data_2HA7
# 
_entry.id   2HA7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2HA7         pdb_00002ha7 10.2210/pdb2ha7/pdb 
RCSB  RCSB038123   ?            ?                   
WWPDB D_1000038123 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1J06 'apo mACHE' unspecified 
PDB 2H9Y .           unspecified 
PDB 2HA0 .           unspecified 
PDB 2HA2 .           unspecified 
PDB 2HA3 .           unspecified 
PDB 2HA4 .           unspecified 
PDB 2HA5 .           unspecified 
PDB 2HA6 .           unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HA7 
_pdbx_database_status.recvd_initial_deposition_date   2006-06-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bourne, Y.'       1 
'Radic, Z.'        2 
'Sulzenbacher, G.' 3 
'Kim, E.'          4 
'Taylor, P.'       5 
'Marchot, P.'      6 
# 
_citation.id                        primary 
_citation.title                     
;Substrate and product trafficking through the active center gorge of acetylcholinesterase analyzed by crystallography and equilibrium binding
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                29256 
_citation.page_last                 29267 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16837465 
_citation.pdbx_database_id_DOI      10.1074/jbc.M603018200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bourne, Y.'       1 ? 
primary 'Radic, Z.'        2 ? 
primary 'Sulzenbacher, G.' 3 ? 
primary 'Kim, E.'          4 ? 
primary 'Taylor, P.'       5 ? 
primary 'Marchot, P.'      6 ? 
# 
_cell.entry_id           2HA7 
_cell.length_a           79.325 
_cell.length_b           111.115 
_cell.length_c           228.651 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HA7 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase                              59748.488 2   3.1.1.7 S203A 'catalytic domain' ? 
2 non-polymer syn 'IODIDE ION'                                      126.904   9   ?       ?     ?                  ? 
3 non-polymer syn '2-(TRIMETHYLAMMONIUM)ETHYL THIOL'                120.236   2   ?       ?     ?                  ? 
4 non-polymer syn 'butanoic acid'                                   88.105    2   ?       ?     ?                  ? 
5 non-polymer syn '2-(BUTYRYLSULFANYL)-N,N,N-TRIMETHYLETHANAMINIUM' 190.326   2   ?       ?     ?                  ? 
6 non-polymer syn 'HEXAETHYLENE GLYCOL'                             282.331   1   ?       ?     ?                  ? 
7 water       nat water                                             18.015    234 ?       ?     ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGEAAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGEAAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 ALA n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     Homo 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              'LAMBDA ZAP' 
_entity_src_gen.pdbx_host_org_cell_line            'HEK 293' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 'HUMAN EMBRYONIC KIDNEY CELLS (HEK)' 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           32 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2HA7 A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 2HA7 B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2HA7 ALA A 203 ? UNP P21836 SER 234 'engineered mutation' 203 1 
2 2HA7 ALA B 203 ? UNP P21836 SER 234 'engineered mutation' 203 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                           ?                            'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                          ?                            'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                        ?                            'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                   ?                            'C4 H7 N O4'     133.103 
BCH non-polymer         . '2-(BUTYRYLSULFANYL)-N,N,N-TRIMETHYLETHANAMINIUM' BUTYRYLTHIOCHOLINE           'C9 H20 N O S 1' 190.326 
BUA non-polymer         . 'butanoic acid'                                   ?                            'C4 H8 O2'       88.105  
CYS 'L-peptide linking' y CYSTEINE                                          ?                            'C3 H7 N O2 S'   121.158 
ETM non-polymer         . '2-(TRIMETHYLAMMONIUM)ETHYL THIOL'                ?                            'C5 H14 N S 1'   120.236 
GLN 'L-peptide linking' y GLUTAMINE                                         ?                            'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                   ?                            'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                           ?                            'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                         ?                            'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                             ?                            'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                        ?                            'C6 H13 N O2'    131.173 
IOD non-polymer         . 'IODIDE ION'                                      ?                            'I -1'           126.904 
LEU 'L-peptide linking' y LEUCINE                                           ?                            'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                            ?                            'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                        ?                            'C5 H11 N O2 S'  149.211 
P6G non-polymer         . 'HEXAETHYLENE GLYCOL'                             'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7'     282.331 
PHE 'L-peptide linking' y PHENYLALANINE                                     ?                            'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                           ?                            'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                            ?                            'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                         ?                            'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                        ?                            'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                          ?                            'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                            ?                            'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2HA7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.21 
_exptl_crystal.density_percent_sol   70.81 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    
'25-32% PEG550 MME or PEG600, 60-100mM HEPES or Na acetate, pH 6.5-8.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2004-06-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.933 
# 
_reflns.entry_id                     2HA7 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.65 
_reflns.d_resolution_low             20 
_reflns.number_all                   ? 
_reflns.number_obs                   57849 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.068 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.0 
_reflns.B_iso_Wilson_estimate        49.2 
_reflns.pdbx_redundancy              4.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.65 
_reflns_shell.d_res_low              2.75 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.467 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.0 
_reflns_shell.pdbx_redundancy        4.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2HA7 
_refine.ls_number_reflns_obs                     57514 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.66 
_refine.ls_percent_reflns_obs                    99.85 
_refine.ls_R_factor_obs                          0.2005 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19964 
_refine.ls_R_factor_R_free                       0.24141 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1202 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               .942 
_refine.correlation_coeff_Fo_to_Fc_free          .915 
_refine.B_iso_mean                               55.794 
_refine.aniso_B[1][1]                            3.20 
_refine.aniso_B[2][2]                            3.60 
_refine.aniso_B[3][3]                            -6.80 
_refine.aniso_B[1][2]                            .00 
_refine.aniso_B[1][3]                            .00 
_refine.aniso_B[2][3]                            .00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             .80 
_refine.pdbx_solvent_shrinkage_radii             .80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1J06 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       .329 
_refine.pdbx_overall_ESU_R_Free                  .251 
_refine.overall_SU_ML                            .184 
_refine.overall_SU_B                             16.740 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8348 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         78 
_refine_hist.number_atoms_solvent             234 
_refine_hist.number_atoms_total               8660 
_refine_hist.d_res_high                       2.66 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             .010   .022   ? 8665  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.232  1.963  ? 11835 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.856  5.000  ? 1066  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.737 22.861 ? 395   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.789 15.000 ? 1253  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       21.225 15.000 ? 72    'X-RAY DIFFRACTION' ? 
r_chiral_restr               .087   .200   ? 1270  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         .004   .020   ? 6802  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                .202   .200   ? 3758  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              .306   .200   ? 5882  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        .130   .200   ? 292   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       .228   .200   ? 53    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     .080   .200   ? 12    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  .456   1.500  ? 5372  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 .839   2.000  ? 8610  'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.262  3.000  ? 3676  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.171  4.500  ? 3225  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1960 .11  .50   'medium positional' 1 'X-RAY DIFFRACTION' 1 ? ? ? 
1 A 1884 .38  5.00  'loose positional'  1 'X-RAY DIFFRACTION' 2 ? ? ? 
1 A 1960 .45  2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 3 ? ? ? 
1 A 1884 1.29 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 4 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.657 
_refine_ls_shell.d_res_low                        2.725 
_refine_ls_shell.number_reflns_R_work             4021 
_refine_ls_shell.R_factor_R_work                  0.26 
_refine_ls_shell.percent_reflns_obs               99.76 
_refine_ls_shell.R_factor_R_free                  0.302 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             76 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1  A 
1 2  B 
1 3  A 
1 4  B 
1 5  A 
1 6  B 
1 7  A 
1 8  B 
1 9  A 
1 10 B 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1  A 16  A 56  1 5 A GLN 16  ? A TRP 56  ? 1 ? 
2  B 16  B 56  1 5 B GLN 16  ? B TRP 56  ? 1 ? 
3  A 60  A 74  2 5 A LEU 60  ? A ASP 74  ? 1 ? 
4  B 60  B 74  2 5 B LEU 60  ? B ASP 74  ? 1 ? 
5  A 80  A 255 3 5 A PHE 80  ? A VAL 255 ? 1 ? 
6  B 80  B 255 3 5 B PHE 80  ? B VAL 255 ? 1 ? 
7  A 265 A 490 4 5 A ASN 265 ? A ASN 490 ? 1 ? 
8  B 265 B 490 4 5 B ASN 265 ? B ASN 490 ? 1 ? 
9  A 508 A 539 5 5 A GLN 508 ? A LEU 539 ? 1 ? 
10 B 508 B 539 5 5 B GLN 508 ? B LEU 539 ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2HA7 
_struct.title                     
'Crystal structure of mutant S203A of mouse acetylcholinesterase complexed with butyrylthiocholine' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HA7 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'HYDROLASE FOLD, SERINE ESTERASE, ACETYLCHOLINESTERASE, MUTANT, HOMODIMER, GLYCOSYLATED PROTEIN, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 2 ? 
M N N 2 ? 
N N N 2 ? 
O N N 2 ? 
P N N 2 ? 
Q N N 3 ? 
R N N 4 ? 
S N N 7 ? 
T N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLU A 142 ? GLY A 135 GLU A 142 1 ? 8  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  ALA A 203 ? SER A 215 ? ALA A 203 SER A 215 1 ? 13 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 ALA A 241 ? VAL A 255 ? ALA A 241 VAL A 255 1 ? 15 
HELX_P HELX_P12 12 ASN A 265 ? THR A 275 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P13 13 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 TRP A 286 ? LEU A 289 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 15 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 GLY A 335 ? VAL A 340 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASN A 464 ? GLY A 456 ASN A 464 5 ? 9  
HELX_P HELX_P24 24 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 25 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 26 ARG A 534 ? SER A 541 ? ARG A 534 SER A 541 1 ? 8  
HELX_P HELX_P27 27 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P28 28 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 29 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 30 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 31 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P32 32 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 33 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P34 34 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 35 ALA B 203 ? LEU B 214 ? ALA B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 36 SER B 215 ? PHE B 222 ? SER B 215 PHE B 222 5 ? 8  
HELX_P HELX_P37 37 ALA B 241 ? VAL B 255 ? ALA B 241 VAL B 255 1 ? 15 
HELX_P HELX_P38 38 ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P39 39 PRO B 277 ? GLU B 285 ? PRO B 277 GLU B 285 1 ? 9  
HELX_P HELX_P40 40 TRP B 286 ? LEU B 289 ? TRP B 286 LEU B 289 5 ? 4  
HELX_P HELX_P41 41 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 42 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 43 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 44 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 45 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 46 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 47 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 48 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 49 GLY B 456 ? ASN B 464 ? GLY B 456 ASN B 464 5 ? 9  
HELX_P HELX_P50 50 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 51 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 52 ARG B 534 ? SER B 541 ? ARG B 534 SER B 541 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 69  SG ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.051 ? ? 
disulf2 disulf ? ? A CYS 257 SG ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.114 ? ? 
disulf3 disulf ? ? A CYS 409 SG ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.053 ? ? 
disulf4 disulf ? ? B CYS 69  SG ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.073 ? ? 
disulf5 disulf ? ? B CYS 257 SG ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.081 ? ? 
disulf6 disulf ? ? B CYS 409 SG ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.073 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -4.26 
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 -1.65 
3 CYS 257 B . ? CYS 257 B PRO 258 B ? PRO 258 B 1 3.52  
4 SER 497 B . ? SER 497 B PRO 498 B ? PRO 498 B 1 13.49 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 2  ? 
D ? 2  ? 
E ? 3  ? 
F ? 11 ? 
G ? 2  ? 
H ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
C 1  2  ? parallel      
D 1  2  ? parallel      
E 1  2  ? anti-parallel 
E 2  3  ? parallel      
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
F 3  4  ? anti-parallel 
F 4  5  ? parallel      
F 5  6  ? parallel      
F 6  7  ? parallel      
F 7  8  ? parallel      
F 8  9  ? parallel      
F 9  10 ? parallel      
F 10 11 ? anti-parallel 
G 1  2  ? parallel      
H 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
A 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
A 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
B 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
B 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
B 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
B 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
B 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
B 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
B 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
B 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
B 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
B 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
B 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
C 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
C 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
D 1  VAL A 239 ? SER A 240 ? VAL A 239 SER A 240 
D 2  VAL A 302 ? VAL A 303 ? VAL A 302 VAL A 303 
E 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
E 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
E 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
F 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
F 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
F 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
F 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
F 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
F 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
F 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
F 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
F 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
F 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
F 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
G 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
G 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
H 1  VAL B 239 ? SER B 240 ? VAL B 239 SER B 240 
H 2  VAL B 302 ? VAL B 303 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
A 2  3  N GLN A 16  ? N GLN A 16  O LEU A 60  ? O LEU A 60  
B 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
B 2  3  N SER A 30  ? N SER A 30  O THR A 103 ? O THR A 103 
B 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
B 4  5  O VAL A 147 ? O VAL A 147 N TRP A 117 ? N TRP A 117 
B 5  6  N VAL A 114 ? N VAL A 114 O SER A 196 ? O SER A 196 
B 6  7  N GLY A 201 ? N GLY A 201 O GLN A 228 ? O GLN A 228 
B 7  8  N LEU A 227 ? N LEU A 227 O LEU A 327 ? O LEU A 327 
B 8  9  N VAL A 328 ? N VAL A 328 O TYR A 426 ? O TYR A 426 
B 9  10 N ILE A 429 ? N ILE A 429 O LEU A 513 ? O LEU A 513 
B 10 11 N TYR A 510 ? N TYR A 510 O ARG A 521 ? O ARG A 521 
C 1  2  N VAL A 68  ? N VAL A 68  O SER A 93  ? O SER A 93  
D 1  2  N VAL A 239 ? N VAL A 239 O VAL A 303 ? O VAL A 303 
E 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
E 2  3  N GLN B 16  ? N GLN B 16  O LEU B 60  ? O LEU B 60  
F 1  2  N ILE B 20  ? N ILE B 20  O ALA B 31  ? O ALA B 31  
F 2  3  N PHE B 32  ? N PHE B 32  O VAL B 101 ? O VAL B 101 
F 3  4  N ASN B 100 ? N ASN B 100 O SER B 148 ? O SER B 148 
F 4  5  O VAL B 147 ? O VAL B 147 N TRP B 117 ? N TRP B 117 
F 5  6  N VAL B 114 ? N VAL B 114 O THR B 198 ? O THR B 198 
F 6  7  N GLY B 201 ? N GLY B 201 O GLN B 228 ? O GLN B 228 
F 7  8  N LEU B 227 ? N LEU B 227 O LEU B 327 ? O LEU B 327 
F 8  9  N VAL B 328 ? N VAL B 328 O TYR B 426 ? O TYR B 426 
F 9  10 N ILE B 429 ? N ILE B 429 O LEU B 513 ? O LEU B 513 
F 10 11 N TYR B 510 ? N TYR B 510 O ARG B 521 ? O ARG B 521 
G 1  2  N VAL B 68  ? N VAL B 68  O SER B 93  ? O SER B 93  
H 1  2  N VAL B 239 ? N VAL B 239 O VAL B 303 ? O VAL B 303 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A IOD 900 ? 2  'BINDING SITE FOR RESIDUE IOD A 900' 
AC2 Software A IOD 902 ? 1  'BINDING SITE FOR RESIDUE IOD A 902' 
AC3 Software A IOD 903 ? 3  'BINDING SITE FOR RESIDUE IOD A 903' 
AC4 Software B IOD 904 ? 1  'BINDING SITE FOR RESIDUE IOD B 904' 
AC5 Software B IOD 905 ? 1  'BINDING SITE FOR RESIDUE IOD B 905' 
AC6 Software B IOD 906 ? 1  'BINDING SITE FOR RESIDUE IOD B 906' 
AC7 Software A IOD 907 ? 2  'BINDING SITE FOR RESIDUE IOD A 907' 
AC8 Software B IOD 908 ? 2  'BINDING SITE FOR RESIDUE IOD B 908' 
AC9 Software B IOD 909 ? 1  'BINDING SITE FOR RESIDUE IOD B 909' 
BC1 Software A ETM 908 ? 8  'BINDING SITE FOR RESIDUE ETM A 908' 
BC2 Software A BUA 909 ? 7  'BINDING SITE FOR RESIDUE BUA A 909' 
BC3 Software A BCH 910 ? 6  'BINDING SITE FOR RESIDUE BCH A 910' 
BC4 Software B ETM 602 ? 7  'BINDING SITE FOR RESIDUE ETM B 602' 
BC5 Software B BUA 603 ? 7  'BINDING SITE FOR RESIDUE BUA B 603' 
BC6 Software A BCH 601 ? 2  'BINDING SITE FOR RESIDUE BCH A 601' 
BC7 Software A P6G 901 ? 10 'BINDING SITE FOR RESIDUE P6G A 901' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2  PHE A 295 ? PHE A 295  . ? 1_555 ? 
