026 C C   . TRP B 1 500 ? -1.017  22.926  -28.753 1.00 53.22  ? 500  TRP B C   1 
ATOM   8027 O O   . TRP B 1 500 ? -0.846  23.473  -29.834 1.00 53.11  ? 500  TRP B O   1 
ATOM   8028 C CB  . TRP B 1 500 ? -2.283  21.038  -29.802 1.00 52.77  ? 500  TRP B CB  1 
ATOM   8029 C CG  . TRP B 1 500 ? -1.171  20.043  -29.967 1.00 50.96  ? 500  TRP B CG  1 
ATOM   8030 C CD1 . TRP B 1 500 ? 0.087   20.090  -29.436 1.00 49.96  ? 500  TRP B CD1 1 
ATOM   8031 C CD2 . TRP B 1 500 ? -1.226  18.864  -30.765 1.00 49.42  ? 500  TRP B CD2 1 
ATOM   8032 N NE1 . TRP B 1 500 ? 0.811   18.982  -29.841 1.00 49.48  ? 500  TRP B NE1 1 
ATOM   8033 C CE2 . TRP B 1 500 ? 0.022   18.221  -30.661 1.00 48.86  ? 500  TRP B CE2 1 
ATOM   8034 C CE3 . TRP B 1 500 ? -2.220  18.281  -31.558 1.00 50.61  ? 500  TRP B CE3 1 
ATOM   8035 C CZ2 . TRP B 1 500 ? 0.301   17.029  -31.320 1.00 48.20  ? 500  TRP B CZ2 1 
ATOM   8036 C CZ3 . TRP B 1 500 ? -1.937  17.088  -32.207 1.00 49.24  ? 500  TRP B CZ3 1 
ATOM   8037 C CH2 . TRP B 1 500 ? -0.690  16.482  -32.085 1.00 48.34  ? 500  TRP B CH2 1 
ATOM   8038 N N   . PRO B 1 501 ? -0.199  23.127  -27.712 1.00 52.40  ? 501  PRO B N   1 
ATOM   8039 C CA  . PRO B 1 501 ? 0.867   24.119  -27.814 1.00 52.63  ? 501  PRO B CA  1 
ATOM   8040 C C   . PRO B 1 501 ? 2.111   23.566  -28.508 1.00 51.50  ? 501  PRO B C   1 
ATOM   8041 O O   . PRO B 1 501 ? 2.337   22.349  -28.486 1.00 50.58  ? 501  PRO B O   1 
ATOM   8042 C CB  . PRO B 1 501 ? 1.169   24.451  -26.358 1.00 52.72  ? 501  PRO B CB  1 
ATOM   8043 C CG  . PRO B 1 501 ? 0.826   23.235  -25.610 1.00 52.39  ? 501  PRO B CG  1 
ATOM   8044 C CD  . PRO B 1 501 ? -0.177  22.452  -26.403 1.00 52.53  ? 501  PRO B CD  1 
ATOM   8045 N N   . PRO B 1 502 ? 2.901   24.444  -29.146 1.00 51.98  ? 502  PRO B N   1 
ATOM   8046 C CA  . PRO B 1 502 ? 4.152   23.960  -29.713 1.00 51.53  ? 502  PRO B CA  1 
ATOM   8047 C C   . PRO B 1 502 ? 5.106   23.431  -28.642 1.00 51.46  ? 502  PRO B C   1 
ATOM   8048 O O   . PRO B 1 502 ? 5.118   23.925  -27.503 1.00 51.78  ? 502  PRO B O   1 
ATOM   8049 C CB  . PRO B 1 502 ? 4.745   25.199  -30.398 1.00 52.10  ? 502  PRO B CB  1 
ATOM   8050 C CG  . PRO B 1 502 ? 3.625   26.179  -30.505 1.00 53.28  ? 502  PRO B CG  1 
ATOM   8051 C CD  . PRO B 1 502 ? 2.682   25.878  -29.411 1.00 52.97  ? 502  PRO B CD  1 
ATOM   8052 N N   . TYR B 1 503 ? 5.887   22.426  -29.020 1.00 51.07  ? 503  TYR B N   1 
ATOM   8053 C CA  . TYR B 1 503 ? 6.966   21.901  -28.190 1.00 51.13  ? 503  TYR B CA  1 
ATOM   8054 C C   . TYR B 1 503 ? 8.128   22.869  -28.255 1.00 51.99  ? 503  TYR B C   1 
ATOM   8055 O O   . TYR B 1 503 ? 8.529   23.288  -29.345 1.00 52.22  ? 503  TYR B O   1 
ATOM   8056 C CB  . TYR B 1 503 ? 7.426   20.538  -28.703 1.00 50.53  ? 503  TYR B CB  1 
ATOM   8057 C CG  . TYR B 1 503 ? 8.473   19.877  -27.834 1.00 50.64  ? 503  TYR B CG  1 
ATOM   8058 C CD1 . TYR B 1 503 ? 9.832   20.107  -28.042 1.00 51.07  ? 503  TYR B CD1 1 
ATOM   8059 C CD2 . TYR B 1 503 ? 8.103   19.000  -26.809 1.00 51.08  ? 503  TYR B CD2 1 
ATOM   8060 C CE1 . TYR B 1 503 ? 10.786  19.504  -27.239 1.00 50.30  ? 503  TYR B CE1 1 
ATOM   8061 C CE2 . TYR B 1 503 ? 9.043   18.396  -26.012 1.00 50.05  ? 503  TYR B CE2 1 
ATOM   8062 C CZ  . TYR B 1 503 ? 10.379  18.656  -26.230 1.00 50.33  ? 503  TYR B CZ  1 
ATOM   8063 O OH  . TYR B 1 503 ? 11.303  18.056  -25.431 1.00 52.10  ? 503  TYR B OH  1 
ATOM   8064 N N   . THR B 1 504 ? 8.656   23.216  -27.082 1.00 52.81  ? 504  THR B N   1 
ATOM   8065 C CA  . THR B 1 504 ? 9.810   24.095  -26.956 1.00 54.25  ? 504  THR B CA  1 
ATOM   8066 C C   . THR B 1 504 ? 10.804  23.469  -25.987 1.00 54.96  ? 504  THR B C   1 
ATOM   8067 O O   . THR B 1 504 ? 10.443  22.614  -25.179 1.00 53.80  ? 504  THR B O   1 
ATOM   8068 C CB  . THR B 1 504 ? 9.391   25.449  -26.395 1.00 55.26  ? 504  THR B CB  1 
ATOM   8069 O OG1 . THR B 1 504 ? 8.797   25.246  -25.108 1.00 54.98  ? 504  THR B OG1 1 
ATOM   8070 C CG2 . THR B 1 504 ? 8.378   26.133  -27.332 1.00 55.07  ? 504  THR B CG2 1 
ATOM   8071 N N   . THR B 1 505 ? 12.054  23.907  -26.060 1.00 56.86  ? 505  THR B N   1 
ATOM   8072 C CA  . THR B 1 505 ? 13.086  23.387  -25.168 1.00 58.02  ? 505  THR B CA  1 
ATOM   8073 C C   . THR B 1 505 ? 12.847  23.885  -23.744 1.00 59.04  ? 505  THR B C   1 
ATOM   8074 O O   . THR B 1 505 ? 13.128  23.171  -22.793 1.00 59.04  ? 505  THR B O   1 
ATOM   8075 C CB  . THR B 1 505 ? 14.520  23.729  -25.660 1.00 58.81  ? 505  THR B CB  1 
ATOM   8076 O OG1 . THR B 1 505 ? 14.694  25.150  -25.720 1.00 61.38  ? 505  THR B OG1 1 
ATOM   8077 C CG2 . THR B 1 505 ? 14.774  23.124  -27.028 1.00 58.21  ? 505  THR B CG2 1 
ATOM   8078 N N   . ALA B 1 506 ? 12.283  25.084  -23.611 1.00 60.42  ? 506  ALA B N   1 
ATOM   8079 C CA  . ALA B 1 506 ? 11.919  25.636  -22.301 1.00 61.37  ? 506  ALA B CA  1 
ATOM   8080 C C   . ALA B 1 506 ? 10.804  24.853  -21.597 1.00 61.47  ? 506  ALA B C   1 
ATOM   8081 O O   . ALA B 1 506 ? 11.030  24.316  -20.497 1.00 62.84  ? 506  ALA B O   1 
ATOM   8082 C CB  . ALA B 1 506 ? 11.526  27.129  -22.427 1.00 62.86  ? 506  ALA B CB  1 
ATOM   8083 N N   . ALA B 1 507 ? 9.619   24.772  -22.214 1.00 60.37  ? 507  ALA B N   1 
ATOM   8084 C CA  . ALA B 1 507 ? 8.441   24.175  -21.553 1.00 59.19  ? 507  ALA B CA  1 
ATOM   8085 C C   . ALA B 1 507 ? 8.239   22.695  -21.848 1.00 57.09  ? 507  ALA B C   1 
ATOM   8086 O O   . ALA B 1 507 ? 7.605   21.995  -21.069 1.00 56.77  ? 507  ALA B O   1 
ATOM   8087 C CB  . ALA B 1 507 ? 7.180   24.959  -21.905 1.00 59.56  ? 507  ALA B CB  1 
ATOM   8088 N N   . GLN B 1 508 ? 8.742   22.223  -22.985 1.00 55.42  ? 508  GLN B N   1 
ATOM   8089 C CA  . GLN B 1 508 ? 8.701   20.801  -23.323 1.00 53.46  ? 508  GLN B CA  1 
ATOM   8090 C C   . GLN B 1 508 ? 7.265   20.252  -23.343 1.00 52.22  ? 508  GLN B C   1 
ATOM   8091 O O   . GLN B 1 508 ? 7.009   19.105  -22.957 1.00 50.37  ? 508  GLN B O   1 
ATOM   8092 C CB  . GLN B 1 508 ? 9.604   20.008  -22.374 1.00 53.19  ? 508  GLN B CB  1 
ATOM   8093 C CG  . GLN B 1 508 ? 11.052  20.489  -22.405 1.00 54.15  ? 508  GLN B CG  1 
ATOM   8094 C CD  . GLN B 1 508 ? 11.972  19.743  -21.446 1.00 54.84  ? 508  GLN B CD  1 
ATOM   8095 O OE1 . GLN B 1 508 ? 11.941  18.513  -21.364 1.00 54.58  ? 508  GLN B OE1 1 
ATOM   8096 N NE2 . GLN B 1 508 ? 12.822  20.493  -20.738 1.00 57.08  ? 508  GLN B NE2 1 
ATOM   8097 N N   . GLN B 1 509 ? 6.339   21.073  -23.844 1.00 51.70  ? 509  GLN B N   1 
ATOM   8098 C CA  . GLN B 1 509 ? 4.926   20.707  -23.844 1.00 51.03  ? 509  GLN B CA  1 
ATOM   8099 C C   . GLN B 1 509 ? 4.578   19.766  -24.991 1.00 50.04  ? 509  GLN B C   1 
ATOM   8100 O O   . GLN B 1 509 ? 5.028   19.953  -26.126 1.00 49.78  ? 509  GLN B O   1 
ATOM   8101 C CB  . GLN B 1 509 ? 4.035   21.941  -23.907 1.00 51.74  ? 509  GLN B CB  1 
ATOM   8102 C CG  . GLN B 1 509 ? 3.971   22.719  -22.618 1.00 52.22  ? 509  GLN B CG  1 
ATOM   8103 C CD  . GLN B 1 509 ? 3.425   24.098  -22.838 1.00 53.99  ? 509  GLN B CD  1 
ATOM   8104 O OE1 . GLN B 1 509 ? 3.953   24.856  -23.642 1.00 56.04  ? 509  GLN B OE1 1 
ATOM   8105 N NE2 . GLN B 1 509 ? 2.365   24.433  -22.139 1.00 54.86  ? 509  GLN B NE2 1 
ATOM   8106 N N   . TYR B 1 510 ? 3.782   18.750  -24.666 1.00 49.30  ? 510  TYR B N   1 
ATOM   8107 C CA  . TYR B 1 510 ? 3.233   17.816  -25.633 1.00 48.61  ? 510  TYR B CA  1 
ATOM   8108 C C   . TYR B 1 510 ? 1.833   17.400  -25.162 1.00 48.68  ? 510  TYR B C   1 
ATOM   8109 O O   . TYR B 1 510 ? 1.438   17.725  -24.054 1.00 49.50  ? 510  TYR B O   1 
ATOM   8110 C CB  . TYR B 1 510 ? 4.154   16.599  -25.792 1.00 48.13  ? 510  TYR B CB  1 
ATOM   8111 C CG  . TYR B 1 510 ? 4.250   15.725  -24.563 1.00 48.02  ? 510  TYR B CG  1 
ATOM   8112 C CD1 . TYR B 1 510 ? 5.031   16.103  -23.488 1.00 49.04  ? 510  TYR B CD1 1 
ATOM   8113 C CD2 . TYR B 1 510 ? 3.541   14.526  -24.471 1.00 48.73  ? 510  TYR B CD2 1 
ATOM   8114 C CE1 . TYR B 1 510 ? 5.109   15.322  -22.354 1.00 49.72  ? 510  TYR B CE1 1 
ATOM   8115 C CE2 . TYR B 1 510 ? 3.615   13.736  -23.337 1.00 47.75  ? 510  TYR B CE2 1 
ATOM   8116 C CZ  . TYR B 1 510 ? 4.408   14.138  -22.287 1.00 49.09  ? 510  TYR B CZ  1 
ATOM   8117 O OH  . TYR B 1 510 ? 4.498   13.377  -21.147 1.00 49.72  ? 510  TYR B OH  1 
ATOM   8118 N N   . VAL B 1 511 ? 1.076   16.705  -26.005 1.00 48.21  ? 511  VAL B N   1 
ATOM   8119 C CA  . VAL B 1 511 ? -0.291  16.298  -25.649 1.00 48.21  ? 511  VAL B CA  1 
ATOM   8120 C C   . VAL B 1 511 ? -0.481  14.794  -25.669 1.00 48.52  ? 511  VAL B C   1 
ATOM   8121 O O   . VAL B 1 511 ? 0.227   14.080  -26.375 1.00 47.47  ? 511  VAL B O   1 
ATOM   8122 C CB  . VAL B 1 511 ? -1.344  16.902  -26.601 1.00 48.89  ? 511  VAL B CB  1 
ATOM   8123 C CG1 . VAL B 1 511 ? -1.305  18.431  -26.555 1.00 47.84  ? 511  VAL B CG1 1 
ATOM   8124 C CG2 . VAL B 1 511 ? -1.164  16.372  -28.020 1.00 46.97  ? 511  VAL B CG2 1 
ATOM   8125 N N   . SER B 1 512 ? -1.454  14.328  -24.889 1.00 49.62  ? 512  SER B N   1 
ATOM   8126 C CA  . SER B 1 512 ? -1.908  12.951  -24.949 1.00 49.93  ? 512  SER B CA  1 
ATOM   8127 C C   . SER B 1 512 ? -3.075  12.832  -25.918 1.00 50.67  ? 512  SER B C   1 
ATOM   8128 O O   . SER B 1 512 ? -4.043  13.593  -25.848 1.00 51.27  ? 512  SER B O   1 
ATOM   8129 C CB  . SER B 1 512 ? -2.327  12.442  -23.570 1.00 50.80  ? 512  SER B CB  1 
ATOM   8130 O OG  . SER B 1 512 ? -3.283  13.294  -22.986 1.00 50.34  ? 512  SER B OG  1 
ATOM   8131 N N   . LEU B 1 513 ? -2.940  11.894  -26.847 1.00 50.13  ? 513  LEU B N   1 
ATOM   8132 C CA  . LEU B 1 513 ? -3.973  11.588  -27.797 1.00 50.97  ? 513  LEU B CA  1 
ATOM   8133 C C   . LEU B 1 513 ? -4.641  10.284  -27.327 1.00 51.96  ? 513  LEU B C   1 
ATOM   8134 O O   . LEU B 1 513 ? -4.076  9.195   -27.453 1.00 51.66  ? 513  LEU B O   1 
ATOM   8135 C CB  . LEU B 1 513 ? -3.379  11.435  -29.197 1.00 50.14  ? 513  LEU B CB  1 
ATOM   8136 C CG  . LEU B 1 513 ? -2.698  12.671  -29.792 1.00 49.08  ? 513  LEU B CG  1 
ATOM   8137 C CD1 . LEU B 1 513 ? -2.100  12.339  -31.164 1.00 45.65  ? 513  LEU B CD1 1 
ATOM   8138 C CD2 . LEU B 1 513 ? -3.672  13.870  -29.867 1.00 50.12  ? 513  LEU B CD2 1 
ATOM   8139 N N   . ASN B 1 514 ? -5.810  10.425  -26.725 1.00 53.41  ? 514  ASN B N   1 
ATOM   8140 C CA  . ASN B 1 514 ? -6.603  9.285   -26.282 1.00 55.01  ? 514  ASN B CA  1 
ATOM   8141 C C   . ASN B 1 514 ? -8.074  9.669   -26.370 1.00 56.89  ? 514  ASN B C   1 
ATOM   8142 O O   . ASN B 1 514 ? -8.387  10.722  -26.932 1.00 56.51  ? 514  ASN B O   1 
ATOM   8143 C CB  . ASN B 1 514 ? -6.178  8.844   -24.870 1.00 54.99  ? 514  ASN B CB  1 
ATOM   8144 C CG  . ASN B 1 514 ? -6.282  9.953   -23.840 1.00 56.26  ? 514  ASN B CG  1 
ATOM   8145 O OD1 . ASN B 1 514 ? -7.294  10.649  -23.755 1.00 58.10  ? 514  ASN B OD1 1 
ATOM   8146 N ND2 . ASN B 1 514 ? -5.237  10.107  -23.026 1.00 55.52  ? 514  ASN B ND2 1 
ATOM   8147 N N   . LEU B 1 515 ? -8.969  8.832   -25.835 1.00 59.04  ? 515  LEU B N   1 
ATOM   8148 C CA  . LEU B 1 515 ? -10.406 9.096   -25.920 1.00 61.23  ? 515  LEU B CA  1 
ATOM   8149 C C   . LEU B 1 515 ? -10.840 10.329  -25.130 1.00 62.71  ? 515  LEU B C   1 
ATOM   8150 O O   . LEU B 1 515 ? -11.865 10.922  -25.447 1.00 64.23  ? 515  LEU B O   1 
ATOM   8151 C CB  . LEU B 1 515 ? -11.226 7.874   -25.485 1.00 62.37  ? 515  LEU B CB  1 
ATOM   8152 C CG  . LEU B 1 515 ? -11.088 6.622   -26.369 1.00 62.62  ? 515  LEU B CG  1 
ATOM   8153 C CD1 . LEU B 1 515 ? -12.047 5.533   -25.917 1.00 64.43  ? 515  LEU B CD1 1 
ATOM   8154 C CD2 . LEU B 1 515 ? -11.312 6.940   -27.843 1.00 62.16  ? 515  LEU B CD2 1 
ATOM   8155 N N   . LYS B 1 516 ? -10.072 10.711  -24.111 1.00 63.07  ? 516  LYS B N   1 
ATOM   8156 C CA  . LYS B 1 516 ? -10.358 11.931  -23.352 1.00 64.64  ? 516  LYS B CA  1 
ATOM   8157 C C   . LYS B 1 516 ? -9.914  13.171  -24.149 1.00 63.80  ? 516  LYS B C   1 
ATOM   8158 O O   . LYS B 1 516 ? -9.114  13.060  -25.077 1.00 62.78  ? 516  LYS B O   1 
ATOM   8159 C CB  . LYS B 1 516 ? -9.659  11.903  -21.985 1.00 64.43  ? 516  LYS B CB  1 
ATOM   8160 C CG  . LYS B 1 516 ? -9.883  10.617  -21.167 1.00 66.51  ? 516  LYS B CG  1 
ATOM   8161 C CD  . LYS B 1 516 ? -9.471  10.788  -19.692 1.00 67.25  ? 516  LYS B CD  1 
ATOM   8162 C CE  . LYS B 1 516 ? -7.959  10.589  -19.462 1.00 68.65  ? 516  LYS B CE  1 
ATOM   8163 N NZ  . LYS B 1 516 ? -7.474  11.223  -18.157 1.00 69.70  ? 516  LYS B NZ  1 
ATOM   8164 N N   . PRO B 1 517 ? -10.444 14.357  -23.805 1.00 64.54  ? 517  PRO B N   1 
ATOM   8165 C CA  . PRO B 1 517 ? -9.959  15.586  -24.438 1.00 64.06  ? 517  PRO B CA  1 
ATOM   8166 C C   . PRO B 1 517 ? -8.440  15.797  -24.280 1.00 62.79  ? 517  PRO B C   1 
ATOM   8167 O O   . PRO B 1 517 ? -7.842  15.302  -23.315 1.00 62.08  ? 517  PRO B O   1 
ATOM   8168 C CB  . PRO B 1 517 ? -10.741 16.688  -23.706 1.00 65.55  ? 517  PRO B CB  1 
ATOM   8169 C CG  . PRO B 1 517 ? -11.967 16.021  -23.192 1.00 66.52  ? 517  PRO B CG  1 
ATOM   8170 C CD  . PRO B 1 517 ? -11.530 14.625  -22.845 1.00 66.20  ? 517  PRO B CD  1 
ATOM   8171 N N   . LEU B 1 518 ? -7.833  16.518  -25.226 1.00 62.15  ? 518  LEU B N   1 
ATOM   8172 C CA  . LEU B 1 518 ? -6.396  16.814  -25.187 1.00 60.93  ? 518  LEU B CA  1 
ATOM   8173 C C   . LEU B 1 518 ? -5.963  17.270  -23.807 1.00 60.96  ? 518  LEU B C   1 
ATOM   8174 O O   . LEU B 1 518 ? -6.569  18.168  -23.225 1.00 62.03  ? 518  LEU B O   1 
ATOM   8175 C CB  . LEU B 1 518 ? -6.018  17.946  -26.157 1.00 61.03  ? 518  LEU B CB  1 
ATOM   8176 C CG  . LEU B 1 518 ? -5.684  17.683  -27.614 1.00 60.81  ? 518  LEU B CG  1 
ATOM   8177 C CD1 . LEU B 1 518 ? -5.033  18.920  -28.219 1.00 61.46  ? 518  LEU B CD1 1 
ATOM   8178 C CD2 . LEU B 1 518 ? -4.771  16.493  -27.761 1.00 60.21  ? 518  LEU B CD2 1 
ATOM   8179 N N   . GLU B 1 519 ? -4.882  16.682  -23.315 1.00 59.87  ? 519  GLU B N   1 
ATOM   8180 C CA  . GLU B 1 519 ? -4.278  17.096  -22.070 1.00 60.15  ? 519  GLU B CA  1 
ATOM   8181 C C   . GLU B 1 519 ? -2.833  17.475  -22.377 1.00 58.17  ? 519  GLU B C   1 
ATOM   8182 O O   . GLU B 1 519 ? -2.115  16.727  -23.047 1.00 57.03  ? 519  GLU B O   1 
ATOM   8183 C CB  . GLU B 1 519 ? -4.367  15.953  -21.055 1.00 60.46  ? 519  GLU B CB  1 
ATOM   8184 C CG  . GLU B 1 519 ? -3.412  16.026  -19.873 1.00 61.68  ? 519  GLU B CG  1 
ATOM   8185 C CD  . GLU B 1 519 ? -3.588  14.851  -18.907 1.00 62.89  ? 519  GLU B CD  1 
ATOM   8186 O OE1 . GLU B 1 519 ? -4.710  14.707  -18.354 1.00 68.78  ? 519  GLU B OE1 1 
ATOM   8187 O OE2 . GLU B 1 519 ? -2.607  14.094  -18.689 1.00 64.41  ? 519  GLU B OE2 1 
ATOM   8188 N N   . VAL B 1 520 ? -2.417  18.638  -21.887 1.00 57.44  ? 520  VAL B N   1 
ATOM   8189 C CA  . VAL B 1 520 ? -1.063  19.116  -22.092 1.00 56.28  ? 520  VAL B CA  1 
ATOM   8190 C C   . VAL B 1 520 ? -0.157  18.605  -20.962 1.00 55.51  ? 520  VAL B C   1 
ATOM   8191 O O   . VAL B 1 520 ? -0.479  18.716  -19.791 1.00 55.74  ? 520  VAL B O   1 
ATOM   8192 C CB  . VAL B 1 520 ? -1.030  20.663  -22.167 1.00 57.05  ? 520  VAL B CB  1 
ATOM   8193 C CG1 . VAL B 1 520 ? 0.389   21.168  -22.339 1.00 56.00  ? 520  VAL B CG1 1 
ATOM   8194 C CG2 . VAL B 1 520 ? -1.945  21.168  -23.300 1.00 57.34  ? 520  VAL B CG2 1 
ATOM   8195 N N   . ARG B 1 521 ? 0.974   18.029  -21.337 1.00 54.35  ? 521  ARG B N   1 
ATOM   8196 C CA  . ARG B 1 521 ? 1.953   17.551  -20.383 1.00 54.13  ? 521  ARG B CA  1 
ATOM   8197 C C   . ARG B 1 521 ? 3.289   18.200  -20.687 1.00 53.57  ? 521  ARG B C   1 
ATOM   8198 O O   . ARG B 1 521 ? 3.510   18.706  -21.783 1.00 52.79  ? 521  ARG B O   1 
ATOM   8199 C CB  . ARG B 1 521 ? 2.071   16.036  -20.489 1.00 53.71  ? 521  ARG B CB  1 
ATOM   8200 C CG  . ARG B 1 521 ? 0.794   15.317  -20.098 1.00 54.71  ? 521  ARG B CG  1 
ATOM   8201 C CD  . ARG B 1 521 ? 0.910   13.821  -20.309 1.00 54.19  ? 521  ARG B CD  1 
ATOM   8202 N NE  . ARG B 1 521 ? -0.392  13.168  -20.204 1.00 55.18  ? 521  ARG B NE  1 
ATOM   8203 C CZ  . ARG B 1 521 ? -0.609  11.882  -20.469 1.00 55.21  ? 521  ARG B CZ  1 
ATOM   8204 N NH1 . ARG B 1 521 ? 0.375   11.098  -20.887 1.00 53.23  ? 521  ARG B NH1 1 
ATOM   8205 N NH2 . ARG B 1 521 ? -1.832  11.389  -20.348 1.00 57.39  ? 521  ARG B NH2 1 
ATOM   8206 N N   . ARG B 1 522 ? 4.183   18.178  -19.713 1.00 53.92  ? 522  ARG B N   1 
ATOM   8207 C CA  . ARG B 1 522 ? 5.505   18.757  -19.885 1.00 54.35  ? 522  ARG B CA  1 
ATOM   8208 C C   . ARG B 1 522 ? 6.549   17.687  -19.639 1.00 54.52  ? 522  ARG B C   1 
ATOM   8209 O O   . ARG B 1 522 ? 6.460   16.958  -18.662 1.00 54.92  ? 522  ARG B O   1 
ATOM   8210 C CB  . ARG B 1 522 ? 5.690   19.930  -18.941 1.00 54.91  ? 522  ARG B CB  1 
ATOM   8211 C CG  . ARG B 1 522 ? 4.819   21.104  -19.318 1.00 55.70  ? 522  ARG B CG  1 
ATOM   8212 C CD  . ARG B 1 522 ? 4.890   22.219  -18.310 1.00 57.51  ? 522  ARG B CD  1 
ATOM   8213 N NE  . ARG B 1 522 ? 6.198   22.864  -18.319 1.00 59.05  ? 522  ARG B NE  1 
ATOM   8214 C CZ  . ARG B 1 522 ? 6.465   24.047  -17.772 1.00 59.83  ? 522  ARG B CZ  1 
ATOM   8215 N NH1 . ARG B 1 522 ? 5.518   24.751  -17.165 1.00 59.61  ? 522  ARG B NH1 1 
ATOM   8216 N NH2 . ARG B 1 522 ? 7.696   24.531  -17.846 1.00 60.57  ? 522  ARG B NH2 1 
ATOM   8217 N N   . GLY B 1 523 ? 7.500   17.567  -20.560 1.00 54.77  ? 523  GLY B N   1 
ATOM   8218 C CA  . GLY B 1 523 ? 8.668   16.728  -20.367 1.00 55.24  ? 523  GLY B CA  1 
ATOM   8219 C C   . GLY B 1 523 ? 8.414   15.336  -20.873 1.00 55.33  ? 523  GLY B C   1 
ATOM   8220 O O   . GLY B 1 523 ? 7.671   14.584  -20.260 1.00 56.27  ? 523  GLY B O   1 
ATOM   8221 N N   . LEU B 1 524 ? 9.040   14.992  -21.987 1.00 55.47  ? 524  LEU B N   1 
ATOM   8222 C CA  . LEU B 1 524 ? 8.841   13.698  -22.620 1.00 55.89  ? 524  LEU B CA  1 
ATOM   8223 C C   . LEU B 1 524 ? 9.876   12.704  -22.103 1.00 55.68  ? 524  LEU B C   1 
ATOM   8224 O O   . LEU B 1 524 ? 10.989  12.622  -22.634 1.00 55.61  ? 524  LEU B O   1 
ATOM   8225 C CB  . LEU B 1 524 ? 8.941   13.894  -24.136 1.00 55.45  ? 524  LEU B CB  1 
ATOM   8226 C CG  . LEU B 1 524 ? 8.412   12.875  -25.133 1.00 56.17  ? 524  LEU B CG  1 
ATOM   8227 C CD1 . LEU B 1 524 ? 7.062   12.221  -24.758 1.00 57.31  ? 524  LEU B CD1 1 
ATOM   8228 C CD2 . LEU B 1 524 ? 8.336   13.618  -26.475 1.00 56.55  ? 524  LEU B CD2 1 
ATOM   8229 N N   . ARG B 1 525 ? 9.503   11.955  -21.063 1.00 55.64  ? 525  ARG B N   1 
ATOM   8230 C CA  . ARG B 1 525 ? 10.435  11.094  -20.334 1.00 56.04  ? 525  ARG B CA  1 
ATOM   8231 C C   . ARG B 1 525 ? 11.742  11.846  -20.014 1.00 54.59  ? 525  ARG B C   1 
ATOM   8232 O O   . ARG B 1 525 ? 12.828  11.350  -20.288 1.00 53.41  ? 525  ARG B O   1 
ATOM   8233 C CB  . ARG B 1 525 ? 10.775  9.847   -21.152 1.00 56.51  ? 525  ARG B CB  1 
ATOM   8234 C CG  . ARG B 1 525 ? 9.627   8.944   -21.441 1.00 60.76  ? 525  ARG B CG  1 
ATOM   8235 C CD  . ARG B 1 525 ? 9.369   7.993   -20.320 1.00 66.12  ? 525  ARG B CD  1 
ATOM   8236 N NE  . ARG B 1 525 ? 9.255   6.631   -20.819 1.00 69.59  ? 525  ARG B NE  1 
ATOM   8237 C CZ  . ARG B 1 525 ? 8.212   6.152   -21.500 1.00 70.45  ? 525  ARG B CZ  1 
ATOM   8238 N NH1 . ARG B 1 525 ? 7.165   6.921   -21.807 1.00 71.51  ? 525  ARG B NH1 1 
ATOM   8239 N NH2 . ARG B 1 525 ? 8.231   4.886   -21.888 1.00 70.28  ? 525  ARG B NH2 1 
ATOM   8240 N N   . ALA B 1 526 ? 11.629  13.044  -19.453 1.00 54.03  ? 526  ALA B N   1 
ATOM   8241 C CA  . ALA B 1 526 ? 12.790  13.944  -19.343 1.00 53.49  ? 526  ALA B CA  1 
ATOM   8242 C C   . ALA B 1 526 ? 13.970  13.345  -18.594 1.00 53.27  ? 526  ALA B C   1 
ATOM   8243 O O   . ALA B 1 526 ? 15.093  13.438  -19.069 1.00 53.44  ? 526  ALA B O   1 
ATOM   8244 C CB  . ALA B 1 526 ? 12.398  15.278  -18.727 1.00 53.71  ? 526  ALA B CB  1 
ATOM   8245 N N   . GLN B 1 527 ? 13.734  12.759  -17.425 1.00 53.29  ? 527  GLN B N   1 
ATOM   8246 C CA  . GLN B 1 527 ? 14.840  12.246  -16.607 1.00 53.94  ? 527  GLN B CA  1 
ATOM   8247 C C   . GLN B 1 527 ? 15.476  11.034  -17.271 1.00 53.05  ? 527  GLN B C   1 
ATOM   8248 O O   . GLN B 1 527 ? 16.695  10.934  -17.364 1.00 52.24  ? 527  GLN B O   1 
ATOM   8249 C CB  . GLN B 1 527 ? 14.392  11.880  -15.184 1.00 54.72  ? 527  GLN B CB  1 
ATOM   8250 C CG  . GLN B 1 527 ? 13.989  13.054  -14.304 1.00 55.53  ? 527  GLN B CG  1 
ATOM   8251 C CD  . GLN B 1 527 ? 15.032  14.167  -14.250 1.00 57.76  ? 527  GLN B CD  1 
ATOM   8252 O OE1 . GLN B 1 527 ? 14.796  15.265  -14.763 1.00 60.04  ? 527  GLN B OE1 1 
ATOM   8253 N NE2 . GLN B 1 527 ? 16.176  13.898  -13.618 1.00 56.50  ? 527  GLN B NE2 1 
ATOM   8254 N N   . THR B 1 528 ? 14.641  10.127  -17.755 1.00 52.67  ? 528  THR B N   1 
ATOM   8255 C CA  . THR B 1 528 ? 15.141  8.909   -18.378 1.00 52.75  ? 528  THR B CA  1 
ATOM   8256 C C   . THR B 1 528 ? 15.827  9.207   -19.697 1.00 52.28  ? 528  THR B C   1 
ATOM   8257 O O   . THR B 1 528 ? 16.838  8.584   -20.019 1.00 52.62  ? 528  THR B O   1 
ATOM   8258 C CB  . THR B 1 528 ? 14.031  7.877   -18.566 1.00 52.71  ? 528  THR B CB  1 
ATOM   8259 O OG1 . THR B 1 528 ? 13.611  7.432   -17.278 1.00 54.47  ? 528  THR B OG1 1 
ATOM   8260 C CG2 . THR B 1 528 ? 14.519  6.654   -19.387 1.00 52.58  ? 528  THR B CG2 1 
ATOM   8261 N N   . CYS B 1 529 ? 15.326  10.167  -20.464 1.00 52.00  ? 529  CYS B N   1 
ATOM   8262 C CA  . CYS B 1 529 ? 15.983  10.446  -21.743 1.00 52.00  ? 529  CYS B CA  1 
ATOM   8263 C C   . CYS B 1 529 ? 17.288  11.186  -21.543 1.00 52.19  ? 529  CYS B C   1 
ATOM   8264 O O   . CYS B 1 529 ? 18.178  11.063  -22.374 1.00 52.64  ? 529  CYS B O   1 
ATOM   8265 C CB  . CYS B 1 529 ? 15.057  11.124  -22.741 1.00 51.50  ? 529  CYS B CB  1 
ATOM   8266 S SG  . CYS B 1 529 ? 13.771  9.956   -23.346 1.00 53.35  ? 529  CYS B SG  1 
ATOM   8267 N N   . ALA B 1 530 ? 17.417  11.922  -20.436 1.00 52.01  ? 530  ALA B N   1 
ATOM   8268 C CA  . ALA B 1 530 ? 18.712  12.482  -20.048 1.00 52.67  ? 530  ALA B CA  1 
ATOM   8269 C C   . ALA B 1 530 ? 19.721  11.355  -19.820 1.00 52.79  ? 530  ALA B C   1 
ATOM   8270 O O   . ALA B 1 530 ? 20.883  11.484  -20.164 1.00 53.19  ? 530  ALA B O   1 
ATOM   8271 C CB  . ALA B 1 530 ? 18.593  13.370  -18.798 1.00 52.68  ? 530  ALA B CB  1 
ATOM   8272 N N   . PHE B 1 531 ? 19.267  10.241  -19.255 1.00 52.73  ? 531  PHE B N   1 
ATOM   8273 C CA  . PHE B 1 531 ? 20.130  9.076   -19.086 1.00 52.92  ? 531  PHE B CA  1 
ATOM   8274 C C   . PHE B 1 531 ? 20.666  8.579   -20.450 1.00 53.09  ? 531  PHE B C   1 
ATOM   8275 O O   . PHE B 1 531 ? 21.878  8.413   -20.637 1.00 53.50  ? 531  PHE B O   1 
ATOM   8276 C CB  . PHE B 1 531 ? 19.375  7.966   -18.354 1.00 52.51  ? 531  PHE B CB  1 
ATOM   8277 C CG  . PHE B 1 531 ? 20.077  6.643   -18.370 1.00 52.76  ? 531  PHE B CG  1 
ATOM   8278 C CD1 . PHE B 1 531 ? 21.212  6.440   -17.598 1.00 52.88  ? 531  PHE B CD1 1 
ATOM   8279 C CD2 . PHE B 1 531 ? 19.599  5.600   -19.146 1.00 52.04  ? 531  PHE B CD2 1 
ATOM   8280 C CE1 . PHE B 1 531 ? 21.868  5.215   -17.605 1.00 54.67  ? 531  PHE B CE1 1 
ATOM   8281 C CE2 . PHE B 1 531 ? 20.249  4.371   -19.166 1.00 53.85  ? 531  PHE B CE2 1 
ATOM   8282 C CZ  . PHE B 1 531 ? 21.380  4.176   -18.389 1.00 54.33  ? 531  PHE B CZ  1 
ATOM   8283 N N   . TRP B 1 532 ? 19.753  8.367   -21.390 1.00 52.40  ? 532  TRP B N   1 
ATOM   8284 C CA  . TRP B 1 532 ? 20.090  7.848   -22.718 1.00 52.57  ? 532  TRP B CA  1 
ATOM   8285 C C   . TRP B 1 532 ? 20.821  8.876   -23.581 1.00 53.25  ? 532  TRP B C   1 
ATOM   8286 O O   . TRP B 1 532 ? 21.798  8.547   -24.226 1.00 53.90  ? 532  TRP B O   1 
ATOM   8287 C CB  . TRP B 1 532 ? 18.828  7.376   -23.459 1.00 51.12  ? 532  TRP B CB  1 
ATOM   8288 C CG  . TRP B 1 532 ? 18.208  6.121   -22.929 1.00 50.66  ? 532  TRP B CG  1 
ATOM   8289 C CD1 . TRP B 1 532 ? 17.091  6.029   -22.170 1.00 50.40  ? 532  TRP B CD1 1 
ATOM   8290 C CD2 . TRP B 1 532 ? 18.662  4.774   -23.137 1.00 50.52  ? 532  TRP B CD2 1 
ATOM   8291 N NE1 . TRP B 1 532 ? 16.809  4.713   -21.888 1.00 51.06  ? 532  TRP B NE1 1 
ATOM   8292 C CE2 . TRP B 1 532 ? 17.757  3.922   -22.473 1.00 50.74  ? 532  TRP B CE2 1 
ATOM   8293 C CE3 . TRP B 1 532 ? 19.742  4.208   -23.822 1.00 51.23  ? 532  TRP B CE3 1 
ATOM   8294 C CZ2 . TRP B 1 532 ? 17.900  2.535   -22.463 1.00 51.70  ? 532  TRP B CZ2 1 
ATOM   8295 C CZ3 . TRP B 1 532 ? 19.882  2.828   -23.819 1.00 51.64  ? 532  TRP B CZ3 1 
ATOM   8296 C CH2 . TRP B 1 532 ? 18.968  2.008   -23.135 1.00 51.90  ? 532  TRP B CH2 1 
ATOM   8297 N N   . ASN B 1 533 ? 20.352  10.117  -23.585 1.00 54.00  ? 533  ASN B N   1 
ATOM   8298 C CA  . ASN B 1 533 ? 20.873  11.125  -24.511 1.00 54.59  ? 533  ASN B CA  1 
ATOM   8299 C C   . ASN B 1 533 ? 22.093  11.867  -24.015 1.00 56.73  ? 533  ASN B C   1 
ATOM   8300 O O   . ASN B 1 533 ? 22.868  12.365  -24.825 1.00 57.10  ? 533  ASN B O   1 
ATOM   8301 C CB  . ASN B 1 533 ? 19.777  12.116  -24.889 1.00 53.91  ? 533  ASN B CB  1 
ATOM   8302 C CG  . ASN B 1 533 ? 18.613  11.443  -25.588 1.00 53.13  ? 533  ASN B CG  1 
ATOM   8303 O OD1 . ASN B 1 533 ? 18.737  10.309  -26.037 1.00 54.57  ? 533  ASN B OD1 1 
ATOM   8304 N ND2 . ASN B 1 533 ? 17.478  12.127  -25.670 1.00 50.96  ? 533  ASN B ND2 1 
ATOM   8305 N N   . ARG B 1 534 ? 22.274  11.944  -22.698 1.00 58.36  ? 534  ARG B N   1 
ATOM   8306 C CA  . ARG B 1 534 ? 23.398  12.678  -22.132 1.00 60.50  ? 534  ARG B CA  1 
ATOM   8307 C C   . ARG B 1 534 ? 24.399  11.781  -21.440 1.00 61.41  ? 534  ARG B C   1 
ATOM   8308 O O   . ARG B 1 534 ? 25.602  11.901  -21.674 1.00 62.53  ? 534  ARG B O   1 
ATOM   8309 C CB  . ARG B 1 534 ? 22.910  13.756  -21.165 1.00 60.83  ? 534  ARG B CB  1 
ATOM   8310 C CG  . ARG B 1 534 ? 21.996  14.771  -21.820 1.00 61.24  ? 534  ARG B CG  1 
ATOM   8311 C CD  . ARG B 1 534 ? 21.421  15.732  -20.820 1.00 62.26  ? 534  ARG B CD  1 
ATOM   8312 N NE  . ARG B 1 534 ? 20.327  16.511  -21.401 1.00 63.91  ? 534  ARG B NE  1 
ATOM   8313 C CZ  . ARG B 1 534 ? 20.446  17.740  -21.914 1.00 64.53  ? 534  ARG B CZ  1 
ATOM   8314 N NH1 . ARG B 1 534 ? 21.606  18.390  -21.899 1.00 64.51  ? 534  ARG B NH1 1 
ATOM   8315 N NH2 . ARG B 1 534 ? 19.369  18.336  -22.417 1.00 63.80  ? 534  ARG B NH2 1 
ATOM   8316 N N   . PHE B 1 535 ? 23.935  10.882  -20.582 1.00 61.36  ? 535  PHE B N   1 
ATOM   8317 C CA  . PHE B 1 535 ? 24.894  10.139  -19.782 1.00 62.36  ? 535  PHE B CA  1 
ATOM   8318 C C   . PHE B 1 535 ? 25.557  8.989   -20.534 1.00 63.28  ? 535  PHE B C   1 
ATOM   8319 O O   . PHE B 1 535 ? 26.780  8.867   -20.516 1.00 64.08  ? 535  PHE B O   1 
ATOM   8320 C CB  . PHE B 1 535 ? 24.314  9.615   -18.474 1.00 61.73  ? 535  PHE B CB  1 
ATOM   8321 C CG  . PHE B 1 535 ? 25.300  8.801   -17.708 1.00 62.50  ? 535  PHE B CG  1 
ATOM   8322 C CD1 . PHE B 1 535 ? 26.426  9.402   -17.176 1.00 62.53  ? 535  PHE B CD1 1 
ATOM   8323 C CD2 . PHE B 1 535 ? 25.155  7.426   -17.589 1.00 62.17  ? 535  PHE B CD2 1 
ATOM   8324 C CE1 . PHE B 1 535 ? 27.368  8.657   -16.499 1.00 64.00  ? 535  PHE B CE1 1 
ATOM   8325 C CE2 . PHE B 1 535 ? 26.101  6.674   -16.903 1.00 63.17  ? 535  PHE B CE2 1 
ATOM   8326 C CZ  . PHE B 1 535 ? 27.199  7.289   -16.360 1.00 64.07  ? 535  PHE B CZ  1 
ATOM   8327 N N   . LEU B 1 536 ? 24.769  8.131   -21.164 1.00 63.20  ? 536  LEU B N   1 
ATOM   8328 C CA  . LEU B 1 536 ? 25.343  6.958   -21.809 1.00 64.96  ? 536  LEU B CA  1 
ATOM   8329 C C   . LEU B 1 536 ? 26.398  7.291   -22.887 1.00 65.96  ? 536  LEU B C   1 
ATOM   8330 O O   . LEU B 1 536 ? 27.374  6.562   -23.019 1.00 66.76  ? 536  LEU B O   1 
ATOM   8331 C CB  . LEU B 1 536 ? 24.253  6.039   -22.377 1.00 64.14  ? 536  LEU B CB  1 
ATOM   8332 C CG  . LEU B 1 536 ? 23.500  5.143   -21.384 1.00 64.18  ? 536  LEU B CG  1 
ATOM   8333 C CD1 . LEU B 1 536 ? 22.678  4.116   -22.143 1.00 62.15  ? 536  LEU B CD1 1 
ATOM   8334 C CD2 . LEU B 1 536 ? 24.454  4.449   -20.415 1.00 64.46  ? 536  LEU B CD2 1 
ATOM   8335 N N   . PRO B 1 537 ? 26.181  8.355   -23.688 1.00 66.48  ? 537  PRO B N   1 
ATOM   8336 C CA  . PRO B 1 537 ? 27.239  8.854   -24.579 1.00 67.79  ? 537  PRO B CA  1 
ATOM   8337 C C   . PRO B 1 537 ? 28.545  9.229   -23.865 1.00 70.81  ? 537  PRO B C   1 
ATOM   8338 O O   . PRO B 1 537 ? 29.618  8.822   -24.313 1.00 71.97  ? 537  PRO B O   1 
ATOM   8339 C CB  . PRO B 1 537 ? 26.593  10.086  -25.225 1.00 67.04  ? 537  PRO B CB  1 
ATOM   8340 C CG  . PRO B 1 537 ? 25.143  9.769   -25.221 1.00 65.18  ? 537  PRO B CG  1 
ATOM   8341 C CD  . PRO B 1 537 ? 24.921  9.086   -23.902 1.00 65.15  ? 537  PRO B CD  1 
ATOM   8342 N N   . LYS B 1 538 ? 28.457  9.995   -22.775 1.00 72.62  ? 538  LYS B N   1 
ATOM   8343 C CA  . LYS B 1 538 ? 29.637  10.315  -21.966 1.00 75.40  ? 538  LYS B CA  1 
ATOM   8344 C C   . LYS B 1 538 ? 30.301  9.051   -21.452 1.00 77.40  ? 538  LYS B C   1 
ATOM   8345 O O   . LYS B 1 538 ? 31.523  9.007   -21.322 1.00 79.12  ? 538  LYS B O   1 
ATOM   8346 C CB  . LYS B 1 538 ? 29.282  11.182  -20.761 1.00 75.49  ? 538  LYS B CB  1 
ATOM   8347 C CG  . LYS B 1 538 ? 28.878  12.609  -21.066 1.00 75.66  ? 538  LYS B CG  1 
ATOM   8348 C CD  . LYS B 1 538 ? 28.333  13.277  -19.799 1.00 75.97  ? 538  LYS B CD  1 
ATOM   8349 C CE  . LYS B 1 538 ? 27.400  14.460  -20.100 1.00 76.61  ? 538  LYS B CE  1 
ATOM   8350 N NZ  . LYS B 1 538 ? 27.978  15.788  -19.732 1.00 78.28  ? 538  LYS B NZ  1 
ATOM   8351 N N   . LEU B 1 539 ? 29.504  8.030   -21.148 1.00 78.35  ? 539  LEU B N   1 
ATOM   8352 C CA  . LEU B 1 539 ? 30.046  6.799   -20.587 1.00 80.56  ? 539  LEU B CA  1 
ATOM   8353 C C   . LEU B 1 539 ? 30.923  6.084   -21.602 1.00 82.88  ? 539  LEU B C   1 
ATOM   8354 O O   . LEU B 1 539 ? 32.083  5.796   -21.325 1.00 84.23  ? 539  LEU B O   1 
ATOM   8355 C CB  . LEU B 1 539 ? 28.938  5.866   -20.079 1.00 79.69  ? 539  LEU B CB  1 
ATOM   8356 C CG  . LEU B 1 539 ? 29.356  4.484   -19.560 1.00 79.93  ? 539  LEU B CG  1 
ATOM   8357 C CD1 . LEU B 1 539 ? 30.503  4.568   -18.563 1.00 80.87  ? 539  LEU B CD1 1 
ATOM   8358 C CD2 . LEU B 1 539 ? 28.160  3.774   -18.940 1.00 79.59  ? 539  LEU B CD2 1 
ATOM   8359 N N   . LEU B 1 540 ? 30.389  5.807   -22.784 1.00 83.99  ? 540  LEU B N   1 
ATOM   8360 C CA  . LEU B 1 540 ? 31.153  5.012   -23.751 1.00 86.34  ? 540  LEU B CA  1 
ATOM   8361 C C   . LEU B 1 540 ? 32.266  5.801   -24.462 1.00 88.57  ? 540  LEU B C   1 
ATOM   8362 O O   . LEU B 1 540 ? 33.241  5.206   -24.917 1.00 90.08  ? 540  LEU B O   1 
ATOM   8363 C CB  . LEU B 1 540 ? 30.216  4.281   -24.715 1.00 85.32  ? 540  LEU B CB  1 
ATOM   8364 C CG  . LEU B 1 540 ? 29.321  3.260   -23.965 1.00 85.29  ? 540  LEU B CG  1 
ATOM   8365 C CD1 . LEU B 1 540 ? 28.710  2.213   -24.939 1.00 84.50  ? 540  LEU B CD1 1 
ATOM   8366 C CD2 . LEU B 1 540 ? 30.060  2.543   -22.795 1.00 83.12  ? 540  LEU B CD2 1 
ATOM   8367 N N   . SER B 1 541 ? 32.153  7.128   -24.506 1.00 89.73  ? 541  SER B N   1 
ATOM   8368 C CA  . SER B 1 541 ? 33.265  7.969   -24.959 1.00 92.36  ? 541  SER B CA  1 
ATOM   8369 C C   . SER B 1 541 ? 34.422  8.028   -23.931 1.00 94.81  ? 541  SER B C   1 
ATOM   8370 O O   . SER B 1 541 ? 35.541  8.410   -24.281 1.00 96.26  ? 541  SER B O   1 
ATOM   8371 C CB  . SER B 1 541 ? 32.778  9.383   -25.301 1.00 91.50  ? 541  SER B CB  1 
ATOM   8372 O OG  . SER B 1 541 ? 32.757  10.220  -24.158 1.00 92.36  ? 541  SER B OG  1 
ATOM   8373 N N   . ALA B 1 542 ? 34.142  7.662   -22.677 1.00 95.91  ? 542  ALA B N   1 
ATOM   8374 C CA  . ALA B 1 542 ? 35.163  7.528   -21.633 1.00 98.29  ? 542  ALA B CA  1 
ATOM   8375 C C   . ALA B 1 542 ? 35.396  6.049   -21.259 1.00 99.88  ? 542  ALA B C   1 
ATOM   8376 O O   . ALA B 1 542 ? 36.445  5.492   -21.598 1.00 101.57 ? 542  ALA B O   1 
ATOM   8377 C CB  . ALA B 1 542 ? 34.771  8.342   -20.402 1.00 98.18  ? 542  ALA B CB  1 
ATOM   8378 N N   . THR B 1 543 ? 34.431  5.443   -20.547 1.00 86.28  ? 543  THR B N   1 
ATOM   8379 C CA  . THR B 1 543 ? 34.425  3.997   -20.166 1.00 86.43  ? 543  THR B CA  1 
ATOM   8380 C C   . THR B 1 543 ? 35.275  3.643   -18.893 1.00 87.05  ? 543  THR B C   1 
ATOM   8381 O O   . THR B 1 543 ? 36.105  2.718   -18.835 1.00 87.26  ? 543  THR B O   1 
ATOM   8382 C CB  . THR B 1 543 ? 34.780  3.090   -21.386 1.00 86.66  ? 543  THR B CB  1 
ATOM   8383 O OG1 . THR B 1 543 ? 33.985  3.487   -22.510 1.00 87.05  ? 543  THR B OG1 1 
ATOM   8384 C CG2 . THR B 1 543 ? 34.522  1.609   -21.092 1.00 86.72  ? 543  THR B CG2 1 
ATOM   8385 O OXT . THR B 1 543 ? 35.134  4.275   -17.834 1.00 87.13  ? 543  THR B OXT 1 
HETATM 8386 C C1  . NAG C 2 .   ? 24.615  34.831  -0.768  1.00 83.98  ? 1    NAG C C1  1 
HETATM 8387 C C2  . NAG C 2 .   ? 24.825  35.491  -2.144  1.00 89.25  ? 1    NAG C C2  1 
HETATM 8388 C C3  . NAG C 2 .   ? 26.071  34.926  -2.848  1.00 90.17  ? 1    NAG C C3  1 
HETATM 8389 C C4  . NAG C 2 .   ? 27.290  34.945  -1.935  1.00 90.86  ? 1    NAG C C4  1 
HETATM 8390 C C5  . NAG C 2 .   ? 26.970  34.381  -0.552  1.00 91.22  ? 1    NAG C C5  1 
HETATM 8391 C C6  . NAG C 2 .   ? 28.129  34.595  0.429   1.00 94.08  ? 1    NAG C C6  1 
HETATM 8392 C C7  . NAG C 2 .   ? 23.145  36.471  -3.642  1.00 92.52  ? 1    NAG C C7  1 
HETATM 8393 C C8  . NAG C 2 .   ? 23.308  36.502  -5.142  1.00 92.84  ? 1    NAG C C8  1 
HETATM 8394 N N2  . NAG C 2 .   ? 23.628  35.399  -2.990  1.00 90.82  ? 1    NAG C N2  1 
HETATM 8395 O O3  . NAG C 2 .   ? 26.407  35.665  -4.005  1.00 90.24  ? 1    NAG C O3  1 
HETATM 8396 O O4  . NAG C 2 .   ? 28.314  34.183  -2.538  1.00 91.35  ? 1    NAG C O4  1 
HETATM 8397 O O5  . NAG C 2 .   ? 25.812  34.996  -0.025  1.00 86.80  ? 1    NAG C O5  1 
HETATM 8398 O O6  . NAG C 2 .   ? 28.480  35.968  0.513   1.00 98.37  ? 1    NAG C O6  1 
HETATM 8399 O O7  . NAG C 2 .   ? 22.586  37.410  -3.064  1.00 93.24  ? 1    NAG C O7  1 
HETATM 8400 C C1  . FUC C 2 .   ? 28.254  36.556  1.820   1.00 102.04 ? 2    FUC C C1  1 
HETATM 8401 C C2  . FUC C 2 .   ? 29.136  37.802  1.972   1.00 103.60 ? 2    FUC C C2  1 
HETATM 8402 C C3  . FUC C 2 .   ? 28.745  38.840  0.922   1.00 104.73 ? 2    FUC C C3  1 
HETATM 8403 C C4  . FUC C 2 .   ? 27.239  39.152  0.989   1.00 104.83 ? 2    FUC C C4  1 
HETATM 8404 C C5  . FUC C 2 .   ? 26.360  37.893  1.152   1.00 104.08 ? 2    FUC C C5  1 
HETATM 8405 C C6  . FUC C 2 .   ? 24.942  38.244  1.609   1.00 103.61 ? 2    FUC C C6  1 
HETATM 8406 O O2  . FUC C 2 .   ? 30.515  37.484  1.870   1.00 104.11 ? 2    FUC C O2  1 
HETATM 8407 O O3  . FUC C 2 .   ? 29.530  40.002  1.105   1.00 105.28 ? 2    FUC C O3  1 
HETATM 8408 O O4  . FUC C 2 .   ? 26.975  40.080  2.024   1.00 105.75 ? 2    FUC C O4  1 
HETATM 8409 O O5  . FUC C 2 .   ? 26.906  36.941  2.063   1.00 102.82 ? 2    FUC C O5  1 
HETATM 8410 C C1  . NAG D 3 .   ? 11.586  33.258  25.343  1.00 81.61  ? 701  NAG A C1  1 
HETATM 8411 C C2  . NAG D 3 .   ? 13.066  33.636  25.204  1.00 85.34  ? 701  NAG A C2  1 
HETATM 8412 C C3  . NAG D 3 .   ? 13.412  34.927  25.961  1.00 86.75  ? 701  NAG A C3  1 
HETATM 8413 C C4  . NAG D 3 .   ? 12.409  36.037  25.633  1.00 87.62  ? 701  NAG A C4  1 
HETATM 8414 C C5  . NAG D 3 .   ? 10.991  35.506  25.873  1.00 87.96  ? 701  NAG A C5  1 
HETATM 8415 C C6  . NAG D 3 .   ? 9.897   36.567  25.659  1.00 89.36  ? 701  NAG A C6  1 
HETATM 8416 C C7  . NAG D 3 .   ? 14.770  31.891  24.913  1.00 86.79  ? 701  NAG A C7  1 
HETATM 8417 C C8  . NAG D 3 .   ? 15.222  30.547  25.404  1.00 86.14  ? 701  NAG A C8  1 
HETATM 8418 N N2  . NAG D 3 .   ? 13.910  32.552  25.689  1.00 85.97  ? 701  NAG A N2  1 
HETATM 8419 O O3  . NAG D 3 .   ? 14.734  35.336  25.656  1.00 86.31  ? 701  NAG A O3  1 
HETATM 8420 O O4  . NAG D 3 .   ? 12.664  37.199  26.408  1.00 88.67  ? 701  NAG A O4  1 
HETATM 8421 O O5  . NAG D 3 .   ? 10.780  34.382  25.026  1.00 84.75  ? 701  NAG A O5  1 
HETATM 8422 O O6  . NAG D 3 .   ? 9.981   37.205  24.392  1.00 90.79  ? 701  NAG A O6  1 
HETATM 8423 O O7  . NAG D 3 .   ? 15.196  32.327  23.845  1.00 87.40  ? 701  NAG A O7  1 
HETATM 8424 C C   . ACT E 4 .   ? 29.244  14.943  11.980  1.00 61.31  ? 1903 ACT A C   1 
HETATM 8425 O O   . ACT E 4 .   ? 28.417  15.846  11.660  1.00 60.53  ? 1903 ACT A O   1 
HETATM 8426 O OXT . ACT E 4 .   ? 29.465  14.644  13.211  1.00 59.64  ? 1903 ACT A OXT 1 
HETATM 8427 C CH3 . ACT E 4 .   ? 29.941  14.225  10.866  1.00 61.78  ? 1903 ACT A CH3 1 
HETATM 8428 N N1  A AT3 F 5 .   ? 26.909  18.589  14.925  0.50 80.51  ? 1901 AT3 A N1  1 
HETATM 8429 C C2  A AT3 F 5 .   ? 27.490  19.937  14.968  0.50 81.26  ? 1901 AT3 A C2  1 
HETATM 8430 C C3  A AT3 F 5 .   ? 28.000  20.508  13.648  0.50 82.03  ? 1901 AT3 A C3  1 
HETATM 8431 C C5  A AT3 F 5 .   ? 29.545  19.082  11.860  0.50 83.00  ? 1901 AT3 A C5  1 
HETATM 8432 O O7  A AT3 F 5 .   ? 28.479  19.037  11.308  0.50 84.10  ? 1901 AT3 A O7  1 
HETATM 8433 C C6  A AT3 F 5 .   ? 30.748  18.394  11.319  0.50 83.08  ? 1901 AT3 A C6  1 
HETATM 8434 C C8  A AT3 F 5 .   ? 25.472  18.665  14.764  0.50 80.46  ? 1901 AT3 A C8  1 
HETATM 8435 C C9  A AT3 F 5 .   ? 27.439  17.742  13.871  0.50 80.22  ? 1901 AT3 A C9  1 
HETATM 8436 C C10 A AT3 F 5 .   ? 27.192  17.944  16.199  0.50 80.68  ? 1901 AT3 A C10 1 
HETATM 8437 S S24 A AT3 F 5 .   ? 29.634  19.952  13.259  0.50 82.47  ? 1901 AT3 A S24 1 
HETATM 8438 S SD  B ETM G 6 .   ? 27.876  22.024  13.946  0.50 62.67  ? 1909 ETM A SD  1 
HETATM 8439 C C1  B ETM G 6 .   ? 28.050  20.261  14.042  0.50 60.68  ? 1909 ETM A C1  1 
HETATM 8440 C C2  B ETM G 6 .   ? 26.807  19.687  14.711  0.50 59.49  ? 1909 ETM A C2  1 
HETATM 8441 N N1  B ETM G 6 .   ? 26.692  18.233  14.914  0.50 58.72  ? 1909 ETM A N1  1 
HETATM 8442 C C3  B ETM G 6 .   ? 27.362  17.349  13.966  0.50 58.16  ? 1909 ETM A C3  1 
HETATM 8443 C C4  B ETM G 6 .   ? 25.278  17.868  14.938  0.50 58.86  ? 1909 ETM A C4  1 
HETATM 8444 C C5  B ETM G 6 .   ? 27.303  17.978  16.219  0.50 58.49  ? 1909 ETM A C5  1 
HETATM 8445 N N1  . AT3 H 5 .   ? 17.637  25.495  21.893  1.00 81.27  ? 1902 AT3 A N1  1 
HETATM 8446 C C2  . AT3 H 5 .   ? 18.727  26.339  22.435  1.00 81.23  ? 1902 AT3 A C2  1 
HETATM 8447 C C3  . AT3 H 5 .   ? 19.927  26.469  21.488  1.00 81.51  ? 1902 AT3 A C3  1 
HETATM 8448 C C5  . AT3 H 5 .   ? 22.170  26.369  23.129  1.00 81.44  ? 1902 AT3 A C5  1 
HETATM 8449 O O7  . AT3 H 5 .   ? 21.841  25.180  23.212  1.00 78.72  ? 1902 AT3 A O7  1 
HETATM 8450 C C6  . AT3 H 5 .   ? 23.409  26.922  23.785  1.00 79.61  ? 1902 AT3 A C6  1 
HETATM 8451 C C8  . AT3 H 5 .   ? 18.159  24.214  21.383  1.00 80.18  ? 1902 AT3 A C8  1 
HETATM 8452 C C9  . AT3 H 5 .   ? 16.679  25.215  22.972  1.00 79.55  ? 1902 AT3 A C9  1 
HETATM 8453 C C10 . AT3 H 5 .   ? 16.938  26.208  20.807  1.00 80.26  ? 1902 AT3 A C10 1 
HETATM 8454 S S24 . AT3 H 5 .   ? 21.208  27.427  22.248  1.00 81.92  ? 1902 AT3 A S24 1 
HETATM 8455 S SD  . ETM I 6 .   ? 37.603  25.053  8.316   1.00 98.41  ? 1905 ETM A SD  1 
HETATM 8456 C C1  . ETM I 6 .   ? 35.896  24.987  7.798   1.00 96.66  ? 1905 ETM A C1  1 
HETATM 8457 C C2  . ETM I 6 .   ? 34.997  24.715  9.014   1.00 95.87  ? 1905 ETM A C2  1 
HETATM 8458 N N1  . ETM I 6 .   ? 34.441  23.342  9.237   1.00 95.16  ? 1905 ETM A N1  1 
HETATM 8459 C C3  . ETM I 6 .   ? 33.029  23.072  8.908   1.00 94.42  ? 1905 ETM A C3  1 
HETATM 8460 C C4  . ETM I 6 .   ? 34.626  23.000  10.661  1.00 95.33  ? 1905 ETM A C4  1 
HETATM 8461 C C5  . ETM I 6 .   ? 35.189  22.426  8.362   1.00 95.06  ? 1905 ETM A C5  1 
HETATM 8462 C C   . ACT J 4 .   ? 10.172  0.023   -37.951 1.00 64.25  ? 1953 ACT B C   1 
HETATM 8463 O O   . ACT J 4 .   ? 9.294   -0.559  -37.256 1.00 64.22  ? 1953 ACT B O   1 
HETATM 8464 O OXT . ACT J 4 .   ? 9.889   0.410   -39.136 1.00 62.41  ? 1953 ACT B OXT 1 
HETATM 8465 C CH3 . ACT J 4 .   ? 11.524  0.234   -37.335 1.00 64.61  ? 1953 ACT B CH3 1 
HETATM 8466 N N1  A AT3 K 5 .   ? 5.421   -1.767  -38.650 0.50 78.60  ? 1951 AT3 B N1  1 
HETATM 8467 C C2  A AT3 K 5 .   ? 5.158   -3.195  -38.833 0.50 79.66  ? 1951 AT3 B C2  1 
HETATM 8468 C C3  A AT3 K 5 .   ? 5.972   -4.073  -37.895 0.50 80.63  ? 1951 AT3 B C3  1 
HETATM 8469 C C5  A AT3 K 5 .   ? 8.655   -3.902  -37.197 0.50 83.09  ? 1951 AT3 B C5  1 
HETATM 8470 O O7  A AT3 K 5 .   ? 9.748   -3.414  -37.405 0.50 82.13  ? 1951 AT3 B O7  1 
HETATM 8471 C C6  A AT3 K 5 .   ? 8.174   -4.251  -35.825 0.50 84.09  ? 1951 AT3 B C6  1 
HETATM 8472 C C8  A AT3 K 5 .   ? 4.465   -1.204  -37.712 0.50 78.39  ? 1951 AT3 B C8  1 
HETATM 8473 C C9  A AT3 K 5 .   ? 6.767   -1.554  -38.154 0.50 78.28  ? 1951 AT3 B C9  1 
HETATM 8474 C C10 A AT3 K 5 .   ? 5.259   -1.068  -39.916 0.50 78.37  ? 1951 AT3 B C10 1 
HETATM 8475 S S24 A AT3 K 5 .   ? 7.634   -4.210  -38.462 0.50 81.55  ? 1951 AT3 B S24 1 
HETATM 8476 S SD  B ETM L 6 .   ? 5.789   -5.047  -37.815 0.50 77.14  ? 1959 ETM B SD  1 
HETATM 8477 C C1  B ETM L 6 .   ? 6.577   -3.580  -38.411 0.50 75.88  ? 1959 ETM B C1  1 
HETATM 8478 C C2  B ETM L 6 .   ? 5.470   -2.767  -39.060 0.50 75.09  ? 1959 ETM B C2  1 
HETATM 8479 N N1  B ETM L 6 .   ? 5.395   -1.342  -38.706 0.50 74.25  ? 1959 ETM B N1  1 
HETATM 8480 C C3  B ETM L 6 .   ? 6.631   -0.781  -38.181 0.50 73.88  ? 1959 ETM B C3  1 
HETATM 8481 C C4  B ETM L 6 .   ? 4.318   -1.110  -37.739 0.50 73.89  ? 1959 ETM B C4  1 
HETATM 8482 C C5  B ETM L 6 .   ? 5.106   -0.633  -39.951 0.50 74.07  ? 1959 ETM B C5  1 
HETATM 8483 N N1  . AT3 M 5 .   ? -7.816  -3.479  -38.332 1.00 90.87  ? 1952 AT3 B N1  1 
HETATM 8484 C C2  . AT3 M 5 .   ? -7.169  -4.798  -38.520 1.00 90.97  ? 1952 AT3 B C2  1 
HETATM 8485 C C3  . AT3 M 5 .   ? -7.412  -5.395  -39.907 1.00 91.09  ? 1952 AT3 B C3  1 
HETATM 8486 C C5  . AT3 M 5 .   ? -5.510  -5.986  -41.774 1.00 88.86  ? 1952 AT3 B C5  1 
HETATM 8487 O O7  . AT3 M 5 .   ? -5.238  -4.787  -41.829 1.00 86.55  ? 1952 AT3 B O7  1 
HETATM 8488 C C6  . AT3 M 5 .   ? -5.306  -6.948  -42.915 1.00 87.35  ? 1952 AT3 B C6  1 
HETATM 8489 C C8  . AT3 M 5 .   ? -9.130  -3.368  -38.985 1.00 90.46  ? 1952 AT3 B C8  1 
HETATM 8490 C C9  . AT3 M 5 .   ? -8.019  -3.294  -36.891 1.00 91.37  ? 1952 AT3 B C9  1 
HETATM 8491 C C10 . AT3 M 5 .   ? -6.939  -2.419  -38.848 1.00 90.37  ? 1952 AT3 B C10 1 
HETATM 8492 S S24 . AT3 M 5 .   ? -6.160  -6.564  -40.354 1.00 90.47  ? 1952 AT3 B S24 1 
HETATM 8493 S SD  . ETM N 6 .   ? 14.403  -13.674 -37.977 0.80 97.48  ? 1955 ETM B SD  1 
HETATM 8494 C C1  . ETM N 6 .   ? 13.981  -12.053 -37.326 0.80 95.52  ? 1955 ETM B C1  1 
HETATM 8495 C C2  . ETM N 6 .   ? 12.475  -11.769 -37.466 0.80 94.63  ? 1955 ETM B C2  1 
HETATM 8496 N N1  . ETM N 6 .   ? 12.048  -10.369 -37.776 0.80 93.55  ? 1955 ETM B N1  1 
HETATM 8497 C C3  . ETM N 6 .   ? 12.663  -9.289  -36.985 0.80 93.41  ? 1955 ETM B C3  1 
HETATM 8498 C C4  . ETM N 6 .   ? 10.585  -10.206 -37.712 0.80 93.32  ? 1955 ETM B C4  1 
HETATM 8499 C C5  . ETM N 6 .   ? 12.432  -10.151 -39.170 0.80 93.63  ? 1955 ETM B C5  1 
HETATM 8500 N N1  . AT3 O 5 .   ? -9.876  -2.921  -48.685 1.00 70.45  ? 1961 AT3 B N1  1 
HETATM 8501 C C2  . AT3 O 5 .   ? -9.023  -2.665  -49.866 1.00 70.53  ? 1961 AT3 B C2  1 
HETATM 8502 C C3  . AT3 O 5 .   ? -9.346  -3.503  -51.104 1.00 70.30  ? 1961 AT3 B C3  1 
HETATM 8503 C C5  . AT3 O 5 .   ? -8.813  -1.551  -53.157 1.00 71.59  ? 1961 AT3 B C5  1 
HETATM 8504 O O7  . AT3 O 5 .   ? -9.849  -1.006  -52.803 1.00 73.59  ? 1961 AT3 B O7  1 
HETATM 8505 C C6  . AT3 O 5 .   ? -7.981  -0.961  -54.248 1.00 71.41  ? 1961 AT3 B C6  1 
HETATM 8506 C C8  . AT3 O 5 .   ? -9.738  -4.310  -48.207 1.00 68.69  ? 1961 AT3 B C8  1 
HETATM 8507 C C9  . AT3 O 5 .   ? -9.431  -1.999  -47.629 1.00 70.57  ? 1961 AT3 B C9  1 
HETATM 8508 C C10 . AT3 O 5 .   ? -11.284 -2.603  -48.962 1.00 69.65  ? 1961 AT3 B C10 1 
HETATM 8509 S S24 . AT3 O 5 .   ? -8.314  -2.981  -52.444 1.00 69.91  ? 1961 AT3 B S24 1 
HETATM 8510 O O1  . P6G P 7 .   ? 15.151  5.444   -12.079 1.00 73.95  ? 2901 P6G B O1  1 
HETATM 8511 C C2  . P6G P 7 .   ? 16.249  6.354   -11.847 1.00 74.35  ? 2901 P6G B C2  1 
HETATM 8512 C C3  . P6G P 7 .   ? 17.774  6.097   -11.697 1.00 73.35  ? 2901 P6G B C3  1 
HETATM 8513 O O4  . P6G P 7 .   ? 18.228  5.527   -10.311 1.00 73.18  ? 2901 P6G B O4  1 
HETATM 8514 C C5  . P6G P 7 .   ? 19.053  4.345   -10.356 1.00 73.44  ? 2901 P6G B C5  1 
HETATM 8515 C C6  . P6G P 7 .   ? 20.279  4.659   -11.032 1.00 71.64  ? 2901 P6G B C6  1 
HETATM 8516 O O7  . P6G P 7 .   ? 21.160  3.483   -11.489 1.00 71.45  ? 2901 P6G B O7  1 
HETATM 8517 C C8  . P6G P 7 .   ? 22.451  3.884   -11.996 1.00 70.29  ? 2901 P6G B C8  1 
HETATM 8518 C C9  . P6G P 7 .   ? 22.382  4.548   -13.382 1.00 67.80  ? 2901 P6G B C9  1 
HETATM 8519 O O10 . P6G P 7 .   ? 22.771  6.104   -13.377 1.00 68.09  ? 2901 P6G B O10 1 
HETATM 8520 C C11 . P6G P 7 .   ? 23.704  6.585   -14.337 1.00 67.68  ? 2901 P6G B C11 1 
HETATM 8521 C C12 . P6G P 7 .   ? 23.666  8.033   -14.349 1.00 69.16  ? 2901 P6G B C12 1 
HETATM 8522 O O13 . P6G P 7 .   ? 22.278  8.757   -14.556 1.00 72.77  ? 2901 P6G B O13 1 
HETATM 8523 C C14 . P6G P 7 .   ? 22.197  9.839   -15.532 1.00 72.83  ? 2901 P6G B C14 1 
HETATM 8524 C C15 . P6G P 7 .   ? 20.971  10.616  -15.444 1.00 74.82  ? 2901 P6G B C15 1 
HETATM 8525 O O16 . P6G P 7 .   ? 19.767  9.892   -14.743 1.00 77.61  ? 2901 P6G B O16 1 
HETATM 8526 C C17 . P6G P 7 .   ? 18.503  10.583  -14.586 1.00 77.54  ? 2901 P6G B C17 1 
HETATM 8527 C C18 . P6G P 7 .   ? 17.735  9.880   -13.617 1.00 76.83  ? 2901 P6G B C18 1 
HETATM 8528 O O19 . P6G P 7 .   ? 17.120  10.781  -12.451 1.00 76.58  ? 2901 P6G B O19 1 
HETATM 8529 O O   . HOH Q 8 .   ? 41.481  13.442  31.556  1.00 43.55  ? 1910 HOH A O   1 
HETATM 8530 O O   . HOH Q 8 .   ? 43.313  14.867  24.890  1.00 47.57  ? 1911 HOH A O   1 
HETATM 8531 O O   . HOH Q 8 .   ? 38.893  15.518  0.982   1.00 41.87  ? 1912 HOH A O   1 
HETATM 8532 O O   . HOH Q 8 .   ? 45.083  7.667   29.698  1.00 52.40  ? 1913 HOH A O   1 
HETATM 8533 O O   . HOH Q 8 .   ? 58.765  20.840  8.558   1.00 56.28  ? 1914 HOH A O   1 
HETATM 8534 O O   . HOH Q 8 .   ? 25.916  14.931  18.251  1.00 41.08  ? 1915 HOH A O   1 
HETATM 8535 O O   . HOH Q 8 .   ? 40.794  25.863  19.328  1.00 59.51  ? 1916 HOH A O   1 
HETATM 8536 O O   . HOH Q 8 .   ? 36.170  23.140  33.059  1.00 64.08  ? 1917 HOH A O   1 
HETATM 8537 O O   . HOH Q 8 .   ? 17.755  21.385  -12.140 1.00 59.75  ? 1918 HOH A O   1 
HETATM 8538 O O   . HOH Q 8 .   ? 53.145  25.430  8.603   1.00 47.70  ? 1919 HOH A O   1 
HETATM 8539 O O   . HOH Q 8 .   ? 31.127  25.021  -12.933 1.00 50.29  ? 1920 HOH A O   1 
HETATM 8540 O O   . HOH Q 8 .   ? 7.835   11.105  27.443  1.00 55.37  ? 1921 HOH A O   1 
HETATM 8541 O O   . HOH Q 8 .   ? 38.010  14.648  12.513  1.00 42.02  ? 1922 HOH A O   1 
HETATM 8542 O O   . HOH Q 8 .   ? 22.002  19.915  7.360   1.00 42.96  ? 1923 HOH A O   1 