2  AC1 2  BCH I .   ? BCH A 910  . ? 1_555 ? 
3  AC2 1  ARG A 245 ? ARG A 245  . ? 1_555 ? 
4  AC3 3  PRO A 290 ? PRO A 290  . ? 1_555 ? 
5  AC3 3  GLN A 291 ? GLN A 291  . ? 1_555 ? 
6  AC3 3  SER A 293 ? SER A 293  . ? 1_555 ? 
7  AC4 1  ARG B 245 ? ARG B 245  . ? 1_555 ? 
8  AC5 1  SER B 293 ? SER B 293  . ? 1_555 ? 
9  AC6 1  LYS B 332 ? LYS B 332  . ? 1_555 ? 
10 AC7 2  VAL A 255 ? VAL A 255  . ? 1_555 ? 
11 AC7 2  ASP A 280 ? ASP A 280  . ? 1_555 ? 
12 AC8 2  LYS B 53  ? LYS B 53   . ? 1_555 ? 
13 AC8 2  HOH T .   ? HOH B 966  . ? 1_555 ? 
14 AC9 1  PHE B 295 ? PHE B 295  . ? 1_555 ? 
15 BC1 8  TRP A 86  ? TRP A 86   . ? 1_555 ? 
16 BC1 8  GLY A 120 ? GLY A 120  . ? 1_555 ? 
17 BC1 8  GLY A 121 ? GLY A 121  . ? 1_555 ? 
18 BC1 8  GLU A 202 ? GLU A 202  . ? 1_555 ? 
19 BC1 8  TYR A 337 ? TYR A 337  . ? 1_555 ? 
20 BC1 8  HIS A 447 ? HIS A 447  . ? 1_555 ? 
21 BC1 8  BUA H .   ? BUA A 909  . ? 1_555 ? 
22 BC1 8  HOH S .   ? HOH A 1001 . ? 1_555 ? 
23 BC2 7  GLY A 121 ? GLY A 121  . ? 1_555 ? 
24 BC2 7  GLY A 122 ? GLY A 122  . ? 1_555 ? 
25 BC2 7  TYR A 124 ? TYR A 124  . ? 1_555 ? 
26 BC2 7  ALA A 203 ? ALA A 203  . ? 1_555 ? 
27 BC2 7  ALA A 204 ? ALA A 204  . ? 1_555 ? 
28 BC2 7  HIS A 447 ? HIS A 447  . ? 1_555 ? 
29 BC2 7  ETM G .   ? ETM A 908  . ? 1_555 ? 
30 BC3 6  TYR A 72  ? TYR A 72   . ? 1_555 ? 
31 BC3 6  TYR A 124 ? TYR A 124  . ? 1_555 ? 
32 BC3 6  TRP A 286 ? TRP A 286  . ? 1_555 ? 
33 BC3 6  TYR A 337 ? TYR A 337  . ? 1_555 ? 
34 BC3 6  TYR A 341 ? TYR A 341  . ? 1_555 ? 
35 BC3 6  IOD C .   ? IOD A 900  . ? 1_555 ? 
36 BC4 7  TRP B 86  ? TRP B 86   . ? 1_555 ? 
37 BC4 7  GLY B 120 ? GLY B 120  . ? 1_555 ? 
38 BC4 7  GLY B 121 ? GLY B 121  . ? 1_555 ? 
39 BC4 7  GLU B 202 ? GLU B 202  . ? 1_555 ? 
40 BC4 7  TYR B 337 ? TYR B 337  . ? 1_555 ? 
41 BC4 7  HIS B 447 ? HIS B 447  . ? 1_555 ? 
42 BC4 7  BUA R .   ? BUA B 603  . ? 1_555 ? 
43 BC5 7  GLY B 121 ? GLY B 121  . ? 1_555 ? 
44 BC5 7  GLY B 122 ? GLY B 122  . ? 1_555 ? 
45 BC5 7  TYR B 124 ? TYR B 124  . ? 1_555 ? 
46 BC5 7  ALA B 203 ? ALA B 203  . ? 1_555 ? 
47 BC5 7  ALA B 204 ? ALA B 204  . ? 1_555 ? 
48 BC5 7  HIS B 447 ? HIS B 447  . ? 1_555 ? 
49 BC5 7  ETM Q .   ? ETM B 602  . ? 1_555 ? 
50 BC6 2  ASP A 396 ? ASP A 396  . ? 1_555 ? 
51 BC6 2  TRP A 442 ? TRP A 442  . ? 1_555 ? 
52 BC7 10 LEU A 380 ? LEU A 380  . ? 1_555 ? 
53 BC7 10 HIS A 381 ? HIS A 381  . ? 1_555 ? 
54 BC7 10 GLN A 527 ? GLN A 527  . ? 1_555 ? 
55 BC7 10 PHE A 535 ? PHE A 535  . ? 1_555 ? 
56 BC7 10 HOH S .   ? HOH A 913  . ? 1_555 ? 
57 BC7 10 ALA B 377 ? ALA B 377  . ? 4_455 ? 
58 BC7 10 LEU B 380 ? LEU B 380  . ? 4_455 ? 
59 BC7 10 HIS B 381 ? HIS B 381  . ? 4_455 ? 
60 BC7 10 PHE B 531 ? PHE B 531  . ? 4_455 ? 
61 BC7 10 PHE B 535 ? PHE B 535  . ? 4_455 ? 
# 
_database_PDB_matrix.entry_id          2HA7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HA7 
_atom_sites.fract_transf_matrix[1][1]   .012606 
_atom_sites.fract_transf_matrix[1][2]   .000000 
_atom_sites.fract_transf_matrix[1][3]   .000000 
_atom_sites.fract_transf_matrix[2][1]   .000000 
_atom_sites.fract_transf_matrix[2][2]   .009000 
_atom_sites.fract_transf_matrix[2][3]   .000000 
_atom_sites.fract_transf_matrix[3][1]   .000000 
_atom_sites.fract_transf_matrix[3][2]   .000000 
_atom_sites.fract_transf_matrix[3][3]   .004373 
_atom_sites.fract_transf_vector[1]      .00000 
_atom_sites.fract_transf_vector[2]      .00000 
_atom_sites.fract_transf_vector[3]      .00000 
# 
loop_
_atom_type.symbol 
C 
I 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 29.362 18.399  60.503  1.00 90.24  ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 30.020 18.222  59.169  1.00 88.29  ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 29.362 17.128  58.313  1.00 85.87  ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 29.700 16.957  57.123  1.00 84.32  ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 31.527 17.975  59.323  1.00 88.95  ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 31.902 16.825  60.274  1.00 91.80  ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 33.387 16.828  60.650  1.00 94.76  ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 34.234 17.168  59.779  1.00 93.72  ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 33.699 16.483  61.819  1.00 96.08  ? 1    GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 28.429 16.394  58.925  1.00 85.29  ? 2    GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 27.554 15.482  58.193  1.00 82.29  ? 2    GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 26.222 16.156  57.970  1.00 81.26  ? 2    GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 25.184 15.587  58.281  1.00 81.58  ? 2    GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 26.272 17.383  57.440  1.00 80.24  ? 3    ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 25.090 18.227  57.177  1.00 79.57  ? 3    ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 24.723 18.340  55.693  1.00 77.24  ? 3    ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 23.811 19.085  55.342  1.00 77.43  ? 3    ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 25.267 19.640  57.759  1.00 80.71  ? 3    ARG A CB  1 
ATOM   19   C CG  . ARG A 1 3   ? 24.622 19.867  59.142  1.00 83.05  ? 3    ARG A CG  1 
ATOM   20   C CD  . ARG A 1 3   ? 25.625 19.653  60.304  1.00 83.95  ? 3    ARG A CD  1 
ATOM   21   N NE  . ARG A 1 3   ? 25.129 20.016  61.644  1.00 84.81  ? 3    ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 3   ? 23.914 19.750  62.134  1.00 84.42  ? 3    ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 3   ? 23.002 19.094  61.426  1.00 82.92  ? 3    ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 3   ? 23.613 20.136  63.359  1.00 85.29  ? 3    ARG A NH2 1 
ATOM   25   N N   . GLU A 1 4   ? 25.421 17.609  54.828  1.00 74.73  ? 4    GLU A N   1 
ATOM   26   C CA  . GLU A 1 4   ? 25.097 17.628  53.403  1.00 72.54  ? 4    GLU A CA  1 
ATOM   27   C C   . GLU A 1 4   ? 24.063 16.593  53.001  1.00 71.19  ? 4    GLU A C   1 
ATOM   28   O O   . GLU A 1 4   ? 23.749 15.698  53.777  1.00 72.19  ? 4    GLU A O   1 
ATOM   29   C CB  . GLU A 1 4   ? 26.341 17.513  52.529  1.00 71.44  ? 4    GLU A CB  1 
ATOM   30   C CG  . GLU A 1 4   ? 27.387 16.550  53.010  1.00 72.37  ? 4    GLU A CG  1 
ATOM   31   C CD  . GLU A 1 4   ? 28.676 16.748  52.262  1.00 72.75  ? 4    GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 4   ? 28.611 16.996  51.033  1.00 72.54  ? 4    GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 4   ? 29.747 16.670  52.897  1.00 73.55  ? 4    GLU A OE2 1 
ATOM   34   N N   . ASP A 1 5   ? 23.539 16.731  51.785  1.00 68.78  ? 5    ASP A N   1 
ATOM   35   C CA  . ASP A 1 5   ? 22.405 15.942  51.336  1.00 67.58  ? 5    ASP A CA  1 
ATOM   36   C C   . ASP A 1 5   ? 22.786 14.467  51.169  1.00 66.50  ? 5    ASP A C   1 
ATOM   37   O O   . ASP A 1 5   ? 23.526 14.110  50.251  1.00 65.20  ? 5    ASP A O   1 
ATOM   38   C CB  . ASP A 1 5   ? 21.832 16.538  50.045  1.00 66.33  ? 5    ASP A CB  1 
ATOM   39   C CG  . ASP A 1 5   ? 20.572 15.817  49.556  1.00 66.15  ? 5    ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 5   ? 20.259 14.714  50.047  1.00 66.43  ? 5    ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 5   ? 19.890 16.359  48.660  1.00 65.32  ? 5    ASP A OD2 1 
ATOM   42   N N   . PRO A 1 6   ? 22.263 13.597  52.053  1.00 67.23  ? 6    PRO A N   1 
ATOM   43   C CA  . PRO A 1 6   ? 22.601 12.161  52.048  1.00 66.24  ? 6    PRO A CA  1 
ATOM   44   C C   . PRO A 1 6   ? 22.463 11.476  50.684  1.00 63.97  ? 6    PRO A C   1 
ATOM   45   O O   . PRO A 1 6   ? 23.128 10.465  50.438  1.00 63.40  ? 6    PRO A O   1 
ATOM   46   C CB  . PRO A 1 6   ? 21.601 11.555  53.047  1.00 67.79  ? 6    PRO A CB  1 
ATOM   47   C CG  . PRO A 1 6   ? 20.577 12.613  53.289  1.00 69.00  ? 6    PRO A CG  1 
ATOM   48   C CD  . PRO A 1 6   ? 21.292 13.913  53.115  1.00 68.91  ? 6    PRO A CD  1 
ATOM   49   N N   . GLN A 1 7   ? 21.627 12.031  49.807  1.00 62.33  ? 7    GLN A N   1 
ATOM   50   C CA  . GLN A 1 7   ? 21.363 11.426  48.504  1.00 60.16  ? 7    GLN A CA  1 
ATOM   51   C C   . GLN A 1 7   ? 22.387 11.821  47.432  1.00 57.25  ? 7    GLN A C   1 
ATOM   52   O O   . GLN A 1 7   ? 22.343 11.326  46.308  1.00 56.36  ? 7    GLN A O   1 
ATOM   53   C CB  . GLN A 1 7   ? 19.939 11.764  48.051  1.00 61.08  ? 7    GLN A CB  1 
ATOM   54   C CG  . GLN A 1 7   ? 19.327 10.777  47.027  1.00 62.66  ? 7    GLN A CG  1 
ATOM   55   C CD  . GLN A 1 7   ? 18.904 9.434   47.624  1.00 66.13  ? 7    GLN A CD  1 
ATOM   56   O OE1 . GLN A 1 7   ? 18.904 8.421   46.928  1.00 66.72  ? 7    GLN A OE1 1 
ATOM   57   N NE2 . GLN A 1 7   ? 18.529 9.426   48.913  1.00 68.78  ? 7    GLN A NE2 1 
ATOM   58   N N   . LEU A 1 8   ? 23.321 12.701  47.772  1.00 55.63  ? 8    LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? 24.322 13.135  46.795  1.00 52.60  ? 8    LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? 25.723 12.551  47.039  1.00 51.61  ? 8    LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? 26.679 12.885  46.329  1.00 50.56  ? 8    LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? 24.348 14.659  46.689  1.00 52.29  ? 8    LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? 22.988 15.264  46.311  1.00 52.27  ? 8    LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? 22.915 16.750  46.608  1.00 52.41  ? 8    LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? 22.665 14.984  44.854  1.00 50.51  ? 8    LEU A CD2 1 
ATOM   66   N N   . LEU A 1 9   ? 25.834 11.662  48.020  1.00 51.28  ? 9    LEU A N   1 
ATOM   67   C CA  . LEU A 1 9   ? 27.119 11.063  48.341  1.00 50.58  ? 9    LEU A CA  1 
ATOM   68   C C   . LEU A 1 9   ? 27.188 9.622   47.855  1.00 49.37  ? 9    LEU A C   1 
ATOM   69   O O   . LEU A 1 9   ? 26.485 8.770   48.373  1.00 50.15  ? 9    LEU A O   1 
ATOM   70   C CB  . LEU A 1 9   ? 27.390 11.165  49.847  1.00 51.96  ? 9    LEU A CB  1 
ATOM   71   C CG  . LEU A 1 9   ? 27.277 12.574  50.450  1.00 52.37  ? 9    LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 9   ? 27.352 12.571  51.993  1.00 52.87  ? 9    LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 9   ? 28.328 13.517  49.841  1.00 52.27  ? 9    LEU A CD2 1 
ATOM   74   N N   . VAL A 1 10  ? 28.015 9.371   46.843  1.00 47.57  ? 10   VAL A N   1 
ATOM   75   C CA  . VAL A 1 10  ? 28.144 8.048   46.225  1.00 47.21  ? 10   VAL A CA  1 
ATOM   76   C C   . VAL A 1 10  ? 29.627 7.676   46.080  1.00 47.20  ? 10   VAL A C   1 
ATOM   77   O O   . VAL A 1 10  ? 30.470 8.551   45.841  1.00 47.19  ? 10   VAL A O   1 
ATOM   78   C CB  . VAL A 1 10  ? 27.421 8.000   44.827  1.00 46.21  ? 10   VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 10  ? 27.829 6.769   44.005  1.00 46.21  ? 10   VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 10  ? 25.912 8.001   44.995  1.00 46.11  ? 10   VAL A CG2 1 
ATOM   81   N N   . ARG A 1 11  ? 29.939 6.386   46.222  1.00 47.46  ? 11   ARG A N   1 
ATOM   82   C CA  . ARG A 1 11  ? 31.299 5.868   46.039  1.00 47.03  ? 11   ARG A CA  1 
ATOM   83   C C   . ARG A 1 11  ? 31.446 5.107   44.728  1.00 46.39  ? 11   ARG A C   1 
ATOM   84   O O   . ARG A 1 11  ? 30.600 4.289   44.391  1.00 46.92  ? 11   ARG A O   1 
ATOM   85   C CB  . ARG A 1 11  ? 31.673 4.945   47.186  1.00 48.27  ? 11   ARG A CB  1 
ATOM   86   C CG  . ARG A 1 11  ? 33.025 4.278   47.005  1.00 48.64  ? 11   ARG A CG  1 
ATOM   87   C CD  . ARG A 1 11  ? 33.441 3.455   48.218  1.00 49.80  ? 11   ARG A CD  1 
ATOM   88   N NE  . ARG A 1 11  ? 33.908 4.261   49.358  1.00 50.91  ? 11   ARG A NE  1 
ATOM   89   C CZ  . ARG A 1 11  ? 35.129 4.782   49.479  1.00 51.25  ? 11   ARG A CZ  1 
ATOM   90   N NH1 . ARG A 1 11  ? 35.451 5.477   50.566  1.00 51.06  ? 11   ARG A NH1 1 
ATOM   91   N NH2 . ARG A 1 11  ? 36.029 4.623   48.514  1.00 51.07  ? 11   ARG A NH2 1 
ATOM   92   N N   . VAL A 1 12  ? 32.523 5.383   43.995  1.00 45.92  ? 12   VAL A N   1 
ATOM   93   C CA  . VAL A 1 12  ? 32.883 4.605   42.798  1.00 45.27  ? 12   VAL A CA  1 
ATOM   94   C C   . VAL A 1 12  ? 34.254 3.916   42.970  1.00 45.93  ? 12   VAL A C   1 
ATOM   95   O O   . VAL A 1 12  ? 34.911 4.106   43.996  1.00 46.76  ? 12   VAL A O   1 
ATOM   96   C CB  . VAL A 1 12  ? 32.824 5.460   41.519  1.00 43.86  ? 12   VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 12  ? 31.388 5.871   41.244  1.00 44.14  ? 12   VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 12  ? 33.719 6.689   41.629  1.00 43.07  ? 12   VAL A CG2 1 
ATOM   99   N N   . ARG A 1 13  ? 34.674 3.116   41.988  1.00 45.69  ? 13   ARG A N   1 
ATOM   100  C CA  . ARG A 1 13  ? 35.974 2.410   42.057  1.00 47.03  ? 13   ARG A CA  1 
ATOM   101  C C   . ARG A 1 13  ? 37.140 3.322   42.435  1.00 47.59  ? 13   ARG A C   1 
ATOM   102  O O   . ARG A 1 13  ? 38.091 2.890   43.078  1.00 48.76  ? 13   ARG A O   1 
ATOM   103  C CB  . ARG A 1 13  ? 36.297 1.714   40.729  1.00 46.36  ? 13   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 13  ? 37.661 1.016   40.706  1.00 47.92  ? 13   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 13  ? 37.721 -0.117  41.747  1.00 49.39  ? 13   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 13  ? 39.013 -0.795  41.848  1.00 50.41  ? 13   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 13  ? 40.061 -0.345  42.541  1.00 52.51  ? 13   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 13  ? 41.177 -1.062  42.592  1.00 53.35  ? 13   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 13  ? 40.007 0.820   43.182  1.00 51.32  ? 13   ARG A NH2 1 
ATOM   110  N N   . GLY A 1 14  ? 37.050 4.583   42.023  1.00 47.08  ? 14   GLY A N   1 
ATOM   111  C CA  . GLY A 1 14  ? 38.098 5.549   42.257  1.00 48.19  ? 14   GLY A CA  1 
ATOM   112  C C   . GLY A 1 14  ? 37.987 6.342   43.543  1.00 49.45  ? 14   GLY A C   1 
ATOM   113  O O   . GLY A 1 14  ? 38.962 6.990   43.958  1.00 50.61  ? 14   GLY A O   1 
ATOM   114  N N   . GLY A 1 15  ? 36.813 6.326   44.169  1.00 49.40  ? 15   GLY A N   1 
ATOM   115  C CA  . GLY A 1 15  ? 36.643 6.998   45.457  1.00 50.50  ? 15   GLY A CA  1 
ATOM   116  C C   . GLY A 1 15  ? 35.268 7.601   45.636  1.00 50.49  ? 15   GLY A C   1 
ATOM   117  O O   . GLY A 1 15  ? 34.315 7.228   44.927  1.00 49.72  ? 15   GLY A O   1 
ATOM   118  N N   . GLN A 1 16  ? 35.174 8.538   46.581  1.00 51.16  ? 16   GLN A N   1 
ATOM   119  C CA  . GLN A 1 16  ? 33.911 9.176   46.944  1.00 51.04  ? 16   GLN A CA  1 
ATOM   120  C C   . GLN A 1 16  ? 33.610 10.398  46.097  1.00 49.92  ? 16   GLN A C   1 
ATOM   121  O O   . GLN A 1 16  ? 34.510 11.185  45.798  1.00 50.02  ? 16   GLN A O   1 
ATOM   122  C CB  . GLN A 1 16  ? 33.929 9.563   48.420  1.00 52.49  ? 16   GLN A CB  1 
ATOM   123  C CG  . GLN A 1 16  ? 33.792 8.365   49.343  1.00 54.25  ? 16   GLN A CG  1 
ATOM   124  C CD  . GLN A 1 16  ? 33.790 8.749   50.803  1.00 56.92  ? 16   GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 16  ? 34.781 9.283   51.319  1.00 58.83  ? 16   GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 16  ? 32.683 8.466   51.488  1.00 56.29  ? 16   GLN A NE2 1 
ATOM   127  N N   . LEU A 1 17  ? 32.341 10.549  45.718  1.00 49.11  ? 17   LEU A N   1 
ATOM   128  C CA  . LEU A 1 17  ? 31.869 11.702  44.934  1.00 47.71  ? 17   LEU A CA  1 
ATOM   129  C C   . LEU A 1 17  ? 30.771 12.470  45.660  1.00 48.20  ? 17   LEU A C   1 
ATOM   130  O O   . LEU A 1 17  ? 29.970 11.883  46.399  1.00 48.55  ? 17   LEU A O   1 
ATOM   131  C CB  . LEU A 1 17  ? 31.309 11.241  43.582  1.00 46.46  ? 17   LEU A CB  1 
ATOM   132  C CG  . LEU A 1 17  ? 32.143 10.378  42.643  1.00 45.13  ? 17   LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 17  ? 31.230 9.710   41.638  1.00 44.47  ? 17   LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 17  ? 33.191 11.211  41.936  1.00 45.17  ? 17   LEU A CD2 1 
ATOM   135  N N   . ARG A 1 18  ? 30.741 13.782  45.445  1.00 48.18  ? 18   ARG A N   1 
ATOM   136  C CA  . ARG A 1 18  ? 29.622 14.618  45.876  1.00 49.11  ? 18   ARG A CA  1 
ATOM   137  C C   . ARG A 1 18  ? 28.919 15.213  44.655  1.00 48.12  ? 18   ARG A C   1 
ATOM   138  O O   . ARG A 1 18  ? 29.518 15.993  43.906  1.00 47.79  ? 18   ARG A O   1 
ATOM   139  C CB  . ARG A 1 18  ? 30.085 15.721  46.834  1.00 49.94  ? 18   ARG A CB  1 
ATOM   140  C CG  . ARG A 1 18  ? 28.958 16.670  47.306  1.00 51.74  ? 18   ARG A CG  1 
ATOM   141  C CD  . ARG A 1 18  ? 29.401 17.689  48.383  1.00 52.88  ? 18   ARG A CD  1 
ATOM   142  N NE  . ARG A 1 18  ? 30.829 17.987  48.292  1.00 54.25  ? 18   ARG A NE  1 
ATOM   143  C CZ  . ARG A 1 18  ? 31.727 17.766  49.253  1.00 55.45  ? 18   ARG A CZ  1 
ATOM   144  N NH1 . ARG A 1 18  ? 31.378 17.266  50.434  1.00 54.87  ? 18   ARG A NH1 1 
ATOM   145  N NH2 . ARG A 1 18  ? 32.997 18.061  49.021  1.00 56.96  ? 18   ARG A NH2 1 
ATOM   146  N N   . GLY A 1 19  ? 27.657 14.837  44.455  1.00 47.93  ? 19   GLY A N   1 
ATOM   147  C CA  . GLY A 1 19  ? 26.865 15.370  43.343  1.00 47.13  ? 19   GLY A CA  1 
ATOM   148  C C   . GLY A 1 19  ? 26.020 16.584  43.698  1.00 47.94  ? 19   GLY A C   1 
ATOM   149  O O   . GLY A 1 19  ? 26.092 17.105  44.811  1.00 48.76  ? 19   GLY A O   1 
ATOM   150  N N   . ILE A 1 20  ? 25.208 17.025  42.743  1.00 47.59  ? 20   ILE A N   1 
ATOM   151  C CA  . ILE A 1 20  ? 24.341 18.182  42.936  1.00 48.64  ? 20   ILE A CA  1 
ATOM   152  C C   . ILE A 1 20  ? 22.871 17.847  42.632  1.00 49.43  ? 20   ILE A C   1 
ATOM   153  O O   . ILE A 1 20  ? 22.559 17.076  41.715  1.00 48.54  ? 20   ILE A O   1 
ATOM   154  C CB  . ILE A 1 20  ? 24.838 19.410  42.106  1.00 48.17  ? 20   ILE A CB  1 
ATOM   155  C CG1 . ILE A 1 20  ? 23.995 20.658  42.399  1.00 49.72  ? 20   ILE A CG1 1 
ATOM   156  C CG2 . ILE A 1 20  ? 24.902 19.090  40.592  1.00 45.45  ? 20   ILE A CG2 1 
ATOM   157  C CD1 . ILE A 1 20  ? 24.613 21.986  41.899  1.00 50.16  ? 20   ILE A CD1 1 
ATOM   158  N N   . ARG A 1 21  ? 21.978 18.424  43.422  1.00 51.38  ? 21   ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? 20.552 18.301  43.196  1.00 53.02  ? 21   ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? 20.103 19.386  42.205  1.00 53.30  ? 21   ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? 20.157 20.581  42.508  1.00 54.23  ? 21   ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? 19.806 18.410  44.533  1.00 54.73  ? 21   ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? 18.300 18.325  44.430  1.00 56.76  ? 21   ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? 17.616 18.680  45.744  1.00 61.35  ? 21   ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? 16.348 19.340  45.456  1.00 66.56  ? 21   ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? 15.284 19.362  46.256  1.00 70.57  ? 21   ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? 15.300 18.750  47.439  1.00 72.73  ? 21   ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? 14.186 19.996  45.856  1.00 71.67  ? 21   ARG A NH2 1 