HETATM 8543 O O   . HOH Q 8 .   ? 30.789  7.755   6.554   1.00 46.11  ? 1924 HOH A O   1 
HETATM 8544 O O   . HOH Q 8 .   ? 21.137  14.615  12.874  1.00 42.83  ? 1925 HOH A O   1 
HETATM 8545 O O   . HOH Q 8 .   ? 42.686  7.014   14.076  1.00 44.79  ? 1926 HOH A O   1 
HETATM 8546 O O   . HOH Q 8 .   ? 32.934  14.034  17.114  1.00 42.21  ? 1927 HOH A O   1 
HETATM 8547 O O   . HOH Q 8 .   ? 46.453  10.160  10.911  1.00 48.09  ? 1928 HOH A O   1 
HETATM 8548 O O   . HOH Q 8 .   ? 29.134  11.601  24.551  1.00 40.81  ? 1929 HOH A O   1 
HETATM 8549 O O   . HOH Q 8 .   ? 19.040  19.705  18.358  1.00 41.81  ? 1930 HOH A O   1 
HETATM 8550 O O   . HOH Q 8 .   ? 27.353  -1.837  37.365  1.00 42.55  ? 1931 HOH A O   1 
HETATM 8551 O O   . HOH Q 8 .   ? 40.305  12.012  33.540  1.00 45.55  ? 1932 HOH A O   1 
HETATM 8552 O O   . HOH Q 8 .   ? 18.526  11.466  13.120  1.00 46.45  ? 1933 HOH A O   1 
HETATM 8553 O O   . HOH Q 8 .   ? 41.177  6.620   3.001   1.00 46.30  ? 1934 HOH A O   1 
HETATM 8554 O O   . HOH Q 8 .   ? 40.748  16.219  21.702  1.00 44.94  ? 1935 HOH A O   1 
HETATM 8555 O O   . HOH Q 8 .   ? 11.159  0.656   10.494  1.00 52.14  ? 1936 HOH A O   1 
HETATM 8556 O O   . HOH Q 8 .   ? 34.562  6.270   -11.048 1.00 51.54  ? 1937 HOH A O   1 
HETATM 8557 O O   . HOH Q 8 .   ? 47.056  7.247   17.975  1.00 45.16  ? 1938 HOH A O   1 
HETATM 8558 O O   . HOH Q 8 .   ? 34.953  16.868  24.434  1.00 46.93  ? 1939 HOH A O   1 
HETATM 8559 O O   . HOH Q 8 .   ? 25.376  14.685  27.964  1.00 45.14  ? 1940 HOH A O   1 
HETATM 8560 O O   . HOH Q 8 .   ? 17.220  14.473  28.675  1.00 45.24  ? 1941 HOH A O   1 
HETATM 8561 O O   . HOH Q 8 .   ? 28.680  17.583  19.783  1.00 40.00  ? 1942 HOH A O   1 
HETATM 8562 O O   . HOH Q 8 .   ? 52.213  15.814  24.514  1.00 46.78  ? 1943 HOH A O   1 
HETATM 8563 O O   . HOH Q 8 .   ? 9.690   -3.426  6.534   1.00 59.98  ? 1944 HOH A O   1 
HETATM 8564 O O   . HOH Q 8 .   ? 32.101  16.404  32.389  1.00 41.19  ? 1945 HOH A O   1 
HETATM 8565 O O   . HOH Q 8 .   ? 45.987  12.065  22.616  1.00 45.87  ? 1946 HOH A O   1 
HETATM 8566 O O   . HOH Q 8 .   ? 37.187  9.202   4.346   1.00 41.16  ? 1947 HOH A O   1 
HETATM 8567 O O   . HOH Q 8 .   ? 28.415  -0.610  29.479  1.00 46.40  ? 1948 HOH A O   1 
HETATM 8568 O O   . HOH Q 8 .   ? 14.765  7.640   -4.584  1.00 48.03  ? 1949 HOH A O   1 
HETATM 8569 O O   . HOH Q 8 .   ? 39.589  19.746  16.366  1.00 42.10  ? 1950 HOH A O   1 
HETATM 8570 O O   . HOH Q 8 .   ? 24.786  18.152  28.710  1.00 46.81  ? 1951 HOH A O   1 
HETATM 8571 O O   . HOH Q 8 .   ? 36.401  12.318  6.805   1.00 43.71  ? 1952 HOH A O   1 
HETATM 8572 O O   . HOH Q 8 .   ? 18.351  14.513  4.126   1.00 49.68  ? 1953 HOH A O   1 
HETATM 8573 O O   . HOH Q 8 .   ? 60.873  15.257  10.628  1.00 77.84  ? 1954 HOH A O   1 
HETATM 8574 O O   . HOH Q 8 .   ? 18.841  23.093  38.675  1.00 55.79  ? 1955 HOH A O   1 
HETATM 8575 O O   . HOH Q 8 .   ? 23.858  23.099  22.995  1.00 46.01  ? 1956 HOH A O   1 
HETATM 8576 O O   . HOH Q 8 .   ? 10.620  17.027  33.922  1.00 54.85  ? 1957 HOH A O   1 
HETATM 8577 O O   . HOH Q 8 .   ? 38.053  11.582  4.707   1.00 41.73  ? 1958 HOH A O   1 
HETATM 8578 O O   . HOH Q 8 .   ? 42.945  9.137   11.296  1.00 42.61  ? 1959 HOH A O   1 
HETATM 8579 O O   . HOH Q 8 .   ? 14.125  20.408  14.104  1.00 44.65  ? 1960 HOH A O   1 
HETATM 8580 O O   . HOH Q 8 .   ? 27.389  7.424   -0.636  1.00 51.22  ? 1961 HOH A O   1 
HETATM 8581 O O   . HOH Q 8 .   ? 17.152  19.094  -0.899  1.00 46.19  ? 1962 HOH A O   1 
HETATM 8582 O O   . HOH Q 8 .   ? 31.479  16.431  29.628  1.00 45.76  ? 1963 HOH A O   1 
HETATM 8583 O O   . HOH Q 8 .   ? 19.600  14.268  1.696   1.00 51.14  ? 1964 HOH A O   1 
HETATM 8584 O O   . HOH Q 8 .   ? 39.235  18.239  10.464  1.00 55.44  ? 1965 HOH A O   1 
HETATM 8585 O O   . HOH Q 8 .   ? 4.725   17.971  11.194  1.00 64.13  ? 1966 HOH A O   1 
HETATM 8586 O O   . HOH Q 8 .   ? 34.046  22.939  18.487  1.00 49.51  ? 1967 HOH A O   1 
HETATM 8587 O O   . HOH Q 8 .   ? 36.419  16.181  38.236  1.00 50.21  ? 1968 HOH A O   1 
HETATM 8588 O O   . HOH Q 8 .   ? 37.657  8.232   47.751  1.00 51.46  ? 1969 HOH A O   1 
HETATM 8589 O O   . HOH Q 8 .   ? 32.621  18.698  28.997  1.00 46.47  ? 1970 HOH A O   1 
HETATM 8590 O O   . HOH Q 8 .   ? 49.570  22.440  24.945  1.00 50.40  ? 1971 HOH A O   1 
HETATM 8591 O O   . HOH Q 8 .   ? 41.489  18.494  18.110  1.00 48.50  ? 1972 HOH A O   1 
HETATM 8592 O O   . HOH Q 8 .   ? 29.654  26.809  -6.240  1.00 49.16  ? 1973 HOH A O   1 
HETATM 8593 O O   . HOH Q 8 .   ? 31.926  21.309  21.435  1.00 43.41  ? 1974 HOH A O   1 
HETATM 8594 O O   . HOH Q 8 .   ? 30.732  20.349  16.441  1.00 45.00  ? 1975 HOH A O   1 
HETATM 8595 O O   . HOH Q 8 .   ? 29.462  20.020  18.806  1.00 43.63  ? 1976 HOH A O   1 
HETATM 8596 O O   . HOH Q 8 .   ? 36.518  -5.258  14.066  1.00 52.21  ? 1977 HOH A O   1 
HETATM 8597 O O   . HOH Q 8 .   ? 14.810  32.325  6.458   1.00 54.80  ? 1978 HOH A O   1 
HETATM 8598 O O   . HOH Q 8 .   ? 9.534   24.836  25.607  1.00 53.23  ? 1979 HOH A O   1 
HETATM 8599 O O   . HOH Q 8 .   ? 19.114  0.234   27.925  1.00 49.71  ? 1980 HOH A O   1 
HETATM 8600 O O   . HOH Q 8 .   ? 11.490  22.207  6.441   1.00 58.19  ? 1981 HOH A O   1 
HETATM 8601 O O   . HOH Q 8 .   ? 40.264  26.872  16.722  1.00 54.21  ? 1982 HOH A O   1 
HETATM 8602 O O   . HOH Q 8 .   ? 34.962  15.333  -7.457  1.00 59.94  ? 1983 HOH A O   1 
HETATM 8603 O O   . HOH Q 8 .   ? 43.545  0.325   6.171   1.00 48.89  ? 1984 HOH A O   1 
HETATM 8604 O O   . HOH Q 8 .   ? 38.554  12.871  2.159   1.00 53.55  ? 1985 HOH A O   1 
HETATM 8605 O O   . HOH Q 8 .   ? 17.844  20.720  1.723   1.00 50.22  ? 1986 HOH A O   1 
HETATM 8606 O O   . HOH Q 8 .   ? 45.888  14.434  24.409  1.00 48.13  ? 1987 HOH A O   1 
HETATM 8607 O O   . HOH Q 8 .   ? 19.970  17.280  2.430   1.00 48.44  ? 1988 HOH A O   1 
HETATM 8608 O O   . HOH Q 8 .   ? 17.473  23.263  0.741   1.00 49.77  ? 1989 HOH A O   1 
HETATM 8609 O O   . HOH Q 8 .   ? 30.699  15.575  1.008   1.00 48.28  ? 1990 HOH A O   1 
HETATM 8610 O O   . HOH Q 8 .   ? 40.155  15.998  12.572  1.00 52.39  ? 1991 HOH A O   1 
HETATM 8611 O O   . HOH Q 8 .   ? 39.240  27.263  26.792  1.00 52.30  ? 1992 HOH A O   1 
HETATM 8612 O O   . HOH Q 8 .   ? 43.958  10.826  9.380   1.00 50.07  ? 1993 HOH A O   1 
HETATM 8613 O O   . HOH Q 8 .   ? 23.423  8.575   48.243  1.00 52.67  ? 1994 HOH A O   1 
HETATM 8614 O O   . HOH Q 8 .   ? 33.621  4.522   6.442   1.00 48.57  ? 1995 HOH A O   1 
HETATM 8615 O O   . HOH Q 8 .   ? 34.647  27.351  11.106  1.00 60.82  ? 1996 HOH A O   1 
HETATM 8616 O O   . HOH Q 8 .   ? 25.440  28.814  -14.964 1.00 56.02  ? 1997 HOH A O   1 
HETATM 8617 O O   . HOH Q 8 .   ? 20.430  32.511  10.152  1.00 55.41  ? 1998 HOH A O   1 
HETATM 8618 O O   . HOH Q 8 .   ? 50.548  2.504   7.338   1.00 54.80  ? 1999 HOH A O   1 
HETATM 8619 O O   . HOH Q 8 .   ? 16.523  -3.179  34.031  1.00 58.67  ? 2000 HOH A O   1 
HETATM 8620 O O   . HOH Q 8 .   ? 29.535  7.073   -1.884  1.00 56.31  ? 2001 HOH A O   1 
HETATM 8621 O O   . HOH Q 8 .   ? 15.712  25.294  17.837  1.00 56.76  ? 2002 HOH A O   1 
HETATM 8622 O O   . HOH Q 8 .   ? 35.609  9.138   0.675   1.00 48.87  ? 2003 HOH A O   1 
HETATM 8623 O O   . HOH Q 8 .   ? 15.542  31.059  3.815   1.00 55.44  ? 2004 HOH A O   1 
HETATM 8624 O O   . HOH Q 8 .   ? 43.492  18.172  16.309  1.00 47.00  ? 2005 HOH A O   1 
HETATM 8625 O O   . HOH Q 8 .   ? 36.844  19.226  -4.703  1.00 53.17  ? 2006 HOH A O   1 
HETATM 8626 O O   . HOH Q 8 .   ? 26.367  5.022   0.539   1.00 57.63  ? 2007 HOH A O   1 
HETATM 8627 O O   . HOH Q 8 .   ? 32.237  23.874  34.779  1.00 61.90  ? 2008 HOH A O   1 
HETATM 8628 O O   . HOH Q 8 .   ? 13.757  3.451   32.407  1.00 68.82  ? 2009 HOH A O   1 
HETATM 8629 O O   . HOH Q 8 .   ? 26.739  8.450   7.509   1.00 45.97  ? 2010 HOH A O   1 
HETATM 8630 O O   . HOH Q 8 .   ? 47.913  24.992  23.096  1.00 56.76  ? 2011 HOH A O   1 
HETATM 8631 O O   . HOH Q 8 .   ? 35.953  1.285   36.984  1.00 55.44  ? 2012 HOH A O   1 
HETATM 8632 O O   . HOH Q 8 .   ? 31.752  23.140  16.501  1.00 57.05  ? 2013 HOH A O   1 
HETATM 8633 O O   . HOH Q 8 .   ? 40.299  -2.305  23.974  1.00 55.66  ? 2014 HOH A O   1 
HETATM 8634 O O   . HOH Q 8 .   ? 58.991  20.826  3.413   1.00 64.99  ? 2015 HOH A O   1 
HETATM 8635 O O   . HOH Q 8 .   ? 31.185  28.237  -7.926  1.00 57.01  ? 2016 HOH A O   1 
HETATM 8636 O O   . HOH Q 8 .   ? 15.123  1.184   1.236   1.00 52.65  ? 2017 HOH A O   1 
HETATM 8637 O O   . HOH Q 8 .   ? 15.447  25.891  -16.227 1.00 65.07  ? 2018 HOH A O   1 
HETATM 8638 O O   . HOH Q 8 .   ? 60.274  17.828  9.845   1.00 79.56  ? 2019 HOH A O   1 
HETATM 8639 O O   . HOH Q 8 .   ? 27.777  25.429  23.454  1.00 53.36  ? 2020 HOH A O   1 
HETATM 8640 O O   . HOH Q 8 .   ? 11.558  27.180  12.261  1.00 57.55  ? 2021 HOH A O   1 
HETATM 8641 O O   . HOH Q 8 .   ? 27.987  3.129   2.320   1.00 57.08  ? 2022 HOH A O   1 
HETATM 8642 O O   . HOH Q 8 .   ? 34.635  23.174  -7.322  1.00 55.08  ? 2023 HOH A O   1 
HETATM 8643 O O   . HOH Q 8 .   ? 19.515  21.704  28.543  1.00 55.21  ? 2024 HOH A O   1 
HETATM 8644 O O   . HOH Q 8 .   ? 35.649  25.257  32.256  1.00 64.99  ? 2025 HOH A O   1 
HETATM 8645 O O   . HOH Q 8 .   ? 28.897  1.939   45.805  1.00 49.89  ? 2026 HOH A O   1 
HETATM 8646 O O   . HOH Q 8 .   ? 5.320   11.290  13.602  1.00 50.68  ? 2027 HOH A O   1 
HETATM 8647 O O   . HOH Q 8 .   ? 17.058  2.455   0.071   1.00 52.07  ? 2028 HOH A O   1 
HETATM 8648 O O   . HOH Q 8 .   ? 61.783  16.673  12.275  1.00 71.04  ? 2029 HOH A O   1 
HETATM 8649 O O   . HOH Q 8 .   ? 36.822  -6.810  16.249  1.00 53.43  ? 2030 HOH A O   1 
HETATM 8650 O O   . HOH Q 8 .   ? 18.188  1.151   -3.069  1.00 52.57  ? 2031 HOH A O   1 
HETATM 8651 O O   . HOH Q 8 .   ? 36.402  1.354   34.281  1.00 61.16  ? 2032 HOH A O   1 
HETATM 8652 O O   . HOH Q 8 .   ? 30.490  31.193  -7.399  1.00 53.66  ? 2033 HOH A O   1 
HETATM 8653 O O   . HOH Q 8 .   ? 32.378  20.101  6.291   1.00 55.00  ? 2034 HOH A O   1 
HETATM 8654 O O   . HOH Q 8 .   ? 40.324  10.814  1.388   1.00 52.34  ? 2035 HOH A O   1 
HETATM 8655 O O   . HOH Q 8 .   ? 38.686  3.376   45.426  1.00 51.76  ? 2036 HOH A O   1 
HETATM 8656 O O   . HOH Q 8 .   ? 50.252  16.996  25.957  1.00 56.53  ? 2037 HOH A O   1 
HETATM 8657 O O   . HOH Q 8 .   ? 42.189  16.764  23.818  1.00 52.83  ? 2038 HOH A O   1 
HETATM 8658 O O   . HOH Q 8 .   ? 1.844   8.440   16.597  1.00 56.63  ? 2039 HOH A O   1 
HETATM 8659 O O   . HOH Q 8 .   ? 29.685  25.158  15.579  1.00 56.16  ? 2040 HOH A O   1 
HETATM 8660 O O   . HOH Q 8 .   ? 23.484  19.873  30.587  1.00 54.21  ? 2041 HOH A O   1 
HETATM 8661 O O   . HOH Q 8 .   ? 31.646  2.118   3.339   1.00 55.40  ? 2042 HOH A O   1 
HETATM 8662 O O   . HOH Q 8 .   ? 22.574  19.518  45.488  1.00 53.88  ? 2043 HOH A O   1 
HETATM 8663 O O   . HOH Q 8 .   ? 24.754  22.180  29.639  1.00 49.61  ? 2044 HOH A O   1 
HETATM 8664 O O   . HOH Q 8 .   ? 43.826  23.982  9.975   1.00 54.34  ? 2045 HOH A O   1 
HETATM 8665 O O   . HOH Q 8 .   ? 14.395  -5.941  10.928  1.00 52.92  ? 2046 HOH A O   1 
HETATM 8666 O O   . HOH Q 8 .   ? 40.086  19.391  -4.626  1.00 69.21  ? 2047 HOH A O   1 
HETATM 8667 O O   . HOH Q 8 .   ? 19.349  27.443  16.428  1.00 55.84  ? 2048 HOH A O   1 
HETATM 8668 O O   . HOH Q 8 .   ? 27.500  4.014   46.977  1.00 52.66  ? 2049 HOH A O   1 
HETATM 8669 O O   . HOH Q 8 .   ? 32.618  0.899   44.355  1.00 48.95  ? 2050 HOH A O   1 
HETATM 8670 O O   . HOH Q 8 .   ? 41.427  12.926  35.975  1.00 60.72  ? 2051 HOH A O   1 
HETATM 8671 O O   . HOH Q 8 .   ? 30.366  25.098  -15.432 1.00 56.63  ? 2052 HOH A O   1 
HETATM 8672 O O   . HOH Q 8 .   ? 48.344  4.125   27.244  1.00 70.11  ? 2053 HOH A O   1 
HETATM 8673 O O   . HOH Q 8 .   ? 48.095  0.837   14.385  1.00 53.95  ? 2054 HOH A O   1 
HETATM 8674 O O   . HOH Q 8 .   ? 21.555  33.885  17.079  1.00 55.27  ? 2055 HOH A O   1 
HETATM 8675 O O   . HOH Q 8 .   ? 33.661  -1.967  41.638  1.00 51.79  ? 2056 HOH A O   1 
HETATM 8676 O O   . HOH Q 8 .   ? 3.523   -0.127  4.614   1.00 69.12  ? 2057 HOH A O   1 
HETATM 8677 O O   . HOH Q 8 .   ? 35.829  4.653   39.093  1.00 54.42  ? 2058 HOH A O   1 
HETATM 8678 O O   . HOH Q 8 .   ? 31.821  0.221   41.580  1.00 49.36  ? 2059 HOH A O   1 
HETATM 8679 O O   . HOH Q 8 .   ? 47.879  20.911  26.331  1.00 53.68  ? 2060 HOH A O   1 
HETATM 8680 O O   . HOH Q 8 .   ? 52.117  13.195  3.764   1.00 50.16  ? 2061 HOH A O   1 
HETATM 8681 O O   . HOH Q 8 .   ? 30.330  30.394  14.279  1.00 62.59  ? 2062 HOH A O   1 
HETATM 8682 O O   . HOH Q 8 .   ? 39.775  1.459   25.958  1.00 52.38  ? 2063 HOH A O   1 
HETATM 8683 O O   . HOH Q 8 .   ? 3.746   11.397  10.656  1.00 58.64  ? 2064 HOH A O   1 
HETATM 8684 O O   . HOH Q 8 .   ? 24.569  9.083   52.246  1.00 56.07  ? 2065 HOH A O   1 
HETATM 8685 O O   . HOH Q 8 .   ? 30.805  14.239  51.522  1.00 65.08  ? 2066 HOH A O   1 
HETATM 8686 O O   . HOH Q 8 .   ? 20.554  0.148   -3.345  1.00 60.41  ? 2067 HOH A O   1 
HETATM 8687 O O   . HOH Q 8 .   ? 35.903  2.436   45.749  1.00 59.68  ? 2068 HOH A O   1 
HETATM 8688 O O   . HOH Q 8 .   ? 42.276  26.963  14.873  1.00 57.24  ? 2069 HOH A O   1 
HETATM 8689 O O   . HOH Q 8 .   ? 22.379  19.121  32.982  1.00 64.71  ? 2070 HOH A O   1 
HETATM 8690 O O   . HOH Q 8 .   ? 9.930   10.305  3.103   1.00 50.38  ? 2071 HOH A O   1 
HETATM 8691 O O   . HOH Q 8 .   ? 21.788  -6.246  36.713  1.00 62.09  ? 2072 HOH A O   1 
HETATM 8692 O O   . HOH Q 8 .   ? 25.397  36.842  9.709   1.00 70.93  ? 2073 HOH A O   1 
HETATM 8693 O O   . HOH Q 8 .   ? 44.278  0.934   43.511  1.00 63.94  ? 2074 HOH A O   1 
HETATM 8694 O O   . HOH Q 8 .   ? 36.909  2.372   5.114   1.00 62.28  ? 2075 HOH A O   1 
HETATM 8695 O O   . HOH Q 8 .   ? 47.336  -0.710  12.290  1.00 61.41  ? 2076 HOH A O   1 
HETATM 8696 O O   . HOH Q 8 .   ? 17.550  22.455  31.938  1.00 71.87  ? 2077 HOH A O   1 
HETATM 8697 O O   . HOH Q 8 .   ? 45.672  21.013  27.766  1.00 63.73  ? 2078 HOH A O   1 
HETATM 8698 O O   . HOH Q 8 .   ? 24.985  3.870   45.925  1.00 52.53  ? 2079 HOH A O   1 
HETATM 8699 O O   . HOH Q 8 .   ? 24.495  13.415  55.320  1.00 51.32  ? 2080 HOH A O   1 
HETATM 8700 O O   . HOH Q 8 .   ? 13.858  18.635  1.808   1.00 59.04  ? 2081 HOH A O   1 
HETATM 8701 O O   . HOH Q 8 .   ? 21.077  23.581  36.254  1.00 65.95  ? 2082 HOH A O   1 
HETATM 8702 O O   . HOH Q 8 .   ? 38.655  5.150   49.216  1.00 60.87  ? 2083 HOH A O   1 
HETATM 8703 O O   . HOH Q 8 .   ? 36.897  21.750  -6.367  1.00 58.87  ? 2084 HOH A O   1 
HETATM 8704 O O   . HOH Q 8 .   ? 34.621  23.576  -10.194 1.00 59.06  ? 2085 HOH A O   1 
HETATM 8705 O O   . HOH Q 8 .   ? 21.478  0.033   -0.642  1.00 65.86  ? 2086 HOH A O   1 
HETATM 8706 O O   . HOH Q 8 .   ? 44.873  0.651   16.178  1.00 57.60  ? 2087 HOH A O   1 
HETATM 8707 O O   . HOH Q 8 .   ? 38.638  20.832  2.315   1.00 67.68  ? 2088 HOH A O   1 
HETATM 8708 O O   . HOH Q 8 .   ? 14.534  3.498   30.285  1.00 66.39  ? 2089 HOH A O   1 
HETATM 8709 O O   . HOH Q 8 .   ? 46.522  8.052   27.057  1.00 58.29  ? 2090 HOH A O   1 
HETATM 8710 O O   . HOH Q 8 .   ? 50.635  2.687   4.888   1.00 61.82  ? 2091 HOH A O   1 
HETATM 8711 O O   . HOH Q 8 .   ? 22.240  28.529  -14.818 1.00 58.67  ? 2092 HOH A O   1 
HETATM 8712 O O   . HOH Q 8 .   ? 25.996  -7.841  25.407  1.00 73.80  ? 2093 HOH A O   1 
HETATM 8713 O O   . HOH Q 8 .   ? 41.349  -0.102  4.496   1.00 61.51  ? 2094 HOH A O   1 
HETATM 8714 O O   . HOH Q 8 .   ? 30.370  10.273  48.804  1.00 63.25  ? 2095 HOH A O   1 
HETATM 8715 O O   . HOH Q 8 .   ? 50.770  14.209  1.369   1.00 59.09  ? 2096 HOH A O   1 
HETATM 8716 O O   . HOH Q 8 .   ? 57.548  8.220   20.402  1.00 69.56  ? 2097 HOH A O   1 
HETATM 8717 O O   . HOH Q 8 .   ? 39.680  5.595   46.558  1.00 61.23  ? 2098 HOH A O   1 
HETATM 8718 O O   . HOH Q 8 .   ? 15.948  -3.612  29.618  1.00 55.84  ? 2099 HOH A O   1 
HETATM 8719 O O   . HOH Q 8 .   ? 18.070  34.113  4.080   1.00 76.70  ? 2100 HOH A O   1 
HETATM 8720 O O   . HOH Q 8 .   ? 30.636  28.561  -10.654 1.00 55.12  ? 2101 HOH A O   1 
HETATM 8721 O O   . HOH Q 8 .   ? 35.344  19.036  4.812   1.00 60.01  ? 2102 HOH A O   1 
HETATM 8722 O O   . HOH Q 8 .   ? 39.459  1.885   3.982   1.00 62.44  ? 2103 HOH A O   1 
HETATM 8723 O O   . HOH Q 8 .   ? 19.094  -6.076  28.149  1.00 60.00  ? 2104 HOH A O   1 
HETATM 8724 O O   . HOH Q 8 .   ? 19.262  33.769  7.997   1.00 60.00  ? 2105 HOH A O   1 
HETATM 8725 O O   . HOH Q 8 .   ? 33.846  27.697  -8.262  1.00 57.60  ? 2106 HOH A O   1 
HETATM 8726 O O   . HOH Q 8 .   ? 14.927  -8.266  5.958   1.00 67.38  ? 2107 HOH A O   1 
HETATM 8727 O O   . HOH Q 8 .   ? 16.558  -9.240  10.006  1.00 59.64  ? 2108 HOH A O   1 
HETATM 8728 O O   . HOH Q 8 .   ? 39.010  15.117  38.989  1.00 58.62  ? 2109 HOH A O   1 
HETATM 8729 O O   . HOH Q 8 .   ? 25.394  17.640  48.715  1.00 72.53  ? 2110 HOH A O   1 
HETATM 8730 O O   . HOH Q 8 .   ? 43.457  11.774  45.103  1.00 61.43  ? 2111 HOH A O   1 
HETATM 8731 O O   . HOH Q 8 .   ? 42.477  -1.003  19.274  1.00 60.22  ? 2112 HOH A O   1 
HETATM 8732 O O   . HOH Q 8 .   ? 46.127  1.384   3.270   1.00 56.65  ? 2113 HOH A O   1 
HETATM 8733 O O   . HOH Q 8 .   ? 5.658   5.446   0.836   1.00 64.70  ? 2114 HOH A O   1 
HETATM 8734 O O   . HOH Q 8 .   ? 9.110   7.360   35.196  1.00 68.05  ? 2115 HOH A O   1 
HETATM 8735 O O   . HOH Q 8 .   ? 6.953   20.299  31.089  1.00 63.27  ? 2116 HOH A O   1 
HETATM 8736 O O   . HOH Q 8 .   ? 24.409  -7.273  36.849  1.00 62.33  ? 2117 HOH A O   1 
HETATM 8737 O O   . HOH Q 8 .   ? 46.511  -1.607  17.099  1.00 55.49  ? 2118 HOH A O   1 
HETATM 8738 O O   . HOH Q 8 .   ? 26.580  -7.237  35.358  1.00 58.24  ? 2119 HOH A O   1 
HETATM 8739 O O   . HOH Q 8 .   ? 51.952  4.218   3.404   1.00 69.86  ? 2120 HOH A O   1 
HETATM 8740 O O   . HOH Q 8 .   ? 12.216  9.867   37.619  1.00 69.48  ? 2121 HOH A O   1 
HETATM 8741 O O   . HOH Q 8 .   ? 8.732   10.040  37.331  1.00 70.98  ? 2122 HOH A O   1 
HETATM 8742 O O   . HOH Q 8 .   ? 34.844  25.814  -6.599  1.00 59.88  ? 2123 HOH A O   1 
HETATM 8743 O O   . HOH Q 8 .   ? 6.436   20.037  11.533  1.00 58.77  ? 2124 HOH A O   1 
HETATM 8744 O O   . HOH Q 8 .   ? 44.591  10.721  -0.826  1.00 55.28  ? 2125 HOH A O   1 
HETATM 8745 O O   . HOH Q 8 .   ? 30.224  32.239  -1.691  1.00 70.55  ? 2126 HOH A O   1 
HETATM 8746 O O   . HOH Q 8 .   ? 7.351   14.167  34.750  1.00 58.19  ? 2127 HOH A O   1 
HETATM 8747 O O   . HOH Q 8 .   ? 38.800  -5.729  17.350  1.00 63.19  ? 2128 HOH A O   1 
HETATM 8748 O O   . HOH Q 8 .   ? 37.175  7.536   50.333  1.00 64.14  ? 2129 HOH A O   1 
HETATM 8749 O O   . HOH Q 8 .   ? 44.303  1.443   18.709  1.00 56.60  ? 2130 HOH A O   1 
HETATM 8750 O O   . HOH Q 8 .   ? 20.681  18.704  47.517  1.00 56.85  ? 2131 HOH A O   1 
HETATM 8751 O O   . HOH Q 8 .   ? 37.780  7.599   0.346   1.00 64.43  ? 2132 HOH A O   1 
HETATM 8752 O O   . HOH Q 8 .   ? 39.266  8.449   2.380   1.00 53.62  ? 2133 HOH A O   1 
HETATM 8753 O O   . HOH Q 8 .   ? 12.120  8.297   -0.365  1.00 65.13  ? 2134 HOH A O   1 
HETATM 8754 O O   . HOH Q 8 .   ? 12.707  -9.380  4.320   1.00 64.79  ? 2135 HOH A O   1 
HETATM 8755 O O   . HOH Q 8 .   ? 2.742   15.058  18.131  1.00 63.80  ? 2136 HOH A O   1 
HETATM 8756 O O   . HOH Q 8 .   ? 50.941  6.757   3.298   1.00 61.21  ? 2137 HOH A O   1 
HETATM 8757 O O   . HOH Q 8 .   ? 9.058   -7.586  5.361   1.00 71.27  ? 2138 HOH A O   1 
HETATM 8758 O O   . HOH Q 8 .   ? 8.010   17.401  32.604  1.00 61.83  ? 2139 HOH A O   1 
HETATM 8759 O O   . HOH Q 8 .   ? 27.448  31.553  -11.912 1.00 56.77  ? 2140 HOH A O   1 
HETATM 8760 O O   . HOH Q 8 .   ? 12.148  5.392   -2.032  1.00 70.13  ? 2141 HOH A O   1 
HETATM 8761 O O   . HOH Q 8 .   ? 12.046  25.287  6.245   1.00 61.20  ? 2142 HOH A O   1 
HETATM 8762 O O   . HOH Q 8 .   ? 7.780   -4.060  16.265  1.00 62.98  ? 2143 HOH A O   1 
HETATM 8763 O O   . HOH Q 8 .   ? 52.865  8.543   3.927   1.00 55.19  ? 2144 HOH A O   1 
HETATM 8764 O O   . HOH Q 8 .   ? 42.700  1.277   25.807  1.00 67.62  ? 2145 HOH A O   1 
HETATM 8765 O O   . HOH Q 8 .   ? 32.403  27.244  -12.304 1.00 56.07  ? 2146 HOH A O   1 
HETATM 8766 O O   . HOH Q 8 .   ? 30.462  28.916  1.069   1.00 70.70  ? 2147 HOH A O   1 
HETATM 8767 O O   . HOH Q 8 .   ? 33.761  1.108   4.518   1.00 67.04  ? 2148 HOH A O   1 
HETATM 8768 O O   . HOH Q 8 .   ? 43.188  0.140   41.290  1.00 63.35  ? 2149 HOH A O   1 
HETATM 8769 O O   . HOH Q 8 .   ? 39.122  14.783  46.176  1.00 69.91  ? 2150 HOH A O   1 
HETATM 8770 O O   . HOH Q 8 .   ? 38.089  3.845   34.625  1.00 61.95  ? 2151 HOH A O   1 
HETATM 8771 O O   . HOH Q 8 .   ? 3.016   6.086   17.710  1.00 62.88  ? 2152 HOH A O   1 
HETATM 8772 O O   . HOH Q 8 .   ? 53.375  10.889  2.918   1.00 58.22  ? 2153 HOH A O   1 
HETATM 8773 O O   . HOH Q 8 .   ? 29.968  31.099  -11.404 1.00 60.65  ? 2154 HOH A O   1 
HETATM 8774 O O   . HOH Q 8 .   ? 26.091  22.734  38.115  1.00 77.15  ? 2155 HOH A O   1 
HETATM 8775 O O   . HOH Q 8 .   ? 20.723  -6.083  20.356  1.00 67.36  ? 2156 HOH A O   1 
HETATM 8776 O O   . HOH Q 8 .   ? 37.650  16.910  -6.073  1.00 69.21  ? 2157 HOH A O   1 
HETATM 8777 O O   . HOH Q 8 .   ? 45.004  3.020   44.758  1.00 62.93  ? 2158 HOH A O   1 
HETATM 8778 O O   . HOH Q 8 .   ? 9.557   6.427   0.780   1.00 56.11  ? 2159 HOH A O   1 
HETATM 8779 O O   . HOH Q 8 .   ? 30.697  19.049  -11.779 1.00 70.73  ? 2160 HOH A O   1 
HETATM 8780 O O   . HOH Q 8 .   ? 23.545  -3.993  -1.087  1.00 77.08  ? 2161 HOH A O   1 
HETATM 8781 O O   . HOH Q 8 .   ? 26.449  27.233  -16.846 1.00 68.27  ? 2162 HOH A O   1 
HETATM 8782 O O   . HOH Q 8 .   ? 34.851  8.001   -8.604  1.00 62.17  ? 2163 HOH A O   1 
HETATM 8783 O O   . HOH Q 8 .   ? 25.422  18.801  45.957  1.00 57.25  ? 2164 HOH A O   1 
HETATM 8784 O O   . HOH Q 8 .   ? 34.392  -3.109  33.288  1.00 60.99  ? 2165 HOH A O   1 
HETATM 8785 O O   . HOH Q 8 .   ? 40.021  21.971  4.391   1.00 69.30  ? 2166 HOH A O   1 
HETATM 8786 O O   . HOH Q 8 .   ? 38.560  12.250  -13.578 1.00 75.27  ? 2167 HOH A O   1 
HETATM 8787 O O   . HOH Q 8 .   ? 30.301  33.989  -3.914  1.00 70.98  ? 2168 HOH A O   1 
HETATM 8788 O O   . HOH Q 8 .   ? 41.016  2.189   46.390  1.00 58.30  ? 2169 HOH A O   1 
HETATM 8789 O O   . HOH Q 8 .   ? 47.004  17.235  1.179   1.00 64.16  ? 2170 HOH A O   1 
HETATM 8790 O O   . HOH Q 8 .   ? 12.514  8.526   41.903  1.00 68.43  ? 2171 HOH A O   1 
HETATM 8791 O O   . HOH Q 8 .   ? 32.923  22.887  -11.943 1.00 60.36  ? 2172 HOH A O   1 
HETATM 8792 O O   . HOH Q 8 .   ? 48.441  11.400  32.929  1.00 68.64  ? 2173 HOH A O   1 
HETATM 8793 O O   . HOH Q 8 .   ? 20.491  29.425  -13.206 1.00 71.72  ? 2174 HOH A O   1 
HETATM 8794 O O   . HOH Q 8 .   ? 39.144  24.075  34.484  1.00 78.82  ? 2175 HOH A O   1 
HETATM 8795 O O   . HOH Q 8 .   ? 41.958  0.368   44.856  1.00 49.53  ? 2176 HOH A O   1 
HETATM 8796 O O   . HOH Q 8 .   ? 23.801  32.517  -4.285  1.00 58.84  ? 2177 HOH A O   1 
HETATM 8797 O O   . HOH Q 8 .   ? 41.138  0.514   39.759  1.00 61.06  ? 2178 HOH A O   1 
HETATM 8798 O O   . HOH Q 8 .   ? 33.180  17.863  38.564  1.00 55.31  ? 2179 HOH A O   1 
HETATM 8799 O O   . HOH Q 8 .   ? 18.077  24.832  18.030  1.00 66.41  ? 2180 HOH A O   1 
HETATM 8800 O O   . HOH Q 8 .   ? 3.928   3.171   18.432  1.00 65.97  ? 2181 HOH A O   1 
HETATM 8801 O O   . HOH Q 8 .   ? 46.424  12.521  -1.355  1.00 68.03  ? 2182 HOH A O   1 
HETATM 8802 O O   . HOH Q 8 .   ? 4.778   23.598  16.795  1.00 70.76  ? 2183 HOH A O   1 
HETATM 8803 O O   . HOH Q 8 .   ? 32.544  -7.593  13.367  1.00 71.24  ? 2184 HOH A O   1 
HETATM 8804 O O   . HOH Q 8 .   ? 34.602  26.723  -10.400 1.00 63.43  ? 2185 HOH A O   1 
HETATM 8805 O O   . HOH Q 8 .   ? 15.317  -7.333  24.425  1.00 72.50  ? 2186 HOH A O   1 
HETATM 8806 O O   . HOH Q 8 .   ? 35.938  26.776  25.522  1.00 57.36  ? 2187 HOH A O   1 
HETATM 8807 O O   . HOH Q 8 .   ? 8.291   21.272  10.135  1.00 57.73  ? 2188 HOH A O   1 
HETATM 8808 O O   . HOH Q 8 .   ? 0.870   4.714   7.766   1.00 64.44  ? 2189 HOH A O   1 
HETATM 8809 O O   . HOH Q 8 .   ? 43.723  1.900   38.063  1.00 74.51  ? 2190 HOH A O   1 
HETATM 8810 O O   . HOH Q 8 .   ? 25.895  33.423  -5.809  1.00 58.65  ? 2191 HOH A O   1 
HETATM 8811 O O   . HOH Q 8 .   ? 13.395  4.694   36.796  1.00 59.84  ? 2192 HOH A O   1 
HETATM 8812 O O   . HOH Q 8 .   ? 13.736  2.075   37.375  1.00 62.84  ? 2193 HOH A O   1 
HETATM 8813 O O   . HOH Q 8 .   ? 44.995  10.314  38.269  1.00 80.76  ? 2194 HOH A O   1 
HETATM 8814 O O   . HOH Q 8 .   ? 23.504  -4.207  -7.964  1.00 68.01  ? 2195 HOH A O   1 
HETATM 8815 O O   . HOH Q 8 .   ? 12.719  6.173   -4.767  1.00 67.70  ? 2196 HOH A O   1 
HETATM 8816 O O   . HOH Q 8 .   ? 36.983  17.326  43.957  1.00 67.97  ? 2197 HOH A O   1 
HETATM 8817 O O   . HOH Q 8 .   ? 39.590  -3.634  19.382  1.00 61.94  ? 2198 HOH A O   1 
HETATM 8818 O O   . HOH Q 8 .   ? 58.874  7.400   22.531  1.00 73.63  ? 2199 HOH A O   1 
HETATM 8819 O O   . HOH Q 8 .   ? 32.767  29.301  -0.155  1.00 65.69  ? 2200 HOH A O   1 
HETATM 8820 O O   . HOH Q 8 .   ? 35.429  25.355  -0.797  1.00 69.94  ? 2201 HOH A O   1 
HETATM 8821 O O   . HOH Q 8 .   ? 33.917  7.779   -1.146  1.00 68.67  ? 2202 HOH A O   1 
HETATM 8822 O O   . HOH Q 8 .   ? 21.335  32.039  -9.656  1.00 65.55  ? 2203 HOH A O   1 
HETATM 8823 O O   . HOH Q 8 .   ? 46.534  7.601   0.290   1.00 68.78  ? 2204 HOH A O   1 
HETATM 8824 O O   . HOH Q 8 .   ? 36.490  -2.574  34.867  1.00 62.41  ? 2205 HOH A O   1 
HETATM 8825 O O   . HOH Q 8 .   ? 14.056  30.721  -0.499  1.00 75.33  ? 2206 HOH A O   1 
HETATM 8826 O O   . HOH Q 8 .   ? 24.896  -5.296  39.219  1.00 59.59  ? 2207 HOH A O   1 
HETATM 8827 O O   . HOH Q 8 .   ? 25.475  -3.332  -2.503  1.00 72.49  ? 2208 HOH A O   1 
HETATM 8828 O O   . HOH Q 8 .   ? 12.325  -7.976  11.761  1.00 69.66  ? 2209 HOH A O   1 
HETATM 8829 O O   . HOH Q 8 .   ? 31.407  5.146   0.897   1.00 69.58  ? 2210 HOH A O   1 
HETATM 8830 O O   . HOH Q 8 .   ? 3.685   12.379  7.881   1.00 67.12  ? 2211 HOH A O   1 
HETATM 8831 O O   . HOH Q 8 .   ? 56.147  2.119   13.516  1.00 72.10  ? 2212 HOH A O   1 
HETATM 8832 O O   . HOH Q 8 .   ? 11.675  13.848  39.998  1.00 56.03  ? 2213 HOH A O   1 
HETATM 8833 O O   . HOH Q 8 .   ? 19.635  25.655  25.944  1.00 73.31  ? 2214 HOH A O   1 
HETATM 8834 O O   . HOH Q 8 .   ? 58.506  14.291  23.228  1.00 67.89  ? 2215 HOH A O   1 
HETATM 8835 O O   . HOH Q 8 .   ? 49.840  1.554   21.805  1.00 62.67  ? 2216 HOH A O   1 
HETATM 8836 O O   . HOH Q 8 .   ? 27.875  25.049  -16.175 1.00 65.42  ? 2217 HOH A O   1 
HETATM 8837 O O   . HOH Q 8 .   ? 13.238  11.657  39.561  1.00 65.38  ? 2218 HOH A O   1 
HETATM 8838 O O   . HOH Q 8 .   ? 11.673  2.524   -6.597  1.00 70.74  ? 2219 HOH A O   1 
HETATM 8839 O O   . HOH Q 8 .   ? 49.803  5.691   27.917  1.00 76.99  ? 2220 HOH A O   1 
HETATM 8840 O O   . HOH Q 8 .   ? 5.640   -3.125  14.988  1.00 72.58  ? 2221 HOH A O   1 
HETATM 8841 O O   . HOH Q 8 .   ? 8.233   -1.804  23.764  1.00 64.50  ? 2222 HOH A O   1 
HETATM 8842 O O   . HOH Q 8 .   ? 31.496  4.526   -4.948  1.00 68.13  ? 2223 HOH A O   1 
HETATM 8843 O O   . HOH Q 8 .   ? 35.509  0.325   1.553   1.00 69.83  ? 2224 HOH A O   1 
HETATM 8844 O O   . HOH Q 8 .   ? 35.523  6.908   -14.054 1.00 73.26  ? 2225 HOH A O   1 
HETATM 8845 O O   . HOH Q 8 .   ? 8.206   28.627  19.354  1.00 63.60  ? 2226 HOH A O   1 
HETATM 8846 O O   . HOH Q 8 .   ? 20.654  -6.199  1.186   1.00 73.43  ? 2227 HOH A O   1 
HETATM 8847 O O   . HOH Q 8 .   ? 48.272  -0.151  20.885  1.00 62.15  ? 2228 HOH A O   1 
HETATM 8848 O O   . HOH Q 8 .   ? 33.823  28.281  21.930  1.00 63.43  ? 2229 HOH A O   1 
HETATM 8849 O O   . HOH Q 8 .   ? 31.952  6.395   -1.037  1.00 68.62  ? 2230 HOH A O   1 
HETATM 8850 O O   . HOH Q 8 .   ? 39.671  3.533   39.667  1.00 65.71  ? 2231 HOH A O   1 
HETATM 8851 O O   . HOH Q 8 .   ? 33.581  28.590  24.493  1.00 67.17  ? 2232 HOH A O   1 
HETATM 8852 O O   . HOH Q 8 .   ? 45.754  0.328   20.671  1.00 59.44  ? 2233 HOH A O   1 
HETATM 8853 O O   . HOH Q 8 .   ? 39.495  16.825  48.118  1.00 76.52  ? 2234 HOH A O   1 
HETATM 8854 O O   . HOH Q 8 .   ? 2.032   26.783  21.628  1.00 71.09  ? 2235 HOH A O   1 
HETATM 8855 O O   . HOH Q 8 .   ? 36.615  10.129  -15.407 1.00 67.57  ? 2236 HOH A O   1 
HETATM 8856 O O   . HOH Q 8 .   ? 7.016   28.220  26.809  1.00 72.46  ? 2237 HOH A O   1 
HETATM 8857 O O   . HOH Q 8 .   ? 34.004  20.224  -12.759 1.00 70.08  ? 2238 HOH A O   1 
HETATM 8858 O O   . HOH Q 8 .   ? 15.059  -7.053  27.007  1.00 73.83  ? 2239 HOH A O   1 
HETATM 8859 O O   . HOH Q 8 .   ? 22.920  18.900  61.967  1.00 69.26  ? 2240 HOH A O   1 
HETATM 8860 O O   . HOH Q 8 .   ? 5.643   12.137  29.036  1.00 65.06  ? 2241 HOH A O   1 
HETATM 8861 O O   . HOH Q 8 .   ? 13.592  23.174  34.908  1.00 69.37  ? 2242 HOH A O   1 
HETATM 8862 O O   . HOH Q 8 .   ? 12.087  7.130   38.051  1.00 72.13  ? 2243 HOH A O   1 
HETATM 8863 O O   . HOH Q 8 .   ? 25.670  -7.869  30.338  1.00 82.24  ? 2244 HOH A O   1 
HETATM 8864 O O   . HOH Q 8 .   ? 54.367  25.064  14.337  1.00 69.17  ? 2245 HOH A O   1 
HETATM 8865 O O   . HOH Q 8 .   ? 40.879  16.608  37.489  1.00 66.17  ? 2246 HOH A O   1 
HETATM 8866 O O   . HOH Q 8 .   ? 12.075  27.714  -1.973  1.00 67.80  ? 2247 HOH A O   1 
HETATM 8867 O O   . HOH Q 8 .   ? 50.979  12.121  31.650  1.00 66.18  ? 2248 HOH A O   1 
HETATM 8868 O O   . HOH Q 8 .   ? 25.548  23.997  34.013  1.00 70.36  ? 2249 HOH A O   1 
HETATM 8869 O O   . HOH Q 8 .   ? 43.326  15.680  36.184  1.00 63.63  ? 2250 HOH A O   1 
HETATM 8870 O O   . HOH Q 8 .   ? 32.725  -10.136 9.994   1.00 75.67  ? 2251 HOH A O   1 
HETATM 8871 O O   . HOH Q 8 .   ? 24.786  21.885  35.010  1.00 68.17  ? 2252 HOH A O   1 
HETATM 8872 O O   . HOH Q 8 .   ? 56.452  13.124  25.637  1.00 65.99  ? 2253 HOH A O   1 
HETATM 8873 O O   . HOH Q 8 .   ? 42.613  6.155   0.324   1.00 71.98  ? 2254 HOH A O   1 
HETATM 8874 O O   . HOH Q 8 .   ? 9.620   5.272   36.428  1.00 78.61  ? 2255 HOH A O   1 
HETATM 8875 O O   . HOH Q 8 .   ? 23.717  19.308  50.251  1.00 73.20  ? 2256 HOH A O   1 
HETATM 8876 O O   . HOH Q 8 .   ? 24.276  35.810  12.645  1.00 77.50  ? 2257 HOH A O   1 
HETATM 8877 O O   . HOH Q 8 .   ? 33.109  30.812  19.822  1.00 78.32  ? 2258 HOH A O   1 
HETATM 8878 O O   . HOH Q 8 .   ? 24.223  32.756  -8.840  1.00 61.41  ? 2259 HOH A O   1 
HETATM 8879 O O   . HOH Q 8 .   ? 40.534  19.131  35.054  1.00 73.48  ? 2260 HOH A O   1 
HETATM 8880 O O   . HOH Q 8 .   ? 56.735  2.752   16.394  1.00 76.21  ? 2261 HOH A O   1 
HETATM 8881 O O   . HOH Q 8 .   ? 12.679  -5.458  -1.896  1.00 72.13  ? 2262 HOH A O   1 
HETATM 8882 O O   . HOH Q 8 .   ? 43.536  24.230  29.292  1.00 70.82  ? 2263 HOH A O   1 
HETATM 8883 O O   . HOH Q 8 .   ? 28.571  -5.575  35.861  1.00 60.41  ? 2264 HOH A O   1 
HETATM 8884 O O   . HOH Q 8 .   ? 37.551  2.917   37.971  1.00 69.31  ? 2265 HOH A O   1 
HETATM 8885 O O   . HOH Q 8 .   ? 36.985  14.588  50.998  1.00 67.70  ? 2266 HOH A O   1 
HETATM 8886 O O   . HOH Q 8 .   ? 64.093  4.803   16.513  1.00 87.72  ? 2267 HOH A O   1 
HETATM 8887 O O   . HOH Q 8 .   ? 55.601  15.290  26.300  1.00 61.82  ? 2268 HOH A O   1 
HETATM 8888 O O   . HOH Q 8 .   ? 2.516   17.233  18.703  1.00 61.62  ? 2269 HOH A O   1 
HETATM 8889 O O   . HOH Q 8 .   ? 35.322  16.719  50.881  1.00 65.27  ? 2270 HOH A O   1 
HETATM 8890 O O   . HOH Q 8 .   ? 25.456  19.557  -16.970 1.00 64.25  ? 2271 HOH A O   1 
HETATM 8891 O O   . HOH Q 8 .   ? 13.793  -9.898  13.337  1.00 78.80  ? 2272 HOH A O   1 
HETATM 8892 O O   . HOH Q 8 .   ? 7.169   3.948   -1.596  1.00 70.90  ? 2273 HOH A O   1 
HETATM 8893 O O   . HOH Q 8 .   ? 48.831  -1.129  18.598  1.00 64.77  ? 2274 HOH A O   1 
HETATM 8894 O O   . HOH Q 8 .   ? 54.201  13.032  30.434  1.00 67.80  ? 2275 HOH A O   1 
HETATM 8895 O O   . HOH Q 8 .   ? 12.765  29.941  -3.912  1.00 63.27  ? 2276 HOH A O   1 
HETATM 8896 O O   . HOH Q 8 .   ? 14.965  16.130  50.193  1.00 74.89  ? 2277 HOH A O   1 
HETATM 8897 O O   . HOH Q 8 .   ? 48.681  21.589  3.294   1.00 66.85  ? 2278 HOH A O   1 
HETATM 8898 O O   . HOH Q 8 .   ? 31.055  15.453  60.746  1.00 78.50  ? 2279 HOH A O   1 
HETATM 8899 O O   . HOH Q 8 .   ? 61.434  15.911  19.891  1.00 68.52  ? 2280 HOH A O   1 
HETATM 8900 O O   . HOH Q 8 .   ? 12.633  14.667  46.286  1.00 67.21  ? 2281 HOH A O   1 
HETATM 8901 O O   . HOH Q 8 .   ? 44.013  9.636   41.311  1.00 62.95  ? 2282 HOH A O   1 
HETATM 8902 O O   . HOH Q 8 .   ? 13.034  -0.051  35.593  1.00 69.44  ? 2283 HOH A O   1 
HETATM 8903 O O   . HOH Q 8 .   ? 13.733  13.144  48.336  1.00 64.88  ? 2284 HOH A O   1 
HETATM 8904 O O   . HOH Q 8 .   ? 49.426  24.634  4.651   1.00 65.47  ? 2285 HOH A O   1 
HETATM 8905 O O   . HOH Q 8 .   ? 32.813  23.052  13.363  1.00 64.86  ? 2286 HOH A O   1 
HETATM 8906 O O   . HOH Q 8 .   ? 11.893  11.927  2.081   1.00 70.33  ? 2287 HOH A O   1 
HETATM 8907 O O   . HOH Q 8 .   ? 0.269   12.671  17.605  1.00 75.34  ? 2288 HOH A O   1 
HETATM 8908 O O   . HOH Q 8 .   ? 0.259   10.049  17.914  1.00 68.82  ? 2289 HOH A O   1 
HETATM 8909 O O   . HOH Q 8 .   ? 3.734   10.561  24.701  1.00 77.38  ? 2290 HOH A O   1 
HETATM 8910 O O   . HOH Q 8 .   ? 8.211   -5.493  9.297   1.00 64.21  ? 2291 HOH A O   1 
HETATM 8911 O O   . HOH Q 8 .   ? 47.816  2.667   46.004  1.00 76.32  ? 2292 HOH A O   1 
HETATM 8912 O O   . HOH Q 8 .   ? 59.189  14.638  9.084   1.00 76.62  ? 2293 HOH A O   1 
HETATM 8913 O O   . HOH Q 8 .   ? 16.884  -6.280  29.612  1.00 62.61  ? 2294 HOH A O   1 
HETATM 8914 O O   . HOH Q 8 .   ? 16.948  -10.646 3.746   1.00 75.44  ? 2295 HOH A O   1 
HETATM 8915 O O   . HOH Q 8 .   ? 43.607  12.001  42.214  1.00 71.40  ? 2296 HOH A O   1 
HETATM 8916 O O   . HOH Q 8 .   ? 20.220  36.505  8.372   1.00 64.32  ? 2297 HOH A O   1 
HETATM 8917 O O   . HOH Q 8 .   ? 16.478  16.682  0.090   1.00 72.83  ? 2298 HOH A O   1 
HETATM 8918 O O   . HOH Q 8 .   ? 46.921  0.670   30.981  1.00 83.52  ? 2299 HOH A O   1 
HETATM 8919 O O   . HOH Q 8 .   ? 14.188  27.105  21.869  1.00 79.09  ? 2300 HOH A O   1 
HETATM 8920 O O   . HOH Q 8 .   ? 15.440  22.725  32.940  1.00 82.73  ? 2301 HOH A O   1 
HETATM 8921 O O   . HOH Q 8 .   ? 60.022  3.694   15.081  1.00 77.64  ? 2302 HOH A O   1 
HETATM 8922 O O   . HOH Q 8 .   ? 3.356   8.446   23.565  1.00 73.75  ? 2303 HOH A O   1 
HETATM 8923 O O   . HOH Q 8 .   ? 38.654  8.348   -5.587  1.00 67.77  ? 2304 HOH A O   1 
HETATM 8924 O O   . HOH Q 8 .   ? 42.518  6.128   47.322  1.00 65.67  ? 2305 HOH A O   1 
HETATM 8925 O O   . HOH Q 8 .   ? 32.820  -5.255  35.404  1.00 66.77  ? 2306 HOH A O   1 
HETATM 8926 O O   . HOH Q 8 .   ? 23.405  36.607  15.709  1.00 78.28  ? 2307 HOH A O   1 
HETATM 8927 O O   . HOH Q 8 .   ? 35.185  19.614  -15.927 1.00 83.13  ? 2308 HOH A O   1 
HETATM 8928 O O   . HOH Q 8 .   ? 57.836  18.931  1.608   1.00 53.34  ? 2309 HOH A O   1 
HETATM 8929 O O   . HOH Q 8 .   ? 32.570  6.520   -6.357  1.00 67.94  ? 2310 HOH A O   1 
HETATM 8930 O O   . HOH Q 8 .   ? 6.412   14.293  38.056  1.00 70.60  ? 2311 HOH A O   1 
HETATM 8931 O O   . HOH Q 8 .   ? 39.723  14.359  44.143  1.00 66.31  ? 2312 HOH A O   1 
HETATM 8932 O O   . HOH Q 8 .   ? 17.856  21.606  43.460  1.00 77.77  ? 2313 HOH A O   1 
HETATM 8933 O O   . HOH Q 8 .   ? 35.048  34.766  12.000  1.00 78.95  ? 2314 HOH A O   1 
HETATM 8934 O O   . HOH Q 8 .   ? 18.169  36.284  5.472   1.00 90.15  ? 2315 HOH A O   1 
HETATM 8935 O O   . HOH Q 8 .   ? 36.240  11.858  -17.654 1.00 75.95  ? 2316 HOH A O   1 
HETATM 8936 O O   . HOH Q 8 .   ? 16.441  17.163  -5.057  1.00 65.59  ? 2317 HOH A O   1 
HETATM 8937 O O   . HOH Q 8 .   ? 29.141  2.383   -1.453  1.00 66.00  ? 2318 HOH A O   1 
HETATM 8938 O O   . HOH Q 8 .   ? 30.838  8.116   -4.949  1.00 66.38  ? 2319 HOH A O   1 
HETATM 8939 O O   . HOH Q 8 .   ? 14.030  16.024  1.423   1.00 73.35  ? 2320 HOH A O   1 
HETATM 8940 O O   . HOH Q 8 .   ? 2.849   6.498   3.343   1.00 75.45  ? 2321 HOH A O   1 
HETATM 8941 O O   . HOH Q 8 .   ? 48.778  12.322  -2.631  1.00 79.06  ? 2322 HOH A O   1 
HETATM 8942 O O   . HOH Q 8 .   ? 32.157  28.876  -14.574 1.00 63.17  ? 2323 HOH A O   1 
HETATM 8943 O O   . HOH Q 8 .   ? 34.995  -8.581  13.288  1.00 77.33  ? 2324 HOH A O   1 
HETATM 8944 O O   . HOH Q 8 .   ? 9.320   2.948   37.572  1.00 76.93  ? 2325 HOH A O   1 
HETATM 8945 O O   . HOH Q 8 .   ? 48.503  -1.256  5.743   1.00 68.62  ? 2326 HOH A O   1 
HETATM 8946 O O   . HOH Q 8 .   ? 46.164  8.858   -2.012  1.00 85.41  ? 2327 HOH A O   1 
HETATM 8947 O O   . HOH Q 8 .   ? 5.562   29.624  22.693  1.00 78.80  ? 2328 HOH A O   1 
HETATM 8948 O O   . HOH Q 8 .   ? 21.067  19.514  52.852  1.00 64.82  ? 2329 HOH A O   1 
HETATM 8949 O O   . HOH Q 8 .   ? 15.736  13.965  -9.431  1.00 63.81  ? 2330 HOH A O   1 
HETATM 8950 O O   . HOH Q 8 .   ? 63.451  11.841  19.481  1.00 76.62  ? 2331 HOH A O   1 
HETATM 8951 O O   . HOH Q 8 .   ? 57.988  4.083   9.712   1.00 78.41  ? 2332 HOH A O   1 
HETATM 8952 O O   . HOH Q 8 .   ? 3.739   -3.085  16.953  1.00 77.93  ? 2333 HOH A O   1 
HETATM 8953 O O   . HOH Q 8 .   ? 7.822   10.788  1.169   1.00 67.03  ? 2334 HOH A O   1 
HETATM 8954 O O   . HOH Q 8 .   ? 19.505  -8.087  -0.358  1.00 87.77  ? 2335 HOH A O   1 
HETATM 8955 O O   . HOH Q 8 .   ? 3.300   3.866   21.012  1.00 75.26  ? 2336 HOH A O   1 
HETATM 8956 O O   . HOH Q 8 .   ? 50.955  16.816  0.320   1.00 70.00  ? 2337 HOH A O   1 
HETATM 8957 O O   . HOH Q 8 .   ? 61.484  13.245  9.097   1.00 83.44  ? 2338 HOH A O   1 
HETATM 8958 O O   . HOH Q 8 .   ? 14.323  -8.751  8.530   1.00 72.50  ? 2339 HOH A O   1 
HETATM 8959 O O   . HOH Q 8 .   ? 53.203  20.008  25.598  1.00 64.18  ? 2340 HOH A O   1 
HETATM 8960 O O   . HOH Q 8 .   ? 21.666  22.379  -19.547 1.00 73.33  ? 2341 HOH A O   1 
HETATM 8961 O O   . HOH Q 8 .   ? 13.998  32.094  16.262  1.00 76.16  ? 2342 HOH A O   1 
HETATM 8962 O O   . HOH Q 8 .   ? 11.476  3.127   -11.550 1.00 58.19  ? 2343 HOH A O   1 
HETATM 8963 O O   . HOH Q 8 .   ? 46.628  2.168   40.508  1.00 72.14  ? 2344 HOH A O   1 
HETATM 8964 O O   . HOH Q 8 .   ? 37.970  17.676  -8.456  1.00 73.02  ? 2345 HOH A O   1 
HETATM 8965 O O   . HOH Q 8 .   ? 44.863  -3.457  8.032   1.00 65.33  ? 2346 HOH A O   1 
HETATM 8966 O O   . HOH Q 8 .   ? 43.000  21.516  0.721   1.00 74.19  ? 2347 HOH A O   1 
HETATM 8967 O O   . HOH Q 8 .   ? 44.714  27.970  11.132  1.00 74.20  ? 2348 HOH A O   1 
HETATM 8968 O O   . HOH Q 8 .   ? 10.708  31.655  -0.311  1.00 79.66  ? 2349 HOH A O   1 
HETATM 8969 O O   . HOH Q 8 .   ? 36.158  5.065   2.625   1.00 74.51  ? 2350 HOH A O   1 
HETATM 8970 O O   . HOH Q 8 .   ? 21.516  24.338  31.775  1.00 61.01  ? 2351 HOH A O   1 
HETATM 8971 O O   . HOH Q 8 .   ? 53.453  22.311  24.975  1.00 77.78  ? 2352 HOH A O   1 
HETATM 8972 O O   . HOH Q 8 .   ? 6.484   23.544  27.656  1.00 70.92  ? 2353 HOH A O   1 
HETATM 8973 O O   . HOH Q 8 .   ? 15.422  32.311  10.898  1.00 71.79  ? 2354 HOH A O   1 
HETATM 8974 O O   . HOH Q 8 .   ? 11.898  2.842   33.271  1.00 72.56  ? 2355 HOH A O   1 
HETATM 8975 O O   . HOH Q 8 .   ? 9.312   2.586   33.112  1.00 71.54  ? 2356 HOH A O   1 
HETATM 8976 O O   . HOH Q 8 .   ? 29.889  0.252   2.468   1.00 75.13  ? 2357 HOH A O   1 
HETATM 8977 O O   . HOH Q 8 .   ? 21.473  -4.300  0.226   1.00 75.80  ? 2358 HOH A O   1 
HETATM 8978 O O   . HOH Q 8 .   ? 23.088  -9.127  23.905  1.00 68.96  ? 2359 HOH A O   1 
HETATM 8979 O O   . HOH Q 8 .   ? 16.904  -12.621 7.512   1.00 71.67  ? 2360 HOH A O   1 
HETATM 8980 O O   . HOH Q 8 .   ? 14.603  13.785  2.837   1.00 76.18  ? 2361 HOH A O   1 
HETATM 8981 O O   . HOH Q 8 .   ? 17.237  13.007  -3.279  1.00 65.36  ? 2362 HOH A O   1 
HETATM 8982 O O   . HOH Q 8 .   ? -0.127  10.724  9.949   1.00 76.47  ? 2363 HOH A O   1 
HETATM 8983 O O   . HOH Q 8 .   ? 48.869  0.899   3.459   1.00 70.65  ? 2364 HOH A O   1 
HETATM 8984 O O   . HOH Q 8 .   ? 55.445  8.362   7.958   1.00 67.04  ? 2365 HOH A O   1 
HETATM 8985 O O   . HOH Q 8 .   ? 48.623  -3.397  14.580  1.00 69.99  ? 2366 HOH A O   1 
HETATM 8986 O O   . HOH Q 8 .   ? 41.910  10.742  -0.936  1.00 63.45  ? 2367 HOH A O   1 
HETATM 8987 O O   . HOH Q 8 .   ? 40.872  12.245  -2.689  1.00 61.47  ? 2368 HOH A O   1 
HETATM 8988 O O   . HOH Q 8 .   ? 45.959  3.388   35.349  1.00 76.78  ? 2369 HOH A O   1 
HETATM 8989 O O   . HOH Q 8 .   ? 51.293  9.691   35.900  1.00 79.13  ? 2370 HOH A O   1 
HETATM 8990 O O   . HOH Q 8 .   ? 60.530  23.292  12.191  1.00 69.17  ? 2371 HOH A O   1 
HETATM 8991 O O   . HOH Q 8 .   ? 53.123  22.335  2.598   1.00 67.39  ? 2372 HOH A O   1 
HETATM 8992 O O   . HOH Q 8 .   ? 54.667  19.532  2.999   1.00 76.88  ? 2373 HOH A O   1 
HETATM 8993 O O   . HOH Q 8 .   ? 41.792  26.481  26.740  1.00 60.50  ? 2374 HOH A O   1 
HETATM 8994 O O   . HOH Q 8 .   ? 42.501  22.540  33.108  1.00 72.83  ? 2375 HOH A O   1 
HETATM 8995 O O   . HOH Q 8 .   ? 5.668   7.259   21.873  1.00 68.31  ? 2376 HOH A O   1 
HETATM 8996 O O   . HOH Q 8 .   ? 21.951  3.870   44.228  1.00 64.05  ? 2377 HOH A O   1 
HETATM 8997 O O   . HOH Q 8 .   ? 24.698  -6.442  41.509  1.00 69.67  ? 2378 HOH A O   1 
HETATM 8998 O O   . HOH Q 8 .   ? 31.628  -3.507  42.476  1.00 64.59  ? 2379 HOH A O   1 
HETATM 8999 O O   . HOH Q 8 .   ? 13.207  22.287  -5.313  1.00 67.71  ? 2380 HOH A O   1 
HETATM 9000 O O   . HOH Q 8 .   ? 6.038   24.596  14.855  1.00 69.79  ? 2381 HOH A O   1 
HETATM 9001 O O   . HOH Q 8 .   ? 35.772  26.624  -4.357  1.00 71.63  ? 2382 HOH A O   1 
HETATM 9002 O O   . HOH Q 8 .   ? 33.899  -6.210  38.099  1.00 80.03  ? 2383 HOH A O   1 
HETATM 9003 O O   . HOH Q 8 .   ? 16.818  33.568  8.016   1.00 68.89  ? 2384 HOH A O   1 
HETATM 9004 O O   . HOH Q 8 .   ? 9.425   32.036  28.209  1.00 78.26  ? 2385 HOH A O   1 
HETATM 9005 O O   . HOH Q 8 .   ? 14.830  -3.876  32.109  1.00 63.30  ? 2386 HOH A O   1 
HETATM 9006 O O   . HOH Q 8 .   ? 53.667  -0.013  9.556   1.00 80.96  ? 2387 HOH A O   1 
HETATM 9007 O O   . HOH Q 8 .   ? 45.638  5.511   43.186  1.00 67.27  ? 2388 HOH A O   1 
HETATM 9008 O O   . HOH Q 8 .   ? 51.222  12.289  -0.729  1.00 69.24  ? 2389 HOH A O   1 
HETATM 9009 O O   . HOH Q 8 .   ? 6.355   18.758  8.402   1.00 81.42  ? 2390 HOH A O   1 
HETATM 9010 O O   . HOH Q 8 .   ? 27.285  35.876  6.049   1.00 72.27  ? 2391 HOH A O   1 
HETATM 9011 O O   . HOH Q 8 .   ? 45.159  13.681  37.725  1.00 76.50  ? 2392 HOH A O   1 
HETATM 9012 O O   . HOH Q 8 .   ? 22.299  -6.646  -1.780  1.00 85.00  ? 2393 HOH A O   1 
HETATM 9013 O O   . HOH Q 8 .   ? 35.900  -9.133  6.208   1.00 75.23  ? 2394 HOH A O   1 
HETATM 9014 O O   . HOH R 8 .   ? 15.804  10.063  -56.806 1.00 53.01  ? 2902 HOH B O   1 
HETATM 9015 O O   . HOH R 8 .   ? -0.301  26.670  -32.294 1.00 50.25  ? 2903 HOH B O   1 
HETATM 9016 O O   . HOH R 8 .   ? 4.518   1.558   -69.559 1.00 44.92  ? 2904 HOH B O   1 
HETATM 9017 O O   . HOH R 8 .   ? -6.458  18.883  -46.732 1.00 70.75  ? 2905 HOH B O   1 
HETATM 9018 O O   . HOH R 8 .   ? 23.455  -3.135  -35.109 1.00 53.83  ? 2906 HOH B O   1 
HETATM 9019 O O   . HOH R 8 .   ? 7.065   -8.276  -44.850 1.00 50.63  ? 2907 HOH B O   1 
HETATM 9020 O O   . HOH R 8 .   ? -4.200  1.105   -30.580 1.00 51.66  ? 2908 HOH B O   1 
HETATM 9021 O O   . HOH R 8 .   ? 5.136   8.506   -64.379 1.00 57.34  ? 2909 HOH B O   1 
HETATM 9022 O O   . HOH R 8 .   ? 4.746   -3.791  -42.859 1.00 46.57  ? 2910 HOH B O   1 
HETATM 9023 O O   . HOH R 8 .   ? 12.029  -4.055  -11.015 1.00 59.05  ? 2911 HOH B O   1 
HETATM 9024 O O   . HOH R 8 .   ? 4.458   4.760   -48.567 1.00 42.02  ? 2912 HOH B O   1 
HETATM 9025 O O   . HOH R 8 .   ? 6.849   -2.311  -51.089 1.00 44.77  ? 2913 HOH B O   1 
HETATM 9026 O O   . HOH R 8 .   ? 5.169   8.674   -20.793 1.00 69.23  ? 2914 HOH B O   1 
HETATM 9027 O O   . HOH R 8 .   ? 3.795   3.827   -34.197 1.00 47.58  ? 2915 HOH B O   1 
HETATM 9028 O O   . HOH R 8 .   ? 3.198   7.621   -33.408 1.00 44.26  ? 2916 HOH B O   1 
HETATM 9029 O O   . HOH R 8 .   ? -6.379  -3.539  -55.914 1.00 41.73  ? 2917 HOH B O   1 
HETATM 9030 O O   . HOH R 8 .   ? 17.207  5.280   -35.153 1.00 50.44  ? 2918 HOH B O   1 
HETATM 9031 O O   . HOH R 8 .   ? 10.675  0.046   -44.272 1.00 44.02  ? 2919 HOH B O   1 
HETATM 9032 O O   . HOH R 8 .   ? 23.098  0.671   -53.402 1.00 47.40  ? 2920 HOH B O   1 
HETATM 9033 O O   . HOH R 8 .   ? 6.379   23.853  -25.089 1.00 46.21  ? 2921 HOH B O   1 
HETATM 9034 O O   . HOH R 8 .   ? 16.614  -3.253  -43.198 1.00 49.82  ? 2922 HOH B O   1 
HETATM 9035 O O   . HOH R 8 .   ? 1.802   19.502  -60.122 1.00 56.21  ? 2923 HOH B O   1 
HETATM 9036 O O   . HOH R 8 .   ? 23.101  -5.813  -33.891 1.00 47.79  ? 2924 HOH B O   1 
HETATM 9037 O O   . HOH R 8 .   ? 14.238  -7.318  -49.216 1.00 54.36  ? 2925 HOH B O   1 
HETATM 9038 O O   . HOH R 8 .   ? 9.075   1.680   -68.639 1.00 51.70  ? 2926 HOH B O   1 
HETATM 9039 O O   . HOH R 8 .   ? 4.446   -1.065  -43.678 1.00 45.42  ? 2927 HOH B O   1 
HETATM 9040 O O   . HOH R 8 .   ? 0.002   19.628  -47.180 1.00 48.71  ? 2928 HOH B O   1 
HETATM 9041 O O   . HOH R 8 .   ? 13.453  6.466   -33.668 1.00 48.28  ? 2929 HOH B O   1 
HETATM 9042 O O   . HOH R 8 .   ? 3.516   19.869  -28.491 1.00 44.60  ? 2930 HOH B O   1 
HETATM 9043 O O   . HOH R 8 .   ? 14.981  2.672   -62.274 1.00 47.71  ? 2931 HOH B O   1 
HETATM 9044 O O   . HOH R 8 .   ? 12.840  14.634  -22.979 1.00 52.08  ? 2932 HOH B O   1 
HETATM 9045 O O   . HOH R 8 .   ? -1.703  -2.974  -60.979 1.00 58.49  ? 2933 HOH B O   1 
HETATM 9046 O O   . HOH R 8 .   ? 4.143   10.965  -65.480 1.00 56.09  ? 2934 HOH B O   1 
HETATM 9047 O O   . HOH R 8 .   ? 25.282  -2.803  -47.039 1.00 55.66  ? 2935 HOH B O   1 
HETATM 9048 O O   . HOH R 8 .   ? 17.657  -2.703  -56.269 1.00 45.63  ? 2936 HOH B O   1 
HETATM 9049 O O   . HOH R 8 .   ? -2.478  -0.418  -61.639 1.00 65.05  ? 2937 HOH B O   1 
HETATM 9050 O O   . HOH R 8 .   ? 8.194   -0.316  -67.383 1.00 53.37  ? 2938 HOH B O   1 
HETATM 9051 O O   . HOH R 8 .   ? 6.729   4.179   -25.355 1.00 51.70  ? 2939 HOH B O   1 
HETATM 9052 O O   . HOH R 8 .   ? -7.526  7.536   -45.169 1.00 49.10  ? 2940 HOH B O   1 
HETATM 9053 O O   . HOH R 8 .   ? 1.533   0.118   -53.515 1.00 54.45  ? 2941 HOH B O   1 
HETATM 9054 O O   . HOH R 8 .   ? 4.767   -5.502  -46.465 1.00 54.65  ? 2942 HOH B O   1 
HETATM 9055 O O   . HOH R 8 .   ? 8.999   -0.832  -61.137 1.00 48.55  ? 2943 HOH B O   1 
HETATM 9056 O O   . HOH R 8 .   ? 22.017  2.141   -47.967 1.00 50.15  ? 2944 HOH B O   1 
HETATM 9057 O O   . HOH R 8 .   ? 6.552   0.139   -64.947 1.00 48.13  ? 2945 HOH B O   1 
HETATM 9058 O O   . HOH R 8 .   ? 13.567  -7.888  -46.749 1.00 46.38  ? 2946 HOH B O   1 
HETATM 9059 O O   . HOH R 8 .   ? -2.773  0.561   -37.078 1.00 52.75  ? 2947 HOH B O   1 