ATOM   169  N N   . LEU A 1 22  ? 19.674 18.971  41.018  1.00 52.89  ? 22   LEU A N   1 
ATOM   170  C CA  . LEU A 1 22  ? 19.256 19.932  40.002  1.00 53.34  ? 22   LEU A CA  1 
ATOM   171  C C   . LEU A 1 22  ? 17.747 20.064  39.943  1.00 55.08  ? 22   LEU A C   1 
ATOM   172  O O   . LEU A 1 22  ? 17.028 19.123  40.253  1.00 56.01  ? 22   LEU A O   1 
ATOM   173  C CB  . LEU A 1 22  ? 19.816 19.564  38.622  1.00 51.52  ? 22   LEU A CB  1 
ATOM   174  C CG  . LEU A 1 22  ? 21.334 19.652  38.388  1.00 49.89  ? 22   LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 22  ? 21.650 19.285  36.955  1.00 48.72  ? 22   LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 22  ? 21.917 21.023  38.720  1.00 48.46  ? 22   LEU A CD2 1 
ATOM   177  N N   . LYS A 1 23  ? 17.273 21.239  39.541  1.00 56.36  ? 23   LYS A N   1 
ATOM   178  C CA  . LYS A 1 23  ? 15.848 21.477  39.339  1.00 57.93  ? 23   LYS A CA  1 
ATOM   179  C C   . LYS A 1 23  ? 15.445 21.083  37.917  1.00 57.02  ? 23   LYS A C   1 
ATOM   180  O O   . LYS A 1 23  ? 16.162 21.352  36.953  1.00 55.32  ? 23   LYS A O   1 
ATOM   181  C CB  . LYS A 1 23  ? 15.529 22.943  39.602  1.00 59.42  ? 23   LYS A CB  1 
ATOM   182  C CG  . LYS A 1 23  ? 14.052 23.265  39.748  1.00 63.96  ? 23   LYS A CG  1 
ATOM   183  C CD  . LYS A 1 23  ? 13.851 24.773  40.004  1.00 68.72  ? 23   LYS A CD  1 
ATOM   184  C CE  . LYS A 1 23  ? 12.449 25.236  39.603  1.00 71.31  ? 23   LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 23  ? 11.455 25.033  40.692  1.00 73.84  ? 23   LYS A NZ  1 
ATOM   186  N N   . ALA A 1 24  ? 14.310 20.402  37.802  1.00 57.87  ? 24   ALA A N   1 
ATOM   187  C CA  . ALA A 1 24  ? 13.730 20.079  36.502  1.00 57.59  ? 24   ALA A CA  1 
ATOM   188  C C   . ALA A 1 24  ? 12.237 20.340  36.604  1.00 59.64  ? 24   ALA A C   1 
ATOM   189  O O   . ALA A 1 24  ? 11.654 20.159  37.676  1.00 61.19  ? 24   ALA A O   1 
ATOM   190  C CB  . ALA A 1 24  ? 14.005 18.630  36.116  1.00 56.02  ? 24   ALA A CB  1 
ATOM   191  N N   . PRO A 1 25  ? 11.607 20.785  35.500  1.00 60.03  ? 25   PRO A N   1 
ATOM   192  C CA  . PRO A 1 25  ? 10.191 21.188  35.555  1.00 61.49  ? 25   PRO A CA  1 
ATOM   193  C C   . PRO A 1 25  ? 9.297  20.296  36.424  1.00 62.51  ? 25   PRO A C   1 
ATOM   194  O O   . PRO A 1 25  ? 8.469  20.811  37.171  1.00 64.62  ? 25   PRO A O   1 
ATOM   195  C CB  . PRO A 1 25  ? 9.760  21.122  34.091  1.00 61.31  ? 25   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 25  ? 11.030 21.462  33.327  1.00 59.95  ? 25   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 25  ? 12.187 20.949  34.147  1.00 58.42  ? 25   PRO A CD  1 
ATOM   198  N N   . GLY A 1 26  ? 9.468  18.980  36.343  1.00 61.42  ? 26   GLY A N   1 
ATOM   199  C CA  . GLY A 1 26  ? 8.614  18.044  37.088  1.00 62.22  ? 26   GLY A CA  1 
ATOM   200  C C   . GLY A 1 26  ? 9.102  17.646  38.477  1.00 62.35  ? 26   GLY A C   1 
ATOM   201  O O   . GLY A 1 26  ? 8.415  16.906  39.188  1.00 63.57  ? 26   GLY A O   1 
ATOM   202  N N   . GLY A 1 27  ? 10.280 18.136  38.868  1.00 60.71  ? 27   GLY A N   1 
ATOM   203  C CA  . GLY A 1 27  ? 10.888 17.776  40.149  1.00 60.24  ? 27   GLY A CA  1 
ATOM   204  C C   . GLY A 1 27  ? 12.407 17.669  40.076  1.00 58.24  ? 27   GLY A C   1 
ATOM   205  O O   . GLY A 1 27  ? 12.999 17.885  39.012  1.00 56.72  ? 27   GLY A O   1 
ATOM   206  N N   . PRO A 1 28  ? 13.057 17.329  41.207  1.00 57.82  ? 28   PRO A N   1 
ATOM   207  C CA  . PRO A 1 28  ? 14.523 17.364  41.223  1.00 55.92  ? 28   PRO A CA  1 
ATOM   208  C C   . PRO A 1 28  ? 15.160 16.133  40.583  1.00 54.38  ? 28   PRO A C   1 
ATOM   209  O O   . PRO A 1 28  ? 14.523 15.076  40.534  1.00 54.82  ? 28   PRO A O   1 
ATOM   210  C CB  . PRO A 1 28  ? 14.857 17.432  42.711  1.00 56.88  ? 28   PRO A CB  1 
ATOM   211  C CG  . PRO A 1 28  ? 13.673 16.807  43.410  1.00 58.58  ? 28   PRO A CG  1 
ATOM   212  C CD  . PRO A 1 28  ? 12.481 16.909  42.501  1.00 59.14  ? 28   PRO A CD  1 
ATOM   213  N N   . VAL A 1 29  ? 16.383 16.299  40.069  1.00 52.19  ? 29   VAL A N   1 
ATOM   214  C CA  . VAL A 1 29  ? 17.218 15.189  39.617  1.00 50.90  ? 29   VAL A CA  1 
ATOM   215  C C   . VAL A 1 29  ? 18.609 15.222  40.284  1.00 50.25  ? 29   VAL A C   1 
ATOM   216  O O   . VAL A 1 29  ? 19.023 16.250  40.834  1.00 49.98  ? 29   VAL A O   1 
ATOM   217  C CB  . VAL A 1 29  ? 17.374 15.105  38.046  1.00 49.67  ? 29   VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 29  ? 16.054 15.232  37.354  1.00 50.17  ? 29   VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 29  ? 18.350 16.138  37.512  1.00 48.42  ? 29   VAL A CG2 1 
ATOM   220  N N   . SER A 1 30  ? 19.306 14.086  40.228  1.00 49.40  ? 30   SER A N   1 
ATOM   221  C CA  . SER A 1 30  ? 20.647 13.949  40.771  1.00 49.06  ? 30   SER A CA  1 
ATOM   222  C C   . SER A 1 30  ? 21.652 14.028  39.629  1.00 47.73  ? 30   SER A C   1 
ATOM   223  O O   . SER A 1 30  ? 21.492 13.364  38.599  1.00 47.64  ? 30   SER A O   1 
ATOM   224  C CB  . SER A 1 30  ? 20.803 12.615  41.489  1.00 49.37  ? 30   SER A CB  1 
ATOM   225  O OG  . SER A 1 30  ? 19.980 12.531  42.635  1.00 51.54  ? 30   SER A OG  1 
ATOM   226  N N   . ALA A 1 31  ? 22.689 14.835  39.806  1.00 46.83  ? 31   ALA A N   1 
ATOM   227  C CA  . ALA A 1 31  ? 23.693 14.988  38.773  1.00 45.06  ? 31   ALA A CA  1 
ATOM   228  C C   . ALA A 1 31  ? 25.064 14.817  39.380  1.00 44.66  ? 31   ALA A C   1 
ATOM   229  O O   . ALA A 1 31  ? 25.355 15.373  40.443  1.00 45.92  ? 31   ALA A O   1 
ATOM   230  C CB  . ALA A 1 31  ? 23.573 16.344  38.116  1.00 44.90  ? 31   ALA A CB  1 
ATOM   231  N N   . PHE A 1 32  ? 25.896 14.026  38.718  1.00 43.20  ? 32   PHE A N   1 
ATOM   232  C CA  . PHE A 1 32  ? 27.286 13.864  39.116  1.00 42.61  ? 32   PHE A CA  1 
ATOM   233  C C   . PHE A 1 32  ? 28.148 14.247  37.916  1.00 41.67  ? 32   PHE A C   1 
ATOM   234  O O   . PHE A 1 32  ? 28.387 13.445  37.019  1.00 41.11  ? 32   PHE A O   1 
ATOM   235  C CB  . PHE A 1 32  ? 27.546 12.428  39.576  1.00 41.96  ? 32   PHE A CB  1 
ATOM   236  C CG  . PHE A 1 32  ? 26.773 12.031  40.806  1.00 42.07  ? 32   PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 32  ? 25.483 11.519  40.706  1.00 41.77  ? 32   PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 32  ? 27.336 12.147  42.069  1.00 42.03  ? 32   PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 32  ? 24.771 11.140  41.844  1.00 40.57  ? 32   PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 32  ? 26.617 11.780  43.212  1.00 41.63  ? 32   PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 32  ? 25.343 11.271  43.093  1.00 41.44  ? 32   PHE A CZ  1 
ATOM   242  N N   . LEU A 1 33  ? 28.586 15.498  37.886  1.00 41.89  ? 33   LEU A N   1 
ATOM   243  C CA  . LEU A 1 33  ? 29.282 16.043  36.709  1.00 40.89  ? 33   LEU A CA  1 
ATOM   244  C C   . LEU A 1 33  ? 30.800 16.048  36.888  1.00 41.01  ? 33   LEU A C   1 
ATOM   245  O O   . LEU A 1 33  ? 31.294 16.221  37.995  1.00 42.09  ? 33   LEU A O   1 
ATOM   246  C CB  . LEU A 1 33  ? 28.755 17.448  36.415  1.00 40.75  ? 33   LEU A CB  1 
ATOM   247  C CG  . LEU A 1 33  ? 27.225 17.580  36.351  1.00 40.04  ? 33   LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 33  ? 26.823 19.027  36.135  1.00 41.49  ? 33   LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 33  ? 26.610 16.704  35.266  1.00 38.28  ? 33   LEU A CD2 1 
ATOM   250  N N   . GLY A 1 34  ? 31.540 15.819  35.811  1.00 40.25  ? 34   GLY A N   1 
ATOM   251  C CA  . GLY A 1 34  ? 33.001 15.845  35.891  1.00 40.55  ? 34   GLY A CA  1 
ATOM   252  C C   . GLY A 1 34  ? 33.685 14.713  36.656  1.00 41.23  ? 34   GLY A C   1 
ATOM   253  O O   . GLY A 1 34  ? 34.731 14.922  37.265  1.00 41.63  ? 34   GLY A O   1 
ATOM   254  N N   . ILE A 1 35  ? 33.115 13.508  36.624  1.00 41.32  ? 35   ILE A N   1 
ATOM   255  C CA  . ILE A 1 35  ? 33.784 12.339  37.203  1.00 41.97  ? 35   ILE A CA  1 
ATOM   256  C C   . ILE A 1 35  ? 34.947 11.903  36.294  1.00 42.47  ? 35   ILE A C   1 
ATOM   257  O O   . ILE A 1 35  ? 34.738 11.618  35.108  1.00 42.51  ? 35   ILE A O   1 
ATOM   258  C CB  . ILE A 1 35  ? 32.819 11.156  37.367  1.00 41.72  ? 35   ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 35  ? 31.577 11.557  38.174  1.00 41.04  ? 35   ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 35  ? 33.548 9.957   37.977  1.00 41.84  ? 35   ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 35  ? 30.409 10.562  38.029  1.00 39.37  ? 35   ILE A CD1 1 
ATOM   262  N N   . PRO A 1 36  ? 36.177 11.870  36.827  1.00 43.31  ? 36   PRO A N   1 
ATOM   263  C CA  . PRO A 1 36  ? 37.296 11.468  35.961  1.00 43.39  ? 36   PRO A CA  1 
ATOM   264  C C   . PRO A 1 36  ? 37.308 9.977   35.725  1.00 43.78  ? 36   PRO A C   1 
ATOM   265  O O   . PRO A 1 36  ? 37.189 9.215   36.680  1.00 45.23  ? 36   PRO A O   1 
ATOM   266  C CB  . PRO A 1 36  ? 38.539 11.878  36.764  1.00 44.41  ? 36   PRO A CB  1 
ATOM   267  C CG  . PRO A 1 36  ? 38.088 12.003  38.184  1.00 44.62  ? 36   PRO A CG  1 
ATOM   268  C CD  . PRO A 1 36  ? 36.602 12.214  38.198  1.00 44.13  ? 36   PRO A CD  1 
ATOM   269  N N   . PHE A 1 37  ? 37.466 9.552   34.475  1.00 43.61  ? 37   PHE A N   1 
ATOM   270  C CA  . PHE A 1 37  ? 37.502 8.117   34.181  1.00 43.79  ? 37   PHE A CA  1 
ATOM   271  C C   . PHE A 1 37  ? 38.839 7.625   33.617  1.00 44.35  ? 37   PHE A C   1 
ATOM   272  O O   . PHE A 1 37  ? 38.997 6.441   33.322  1.00 45.26  ? 37   PHE A O   1 
ATOM   273  C CB  . PHE A 1 37  ? 36.314 7.684   33.307  1.00 42.77  ? 37   PHE A CB  1 
ATOM   274  C CG  . PHE A 1 37  ? 36.357 8.214   31.903  1.00 41.78  ? 37   PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 37  ? 36.955 7.475   30.885  1.00 42.23  ? 37   PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 37  ? 35.767 9.432   31.588  1.00 39.75  ? 37   PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 37  ? 37.002 7.964   29.567  1.00 41.63  ? 37   PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 37  ? 35.795 9.926   30.284  1.00 39.40  ? 37   PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 37  ? 36.420 9.198   29.270  1.00 40.10  ? 37   PHE A CZ  1 
ATOM   280  N N   . ALA A 1 38  ? 39.801 8.526   33.492  1.00 44.39  ? 38   ALA A N   1 
ATOM   281  C CA  . ALA A 1 38  ? 41.110 8.192   32.931  1.00 45.31  ? 38   ALA A CA  1 
ATOM   282  C C   . ALA A 1 38  ? 42.181 9.097   33.509  1.00 46.31  ? 38   ALA A C   1 
ATOM   283  O O   . ALA A 1 38  ? 41.894 10.214  33.936  1.00 46.22  ? 38   ALA A O   1 
ATOM   284  C CB  . ALA A 1 38  ? 41.099 8.324   31.411  1.00 44.12  ? 38   ALA A CB  1 
ATOM   285  N N   . GLU A 1 39  ? 43.419 8.622   33.514  1.00 47.72  ? 39   GLU A N   1 
ATOM   286  C CA  . GLU A 1 39  ? 44.528 9.514   33.755  1.00 49.20  ? 39   GLU A CA  1 
ATOM   287  C C   . GLU A 1 39  ? 44.506 10.595  32.670  1.00 48.43  ? 39   GLU A C   1 
ATOM   288  O O   . GLU A 1 39  ? 44.174 10.307  31.511  1.00 47.74  ? 39   GLU A O   1 
ATOM   289  C CB  . GLU A 1 39  ? 45.845 8.750   33.778  1.00 50.83  ? 39   GLU A CB  1 
ATOM   290  C CG  . GLU A 1 39  ? 46.066 7.992   35.081  1.00 53.93  ? 39   GLU A CG  1 
ATOM   291  C CD  . GLU A 1 39  ? 46.179 8.919   36.276  1.00 57.32  ? 39   GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 39  ? 47.113 9.752   36.269  1.00 60.93  ? 39   GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 39  ? 45.340 8.831   37.210  1.00 56.41  ? 39   GLU A OE2 1 
ATOM   294  N N   . PRO A 1 40  ? 44.807 11.852  33.050  1.00 48.65  ? 40   PRO A N   1 
ATOM   295  C CA  . PRO A 1 40  ? 44.784 12.921  32.059  1.00 48.04  ? 40   PRO A CA  1 
ATOM   296  C C   . PRO A 1 40  ? 45.776 12.607  30.935  1.00 48.29  ? 40   PRO A C   1 
ATOM   297  O O   . PRO A 1 40  ? 46.938 12.321  31.207  1.00 49.77  ? 40   PRO A O   1 
ATOM   298  C CB  . PRO A 1 40  ? 45.226 14.152  32.860  1.00 49.06  ? 40   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 40  ? 44.987 13.794  34.297  1.00 49.55  ? 40   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 40  ? 45.194 12.333  34.389  1.00 49.51  ? 40   PRO A CD  1 
ATOM   301  N N   . PRO A 1 41  ? 45.318 12.621  29.677  1.00 47.22  ? 41   PRO A N   1 
ATOM   302  C CA  . PRO A 1 41  ? 46.200 12.211  28.587  1.00 47.59  ? 41   PRO A CA  1 
ATOM   303  C C   . PRO A 1 41  ? 47.159 13.329  28.136  1.00 48.06  ? 41   PRO A C   1 
ATOM   304  O O   . PRO A 1 41  ? 47.149 13.726  26.968  1.00 47.39  ? 41   PRO A O   1 
ATOM   305  C CB  . PRO A 1 41  ? 45.215 11.846  27.478  1.00 46.08  ? 41   PRO A CB  1 
ATOM   306  C CG  . PRO A 1 41  ? 44.082 12.785  27.693  1.00 45.45  ? 41   PRO A CG  1 
ATOM   307  C CD  . PRO A 1 41  ? 43.981 13.008  29.190  1.00 45.90  ? 41   PRO A CD  1 
ATOM   308  N N   . VAL A 1 42  ? 47.992 13.806  29.056  1.00 49.06  ? 42   VAL A N   1 
ATOM   309  C CA  . VAL A 1 42  ? 48.857 14.967  28.809  1.00 49.98  ? 42   VAL A CA  1 
ATOM   310  C C   . VAL A 1 42  ? 50.335 14.586  28.712  1.00 52.02  ? 42   VAL A C   1 
ATOM   311  O O   . VAL A 1 42  ? 50.730 13.502  29.155  1.00 53.13  ? 42   VAL A O   1 
ATOM   312  C CB  . VAL A 1 42  ? 48.673 16.043  29.917  1.00 50.36  ? 42   VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 42  ? 47.197 16.428  30.056  1.00 48.76  ? 42   VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 42  ? 49.219 15.553  31.256  1.00 50.39  ? 42   VAL A CG2 1 
ATOM   315  N N   . GLY A 1 43  ? 51.154 15.476  28.148  1.00 53.09  ? 43   GLY A N   1 
ATOM   316  C CA  . GLY A 1 43  ? 52.612 15.295  28.147  1.00 55.14  ? 43   GLY A CA  1 
ATOM   317  C C   . GLY A 1 43  ? 53.024 14.095  27.312  1.00 55.82  ? 43   GLY A C   1 
ATOM   318  O O   . GLY A 1 43  ? 52.691 14.017  26.125  1.00 55.32  ? 43   GLY A O   1 
ATOM   319  N N   . SER A 1 44  ? 53.714 13.143  27.933  1.00 57.06  ? 44   SER A N   1 
ATOM   320  C CA  . SER A 1 44  ? 54.140 11.923  27.235  1.00 58.17  ? 44   SER A CA  1 
ATOM   321  C C   . SER A 1 44  ? 52.972 11.002  26.867  1.00 56.84  ? 44   SER A C   1 
ATOM   322  O O   . SER A 1 44  ? 53.171 9.983   26.199  1.00 57.24  ? 44   SER A O   1 
ATOM   323  C CB  . SER A 1 44  ? 55.169 11.143  28.063  1.00 59.97  ? 44   SER A CB  1 
ATOM   324  O OG  . SER A 1 44  ? 54.612 10.730  29.301  1.00 60.30  ? 44   SER A OG  1 
ATOM   325  N N   . ARG A 1 45  ? 51.763 11.363  27.295  1.00 55.43  ? 45   ARG A N   1 
ATOM   326  C CA  . ARG A 1 45  ? 50.587 10.534  27.045  1.00 54.29  ? 45   ARG A CA  1 
ATOM   327  C C   . ARG A 1 45  ? 49.697 10.999  25.891  1.00 52.42  ? 45   ARG A C   1 
ATOM   328  O O   . ARG A 1 45  ? 48.700 10.339  25.572  1.00 51.35  ? 45   ARG A O   1 
ATOM   329  C CB  . ARG A 1 45  ? 49.781 10.348  28.332  1.00 54.41  ? 45   ARG A CB  1 
ATOM   330  C CG  . ARG A 1 45  ? 50.553 9.566   29.388  1.00 58.44  ? 45   ARG A CG  1 
ATOM   331  C CD  . ARG A 1 45  ? 49.726 8.414   29.917  1.00 62.86  ? 45   ARG A CD  1 
ATOM   332  N NE  . ARG A 1 45  ? 49.147 8.683   31.236  1.00 65.90  ? 45   ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 45  ? 49.779 8.464   32.393  1.00 69.19  ? 45   ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 45  ? 51.021 7.975   32.408  1.00 70.19  ? 45   ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 45  ? 49.165 8.730   33.546  1.00 70.10  ? 45   ARG A NH2 1 
ATOM   336  N N   . ARG A 1 46  ? 50.063 12.124  25.267  1.00 51.98  ? 46   ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? 49.388 12.618  24.057  1.00 50.09  ? 46   ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? 49.483 11.557  22.966  1.00 49.90  ? 46   ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? 50.539 10.943  22.811  1.00 51.50  ? 46   ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? 50.043 13.924  23.579  1.00 50.48  ? 46   ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? 49.244 14.689  22.535  1.00 48.25  ? 46   ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? 50.034 15.837  21.943  1.00 47.82  ? 46   ARG A CD  1 
ATOM   343  N NE  . ARG A 1 46  ? 49.951 17.051  22.751  1.00 47.61  ? 46   ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 46  ? 50.559 18.199  22.457  1.00 47.65  ? 46   ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 46  ? 51.305 18.301  21.365  1.00 47.97  ? 46   ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 46  ? 50.426 19.251  23.259  1.00 46.56  ? 46   ARG A NH2 1 
ATOM   347  N N   . PHE A 1 47  ? 48.394 11.345  22.221  1.00 48.13  ? 47   PHE A N   1 
ATOM   348  C CA  . PHE A 1 47  ? 48.298 10.300  21.169  1.00 48.07  ? 47   PHE A CA  1 
ATOM   349  C C   . PHE A 1 47  ? 48.224 8.858   21.692  1.00 49.29  ? 47   PHE A C   1 
ATOM   350  O O   . PHE A 1 47  ? 47.900 7.942   20.930  1.00 49.57  ? 47   PHE A O   1 
ATOM   351  C CB  . PHE A 1 47  ? 49.418 10.387  20.113  1.00 48.19  ? 47   PHE A CB  1 
ATOM   352  C CG  . PHE A 1 47  ? 49.738 11.787  19.656  1.00 47.63  ? 47   PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 47  ? 48.751 12.612  19.104  1.00 45.24  ? 47   PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 47  ? 51.033 12.276  19.760  1.00 47.43  ? 47   PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 47  ? 49.048 13.898  18.676  1.00 44.20  ? 47   PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 47  ? 51.336 13.565  19.343  1.00 47.61  ? 47   PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 47  ? 50.339 14.379  18.800  1.00 46.18  ? 47   PHE A CZ  1 
ATOM   358  N N   . MET A 1 48  ? 48.529 8.655   22.974  1.00 50.43  ? 48   MET A N   1 
ATOM   359  C CA  . MET A 1 48  ? 48.562 7.318   23.563  1.00 51.66  ? 48   MET A CA  1 
ATOM   360  C C   . MET A 1 48  ? 47.176 6.894   24.071  1.00 50.55  ? 48   MET A C   1 
ATOM   361  O O   . MET A 1 48  ? 46.379 7.749   24.492  1.00 49.50  ? 48   MET A O   1 
ATOM   362  C CB  . MET A 1 48  ? 49.568 7.286   24.704  1.00 53.24  ? 48   MET A CB  1 
ATOM   363  C CG  . MET A 1 48  ? 51.014 7.369   24.262  1.00 57.31  ? 48   MET A CG  1 
ATOM   364  S SD  . MET A 1 48  ? 51.662 5.757   23.769  1.00 65.74  ? 48   MET A SD  1 
ATOM   365  C CE  . MET A 1 48  ? 51.892 4.996   25.376  1.00 65.66  ? 48   MET A CE  1 
ATOM   366  N N   . PRO A 1 49  ? 46.871 5.575   24.015  1.00 50.77  ? 49   PRO A N   1 
ATOM   367  C CA  . PRO A 1 49  ? 45.629 5.020   24.588  1.00 49.92  ? 49   PRO A CA  1 
ATOM   368  C C   . PRO A 1 49  ? 45.416 5.479   26.032  1.00 49.62  ? 49   PRO A C   1 
ATOM   369  O O   . PRO A 1 49  ? 46.398 5.691   26.751  1.00 50.86  ? 49   PRO A O   1 
ATOM   370  C CB  . PRO A 1 49  ? 45.880 3.508   24.584  1.00 50.65  ? 49   PRO A CB  1 
ATOM   371  C CG  . PRO A 1 49  ? 46.884 3.279   23.536  1.00 51.64  ? 49   PRO A CG  1 
ATOM   372  C CD  . PRO A 1 49  ? 47.696 4.532   23.375  1.00 51.86  ? 49   PRO A CD  1 