HETATM 9060 O O   . HOH R 8 .   ? 10.379  -7.800  -5.565  1.00 53.93  ? 2948 HOH B O   1 
HETATM 9061 O O   . HOH R 8 .   ? 5.587   -2.133  -29.515 1.00 54.03  ? 2949 HOH B O   1 
HETATM 9062 O O   . HOH R 8 .   ? -3.635  0.975   -48.696 1.00 51.95  ? 2950 HOH B O   1 
HETATM 9063 O O   . HOH R 8 .   ? -3.248  -5.258  -45.471 1.00 59.49  ? 2951 HOH B O   1 
HETATM 9064 O O   . HOH R 8 .   ? 16.864  -8.210  -48.846 1.00 52.11  ? 2952 HOH B O   1 
HETATM 9065 O O   . HOH R 8 .   ? -8.731  -0.122  -45.362 1.00 62.51  ? 2953 HOH B O   1 
HETATM 9066 O O   . HOH R 8 .   ? 8.244   24.854  -31.619 1.00 47.84  ? 2954 HOH B O   1 
HETATM 9067 O O   . HOH R 8 .   ? -10.099 32.044  -35.164 1.00 56.78  ? 2955 HOH B O   1 
HETATM 9068 O O   . HOH R 8 .   ? -6.690  13.220  -26.605 1.00 48.76  ? 2956 HOH B O   1 
HETATM 9069 O O   . HOH R 8 .   ? -0.549  7.945   -72.845 1.00 53.36  ? 2957 HOH B O   1 
HETATM 9070 O O   . HOH R 8 .   ? 19.494  -1.084  -37.884 1.00 48.54  ? 2958 HOH B O   1 
HETATM 9071 O O   . HOH R 8 .   ? 12.539  -5.337  -54.505 1.00 58.58  ? 2959 HOH B O   1 
HETATM 9072 O O   . HOH R 8 .   ? 11.806  10.088  -17.061 1.00 46.53  ? 2960 HOH B O   1 
HETATM 9073 O O   . HOH R 8 .   ? -1.112  3.926   -48.939 1.00 51.77  ? 2961 HOH B O   1 
HETATM 9074 O O   . HOH R 8 .   ? 12.852  -4.449  -52.011 1.00 53.97  ? 2962 HOH B O   1 
HETATM 9075 O O   . HOH R 8 .   ? 33.621  -12.197 -55.790 1.00 68.91  ? 2963 HOH B O   1 
HETATM 9076 O O   . HOH R 8 .   ? 12.500  26.031  -28.215 1.00 50.51  ? 2964 HOH B O   1 
HETATM 9077 O O   . HOH R 8 .   ? 7.746   1.238   -62.346 1.00 48.75  ? 2965 HOH B O   1 
HETATM 9078 O O   . HOH R 8 .   ? -3.015  -3.693  -42.936 1.00 56.18  ? 2966 HOH B O   1 
HETATM 9079 O O   . HOH R 8 .   ? 20.626  6.937   -37.024 1.00 49.48  ? 2967 HOH B O   1 
HETATM 9080 O O   . HOH R 8 .   ? 22.720  1.026   -36.692 1.00 50.11  ? 2968 HOH B O   1 
HETATM 9081 O O   . HOH R 8 .   ? 4.812   -13.195 -53.859 1.00 55.63  ? 2969 HOH B O   1 
HETATM 9082 O O   . HOH R 8 .   ? -1.224  -9.779  -56.205 1.00 58.95  ? 2970 HOH B O   1 
HETATM 9083 O O   . HOH R 8 .   ? 6.349   17.011  -53.740 1.00 48.97  ? 2971 HOH B O   1 
HETATM 9084 O O   . HOH R 8 .   ? 27.262  1.598   -37.954 1.00 58.00  ? 2972 HOH B O   1 
HETATM 9085 O O   . HOH R 8 .   ? 1.772   -2.679  -53.269 1.00 58.24  ? 2973 HOH B O   1 
HETATM 9086 O O   . HOH R 8 .   ? 17.353  1.444   -60.758 1.00 56.48  ? 2974 HOH B O   1 
HETATM 9087 O O   . HOH R 8 .   ? 24.289  -2.532  -59.551 1.00 56.88  ? 2975 HOH B O   1 
HETATM 9088 O O   . HOH R 8 .   ? 11.167  16.563  -23.274 1.00 53.78  ? 2976 HOH B O   1 
HETATM 9089 O O   . HOH R 8 .   ? -5.676  -2.681  -48.961 1.00 55.39  ? 2977 HOH B O   1 
HETATM 9090 O O   . HOH R 8 .   ? -5.111  -6.562  -47.267 1.00 60.53  ? 2978 HOH B O   1 
HETATM 9091 O O   . HOH R 8 .   ? 16.902  -7.852  -60.663 1.00 50.15  ? 2979 HOH B O   1 
HETATM 9092 O O   . HOH R 8 .   ? -15.067 0.492   -53.216 1.00 59.14  ? 2980 HOH B O   1 
HETATM 9093 O O   . HOH R 8 .   ? -1.521  -10.051 -21.304 1.00 59.91  ? 2981 HOH B O   1 
HETATM 9094 O O   . HOH R 8 .   ? 13.411  -3.918  -56.342 1.00 54.45  ? 2982 HOH B O   1 
HETATM 9095 O O   . HOH R 8 .   ? -1.552  26.568  -29.776 1.00 61.43  ? 2983 HOH B O   1 
HETATM 9096 O O   . HOH R 8 .   ? 22.175  -1.560  -37.192 1.00 48.76  ? 2984 HOH B O   1 
HETATM 9097 O O   . HOH R 8 .   ? 15.861  14.917  -21.166 1.00 57.79  ? 2985 HOH B O   1 
HETATM 9098 O O   . HOH R 8 .   ? 13.522  -6.746  -34.185 1.00 56.48  ? 2986 HOH B O   1 
HETATM 9099 O O   . HOH R 8 .   ? -6.162  0.185   -49.318 1.00 57.91  ? 2987 HOH B O   1 
HETATM 9100 O O   . HOH R 8 .   ? 24.194  -2.509  -44.393 1.00 50.66  ? 2988 HOH B O   1 
HETATM 9101 O O   . HOH R 8 .   ? 5.284   14.328  -18.904 1.00 51.24  ? 2989 HOH B O   1 
HETATM 9102 O O   . HOH R 8 .   ? 17.188  -6.867  -41.415 1.00 67.62  ? 2990 HOH B O   1 
HETATM 9103 O O   . HOH R 8 .   ? 4.365   2.152   -41.215 1.00 49.73  ? 2991 HOH B O   1 
HETATM 9104 O O   . HOH R 8 .   ? 0.394   0.398   -56.206 1.00 46.77  ? 2992 HOH B O   1 
HETATM 9105 O O   . HOH R 8 .   ? -4.641  -6.748  -34.580 1.00 66.36  ? 2993 HOH B O   1 
HETATM 9106 O O   . HOH R 8 .   ? 18.790  5.989   -27.414 1.00 53.58  ? 2994 HOH B O   1 
HETATM 9107 O O   . HOH R 8 .   ? 22.745  15.670  -46.001 1.00 54.58  ? 2995 HOH B O   1 
HETATM 9108 O O   . HOH R 8 .   ? 23.548  1.214   -32.657 1.00 54.76  ? 2996 HOH B O   1 
HETATM 9109 O O   . HOH R 8 .   ? 22.977  -0.321  -45.504 1.00 45.87  ? 2997 HOH B O   1 
HETATM 9110 O O   . HOH R 8 .   ? 22.330  17.430  -47.970 1.00 54.67  ? 2998 HOH B O   1 
HETATM 9111 O O   . HOH R 8 .   ? 10.762  -14.389 -46.530 1.00 52.88  ? 2999 HOH B O   1 
HETATM 9112 O O   . HOH R 8 .   ? 9.067   3.223   -24.215 1.00 58.99  ? 3000 HOH B O   1 
HETATM 9113 O O   . HOH R 8 .   ? 21.911  11.884  -32.104 1.00 67.14  ? 3001 HOH B O   1 
HETATM 9114 O O   . HOH R 8 .   ? 28.383  5.625   -51.921 1.00 55.73  ? 3002 HOH B O   1 
HETATM 9115 O O   . HOH R 8 .   ? -1.329  -7.278  -45.082 1.00 55.24  ? 3003 HOH B O   1 
HETATM 9116 O O   . HOH R 8 .   ? 12.446  -0.376  -68.630 1.00 50.29  ? 3004 HOH B O   1 
HETATM 9117 O O   . HOH R 8 .   ? -7.872  1.791   -50.810 1.00 61.34  ? 3005 HOH B O   1 
HETATM 9118 O O   . HOH R 8 .   ? 23.099  9.833   -35.861 1.00 60.57  ? 3006 HOH B O   1 
HETATM 9119 O O   . HOH R 8 .   ? 6.445   -0.493  -20.133 1.00 51.48  ? 3007 HOH B O   1 
HETATM 9120 O O   . HOH R 8 .   ? -1.498  -1.301  -65.103 1.00 56.68  ? 3008 HOH B O   1 
HETATM 9121 O O   . HOH R 8 .   ? 1.735   23.029  -19.646 1.00 56.83  ? 3009 HOH B O   1 
HETATM 9122 O O   . HOH R 8 .   ? -0.441  -6.771  -58.204 1.00 64.88  ? 3010 HOH B O   1 
HETATM 9123 O O   . HOH R 8 .   ? -8.609  6.888   -23.708 1.00 69.98  ? 3011 HOH B O   1 
HETATM 9124 O O   . HOH R 8 .   ? -4.169  20.533  -20.512 1.00 57.62  ? 3012 HOH B O   1 
HETATM 9125 O O   . HOH R 8 .   ? 5.066   -1.662  -22.318 1.00 54.71  ? 3013 HOH B O   1 
HETATM 9126 O O   . HOH R 8 .   ? 12.033  4.200   -75.081 1.00 49.81  ? 3014 HOH B O   1 
HETATM 9127 O O   . HOH R 8 .   ? 2.771   9.446   -73.657 1.00 63.15  ? 3015 HOH B O   1 
HETATM 9128 O O   . HOH R 8 .   ? 32.813  -16.023 -57.098 1.00 77.70  ? 3016 HOH B O   1 
HETATM 9129 O O   . HOH R 8 .   ? -7.265  -3.173  -34.010 1.00 62.98  ? 3017 HOH B O   1 
HETATM 9130 O O   . HOH R 8 .   ? 22.482  -0.581  -28.444 1.00 59.29  ? 3018 HOH B O   1 
HETATM 9131 O O   . HOH R 8 .   ? 10.181  -5.514  -64.822 1.00 59.79  ? 3019 HOH B O   1 
HETATM 9132 O O   . HOH R 8 .   ? 18.294  8.716   -27.920 1.00 55.02  ? 3020 HOH B O   1 
HETATM 9133 O O   . HOH R 8 .   ? 11.554  26.802  -32.416 1.00 60.10  ? 3021 HOH B O   1 
HETATM 9134 O O   . HOH R 8 .   ? 9.149   13.545  -17.974 1.00 56.42  ? 3022 HOH B O   1 
HETATM 9135 O O   . HOH R 8 .   ? -12.441 2.813   -63.509 1.00 69.13  ? 3023 HOH B O   1 
HETATM 9136 O O   . HOH R 8 .   ? 1.633   7.278   -21.067 1.00 67.43  ? 3024 HOH B O   1 
HETATM 9137 O O   . HOH R 8 .   ? 16.858  -3.433  -66.489 1.00 56.05  ? 3025 HOH B O   1 
HETATM 9138 O O   . HOH R 8 .   ? 21.811  9.586   -33.562 1.00 59.20  ? 3026 HOH B O   1 
HETATM 9139 O O   . HOH R 8 .   ? 7.666   0.520   -24.491 1.00 53.98  ? 3027 HOH B O   1 
HETATM 9140 O O   . HOH R 8 .   ? 19.317  10.069  -30.646 1.00 55.05  ? 3028 HOH B O   1 
HETATM 9141 O O   . HOH R 8 .   ? 2.560   -12.046 -47.148 1.00 58.75  ? 3029 HOH B O   1 
HETATM 9142 O O   . HOH R 8 .   ? 12.184  27.458  -25.650 1.00 61.71  ? 3030 HOH B O   1 
HETATM 9143 O O   . HOH R 8 .   ? 2.616   1.672   -20.581 1.00 63.91  ? 3031 HOH B O   1 
HETATM 9144 O O   . HOH R 8 .   ? 4.258   -4.032  -21.279 1.00 53.60  ? 3032 HOH B O   1 
HETATM 9145 O O   . HOH R 8 .   ? 29.882  6.773   -42.554 1.00 57.82  ? 3033 HOH B O   1 
HETATM 9146 O O   . HOH R 8 .   ? -12.222 14.210  -39.568 1.00 64.53  ? 3034 HOH B O   1 
HETATM 9147 O O   . HOH R 8 .   ? 9.251   9.415   -63.061 1.00 56.52  ? 3035 HOH B O   1 
HETATM 9148 O O   . HOH R 8 .   ? 10.311  -13.454 -49.114 1.00 58.27  ? 3036 HOH B O   1 
HETATM 9149 O O   . HOH R 8 .   ? 15.928  -4.429  -57.396 1.00 55.90  ? 3037 HOH B O   1 
HETATM 9150 O O   . HOH R 8 .   ? 6.721   -4.945  -41.662 1.00 50.40  ? 3038 HOH B O   1 
HETATM 9151 O O   . HOH R 8 .   ? -8.748  20.312  -47.365 1.00 71.83  ? 3039 HOH B O   1 
HETATM 9152 O O   . HOH R 8 .   ? -4.461  -10.734 -23.207 1.00 64.24  ? 3040 HOH B O   1 
HETATM 9153 O O   . HOH R 8 .   ? 23.035  7.182   -53.232 1.00 60.31  ? 3041 HOH B O   1 
HETATM 9154 O O   . HOH R 8 .   ? 4.745   26.626  -26.690 1.00 53.40  ? 3042 HOH B O   1 
HETATM 9155 O O   . HOH R 8 .   ? 29.300  7.650   -40.157 1.00 64.68  ? 3043 HOH B O   1 
HETATM 9156 O O   . HOH R 8 .   ? 11.085  12.367  -16.323 1.00 53.21  ? 3044 HOH B O   1 
HETATM 9157 O O   . HOH R 8 .   ? -3.823  22.938  -20.665 1.00 58.66  ? 3045 HOH B O   1 
HETATM 9158 O O   . HOH R 8 .   ? 9.194   -1.114  -12.907 1.00 75.52  ? 3046 HOH B O   1 
HETATM 9159 O O   . HOH R 8 .   ? -4.950  2.065   -74.036 1.00 63.46  ? 3047 HOH B O   1 
HETATM 9160 O O   . HOH R 8 .   ? 0.823   -0.476  -63.399 1.00 59.39  ? 3048 HOH B O   1 
HETATM 9161 O O   . HOH R 8 .   ? 6.588   -18.232 -23.087 1.00 75.15  ? 3049 HOH B O   1 
HETATM 9162 O O   . HOH R 8 .   ? 11.356  21.585  -46.965 1.00 56.31  ? 3050 HOH B O   1 
HETATM 9163 O O   . HOH R 8 .   ? 24.595  -1.584  -62.570 1.00 71.81  ? 3051 HOH B O   1 
HETATM 9164 O O   . HOH R 8 .   ? 19.022  12.928  -55.913 1.00 59.90  ? 3052 HOH B O   1 
HETATM 9165 O O   . HOH R 8 .   ? 3.825   -13.804 -38.397 1.00 64.45  ? 3053 HOH B O   1 
HETATM 9166 O O   . HOH R 8 .   ? 1.075   20.927  -18.479 1.00 59.37  ? 3054 HOH B O   1 
HETATM 9167 O O   . HOH R 8 .   ? 23.650  -6.765  -64.981 1.00 70.77  ? 3055 HOH B O   1 
HETATM 9168 O O   . HOH R 8 .   ? -2.961  -0.134  -22.826 1.00 66.65  ? 3056 HOH B O   1 
HETATM 9169 O O   . HOH R 8 .   ? -2.784  22.747  -58.191 1.00 68.93  ? 3057 HOH B O   1 
HETATM 9170 O O   . HOH R 8 .   ? -14.761 2.860   -61.242 1.00 64.03  ? 3058 HOH B O   1 
HETATM 9171 O O   . HOH R 8 .   ? -6.720  2.503   -24.258 1.00 59.65  ? 3059 HOH B O   1 
HETATM 9172 O O   . HOH R 8 .   ? 16.984  -2.506  -29.390 1.00 64.63  ? 3060 HOH B O   1 
HETATM 9173 O O   . HOH R 8 .   ? -19.886 1.735   -29.857 1.00 72.53  ? 3061 HOH B O   1 
HETATM 9174 O O   . HOH R 8 .   ? -1.706  24.586  -47.389 1.00 60.39  ? 3062 HOH B O   1 
HETATM 9175 O O   . HOH R 8 .   ? -19.540 9.287   -38.989 1.00 82.91  ? 3063 HOH B O   1 
HETATM 9176 O O   . HOH R 8 .   ? 24.802  -5.225  -24.802 1.00 64.51  ? 3064 HOH B O   1 
HETATM 9177 O O   . HOH R 8 .   ? -13.381 30.594  -25.060 1.00 56.46  ? 3065 HOH B O   1 
HETATM 9178 O O   . HOH R 8 .   ? -5.180  -3.523  -35.517 1.00 64.61  ? 3066 HOH B O   1 
HETATM 9179 O O   . HOH R 8 .   ? 14.394  -17.251 -14.747 1.00 74.77  ? 3067 HOH B O   1 
HETATM 9180 O O   . HOH R 8 .   ? -4.855  -6.950  -59.488 1.00 71.27  ? 3068 HOH B O   1 
HETATM 9181 O O   . HOH R 8 .   ? 19.670  -8.435  -60.928 1.00 62.99  ? 3069 HOH B O   1 
HETATM 9182 O O   . HOH R 8 .   ? 22.621  15.700  -50.351 1.00 64.81  ? 3070 HOH B O   1 
HETATM 9183 O O   . HOH R 8 .   ? 30.183  1.270   -36.826 1.00 67.67  ? 3071 HOH B O   1 
HETATM 9184 O O   . HOH R 8 .   ? 24.876  7.270   -37.905 1.00 60.95  ? 3072 HOH B O   1 
HETATM 9185 O O   . HOH R 8 .   ? -12.507 11.425  -28.661 1.00 75.66  ? 3073 HOH B O   1 
HETATM 9186 O O   . HOH R 8 .   ? -6.367  -5.044  -50.511 1.00 58.11  ? 3074 HOH B O   1 
HETATM 9187 O O   . HOH R 8 .   ? 26.733  8.867   -53.679 1.00 59.03  ? 3075 HOH B O   1 
HETATM 9188 O O   . HOH R 8 .   ? -6.084  13.133  -23.178 1.00 64.99  ? 3076 HOH B O   1 
HETATM 9189 O O   . HOH R 8 .   ? -16.407 8.504   -45.417 1.00 62.54  ? 3077 HOH B O   1 
HETATM 9190 O O   . HOH R 8 .   ? 25.655  -9.343  -63.317 1.00 65.79  ? 3078 HOH B O   1 
HETATM 9191 O O   . HOH R 8 .   ? 18.206  15.099  -22.195 1.00 60.34  ? 3079 HOH B O   1 
HETATM 9192 O O   . HOH R 8 .   ? 25.236  7.153   -51.831 1.00 58.30  ? 3080 HOH B O   1 
HETATM 9193 O O   . HOH R 8 .   ? 32.314  -8.811  -43.635 1.00 60.31  ? 3081 HOH B O   1 
HETATM 9194 O O   . HOH R 8 .   ? 29.782  6.868   -49.870 1.00 65.54  ? 3082 HOH B O   1 
HETATM 9195 O O   . HOH R 8 .   ? -3.922  24.306  -51.267 1.00 62.48  ? 3083 HOH B O   1 
HETATM 9196 O O   . HOH R 8 .   ? 22.094  5.801   -30.668 1.00 72.73  ? 3084 HOH B O   1 
HETATM 9197 O O   . HOH R 8 .   ? 15.711  -13.207 -21.282 1.00 68.12  ? 3085 HOH B O   1 
HETATM 9198 O O   . HOH R 8 .   ? 17.620  -5.351  -44.132 1.00 58.54  ? 3086 HOH B O   1 
HETATM 9199 O O   . HOH R 8 .   ? 30.751  11.582  -43.749 1.00 73.02  ? 3087 HOH B O   1 
HETATM 9200 O O   . HOH R 8 .   ? 14.326  7.214   -67.880 1.00 57.12  ? 3088 HOH B O   1 
HETATM 9201 O O   . HOH R 8 .   ? 16.984  -15.592 -20.633 1.00 67.35  ? 3089 HOH B O   1 
HETATM 9202 O O   . HOH R 8 .   ? -1.802  -14.151 -23.062 1.00 83.99  ? 3090 HOH B O   1 
HETATM 9203 O O   . HOH R 8 .   ? 33.427  2.124   -47.391 1.00 61.86  ? 3091 HOH B O   1 
HETATM 9204 O O   . HOH R 8 .   ? -9.410  17.730  -33.970 1.00 67.74  ? 3092 HOH B O   1 
HETATM 9205 O O   . HOH R 8 .   ? 15.051  2.674   -69.481 1.00 62.72  ? 3093 HOH B O   1 
HETATM 9206 O O   . HOH R 8 .   ? 22.505  10.204  -53.032 1.00 61.90  ? 3094 HOH B O   1 
HETATM 9207 O O   . HOH R 8 .   ? 32.970  4.462   -41.679 1.00 55.93  ? 3095 HOH B O   1 
HETATM 9208 O O   . HOH R 8 .   ? -14.249 -7.914  -38.125 1.00 72.90  ? 3096 HOH B O   1 
HETATM 9209 O O   . HOH R 8 .   ? 9.595   -13.500 -38.622 1.00 74.57  ? 3097 HOH B O   1 
HETATM 9210 O O   . HOH R 8 .   ? 17.448  14.851  -25.046 1.00 62.39  ? 3098 HOH B O   1 
HETATM 9211 O O   . HOH R 8 .   ? 4.662   -8.966  -39.899 1.00 59.50  ? 3099 HOH B O   1 
HETATM 9212 O O   . HOH R 8 .   ? -12.980 6.577   -67.169 1.00 76.52  ? 3100 HOH B O   1 
HETATM 9213 O O   . HOH R 8 .   ? 32.813  -11.231 -44.978 1.00 67.90  ? 3101 HOH B O   1 
HETATM 9214 O O   . HOH R 8 .   ? 4.297   -20.323 -25.309 1.00 76.81  ? 3102 HOH B O   1 
HETATM 9215 O O   . HOH R 8 .   ? 25.792  -2.005  -35.789 1.00 61.21  ? 3103 HOH B O   1 
HETATM 9216 O O   . HOH R 8 .   ? -14.863 -2.957  -30.721 1.00 67.32  ? 3104 HOH B O   1 
HETATM 9217 O O   . HOH R 8 .   ? -2.084  -12.476 -29.228 1.00 69.08  ? 3105 HOH B O   1 
HETATM 9218 O O   . HOH R 8 .   ? 10.562  4.700   -19.214 1.00 56.02  ? 3106 HOH B O   1 
HETATM 9219 O O   . HOH R 8 .   ? 32.749  6.823   -42.764 1.00 60.22  ? 3107 HOH B O   1 
HETATM 9220 O O   . HOH R 8 .   ? 21.203  5.224   -27.269 1.00 63.06  ? 3108 HOH B O   1 
HETATM 9221 O O   . HOH R 8 .   ? 0.933   13.481  -71.262 1.00 64.87  ? 3109 HOH B O   1 
HETATM 9222 O O   . HOH R 8 .   ? -3.943  -5.406  -56.995 1.00 59.12  ? 3110 HOH B O   1 
HETATM 9223 O O   . HOH R 8 .   ? 4.278   -9.633  -10.855 1.00 70.43  ? 3111 HOH B O   1 
HETATM 9224 O O   . HOH R 8 .   ? 21.234  -12.092 -23.321 1.00 62.65  ? 3112 HOH B O   1 
HETATM 9225 O O   . HOH R 8 .   ? 0.428   -18.726 -31.244 1.00 78.39  ? 3113 HOH B O   1 
HETATM 9226 O O   . HOH R 8 .   ? -1.407  24.003  -19.974 1.00 71.48  ? 3114 HOH B O   1 
HETATM 9227 O O   . HOH R 8 .   ? -5.524  -13.524 -35.385 1.00 67.31  ? 3115 HOH B O   1 
HETATM 9228 O O   . HOH R 8 .   ? 13.617  -10.902 -59.271 1.00 59.97  ? 3116 HOH B O   1 
HETATM 9229 O O   . HOH R 8 .   ? 32.080  -9.464  -41.064 1.00 66.10  ? 3117 HOH B O   1 
HETATM 9230 O O   . HOH R 8 .   ? 18.207  -14.431 -43.001 1.00 63.87  ? 3118 HOH B O   1 
HETATM 9231 O O   . HOH R 8 .   ? -4.104  -3.754  -67.102 1.00 60.12  ? 3119 HOH B O   1 
HETATM 9232 O O   . HOH R 8 .   ? 12.276  16.146  -14.736 1.00 65.39  ? 3120 HOH B O   1 
HETATM 9233 O O   . HOH R 8 .   ? 25.590  5.095   -59.045 1.00 70.14  ? 3121 HOH B O   1 
HETATM 9234 O O   . HOH R 8 .   ? 32.355  -2.129  -19.625 1.00 67.92  ? 3122 HOH B O   1 
HETATM 9235 O O   . HOH R 8 .   ? 25.522  0.592   -36.285 1.00 58.82  ? 3123 HOH B O   1 
HETATM 9236 O O   . HOH R 8 .   ? 25.209  16.498  -20.376 1.00 65.59  ? 3124 HOH B O   1 
HETATM 9237 O O   . HOH R 8 .   ? 22.809  6.969   -26.075 1.00 69.11  ? 3125 HOH B O   1 
HETATM 9238 O O   . HOH R 8 .   ? 2.434   -11.811 -51.416 1.00 67.06  ? 3126 HOH B O   1 
HETATM 9239 O O   . HOH R 8 .   ? 18.147  28.907  -35.827 1.00 81.35  ? 3127 HOH B O   1 
HETATM 9240 O O   . HOH R 8 .   ? -8.445  15.111  -20.596 1.00 68.05  ? 3128 HOH B O   1 
HETATM 9241 O O   . HOH R 8 .   ? -13.887 2.774   -27.387 1.00 61.98  ? 3129 HOH B O   1 
HETATM 9242 O O   . HOH R 8 .   ? -14.798 17.406  -54.421 1.00 74.10  ? 3130 HOH B O   1 
HETATM 9243 O O   . HOH R 8 .   ? 6.691   12.916  -64.423 1.00 64.62  ? 3131 HOH B O   1 
HETATM 9244 O O   . HOH R 8 .   ? 19.150  -15.348 -26.699 1.00 74.43  ? 3132 HOH B O   1 
HETATM 9245 O O   . HOH R 8 .   ? 23.278  -9.046  -27.552 1.00 72.82  ? 3133 HOH B O   1 
HETATM 9246 O O   . HOH R 8 .   ? -0.130  -12.093 -51.283 1.00 70.77  ? 3134 HOH B O   1 
HETATM 9247 O O   . HOH R 8 .   ? 23.586  -12.726 -35.482 1.00 70.17  ? 3135 HOH B O   1 
HETATM 9248 O O   . HOH R 8 .   ? 3.355   16.750  -17.132 1.00 65.55  ? 3136 HOH B O   1 
HETATM 9249 O O   . HOH R 8 .   ? 8.863   -8.710  -40.271 1.00 61.86  ? 3137 HOH B O   1 
HETATM 9250 O O   . HOH R 8 .   ? 34.120  -2.448  -43.493 1.00 65.77  ? 3138 HOH B O   1 
HETATM 9251 O O   . HOH R 8 .   ? -8.876  -3.921  -42.777 1.00 67.98  ? 3139 HOH B O   1 
HETATM 9252 O O   . HOH R 8 .   ? -9.898  -2.831  -61.787 1.00 64.55  ? 3140 HOH B O   1 
HETATM 9253 O O   . HOH R 8 .   ? -9.682  21.408  -51.857 1.00 67.02  ? 3141 HOH B O   1 
HETATM 9254 O O   . HOH R 8 .   ? 3.166   11.072  -20.518 1.00 63.78  ? 3142 HOH B O   1 
HETATM 9255 O O   . HOH R 8 .   ? -2.863  -16.598 -27.614 1.00 63.82  ? 3143 HOH B O   1 
HETATM 9256 O O   . HOH R 8 .   ? 0.894   26.826  -23.112 1.00 70.94  ? 3144 HOH B O   1 
HETATM 9257 O O   . HOH R 8 .   ? 16.906  -7.200  -34.797 1.00 65.02  ? 3145 HOH B O   1 
HETATM 9258 O O   . HOH R 8 .   ? -4.997  11.902  -20.859 1.00 65.93  ? 3146 HOH B O   1 
HETATM 9259 O O   . HOH R 8 .   ? -9.100  -2.173  -57.352 1.00 63.72  ? 3147 HOH B O   1 
HETATM 9260 O O   . HOH R 8 .   ? -4.394  2.152   -23.200 1.00 71.38  ? 3148 HOH B O   1 
HETATM 9261 O O   . HOH R 8 .   ? 34.753  -4.851  -49.216 1.00 69.22  ? 3149 HOH B O   1 
HETATM 9262 O O   . HOH R 8 .   ? 7.069   27.756  -31.151 1.00 70.07  ? 3150 HOH B O   1 
HETATM 9263 O O   . HOH R 8 .   ? 6.464   -7.946  -41.905 1.00 64.38  ? 3151 HOH B O   1 
HETATM 9264 O O   . HOH R 8 .   ? 15.665  16.819  -56.051 1.00 70.11  ? 3152 HOH B O   1 
HETATM 9265 O O   . HOH R 8 .   ? 15.179  5.697   -69.972 1.00 72.17  ? 3153 HOH B O   1 
HETATM 9266 O O   . HOH R 8 .   ? 7.821   -15.606 -18.978 1.00 74.21  ? 3154 HOH B O   1 
HETATM 9267 O O   . HOH R 8 .   ? -0.888  7.093   -77.166 1.00 68.53  ? 3155 HOH B O   1 
HETATM 9268 O O   . HOH R 8 .   ? -10.144 -1.910  -44.122 1.00 64.50  ? 3156 HOH B O   1 
HETATM 9269 O O   . HOH R 8 .   ? 7.027   11.445  -19.018 1.00 70.54  ? 3157 HOH B O   1 
HETATM 9270 O O   . HOH R 8 .   ? -4.430  -12.057 -25.891 1.00 78.46  ? 3158 HOH B O   1 
HETATM 9271 O O   . HOH R 8 .   ? 3.805   0.334   -66.172 1.00 62.83  ? 3159 HOH B O   1 
HETATM 9272 O O   . HOH R 8 .   ? 20.067  -10.521 -34.460 1.00 63.94  ? 3160 HOH B O   1 
HETATM 9273 O O   . HOH R 8 .   ? -8.228  2.032   -73.056 1.00 68.44  ? 3161 HOH B O   1 
HETATM 9274 O O   . HOH R 8 .   ? -12.671 -1.128  -52.316 1.00 65.02  ? 3162 HOH B O   1 
HETATM 9275 O O   . HOH R 8 .   ? 25.578  7.274   -57.648 1.00 70.41  ? 3163 HOH B O   1 
HETATM 9276 O O   . HOH R 8 .   ? -17.485 8.925   -42.878 1.00 68.91  ? 3164 HOH B O   1 
HETATM 9277 O O   . HOH R 8 .   ? 1.577   28.106  -38.703 1.00 83.18  ? 3165 HOH B O   1 
HETATM 9278 O O   . HOH R 8 .   ? 19.200  -15.573 -17.948 1.00 72.15  ? 3166 HOH B O   1 
HETATM 9279 O O   . HOH R 8 .   ? -1.469  -3.429  -63.616 1.00 60.78  ? 3167 HOH B O   1 
HETATM 9280 O O   . HOH R 8 .   ? 1.450   -16.127 -17.954 1.00 74.40  ? 3168 HOH B O   1 
HETATM 9281 O O   . HOH R 8 .   ? 7.531   9.500   -65.037 1.00 61.25  ? 3169 HOH B O   1 
HETATM 9282 O O   . HOH R 8 .   ? 31.866  -12.115 -40.193 1.00 70.44  ? 3170 HOH B O   1 
HETATM 9283 O O   . HOH R 8 .   ? 21.066  -6.815  -11.083 1.00 78.05  ? 3171 HOH B O   1 
HETATM 9284 O O   . HOH R 8 .   ? -4.300  -9.793  -50.355 1.00 72.61  ? 3172 HOH B O   1 
HETATM 9285 O O   . HOH R 8 .   ? 21.211  13.630  -52.149 1.00 63.01  ? 3173 HOH B O   1 
HETATM 9286 O O   . HOH R 8 .   ? 33.425  4.636   -47.986 1.00 74.60  ? 3174 HOH B O   1 
HETATM 9287 O O   . HOH R 8 .   ? 27.670  6.586   -38.363 1.00 69.71  ? 3175 HOH B O   1 
HETATM 9288 O O   . HOH R 8 .   ? 35.085  3.289   -43.795 1.00 72.96  ? 3176 HOH B O   1 
HETATM 9289 O O   . HOH R 8 .   ? 9.268   -15.985 -44.745 1.00 66.10  ? 3177 HOH B O   1 
HETATM 9290 O O   . HOH R 8 .   ? 20.083  15.504  -56.334 1.00 68.52  ? 3178 HOH B O   1 
HETATM 9291 O O   . HOH R 8 .   ? 31.902  1.188   -20.391 1.00 77.76  ? 3179 HOH B O   1 
HETATM 9292 O O   . HOH R 8 .   ? 22.687  16.405  -55.266 1.00 71.66  ? 3180 HOH B O   1 
HETATM 9293 O O   . HOH R 8 .   ? -7.964  -3.902  -26.863 1.00 66.04  ? 3181 HOH B O   1 
HETATM 9294 O O   . HOH R 8 .   ? 34.302  -7.413  -44.175 1.00 66.73  ? 3182 HOH B O   1 
HETATM 9295 O O   . HOH R 8 .   ? 2.410   25.403  -48.173 1.00 60.79  ? 3183 HOH B O   1 
HETATM 9296 O O   . HOH R 8 .   ? -6.275  -10.498 -27.251 1.00 78.15  ? 3184 HOH B O   1 
HETATM 9297 O O   . HOH R 8 .   ? 23.548  7.678   -55.864 1.00 63.91  ? 3185 HOH B O   1 
HETATM 9298 O O   . HOH R 8 .   ? 32.476  -11.541 -49.874 1.00 80.58  ? 3186 HOH B O   1 
HETATM 9299 O O   . HOH R 8 .   ? -7.094  22.003  -31.076 1.00 60.88  ? 3187 HOH B O   1 
HETATM 9300 O O   . HOH R 8 .   ? 5.871   17.171  -15.958 1.00 65.04  ? 3188 HOH B O   1 
HETATM 9301 O O   . HOH R 8 .   ? 23.944  1.234   -27.731 1.00 64.13  ? 3189 HOH B O   1 
HETATM 9302 O O   . HOH R 8 .   ? 9.442   21.059  -57.243 1.00 72.03  ? 3190 HOH B O   1 
HETATM 9303 O O   . HOH R 8 .   ? 31.888  -4.804  -22.114 1.00 80.76  ? 3191 HOH B O   1 
HETATM 9304 O O   . HOH R 8 .   ? 22.590  8.864   -27.896 1.00 68.59  ? 3192 HOH B O   1 
HETATM 9305 O O   . HOH R 8 .   ? 16.851  -14.182 -11.491 1.00 68.31  ? 3193 HOH B O   1 
HETATM 9306 O O   . HOH R 8 .   ? -16.711 -8.832  -38.098 1.00 87.45  ? 3194 HOH B O   1 
HETATM 9307 O O   . HOH R 8 .   ? -12.320 -0.677  -44.785 1.00 70.50  ? 3195 HOH B O   1 
HETATM 9308 O O   . HOH R 8 .   ? 22.478  11.195  -28.017 1.00 71.38  ? 3196 HOH B O   1 
HETATM 9309 O O   . HOH R 8 .   ? 21.893  -0.270  -66.243 1.00 77.92  ? 3197 HOH B O   1 
HETATM 9310 O O   . HOH R 8 .   ? 0.030   26.393  -48.400 1.00 65.60  ? 3198 HOH B O   1 
HETATM 9311 O O   . HOH R 8 .   ? 17.947  8.712   -58.309 1.00 73.07  ? 3199 HOH B O   1 
HETATM 9312 O O   . HOH R 8 .   ? 7.160   -17.065 -45.785 1.00 65.09  ? 3200 HOH B O   1 
HETATM 9313 O O   . HOH R 8 .   ? 19.363  -20.112 -56.421 1.00 75.89  ? 3201 HOH B O   1 
HETATM 9314 O O   . HOH R 8 .   ? 23.530  17.071  -52.496 1.00 70.72  ? 3202 HOH B O   1 
HETATM 9315 O O   . HOH R 8 .   ? 5.131   31.065  -37.829 1.00 81.49  ? 3203 HOH B O   1 
HETATM 9316 O O   . HOH R 8 .   ? 22.869  19.635  -51.897 1.00 75.30  ? 3204 HOH B O   1 
HETATM 9317 O O   . HOH R 8 .   ? 14.744  -17.790 -20.232 1.00 69.88  ? 3205 HOH B O   1 
HETATM 9318 O O   . HOH R 8 .   ? 38.338  -6.916  -61.039 1.00 83.10  ? 3206 HOH B O   1 
HETATM 9319 O O   . HOH R 8 .   ? 8.639   27.416  -39.165 1.00 77.16  ? 3207 HOH B O   1 
HETATM 9320 O O   . HOH R 8 .   ? 21.990  9.260   -57.198 1.00 70.67  ? 3208 HOH B O   1 
HETATM 9321 O O   . HOH R 8 .   ? 22.751  -13.036 -21.243 1.00 71.23  ? 3209 HOH B O   1 
HETATM 9322 O O   . HOH R 8 .   ? 32.999  11.900  -20.354 1.00 77.34  ? 3210 HOH B O   1 
HETATM 9323 O O   . HOH R 8 .   ? 4.908   22.025  -59.951 1.00 72.55  ? 3211 HOH B O   1 
HETATM 9324 O O   . HOH R 8 .   ? 8.189   -14.942 -49.999 1.00 69.32  ? 3212 HOH B O   1 
HETATM 9325 O O   . HOH R 8 .   ? 38.300  -2.723  -61.653 1.00 78.71  ? 3213 HOH B O   1 
HETATM 9326 O O   . HOH R 8 .   ? 5.612   19.553  -14.948 1.00 68.36  ? 3214 HOH B O   1 
HETATM 9327 O O   . HOH R 8 .   ? 8.789   -19.163 -21.790 1.00 84.85  ? 3215 HOH B O   1 
HETATM 9328 O O   . HOH R 8 .   ? -10.546 22.332  -45.901 1.00 67.51  ? 3216 HOH B O   1 
HETATM 9329 O O   . HOH R 8 .   ? -12.204 0.975   -26.408 1.00 73.56  ? 3217 HOH B O   1 
HETATM 9330 O O   . HOH R 8 .   ? -0.261  26.889  -51.353 1.00 72.70  ? 3218 HOH B O   1 
HETATM 9331 O O   . HOH R 8 .   ? 22.557  -11.753 -18.627 1.00 64.57  ? 3219 HOH B O   1 
HETATM 9332 O O   . HOH R 8 .   ? -15.256 4.078   -25.446 1.00 86.84  ? 3220 HOH B O   1 
HETATM 9333 O O   . HOH R 8 .   ? 21.615  19.348  -43.967 1.00 74.97  ? 3221 HOH B O   1 
HETATM 9334 O O   . HOH R 8 .   ? 32.849  0.907   -58.367 1.00 70.64  ? 3222 HOH B O   1 
HETATM 9335 O O   . HOH R 8 .   ? -6.994  -8.502  -53.772 1.00 81.34  ? 3223 HOH B O   1 
HETATM 9336 O O   . HOH R 8 .   ? 4.153   -15.840 -17.865 1.00 70.63  ? 3224 HOH B O   1 
HETATM 9337 O O   . HOH R 8 .   ? 15.738  -3.407  -3.211  1.00 73.21  ? 3225 HOH B O   1 
HETATM 9338 O O   . HOH R 8 .   ? -5.526  15.635  -66.731 1.00 69.64  ? 3226 HOH B O   1 
HETATM 9339 O O   . HOH R 8 .   ? 6.991   1.512   -6.877  1.00 72.57  ? 3227 HOH B O   1 
HETATM 9340 O O   . HOH R 8 .   ? 10.894  10.318  -68.448 1.00 71.42  ? 3228 HOH B O   1 
HETATM 9341 O O   . HOH R 8 .   ? 7.805   8.728   -17.561 1.00 80.55  ? 3229 HOH B O   1 
HETATM 9342 O O   . HOH R 8 .   ? -21.300 9.736   -57.737 1.00 86.75  ? 3230 HOH B O   1 
HETATM 9343 O O   . HOH R 8 .   ? 37.273  5.820   -18.130 1.00 76.95  ? 3231 HOH B O   1 
HETATM 9344 O O   . HOH R 8 .   ? -9.241  -7.323  -35.192 1.00 79.21  ? 3232 HOH B O   1 
HETATM 9345 O O   . HOH R 8 .   ? -0.251  -9.456  -16.316 1.00 66.82  ? 3233 HOH B O   1 
HETATM 9346 O O   . HOH R 8 .   ? -5.185  -8.712  -55.966 1.00 88.58  ? 3234 HOH B O   1 
HETATM 9347 O O   . HOH R 8 .   ? 0.504   16.823  -67.970 1.00 77.55  ? 3235 HOH B O   1 
HETATM 9348 O O   . HOH R 8 .   ? -7.121  26.393  -42.665 1.00 76.05  ? 3236 HOH B O   1 
HETATM 9349 O O   . HOH R 8 .   ? 19.122  -15.931 -21.889 1.00 72.07  ? 3237 HOH B O   1 
HETATM 9350 O O   . HOH R 8 .   ? 24.501  -10.156 -18.986 1.00 75.72  ? 3238 HOH B O   1 
HETATM 9351 O O   . HOH R 8 .   ? 1.074   17.523  -65.567 1.00 72.19  ? 3239 HOH B O   1 
HETATM 9352 O O   . HOH R 8 .   ? 9.932   24.061  -50.053 1.00 72.07  ? 3240 HOH B O   1 
HETATM 9353 O O   . HOH R 8 .   ? -8.211  4.729   -24.341 1.00 65.45  ? 3241 HOH B O   1 
HETATM 9354 O O   . HOH R 8 .   ? 37.705  -8.831  -54.432 1.00 83.44  ? 3242 HOH B O   1 
HETATM 9355 O O   . HOH R 8 .   ? -18.151 -8.961  -35.944 1.00 88.73  ? 3243 HOH B O   1 
HETATM 9356 O O   . HOH R 8 .   ? 36.165  4.952   -24.147 1.00 81.78  ? 3244 HOH B O   1 
HETATM 9357 O O   . HOH R 8 .   ? -4.314  25.308  -48.724 1.00 67.73  ? 3245 HOH B O   1 
HETATM 9358 O O   . HOH R 8 .   ? 17.791  16.336  -57.117 1.00 75.83  ? 3246 HOH B O   1 
HETATM 9359 O O   . HOH R 8 .   ? 8.137   24.160  -53.196 1.00 83.52  ? 3247 HOH B O   1 
HETATM 9360 O O   . HOH R 8 .   ? 21.645  11.410  -55.544 1.00 74.79  ? 3248 HOH B O   1 
HETATM 9361 O O   . HOH R 8 .   ? 34.772  -9.757  -50.579 1.00 79.27  ? 3249 HOH B O   1 
HETATM 9362 O O   . HOH R 8 .   ? 33.125  -14.691 -55.312 1.00 79.61  ? 3250 HOH B O   1 
HETATM 9363 O O   . HOH R 8 .   ? -20.091 -11.299 -33.435 1.00 80.85  ? 3251 HOH B O   1 
HETATM 9364 O O   . HOH R 8 .   ? -18.027 12.628  -45.145 1.00 62.95  ? 3252 HOH B O   1 
HETATM 9365 O O   . HOH R 8 .   ? 5.132   24.126  -57.885 1.00 79.71  ? 3253 HOH B O   1 
HETATM 9366 O O   . HOH R 8 .   ? 21.184  15.979  -26.074 1.00 77.93  ? 3254 HOH B O   1 
HETATM 9367 O O   . HOH R 8 .   ? 11.242  12.818  -65.892 1.00 77.25  ? 3255 HOH B O   1 
HETATM 9368 O O   . HOH R 8 .   ? -13.585 7.651   -22.476 1.00 79.39  ? 3256 HOH B O   1 
HETATM 9369 O O   . HOH R 8 .   ? -1.505  -11.271 -45.482 1.00 76.60  ? 3257 HOH B O   1 
HETATM 9370 O O   . HOH R 8 .   ? -6.916  24.051  -47.673 1.00 73.10  ? 3258 HOH B O   1 
HETATM 9371 O O   . HOH R 8 .   ? 25.335  9.816   -29.391 1.00 75.35  ? 3259 HOH B O   1 
HETATM 9372 O O   . HOH R 8 .   ? -0.362  20.280  -64.279 1.00 83.40  ? 3260 HOH B O   1 
HETATM 9373 O O   . HOH R 8 .   ? 27.685  7.671   -55.975 1.00 71.83  ? 3261 HOH B O   1 
HETATM 9374 O O   . HOH R 8 .   ? 32.700  6.576   -49.358 1.00 72.42  ? 3262 HOH B O   1 
HETATM 9375 O O   . HOH R 8 .   ? -7.593  -6.926  -49.362 1.00 73.46  ? 3263 HOH B O   1 
HETATM 9376 O O   . HOH R 8 .   ? -4.965  24.867  -37.829 1.00 68.92  ? 3264 HOH B O   1 
HETATM 9377 O O   . HOH R 8 .   ? 19.889  -18.251 -61.789 1.00 62.32  ? 3265 HOH B O   1 
HETATM 9378 O O   . HOH R 8 .   ? 14.498  15.411  -10.410 1.00 63.44  ? 3266 HOH B O   1 
HETATM 9379 O O   . HOH R 8 .   ? 2.100   -19.441 -33.931 1.00 74.02  ? 3267 HOH B O   1 
HETATM 9380 O O   . HOH R 8 .   ? -8.951  -6.872  -54.077 1.00 75.12  ? 3268 HOH B O   1 
HETATM 9381 O O   . HOH R 8 .   ? -0.391  -12.358 -53.586 1.00 88.78  ? 3269 HOH B O   1 
HETATM 9382 O O   . HOH R 8 .   ? 11.400  -17.933 -24.452 1.00 83.89  ? 3270 HOH B O   1 
HETATM 9383 O O   . HOH R 8 .   ? -3.764  1.989   -76.848 1.00 75.34  ? 3271 HOH B O   1 
HETATM 9384 O O   . HOH R 8 .   ? 8.373   28.837  -33.815 1.00 80.95  ? 3272 HOH B O   1 
HETATM 9385 O O   . HOH R 8 .   ? -0.485  -6.237  -60.287 1.00 73.74  ? 3273 HOH B O   1 
HETATM 9386 O O   . HOH R 8 .   ? 30.968  6.630   -58.365 1.00 67.90  ? 3274 HOH B O   1 
HETATM 9387 O O   . HOH R 8 .   ? 23.000  5.777   -61.701 1.00 73.47  ? 3275 HOH B O   1 
HETATM 9388 O O   . HOH R 8 .   ? 31.533  11.185  -50.295 1.00 77.00  ? 3276 HOH B O   1 
HETATM 9389 O O   . HOH R 8 .   ? 26.460  -20.821 -50.804 1.00 70.13  ? 3277 HOH B O   1 
HETATM 9390 O O   . HOH R 8 .   ? -4.162  27.798  -37.956 1.00 79.94  ? 3278 HOH B O   1 
HETATM 9391 O O   . HOH R 8 .   ? 9.019   1.320   -16.566 1.00 70.96  ? 3279 HOH B O   1 
HETATM 9392 O O   . HOH R 8 .   ? 12.629  8.813   -13.334 1.00 71.61  ? 3280 HOH B O   1 
HETATM 9393 O O   . HOH R 8 .   ? 31.417  -7.491  -36.599 1.00 78.46  ? 3281 HOH B O   1 
HETATM 9394 O O   . HOH R 8 .   ? 38.927  -4.999  -62.685 1.00 90.29  ? 3282 HOH B O   1 
HETATM 9395 O O   . HOH R 8 .   ? 24.524  5.272   -34.830 1.00 69.82  ? 3283 HOH B O   1 
HETATM 9396 O O   . HOH R 8 .   ? 28.476  7.498   -60.690 1.00 74.69  ? 3284 HOH B O   1 
HETATM 9397 O O   . HOH R 8 .   ? -0.323  1.125   -21.972 1.00 66.19  ? 3285 HOH B O   1 
HETATM 9398 O O   . HOH R 8 .   ? -10.344 -3.627  -59.464 1.00 73.63  ? 3286 HOH B O   1 
HETATM 9399 O O   . HOH R 8 .   ? 29.238  5.917   -54.675 1.00 70.17  ? 3287 HOH B O   1 
HETATM 9400 O O   . HOH R 8 .   ? 9.876   22.892  -18.675 1.00 69.60  ? 3288 HOH B O   1 
HETATM 9401 O O   . HOH R 8 .   ? 17.664  17.945  -27.737 1.00 66.82  ? 3289 HOH B O   1 
HETATM 9402 O O   . HOH R 8 .   ? -8.625  -7.057  -46.257 1.00 74.75  ? 3290 HOH B O   1 
HETATM 9403 O O   . HOH R 8 .   ? -2.112  -6.554  -18.797 1.00 72.83  ? 3291 HOH B O   1 
HETATM 9404 O O   . HOH R 8 .   ? 23.930  18.016  -20.443 1.00 68.43  ? 3292 HOH B O   1 
HETATM 9405 O O   . HOH R 8 .   ? -16.466 16.687  -47.724 1.00 72.90  ? 3293 HOH B O   1 
HETATM 9406 O O   . HOH R 8 .   ? -14.194 18.129  -47.086 1.00 80.45  ? 3294 HOH B O   1 
HETATM 9407 O O   . HOH R 8 .   ? 20.046  9.787   -58.676 1.00 72.52  ? 3295 HOH B O   1 
HETATM 9408 O O   . HOH R 8 .   ? 30.283  10.133  -52.240 1.00 75.90  ? 3296 HOH B O   1 
HETATM 9409 O O   . HOH R 8 .   ? 9.249   25.929  -47.149 1.00 83.95  ? 3297 HOH B O   1 
HETATM 9410 O O   . HOH R 8 .   ? -18.666 6.702   -40.997 1.00 73.58  ? 3298 HOH B O   1 
HETATM 9411 O O   . HOH R 8 .   ? 34.469  -4.741  -45.055 1.00 70.84  ? 3299 HOH B O   1 
HETATM 9412 O O   . HOH R 8 .   ? 2.566   11.284  -17.671 1.00 78.22  ? 3300 HOH B O   1 
HETATM 9413 O O   . HOH R 8 .   ? 23.015  -14.797 -31.813 1.00 92.13  ? 3301 HOH B O   1 
HETATM 9414 O O   . HOH R 8 .   ? 16.872  -1.276  -2.472  1.00 73.25  ? 3302 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 PRO 258 258 ?   ?   ?   A . n 
A 1 259 PRO 259 259 ?   ?   ?   A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 GLY 261 261 ?   ?   ?   A . n 
A 1 262 ALA 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 HIS 284 284 284 HIS HIS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 GLN 325 325 325 GLN GLN A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 GLN 358 358 358 GLN GLN A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ASP 372 372 372 ASP ASP A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 TYR 382 382 382 TYR TYR A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 TRP 385 385 385 TRP TRP A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 HIS 393 393 393 HIS HIS A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 MET 398 398 398 MET MET A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 VAL 402 402 402 VAL VAL A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 CYS 409 409 409 CYS CYS A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 TYR 428 428 428 TYR TYR A . n 
A 1 429 ILE 429 429 429 ILE ILE A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 HIS 432 432 432 HIS HIS A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 SER 435 435 435 SER SER A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 TRP 439 439 439 TRP TRP A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 TRP 442 442 442 TRP TRP A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 HIS 447 447 447 HIS HIS A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 TYR 449 449 449 TYR TYR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ILE 451 451 451 ILE ILE A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 THR 466 466 466 THR THR A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 LEU 476 476 476 LEU LEU A . n 
A 1 477 MET 477 477 477 MET MET A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 TRP 480 480 480 TRP TRP A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASN 482 482 482 ASN ASN A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 ARG 485 485 485 ARG ARG A . n 
A 1 486 THR 486 486 486 THR THR A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 PRO 489 489 489 PRO PRO A . n 
A 1 490 ASN 490 490 490 ASN ASN A . n 
A 1 491 ASP 491 491 491 ASP ASP A . n 
A 1 492 PRO 492 492 492 PRO PRO A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 ASP 494 494 494 ASP ASP A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 SER 497 497 497 SER SER A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 GLN 499 499 499 GLN GLN A . n 
A 1 500 TRP 500 500 500 TRP TRP A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 THR 504 504 504 THR THR A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ALA 506 506 506 ALA ALA A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 ASN 514 514 514 ASN ASN A . n 
A 1 515 LEU 515 515 515 LEU LEU A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 PRO 517 517 517 PRO PRO A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ARG 521 521 521 ARG ARG A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ARG 525 525 525 ARG ARG A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 THR 528 528 528 THR THR A . n 
A 1 529 CYS 529 529 529 CYS CYS A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 PHE 531 531 531 PHE PHE A . n 
A 1 532 TRP 532 532 532 TRP TRP A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 SER 541 541 541 SER SER A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 THR 543 543 ?   ?   ?   A . n 
B 1 1   GLU 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  PRO 25  25  25  PRO PRO B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  MET 48  48  48  MET MET B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  TRP 56  56  56  TRP TRP B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  CYS 69  69  69  CYS CYS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  TRP 86  86  86  TRP TRP B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  CYS 96  96  96  CYS CYS B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  TYR 98  98  98  TYR TYR B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 PRO 111 111 111 PRO PRO B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 PHE 158 158 158 PHE PHE B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 GLN 184 184 184 GLN GLN B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 ILE 187 187 187 ILE ILE B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 MET 195 195 195 MET MET B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 PHE 200 200 200 PHE PHE B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 ALA 203 203 203 ALA ALA B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 SER 208 208 208 SER SER B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 MET 211 211 211 MET MET B . n 
B 1 212 HIS 212 212 212 HIS HIS B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 LEU 221 221 221 LEU LEU B . n 
B 1 222 PHE 222 222 222 PHE PHE B . n 
B 1 223 HIS 223 223 223 HIS HIS B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ARG 245 245 245 ARG ARG B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ARG 247 247 247 ARG ARG B . n 
B 1 248 ALA 248 248 248 ALA ALA B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ARG 253 253 253 ARG ARG B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 CYS 257 257 257 CYS CYS B . n 
B 1 258 PRO 258 258 ?   ?   ?   B . n 
B 1 259 PRO 259 259 ?   ?   ?   B . n 
B 1 260 GLY 260 260 ?   ?   ?   B . n 
B 1 261 GLY 261 261 ?   ?   ?   B . n 
B 1 262 ALA 262 262 ?   ?   ?   B . n 
B 1 263 GLY 263 263 ?   ?   ?   B . n 
B 1 264 GLY 264 264 ?   ?   ?   B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 ASP 266 266 266 ASP ASP B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ARG 274 274 274 ARG ARG B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 ASP 283 283 283 ASP ASP B . n 
B 1 284 HIS 284 284 284 HIS HIS B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 TRP 286 286 286 TRP TRP B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 PHE 295 295 295 PHE PHE B . n 
B 1 296 ARG 296 296 296 ARG ARG B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 VAL 300 300 300 VAL VAL B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 ASP 304 304 304 ASP ASP B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 PHE 307 307 307 PHE PHE B . n 
B 1 308 LEU 308 308 308 LEU LEU B . n 
B 1 309 SER 309 309 309 SER SER B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 PRO 312 312 312 PRO PRO B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 ILE 316 316 316 ILE ILE B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 GLN 322 322 322 GLN GLN B . n 
B 1 323 ASP 323 323 323 ASP ASP B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 GLN 325 325 325 GLN GLN B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 VAL 331 331 331 VAL VAL B . n 
B 1 332 LYS 332 332 332 LYS LYS B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 TYR 337 337 337 TYR TYR B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 TYR 341 341 341 TYR TYR B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 PRO 344 344 344 PRO PRO B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 PHE 346 346 346 PHE PHE B . n 
B 1 347 SER 347 347 347 SER SER B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 ASN 350 350 350 ASN ASN B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 ILE 354 354 354 ILE ILE B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 ARG 356 356 356 ARG ARG B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 GLN 358 358 358 GLN GLN B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 VAL 363 363 363 VAL VAL B . n 
B 1 364 ARG 364 364 364 ARG ARG B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 GLY 366 366 366 GLY GLY B . n 
B 1 367 VAL 367 367 367 VAL VAL B . n 
B 1 368 PRO 368 368 368 PRO PRO B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 SER 371 371 371 SER SER B . n 
B 1 372 ASP 372 372 372 ASP ASP B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 ALA 375 375 375 ALA ALA B . n 
B 1 376 GLU 376 376 376 GLU GLU B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 VAL 379 379 379 VAL VAL B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 HIS 381 381 381 HIS HIS B . n 
B 1 382 TYR 382 382 382 TYR TYR B . n 
B 1 383 THR 383 383 383 THR THR B . n 
B 1 384 ASP 384 384 384 ASP ASP B . n 
B 1 385 TRP 385 385 385 TRP TRP B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 HIS 387 387 387 HIS HIS B . n 
B 1 388 PRO 388 388 388 PRO PRO B . n 
B 1 389 GLU 389 389 389 GLU GLU B . n 
B 1 390 ASP 390 390 390 ASP ASP B . n 
B 1 391 PRO 391 391 391 PRO PRO B . n 
B 1 392 THR 392 392 392 THR THR B . n 
B 1 393 HIS 393 393 393 HIS HIS B . n 
B 1 394 LEU 394 394 394 LEU LEU B . n 
B 1 395 ARG 395 395 395 ARG ARG B . n 
B 1 396 ASP 396 396 396 ASP ASP B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 MET 398 398 398 MET MET B . n 
B 1 399 SER 399 399 399 SER SER B . n 
B 1 400 ALA 400 400 400 ALA ALA B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 VAL 402 402 402 VAL VAL B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 ASP 404 404 404 ASP ASP B . n 
B 1 405 HIS 405 405 405 HIS HIS B . n 
B 1 406 ASN 406 406 406 ASN ASN B . n 
B 1 407 VAL 407 407 407 VAL VAL B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 CYS 409 409 409 CYS CYS B . n 
B 1 410 PRO 410 410 410 PRO PRO B . n 
B 1 411 VAL 411 411 411 VAL VAL B . n 
B 1 412 ALA 412 412 412 ALA ALA B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 ALA 415 415 415 ALA ALA B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 ARG 417 417 417 ARG ARG B . n 
B 1 418 LEU 418 418 418 LEU LEU B . n 
B 1 419 ALA 419 419 419 ALA ALA B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 GLN 421 421 421 GLN GLN B . n 
B 1 422 GLY 422 422 422 GLY GLY B . n 
B 1 423 ALA 423 423 423 ALA ALA B . n 
B 1 424 ARG 424 424 424 ARG ARG B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 TYR 426 426 426 TYR TYR B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 TYR 428 428 428 TYR TYR B . n 
B 1 429 ILE 429 429 429 ILE ILE B . n 
B 1 430 PHE 430 430 430 PHE PHE B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 HIS 432 432 432 HIS HIS B . n 
B 1 433 ARG 433 433 433 ARG ARG B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 SER 435 435 435 SER SER B . n 
B 1 436 THR 436 436 436 THR THR B . n 
B 1 437 LEU 437 437 437 LEU LEU B . n 
B 1 438 THR 438 438 438 THR THR B . n 
B 1 439 TRP 439 439 439 TRP TRP B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 LEU 441 441 441 LEU LEU B . n 
B 1 442 TRP 442 442 442 TRP TRP B . n 
B 1 443 MET 443 443 443 MET MET B . n 
B 1 444 GLY 444 444 444 GLY GLY B . n 
B 1 445 VAL 445 445 445 VAL VAL B . n 
B 1 446 PRO 446 446 446 PRO PRO B . n 
B 1 447 HIS 447 447 447 HIS HIS B . n 
B 1 448 GLY 448 448 448 GLY GLY B . n 
B 1 449 TYR 449 449 449 TYR TYR B . n 
B 1 450 GLU 450 450 450 GLU GLU B . n 
B 1 451 ILE 451 451 451 ILE ILE B . n 
B 1 452 GLU 452 452 452 GLU GLU B . n 
B 1 453 PHE 453 453 453 PHE PHE B . n 
B 1 454 ILE 454 454 454 ILE ILE B . n 
B 1 455 PHE 455 455 455 PHE PHE B . n 
B 1 456 GLY 456 456 456 GLY GLY B . n 
B 1 457 LEU 457 457 457 LEU LEU B . n 
B 1 458 PRO 458 458 458 PRO PRO B . n 
B 1 459 LEU 459 459 459 LEU LEU B . n 
B 1 460 ASP 460 460 460 ASP ASP B . n 
B 1 461 PRO 461 461 461 PRO PRO B . n 
B 1 462 SER 462 462 462 SER SER B . n 
B 1 463 LEU 463 463 463 LEU LEU B . n 
B 1 464 ASN 464 464 464 ASN ASN B . n 
B 1 465 TYR 465 465 465 TYR TYR B . n 
B 1 466 THR 466 466 466 THR THR B . n 
B 1 467 THR 467 467 467 THR THR B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 GLU 469 469 469 GLU GLU B . n 
B 1 470 ARG 470 470 470 ARG ARG B . n 
B 1 471 ILE 471 471 471 ILE ILE B . n 
B 1 472 PHE 472 472 472 PHE PHE B . n 
B 1 473 ALA 473 473 473 ALA ALA B . n 
B 1 474 GLN 474 474 474 GLN GLN B . n 
B 1 475 ARG 475 475 475 ARG ARG B . n 
B 1 476 LEU 476 476 476 LEU LEU B . n 
B 1 477 MET 477 477 477 MET MET B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 TYR 479 479 479 TYR TYR B . n 
B 1 480 TRP 480 480 480 TRP TRP B . n 
B 1 481 THR 481 481 481 THR THR B . n 
B 1 482 ASN 482 482 482 ASN ASN B . n 
B 1 483 PHE 483 483 483 PHE PHE B . n 
B 1 484 ALA 484 484 484 ALA ALA B . n 
B 1 485 ARG 485 485 485 ARG ARG B . n 
B 1 486 THR 486 486 486 THR THR B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 ASP 488 488 488 ASP ASP B . n 
B 1 489 PRO 489 489 489 PRO PRO B . n 
B 1 490 ASN 490 490 490 ASN ASN B . n 
B 1 491 ASP 491 491 491 ASP ASP B . n 
B 1 492 PRO 492 492 492 PRO PRO B . n 
B 1 493 ARG 493 493 493 ARG ARG B . n 
B 1 494 ASP 494 494 494 ASP ASP B . n 
B 1 495 SER 495 495 495 SER SER B . n 
B 1 496 LYS 496 496 496 LYS LYS B . n 
B 1 497 SER 497 497 497 SER SER B . n 
B 1 498 PRO 498 498 498 PRO PRO B . n 
B 1 499 GLN 499 499 499 GLN GLN B . n 
B 1 500 TRP 500 500 500 TRP TRP B . n 
B 1 501 PRO 501 501 501 PRO PRO B . n 
B 1 502 PRO 502 502 502 PRO PRO B . n 
B 1 503 TYR 503 503 503 TYR TYR B . n 
B 1 504 THR 504 504 504 THR THR B . n 
B 1 505 THR 505 505 505 THR THR B . n 
B 1 506 ALA 506 506 506 ALA ALA B . n 
B 1 507 ALA 507 507 507 ALA ALA B . n 
B 1 508 GLN 508 508 508 GLN GLN B . n 
B 1 509 GLN 509 509 509 GLN GLN B . n 
B 1 510 TYR 510 510 510 TYR TYR B . n 
B 1 511 VAL 511 511 511 VAL VAL B . n 
B 1 512 SER 512 512 512 SER SER B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 ASN 514 514 514 ASN ASN B . n 
B 1 515 LEU 515 515 515 LEU LEU B . n 
B 1 516 LYS 516 516 516 LYS LYS B . n 
B 1 517 PRO 517 517 517 PRO PRO B . n 
B 1 518 LEU 518 518 518 LEU LEU B . n 
B 1 519 GLU 519 519 519 GLU GLU B . n 
B 1 520 VAL 520 520 520 VAL VAL B . n 
B 1 521 ARG 521 521 521 ARG ARG B . n 
B 1 522 ARG 522 522 522 ARG ARG B . n 
B 1 523 GLY 523 523 523 GLY GLY B . n 
B 1 524 LEU 524 524 524 LEU LEU B . n 
B 1 525 ARG 525 525 525 ARG ARG B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 GLN 527 527 527 GLN GLN B . n 
B 1 528 THR 528 528 528 THR THR B . n 
B 1 529 CYS 529 529 529 CYS CYS B . n 
B 1 530 ALA 530 530 530 ALA ALA B . n 
B 1 531 PHE 531 531 531 PHE PHE B . n 
B 1 532 TRP 532 532 532 TRP TRP B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ARG 534 534 534 ARG ARG B . n 
B 1 535 PHE 535 535 535 PHE PHE B . n 
B 1 536 LEU 536 536 536 LEU LEU B . n 
B 1 537 PRO 537 537 537 PRO PRO B . n 
B 1 538 LYS 538 538 538 LYS LYS B . n 
B 1 539 LEU 539 539 539 LEU LEU B . n 
B 1 540 LEU 540 540 540 LEU LEU B . n 
B 1 541 SER 541 541 541 SER SER B . n 
B 1 542 ALA 542 542 542 ALA ALA B . n 
B 1 543 THR 543 543 543 THR THR B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 NAG 1   701  701 NAG NAG A . 