ATOM   373  N N   . PRO A 1 50  ? 44.153 5.612   26.466  1.00 48.38  ? 50   PRO A N   1 
ATOM   374  C CA  . PRO A 1 50  ? 43.893 6.021   27.843  1.00 48.71  ? 50   PRO A CA  1 
ATOM   375  C C   . PRO A 1 50  ? 44.194 4.921   28.868  1.00 50.67  ? 50   PRO A C   1 
ATOM   376  O O   . PRO A 1 50  ? 44.011 3.724   28.591  1.00 50.99  ? 50   PRO A O   1 
ATOM   377  C CB  . PRO A 1 50  ? 42.398 6.344   27.840  1.00 47.24  ? 50   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 50  ? 41.842 5.533   26.757  1.00 46.72  ? 50   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 50  ? 42.912 5.382   25.713  1.00 47.09  ? 50   PRO A CD  1 
ATOM   380  N N   . GLU A 1 51  ? 44.683 5.349   30.030  1.00 52.04  ? 51   GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 44.946 4.484   31.181  1.00 53.86  ? 51   GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 43.869 4.817   32.208  1.00 52.89  ? 51   GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 43.482 5.990   32.346  1.00 51.98  ? 51   GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 46.336 4.766   31.759  1.00 55.50  ? 51   GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 47.475 4.627   30.734  1.00 60.35  ? 51   GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 48.883 4.638   31.362  1.00 67.35  ? 51   GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 49.521 3.557   31.464  1.00 70.23  ? 51   GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 49.357 5.729   31.755  1.00 69.07  ? 51   GLU A OE2 1 
ATOM   389  N N   . PRO A 1 52  ? 43.369 3.796   32.932  1.00 53.08  ? 52   PRO A N   1 
ATOM   390  C CA  . PRO A 1 52  ? 42.320 4.002   33.954  1.00 52.04  ? 52   PRO A CA  1 
ATOM   391  C C   . PRO A 1 52  ? 42.717 5.055   35.001  1.00 51.57  ? 52   PRO A C   1 
ATOM   392  O O   . PRO A 1 52  ? 43.886 5.145   35.376  1.00 52.19  ? 52   PRO A O   1 
ATOM   393  C CB  . PRO A 1 52  ? 42.205 2.626   34.625  1.00 53.26  ? 52   PRO A CB  1 
ATOM   394  C CG  . PRO A 1 52  ? 42.720 1.664   33.616  1.00 54.57  ? 52   PRO A CG  1 
ATOM   395  C CD  . PRO A 1 52  ? 43.785 2.387   32.833  1.00 54.10  ? 52   PRO A CD  1 
ATOM   396  N N   . LYS A 1 53  ? 41.748 5.835   35.468  1.00 50.35  ? 53   LYS A N   1 
ATOM   397  C CA  . LYS A 1 53  ? 41.998 6.853   36.489  1.00 50.48  ? 53   LYS A CA  1 
ATOM   398  C C   . LYS A 1 53  ? 42.520 6.215   37.771  1.00 51.95  ? 53   LYS A C   1 
ATOM   399  O O   . LYS A 1 53  ? 41.981 5.210   38.226  1.00 52.57  ? 53   LYS A O   1 
ATOM   400  C CB  . LYS A 1 53  ? 40.720 7.639   36.779  1.00 49.50  ? 53   LYS A CB  1 
ATOM   401  C CG  . LYS A 1 53  ? 40.802 8.604   37.952  1.00 50.14  ? 53   LYS A CG  1 
ATOM   402  C CD  . LYS A 1 53  ? 41.608 9.850   37.619  1.00 50.79  ? 53   LYS A CD  1 
ATOM   403  C CE  . LYS A 1 53  ? 41.913 10.658  38.868  1.00 52.17  ? 53   LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 53  ? 42.892 11.744  38.594  1.00 53.07  ? 53   LYS A NZ  1 
ATOM   405  N N   . ARG A 1 54  ? 43.576 6.790   38.340  1.00 52.51  ? 54   ARG A N   1 
ATOM   406  C CA  . ARG A 1 54  ? 44.105 6.305   39.602  1.00 54.13  ? 54   ARG A CA  1 
ATOM   407  C C   . ARG A 1 54  ? 43.251 6.843   40.749  1.00 53.39  ? 54   ARG A C   1 
ATOM   408  O O   . ARG A 1 54  ? 42.875 8.016   40.728  1.00 52.84  ? 54   ARG A O   1 
ATOM   409  C CB  . ARG A 1 54  ? 45.578 6.695   39.774  1.00 55.74  ? 54   ARG A CB  1 
ATOM   410  C CG  . ARG A 1 54  ? 46.547 5.882   38.911  1.00 58.94  ? 54   ARG A CG  1 
ATOM   411  C CD  . ARG A 1 54  ? 47.987 6.074   39.376  1.00 68.20  ? 54   ARG A CD  1 
ATOM   412  N NE  . ARG A 1 54  ? 48.246 7.462   39.788  1.00 74.32  ? 54   ARG A NE  1 
ATOM   413  C CZ  . ARG A 1 54  ? 49.098 8.299   39.189  1.00 77.28  ? 54   ARG A CZ  1 
ATOM   414  N NH1 . ARG A 1 54  ? 49.826 7.895   38.144  1.00 78.58  ? 54   ARG A NH1 1 
ATOM   415  N NH2 . ARG A 1 54  ? 49.233 9.545   39.650  1.00 77.52  ? 54   ARG A NH2 1 
ATOM   416  N N   . PRO A 1 55  ? 42.933 5.990   41.749  1.00 53.78  ? 55   PRO A N   1 
ATOM   417  C CA  . PRO A 1 55  ? 42.026 6.407   42.835  1.00 53.64  ? 55   PRO A CA  1 
ATOM   418  C C   . PRO A 1 55  ? 42.479 7.681   43.559  1.00 54.21  ? 55   PRO A C   1 
ATOM   419  O O   . PRO A 1 55  ? 43.686 7.909   43.723  1.00 55.13  ? 55   PRO A O   1 
ATOM   420  C CB  . PRO A 1 55  ? 42.051 5.216   43.799  1.00 54.62  ? 55   PRO A CB  1 
ATOM   421  C CG  . PRO A 1 55  ? 42.459 4.057   42.965  1.00 54.82  ? 55   PRO A CG  1 
ATOM   422  C CD  . PRO A 1 55  ? 43.397 4.597   41.923  1.00 54.50  ? 55   PRO A CD  1 
ATOM   423  N N   . TRP A 1 56  ? 41.505 8.505   43.956  1.00 53.62  ? 56   TRP A N   1 
ATOM   424  C CA  . TRP A 1 56  ? 41.753 9.730   44.720  1.00 54.16  ? 56   TRP A CA  1 
ATOM   425  C C   . TRP A 1 56  ? 41.374 9.580   46.201  1.00 55.29  ? 56   TRP A C   1 
ATOM   426  O O   . TRP A 1 56  ? 40.644 8.647   46.600  1.00 55.45  ? 56   TRP A O   1 
ATOM   427  C CB  . TRP A 1 56  ? 40.990 10.896  44.099  1.00 53.35  ? 56   TRP A CB  1 
ATOM   428  C CG  . TRP A 1 56  ? 39.502 10.677  44.066  1.00 53.75  ? 56   TRP A CG  1 
ATOM   429  C CD1 . TRP A 1 56  ? 38.603 11.007  45.043  1.00 54.49  ? 56   TRP A CD1 1 
ATOM   430  C CD2 . TRP A 1 56  ? 38.738 10.076  43.010  1.00 53.13  ? 56   TRP A CD2 1 
ATOM   431  N NE1 . TRP A 1 56  ? 37.331 10.653  44.661  1.00 53.84  ? 56   TRP A NE1 1 
ATOM   432  C CE2 . TRP A 1 56  ? 37.384 10.079  43.419  1.00 53.06  ? 56   TRP A CE2 1 
ATOM   433  C CE3 . TRP A 1 56  ? 39.064 9.539   41.759  1.00 52.03  ? 56   TRP A CE3 1 
ATOM   434  C CZ2 . TRP A 1 56  ? 36.357 9.563   42.621  1.00 51.48  ? 56   TRP A CZ2 1 
ATOM   435  C CZ3 . TRP A 1 56  ? 38.041 9.029   40.965  1.00 51.02  ? 56   TRP A CZ3 1 
ATOM   436  C CH2 . TRP A 1 56  ? 36.705 9.045   41.401  1.00 50.57  ? 56   TRP A CH2 1 
ATOM   437  N N   . SER A 1 57  ? 41.867 10.498  47.023  1.00 56.11  ? 57   SER A N   1 
ATOM   438  C CA  . SER A 1 57  ? 41.518 10.477  48.440  1.00 57.23  ? 57   SER A CA  1 
ATOM   439  C C   . SER A 1 57  ? 40.467 11.538  48.744  1.00 56.47  ? 57   SER A C   1 
ATOM   440  O O   . SER A 1 57  ? 40.435 12.591  48.108  1.00 55.70  ? 57   SER A O   1 
ATOM   441  C CB  . SER A 1 57  ? 42.761 10.655  49.321  1.00 59.02  ? 57   SER A CB  1 
ATOM   442  O OG  . SER A 1 57  ? 43.462 11.820  48.952  1.00 59.02  ? 57   SER A OG  1 
ATOM   443  N N   . GLY A 1 58  ? 39.604 11.245  49.709  1.00 56.69  ? 58   GLY A N   1 
ATOM   444  C CA  . GLY A 1 58  ? 38.552 12.168  50.098  1.00 56.33  ? 58   GLY A CA  1 
ATOM   445  C C   . GLY A 1 58  ? 37.441 12.268  49.073  1.00 54.66  ? 58   GLY A C   1 
ATOM   446  O O   . GLY A 1 58  ? 37.346 11.452  48.152  1.00 53.64  ? 58   GLY A O   1 
ATOM   447  N N   . VAL A 1 59  ? 36.608 13.290  49.233  1.00 54.33  ? 59   VAL A N   1 
ATOM   448  C CA  . VAL A 1 59  ? 35.399 13.438  48.446  1.00 52.71  ? 59   VAL A CA  1 
ATOM   449  C C   . VAL A 1 59  ? 35.659 14.380  47.278  1.00 52.02  ? 59   VAL A C   1 
ATOM   450  O O   . VAL A 1 59  ? 35.947 15.560  47.475  1.00 52.58  ? 59   VAL A O   1 
ATOM   451  C CB  . VAL A 1 59  ? 34.230 13.964  49.317  1.00 53.35  ? 59   VAL A CB  1 
ATOM   452  C CG1 . VAL A 1 59  ? 32.910 13.920  48.538  1.00 51.41  ? 59   VAL A CG1 1 
ATOM   453  C CG2 . VAL A 1 59  ? 34.120 13.160  50.615  1.00 53.78  ? 59   VAL A CG2 1 
ATOM   454  N N   . LEU A 1 60  ? 35.570 13.844  46.067  1.00 51.04  ? 60   LEU A N   1 
ATOM   455  C CA  . LEU A 1 60  ? 35.723 14.637  44.860  1.00 50.65  ? 60   LEU A CA  1 
ATOM   456  C C   . LEU A 1 60  ? 34.439 15.408  44.578  1.00 50.74  ? 60   LEU A C   1 
ATOM   457  O O   . LEU A 1 60  ? 33.348 14.832  44.510  1.00 50.81  ? 60   LEU A O   1 
ATOM   458  C CB  . LEU A 1 60  ? 36.087 13.746  43.668  1.00 49.48  ? 60   LEU A CB  1 
ATOM   459  C CG  . LEU A 1 60  ? 36.382 14.413  42.314  1.00 48.58  ? 60   LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 60  ? 37.444 13.639  41.546  1.00 48.21  ? 60   LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 60  ? 35.135 14.495  41.471  1.00 48.67  ? 60   LEU A CD2 1 
ATOM   462  N N   . ASP A 1 61  ? 34.562 16.717  44.411  1.00 51.35  ? 61   ASP A N   1 
ATOM   463  C CA  . ASP A 1 61  ? 33.407 17.493  44.023  1.00 51.47  ? 61   ASP A CA  1 
ATOM   464  C C   . ASP A 1 61  ? 32.988 17.205  42.576  1.00 49.86  ? 61   ASP A C   1 
ATOM   465  O O   . ASP A 1 61  ? 33.762 17.396  41.631  1.00 49.30  ? 61   ASP A O   1 
ATOM   466  C CB  . ASP A 1 61  ? 33.629 18.982  44.242  1.00 52.36  ? 61   ASP A CB  1 
ATOM   467  C CG  . ASP A 1 61  ? 32.384 19.782  43.938  1.00 53.98  ? 61   ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 61  ? 32.150 20.051  42.734  1.00 53.77  ? 61   ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 61  ? 31.622 20.096  44.892  1.00 56.07  ? 61   ASP A OD2 1 
ATOM   470  N N   . ALA A 1 62  ? 31.756 16.742  42.416  1.00 49.41  ? 62   ALA A N   1 
ATOM   471  C CA  . ALA A 1 62  ? 31.233 16.417  41.090  1.00 48.20  ? 62   ALA A CA  1 
ATOM   472  C C   . ALA A 1 62  ? 29.981 17.237  40.797  1.00 47.90  ? 62   ALA A C   1 
ATOM   473  O O   . ALA A 1 62  ? 28.968 16.707  40.338  1.00 47.27  ? 62   ALA A O   1 
ATOM   474  C CB  . ALA A 1 62  ? 30.951 14.922  40.972  1.00 47.63  ? 62   ALA A CB  1 
ATOM   475  N N   . THR A 1 63  ? 30.078 18.540  41.055  1.00 48.52  ? 63   THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? 28.938 19.444  40.934  1.00 48.91  ? 63   THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? 28.993 20.362  39.702  1.00 48.43  ? 63   THR A C   1 
ATOM   478  O O   . THR A 1 63  ? 28.035 21.082  39.430  1.00 49.09  ? 63   THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? 28.729 20.289  42.227  1.00 50.38  ? 63   THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? 29.837 21.175  42.415  1.00 51.08  ? 63   THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? 28.588 19.391  43.465  1.00 50.04  ? 63   THR A CG2 1 
ATOM   482  N N   . THR A 1 64  ? 30.098 20.335  38.961  1.00 47.71  ? 64   THR A N   1 
ATOM   483  C CA  . THR A 1 64  ? 30.246 21.166  37.756  1.00 47.39  ? 64   THR A CA  1 
ATOM   484  C C   . THR A 1 64  ? 30.837 20.355  36.617  1.00 46.09  ? 64   THR A C   1 
ATOM   485  O O   . THR A 1 64  ? 31.536 19.373  36.856  1.00 46.53  ? 64   THR A O   1 
ATOM   486  C CB  . THR A 1 64  ? 31.199 22.364  37.976  1.00 48.26  ? 64   THR A CB  1 
ATOM   487  O OG1 . THR A 1 64  ? 32.521 21.873  38.213  1.00 49.03  ? 64   THR A OG1 1 
ATOM   488  C CG2 . THR A 1 64  ? 30.768 23.243  39.153  1.00 49.97  ? 64   THR A CG2 1 
ATOM   489  N N   . PHE A 1 65  ? 30.573 20.771  35.379  1.00 45.17  ? 65   PHE A N   1 
ATOM   490  C CA  . PHE A 1 65  ? 31.176 20.130  34.215  1.00 43.57  ? 65   PHE A CA  1 
ATOM   491  C C   . PHE A 1 65  ? 32.674 20.392  34.212  1.00 43.73  ? 65   PHE A C   1 
ATOM   492  O O   . PHE A 1 65  ? 33.142 21.419  34.711  1.00 44.75  ? 65   PHE A O   1 
ATOM   493  C CB  . PHE A 1 65  ? 30.567 20.651  32.921  1.00 42.57  ? 65   PHE A CB  1 
ATOM   494  C CG  . PHE A 1 65  ? 29.172 20.140  32.651  1.00 42.77  ? 65   PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 65  ? 28.947 18.782  32.398  1.00 42.05  ? 65   PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 65  ? 28.082 21.023  32.635  1.00 40.24  ? 65   PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 65  ? 27.660 18.311  32.145  1.00 40.93  ? 65   PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 65  ? 26.816 20.573  32.384  1.00 39.33  ? 65   PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 65  ? 26.593 19.215  32.142  1.00 41.37  ? 65   PHE A CZ  1 
ATOM   500  N N   . GLN A 1 66  ? 33.427 19.457  33.657  1.00 42.58  ? 66   GLN A N   1 
ATOM   501  C CA  . GLN A 1 66  ? 34.858 19.641  33.537  1.00 42.57  ? 66   GLN A CA  1 
ATOM   502  C C   . GLN A 1 66  ? 35.236 20.230  32.194  1.00 41.93  ? 66   GLN A C   1 
ATOM   503  O O   . GLN A 1 66  ? 34.359 20.524  31.362  1.00 40.76  ? 66   GLN A O   1 
ATOM   504  C CB  . GLN A 1 66  ? 35.587 18.323  33.782  1.00 42.54  ? 66   GLN A CB  1 
ATOM   505  C CG  . GLN A 1 66  ? 35.894 18.102  35.233  1.00 43.48  ? 66   GLN A CG  1 
ATOM   506  C CD  . GLN A 1 66  ? 37.121 18.865  35.659  1.00 46.81  ? 66   GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 66  ? 37.790 19.498  34.830  1.00 47.62  ? 66   GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 66  ? 37.455 18.785  36.946  1.00 47.04  ? 66   GLN A NE2 1 
ATOM   509  N N   . ASN A 1 67  ? 36.550 20.407  32.007  1.00 41.94  ? 67   ASN A N   1 
ATOM   510  C CA  . ASN A 1 67  ? 37.125 20.894  30.762  1.00 41.29  ? 67   ASN A CA  1 
ATOM   511  C C   . ASN A 1 67  ? 36.617 20.132  29.547  1.00 40.15  ? 67   ASN A C   1 
ATOM   512  O O   . ASN A 1 67  ? 36.291 18.945  29.621  1.00 39.28  ? 67   ASN A O   1 
ATOM   513  C CB  . ASN A 1 67  ? 38.644 20.798  30.794  1.00 42.08  ? 67   ASN A CB  1 
ATOM   514  C CG  . ASN A 1 67  ? 39.266 21.610  31.915  1.00 43.46  ? 67   ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 67  ? 38.852 22.738  32.214  1.00 42.52  ? 67   ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 67  ? 40.286 21.035  32.536  1.00 44.74  ? 67   ASN A ND2 1 
ATOM   517  N N   . VAL A 1 68  ? 36.545 20.857  28.438  1.00 39.78  ? 68   VAL A N   1 
ATOM   518  C CA  . VAL A 1 68  ? 36.245 20.317  27.126  1.00 38.88  ? 68   VAL A CA  1 
ATOM   519  C C   . VAL A 1 68  ? 37.577 19.983  26.443  1.00 39.34  ? 68   VAL A C   1 
ATOM   520  O O   . VAL A 1 68  ? 38.585 20.683  26.646  1.00 40.01  ? 68   VAL A O   1 
ATOM   521  C CB  . VAL A 1 68  ? 35.472 21.369  26.331  1.00 38.72  ? 68   VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? 35.246 20.936  24.900  1.00 37.52  ? 68   VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? 34.151 21.658  27.029  1.00 38.59  ? 68   VAL A CG2 1 
ATOM   524  N N   . CYS A 1 69  ? 37.594 18.897  25.674  1.00 39.13  ? 69   CYS A N   1 
ATOM   525  C CA  . CYS A 1 69  ? 38.813 18.448  24.995  1.00 40.03  ? 69   CYS A CA  1 
ATOM   526  C C   . CYS A 1 69  ? 39.315 19.477  23.964  1.00 40.74  ? 69   CYS A C   1 
ATOM   527  O O   . CYS A 1 69  ? 38.528 20.048  23.214  1.00 40.32  ? 69   CYS A O   1 
ATOM   528  C CB  . CYS A 1 69  ? 38.598 17.066  24.390  1.00 39.01  ? 69   CYS A CB  1 
ATOM   529  S SG  . CYS A 1 69  ? 38.392 15.718  25.657  1.00 41.17  ? 69   CYS A SG  1 
ATOM   530  N N   . TYR A 1 70  ? 40.620 19.743  23.964  1.00 42.37  ? 70   TYR A N   1 
ATOM   531  C CA  . TYR A 1 70  ? 41.194 20.772  23.083  1.00 43.63  ? 70   TYR A CA  1 
ATOM   532  C C   . TYR A 1 70  ? 40.723 20.608  21.632  1.00 43.40  ? 70   TYR A C   1 
ATOM   533  O O   . TYR A 1 70  ? 40.722 19.493  21.095  1.00 42.75  ? 70   TYR A O   1 
ATOM   534  C CB  . TYR A 1 70  ? 42.729 20.796  23.149  1.00 44.56  ? 70   TYR A CB  1 
ATOM   535  C CG  . TYR A 1 70  ? 43.258 22.201  23.095  1.00 45.63  ? 70   TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 70  ? 43.626 22.878  24.261  1.00 47.30  ? 70   TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 70  ? 43.351 22.875  21.885  1.00 45.77  ? 70   TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 70  ? 44.095 24.193  24.214  1.00 48.12  ? 70   TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 70  ? 43.805 24.180  21.824  1.00 46.55  ? 70   TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 70  ? 44.174 24.837  22.985  1.00 48.68  ? 70   TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 70  ? 44.636 26.141  22.898  1.00 50.43  ? 70   TYR A OH  1 
ATOM   542  N N   . GLN A 1 71  ? 40.314 21.711  21.006  1.00 43.56  ? 71   GLN A N   1 
ATOM   543  C CA  . GLN A 1 71  ? 39.660 21.615  19.699  1.00 43.53  ? 71   GLN A CA  1 
ATOM   544  C C   . GLN A 1 71  ? 39.545 22.948  18.974  1.00 45.12  ? 71   GLN A C   1 
ATOM   545  O O   . GLN A 1 71  ? 39.674 24.015  19.575  1.00 45.40  ? 71   GLN A O   1 
ATOM   546  C CB  . GLN A 1 71  ? 38.266 20.970  19.828  1.00 41.64  ? 71   GLN A CB  1 
ATOM   547  C CG  . GLN A 1 71  ? 37.309 21.735  20.731  1.00 39.65  ? 71   GLN A CG  1 
ATOM   548  C CD  . GLN A 1 71  ? 36.042 20.979  21.053  1.00 38.23  ? 71   GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 71  ? 34.980 21.309  20.530  1.00 39.33  ? 71   GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 71  ? 36.137 19.957  21.918  1.00 35.97  ? 71   GLN A NE2 1 
ATOM   551  N N   . TYR A 1 72  ? 39.302 22.849  17.670  1.00 46.58  ? 72   TYR A N   1 
ATOM   552  C CA  . TYR A 1 72  ? 38.960 23.978  16.819  1.00 48.78  ? 72   TYR A CA  1 
ATOM   553  C C   . TYR A 1 72  ? 37.643 24.606  17.270  1.00 49.36  ? 72   TYR A C   1 
ATOM   554  O O   . TYR A 1 72  ? 36.680 23.903  17.507  1.00 48.82  ? 72   TYR A O   1 
ATOM   555  C CB  . TYR A 1 72  ? 38.873 23.491  15.365  1.00 48.85  ? 72   TYR A CB  1 
ATOM   556  C CG  . TYR A 1 72  ? 38.455 24.543  14.362  1.00 50.47  ? 72   TYR A CG  1 
ATOM   557  C CD1 . TYR A 1 72  ? 37.125 24.615  13.919  1.00 49.51  ? 72   TYR A CD1 1 
ATOM   558  C CD2 . TYR A 1 72  ? 39.382 25.468  13.850  1.00 51.20  ? 72   TYR A CD2 1 
ATOM   559  C CE1 . TYR A 1 72  ? 36.722 25.563  13.001  1.00 48.90  ? 72   TYR A CE1 1 
ATOM   560  C CE2 . TYR A 1 72  ? 38.985 26.434  12.927  1.00 52.08  ? 72   TYR A CE2 1 
ATOM   561  C CZ  . TYR A 1 72  ? 37.647 26.471  12.509  1.00 52.01  ? 72   TYR A CZ  1 
ATOM   562  O OH  . TYR A 1 72  ? 37.223 27.420  11.598  1.00 53.50  ? 72   TYR A OH  1 
ATOM   563  N N   . VAL A 1 73  ? 37.624 25.930  17.402  1.00 51.68  ? 73   VAL A N   1 
ATOM   564  C CA  . VAL A 1 73  ? 36.421 26.693  17.764  1.00 52.91  ? 73   VAL A CA  1 
ATOM   565  C C   . VAL A 1 73  ? 35.896 27.447  16.537  1.00 54.25  ? 73   VAL A C   1 
ATOM   566  O O   . VAL A 1 73  ? 36.654 28.117  15.845  1.00 54.97  ? 73   VAL A O   1 
ATOM   567  C CB  . VAL A 1 73  ? 36.723 27.697  18.909  1.00 54.09  ? 73   VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 73  ? 35.590 28.716  19.092  1.00 53.85  ? 73   VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 73  ? 36.995 26.955  20.207  1.00 53.97  ? 73   VAL A CG2 1 
ATOM   570  N N   . ASP A 1 74  ? 34.594 27.342  16.280  1.00 55.44  ? 74   ASP A N   1 
ATOM   571  C CA  . ASP A 1 74  ? 33.977 27.925  15.082  1.00 56.89  ? 74   ASP A CA  1 
ATOM   572  C C   . ASP A 1 74  ? 33.924 29.454  15.084  1.00 58.89  ? 74   ASP A C   1 
ATOM   573  O O   . ASP A 1 74  ? 33.527 30.076  16.078  1.00 59.10  ? 74   ASP A O   1 
ATOM   574  C CB  . ASP A 1 74  ? 32.574 27.369  14.892  1.00 56.49  ? 74   ASP A CB  1 
ATOM   575  C CG  . ASP A 1 74  ? 32.115 27.440  13.456  1.00 58.24  ? 74   ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 74  ? 32.307 26.429  12.736  1.00 59.37  ? 74   ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 74  ? 31.587 28.504  13.043  1.00 59.26  ? 74   ASP A OD2 1 
ATOM   578  N N   . THR A 1 75  ? 34.306 30.046  13.950  1.00 60.82  ? 75   THR A N   1 
ATOM   579  C CA  . THR A 1 75  ? 34.334 31.506  13.797  1.00 63.43  ? 75   THR A CA  1 
ATOM   580  C C   . THR A 1 75  ? 33.613 32.043  12.560  1.00 64.24  ? 75   THR A C   1 
ATOM   581  O O   . THR A 1 75  ? 33.684 33.243  12.283  1.00 65.58  ? 75   THR A O   1 
ATOM   582  C CB  . THR A 1 75  ? 35.782 32.084  13.832  1.00 64.79  ? 75   THR A CB  1 
ATOM   583  O OG1 . THR A 1 75  ? 36.719 31.086  13.411  1.00 64.41  ? 75   THR A OG1 1 
ATOM   584  C CG2 . THR A 1 75  ? 36.140 32.574  15.255  1.00 66.23  ? 75   THR A CG2 1 
ATOM   585  N N   . LEU A 1 76  ? 32.900 31.174  11.840  1.00 63.94  ? 76   LEU A N   1 
ATOM   586  C CA  . LEU A 1 76  ? 32.125 31.609  10.673  1.00 64.56  ? 76   LEU A CA  1 
ATOM   587  C C   . LEU A 1 76  ? 31.151 32.747  11.013  1.00 65.65  ? 76   LEU A C   1 
ATOM   588  O O   . LEU A 1 76  ? 31.275 33.849  10.464  1.00 67.15  ? 76   LEU A O   1 
ATOM   589  C CB  . LEU A 1 76  ? 31.405 30.438  9.990   1.00 63.56  ? 76   LEU A CB  1 
ATOM   590  C CG  . LEU A 1 76  ? 30.892 30.733  8.563   1.00 65.22  ? 76   LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 76  ? 32.003 31.210  7.591   1.00 65.64  ? 76   LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 76  ? 30.140 29.547  7.973   1.00 64.22  ? 76   LEU A CD2 1 
ATOM   593  N N   . TYR A 1 77  ? 30.203 32.497  11.923  1.00 65.00  ? 77   TYR A N   1 
ATOM   594  C CA  . TYR A 1 77  ? 29.266 33.552  12.350  1.00 65.62  ? 77   TYR A CA  1 
ATOM   595  C C   . TYR A 1 77  ? 29.349 33.771  13.857  1.00 65.45  ? 77   TYR A C   1 
ATOM   596  O O   . TYR A 1 77  ? 28.583 33.172  14.609  1.00 65.06  ? 77   TYR A O   1 
ATOM   597  C CB  . TYR A 1 77  ? 27.825 33.212  11.964  1.00 65.28  ? 77   TYR A CB  1 
ATOM   598  C CG  . TYR A 1 77  ? 27.612 32.851  10.517  1.00 65.11  ? 77   TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 77  ? 27.537 33.840  9.540   1.00 65.91  ? 77   TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 77  ? 27.456 31.518  10.125  1.00 63.68  ? 77   TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 77  ? 27.326 33.519  8.204   1.00 66.45  ? 77   TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 77  ? 27.242 31.182  8.787   1.00 64.02  ? 77   TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 77  ? 27.182 32.188  7.829   1.00 65.41  ? 77   TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 77  ? 26.971 31.884  6.498   1.00 65.13  ? 77   TYR A OH  1 
ATOM   605  N N   . PRO A 1 78  ? 30.290 34.618  14.306  1.00 66.00  ? 78   PRO A N   1 
ATOM   606  C CA  . PRO A 1 78  ? 30.496 34.857  15.749  1.00 65.84  ? 78   PRO A CA  1 
ATOM   607  C C   . PRO A 1 78  ? 29.322 35.570  16.444  1.00 66.03  ? 78   PRO A C   1 
ATOM   608  O O   . PRO A 1 78  ? 28.800 36.559  15.926  1.00 67.09  ? 78   PRO A O   1 
ATOM   609  C CB  . PRO A 1 78  ? 31.762 35.727  15.785  1.00 67.26  ? 78   PRO A CB  1 
ATOM   610  C CG  . PRO A 1 78  ? 31.792 36.409  14.435  1.00 68.50  ? 78   PRO A CG  1 
ATOM   611  C CD  . PRO A 1 78  ? 31.235 35.389  13.472  1.00 66.95  ? 78   PRO A CD  1 
ATOM   612  N N   . GLY A 1 79  ? 28.924 35.062  17.612  1.00 64.75  ? 79   GLY A N   1 
ATOM   613  C CA  . GLY A 1 79  ? 27.788 35.622  18.370  1.00 64.67  ? 79   GLY A CA  1 
ATOM   614  C C   . GLY A 1 79  ? 26.422 35.073  17.965  1.00 63.17  ? 79   GLY A C   1 
ATOM   615  O O   . GLY A 1 79  ? 25.403 35.401  18.574  1.00 63.46  ? 79   GLY A O   1 
ATOM   616  N N   . PHE A 1 80  ? 26.417 34.224  16.940  1.00 60.84  ? 80   PHE A N   1 
ATOM   617  C CA  . PHE A 1 80  ? 25.196 33.716  16.336  1.00 59.72  ? 80   PHE A CA  1 
ATOM   618  C C   . PHE A 1 80  ? 24.790 32.385  16.978  1.00 58.38  ? 80   PHE A C   1 
ATOM   619  O O   . PHE A 1 80  ? 25.560 31.419  16.968  1.00 57.29  ? 80   PHE A O   1 
ATOM   620  C CB  . PHE A 1 80  ? 25.420 33.605  14.818  1.00 59.19  ? 80   PHE A CB  1 
ATOM   621  C CG  . PHE A 1 80  ? 24.417 32.758  14.091  1.00 57.66  ? 80   PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 80  ? 23.078 33.134  14.015  1.00 58.81  ? 80   PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 80  ? 24.824 31.603  13.446  1.00 55.97  ? 80   PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 80  ? 22.157 32.358  13.326  1.00 58.15  ? 80   PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 80  ? 23.913 30.816  12.750  1.00 55.57  ? 80   PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 80  ? 22.577 31.192  12.691  1.00 57.41  ? 80   PHE A CZ  1 
ATOM   627  N N   . GLU A 1 81  ? 23.583 32.344  17.538  1.00 58.51  ? 81   GLU A N   1 
ATOM   628  C CA  . GLU A 1 81  ? 23.090 31.180  18.289  1.00 57.90  ? 81   GLU A CA  1 
ATOM   629  C C   . GLU A 1 81  ? 23.223 29.859  17.514  1.00 55.94  ? 81   GLU A C   1 
ATOM   630  O O   . GLU A 1 81  ? 23.505 28.809  18.099  1.00 54.85  ? 81   GLU A O   1 
ATOM   631  C CB  . GLU A 1 81  ? 21.634 31.413  18.693  1.00 59.31  ? 81   GLU A CB  1 
ATOM   632  C CG  . GLU A 1 81  ? 21.085 30.502  19.796  1.00 62.05  ? 81   GLU A CG  1 
ATOM   633  C CD  . GLU A 1 81  ? 19.913 31.151  20.602  1.00 68.91  ? 81   GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 81  ? 19.393 32.249  20.224  1.00 71.00  ? 81   GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 81  ? 19.517 30.554  21.631  1.00 69.54  ? 81   GLU A OE2 1 
ATOM   636  N N   . GLY A 1 82  ? 23.030 29.926  16.199  1.00 55.19  ? 82   GLY A N   1 
ATOM   637  C CA  . GLY A 1 82  ? 23.081 28.753  15.344  1.00 53.29  ? 82   GLY A CA  1 
ATOM   638  C C   . GLY A 1 82  ? 24.399 28.011  15.388  1.00 51.73  ? 82   GLY A C   1 
ATOM   639  O O   . GLY A 1 82  ? 24.425 26.799  15.191  1.00 50.73  ? 82   GLY A O   1 
ATOM   640  N N   . THR A 1 83  ? 25.487 28.732  15.648  1.00 51.47  ? 83   THR A N   1 
ATOM   641  C CA  . THR A 1 83  ? 26.811 28.115  15.741  1.00 50.70  ? 83   THR A CA  1 
ATOM   642  C C   . THR A 1 83  ? 27.318 28.022  17.192  1.00 50.87  ? 83   THR A C   1 
ATOM   643  O O   . THR A 1 83  ? 27.976 27.039  17.564  1.00 50.20  ? 83   THR A O   1 
ATOM   644  C CB  . THR A 1 83  ? 27.859 28.856  14.887  1.00 50.68  ? 83   THR A CB  1 
ATOM   645  O OG1 . THR A 1 83  ? 27.824 30.243  15.212  1.00 53.41  ? 83   THR A OG1 1 
ATOM   646  C CG2 . THR A 1 83  ? 27.578 28.696  13.413  1.00 49.92  ? 83   THR A CG2 1 
ATOM   647  N N   . GLU A 1 84  ? 26.997 29.029  18.005  1.00 51.74  ? 84   GLU A N   1 
ATOM   648  C CA  . GLU A 1 84  ? 27.480 29.088  19.377  1.00 52.13  ? 84   GLU A CA  1 
ATOM   649  C C   . GLU A 1 84  ? 26.976 27.949  20.244  1.00 50.98  ? 84   GLU A C   1 
ATOM   650  O O   . GLU A 1 84  ? 27.662 27.530  21.173  1.00 50.88  ? 84   GLU A O   1 
ATOM   651  C CB  . GLU A 1 84  ? 27.134 30.424  20.039  1.00 54.00  ? 84   GLU A CB  1 
ATOM   652  C CG  . GLU A 1 84  ? 27.741 31.684  19.376  1.00 58.02  ? 84   GLU A CG  1 
ATOM   653  C CD  . GLU A 1 84  ? 29.273 31.785  19.444  1.00 60.87  ? 84   GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 84  ? 29.946 30.820  19.889  1.00 59.83  ? 84   GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 84  ? 29.799 32.856  19.044  1.00 63.71  ? 84   GLU A OE2 1 
ATOM   656  N N   . MET A 1 85  ? 25.787 27.431  19.954  1.00 50.29  ? 85   MET A N   1 
ATOM   657  C CA  . MET A 1 85  ? 25.265 26.308  20.742  1.00 49.22  ? 85   MET A CA  1 
ATOM   658  C C   . MET A 1 85  ? 26.116 25.028  20.616  1.00 47.16  ? 85   MET A C   1 
ATOM   659  O O   . MET A 1 85  ? 25.946 24.103  21.401  1.00 47.11  ? 85   MET A O   1 
ATOM   660  C CB  . MET A 1 85  ? 23.802 26.025  20.400  1.00 48.96  ? 85   MET A CB  1 
ATOM   661  C CG  . MET A 1 85  ? 23.575 25.528  18.984  1.00 49.22  ? 85   MET A CG  1 
ATOM   662  S SD  . MET A 1 85  ? 21.831 25.202  18.628  1.00 51.72  ? 85   MET A SD  1 
ATOM   663  C CE  . MET A 1 85  ? 21.586 23.688  19.538  1.00 49.40  ? 85   MET A CE  1 
ATOM   664  N N   . TRP A 1 86  ? 27.014 24.971  19.632  1.00 45.53  ? 86   TRP A N   1 
ATOM   665  C CA  . TRP A 1 86  ? 27.860 23.793  19.444  1.00 43.97  ? 86   TRP A CA  1 
ATOM   666  C C   . TRP A 1 86  ? 29.290 24.024  19.929  1.00 43.73  ? 86   TRP A C   1 
ATOM   667  O O   . TRP A 1 86  ? 30.083 23.085  20.043  1.00 43.12  ? 86   TRP A O   1 
ATOM   668  C CB  . TRP A 1 86  ? 27.863 23.341  17.980  1.00 43.16  ? 86   TRP A CB  1 
ATOM   669  C CG  . TRP A 1 86  ? 26.490 23.131  17.420  1.00 42.96  ? 86   TRP A CG  1 
ATOM   670  C CD1 . TRP A 1 86  ? 25.853 23.914  16.508  1.00 42.33  ? 86   TRP A CD1 1 
ATOM   671  C CD2 . TRP A 1 86  ? 25.581 22.073  17.748  1.00 41.98  ? 86   TRP A CD2 1 
ATOM   672  N NE1 . TRP A 1 86  ? 24.612 23.413  16.238  1.00 42.67  ? 86   TRP A NE1 1 
ATOM   673  C CE2 . TRP A 1 86  ? 24.415 22.281  16.985  1.00 42.40  ? 86   TRP A CE2 1 
ATOM   674  C CE3 . TRP A 1 86  ? 25.642 20.969  18.609  1.00 40.75  ? 86   TRP A CE3 1 
ATOM   675  C CZ2 . TRP A 1 86  ? 23.310 21.431  17.060  1.00 42.84  ? 86   TRP A CZ2 1 
ATOM   676  C CZ3 . TRP A 1 86  ? 24.554 20.123  18.682  1.00 41.62  ? 86   TRP A CZ3 1 
ATOM   677  C CH2 . TRP A 1 86  ? 23.397 20.358  17.913  1.00 43.02  ? 86   TRP A CH2 1 
ATOM   678  N N   . ASN A 1 87  ? 29.606 25.280  20.209  1.00 44.20  ? 87   ASN A N   1 
ATOM   679  C CA  . ASN A 1 87  ? 30.918 25.678  20.672  1.00 44.30  ? 87   ASN A CA  1 
ATOM   680  C C   . ASN A 1 87  ? 31.178 25.262  22.128  1.00 44.23  ? 87   ASN A C   1 
ATOM   681  O O   . ASN A 1 87  ? 30.234 25.131  22.920  1.00 44.08  ? 87   ASN A O   1 
ATOM   682  C CB  . ASN A 1 87  ? 31.073 27.185  20.500  1.00 45.47  ? 87   ASN A CB  1 
ATOM   683  C CG  . ASN A 1 87  ? 31.490 27.565  19.097  1.00 46.64  ? 87   ASN A CG  1 
ATOM   684  O OD1 . ASN A 1 87  ? 31.824 26.701  18.285  1.00 49.15  ? 87   ASN A OD1 1 
ATOM   685  N ND2 . ASN A 1 87  ? 31.492 28.859  18.805  1.00 46.55  ? 87   ASN A ND2 1 
ATOM   686  N N   . PRO A 1 88  ? 32.459 25.041  22.482  1.00 43.88  ? 88   PRO A N   1 
ATOM   687  C CA  . PRO A 1 88  ? 32.792 24.655  23.853  1.00 43.98  ? 88   PRO A CA  1 
ATOM   688  C C   . PRO A 1 88  ? 32.261 25.650  24.880  1.00 45.02  ? 88   PRO A C   1 
ATOM   689  O O   . PRO A 1 88  ? 32.322 26.858  24.666  1.00 45.13  ? 88   PRO A O   1 
ATOM   690  C CB  . PRO A 1 88  ? 34.321 24.640  23.856  1.00 44.22  ? 88   PRO A CB  1 
ATOM   691  C CG  . PRO A 1 88  ? 34.705 24.413  22.443  1.00 43.77  ? 88   PRO A CG  1 
ATOM   692  C CD  . PRO A 1 88  ? 33.655 25.118  21.625  1.00 43.80  ? 88   PRO A CD  1 
ATOM   693  N N   . ASN A 1 89  ? 31.729 25.128  25.983  1.00 45.28  ? 89   ASN A N   1 
ATOM   694  C CA  . ASN A 1 89  ? 31.163 25.961  27.028  1.00 45.69  ? 89   ASN A CA  1 
ATOM   695  C C   . ASN A 1 89  ? 31.936 25.847  28.340  1.00 46.45  ? 89   ASN A C   1 
ATOM   696  O O   . ASN A 1 89  ? 31.494 26.351  29.375  1.00 47.65  ? 89   ASN A O   1 
ATOM   697  C CB  . ASN A 1 89  ? 29.668 25.668  27.208  1.00 45.25  ? 89   ASN A CB  1 
ATOM   698  C CG  . ASN A 1 89  ? 29.383 24.247  27.686  1.00 45.36  ? 89   ASN A CG  1 
ATOM   699  O OD1 . ASN A 1 89  ? 30.226 23.349  27.582  1.00 44.89  ? 89   ASN A OD1 1 
ATOM   700  N ND2 . ASN A 1 89  ? 28.165 24.032  28.200  1.00 45.12  ? 89   ASN A ND2 1 
ATOM   701  N N   . ARG A 1 90  ? 33.094 25.186  28.288  1.00 46.07  ? 90   ARG A N   1 
ATOM   702  C CA  . ARG A 1 90  ? 34.045 25.145  29.409  1.00 46.89  ? 90   ARG A CA  1 
ATOM   703  C C   . ARG A 1 90  ? 35.476 25.344  28.886  1.00 46.95  ? 90   ARG A C   1 
ATOM   704  O O   . ARG A 1 90  ? 35.699 25.301  27.680  1.00 46.95  ? 90   ARG A O   1 
ATOM   705  C CB  . ARG A 1 90  ? 33.892 23.835  30.209  1.00 46.77  ? 90   ARG A CB  1 
ATOM   706  C CG  . ARG A 1 90  ? 32.600 23.725  31.057  1.00 47.97  ? 90   ARG A CG  1 
ATOM   707  C CD  . ARG A 1 90  ? 32.554 24.749  32.217  1.00 53.99  ? 90   ARG A CD  1 
ATOM   708  N NE  . ARG A 1 90  ? 31.310 24.667  32.984  1.00 60.03  ? 90   ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 90  ? 30.125 25.179  32.604  1.00 62.13  ? 90   ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 90  ? 29.989 25.847  31.460  1.00 62.33  ? 90   ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 90  ? 29.057 25.024  33.377  1.00 62.49  ? 90   ARG A NH2 1 
ATOM   712  N N   . GLU A 1 91  ? 36.436 25.595  29.771  1.00 47.83  ? 91   GLU A N   1 
ATOM   713  C CA  . GLU A 1 91  ? 37.852 25.721  29.380  1.00 48.67  ? 91   GLU A CA  1 
ATOM   714  C C   . GLU A 1 91  ? 38.324 24.566  28.489  1.00 46.77  ? 91   GLU A C   1 
ATOM   715  O O   . GLU A 1 91  ? 37.995 23.390  28.739  1.00 46.13  ? 91   GLU A O   1 
ATOM   716  C CB  . GLU A 1 91  ? 38.750 25.781  30.632  1.00 49.82  ? 91   GLU A CB  1 
ATOM   717  C CG  . GLU A 1 91  ? 40.279 25.795  30.338  1.00 52.52  ? 91   GLU A CG  1 
ATOM   718  C CD  . GLU A 1 91  ? 41.192 25.605  31.576  1.00 54.25  ? 91   GLU A CD  1 
ATOM   719  O OE1 . GLU A 1 91  ? 40.691 25.422  32.723  1.00 57.82  ? 91   GLU A OE1 1 
ATOM   720  O OE2 . GLU A 1 91  ? 42.436 25.634  31.388  1.00 57.80  ? 91   GLU A OE2 1 
ATOM   721  N N   . LEU A 1 92  ? 39.104 24.895  27.460  1.00 46.02  ? 92   LEU A N   1 
ATOM   722  C CA  . LEU A 1 92  ? 39.741 23.873  26.618  1.00 44.46  ? 92   LEU A CA  1 
ATOM   723  C C   . LEU A 1 92  ? 41.020 23.346  27.257  1.00 45.07  ? 92   LEU A C   1 
ATOM   724  O O   . LEU A 1 92  ? 41.915 24.117  27.616  1.00 46.53  ? 92   LEU A O   1 
ATOM   725  C CB  . LEU A 1 92  ? 40.049 24.421  25.223  1.00 44.17  ? 92   LEU A CB  1 
ATOM   726  C CG  . LEU A 1 92  ? 38.916 25.008  24.381  1.00 42.96  ? 92   LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 92  ? 39.467 25.567  23.086  1.00 43.64  ? 92   LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 92  ? 37.902 23.929  24.077  1.00 42.06  ? 92   LEU A CD2 1 
ATOM   729  N N   . SER A 1 93  ? 41.111 22.031  27.404  1.00 44.17  ? 93   SER A N   1 
ATOM   730  C CA  . SER A 1 93  ? 42.306 21.414  27.976  1.00 44.39  ? 93   SER A CA  1 
ATOM   731  C C   . SER A 1 93  ? 42.502 19.984  27.469  1.00 43.94  ? 93   SER A C   1 
ATOM   732  O O   . SER A 1 93  ? 41.544 19.319  27.067  1.00 42.65  ? 93   SER A O   1 
ATOM   733  C CB  . SER A 1 93  ? 42.228 21.429  29.505  1.00 44.83  ? 93   SER A CB  1 
ATOM   734  O OG  . SER A 1 93  ? 43.295 20.705  30.087  1.00 43.81  ? 93   SER A OG  1 
ATOM   735  N N   . GLU A 1 94  ? 43.750 19.522  27.478  1.00 44.78  ? 94   GLU A N   1 
ATOM   736  C CA  . GLU A 1 94  ? 44.047 18.139  27.120  1.00 44.42  ? 94   GLU A CA  1 
ATOM   737  C C   . GLU A 1 94  ? 43.654 17.237  28.268  1.00 44.53  ? 94   GLU A C   1 
ATOM   738  O O   . GLU A 1 94  ? 43.377 16.051  28.063  1.00 44.71  ? 94   GLU A O   1 
ATOM   739  C CB  . GLU A 1 94  ? 45.521 17.949  26.762  1.00 45.39  ? 94   GLU A CB  1 
ATOM   740  C CG  . GLU A 1 94  ? 45.872 18.394  25.355  1.00 45.18  ? 94   GLU A CG  1 
ATOM   741  C CD  . GLU A 1 94  ? 47.344 18.234  25.047  1.00 47.41  ? 94   GLU A CD  1 
ATOM   742  O OE1 . GLU A 1 94  ? 47.773 17.117  24.687  1.00 48.53  ? 94   GLU A OE1 1 
ATOM   743  O OE2 . GLU A 1 94  ? 48.078 19.235  25.154  1.00 49.58  ? 94   GLU A OE2 1 
ATOM   744  N N   . ASP A 1 95  ? 43.624 17.808  29.470  1.00 44.72  ? 95   ASP A N   1 
ATOM   745  C CA  . ASP A 1 95  ? 43.076 17.150  30.641  1.00 44.77  ? 95   ASP A CA  1 
ATOM   746  C C   . ASP A 1 95  ? 41.567 17.270  30.525  1.00 43.30  ? 95   ASP A C   1 
ATOM   747  O O   . ASP A 1 95  ? 40.980 18.252  30.981  1.00 43.83  ? 95   ASP A O   1 
ATOM   748  C CB  . ASP A 1 95  ? 43.577 17.857  31.902  1.00 46.26  ? 95   ASP A CB  1 
ATOM   749  C CG  . ASP A 1 95  ? 43.082 17.215  33.192  1.00 48.29  ? 95   ASP A CG  1 
ATOM   750  O OD1 . ASP A 1 95  ? 42.272 16.254  33.162  1.00 49.19  ? 95   ASP A OD1 1 
ATOM   751  O OD2 . ASP A 1 95  ? 43.519 17.697  34.261  1.00 51.73  ? 95   ASP A OD2 1 
ATOM   752  N N   . CYS A 1 96  ? 40.938 16.282  29.905  1.00 41.88  ? 96   CYS A N   1 
ATOM   753  C CA  . CYS A 1 96  ? 39.532 16.413  29.545  1.00 41.01  ? 96   CYS A CA  1 
ATOM   754  C C   . CYS A 1 96  ? 38.701 15.125  29.597  1.00 40.07  ? 96   CYS A C   1 
ATOM   755  O O   . CYS A 1 96  ? 37.533 15.125  29.206  1.00 39.58  ? 96   CYS A O   1 
ATOM   756  C CB  . CYS A 1 96  ? 39.437 17.008  28.144  1.00 40.75  ? 96   CYS A CB  1 
ATOM   757  S SG  . CYS A 1 96  ? 40.041 15.887  26.864  1.00 40.99  ? 96   CYS A SG  1 
ATOM   758  N N   . LEU A 1 97  ? 39.296 14.041  30.074  1.00 40.02  ? 97   LEU A N   1 
ATOM   759  C CA  . LEU A 1 97  ? 38.611 12.764  30.104  1.00 39.66  ? 97   LEU A CA  1 
ATOM   760  C C   . LEU A 1 97  ? 37.744 12.630  31.368  1.00 39.80  ? 97   LEU A C   1 
ATOM   761  O O   . LEU A 1 97  ? 38.166 12.080  32.392  1.00 40.54  ? 97   LEU A O   1 
ATOM   762  C CB  . LEU A 1 97  ? 39.615 11.603  29.924  1.00 40.27  ? 97   LEU A CB  1 
ATOM   763  C CG  . LEU A 1 97  ? 40.414 11.656  28.609  1.00 40.21  ? 97   LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 97  ? 41.226 10.390  28.333  1.00 39.62  ? 97   LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 97  ? 39.457 11.932  27.443  1.00 39.90  ? 97   LEU A CD2 1 
ATOM   766  N N   . TYR A 1 98  ? 36.525 13.151  31.285  1.00 39.00  ? 98   TYR A N   1 
ATOM   767  C CA  . TYR A 1 98  ? 35.596 13.095  32.399  1.00 39.68  ? 98   TYR A CA  1 
ATOM   768  C C   . TYR A 1 98  ? 34.247 12.687  31.855  1.00 39.41  ? 98   TYR A C   1 
ATOM   769  O O   . TYR A 1 98  ? 33.941 12.961  30.697  1.00 39.72  ? 98   TYR A O   1 
ATOM   770  C CB  . TYR A 1 98  ? 35.502 14.464  33.106  1.00 40.42  ? 98   TYR A CB  1 
ATOM   771  C CG  . TYR A 1 98  ? 36.827 14.973  33.672  1.00 41.19  ? 98   TYR A CG  1 
ATOM   772  C CD1 . TYR A 1 98  ? 37.173 14.760  35.020  1.00 40.82  ? 98   TYR A CD1 1 
ATOM   773  C CD2 . TYR A 1 98  ? 37.734 15.654  32.854  1.00 39.74  ? 98   TYR A CD2 1 
ATOM   774  C CE1 . TYR A 1 98  ? 38.383 15.216  35.533  1.00 41.61  ? 98   TYR A CE1 1 
ATOM   775  C CE2 . TYR A 1 98  ? 38.942 16.111  33.350  1.00 42.20  ? 98   TYR A CE2 1 
ATOM   776  C CZ  . TYR A 1 98  ? 39.265 15.891  34.686  1.00 43.48  ? 98   TYR A CZ  1 
ATOM   777  O OH  . TYR A 1 98  ? 40.470 16.362  35.146  1.00 44.80  ? 98   TYR A OH  1 
ATOM   778  N N   . LEU A 1 99  ? 33.436 12.028  32.670  1.00 39.56  ? 99   LEU A N   1 
ATOM   779  C CA  . LEU A 1 99  ? 32.066 11.741  32.272  1.00 38.95  ? 99   LEU A CA  1 
ATOM   780  C C   . LEU A 1 99  ? 31.072 12.383  33.250  1.00 39.73  ? 99   LEU A C   1 
ATOM   781  O O   . LEU A 1 99  ? 31.482 12.898  34.306  1.00 40.32  ? 99   LEU A O   1 
ATOM   782  C CB  . LEU A 1 99  ? 31.839 10.230  32.140  1.00 38.70  ? 99   LEU A CB  1 
ATOM   783  C CG  . LEU A 1 99  ? 32.273 9.294   33.270  1.00 38.58  ? 99   LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 99  ? 31.245 9.262   34.371  1.00 38.26  ? 99   LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 99  ? 32.481 7.897   32.718  1.00 37.04  ? 99   LEU A CD2 1 