E 4 ACT 1   1903 903 ACT ACT A . 
F 5 AT3 1   1901 901 AT3 ATH A . 
G 6 ETM 1   1909 909 ETM TCH A . 
H 5 AT3 1   1902 902 AT3 ATH A . 
I 6 ETM 1   1905 905 ETM TCH A . 
J 4 ACT 1   1953 953 ACT ACT B . 
K 5 AT3 1   1951 951 AT3 ATH B . 
L 6 ETM 1   1959 959 ETM TCH B . 
M 5 AT3 1   1952 952 AT3 ATH B . 
N 6 ETM 1   1955 955 ETM TCH B . 
O 5 AT3 1   1961 961 AT3 ATH B . 
P 7 P6G 1   2901 901 P6G PEG B . 
Q 8 HOH 1   1910 1   HOH HOH A . 
Q 8 HOH 2   1911 7   HOH HOH A . 
Q 8 HOH 3   1912 8   HOH HOH A . 
Q 8 HOH 4   1913 10  HOH HOH A . 
Q 8 HOH 5   1914 11  HOH HOH A . 
Q 8 HOH 6   1915 12  HOH HOH A . 
Q 8 HOH 7   1916 13  HOH HOH A . 
Q 8 HOH 8   1917 15  HOH HOH A . 
Q 8 HOH 9   1918 16  HOH HOH A . 
Q 8 HOH 10  1919 17  HOH HOH A . 
Q 8 HOH 11  1920 19  HOH HOH A . 
Q 8 HOH 12  1921 20  HOH HOH A . 
Q 8 HOH 13  1922 22  HOH HOH A . 
Q 8 HOH 14  1923 27  HOH HOH A . 
Q 8 HOH 15  1924 29  HOH HOH A . 
Q 8 HOH 16  1925 30  HOH HOH A . 
Q 8 HOH 17  1926 33  HOH HOH A . 
Q 8 HOH 18  1927 38  HOH HOH A . 
Q 8 HOH 19  1928 39  HOH HOH A . 
Q 8 HOH 20  1929 40  HOH HOH A . 
Q 8 HOH 21  1930 42  HOH HOH A . 
Q 8 HOH 22  1931 43  HOH HOH A . 
Q 8 HOH 23  1932 44  HOH HOH A . 
Q 8 HOH 24  1933 45  HOH HOH A . 
Q 8 HOH 25  1934 48  HOH HOH A . 
Q 8 HOH 26  1935 50  HOH HOH A . 
Q 8 HOH 27  1936 52  HOH HOH A . 
Q 8 HOH 28  1937 53  HOH HOH A . 
Q 8 HOH 29  1938 54  HOH HOH A . 
Q 8 HOH 30  1939 55  HOH HOH A . 
Q 8 HOH 31  1940 56  HOH HOH A . 
Q 8 HOH 32  1941 58  HOH HOH A . 
Q 8 HOH 33  1942 59  HOH HOH A . 
Q 8 HOH 34  1943 61  HOH HOH A . 
Q 8 HOH 35  1944 63  HOH HOH A . 
Q 8 HOH 36  1945 65  HOH HOH A . 
Q 8 HOH 37  1946 68  HOH HOH A . 
Q 8 HOH 38  1947 69  HOH HOH A . 
Q 8 HOH 39  1948 72  HOH HOH A . 
Q 8 HOH 40  1949 77  HOH HOH A . 
Q 8 HOH 41  1950 79  HOH HOH A . 
Q 8 HOH 42  1951 82  HOH HOH A . 
Q 8 HOH 43  1952 83  HOH HOH A . 
Q 8 HOH 44  1953 85  HOH HOH A . 
Q 8 HOH 45  1954 86  HOH HOH A . 
Q 8 HOH 46  1955 90  HOH HOH A . 
Q 8 HOH 47  1956 93  HOH HOH A . 
Q 8 HOH 48  1957 95  HOH HOH A . 
Q 8 HOH 49  1958 96  HOH HOH A . 
Q 8 HOH 50  1959 100 HOH HOH A . 
Q 8 HOH 51  1960 101 HOH HOH A . 
Q 8 HOH 52  1961 102 HOH HOH A . 
Q 8 HOH 53  1962 103 HOH HOH A . 
Q 8 HOH 54  1963 104 HOH HOH A . 
Q 8 HOH 55  1964 105 HOH HOH A . 
Q 8 HOH 56  1965 106 HOH HOH A . 
Q 8 HOH 57  1966 109 HOH HOH A . 
Q 8 HOH 58  1967 110 HOH HOH A . 
Q 8 HOH 59  1968 112 HOH HOH A . 
Q 8 HOH 60  1969 114 HOH HOH A . 
Q 8 HOH 61  1970 115 HOH HOH A . 
Q 8 HOH 62  1971 116 HOH HOH A . 
Q 8 HOH 63  1972 118 HOH HOH A . 
Q 8 HOH 64  1973 119 HOH HOH A . 
Q 8 HOH 65  1974 128 HOH HOH A . 
Q 8 HOH 66  1975 129 HOH HOH A . 
Q 8 HOH 67  1976 130 HOH HOH A . 
Q 8 HOH 68  1977 131 HOH HOH A . 
Q 8 HOH 69  1978 132 HOH HOH A . 
Q 8 HOH 70  1979 135 HOH HOH A . 
Q 8 HOH 71  1980 136 HOH HOH A . 
Q 8 HOH 72  1981 138 HOH HOH A . 
Q 8 HOH 73  1982 140 HOH HOH A . 
Q 8 HOH 74  1983 142 HOH HOH A . 
Q 8 HOH 75  1984 143 HOH HOH A . 
Q 8 HOH 76  1985 145 HOH HOH A . 
Q 8 HOH 77  1986 147 HOH HOH A . 
Q 8 HOH 78  1987 149 HOH HOH A . 
Q 8 HOH 79  1988 150 HOH HOH A . 
Q 8 HOH 80  1989 151 HOH HOH A . 
Q 8 HOH 81  1990 154 HOH HOH A . 
Q 8 HOH 82  1991 155 HOH HOH A . 
Q 8 HOH 83  1992 156 HOH HOH A . 
Q 8 HOH 84  1993 158 HOH HOH A . 
Q 8 HOH 85  1994 159 HOH HOH A . 
Q 8 HOH 86  1995 160 HOH HOH A . 
Q 8 HOH 87  1996 161 HOH HOH A . 
Q 8 HOH 88  1997 163 HOH HOH A . 
Q 8 HOH 89  1998 164 HOH HOH A . 
Q 8 HOH 90  1999 165 HOH HOH A . 
Q 8 HOH 91  2000 166 HOH HOH A . 
Q 8 HOH 92  2001 167 HOH HOH A . 
Q 8 HOH 93  2002 169 HOH HOH A . 
Q 8 HOH 94  2003 170 HOH HOH A . 
Q 8 HOH 95  2004 175 HOH HOH A . 
Q 8 HOH 96  2005 177 HOH HOH A . 
Q 8 HOH 97  2006 179 HOH HOH A . 
Q 8 HOH 98  2007 181 HOH HOH A . 
Q 8 HOH 99  2008 182 HOH HOH A . 
Q 8 HOH 100 2009 183 HOH HOH A . 
Q 8 HOH 101 2010 184 HOH HOH A . 
Q 8 HOH 102 2011 185 HOH HOH A . 
Q 8 HOH 103 2012 186 HOH HOH A . 
Q 8 HOH 104 2013 188 HOH HOH A . 
Q 8 HOH 105 2014 189 HOH HOH A . 
Q 8 HOH 106 2015 190 HOH HOH A . 
Q 8 HOH 107 2016 191 HOH HOH A . 
Q 8 HOH 108 2017 192 HOH HOH A . 
Q 8 HOH 109 2018 194 HOH HOH A . 
Q 8 HOH 110 2019 195 HOH HOH A . 
Q 8 HOH 111 2020 197 HOH HOH A . 
Q 8 HOH 112 2021 202 HOH HOH A . 
Q 8 HOH 113 2022 204 HOH HOH A . 
Q 8 HOH 114 2023 205 HOH HOH A . 
Q 8 HOH 115 2024 206 HOH HOH A . 
Q 8 HOH 116 2025 207 HOH HOH A . 
Q 8 HOH 117 2026 208 HOH HOH A . 
Q 8 HOH 118 2027 209 HOH HOH A . 
Q 8 HOH 119 2028 210 HOH HOH A . 
Q 8 HOH 120 2029 214 HOH HOH A . 
Q 8 HOH 121 2030 215 HOH HOH A . 
Q 8 HOH 122 2031 216 HOH HOH A . 
Q 8 HOH 123 2032 217 HOH HOH A . 
Q 8 HOH 124 2033 219 HOH HOH A . 
Q 8 HOH 125 2034 220 HOH HOH A . 
Q 8 HOH 126 2035 222 HOH HOH A . 
Q 8 HOH 127 2036 223 HOH HOH A . 
Q 8 HOH 128 2037 226 HOH HOH A . 
Q 8 HOH 129 2038 230 HOH HOH A . 
Q 8 HOH 130 2039 231 HOH HOH A . 
Q 8 HOH 131 2040 232 HOH HOH A . 
Q 8 HOH 132 2041 233 HOH HOH A . 
Q 8 HOH 133 2042 238 HOH HOH A . 
Q 8 HOH 134 2043 241 HOH HOH A . 
Q 8 HOH 135 2044 242 HOH HOH A . 
Q 8 HOH 136 2045 245 HOH HOH A . 
Q 8 HOH 137 2046 247 HOH HOH A . 
Q 8 HOH 138 2047 251 HOH HOH A . 
Q 8 HOH 139 2048 252 HOH HOH A . 
Q 8 HOH 140 2049 253 HOH HOH A . 
Q 8 HOH 141 2050 256 HOH HOH A . 
Q 8 HOH 142 2051 258 HOH HOH A . 
Q 8 HOH 143 2052 259 HOH HOH A . 
Q 8 HOH 144 2053 260 HOH HOH A . 
Q 8 HOH 145 2054 262 HOH HOH A . 
Q 8 HOH 146 2055 263 HOH HOH A . 
Q 8 HOH 147 2056 264 HOH HOH A . 
Q 8 HOH 148 2057 266 HOH HOH A . 
Q 8 HOH 149 2058 267 HOH HOH A . 
Q 8 HOH 150 2059 271 HOH HOH A . 
Q 8 HOH 151 2060 272 HOH HOH A . 
Q 8 HOH 152 2061 273 HOH HOH A . 
Q 8 HOH 153 2062 275 HOH HOH A . 
Q 8 HOH 154 2063 276 HOH HOH A . 
Q 8 HOH 155 2064 277 HOH HOH A . 
Q 8 HOH 156 2065 278 HOH HOH A . 
Q 8 HOH 157 2066 279 HOH HOH A . 
Q 8 HOH 158 2067 280 HOH HOH A . 
Q 8 HOH 159 2068 281 HOH HOH A . 
Q 8 HOH 160 2069 282 HOH HOH A . 
Q 8 HOH 161 2070 289 HOH HOH A . 
Q 8 HOH 162 2071 290 HOH HOH A . 
Q 8 HOH 163 2072 293 HOH HOH A . 
Q 8 HOH 164 2073 295 HOH HOH A . 
Q 8 HOH 165 2074 297 HOH HOH A . 
Q 8 HOH 166 2075 298 HOH HOH A . 
Q 8 HOH 167 2076 300 HOH HOH A . 
Q 8 HOH 168 2077 301 HOH HOH A . 
Q 8 HOH 169 2078 302 HOH HOH A . 
Q 8 HOH 170 2079 304 HOH HOH A . 
Q 8 HOH 171 2080 305 HOH HOH A . 
Q 8 HOH 172 2081 306 HOH HOH A . 
Q 8 HOH 173 2082 307 HOH HOH A . 
Q 8 HOH 174 2083 308 HOH HOH A . 
Q 8 HOH 175 2084 309 HOH HOH A . 
Q 8 HOH 176 2085 311 HOH HOH A . 
Q 8 HOH 177 2086 312 HOH HOH A . 
Q 8 HOH 178 2087 314 HOH HOH A . 
Q 8 HOH 179 2088 319 HOH HOH A . 
Q 8 HOH 180 2089 320 HOH HOH A . 
Q 8 HOH 181 2090 321 HOH HOH A . 
Q 8 HOH 182 2091 322 HOH HOH A . 
Q 8 HOH 183 2092 323 HOH HOH A . 
Q 8 HOH 184 2093 324 HOH HOH A . 
Q 8 HOH 185 2094 325 HOH HOH A . 
Q 8 HOH 186 2095 327 HOH HOH A . 
Q 8 HOH 187 2096 329 HOH HOH A . 
Q 8 HOH 188 2097 330 HOH HOH A . 
Q 8 HOH 189 2098 331 HOH HOH A . 
Q 8 HOH 190 2099 332 HOH HOH A . 
Q 8 HOH 191 2100 338 HOH HOH A . 
Q 8 HOH 192 2101 339 HOH HOH A . 
Q 8 HOH 193 2102 342 HOH HOH A . 
Q 8 HOH 194 2103 345 HOH HOH A . 
Q 8 HOH 195 2104 346 HOH HOH A . 
Q 8 HOH 196 2105 348 HOH HOH A . 
Q 8 HOH 197 2106 349 HOH HOH A . 
Q 8 HOH 198 2107 350 HOH HOH A . 
Q 8 HOH 199 2108 352 HOH HOH A . 
Q 8 HOH 200 2109 355 HOH HOH A . 
Q 8 HOH 201 2110 359 HOH HOH A . 
Q 8 HOH 202 2111 360 HOH HOH A . 
Q 8 HOH 203 2112 361 HOH HOH A . 
Q 8 HOH 204 2113 363 HOH HOH A . 
Q 8 HOH 205 2114 364 HOH HOH A . 
Q 8 HOH 206 2115 365 HOH HOH A . 
Q 8 HOH 207 2116 366 HOH HOH A . 
Q 8 HOH 208 2117 367 HOH HOH A . 
Q 8 HOH 209 2118 368 HOH HOH A . 
Q 8 HOH 210 2119 370 HOH HOH A . 
Q 8 HOH 211 2120 371 HOH HOH A . 
Q 8 HOH 212 2121 372 HOH HOH A . 
Q 8 HOH 213 2122 373 HOH HOH A . 
Q 8 HOH 214 2123 377 HOH HOH A . 
Q 8 HOH 215 2124 379 HOH HOH A . 
Q 8 HOH 216 2125 384 HOH HOH A . 
Q 8 HOH 217 2126 390 HOH HOH A . 
Q 8 HOH 218 2127 393 HOH HOH A . 
Q 8 HOH 219 2128 396 HOH HOH A . 
Q 8 HOH 220 2129 397 HOH HOH A . 
Q 8 HOH 221 2130 398 HOH HOH A . 
Q 8 HOH 222 2131 399 HOH HOH A . 
Q 8 HOH 223 2132 400 HOH HOH A . 
Q 8 HOH 224 2133 403 HOH HOH A . 
Q 8 HOH 225 2134 405 HOH HOH A . 
Q 8 HOH 226 2135 406 HOH HOH A . 
Q 8 HOH 227 2136 411 HOH HOH A . 
Q 8 HOH 228 2137 415 HOH HOH A . 
Q 8 HOH 229 2138 421 HOH HOH A . 
Q 8 HOH 230 2139 422 HOH HOH A . 
Q 8 HOH 231 2140 423 HOH HOH A . 
Q 8 HOH 232 2141 424 HOH HOH A . 
Q 8 HOH 233 2142 425 HOH HOH A . 
Q 8 HOH 234 2143 426 HOH HOH A . 
Q 8 HOH 235 2144 427 HOH HOH A . 
Q 8 HOH 236 2145 428 HOH HOH A . 
Q 8 HOH 237 2146 429 HOH HOH A . 
Q 8 HOH 238 2147 431 HOH HOH A . 
Q 8 HOH 239 2148 432 HOH HOH A . 
Q 8 HOH 240 2149 433 HOH HOH A . 
Q 8 HOH 241 2150 437 HOH HOH A . 
Q 8 HOH 242 2151 439 HOH HOH A . 
Q 8 HOH 243 2152 440 HOH HOH A . 
Q 8 HOH 244 2153 442 HOH HOH A . 
Q 8 HOH 245 2154 445 HOH HOH A . 
Q 8 HOH 246 2155 446 HOH HOH A . 
Q 8 HOH 247 2156 447 HOH HOH A . 
Q 8 HOH 248 2157 448 HOH HOH A . 
Q 8 HOH 249 2158 449 HOH HOH A . 
Q 8 HOH 250 2159 450 HOH HOH A . 
Q 8 HOH 251 2160 451 HOH HOH A . 
Q 8 HOH 252 2161 452 HOH HOH A . 
Q 8 HOH 253 2162 454 HOH HOH A . 
Q 8 HOH 254 2163 456 HOH HOH A . 
Q 8 HOH 255 2164 458 HOH HOH A . 
Q 8 HOH 256 2165 461 HOH HOH A . 
Q 8 HOH 257 2166 463 HOH HOH A . 
Q 8 HOH 258 2167 464 HOH HOH A . 
Q 8 HOH 259 2168 466 HOH HOH A . 
Q 8 HOH 260 2169 470 HOH HOH A . 
Q 8 HOH 261 2170 471 HOH HOH A . 
Q 8 HOH 262 2171 474 HOH HOH A . 
Q 8 HOH 263 2172 475 HOH HOH A . 
Q 8 HOH 264 2173 476 HOH HOH A . 
Q 8 HOH 265 2174 477 HOH HOH A . 
Q 8 HOH 266 2175 479 HOH HOH A . 
Q 8 HOH 267 2176 481 HOH HOH A . 
Q 8 HOH 268 2177 482 HOH HOH A . 
Q 8 HOH 269 2178 483 HOH HOH A . 
Q 8 HOH 270 2179 485 HOH HOH A . 
Q 8 HOH 271 2180 488 HOH HOH A . 
Q 8 HOH 272 2181 490 HOH HOH A . 
Q 8 HOH 273 2182 492 HOH HOH A . 
Q 8 HOH 274 2183 493 HOH HOH A . 
Q 8 HOH 275 2184 494 HOH HOH A . 
Q 8 HOH 276 2185 496 HOH HOH A . 
Q 8 HOH 277 2186 497 HOH HOH A . 
Q 8 HOH 278 2187 499 HOH HOH A . 
Q 8 HOH 279 2188 501 HOH HOH A . 
Q 8 HOH 280 2189 502 HOH HOH A . 
Q 8 HOH 281 2190 503 HOH HOH A . 
Q 8 HOH 282 2191 509 HOH HOH A . 
Q 8 HOH 283 2192 511 HOH HOH A . 
Q 8 HOH 284 2193 512 HOH HOH A . 
Q 8 HOH 285 2194 514 HOH HOH A . 
Q 8 HOH 286 2195 515 HOH HOH A . 
Q 8 HOH 287 2196 516 HOH HOH A . 
Q 8 HOH 288 2197 519 HOH HOH A . 
Q 8 HOH 289 2198 520 HOH HOH A . 
Q 8 HOH 290 2199 521 HOH HOH A . 
Q 8 HOH 291 2200 522 HOH HOH A . 
Q 8 HOH 292 2201 524 HOH HOH A . 
Q 8 HOH 293 2202 528 HOH HOH A . 
Q 8 HOH 294 2203 529 HOH HOH A . 
Q 8 HOH 295 2204 530 HOH HOH A . 
Q 8 HOH 296 2205 533 HOH HOH A . 
Q 8 HOH 297 2206 534 HOH HOH A . 
Q 8 HOH 298 2207 535 HOH HOH A . 
Q 8 HOH 299 2208 537 HOH HOH A . 
Q 8 HOH 300 2209 539 HOH HOH A . 
Q 8 HOH 301 2210 544 HOH HOH A . 
Q 8 HOH 302 2211 545 HOH HOH A . 
Q 8 HOH 303 2212 547 HOH HOH A . 
Q 8 HOH 304 2213 549 HOH HOH A . 
Q 8 HOH 305 2214 550 HOH HOH A . 
Q 8 HOH 306 2215 551 HOH HOH A . 
Q 8 HOH 307 2216 552 HOH HOH A . 
Q 8 HOH 308 2217 553 HOH HOH A . 
Q 8 HOH 309 2218 555 HOH HOH A . 
Q 8 HOH 310 2219 556 HOH HOH A . 
Q 8 HOH 311 2220 558 HOH HOH A . 
Q 8 HOH 312 2221 559 HOH HOH A . 
Q 8 HOH 313 2222 561 HOH HOH A . 
Q 8 HOH 314 2223 563 HOH HOH A . 
Q 8 HOH 315 2224 565 HOH HOH A . 
Q 8 HOH 316 2225 567 HOH HOH A . 
Q 8 HOH 317 2226 572 HOH HOH A . 
Q 8 HOH 318 2227 574 HOH HOH A . 
Q 8 HOH 319 2228 575 HOH HOH A . 
Q 8 HOH 320 2229 576 HOH HOH A . 
Q 8 HOH 321 2230 579 HOH HOH A . 
Q 8 HOH 322 2231 583 HOH HOH A . 
Q 8 HOH 323 2232 585 HOH HOH A . 
Q 8 HOH 324 2233 586 HOH HOH A . 
Q 8 HOH 325 2234 590 HOH HOH A . 
Q 8 HOH 326 2235 591 HOH HOH A . 
Q 8 HOH 327 2236 593 HOH HOH A . 
Q 8 HOH 328 2237 594 HOH HOH A . 
Q 8 HOH 329 2238 596 HOH HOH A . 
Q 8 HOH 330 2239 599 HOH HOH A . 
Q 8 HOH 331 2240 600 HOH HOH A . 
Q 8 HOH 332 2241 603 HOH HOH A . 
Q 8 HOH 333 2242 604 HOH HOH A . 
Q 8 HOH 334 2243 605 HOH HOH A . 
Q 8 HOH 335 2244 606 HOH HOH A . 
Q 8 HOH 336 2245 607 HOH HOH A . 
Q 8 HOH 337 2246 612 HOH HOH A . 
Q 8 HOH 338 2247 614 HOH HOH A . 
Q 8 HOH 339 2248 615 HOH HOH A . 
Q 8 HOH 340 2249 619 HOH HOH A . 
Q 8 HOH 341 2250 620 HOH HOH A . 
Q 8 HOH 342 2251 621 HOH HOH A . 
Q 8 HOH 343 2252 622 HOH HOH A . 
Q 8 HOH 344 2253 624 HOH HOH A . 
Q 8 HOH 345 2254 628 HOH HOH A . 
Q 8 HOH 346 2255 631 HOH HOH A . 
Q 8 HOH 347 2256 635 HOH HOH A . 
Q 8 HOH 348 2257 637 HOH HOH A . 
Q 8 HOH 349 2258 638 HOH HOH A . 
Q 8 HOH 350 2259 640 HOH HOH A . 
Q 8 HOH 351 2260 644 HOH HOH A . 
Q 8 HOH 352 2261 646 HOH HOH A . 
Q 8 HOH 353 2262 649 HOH HOH A . 
Q 8 HOH 354 2263 653 HOH HOH A . 
Q 8 HOH 355 2264 657 HOH HOH A . 
Q 8 HOH 356 2265 659 HOH HOH A . 
Q 8 HOH 357 2266 660 HOH HOH A . 
Q 8 HOH 358 2267 661 HOH HOH A . 
Q 8 HOH 359 2268 662 HOH HOH A . 
Q 8 HOH 360 2269 664 HOH HOH A . 
Q 8 HOH 361 2270 666 HOH HOH A . 
Q 8 HOH 362 2271 667 HOH HOH A . 
Q 8 HOH 363 2272 671 HOH HOH A . 
Q 8 HOH 364 2273 673 HOH HOH A . 
Q 8 HOH 365 2274 675 HOH HOH A . 
Q 8 HOH 366 2275 676 HOH HOH A . 
Q 8 HOH 367 2276 677 HOH HOH A . 
Q 8 HOH 368 2277 678 HOH HOH A . 
Q 8 HOH 369 2278 681 HOH HOH A . 
Q 8 HOH 370 2279 683 HOH HOH A . 
Q 8 HOH 371 2280 684 HOH HOH A . 
Q 8 HOH 372 2281 686 HOH HOH A . 
Q 8 HOH 373 2282 693 HOH HOH A . 
Q 8 HOH 374 2283 694 HOH HOH A . 
Q 8 HOH 375 2284 696 HOH HOH A . 
Q 8 HOH 376 2285 697 HOH HOH A . 
Q 8 HOH 377 2286 699 HOH HOH A . 
Q 8 HOH 378 2287 700 HOH HOH A . 
Q 8 HOH 379 2288 701 HOH HOH A . 
Q 8 HOH 380 2289 703 HOH HOH A . 
Q 8 HOH 381 2290 706 HOH HOH A . 
Q 8 HOH 382 2291 707 HOH HOH A . 
Q 8 HOH 383 2292 710 HOH HOH A . 
Q 8 HOH 384 2293 717 HOH HOH A . 
Q 8 HOH 385 2294 718 HOH HOH A . 
Q 8 HOH 386 2295 721 HOH HOH A . 
Q 8 HOH 387 2296 722 HOH HOH A . 
Q 8 HOH 388 2297 723 HOH HOH A . 
Q 8 HOH 389 2298 728 HOH HOH A . 
Q 8 HOH 390 2299 730 HOH HOH A . 
Q 8 HOH 391 2300 731 HOH HOH A . 
Q 8 HOH 392 2301 733 HOH HOH A . 
Q 8 HOH 393 2302 734 HOH HOH A . 
Q 8 HOH 394 2303 736 HOH HOH A . 
Q 8 HOH 395 2304 739 HOH HOH A . 
Q 8 HOH 396 2305 740 HOH HOH A . 
Q 8 HOH 397 2306 742 HOH HOH A . 
Q 8 HOH 398 2307 745 HOH HOH A . 
Q 8 HOH 399 2308 747 HOH HOH A . 
Q 8 HOH 400 2309 748 HOH HOH A . 
Q 8 HOH 401 2310 752 HOH HOH A . 
Q 8 HOH 402 2311 755 HOH HOH A . 
Q 8 HOH 403 2312 758 HOH HOH A . 
Q 8 HOH 404 2313 759 HOH HOH A . 
Q 8 HOH 405 2314 760 HOH HOH A . 
Q 8 HOH 406 2315 766 HOH HOH A . 
Q 8 HOH 407 2316 768 HOH HOH A . 
Q 8 HOH 408 2317 769 HOH HOH A . 
Q 8 HOH 409 2318 770 HOH HOH A . 
Q 8 HOH 410 2319 771 HOH HOH A . 
Q 8 HOH 411 2320 775 HOH HOH A . 
Q 8 HOH 412 2321 777 HOH HOH A . 
Q 8 HOH 413 2322 778 HOH HOH A . 
Q 8 HOH 414 2323 779 HOH HOH A . 
Q 8 HOH 415 2324 781 HOH HOH A . 
Q 8 HOH 416 2325 784 HOH HOH A . 
Q 8 HOH 417 2326 787 HOH HOH A . 
Q 8 HOH 418 2327 788 HOH HOH A . 
Q 8 HOH 419 2328 790 HOH HOH A . 
Q 8 HOH 420 2329 792 HOH HOH A . 
Q 8 HOH 421 2330 794 HOH HOH A . 
Q 8 HOH 422 2331 796 HOH HOH A . 
Q 8 HOH 423 2332 797 HOH HOH A . 
Q 8 HOH 424 2333 801 HOH HOH A . 
Q 8 HOH 425 2334 802 HOH HOH A . 
Q 8 HOH 426 2335 803 HOH HOH A . 
Q 8 HOH 427 2336 804 HOH HOH A . 
Q 8 HOH 428 2337 805 HOH HOH A . 
Q 8 HOH 429 2338 806 HOH HOH A . 
Q 8 HOH 430 2339 807 HOH HOH A . 
Q 8 HOH 431 2340 813 HOH HOH A . 
Q 8 HOH 432 2341 814 HOH HOH A . 
Q 8 HOH 433 2342 815 HOH HOH A . 
Q 8 HOH 434 2343 818 HOH HOH A . 
Q 8 HOH 435 2344 820 HOH HOH A . 
Q 8 HOH 436 2345 824 HOH HOH A . 
Q 8 HOH 437 2346 825 HOH HOH A . 
Q 8 HOH 438 2347 829 HOH HOH A . 
Q 8 HOH 439 2348 830 HOH HOH A . 
Q 8 HOH 440 2349 832 HOH HOH A . 
Q 8 HOH 441 2350 836 HOH HOH A . 
Q 8 HOH 442 2351 837 HOH HOH A . 
Q 8 HOH 443 2352 838 HOH HOH A . 
Q 8 HOH 444 2353 839 HOH HOH A . 
Q 8 HOH 445 2354 841 HOH HOH A . 
Q 8 HOH 446 2355 842 HOH HOH A . 