ATOM   786  N N   . ASN A 1 100 ? 29.783 12.329  32.888  1.00 39.24  ? 100  ASN A N   1 
ATOM   787  C CA  . ASN A 1 100 ? 28.683 12.939  33.631  1.00 39.37  ? 100  ASN A CA  1 
ATOM   788  C C   . ASN A 1 100 ? 27.550 11.918  33.822  1.00 40.01  ? 100  ASN A C   1 
ATOM   789  O O   . ASN A 1 100 ? 27.289 11.102  32.938  1.00 40.36  ? 100  ASN A O   1 
ATOM   790  C CB  . ASN A 1 100 ? 28.148 14.152  32.866  1.00 38.72  ? 100  ASN A CB  1 
ATOM   791  C CG  . ASN A 1 100 ? 29.259 15.082  32.354  1.00 38.97  ? 100  ASN A CG  1 
ATOM   792  O OD1 . ASN A 1 100 ? 29.998 15.695  33.134  1.00 39.81  ? 100  ASN A OD1 1 
ATOM   793  N ND2 . ASN A 1 100 ? 29.362 15.203  31.040  1.00 37.83  ? 100  ASN A ND2 1 
ATOM   794  N N   . VAL A 1 101 ? 26.868 11.967  34.963  1.00 40.52  ? 101  VAL A N   1 
ATOM   795  C CA  . VAL A 1 101 ? 25.779 11.042  35.253  1.00 40.83  ? 101  VAL A CA  1 
ATOM   796  C C   . VAL A 1 101 ? 24.552 11.804  35.767  1.00 41.74  ? 101  VAL A C   1 
ATOM   797  O O   . VAL A 1 101 ? 24.657 12.635  36.662  1.00 42.38  ? 101  VAL A O   1 
ATOM   798  C CB  . VAL A 1 101 ? 26.198 9.983   36.304  1.00 41.68  ? 101  VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 101 ? 25.014 9.089   36.674  1.00 42.32  ? 101  VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 101 ? 27.377 9.138   35.817  1.00 40.20  ? 101  VAL A CG2 1 
ATOM   801  N N   . TRP A 1 102 ? 23.397 11.527  35.178  1.00 42.10  ? 102  TRP A N   1 
ATOM   802  C CA  . TRP A 1 102 ? 22.122 12.050  35.659  1.00 43.17  ? 102  TRP A CA  1 
ATOM   803  C C   . TRP A 1 102 ? 21.258 10.874  36.099  1.00 44.27  ? 102  TRP A C   1 
ATOM   804  O O   . TRP A 1 102 ? 21.188 9.847   35.403  1.00 44.13  ? 102  TRP A O   1 
ATOM   805  C CB  . TRP A 1 102 ? 21.395 12.793  34.549  1.00 42.76  ? 102  TRP A CB  1 
ATOM   806  C CG  . TRP A 1 102 ? 21.917 14.166  34.228  1.00 42.31  ? 102  TRP A CG  1 
ATOM   807  C CD1 . TRP A 1 102 ? 21.516 15.353  34.793  1.00 42.79  ? 102  TRP A CD1 1 
ATOM   808  C CD2 . TRP A 1 102 ? 22.889 14.505  33.238  1.00 41.13  ? 102  TRP A CD2 1 
ATOM   809  N NE1 . TRP A 1 102 ? 22.195 16.404  34.222  1.00 42.45  ? 102  TRP A NE1 1 
ATOM   810  C CE2 . TRP A 1 102 ? 23.044 15.911  33.265  1.00 41.81  ? 102  TRP A CE2 1 
ATOM   811  C CE3 . TRP A 1 102 ? 23.662 13.758  32.339  1.00 40.89  ? 102  TRP A CE3 1 
ATOM   812  C CZ2 . TRP A 1 102 ? 23.937 16.582  32.423  1.00 41.19  ? 102  TRP A CZ2 1 
ATOM   813  C CZ3 . TRP A 1 102 ? 24.543 14.430  31.494  1.00 39.25  ? 102  TRP A CZ3 1 
ATOM   814  C CH2 . TRP A 1 102 ? 24.671 15.824  31.545  1.00 40.03  ? 102  TRP A CH2 1 
ATOM   815  N N   . THR A 1 103 ? 20.621 11.011  37.257  1.00 45.26  ? 103  THR A N   1 
ATOM   816  C CA  . THR A 1 103 ? 19.742 9.971   37.781  1.00 46.67  ? 103  THR A CA  1 
ATOM   817  C C   . THR A 1 103 ? 18.522 10.612  38.458  1.00 48.17  ? 103  THR A C   1 
ATOM   818  O O   . THR A 1 103 ? 18.584 11.769  38.882  1.00 48.37  ? 103  THR A O   1 
ATOM   819  C CB  . THR A 1 103 ? 20.467 9.051   38.811  1.00 47.24  ? 103  THR A CB  1 
ATOM   820  O OG1 . THR A 1 103 ? 20.556 9.716   40.071  1.00 48.27  ? 103  THR A OG1 1 
ATOM   821  C CG2 . THR A 1 103 ? 21.863 8.669   38.363  1.00 45.56  ? 103  THR A CG2 1 
ATOM   822  N N   . PRO A 1 104 ? 17.402 9.874   38.551  1.00 49.45  ? 104  PRO A N   1 
ATOM   823  C CA  . PRO A 1 104 ? 16.263 10.308  39.357  1.00 51.37  ? 104  PRO A CA  1 
ATOM   824  C C   . PRO A 1 104 ? 16.664 10.728  40.770  1.00 52.44  ? 104  PRO A C   1 
ATOM   825  O O   . PRO A 1 104 ? 17.711 10.295  41.264  1.00 52.50  ? 104  PRO A O   1 
ATOM   826  C CB  . PRO A 1 104 ? 15.396 9.053   39.415  1.00 52.10  ? 104  PRO A CB  1 
ATOM   827  C CG  . PRO A 1 104 ? 15.646 8.410   38.111  1.00 50.73  ? 104  PRO A CG  1 
ATOM   828  C CD  . PRO A 1 104 ? 17.113 8.602   37.864  1.00 49.74  ? 104  PRO A CD  1 
ATOM   829  N N   . TYR A 1 105 ? 15.854 11.586  41.388  1.00 53.67  ? 105  TYR A N   1 
ATOM   830  C CA  . TYR A 1 105 ? 16.064 11.998  42.768  1.00 55.11  ? 105  TYR A CA  1 
ATOM   831  C C   . TYR A 1 105 ? 14.796 11.743  43.597  1.00 58.12  ? 105  TYR A C   1 
ATOM   832  O O   . TYR A 1 105 ? 13.721 12.263  43.279  1.00 58.87  ? 105  TYR A O   1 
ATOM   833  C CB  . TYR A 1 105 ? 16.498 13.469  42.850  1.00 53.79  ? 105  TYR A CB  1 
ATOM   834  C CG  . TYR A 1 105 ? 16.821 13.998  44.255  1.00 53.35  ? 105  TYR A CG  1 
ATOM   835  C CD1 . TYR A 1 105 ? 18.120 14.326  44.603  1.00 50.88  ? 105  TYR A CD1 1 
ATOM   836  C CD2 . TYR A 1 105 ? 15.817 14.195  45.215  1.00 54.86  ? 105  TYR A CD2 1 
ATOM   837  C CE1 . TYR A 1 105 ? 18.431 14.817  45.860  1.00 51.48  ? 105  TYR A CE1 1 
ATOM   838  C CE2 . TYR A 1 105 ? 16.124 14.694  46.491  1.00 55.45  ? 105  TYR A CE2 1 
ATOM   839  C CZ  . TYR A 1 105 ? 17.444 15.003  46.795  1.00 54.09  ? 105  TYR A CZ  1 
ATOM   840  O OH  . TYR A 1 105 ? 17.787 15.493  48.029  1.00 54.46  ? 105  TYR A OH  1 
ATOM   841  N N   . PRO A 1 106 ? 14.912 10.927  44.658  1.00 60.08  ? 106  PRO A N   1 
ATOM   842  C CA  . PRO A 1 106 ? 16.114 10.182  45.057  1.00 60.32  ? 106  PRO A CA  1 
ATOM   843  C C   . PRO A 1 106 ? 16.469 9.088   44.044  1.00 60.16  ? 106  PRO A C   1 
ATOM   844  O O   . PRO A 1 106 ? 15.636 8.740   43.203  1.00 60.22  ? 106  PRO A O   1 
ATOM   845  C CB  . PRO A 1 106 ? 15.698 9.553   46.394  1.00 62.19  ? 106  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 106 ? 14.187 9.460   46.322  1.00 62.96  ? 106  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 106 ? 13.778 10.693  45.578  1.00 62.12  ? 106  PRO A CD  1 
ATOM   848  N N   . ARG A 1 107 ? 17.694 8.558   44.115  1.00 60.40  ? 107  ARG A N   1 
ATOM   849  C CA  . ARG A 1 107 ? 18.112 7.471   43.212  1.00 60.63  ? 107  ARG A CA  1 
ATOM   850  C C   . ARG A 1 107 ? 17.139 6.302   43.288  1.00 62.61  ? 107  ARG A C   1 
ATOM   851  O O   . ARG A 1 107 ? 16.668 5.955   44.378  1.00 64.41  ? 107  ARG A O   1 
ATOM   852  C CB  . ARG A 1 107 ? 19.521 6.977   43.529  1.00 59.88  ? 107  ARG A CB  1 
ATOM   853  C CG  . ARG A 1 107 ? 20.630 7.924   43.118  1.00 58.96  ? 107  ARG A CG  1 
ATOM   854  C CD  . ARG A 1 107 ? 21.991 7.282   43.293  1.00 59.51  ? 107  ARG A CD  1 
ATOM   855  N NE  . ARG A 1 107 ? 22.243 6.780   44.649  1.00 61.03  ? 107  ARG A NE  1 
ATOM   856  C CZ  . ARG A 1 107 ? 22.652 7.544   45.659  1.00 61.79  ? 107  ARG A CZ  1 
ATOM   857  N NH1 . ARG A 1 107 ? 22.836 8.843   45.463  1.00 61.71  ? 107  ARG A NH1 1 
ATOM   858  N NH2 . ARG A 1 107 ? 22.871 7.018   46.859  1.00 62.24  ? 107  ARG A NH2 1 
ATOM   859  N N   . PRO A 1 108 ? 16.851 5.676   42.136  1.00 62.91  ? 108  PRO A N   1 
ATOM   860  C CA  . PRO A 1 108 ? 15.838 4.604   42.079  1.00 64.80  ? 108  PRO A CA  1 
ATOM   861  C C   . PRO A 1 108 ? 16.256 3.371   42.899  1.00 66.16  ? 108  PRO A C   1 
ATOM   862  O O   . PRO A 1 108 ? 17.433 3.008   42.910  1.00 65.34  ? 108  PRO A O   1 
ATOM   863  C CB  . PRO A 1 108 ? 15.776 4.265   40.582  1.00 64.03  ? 108  PRO A CB  1 
ATOM   864  C CG  . PRO A 1 108 ? 17.135 4.702   40.033  1.00 61.56  ? 108  PRO A CG  1 
ATOM   865  C CD  . PRO A 1 108 ? 17.493 5.918   40.826  1.00 61.12  ? 108  PRO A CD  1 
ATOM   866  N N   . ALA A 1 109 ? 15.305 2.744   43.586  1.00 68.47  ? 109  ALA A N   1 
ATOM   867  C CA  . ALA A 1 109 ? 15.621 1.569   44.420  1.00 70.01  ? 109  ALA A CA  1 
ATOM   868  C C   . ALA A 1 109 ? 15.898 0.293   43.602  1.00 70.13  ? 109  ALA A C   1 
ATOM   869  O O   . ALA A 1 109 ? 16.735 -0.526  43.996  1.00 70.56  ? 109  ALA A O   1 
ATOM   870  C CB  . ALA A 1 109 ? 14.522 1.325   45.447  1.00 72.18  ? 109  ALA A CB  1 
ATOM   871  N N   . SER A 1 110 ? 15.199 0.142   42.472  1.00 69.69  ? 110  SER A N   1 
ATOM   872  C CA  . SER A 1 110 ? 15.349 -1.018  41.582  1.00 69.39  ? 110  SER A CA  1 
ATOM   873  C C   . SER A 1 110 ? 16.198 -0.676  40.343  1.00 66.80  ? 110  SER A C   1 
ATOM   874  O O   . SER A 1 110 ? 16.030 0.405   39.779  1.00 65.77  ? 110  SER A O   1 
ATOM   875  C CB  . SER A 1 110 ? 13.965 -1.514  41.150  1.00 71.01  ? 110  SER A CB  1 
ATOM   876  O OG  . SER A 1 110 ? 13.399 -0.633  40.190  1.00 70.63  ? 110  SER A OG  1 
ATOM   877  N N   . PRO A 1 111 ? 17.103 -1.595  39.920  1.00 65.86  ? 111  PRO A N   1 
ATOM   878  C CA  . PRO A 1 111 ? 18.044 -1.423  38.790  1.00 63.56  ? 111  PRO A CA  1 
ATOM   879  C C   . PRO A 1 111 ? 17.415 -0.877  37.494  1.00 62.10  ? 111  PRO A C   1 
ATOM   880  O O   . PRO A 1 111 ? 16.491 -1.484  36.937  1.00 62.90  ? 111  PRO A O   1 
ATOM   881  C CB  . PRO A 1 111 ? 18.586 -2.838  38.568  1.00 64.53  ? 111  PRO A CB  1 
ATOM   882  C CG  . PRO A 1 111 ? 18.498 -3.477  39.899  1.00 66.19  ? 111  PRO A CG  1 
ATOM   883  C CD  . PRO A 1 111 ? 17.276 -2.911  40.563  1.00 67.37  ? 111  PRO A CD  1 
ATOM   884  N N   . THR A 1 112 ? 17.960 0.240   37.012  1.00 59.17  ? 112  THR A N   1 
ATOM   885  C CA  . THR A 1 112 ? 17.328 1.060   35.989  1.00 57.50  ? 112  THR A CA  1 
ATOM   886  C C   . THR A 1 112 ? 18.139 1.083   34.691  1.00 55.49  ? 112  THR A C   1 
ATOM   887  O O   . THR A 1 112 ? 19.347 1.258   34.734  1.00 54.19  ? 112  THR A O   1 
ATOM   888  C CB  . THR A 1 112 ? 17.156 2.502   36.532  1.00 57.05  ? 112  THR A CB  1 
ATOM   889  O OG1 . THR A 1 112 ? 16.454 2.445   37.777  1.00 58.76  ? 112  THR A OG1 1 
ATOM   890  C CG2 . THR A 1 112 ? 16.391 3.399   35.557  1.00 56.10  ? 112  THR A CG2 1 
ATOM   891  N N   . PRO A 1 113 ? 17.470 0.902   33.534  1.00 55.11  ? 113  PRO A N   1 
ATOM   892  C CA  . PRO A 1 113 ? 18.110 0.956   32.212  1.00 53.81  ? 113  PRO A CA  1 
ATOM   893  C C   . PRO A 1 113 ? 18.936 2.232   31.980  1.00 51.73  ? 113  PRO A C   1 
ATOM   894  O O   . PRO A 1 113 ? 18.519 3.329   32.360  1.00 51.24  ? 113  PRO A O   1 
ATOM   895  C CB  . PRO A 1 113 ? 16.918 0.904   31.250  1.00 54.59  ? 113  PRO A CB  1 
ATOM   896  C CG  . PRO A 1 113 ? 15.878 0.181   32.005  1.00 56.15  ? 113  PRO A CG  1 
ATOM   897  C CD  . PRO A 1 113 ? 16.030 0.614   33.421  1.00 56.22  ? 113  PRO A CD  1 
ATOM   898  N N   . VAL A 1 114 ? 20.094 2.068   31.346  1.00 50.52  ? 114  VAL A N   1 
ATOM   899  C CA  . VAL A 1 114 ? 21.106 3.122   31.254  1.00 48.73  ? 114  VAL A CA  1 
ATOM   900  C C   . VAL A 1 114 ? 21.267 3.574   29.812  1.00 47.76  ? 114  VAL A C   1 
ATOM   901  O O   . VAL A 1 114 ? 21.497 2.752   28.939  1.00 48.69  ? 114  VAL A O   1 
ATOM   902  C CB  . VAL A 1 114 ? 22.478 2.604   31.776  1.00 48.49  ? 114  VAL A CB  1 
ATOM   903  C CG1 . VAL A 1 114 ? 23.586 3.640   31.575  1.00 46.65  ? 114  VAL A CG1 1 
ATOM   904  C CG2 . VAL A 1 114 ? 22.374 2.191   33.238  1.00 49.07  ? 114  VAL A CG2 1 
ATOM   905  N N   . LEU A 1 115 ? 21.144 4.872   29.563  1.00 46.73  ? 115  LEU A N   1 
ATOM   906  C CA  . LEU A 1 115 ? 21.403 5.430   28.243  1.00 45.92  ? 115  LEU A CA  1 
ATOM   907  C C   . LEU A 1 115 ? 22.758 6.125   28.264  1.00 44.59  ? 115  LEU A C   1 
ATOM   908  O O   . LEU A 1 115 ? 23.011 6.937   29.149  1.00 44.77  ? 115  LEU A O   1 
ATOM   909  C CB  . LEU A 1 115 ? 20.322 6.450   27.881  1.00 46.30  ? 115  LEU A CB  1 
ATOM   910  C CG  . LEU A 1 115 ? 18.951 5.981   27.388  1.00 48.31  ? 115  LEU A CG  1 
ATOM   911  C CD1 . LEU A 1 115 ? 17.881 6.927   27.847  1.00 49.70  ? 115  LEU A CD1 1 
ATOM   912  C CD2 . LEU A 1 115 ? 18.951 5.944   25.875  1.00 50.68  ? 115  LEU A CD2 1 
ATOM   913  N N   . ILE A 1 116 ? 23.623 5.803   27.303  1.00 43.46  ? 116  ILE A N   1 
ATOM   914  C CA  . ILE A 1 116 ? 24.919 6.459   27.178  1.00 42.10  ? 116  ILE A CA  1 
ATOM   915  C C   . ILE A 1 116 ? 25.017 7.289   25.892  1.00 41.36  ? 116  ILE A C   1 
ATOM   916  O O   . ILE A 1 116 ? 24.870 6.751   24.784  1.00 41.31  ? 116  ILE A O   1 
ATOM   917  C CB  . ILE A 1 116 ? 26.088 5.440   27.236  1.00 42.39  ? 116  ILE A CB  1 
ATOM   918  C CG1 . ILE A 1 116 ? 25.982 4.601   28.511  1.00 43.13  ? 116  ILE A CG1 1 
ATOM   919  C CG2 . ILE A 1 116 ? 27.444 6.157   27.139  1.00 39.71  ? 116  ILE A CG2 1 
ATOM   920  C CD1 . ILE A 1 116 ? 26.918 3.426   28.564  1.00 42.29  ? 116  ILE A CD1 1 
ATOM   921  N N   . TRP A 1 117 ? 25.296 8.584   26.049  1.00 40.44  ? 117  TRP A N   1 
ATOM   922  C CA  . TRP A 1 117 ? 25.367 9.518   24.926  1.00 40.04  ? 117  TRP A CA  1 
ATOM   923  C C   . TRP A 1 117 ? 26.794 9.755   24.436  1.00 39.89  ? 117  TRP A C   1 
ATOM   924  O O   . TRP A 1 117 ? 27.710 9.962   25.238  1.00 39.88  ? 117  TRP A O   1 
ATOM   925  C CB  . TRP A 1 117 ? 24.735 10.850  25.312  1.00 39.93  ? 117  TRP A CB  1 
ATOM   926  C CG  . TRP A 1 117 ? 24.834 11.931  24.249  1.00 39.64  ? 117  TRP A CG  1 
ATOM   927  C CD1 . TRP A 1 117 ? 25.624 13.035  24.285  1.00 39.97  ? 117  TRP A CD1 1 
ATOM   928  C CD2 . TRP A 1 117 ? 24.107 11.998  23.013  1.00 39.90  ? 117  TRP A CD2 1 
ATOM   929  N NE1 . TRP A 1 117 ? 25.444 13.787  23.150  1.00 40.57  ? 117  TRP A NE1 1 
ATOM   930  C CE2 . TRP A 1 117 ? 24.513 13.174  22.354  1.00 39.65  ? 117  TRP A CE2 1 
ATOM   931  C CE3 . TRP A 1 117 ? 23.153 11.171  22.396  1.00 40.88  ? 117  TRP A CE3 1 
ATOM   932  C CZ2 . TRP A 1 117 ? 23.994 13.558  21.114  1.00 39.03  ? 117  TRP A CZ2 1 
ATOM   933  C CZ3 . TRP A 1 117 ? 22.643 11.548  21.164  1.00 40.56  ? 117  TRP A CZ3 1 
ATOM   934  C CH2 . TRP A 1 117 ? 23.069 12.732  20.534  1.00 39.66  ? 117  TRP A CH2 1 
ATOM   935  N N   . ILE A 1 118 ? 26.973 9.734   23.114  1.00 39.69  ? 118  ILE A N   1 
ATOM   936  C CA  . ILE A 1 118 ? 28.261 10.037  22.498  1.00 39.04  ? 118  ILE A CA  1 
ATOM   937  C C   . ILE A 1 118 ? 28.065 11.165  21.493  1.00 39.52  ? 118  ILE A C   1 
ATOM   938  O O   . ILE A 1 118 ? 27.384 10.977  20.478  1.00 39.95  ? 118  ILE A O   1 
ATOM   939  C CB  . ILE A 1 118 ? 28.853 8.823   21.779  1.00 39.05  ? 118  ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 118 ? 28.835 7.588   22.693  1.00 38.74  ? 118  ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 118 ? 30.257 9.149   21.277  1.00 37.68  ? 118  ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 118 ? 29.469 6.360   22.090  1.00 37.40  ? 118  ILE A CD1 1 
ATOM   943  N N   . TYR A 1 119 ? 28.659 12.330  21.770  1.00 39.42  ? 119  TYR A N   1 
ATOM   944  C CA  . TYR A 1 119 ? 28.427 13.511  20.946  1.00 39.31  ? 119  TYR A CA  1 
ATOM   945  C C   . TYR A 1 119 ? 29.092 13.425  19.572  1.00 39.32  ? 119  TYR A C   1 
ATOM   946  O O   . TYR A 1 119 ? 30.074 12.699  19.389  1.00 38.92  ? 119  TYR A O   1 
ATOM   947  C CB  . TYR A 1 119 ? 28.866 14.796  21.663  1.00 39.29  ? 119  TYR A CB  1 
ATOM   948  C CG  . TYR A 1 119 ? 30.316 14.836  22.106  1.00 39.05  ? 119  TYR A CG  1 
ATOM   949  C CD1 . TYR A 1 119 ? 31.351 15.093  21.193  1.00 39.07  ? 119  TYR A CD1 1 
ATOM   950  C CD2 . TYR A 1 119 ? 30.651 14.645  23.447  1.00 38.79  ? 119  TYR A CD2 1 
ATOM   951  C CE1 . TYR A 1 119 ? 32.691 15.132  21.612  1.00 39.02  ? 119  TYR A CE1 1 
ATOM   952  C CE2 . TYR A 1 119 ? 31.968 14.679  23.875  1.00 39.91  ? 119  TYR A CE2 1 
ATOM   953  C CZ  . TYR A 1 119 ? 32.989 14.930  22.958  1.00 39.87  ? 119  TYR A CZ  1 
ATOM   954  O OH  . TYR A 1 119 ? 34.289 14.970  23.409  1.00 39.57  ? 119  TYR A OH  1 
ATOM   955  N N   . GLY A 1 120 ? 28.531 14.183  18.626  1.00 39.39  ? 120  GLY A N   1 
ATOM   956  C CA  . GLY A 1 120 ? 29.108 14.381  17.299  1.00 39.52  ? 120  GLY A CA  1 
ATOM   957  C C   . GLY A 1 120 ? 29.878 15.690  17.233  1.00 39.35  ? 120  GLY A C   1 
ATOM   958  O O   . GLY A 1 120 ? 30.087 16.340  18.267  1.00 39.75  ? 120  GLY A O   1 
ATOM   959  N N   . GLY A 1 121 ? 30.285 16.072  16.021  1.00 38.86  ? 121  GLY A N   1 
ATOM   960  C CA  . GLY A 1 121 ? 31.241 17.166  15.805  1.00 38.48  ? 121  GLY A CA  1 
ATOM   961  C C   . GLY A 1 121 ? 32.408 16.793  14.885  1.00 38.50  ? 121  GLY A C   1 
ATOM   962  O O   . GLY A 1 121 ? 33.518 17.321  15.034  1.00 39.02  ? 121  GLY A O   1 
ATOM   963  N N   . GLY A 1 122 ? 32.163 15.872  13.954  1.00 37.90  ? 122  GLY A N   1 
ATOM   964  C CA  . GLY A 1 122 ? 33.122 15.509  12.911  1.00 37.92  ? 122  GLY A CA  1 
ATOM   965  C C   . GLY A 1 122 ? 34.418 14.877  13.385  1.00 38.39  ? 122  GLY A C   1 
ATOM   966  O O   . GLY A 1 122 ? 35.386 14.789  12.614  1.00 38.73  ? 122  GLY A O   1 
ATOM   967  N N   . PHE A 1 123 ? 34.449 14.448  14.650  1.00 37.82  ? 123  PHE A N   1 
ATOM   968  C CA  . PHE A 1 123 ? 35.666 13.932  15.281  1.00 37.86  ? 123  PHE A CA  1 
ATOM   969  C C   . PHE A 1 123 ? 36.728 15.003  15.587  1.00 38.35  ? 123  PHE A C   1 
ATOM   970  O O   . PHE A 1 123 ? 37.815 14.664  16.037  1.00 38.89  ? 123  PHE A O   1 
ATOM   971  C CB  . PHE A 1 123 ? 36.283 12.787  14.460  1.00 37.84  ? 123  PHE A CB  1 
ATOM   972  C CG  . PHE A 1 123 ? 35.467 11.536  14.465  1.00 37.41  ? 123  PHE A CG  1 
ATOM   973  C CD1 . PHE A 1 123 ? 35.372 10.754  15.623  1.00 37.07  ? 123  PHE A CD1 1 
ATOM   974  C CD2 . PHE A 1 123 ? 34.785 11.132  13.319  1.00 36.83  ? 123  PHE A CD2 1 
ATOM   975  C CE1 . PHE A 1 123 ? 34.585 9.579   15.647  1.00 36.22  ? 123  PHE A CE1 1 
ATOM   976  C CE2 . PHE A 1 123 ? 34.014 9.961   13.317  1.00 36.62  ? 123  PHE A CE2 1 
ATOM   977  C CZ  . PHE A 1 123 ? 33.912 9.184   14.491  1.00 37.55  ? 123  PHE A CZ  1 
ATOM   978  N N   . TYR A 1 124 ? 36.414 16.279  15.356  1.00 38.38  ? 124  TYR A N   1 
ATOM   979  C CA  . TYR A 1 124 ? 37.342 17.379  15.657  1.00 39.31  ? 124  TYR A CA  1 
ATOM   980  C C   . TYR A 1 124 ? 36.789 18.326  16.742  1.00 39.42  ? 124  TYR A C   1 
ATOM   981  O O   . TYR A 1 124 ? 37.468 19.279  17.157  1.00 39.84  ? 124  TYR A O   1 
ATOM   982  C CB  . TYR A 1 124 ? 37.670 18.188  14.390  1.00 39.58  ? 124  TYR A CB  1 
ATOM   983  C CG  . TYR A 1 124 ? 36.498 18.998  13.890  1.00 40.45  ? 124  TYR A CG  1 
ATOM   984  C CD1 . TYR A 1 124 ? 36.262 20.297  14.364  1.00 41.20  ? 124  TYR A CD1 1 
ATOM   985  C CD2 . TYR A 1 124 ? 35.613 18.473  12.947  1.00 40.92  ? 124  TYR A CD2 1 
ATOM   986  C CE1 . TYR A 1 124 ? 35.179 21.051  13.910  1.00 40.59  ? 124  TYR A CE1 1 
ATOM   987  C CE2 . TYR A 1 124 ? 34.523 19.217  12.492  1.00 41.11  ? 124  TYR A CE2 1 
ATOM   988  C CZ  . TYR A 1 124 ? 34.318 20.502  12.984  1.00 40.83  ? 124  TYR A CZ  1 
ATOM   989  O OH  . TYR A 1 124 ? 33.245 21.229  12.541  1.00 41.51  ? 124  TYR A OH  1 
ATOM   990  N N   . SER A 1 125 ? 35.549 18.093  17.167  1.00 38.56  ? 125  SER A N   1 
ATOM   991  C CA  . SER A 1 125 ? 34.911 18.988  18.114  1.00 38.80  ? 125  SER A CA  1 
ATOM   992  C C   . SER A 1 125 ? 33.805 18.294  18.894  1.00 38.65  ? 125  SER A C   1 
ATOM   993  O O   . SER A 1 125 ? 33.504 17.108  18.658  1.00 37.89  ? 125  SER A O   1 
ATOM   994  C CB  . SER A 1 125 ? 34.367 20.240  17.403  1.00 39.05  ? 125  SER A CB  1 
ATOM   995  O OG  . SER A 1 125 ? 33.319 19.908  16.507  1.00 39.41  ? 125  SER A OG  1 
ATOM   996  N N   . GLY A 1 126 ? 33.206 19.037  19.823  1.00 38.64  ? 126  GLY A N   1 
ATOM   997  C CA  . GLY A 1 126 ? 32.121 18.498  20.635  1.00 39.05  ? 126  GLY A CA  1 
ATOM   998  C C   . GLY A 1 126 ? 32.470 18.388  22.108  1.00 39.54  ? 126  GLY A C   1 
ATOM   999  O O   . GLY A 1 126 ? 33.643 18.488  22.501  1.00 40.10  ? 126  GLY A O   1 
ATOM   1000 N N   . ALA A 1 127 ? 31.445 18.178  22.923  1.00 39.56  ? 127  ALA A N   1 
ATOM   1001 C CA  . ALA A 1 127 ? 31.589 18.195  24.375  1.00 40.12  ? 127  ALA A CA  1 
ATOM   1002 C C   . ALA A 1 127 ? 30.313 17.658  24.998  1.00 40.49  ? 127  ALA A C   1 
ATOM   1003 O O   . ALA A 1 127 ? 29.202 17.980  24.542  1.00 41.32  ? 127  ALA A O   1 
ATOM   1004 C CB  . ALA A 1 127 ? 31.849 19.610  24.855  1.00 40.37  ? 127  ALA A CB  1 
ATOM   1005 N N   . ALA A 1 128 ? 30.447 16.852  26.043  1.00 40.52  ? 128  ALA A N   1 
ATOM   1006 C CA  . ALA A 1 128 ? 29.263 16.296  26.698  1.00 40.29  ? 128  ALA A CA  1 
ATOM   1007 C C   . ALA A 1 128 ? 28.569 17.316  27.582  1.00 40.90  ? 128  ALA A C   1 
ATOM   1008 O O   . ALA A 1 128 ? 27.554 16.994  28.178  1.00 41.71  ? 128  ALA A O   1 
ATOM   1009 C CB  . ALA A 1 128 ? 29.624 15.063  27.502  1.00 40.29  ? 128  ALA A CB  1 
ATOM   1010 N N   . SER A 1 129 ? 29.091 18.543  27.649  1.00 40.90  ? 129  SER A N   1 
ATOM   1011 C CA  . SER A 1 129 ? 28.596 19.551  28.593  1.00 41.84  ? 129  SER A CA  1 
ATOM   1012 C C   . SER A 1 129 ? 27.639 20.596  27.995  1.00 42.54  ? 129  SER A C   1 
ATOM   1013 O O   . SER A 1 129 ? 27.125 21.461  28.718  1.00 43.45  ? 129  SER A O   1 
ATOM   1014 C CB  . SER A 1 129 ? 29.782 20.253  29.297  1.00 42.67  ? 129  SER A CB  1 
ATOM   1015 O OG  . SER A 1 129 ? 30.670 20.897  28.385  1.00 41.49  ? 129  SER A OG  1 
ATOM   1016 N N   . LEU A 1 130 ? 27.431 20.533  26.679  1.00 42.27  ? 130  LEU A N   1 
ATOM   1017 C CA  . LEU A 1 130 ? 26.566 21.461  25.948  1.00 42.32  ? 130  LEU A CA  1 
ATOM   1018 C C   . LEU A 1 130 ? 25.112 21.381  26.415  1.00 43.49  ? 130  LEU A C   1 
ATOM   1019 O O   . LEU A 1 130 ? 24.636 20.322  26.840  1.00 43.45  ? 130  LEU A O   1 
ATOM   1020 C CB  . LEU A 1 130 ? 26.625 21.170  24.443  1.00 41.45  ? 130  LEU A CB  1 
ATOM   1021 C CG  . LEU A 1 130 ? 27.964 21.129  23.694  1.00 39.87  ? 130  LEU A CG  1 
ATOM   1022 C CD1 . LEU A 1 130 ? 27.737 20.793  22.231  1.00 37.88  ? 130  LEU A CD1 1 
ATOM   1023 C CD2 . LEU A 1 130 ? 28.693 22.443  23.804  1.00 40.02  ? 130  LEU A CD2 1 
ATOM   1024 N N   . ASP A 1 131 ? 24.404 22.503  26.312  1.00 44.89  ? 131  ASP A N   1 
ATOM   1025 C CA  . ASP A 1 131 ? 23.017 22.596  26.776  1.00 46.18  ? 131  ASP A CA  1 
ATOM   1026 C C   . ASP A 1 131 ? 22.075 21.592  26.115  1.00 45.95  ? 131  ASP A C   1 
ATOM   1027 O O   . ASP A 1 131 ? 21.170 21.083  26.775  1.00 47.08  ? 131  ASP A O   1 
ATOM   1028 C CB  . ASP A 1 131 ? 22.472 24.010  26.602  1.00 46.93  ? 131  ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 131 ? 23.062 24.999  27.603  1.00 49.36  ? 131  ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 131 ? 23.845 24.601  28.503  1.00 49.43  ? 131  ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 131 ? 22.725 26.197  27.487  1.00 52.10  ? 131  ASP A OD2 1 
ATOM   1032 N N   . VAL A 1 132 ? 22.285 21.300  24.833  1.00 44.77  ? 132  VAL A N   1 
ATOM   1033 C CA  . VAL A 1 132 ? 21.422 20.345  24.130  1.00 44.47  ? 132  VAL A CA  1 
ATOM   1034 C C   . VAL A 1 132 ? 21.591 18.888  24.559  1.00 43.82  ? 132  VAL A C   1 
ATOM   1035 O O   . VAL A 1 132 ? 20.770 18.050  24.194  1.00 44.11  ? 132  VAL A O   1 
ATOM   1036 C CB  . VAL A 1 132 ? 21.548 20.419  22.578  1.00 43.83  ? 132  VAL A CB  1 
ATOM   1037 C CG1 . VAL A 1 132 ? 20.939 21.691  22.082  1.00 45.20  ? 132  VAL A CG1 1 
ATOM   1038 C CG2 . VAL A 1 132 ? 22.993 20.258  22.128  1.00 42.45  ? 132  VAL A CG2 1 
ATOM   1039 N N   . TYR A 1 133 ? 22.654 18.582  25.302  1.00 43.06  ? 133  TYR A N   1 
ATOM   1040 C CA  . TYR A 1 133 ? 22.864 17.209  25.787  1.00 42.69  ? 133  TYR A CA  1 
ATOM   1041 C C   . TYR A 1 133 ? 22.524 17.049  27.292  1.00 43.12  ? 133  TYR A C   1 
ATOM   1042 O O   . TYR A 1 133 ? 23.026 16.152  27.963  1.00 42.85  ? 133  TYR A O   1 
ATOM   1043 C CB  . TYR A 1 133 ? 24.295 16.719  25.491  1.00 41.67  ? 133  TYR A CB  1 
ATOM   1044 C CG  . TYR A 1 133 ? 24.835 16.958  24.088  1.00 41.11  ? 133  TYR A CG  1 
ATOM   1045 C CD1 . TYR A 1 133 ? 24.060 16.710  22.955  1.00 42.07  ? 133  TYR A CD1 1 
ATOM   1046 C CD2 . TYR A 1 133 ? 26.150 17.404  23.897  1.00 41.41  ? 133  TYR A CD2 1 
ATOM   1047 C CE1 . TYR A 1 133 ? 24.570 16.925  21.660  1.00 40.97  ? 133  TYR A CE1 1 
ATOM   1048 C CE2 . TYR A 1 133 ? 26.670 17.609  22.614  1.00 40.49  ? 133  TYR A CE2 1 
ATOM   1049 C CZ  . TYR A 1 133 ? 25.870 17.372  21.502  1.00 40.19  ? 133  TYR A CZ  1 
ATOM   1050 O OH  . TYR A 1 133 ? 26.372 17.567  20.239  1.00 38.52  ? 133  TYR A OH  1 
ATOM   1051 N N   . ASP A 1 134 ? 21.664 17.926  27.802  1.00 43.94  ? 134  ASP A N   1 
ATOM   1052 C CA  . ASP A 1 134 ? 21.316 17.967  29.213  1.00 44.89  ? 134  ASP A CA  1 
ATOM   1053 C C   . ASP A 1 134 ? 20.424 16.784  29.597  1.00 45.24  ? 134  ASP A C   1 
ATOM   1054 O O   . ASP A 1 134 ? 19.272 16.681  29.151  1.00 45.99  ? 134  ASP A O   1 
ATOM   1055 C CB  . ASP A 1 134 ? 20.645 19.306  29.541  1.00 45.90  ? 134  ASP A CB  1 
ATOM   1056 C CG  . ASP A 1 134 ? 20.366 19.489  31.032  1.00 48.44  ? 134  ASP A CG  1 
ATOM   1057 O OD1 . ASP A 1 134 ? 20.662 18.588  31.850  1.00 49.00  ? 134  ASP A OD1 1 
ATOM   1058 O OD2 . ASP A 1 134 ? 19.825 20.555  31.388  1.00 50.50  ? 134  ASP A OD2 1 
ATOM   1059 N N   . GLY A 1 135 ? 20.969 15.898  30.433  1.00 44.72  ? 135  GLY A N   1 
ATOM   1060 C CA  . GLY A 1 135 ? 20.285 14.671  30.822  1.00 44.68  ? 135  GLY A CA  1 
ATOM   1061 C C   . GLY A 1 135 ? 19.173 14.799  31.850  1.00 45.66  ? 135  GLY A C   1 
ATOM   1062 O O   . GLY A 1 135 ? 18.535 13.810  32.189  1.00 46.11  ? 135  GLY A O   1 
ATOM   1063 N N   . ARG A 1 136 ? 18.924 16.010  32.341  1.00 46.14  ? 136  ARG A N   1 
ATOM   1064 C CA  . ARG A 1 136 ? 17.983 16.192  33.445  1.00 47.48  ? 136  ARG A CA  1 
ATOM   1065 C C   . ARG A 1 136 ? 16.537 15.799  33.106  1.00 47.95  ? 136  ARG A C   1 
ATOM   1066 O O   . ARG A 1 136 ? 15.839 15.280  33.970  1.00 49.06  ? 136  ARG A O   1 
ATOM   1067 C CB  . ARG A 1 136 ? 18.083 17.605  34.074  1.00 47.78  ? 136  ARG A CB  1 
ATOM   1068 C CG  . ARG A 1 136 ? 17.297 18.738  33.388  1.00 49.19  ? 136  ARG A CG  1 
ATOM   1069 C CD  . ARG A 1 136 ? 17.492 20.102  34.093  1.00 50.29  ? 136  ARG A CD  1 
ATOM   1070 N NE  . ARG A 1 136 ? 18.882 20.574  34.041  1.00 52.70  ? 136  ARG A NE  1 
ATOM   1071 C CZ  . ARG A 1 136 ? 19.421 21.507  34.840  1.00 54.55  ? 136  ARG A CZ  1 
ATOM   1072 N NH1 . ARG A 1 136 ? 20.702 21.849  34.689  1.00 53.81  ? 136  ARG A NH1 1 
ATOM   1073 N NH2 . ARG A 1 136 ? 18.702 22.108  35.790  1.00 55.19  ? 136  ARG A NH2 1 
ATOM   1074 N N   . PHE A 1 137 ? 16.105 16.015  31.859  1.00 47.33  ? 137  PHE A N   1 
ATOM   1075 C CA  . PHE A 1 137 ? 14.714 15.743  31.455  1.00 47.91  ? 137  PHE A CA  1 
ATOM   1076 C C   . PHE A 1 137 ? 14.420 14.248  31.244  1.00 48.16  ? 137  PHE A C   1 
ATOM   1077 O O   . PHE A 1 137 ? 13.373 13.759  31.678  1.00 49.48  ? 137  PHE A O   1 
ATOM   1078 C CB  . PHE A 1 137 ? 14.300 16.558  30.222  1.00 47.29  ? 137  PHE A CB  1 
ATOM   1079 C CG  . PHE A 1 137 ? 14.685 17.998  30.292  1.00 46.72  ? 137  PHE A CG  1 
ATOM   1080 C CD1 . PHE A 1 137 ? 13.887 18.912  30.958  1.00 48.19  ? 137  PHE A CD1 1 
ATOM   1081 C CD2 . PHE A 1 137 ? 15.855 18.447  29.686  1.00 45.62  ? 137  PHE A CD2 1 
ATOM   1082 C CE1 . PHE A 1 137 ? 14.252 20.263  31.031  1.00 48.37  ? 137  PHE A CE1 1 
ATOM   1083 C CE2 . PHE A 1 137 ? 16.227 19.784  29.753  1.00 45.20  ? 137  PHE A CE2 1 
ATOM   1084 C CZ  . PHE A 1 137 ? 15.426 20.696  30.428  1.00 46.70  ? 137  PHE A CZ  1 
ATOM   1085 N N   . LEU A 1 138 ? 15.331 13.530  30.584  1.00 47.05  ? 138  LEU A N   1 
ATOM   1086 C CA  . LEU A 1 138 ? 15.209 12.076  30.459  1.00 47.14  ? 138  LEU A CA  1 
ATOM   1087 C C   . LEU A 1 138 ? 15.289 11.406  31.826  1.00 48.18  ? 138  LEU A C   1 
ATOM   1088 O O   . LEU A 1 138 ? 14.536 10.468  32.103  1.00 49.22  ? 138  LEU A O   1 
ATOM   1089 C CB  . LEU A 1 138 ? 16.261 11.502  29.505  1.00 45.52  ? 138  LEU A CB  1 
ATOM   1090 C CG  . LEU A 1 138 ? 16.065 11.762  28.005  1.00 44.49  ? 138  LEU A CG  1 
ATOM   1091 C CD1 . LEU A 1 138 ? 17.367 11.574  27.237  1.00 41.76  ? 138  LEU A CD1 1 
ATOM   1092 C CD2 . LEU A 1 138 ? 14.966 10.890  27.416  1.00 44.11  ? 138  LEU A CD2 1 
ATOM   1093 N N   . ALA A 1 139 ? 16.186 11.902  32.679  1.00 48.15  ? 139  ALA A N   1 
ATOM   1094 C CA  . ALA A 1 139 ? 16.301 11.430  34.069  1.00 49.52  ? 139  ALA A CA  1 
ATOM   1095 C C   . ALA A 1 139 ? 15.017 11.641  34.895  1.00 51.43  ? 139  ALA A C   1 
ATOM   1096 O O   . ALA A 1 139 ? 14.591 10.741  35.612  1.00 52.77  ? 139  ALA A O   1 
ATOM   1097 C CB  . ALA A 1 139 ? 17.493 12.093  34.773  1.00 48.62  ? 139  ALA A CB  1 
ATOM   1098 N N   . GLN A 1 140 ? 14.404 12.818  34.789  1.00 51.92  ? 140  GLN A N   1 
ATOM   1099 C CA  . GLN A 1 140 ? 13.257 13.148  35.626  1.00 53.86  ? 140  GLN A CA  1 
ATOM   1100 C C   . GLN A 1 140 ? 11.958 12.554  35.096  1.00 55.38  ? 140  GLN A C   1 
ATOM   1101 O O   . GLN A 1 140 ? 11.217 11.930  35.849  1.00 56.84  ? 140  GLN A O   1 
ATOM   1102 C CB  . GLN A 1 140 ? 13.110 14.661  35.784  1.00 54.04  ? 140  GLN A CB  1 
ATOM   1103 C CG  . GLN A 1 140 ? 12.350 15.101  37.034  1.00 56.00  ? 140  GLN A CG  1 
ATOM   1104 C CD  . GLN A 1 140 ? 10.836 14.940  36.913  1.00 58.60  ? 140  GLN A CD  1 
ATOM   1105 O OE1 . GLN A 1 140 ? 10.257 15.160  35.848  1.00 59.97  ? 140  GLN A OE1 1 
ATOM   1106 N NE2 . GLN A 1 140 ? 10.193 14.560  38.009  1.00 58.55  ? 140  GLN A NE2 1 
ATOM   1107 N N   . VAL A 1 141 ? 11.690 12.754  33.807  1.00 55.13  ? 141  VAL A N   1 
ATOM   1108 C CA  . VAL A 1 141 ? 10.422 12.355  33.198  1.00 56.12  ? 141  VAL A CA  1 
ATOM   1109 C C   . VAL A 1 141 ? 10.360 10.850  32.913  1.00 56.49  ? 141  VAL A C   1 
ATOM   1110 O O   . VAL A 1 141 ? 9.335  10.217  33.168  1.00 57.99  ? 141  VAL A O   1 
ATOM   1111 C CB  . VAL A 1 141 ? 10.130 13.171  31.909  1.00 55.56  ? 141  VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 141 ? 8.855  12.703  31.237  1.00 57.25  ? 141  VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 141 ? 10.018 14.644  32.229  1.00 55.65  ? 141  VAL A CG2 1 
ATOM   1114 N N   . GLU A 1 142 ? 11.444 10.278  32.396  1.00 55.23  ? 142  GLU A N   1 
ATOM   1115 C CA  . GLU A 1 142 ? 11.451 8.853   32.055  1.00 55.66  ? 142  GLU A CA  1 
ATOM   1116 C C   . GLU A 1 142 ? 12.081 7.957   33.125  1.00 55.86  ? 142  GLU A C   1 
ATOM   1117 O O   . GLU A 1 142 ? 12.014 6.733   33.033  1.00 56.40  ? 142  GLU A O   1 
ATOM   1118 C CB  . GLU A 1 142 ? 12.104 8.612   30.681  1.00 54.40  ? 142  GLU A CB  1 
ATOM   1119 C CG  . GLU A 1 142 ? 11.250 9.054   29.471  1.00 55.69  ? 142  GLU A CG  1 
ATOM   1120 C CD  . GLU A 1 142 ? 9.823  8.462   29.466  1.00 60.44  ? 142  GLU A CD  1 
ATOM   1121 O OE1 . GLU A 1 142 ? 9.605  7.325   29.959  1.00 62.55  ? 142  GLU A OE1 1 
ATOM   1122 O OE2 . GLU A 1 142 ? 8.903  9.141   28.961  1.00 62.43  ? 142  GLU A OE2 1 
ATOM   1123 N N   . GLY A 1 143 ? 12.686 8.561   34.144  1.00 55.58  ? 143  GLY A N   1 
ATOM   1124 C CA  . GLY A 1 143 ? 13.365 7.787   35.185  1.00 55.83  ? 143  GLY A CA  1 
ATOM   1125 C C   . GLY A 1 143 ? 14.661 7.130   34.719  1.00 54.54  ? 143  GLY A C   1 
ATOM   1126 O O   . GLY A 1 143 ? 15.132 6.175   35.333  1.00 55.49  ? 143  GLY A O   1 
ATOM   1127 N N   . ALA A 1 144 ? 15.240 7.645   33.640  1.00 52.77  ? 144  ALA A N   1 
ATOM   1128 C CA  . ALA A 1 144 ? 16.443 7.069   33.044  1.00 51.36  ? 144  ALA A CA  1 
ATOM   1129 C C   . ALA A 1 144 ? 17.731 7.391   33.824  1.00 50.20  ? 144  ALA A C   1 
ATOM   1130 O O   . ALA A 1 144 ? 17.834 8.430   34.483  1.00 50.07  ? 144  ALA A O   1 
ATOM   1131 C CB  . ALA A 1 144 ? 16.575 7.546   31.594  1.00 50.18  ? 144  ALA A CB  1 
ATOM   1132 N N   . VAL A 1 145 ? 18.707 6.495   33.750  1.00 49.17  ? 145  VAL A N   1 
ATOM   1133 C CA  . VAL A 1 145 ? 20.057 6.856   34.140  1.00 47.94  ? 145  VAL A CA  1 
ATOM   1134 C C   . VAL A 1 145 ? 20.785 7.229   32.860  1.00 46.94  ? 145  VAL A C   1 
ATOM   1135 O O   . VAL A 1 145 ? 20.909 6.407   31.951  1.00 46.82  ? 145  VAL A O   1 
ATOM   1136 C CB  . VAL A 1 145 ? 20.781 5.731   34.905  1.00 48.24  ? 145  VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 145 ? 22.243 6.088   35.127  1.00 47.22  ? 145  VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 145 ? 20.102 5.492   36.238  1.00 48.64  ? 145  VAL A CG2 1 
ATOM   1139 N N   . LEU A 1 146 ? 21.218 8.486   32.770  1.00 46.24  ? 146  LEU A N   1 
ATOM   1140 C CA  . LEU A 1 146 ? 21.918 8.963   31.582  1.00 45.12  ? 146  LEU A CA  1 
ATOM   1141 C C   . LEU A 1 146 ? 23.373 9.279   31.883  1.00 44.32  ? 146  LEU A C   1 
ATOM   1142 O O   . LEU A 1 146 ? 23.689 9.881   32.913  1.00 44.52  ? 146  LEU A O   1 
ATOM   1143 C CB  . LEU A 1 146 ? 21.223 10.189  30.987  1.00 45.21  ? 146  LEU A CB  1 
ATOM   1144 C CG  . LEU A 1 146 ? 21.565 10.445  29.515  1.00 45.29  ? 146  LEU A CG  1 
ATOM   1145 C CD1 . LEU A 1 146 ? 20.374 11.038  28.820  1.00 46.20  ? 146  LEU A CD1 1 
ATOM   1146 C CD2 . LEU A 1 146 ? 22.820 11.318  29.332  1.00 44.98  ? 146  LEU A CD2 1 
ATOM   1147 N N   . VAL A 1 147 ? 24.246 8.865   30.971  1.00 43.19  ? 147  VAL A N   1 
ATOM   1148 C CA  . VAL A 1 147 ? 25.670 9.067   31.104  1.00 42.59  ? 147  VAL A CA  1 
ATOM   1149 C C   . VAL A 1 147 ? 26.205 9.640   29.807  1.00 41.86  ? 147  VAL A C   1 
ATOM   1150 O O   . VAL A 1 147 ? 25.883 9.137   28.733  1.00 42.19  ? 147  VAL A O   1 
ATOM   1151 C CB  . VAL A 1 147 ? 26.400 7.737   31.355  1.00 42.96  ? 147  VAL A CB  1 
ATOM   1152 C CG1 . VAL A 1 147 ? 27.924 7.939   31.374  1.00 42.82  ? 147  VAL A CG1 1 
ATOM   1153 C CG2 . VAL A 1 147 ? 25.938 7.117   32.645  1.00 44.48  ? 147  VAL A CG2 1 
ATOM   1154 N N   . SER A 1 148 ? 27.037 10.670  29.900  1.00 40.96  ? 148  SER A N   1 
ATOM   1155 C CA  . SER A 1 148 ? 27.761 11.156  28.733  1.00 40.14  ? 148  SER A CA  1 
ATOM   1156 C C   . SER A 1 148 ? 29.245 11.358  29.067  1.00 40.35  ? 148  SER A C   1 
ATOM   1157 O O   . SER A 1 148 ? 29.588 11.768  30.177  1.00 40.78  ? 148  SER A O   1 
ATOM   1158 C CB  . SER A 1 148 ? 27.138 12.455  28.225  1.00 39.72  ? 148  SER A CB  1 
ATOM   1159 O OG  . SER A 1 148 ? 27.273 13.496  29.179  1.00 38.56  ? 148  SER A OG  1 
ATOM   1160 N N   . MET A 1 149 ? 30.121 11.062  28.114  1.00 39.91  ? 149  MET A N   1 
ATOM   1161 C CA  . MET A 1 149 ? 31.548 11.197  28.345  1.00 40.41  ? 149  MET A CA  1 
ATOM   1162 C C   . MET A 1 149 ? 32.211 12.164  27.352  1.00 40.33  ? 149  MET A C   1 
ATOM   1163 O O   . MET A 1 149 ? 31.733 12.335  26.216  1.00 40.16  ? 149  MET A O   1 
ATOM   1164 C CB  . MET A 1 149 ? 32.221 9.827   28.267  1.00 40.82  ? 149  MET A CB  1 
ATOM   1165 C CG  . MET A 1 149 ? 32.697 9.438   26.862  1.00 41.51  ? 149  MET A CG  1 
ATOM   1166 S SD  . MET A 1 149 ? 31.371 9.002   25.714  1.00 43.19  ? 149  MET A SD  1 
ATOM   1167 C CE  . MET A 1 149 ? 30.861 7.419   26.376  1.00 40.37  ? 149  MET A CE  1 
ATOM   1168 N N   . ASN A 1 150 ? 33.291 12.812  27.794  1.00 40.36  ? 150  ASN A N   1 
ATOM   1169 C CA  . ASN A 1 150 ? 34.200 13.500  26.881  1.00 40.23  ? 150  ASN A CA  1 
ATOM   1170 C C   . ASN A 1 150 ? 35.151 12.467  26.293  1.00 40.17  ? 150  ASN A C   1 
ATOM   1171 O O   . ASN A 1 150 ? 35.549 11.524  26.981  1.00 40.69  ? 150  ASN A O   1 
ATOM   1172 C CB  . ASN A 1 150 ? 35.014 14.578  27.603  1.00 40.70  ? 150  ASN A CB  1 
ATOM   1173 C CG  . ASN A 1 150 ? 34.211 15.836  27.903  1.00 41.24  ? 150  ASN A CG  1 
ATOM   1174 O OD1 . ASN A 1 150 ? 33.058 15.980  27.488  1.00 42.21  ? 150  ASN A OD1 1 
ATOM   1175 N ND2 . ASN A 1 150 ? 34.828 16.760  28.625  1.00 40.26  ? 150  ASN A ND2 1 
ATOM   1176 N N   . TYR A 1 151 ? 35.492 12.630  25.019  1.00 39.59  ? 151  TYR A N   1 
ATOM   1177 C CA  . TYR A 1 151 ? 36.518 11.809  24.388  1.00 39.57  ? 151  TYR A CA  1 
ATOM   1178 C C   . TYR A 1 151 ? 37.379 12.743  23.548  1.00 39.48  ? 151  TYR A C   1 
ATOM   1179 O O   . TYR A 1 151 ? 36.908 13.792  23.108  1.00 38.72  ? 151  TYR A O   1 
ATOM   1180 C CB  . TYR A 1 151 ? 35.912 10.655  23.563  1.00 39.62  ? 151  TYR A CB  1 
ATOM   1181 C CG  . TYR A 1 151 ? 35.069 11.077  22.370  1.00 39.73  ? 151  TYR A CG  1 
ATOM   1182 C CD1 . TYR A 1 151 ? 33.701 11.351  22.511  1.00 39.63  ? 151  TYR A CD1 1 
ATOM   1183 C CD2 . TYR A 1 151 ? 35.637 11.201  21.096  1.00 39.59  ? 151  TYR A CD2 1 
ATOM   1184 C CE1 . TYR A 1 151 ? 32.922 11.742  21.418  1.00 39.20  ? 151  TYR A CE1 1 
ATOM   1185 C CE2 . TYR A 1 151 ? 34.866 11.594  19.999  1.00 39.56  ? 151  TYR A CE2 1 
ATOM   1186 C CZ  . TYR A 1 151 ? 33.513 11.866  20.170  1.00 39.56  ? 151  TYR A CZ  1 
ATOM   1187 O OH  . TYR A 1 151 ? 32.759 12.262  19.093  1.00 39.17  ? 151  TYR A OH  1 
ATOM   1188 N N   . ARG A 1 152 ? 38.645 12.380  23.354  1.00 39.78  ? 152  ARG A N   1 
ATOM   1189 C CA  . ARG A 1 152 ? 39.567 13.229  22.610  1.00 39.84  ? 152  ARG A CA  1 
ATOM   1190 C C   . ARG A 1 152 ? 39.187 13.318  21.141  1.00 39.43  ? 152  ARG A C   1 
ATOM   1191 O O   . ARG A 1 152 ? 38.788 12.326  20.524  1.00 39.24  ? 152  ARG A O   1 
ATOM   1192 C CB  . ARG A 1 152 ? 40.999 12.714  22.733  1.00 40.87  ? 152  ARG A CB  1 
ATOM   1193 C CG  . ARG A 1 152 ? 41.709 13.112  24.001  1.00 40.64  ? 152  ARG A CG  1 
ATOM   1194 C CD  . ARG A 1 152 ? 42.995 12.340  24.122  1.00 39.70  ? 152  ARG A CD  1 
ATOM   1195 N NE  . ARG A 1 152 ? 42.716 10.955  24.466  1.00 38.58  ? 152  ARG A NE  1 
ATOM   1196 C CZ  . ARG A 1 152 ? 43.640 10.008  24.602  1.00 39.42  ? 152  ARG A CZ  1 
ATOM   1197 N NH1 . ARG A 1 152 ? 44.928 10.289  24.409  1.00 38.88  ? 152  ARG A NH1 1 
ATOM   1198 N NH2 . ARG A 1 152 ? 43.271 8.772   24.921  1.00 37.02  ? 152  ARG A NH2 1 
ATOM   1199 N N   . VAL A 1 153 ? 39.321 14.517  20.592  1.00 39.41  ? 153  VAL A N   1 
ATOM   1200 C CA  . VAL A 1 153 ? 38.996 14.772  19.190  1.00 39.02  ? 153  VAL A CA  1 
ATOM   1201 C C   . VAL A 1 153 ? 40.211 15.316  18.455  1.00 39.79  ? 153  VAL A C   1 
ATOM   1202 O O   . VAL A 1 153 ? 41.275 15.509  19.063  1.00 40.97  ? 153  VAL A O   1 
ATOM   1203 C CB  . VAL A 1 153 ? 37.824 15.770  19.055  1.00 38.80  ? 153  VAL A CB  1 
ATOM   1204 C CG1 . VAL A 1 153 ? 36.517 15.159  19.627  1.00 37.43  ? 153  VAL A CG1 1 
ATOM   1205 C CG2 . VAL A 1 153 ? 38.168 17.120  19.719  1.00 37.61  ? 153  VAL A CG2 1 
ATOM   1206 N N   . GLY A 1 154 ? 40.048 15.566  17.156  1.00 39.42  ? 154  GLY A N   1 