Q 8 HOH 447 2356 843 HOH HOH A . 
Q 8 HOH 448 2357 844 HOH HOH A . 
Q 8 HOH 449 2358 845 HOH HOH A . 
Q 8 HOH 450 2359 846 HOH HOH A . 
Q 8 HOH 451 2360 847 HOH HOH A . 
Q 8 HOH 452 2361 848 HOH HOH A . 
Q 8 HOH 453 2362 849 HOH HOH A . 
Q 8 HOH 454 2363 850 HOH HOH A . 
Q 8 HOH 455 2364 851 HOH HOH A . 
Q 8 HOH 456 2365 852 HOH HOH A . 
Q 8 HOH 457 2366 855 HOH HOH A . 
Q 8 HOH 458 2367 857 HOH HOH A . 
Q 8 HOH 459 2368 858 HOH HOH A . 
Q 8 HOH 460 2369 860 HOH HOH A . 
Q 8 HOH 461 2370 861 HOH HOH A . 
Q 8 HOH 462 2371 862 HOH HOH A . 
Q 8 HOH 463 2372 863 HOH HOH A . 
Q 8 HOH 464 2373 864 HOH HOH A . 
Q 8 HOH 465 2374 865 HOH HOH A . 
Q 8 HOH 466 2375 869 HOH HOH A . 
Q 8 HOH 467 2376 870 HOH HOH A . 
Q 8 HOH 468 2377 875 HOH HOH A . 
Q 8 HOH 469 2378 877 HOH HOH A . 
Q 8 HOH 470 2379 878 HOH HOH A . 
Q 8 HOH 471 2380 881 HOH HOH A . 
Q 8 HOH 472 2381 882 HOH HOH A . 
Q 8 HOH 473 2382 883 HOH HOH A . 
Q 8 HOH 474 2383 884 HOH HOH A . 
Q 8 HOH 475 2384 885 HOH HOH A . 
Q 8 HOH 476 2385 887 HOH HOH A . 
Q 8 HOH 477 2386 888 HOH HOH A . 
Q 8 HOH 478 2387 889 HOH HOH A . 
Q 8 HOH 479 2388 892 HOH HOH A . 
Q 8 HOH 480 2389 894 HOH HOH A . 
Q 8 HOH 481 2390 895 HOH HOH A . 
Q 8 HOH 482 2391 897 HOH HOH A . 
Q 8 HOH 483 2392 904 HOH HOH A . 
Q 8 HOH 484 2393 909 HOH HOH A . 
Q 8 HOH 485 2394 914 HOH HOH A . 
R 8 HOH 1   2902 2   HOH HOH B . 
R 8 HOH 2   2903 3   HOH HOH B . 
R 8 HOH 3   2904 4   HOH HOH B . 
R 8 HOH 4   2905 5   HOH HOH B . 
R 8 HOH 5   2906 6   HOH HOH B . 
R 8 HOH 6   2907 9   HOH HOH B . 
R 8 HOH 7   2908 14  HOH HOH B . 
R 8 HOH 8   2909 18  HOH HOH B . 
R 8 HOH 9   2910 21  HOH HOH B . 
R 8 HOH 10  2911 23  HOH HOH B . 
R 8 HOH 11  2912 24  HOH HOH B . 
R 8 HOH 12  2913 25  HOH HOH B . 
R 8 HOH 13  2914 26  HOH HOH B . 
R 8 HOH 14  2915 28  HOH HOH B . 
R 8 HOH 15  2916 31  HOH HOH B . 
R 8 HOH 16  2917 32  HOH HOH B . 
R 8 HOH 17  2918 34  HOH HOH B . 
R 8 HOH 18  2919 35  HOH HOH B . 
R 8 HOH 19  2920 36  HOH HOH B . 
R 8 HOH 20  2921 37  HOH HOH B . 
R 8 HOH 21  2922 41  HOH HOH B . 
R 8 HOH 22  2923 46  HOH HOH B . 
R 8 HOH 23  2924 47  HOH HOH B . 
R 8 HOH 24  2925 49  HOH HOH B . 
R 8 HOH 25  2926 51  HOH HOH B . 
R 8 HOH 26  2927 57  HOH HOH B . 
R 8 HOH 27  2928 60  HOH HOH B . 
R 8 HOH 28  2929 62  HOH HOH B . 
R 8 HOH 29  2930 64  HOH HOH B . 
R 8 HOH 30  2931 66  HOH HOH B . 
R 8 HOH 31  2932 67  HOH HOH B . 
R 8 HOH 32  2933 70  HOH HOH B . 
R 8 HOH 33  2934 71  HOH HOH B . 
R 8 HOH 34  2935 73  HOH HOH B . 
R 8 HOH 35  2936 74  HOH HOH B . 
R 8 HOH 36  2937 75  HOH HOH B . 
R 8 HOH 37  2938 76  HOH HOH B . 
R 8 HOH 38  2939 78  HOH HOH B . 
R 8 HOH 39  2940 80  HOH HOH B . 
R 8 HOH 40  2941 81  HOH HOH B . 
R 8 HOH 41  2942 84  HOH HOH B . 
R 8 HOH 42  2943 87  HOH HOH B . 
R 8 HOH 43  2944 88  HOH HOH B . 
R 8 HOH 44  2945 89  HOH HOH B . 
R 8 HOH 45  2946 91  HOH HOH B . 
R 8 HOH 46  2947 92  HOH HOH B . 
R 8 HOH 47  2948 94  HOH HOH B . 
R 8 HOH 48  2949 97  HOH HOH B . 
R 8 HOH 49  2950 98  HOH HOH B . 
R 8 HOH 50  2951 99  HOH HOH B . 
R 8 HOH 51  2952 107 HOH HOH B . 
R 8 HOH 52  2953 108 HOH HOH B . 
R 8 HOH 53  2954 111 HOH HOH B . 
R 8 HOH 54  2955 113 HOH HOH B . 
R 8 HOH 55  2956 117 HOH HOH B . 
R 8 HOH 56  2957 120 HOH HOH B . 
R 8 HOH 57  2958 121 HOH HOH B . 
R 8 HOH 58  2959 122 HOH HOH B . 
R 8 HOH 59  2960 123 HOH HOH B . 
R 8 HOH 60  2961 124 HOH HOH B . 
R 8 HOH 61  2962 125 HOH HOH B . 
R 8 HOH 62  2963 126 HOH HOH B . 
R 8 HOH 63  2964 127 HOH HOH B . 
R 8 HOH 64  2965 133 HOH HOH B . 
R 8 HOH 65  2966 134 HOH HOH B . 
R 8 HOH 66  2967 137 HOH HOH B . 
R 8 HOH 67  2968 139 HOH HOH B . 
R 8 HOH 68  2969 141 HOH HOH B . 
R 8 HOH 69  2970 144 HOH HOH B . 
R 8 HOH 70  2971 146 HOH HOH B . 
R 8 HOH 71  2972 148 HOH HOH B . 
R 8 HOH 72  2973 152 HOH HOH B . 
R 8 HOH 73  2974 153 HOH HOH B . 
R 8 HOH 74  2975 157 HOH HOH B . 
R 8 HOH 75  2976 162 HOH HOH B . 
R 8 HOH 76  2977 168 HOH HOH B . 
R 8 HOH 77  2978 171 HOH HOH B . 
R 8 HOH 78  2979 172 HOH HOH B . 
R 8 HOH 79  2980 173 HOH HOH B . 
R 8 HOH 80  2981 174 HOH HOH B . 
R 8 HOH 81  2982 176 HOH HOH B . 
R 8 HOH 82  2983 178 HOH HOH B . 
R 8 HOH 83  2984 180 HOH HOH B . 
R 8 HOH 84  2985 187 HOH HOH B . 
R 8 HOH 85  2986 193 HOH HOH B . 
R 8 HOH 86  2987 196 HOH HOH B . 
R 8 HOH 87  2988 198 HOH HOH B . 
R 8 HOH 88  2989 199 HOH HOH B . 
R 8 HOH 89  2990 200 HOH HOH B . 
R 8 HOH 90  2991 201 HOH HOH B . 
R 8 HOH 91  2992 203 HOH HOH B . 
R 8 HOH 92  2993 211 HOH HOH B . 
R 8 HOH 93  2994 212 HOH HOH B . 
R 8 HOH 94  2995 213 HOH HOH B . 
R 8 HOH 95  2996 218 HOH HOH B . 
R 8 HOH 96  2997 221 HOH HOH B . 
R 8 HOH 97  2998 224 HOH HOH B . 
R 8 HOH 98  2999 225 HOH HOH B . 
R 8 HOH 99  3000 227 HOH HOH B . 
R 8 HOH 100 3001 228 HOH HOH B . 
R 8 HOH 101 3002 229 HOH HOH B . 
R 8 HOH 102 3003 234 HOH HOH B . 
R 8 HOH 103 3004 235 HOH HOH B . 
R 8 HOH 104 3005 236 HOH HOH B . 
R 8 HOH 105 3006 237 HOH HOH B . 
R 8 HOH 106 3007 239 HOH HOH B . 
R 8 HOH 107 3008 240 HOH HOH B . 
R 8 HOH 108 3009 243 HOH HOH B . 
R 8 HOH 109 3010 244 HOH HOH B . 
R 8 HOH 110 3011 246 HOH HOH B . 
R 8 HOH 111 3012 248 HOH HOH B . 
R 8 HOH 112 3013 249 HOH HOH B . 
R 8 HOH 113 3014 250 HOH HOH B . 
R 8 HOH 114 3015 254 HOH HOH B . 
R 8 HOH 115 3016 255 HOH HOH B . 
R 8 HOH 116 3017 257 HOH HOH B . 
R 8 HOH 117 3018 261 HOH HOH B . 
R 8 HOH 118 3019 265 HOH HOH B . 
R 8 HOH 119 3020 268 HOH HOH B . 
R 8 HOH 120 3021 269 HOH HOH B . 
R 8 HOH 121 3022 270 HOH HOH B . 
R 8 HOH 122 3023 274 HOH HOH B . 
R 8 HOH 123 3024 283 HOH HOH B . 
R 8 HOH 124 3025 284 HOH HOH B . 
R 8 HOH 125 3026 285 HOH HOH B . 
R 8 HOH 126 3027 286 HOH HOH B . 
R 8 HOH 127 3028 287 HOH HOH B . 
R 8 HOH 128 3029 288 HOH HOH B . 
R 8 HOH 129 3030 291 HOH HOH B . 
R 8 HOH 130 3031 292 HOH HOH B . 
R 8 HOH 131 3032 294 HOH HOH B . 
R 8 HOH 132 3033 296 HOH HOH B . 
R 8 HOH 133 3034 299 HOH HOH B . 
R 8 HOH 134 3035 303 HOH HOH B . 
R 8 HOH 135 3036 310 HOH HOH B . 
R 8 HOH 136 3037 313 HOH HOH B . 
R 8 HOH 137 3038 315 HOH HOH B . 
R 8 HOH 138 3039 316 HOH HOH B . 
R 8 HOH 139 3040 317 HOH HOH B . 
R 8 HOH 140 3041 318 HOH HOH B . 
R 8 HOH 141 3042 326 HOH HOH B . 
R 8 HOH 142 3043 328 HOH HOH B . 
R 8 HOH 143 3044 333 HOH HOH B . 
R 8 HOH 144 3045 334 HOH HOH B . 
R 8 HOH 145 3046 335 HOH HOH B . 
R 8 HOH 146 3047 336 HOH HOH B . 
R 8 HOH 147 3048 337 HOH HOH B . 
R 8 HOH 148 3049 340 HOH HOH B . 
R 8 HOH 149 3050 341 HOH HOH B . 
R 8 HOH 150 3051 343 HOH HOH B . 
R 8 HOH 151 3052 344 HOH HOH B . 
R 8 HOH 152 3053 347 HOH HOH B . 
R 8 HOH 153 3054 351 HOH HOH B . 
R 8 HOH 154 3055 353 HOH HOH B . 
R 8 HOH 155 3056 354 HOH HOH B . 
R 8 HOH 156 3057 356 HOH HOH B . 
R 8 HOH 157 3058 357 HOH HOH B . 
R 8 HOH 158 3059 358 HOH HOH B . 
R 8 HOH 159 3060 362 HOH HOH B . 
R 8 HOH 160 3061 369 HOH HOH B . 
R 8 HOH 161 3062 374 HOH HOH B . 
R 8 HOH 162 3063 375 HOH HOH B . 
R 8 HOH 163 3064 376 HOH HOH B . 
R 8 HOH 164 3065 378 HOH HOH B . 
R 8 HOH 165 3066 380 HOH HOH B . 
R 8 HOH 166 3067 381 HOH HOH B . 
R 8 HOH 167 3068 382 HOH HOH B . 
R 8 HOH 168 3069 383 HOH HOH B . 
R 8 HOH 169 3070 385 HOH HOH B . 
R 8 HOH 170 3071 386 HOH HOH B . 
R 8 HOH 171 3072 387 HOH HOH B . 
R 8 HOH 172 3073 388 HOH HOH B . 
R 8 HOH 173 3074 389 HOH HOH B . 
R 8 HOH 174 3075 391 HOH HOH B . 
R 8 HOH 175 3076 392 HOH HOH B . 
R 8 HOH 176 3077 394 HOH HOH B . 
R 8 HOH 177 3078 395 HOH HOH B . 
R 8 HOH 178 3079 401 HOH HOH B . 
R 8 HOH 179 3080 402 HOH HOH B . 
R 8 HOH 180 3081 404 HOH HOH B . 
R 8 HOH 181 3082 407 HOH HOH B . 
R 8 HOH 182 3083 408 HOH HOH B . 
R 8 HOH 183 3084 409 HOH HOH B . 
R 8 HOH 184 3085 410 HOH HOH B . 
R 8 HOH 185 3086 412 HOH HOH B . 
R 8 HOH 186 3087 413 HOH HOH B . 
R 8 HOH 187 3088 414 HOH HOH B . 
R 8 HOH 188 3089 416 HOH HOH B . 
R 8 HOH 189 3090 417 HOH HOH B . 
R 8 HOH 190 3091 418 HOH HOH B . 
R 8 HOH 191 3092 419 HOH HOH B . 
R 8 HOH 192 3093 420 HOH HOH B . 
R 8 HOH 193 3094 430 HOH HOH B . 
R 8 HOH 194 3095 434 HOH HOH B . 
R 8 HOH 195 3096 435 HOH HOH B . 
R 8 HOH 196 3097 436 HOH HOH B . 
R 8 HOH 197 3098 438 HOH HOH B . 
R 8 HOH 198 3099 441 HOH HOH B . 
R 8 HOH 199 3100 443 HOH HOH B . 
R 8 HOH 200 3101 444 HOH HOH B . 
R 8 HOH 201 3102 453 HOH HOH B . 
R 8 HOH 202 3103 455 HOH HOH B . 
R 8 HOH 203 3104 457 HOH HOH B . 
R 8 HOH 204 3105 459 HOH HOH B . 
R 8 HOH 205 3106 460 HOH HOH B . 
R 8 HOH 206 3107 462 HOH HOH B . 
R 8 HOH 207 3108 465 HOH HOH B . 
R 8 HOH 208 3109 467 HOH HOH B . 
R 8 HOH 209 3110 468 HOH HOH B . 
R 8 HOH 210 3111 469 HOH HOH B . 
R 8 HOH 211 3112 472 HOH HOH B . 
R 8 HOH 212 3113 473 HOH HOH B . 
R 8 HOH 213 3114 478 HOH HOH B . 
R 8 HOH 214 3115 480 HOH HOH B . 
R 8 HOH 215 3116 484 HOH HOH B . 
R 8 HOH 216 3117 487 HOH HOH B . 
R 8 HOH 217 3118 489 HOH HOH B . 
R 8 HOH 218 3119 491 HOH HOH B . 
R 8 HOH 219 3120 495 HOH HOH B . 
R 8 HOH 220 3121 498 HOH HOH B . 
R 8 HOH 221 3122 500 HOH HOH B . 
R 8 HOH 222 3123 504 HOH HOH B . 
R 8 HOH 223 3124 505 HOH HOH B . 
R 8 HOH 224 3125 506 HOH HOH B . 
R 8 HOH 225 3126 507 HOH HOH B . 
R 8 HOH 226 3127 508 HOH HOH B . 
R 8 HOH 227 3128 510 HOH HOH B . 
R 8 HOH 228 3129 513 HOH HOH B . 
R 8 HOH 229 3130 517 HOH HOH B . 
R 8 HOH 230 3131 518 HOH HOH B . 
R 8 HOH 231 3132 523 HOH HOH B . 
R 8 HOH 232 3133 525 HOH HOH B . 
R 8 HOH 233 3134 526 HOH HOH B . 
R 8 HOH 234 3135 527 HOH HOH B . 
R 8 HOH 235 3136 531 HOH HOH B . 
R 8 HOH 236 3137 532 HOH HOH B . 
R 8 HOH 237 3138 536 HOH HOH B . 
R 8 HOH 238 3139 538 HOH HOH B . 
R 8 HOH 239 3140 541 HOH HOH B . 
R 8 HOH 240 3141 542 HOH HOH B . 
R 8 HOH 241 3142 543 HOH HOH B . 
R 8 HOH 242 3143 546 HOH HOH B . 
R 8 HOH 243 3144 548 HOH HOH B . 
R 8 HOH 244 3145 554 HOH HOH B . 
R 8 HOH 245 3146 557 HOH HOH B . 
R 8 HOH 246 3147 560 HOH HOH B . 
R 8 HOH 247 3148 562 HOH HOH B . 
R 8 HOH 248 3149 564 HOH HOH B . 
R 8 HOH 249 3150 566 HOH HOH B . 
R 8 HOH 250 3151 568 HOH HOH B . 
R 8 HOH 251 3152 569 HOH HOH B . 
R 8 HOH 252 3153 570 HOH HOH B . 
R 8 HOH 253 3154 571 HOH HOH B . 
R 8 HOH 254 3155 573 HOH HOH B . 
R 8 HOH 255 3156 577 HOH HOH B . 
R 8 HOH 256 3157 578 HOH HOH B . 
R 8 HOH 257 3158 580 HOH HOH B . 
R 8 HOH 258 3159 581 HOH HOH B . 
R 8 HOH 259 3160 582 HOH HOH B . 
R 8 HOH 260 3161 584 HOH HOH B . 
R 8 HOH 261 3162 587 HOH HOH B . 
R 8 HOH 262 3163 588 HOH HOH B . 
R 8 HOH 263 3164 589 HOH HOH B . 
R 8 HOH 264 3165 592 HOH HOH B . 
R 8 HOH 265 3166 595 HOH HOH B . 
R 8 HOH 266 3167 597 HOH HOH B . 
R 8 HOH 267 3168 598 HOH HOH B . 
R 8 HOH 268 3169 601 HOH HOH B . 
R 8 HOH 269 3170 602 HOH HOH B . 
R 8 HOH 270 3171 608 HOH HOH B . 
R 8 HOH 271 3172 609 HOH HOH B . 
R 8 HOH 272 3173 610 HOH HOH B . 
R 8 HOH 273 3174 611 HOH HOH B . 
R 8 HOH 274 3175 613 HOH HOH B . 
R 8 HOH 275 3176 616 HOH HOH B . 
R 8 HOH 276 3177 617 HOH HOH B . 
R 8 HOH 277 3178 618 HOH HOH B . 
R 8 HOH 278 3179 623 HOH HOH B . 
R 8 HOH 279 3180 625 HOH HOH B . 
R 8 HOH 280 3181 626 HOH HOH B . 
R 8 HOH 281 3182 627 HOH HOH B . 
R 8 HOH 282 3183 629 HOH HOH B . 
R 8 HOH 283 3184 630 HOH HOH B . 
R 8 HOH 284 3185 632 HOH HOH B . 
R 8 HOH 285 3186 633 HOH HOH B . 
R 8 HOH 286 3187 634 HOH HOH B . 
R 8 HOH 287 3188 636 HOH HOH B . 
R 8 HOH 288 3189 639 HOH HOH B . 
R 8 HOH 289 3190 641 HOH HOH B . 
R 8 HOH 290 3191 642 HOH HOH B . 
R 8 HOH 291 3192 643 HOH HOH B . 
R 8 HOH 292 3193 645 HOH HOH B . 
R 8 HOH 293 3194 647 HOH HOH B . 
R 8 HOH 294 3195 648 HOH HOH B . 
R 8 HOH 295 3196 650 HOH HOH B . 
R 8 HOH 296 3197 651 HOH HOH B . 
R 8 HOH 297 3198 652 HOH HOH B . 
R 8 HOH 298 3199 654 HOH HOH B . 
R 8 HOH 299 3200 655 HOH HOH B . 
R 8 HOH 300 3201 656 HOH HOH B . 
R 8 HOH 301 3202 658 HOH HOH B . 
R 8 HOH 302 3203 665 HOH HOH B . 
R 8 HOH 303 3204 668 HOH HOH B . 
R 8 HOH 304 3205 669 HOH HOH B . 
R 8 HOH 305 3206 670 HOH HOH B . 
R 8 HOH 306 3207 672 HOH HOH B . 
R 8 HOH 307 3208 674 HOH HOH B . 
R 8 HOH 308 3209 679 HOH HOH B . 
R 8 HOH 309 3210 680 HOH HOH B . 
R 8 HOH 310 3211 682 HOH HOH B . 
R 8 HOH 311 3212 685 HOH HOH B . 
R 8 HOH 312 3213 687 HOH HOH B . 
R 8 HOH 313 3214 688 HOH HOH B . 
R 8 HOH 314 3215 689 HOH HOH B . 
R 8 HOH 315 3216 690 HOH HOH B . 
R 8 HOH 316 3217 692 HOH HOH B . 
R 8 HOH 317 3218 695 HOH HOH B . 
R 8 HOH 318 3219 698 HOH HOH B . 
R 8 HOH 319 3220 702 HOH HOH B . 
R 8 HOH 320 3221 704 HOH HOH B . 
R 8 HOH 321 3222 705 HOH HOH B . 
R 8 HOH 322 3223 708 HOH HOH B . 
R 8 HOH 323 3224 709 HOH HOH B . 
R 8 HOH 324 3225 711 HOH HOH B . 
R 8 HOH 325 3226 712 HOH HOH B . 
R 8 HOH 326 3227 713 HOH HOH B . 
R 8 HOH 327 3228 714 HOH HOH B . 
R 8 HOH 328 3229 715 HOH HOH B . 
R 8 HOH 329 3230 716 HOH HOH B . 
R 8 HOH 330 3231 719 HOH HOH B . 
R 8 HOH 331 3232 720 HOH HOH B . 
R 8 HOH 332 3233 724 HOH HOH B . 
R 8 HOH 333 3234 725 HOH HOH B . 
R 8 HOH 334 3235 726 HOH HOH B . 
R 8 HOH 335 3236 727 HOH HOH B . 
R 8 HOH 336 3237 729 HOH HOH B . 
R 8 HOH 337 3238 732 HOH HOH B . 
R 8 HOH 338 3239 735 HOH HOH B . 
R 8 HOH 339 3240 737 HOH HOH B . 
R 8 HOH 340 3241 741 HOH HOH B . 
R 8 HOH 341 3242 743 HOH HOH B . 
R 8 HOH 342 3243 746 HOH HOH B . 
R 8 HOH 343 3244 749 HOH HOH B . 
R 8 HOH 344 3245 750 HOH HOH B . 
R 8 HOH 345 3246 751 HOH HOH B . 
R 8 HOH 346 3247 753 HOH HOH B . 
R 8 HOH 347 3248 754 HOH HOH B . 
R 8 HOH 348 3249 756 HOH HOH B . 
R 8 HOH 349 3250 757 HOH HOH B . 
R 8 HOH 350 3251 761 HOH HOH B . 
R 8 HOH 351 3252 762 HOH HOH B . 
R 8 HOH 352 3253 763 HOH HOH B . 
R 8 HOH 353 3254 764 HOH HOH B . 
R 8 HOH 354 3255 765 HOH HOH B . 
R 8 HOH 355 3256 772 HOH HOH B . 
R 8 HOH 356 3257 773 HOH HOH B . 
R 8 HOH 357 3258 774 HOH HOH B . 
R 8 HOH 358 3259 776 HOH HOH B . 
R 8 HOH 359 3260 780 HOH HOH B . 
R 8 HOH 360 3261 783 HOH HOH B . 
R 8 HOH 361 3262 785 HOH HOH B . 
R 8 HOH 362 3263 789 HOH HOH B . 
R 8 HOH 363 3264 791 HOH HOH B . 
R 8 HOH 364 3265 793 HOH HOH B . 
R 8 HOH 365 3266 795 HOH HOH B . 
R 8 HOH 366 3267 798 HOH HOH B . 
R 8 HOH 367 3268 799 HOH HOH B . 
R 8 HOH 368 3269 800 HOH HOH B . 
R 8 HOH 369 3270 808 HOH HOH B . 
R 8 HOH 370 3271 809 HOH HOH B . 
R 8 HOH 371 3272 812 HOH HOH B . 
R 8 HOH 372 3273 816 HOH HOH B . 
R 8 HOH 373 3274 817 HOH HOH B . 
R 8 HOH 374 3275 819 HOH HOH B . 
R 8 HOH 375 3276 821 HOH HOH B . 
R 8 HOH 376 3277 822 HOH HOH B . 
R 8 HOH 377 3278 823 HOH HOH B . 
R 8 HOH 378 3279 826 HOH HOH B . 
R 8 HOH 379 3280 828 HOH HOH B . 
R 8 HOH 380 3281 831 HOH HOH B . 
R 8 HOH 381 3282 833 HOH HOH B . 
R 8 HOH 382 3283 835 HOH HOH B . 
R 8 HOH 383 3284 840 HOH HOH B . 
R 8 HOH 384 3285 866 HOH HOH B . 
R 8 HOH 385 3286 872 HOH HOH B . 
R 8 HOH 386 3287 873 HOH HOH B . 
R 8 HOH 387 3288 874 HOH HOH B . 
R 8 HOH 388 3289 880 HOH HOH B . 
R 8 HOH 389 3290 886 HOH HOH B . 
R 8 HOH 390 3291 890 HOH HOH B . 
R 8 HOH 391 3292 891 HOH HOH B . 
R 8 HOH 392 3293 898 HOH HOH B . 
R 8 HOH 393 3294 899 HOH HOH B . 
R 8 HOH 394 3295 900 HOH HOH B . 
R 8 HOH 395 3296 901 HOH HOH B . 
R 8 HOH 396 3297 903 HOH HOH B . 
R 8 HOH 397 3298 906 HOH HOH B . 
R 8 HOH 398 3299 908 HOH HOH B . 
R 8 HOH 399 3300 910 HOH HOH B . 
R 8 HOH 400 3301 912 HOH HOH B . 
R 8 HOH 401 3302 913 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 350 A ASN 350 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 464 A ASN 464 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-07-18 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
5 'Structure model' 2 1 2021-11-10 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' Advisory                    
3  3 'Structure model' 'Version format compliance' 
4  4 'Structure model' Advisory                    
5  4 'Structure model' 'Atomic model'              
6  4 'Structure model' 'Data collection'           
7  4 'Structure model' 'Derived calculations'      
8  4 'Structure model' 'Structure summary'         
9  5 'Structure model' Advisory                    
10 5 'Structure model' 'Database references'       
11 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' entity                        
4  4 'Structure model' pdbx_branch_scheme            
5  4 'Structure model' pdbx_chem_comp_identifier     
6  4 'Structure model' pdbx_entity_branch            
7  4 'Structure model' pdbx_entity_branch_descriptor 
8  4 'Structure model' pdbx_entity_branch_link       
9  4 'Structure model' pdbx_entity_branch_list       
10 4 'Structure model' pdbx_entity_nonpoly           
11 4 'Structure model' pdbx_nonpoly_scheme           
12 4 'Structure model' pdbx_struct_assembly_gen      
13 4 'Structure model' pdbx_unobs_or_zero_occ_atoms  
14 4 'Structure model' struct_asym                   
15 4 'Structure model' struct_conn                   
16 4 'Structure model' struct_site                   
17 4 'Structure model' struct_site_gen               
18 5 'Structure model' chem_comp                     
19 5 'Structure model' database_2                    
20 5 'Structure model' pdbx_unobs_or_zero_occ_atoms  
21 5 'Structure model' struct_ref_seq_dif            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.auth_asym_id'                
2  4 'Structure model' '_atom_site.auth_seq_id'                 
3  4 'Structure model' '_atom_site.label_asym_id'               
4  4 'Structure model' '_atom_site.label_entity_id'             
5  4 'Structure model' '_chem_comp.name'                        
6  4 'Structure model' '_chem_comp.type'                        
7  4 'Structure model' '_entity.formula_weight'                 
8  4 'Structure model' '_entity.pdbx_description'               
9  4 'Structure model' '_entity.pdbx_number_of_molecules'       
10 4 'Structure model' '_entity.type'                           
11 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
12 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'    
13 4 'Structure model' '_struct_conn.pdbx_role'                 
14 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
15 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
16 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
17 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
18 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
19 5 'Structure model' '_chem_comp.pdbx_synonyms'               
20 5 'Structure model' '_database_2.pdbx_DOI'                   
21 5 'Structure model' '_database_2.pdbx_database_accession'    
22 5 'Structure model' '_struct_ref_seq_dif.details'            
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 27.1402 11.5658 16.7145  -.1125 -.1590 -.0414 -.0085 -.0029 .0277  .8529 .6803 1.7687 -.0298 .0344 -.3685 -.0268 
-.0101 -.0401 .0202 .0102  .0028 .1421 -.1099 .0166  'X-RAY DIFFRACTION' 
2 ? refined 7.6473  4.6056  -40.7928 -.0858 -.1061 -.0473 -.0071 -.0191 -.0561 .5858 .7305 2.5085 -.0296 .0029 .4547  .0996  .0448 
-.0432 .0370 -.0872 .0576 .1160 -.0487 -.0124 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 1 A 1 A 542 A 542 ? 'X-RAY DIFFRACTION' ? 
2 2 B 4 B 4 B 543 B 543 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0019 ? 1 
ADSC      'data collection' .        ? 2 
DENZO     'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
# 
_pdbx_entry_details.entry_id                 2HA5 
_pdbx_entry_details.nonpolymer_details       
;AT3(1901) AND ETM(1909) ARE IN ALTERNATE CONFORMATIONS 
OF EACH OTHER.
AT3(1951) AND ETM(1959) ARE IN ALTERNATE CONFORMATIONS 
OF EACH OTHER.
;
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O B HOH 3124 ? ? O B HOH 3292 ? ? 1.99 
2 1 O A HOH 2009 ? ? O A HOH 2355 ? ? 2.14 
3 1 O A HOH 2330 ? ? O B HOH 3266 ? ? 2.14 
4 1 O B HOH 3010 ? ? O B HOH 3273 ? ? 2.15 
5 1 O A HOH 2150 ? ? O A HOH 2312 ? ? 2.16 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLN 
_pdbx_validate_rmsd_bond.auth_seq_id_1             369 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            A 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLN 
_pdbx_validate_rmsd_bond.auth_seq_id_2             369 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            A 
_pdbx_validate_rmsd_bond.bond_value                1.164 
_pdbx_validate_rmsd_bond.bond_target_value         1.521 
_pdbx_validate_rmsd_bond.bond_deviation            -0.357 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.027 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             GLN 
_pdbx_validate_rmsd_angle.auth_seq_id_1              369 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             A 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             GLN 
_pdbx_validate_rmsd_angle.auth_seq_id_2              369 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             A 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             GLN 
_pdbx_validate_rmsd_angle.auth_seq_id_3              369 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             A 
_pdbx_validate_rmsd_angle.angle_value                148.47 
_pdbx_validate_rmsd_angle.angle_target_value         113.40 
_pdbx_validate_rmsd_angle.angle_deviation            35.07 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.20 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 71.95   -4.22   
2  1 ALA A 203 ? ? 59.80   -123.49 
3  1 ASP A 306 ? ? -133.99 -88.52  
4  1 VAL A 407 ? ? -127.16 -60.97  
5  1 ASP A 494 ? ? -66.83  89.42   
6  1 SER A 541 ? ? -61.98  76.05   
7  1 PHE B 47  ? ? 71.89   -1.82   
8  1 ALA B 62  ? ? -116.86 52.05   
9  1 ALA B 167 ? ? -151.25 67.66   
10 1 ALA B 203 ? ? 56.59   -123.60 
11 1 ASP B 306 ? ? -131.48 -83.46  
12 1 VAL B 407 ? ? -126.30 -57.65  
13 1 ASP B 494 ? ? 103.21  106.46  
14 1 SER B 495 ? ? -74.57  -130.58 
15 1 LYS B 496 ? ? 68.79   113.78  
16 1 ALA B 542 ? ? -109.38 -72.71  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A GLN 369 ? CB  A A GLN 369 CB  
2  1 Y 1 A LYS 496 ? CG  ? A LYS 496 CG  
3  1 Y 1 A LYS 496 ? CD  ? A LYS 496 CD  
4  1 Y 1 A LYS 496 ? CE  ? A LYS 496 CE  
5  1 Y 1 A LYS 496 ? NZ  ? A LYS 496 NZ  
6  1 Y 1 B ARG 493 ? CG  ? B ARG 493 CG  
7  1 Y 1 B ARG 493 ? CD  ? B ARG 493 CD  
8  1 Y 1 B ARG 493 ? NE  ? B ARG 493 NE  
9  1 Y 1 B ARG 493 ? CZ  ? B ARG 493 CZ  
10 1 Y 1 B ARG 493 ? NH1 ? B ARG 493 NH1 
11 1 Y 1 B ARG 493 ? NH2 ? B ARG 493 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 258 ? A PRO 258 
2  1 Y 1 A PRO 259 ? A PRO 259 
3  1 Y 1 A GLY 260 ? A GLY 260 
4  1 Y 1 A GLY 261 ? A GLY 261 
5  1 Y 1 A ALA 262 ? A ALA 262 
6  1 Y 1 A GLY 263 ? A GLY 263 
7  1 Y 1 A GLY 264 ? A GLY 264 
8  1 Y 1 A THR 543 ? A THR 543 
9  1 Y 1 B GLU 1   ? B GLU 1   
10 1 Y 1 B GLY 2   ? B GLY 2   
11 1 Y 1 B ARG 3   ? B ARG 3   
12 1 Y 1 B PRO 258 ? B PRO 258 
13 1 Y 1 B PRO 259 ? B PRO 259 
14 1 Y 1 B GLY 260 ? B GLY 260 
15 1 Y 1 B GLY 261 ? B GLY 261 
16 1 Y 1 B ALA 262 ? B ALA 262 
17 1 Y 1 B GLY 263 ? B GLY 263 
18 1 Y 1 B GLY 264 ? B GLY 264 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 W NAG 501 n 
C 2 FUC 2 C FUC 2 W FUC 502 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 LFucpa1-6DGlcpNAcb1-                                                 'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,2,1/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-2/a6-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(6+1)][a-L-Fucp]{}}}'                      LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  FUC 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O6 
_pdbx_entity_branch_link.leaving_atom_id_2          HO6 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 FUC 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
4 'ACETATE ION'                            ACT 
5 ACETYLTHIOCHOLINE                        AT3 
6 '2-(TRIMETHYLAMMONIUM)ETHYL THIOL'       ETM 
7 'HEXAETHYLENE GLYCOL'                    P6G 
8 water                                    HOH 
#