ATOM   1207 C CA  . GLY A 1 154 ? 41.109 16.091  16.309  1.00 39.51  ? 154  GLY A CA  1 
ATOM   1208 C C   . GLY A 1 154 ? 42.375 15.262  16.429  1.00 40.68  ? 154  GLY A C   1 
ATOM   1209 O O   . GLY A 1 154 ? 42.316 14.034  16.606  1.00 40.62  ? 154  GLY A O   1 
ATOM   1210 N N   . THR A 1 155 ? 43.520 15.936  16.324  1.00 41.50  ? 155  THR A N   1 
ATOM   1211 C CA  . THR A 1 155 ? 44.820 15.275  16.409  1.00 42.88  ? 155  THR A CA  1 
ATOM   1212 C C   . THR A 1 155 ? 44.958 14.461  17.694  1.00 43.00  ? 155  THR A C   1 
ATOM   1213 O O   . THR A 1 155 ? 45.450 13.336  17.669  1.00 44.45  ? 155  THR A O   1 
ATOM   1214 C CB  . THR A 1 155 ? 45.994 16.283  16.337  1.00 43.98  ? 155  THR A CB  1 
ATOM   1215 O OG1 . THR A 1 155 ? 45.758 17.360  17.259  1.00 43.56  ? 155  THR A OG1 1 
ATOM   1216 C CG2 . THR A 1 155 ? 46.154 16.825  14.917  1.00 43.54  ? 155  THR A CG2 1 
ATOM   1217 N N   . PHE A 1 156 ? 44.500 15.023  18.804  1.00 42.15  ? 156  PHE A N   1 
ATOM   1218 C CA  . PHE A 1 156 ? 44.711 14.417  20.113  1.00 42.21  ? 156  PHE A CA  1 
ATOM   1219 C C   . PHE A 1 156 ? 43.981 13.102  20.184  1.00 41.77  ? 156  PHE A C   1 
ATOM   1220 O O   . PHE A 1 156 ? 44.428 12.169  20.852  1.00 42.66  ? 156  PHE A O   1 
ATOM   1221 C CB  . PHE A 1 156 ? 44.249 15.368  21.216  1.00 41.57  ? 156  PHE A CB  1 
ATOM   1222 C CG  . PHE A 1 156 ? 44.782 16.761  21.050  1.00 42.01  ? 156  PHE A CG  1 
ATOM   1223 C CD1 . PHE A 1 156 ? 46.107 17.056  21.378  1.00 43.34  ? 156  PHE A CD1 1 
ATOM   1224 C CD2 . PHE A 1 156 ? 43.982 17.760  20.514  1.00 40.60  ? 156  PHE A CD2 1 
ATOM   1225 C CE1 . PHE A 1 156 ? 46.620 18.332  21.200  1.00 44.02  ? 156  PHE A CE1 1 
ATOM   1226 C CE2 . PHE A 1 156 ? 44.465 19.032  20.342  1.00 41.96  ? 156  PHE A CE2 1 
ATOM   1227 C CZ  . PHE A 1 156 ? 45.800 19.327  20.692  1.00 44.43  ? 156  PHE A CZ  1 
ATOM   1228 N N   . GLY A 1 157 ? 42.869 13.031  19.460  1.00 40.54  ? 157  GLY A N   1 
ATOM   1229 C CA  . GLY A 1 157 ? 42.044 11.853  19.448  1.00 39.85  ? 157  GLY A CA  1 
ATOM   1230 C C   . GLY A 1 157 ? 42.368 10.849  18.365  1.00 40.30  ? 157  GLY A C   1 
ATOM   1231 O O   . GLY A 1 157 ? 42.160 9.660   18.577  1.00 40.72  ? 157  GLY A O   1 
ATOM   1232 N N   . PHE A 1 158 ? 42.861 11.310  17.209  1.00 40.43  ? 158  PHE A N   1 
ATOM   1233 C CA  . PHE A 1 158 ? 42.887 10.459  16.014  1.00 40.66  ? 158  PHE A CA  1 
ATOM   1234 C C   . PHE A 1 158 ? 44.110 10.528  15.098  1.00 42.24  ? 158  PHE A C   1 
ATOM   1235 O O   . PHE A 1 158 ? 44.193 9.777   14.123  1.00 43.20  ? 158  PHE A O   1 
ATOM   1236 C CB  . PHE A 1 158 ? 41.590 10.638  15.209  1.00 39.64  ? 158  PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 158 ? 40.351 10.328  16.007  1.00 38.56  ? 158  PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 158 ? 39.929 9.008   16.179  1.00 37.88  ? 158  PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 158 ? 39.641 11.343  16.635  1.00 36.24  ? 158  PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 158 ? 38.806 8.715   16.942  1.00 37.31  ? 158  PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 158 ? 38.515 11.053  17.419  1.00 36.01  ? 158  PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 158 ? 38.100 9.744   17.571  1.00 36.31  ? 158  PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 159 ? 45.058 11.414  15.395  1.00 43.04  ? 159  LEU A N   1 
ATOM   1244 C CA  . LEU A 1 159 ? 46.306 11.426  14.649  1.00 44.44  ? 159  LEU A CA  1 
ATOM   1245 C C   . LEU A 1 159 ? 46.977 10.070  14.819  1.00 45.73  ? 159  LEU A C   1 
ATOM   1246 O O   . LEU A 1 159 ? 47.128 9.576   15.930  1.00 45.75  ? 159  LEU A O   1 
ATOM   1247 C CB  . LEU A 1 159 ? 47.227 12.554  15.121  1.00 45.00  ? 159  LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 159 ? 48.584 12.654  14.411  1.00 46.19  ? 159  LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 159 ? 49.028 14.092  14.267  1.00 45.76  ? 159  LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 159 ? 49.654 11.823  15.131  1.00 47.26  ? 159  LEU A CD2 1 
ATOM   1251 N N   . ALA A 1 160 ? 47.381 9.467   13.711  1.00 47.15  ? 160  ALA A N   1 
ATOM   1252 C CA  . ALA A 1 160 ? 47.863 8.097   13.763  1.00 48.93  ? 160  ALA A CA  1 
ATOM   1253 C C   . ALA A 1 160 ? 49.057 7.852   12.862  1.00 50.82  ? 160  ALA A C   1 
ATOM   1254 O O   . ALA A 1 160 ? 49.080 8.285   11.712  1.00 51.04  ? 160  ALA A O   1 
ATOM   1255 C CB  . ALA A 1 160 ? 46.727 7.124   13.416  1.00 48.50  ? 160  ALA A CB  1 
ATOM   1256 N N   . LEU A 1 161 ? 50.050 7.153   13.394  1.00 52.69  ? 161  LEU A N   1 
ATOM   1257 C CA  . LEU A 1 161 ? 51.079 6.565   12.552  1.00 54.99  ? 161  LEU A CA  1 
ATOM   1258 C C   . LEU A 1 161 ? 50.909 5.061   12.638  1.00 56.29  ? 161  LEU A C   1 
ATOM   1259 O O   . LEU A 1 161 ? 51.561 4.410   13.452  1.00 57.66  ? 161  LEU A O   1 
ATOM   1260 C CB  . LEU A 1 161 ? 52.472 7.040   12.959  1.00 56.02  ? 161  LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 161 ? 52.632 8.513   12.548  1.00 55.66  ? 161  LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 161 ? 53.456 9.282   13.529  1.00 56.80  ? 161  LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 161 ? 53.196 8.668   11.159  1.00 55.54  ? 161  LEU A CD2 1 
ATOM   1264 N N   . PRO A 1 162 ? 49.998 4.503   11.810  1.00 56.30  ? 162  PRO A N   1 
ATOM   1265 C CA  . PRO A 1 162 ? 49.590 3.102   11.945  1.00 57.43  ? 162  PRO A CA  1 
ATOM   1266 C C   . PRO A 1 162 ? 50.772 2.153   12.025  1.00 60.09  ? 162  PRO A C   1 
ATOM   1267 O O   . PRO A 1 162 ? 51.724 2.293   11.270  1.00 61.83  ? 162  PRO A O   1 
ATOM   1268 C CB  . PRO A 1 162 ? 48.772 2.859   10.682  1.00 57.12  ? 162  PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 162 ? 48.185 4.214   10.380  1.00 55.13  ? 162  PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 162 ? 49.297 5.162   10.691  1.00 55.13  ? 162  PRO A CD  1 
ATOM   1271 N N   . GLY A 1 163 ? 50.711 1.210   12.960  1.00 61.32  ? 163  GLY A N   1 
ATOM   1272 C CA  . GLY A 1 163 ? 51.805 0.275   13.200  1.00 63.64  ? 163  GLY A CA  1 
ATOM   1273 C C   . GLY A 1 163 ? 52.693 0.702   14.353  1.00 64.46  ? 163  GLY A C   1 
ATOM   1274 O O   . GLY A 1 163 ? 53.363 -0.128  14.960  1.00 66.07  ? 163  GLY A O   1 
ATOM   1275 N N   . SER A 1 164 ? 52.712 1.997   14.659  1.00 63.50  ? 164  SER A N   1 
ATOM   1276 C CA  . SER A 1 164 ? 53.565 2.497   15.737  1.00 64.49  ? 164  SER A CA  1 
ATOM   1277 C C   . SER A 1 164 ? 53.012 2.166   17.130  1.00 64.35  ? 164  SER A C   1 
ATOM   1278 O O   . SER A 1 164 ? 51.872 1.703   17.275  1.00 62.85  ? 164  SER A O   1 
ATOM   1279 C CB  . SER A 1 164 ? 53.817 4.000   15.594  1.00 63.41  ? 164  SER A CB  1 
ATOM   1280 O OG  . SER A 1 164 ? 52.645 4.742   15.860  1.00 61.17  ? 164  SER A OG  1 
ATOM   1281 N N   . ARG A 1 165 ? 53.844 2.376   18.144  1.00 66.10  ? 165  ARG A N   1 
ATOM   1282 C CA  . ARG A 1 165 ? 53.446 2.142   19.520  1.00 66.91  ? 165  ARG A CA  1 
ATOM   1283 C C   . ARG A 1 165 ? 53.044 3.472   20.143  1.00 64.87  ? 165  ARG A C   1 
ATOM   1284 O O   . ARG A 1 165 ? 52.170 3.528   21.015  1.00 64.11  ? 165  ARG A O   1 
ATOM   1285 C CB  . ARG A 1 165 ? 54.599 1.519   20.313  1.00 69.65  ? 165  ARG A CB  1 
ATOM   1286 C CG  . ARG A 1 165 ? 54.146 0.741   21.550  1.00 73.75  ? 165  ARG A CG  1 
ATOM   1287 C CD  . ARG A 1 165 ? 55.235 0.693   22.649  1.00 81.85  ? 165  ARG A CD  1 
ATOM   1288 N NE  . ARG A 1 165 ? 55.209 1.898   23.495  1.00 84.74  ? 165  ARG A NE  1 
ATOM   1289 C CZ  . ARG A 1 165 ? 56.218 2.761   23.647  1.00 86.49  ? 165  ARG A CZ  1 
ATOM   1290 N NH1 . ARG A 1 165 ? 57.379 2.571   23.023  1.00 88.29  ? 165  ARG A NH1 1 
ATOM   1291 N NH2 . ARG A 1 165 ? 56.062 3.819   24.438  1.00 85.74  ? 165  ARG A NH2 1 
ATOM   1292 N N   . GLU A 1 166 ? 53.677 4.537   19.661  1.00 64.33  ? 166  GLU A N   1 
ATOM   1293 C CA  . GLU A 1 166 ? 53.598 5.847   20.280  1.00 63.00  ? 166  GLU A CA  1 
ATOM   1294 C C   . GLU A 1 166 ? 52.353 6.630   19.831  1.00 60.64  ? 166  GLU A C   1 
ATOM   1295 O O   . GLU A 1 166 ? 51.928 7.579   20.498  1.00 59.83  ? 166  GLU A O   1 
ATOM   1296 C CB  . GLU A 1 166 ? 54.883 6.633   19.992  1.00 64.63  ? 166  GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 166 ? 56.203 5.934   20.410  1.00 67.35  ? 166  GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 166 ? 56.867 5.083   19.291  1.00 70.08  ? 166  GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 166 ? 56.178 4.567   18.374  1.00 69.35  ? 166  GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 166 ? 58.104 4.916   19.345  1.00 72.04  ? 166  GLU A OE2 1 
ATOM   1301 N N   . ALA A 1 167 ? 51.773 6.219   18.705  1.00 59.21  ? 167  ALA A N   1 
ATOM   1302 C CA  . ALA A 1 167 ? 50.583 6.848   18.151  1.00 56.53  ? 167  ALA A CA  1 
ATOM   1303 C C   . ALA A 1 167 ? 49.792 5.839   17.295  1.00 55.87  ? 167  ALA A C   1 
ATOM   1304 O O   . ALA A 1 167 ? 49.776 5.936   16.065  1.00 55.67  ? 167  ALA A O   1 
ATOM   1305 C CB  . ALA A 1 167 ? 50.964 8.080   17.342  1.00 56.02  ? 167  ALA A CB  1 
ATOM   1306 N N   . PRO A 1 168 ? 49.121 4.874   17.955  1.00 55.38  ? 168  PRO A N   1 
ATOM   1307 C CA  . PRO A 1 168 ? 48.509 3.732   17.267  1.00 55.29  ? 168  PRO A CA  1 
ATOM   1308 C C   . PRO A 1 168 ? 47.217 4.041   16.517  1.00 53.74  ? 168  PRO A C   1 
ATOM   1309 O O   . PRO A 1 168 ? 46.810 3.238   15.668  1.00 54.77  ? 168  PRO A O   1 
ATOM   1310 C CB  . PRO A 1 168 ? 48.208 2.758   18.410  1.00 55.60  ? 168  PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 168 ? 48.018 3.621   19.611  1.00 54.56  ? 168  PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 168 ? 48.910 4.818   19.418  1.00 55.07  ? 168  PRO A CD  1 
ATOM   1313 N N   . GLY A 1 169 ? 46.575 5.168   16.833  1.00 51.60  ? 169  GLY A N   1 
ATOM   1314 C CA  . GLY A 1 169 ? 45.293 5.536   16.223  1.00 49.36  ? 169  GLY A CA  1 
ATOM   1315 C C   . GLY A 1 169 ? 44.063 5.143   17.031  1.00 47.96  ? 169  GLY A C   1 
ATOM   1316 O O   . GLY A 1 169 ? 44.150 4.350   17.965  1.00 48.74  ? 169  GLY A O   1 
ATOM   1317 N N   . ASN A 1 170 ? 42.917 5.720   16.676  1.00 46.10  ? 170  ASN A N   1 
ATOM   1318 C CA  . ASN A 1 170 ? 41.632 5.439   17.324  1.00 44.60  ? 170  ASN A CA  1 
ATOM   1319 C C   . ASN A 1 170 ? 41.580 5.615   18.846  1.00 43.91  ? 170  ASN A C   1 
ATOM   1320 O O   . ASN A 1 170 ? 40.759 4.977   19.502  1.00 44.43  ? 170  ASN A O   1 
ATOM   1321 C CB  . ASN A 1 170 ? 41.142 4.024   16.964  1.00 45.12  ? 170  ASN A CB  1 
ATOM   1322 C CG  . ASN A 1 170 ? 40.967 3.825   15.470  1.00 46.03  ? 170  ASN A CG  1 
ATOM   1323 O OD1 . ASN A 1 170 ? 40.465 4.706   14.764  1.00 42.49  ? 170  ASN A OD1 1 
ATOM   1324 N ND2 . ASN A 1 170 ? 41.392 2.655   14.975  1.00 47.01  ? 170  ASN A ND2 1 
ATOM   1325 N N   . VAL A 1 171 ? 42.428 6.457   19.423  1.00 43.06  ? 171  VAL A N   1 
ATOM   1326 C CA  . VAL A 1 171 ? 42.451 6.575   20.889  1.00 42.31  ? 171  VAL A CA  1 
ATOM   1327 C C   . VAL A 1 171 ? 41.224 7.321   21.444  1.00 41.47  ? 171  VAL A C   1 
ATOM   1328 O O   . VAL A 1 171 ? 40.824 7.115   22.589  1.00 41.56  ? 171  VAL A O   1 
ATOM   1329 C CB  . VAL A 1 171 ? 43.790 7.147   21.436  1.00 43.21  ? 171  VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 171 ? 44.971 6.285   20.961  1.00 43.05  ? 171  VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 171 ? 43.982 8.633   21.070  1.00 41.33  ? 171  VAL A CG2 1 
ATOM   1332 N N   . GLY A 1 172 ? 40.603 8.152   20.614  1.00 40.05  ? 172  GLY A N   1 
ATOM   1333 C CA  . GLY A 1 172 ? 39.343 8.761   20.982  1.00 39.22  ? 172  GLY A CA  1 
ATOM   1334 C C   . GLY A 1 172 ? 38.218 7.746   21.125  1.00 39.04  ? 172  GLY A C   1 
ATOM   1335 O O   . GLY A 1 172 ? 37.304 7.927   21.937  1.00 38.07  ? 172  GLY A O   1 
ATOM   1336 N N   . LEU A 1 173 ? 38.277 6.689   20.315  1.00 39.50  ? 173  LEU A N   1 
ATOM   1337 C CA  . LEU A 1 173 ? 37.347 5.567   20.436  1.00 39.80  ? 173  LEU A CA  1 
ATOM   1338 C C   . LEU A 1 173 ? 37.656 4.771   21.710  1.00 40.55  ? 173  LEU A C   1 
ATOM   1339 O O   . LEU A 1 173 ? 36.746 4.358   22.439  1.00 40.40  ? 173  LEU A O   1 
ATOM   1340 C CB  . LEU A 1 173 ? 37.415 4.674   19.190  1.00 40.21  ? 173  LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 173 ? 36.836 5.260   17.892  1.00 39.50  ? 173  LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 173 ? 37.121 4.325   16.730  1.00 38.94  ? 173  LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 173 ? 35.320 5.528   18.015  1.00 37.75  ? 173  LEU A CD2 1 
ATOM   1344 N N   . LEU A 1 174 ? 38.949 4.605   21.978  1.00 41.19  ? 174  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 174 ? 39.443 3.981   23.189  1.00 42.23  ? 174  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 174 ? 39.071 4.769   24.465  1.00 42.12  ? 174  LEU A C   1 
ATOM   1347 O O   . LEU A 1 174 ? 38.848 4.169   25.512  1.00 42.60  ? 174  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 174 ? 40.963 3.728   23.094  1.00 43.15  ? 174  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 174 ? 41.521 2.659   22.119  1.00 42.89  ? 174  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 174 ? 43.037 2.556   22.214  1.00 40.23  ? 174  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 174 ? 40.919 1.283   22.347  1.00 42.87  ? 174  LEU A CD2 1 
ATOM   1352 N N   . ASP A 1 175 ? 38.990 6.098   24.388  1.00 41.69  ? 175  ASP A N   1 
ATOM   1353 C CA  . ASP A 1 175 ? 38.417 6.875   25.502  1.00 41.55  ? 175  ASP A CA  1 
ATOM   1354 C C   . ASP A 1 175 ? 36.947 6.465   25.732  1.00 41.64  ? 175  ASP A C   1 
ATOM   1355 O O   . ASP A 1 175 ? 36.533 6.166   26.865  1.00 41.78  ? 175  ASP A O   1 
ATOM   1356 C CB  . ASP A 1 175 ? 38.504 8.381   25.249  1.00 40.68  ? 175  ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 175 ? 39.936 8.874   25.014  1.00 42.07  ? 175  ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 175 ? 40.898 8.156   25.351  1.00 43.63  ? 175  ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 175 ? 40.105 9.996   24.480  1.00 41.66  ? 175  ASP A OD2 1 
ATOM   1360 N N   . GLN A 1 176 ? 36.170 6.428   24.648  1.00 41.65  ? 176  GLN A N   1 
ATOM   1361 C CA  . GLN A 1 176 ? 34.754 6.060   24.716  1.00 41.74  ? 176  GLN A CA  1 
ATOM   1362 C C   . GLN A 1 176 ? 34.573 4.648   25.287  1.00 42.89  ? 176  GLN A C   1 
ATOM   1363 O O   . GLN A 1 176 ? 33.679 4.414   26.105  1.00 43.05  ? 176  GLN A O   1 
ATOM   1364 C CB  . GLN A 1 176 ? 34.083 6.179   23.345  1.00 41.35  ? 176  GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 176 ? 34.081 7.585   22.725  1.00 40.02  ? 176  GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 176 ? 33.659 7.562   21.257  1.00 40.73  ? 176  GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 176 ? 33.087 6.578   20.785  1.00 43.53  ? 176  GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 176 ? 33.941 8.638   20.530  1.00 38.91  ? 176  GLN A NE2 1 
ATOM   1369 N N   . ARG A 1 177 ? 35.435 3.718   24.881  1.00 43.71  ? 177  ARG A N   1 
ATOM   1370 C CA  . ARG A 1 177 ? 35.371 2.345   25.407  1.00 44.74  ? 177  ARG A CA  1 
ATOM   1371 C C   . ARG A 1 177 ? 35.715 2.268   26.904  1.00 44.85  ? 177  ARG A C   1 
ATOM   1372 O O   . ARG A 1 177 ? 35.103 1.472   27.631  1.00 45.50  ? 177  ARG A O   1 
ATOM   1373 C CB  . ARG A 1 177 ? 36.262 1.387   24.603  1.00 45.89  ? 177  ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 177 ? 36.294 -0.046  25.145  1.00 48.07  ? 177  ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 177 ? 37.225 -0.933  24.349  1.00 50.32  ? 177  ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 177 ? 36.687 -1.209  23.015  1.00 51.60  ? 177  ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 177 ? 37.371 -1.783  22.027  1.00 52.76  ? 177  ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 177 ? 38.640 -2.151  22.199  1.00 53.92  ? 177  ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 177 ? 36.780 -1.992  20.859  1.00 51.54  ? 177  ARG A NH2 1 
ATOM   1380 N N   . LEU A 1 178 ? 36.680 3.081   27.353  1.00 43.83  ? 178  LEU A N   1 
ATOM   1381 C CA  . LEU A 1 178 ? 37.045 3.132   28.769  1.00 43.67  ? 178  LEU A CA  1 
ATOM   1382 C C   . LEU A 1 178 ? 35.878 3.617   29.623  1.00 43.65  ? 178  LEU A C   1 
ATOM   1383 O O   . LEU A 1 178 ? 35.613 3.059   30.690  1.00 44.33  ? 178  LEU A O   1 
ATOM   1384 C CB  . LEU A 1 178 ? 38.290 3.983   29.007  1.00 43.08  ? 178  LEU A CB  1 
ATOM   1385 C CG  . LEU A 1 178 ? 38.837 4.113   30.438  1.00 43.19  ? 178  LEU A CG  1 
ATOM   1386 C CD1 . LEU A 1 178 ? 39.073 2.757   31.131  1.00 43.86  ? 178  LEU A CD1 1 
ATOM   1387 C CD2 . LEU A 1 178 ? 40.105 4.937   30.453  1.00 40.28  ? 178  LEU A CD2 1 
ATOM   1388 N N   . ALA A 1 179 ? 35.160 4.630   29.133  1.00 43.12  ? 179  ALA A N   1 
ATOM   1389 C CA  . ALA A 1 179 ? 33.962 5.122   29.810  1.00 42.69  ? 179  ALA A CA  1 
ATOM   1390 C C   . ALA A 1 179 ? 32.849 4.096   29.773  1.00 43.44  ? 179  ALA A C   1 
ATOM   1391 O O   . ALA A 1 179 ? 32.064 4.009   30.720  1.00 44.54  ? 179  ALA A O   1 
ATOM   1392 C CB  . ALA A 1 179 ? 33.499 6.442   29.225  1.00 41.56  ? 179  ALA A CB  1 
ATOM   1393 N N   . LEU A 1 180 ? 32.771 3.295   28.711  1.00 43.52  ? 180  LEU A N   1 
ATOM   1394 C CA  . LEU A 1 180 ? 31.822 2.181   28.744  1.00 44.30  ? 180  LEU A CA  1 
ATOM   1395 C C   . LEU A 1 180 ? 32.204 1.129   29.808  1.00 45.95  ? 180  LEU A C   1 
ATOM   1396 O O   . LEU A 1 180 ? 31.308 0.577   30.459  1.00 46.70  ? 180  LEU A O   1 
ATOM   1397 C CB  . LEU A 1 180 ? 31.605 1.531   27.369  1.00 44.09  ? 180  LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 180 ? 31.203 2.330   26.120  1.00 43.21  ? 180  LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 180 ? 30.605 1.405   25.066  1.00 42.94  ? 180  LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 180 ? 30.279 3.528   26.376  1.00 40.74  ? 180  LEU A CD2 1 
ATOM   1401 N N   . GLN A 1 181 ? 33.508 0.859   29.983  1.00 46.56  ? 181  GLN A N   1 
ATOM   1402 C CA  . GLN A 1 181 ? 33.986 -0.068  31.040  1.00 48.61  ? 181  GLN A CA  1 
ATOM   1403 C C   . GLN A 1 181 ? 33.633 0.508   32.430  1.00 47.99  ? 181  GLN A C   1 
ATOM   1404 O O   . GLN A 1 181 ? 33.135 -0.216  33.314  1.00 48.60  ? 181  GLN A O   1 
ATOM   1405 C CB  . GLN A 1 181 ? 35.508 -0.382  30.941  1.00 48.94  ? 181  GLN A CB  1 
ATOM   1406 C CG  . GLN A 1 181 ? 35.977 -1.122  29.661  1.00 50.94  ? 181  GLN A CG  1 
ATOM   1407 C CD  . GLN A 1 181 ? 37.527 -1.228  29.518  1.00 51.92  ? 181  GLN A CD  1 
ATOM   1408 O OE1 . GLN A 1 181 ? 38.132 -0.656  28.609  1.00 52.43  ? 181  GLN A OE1 1 
ATOM   1409 N NE2 . GLN A 1 181 ? 38.153 -1.966  30.423  1.00 57.18  ? 181  GLN A NE2 1 
ATOM   1410 N N   . TRP A 1 182 ? 33.869 1.812   32.591  1.00 46.58  ? 182  TRP A N   1 
ATOM   1411 C CA  . TRP A 1 182 ? 33.518 2.543   33.808  1.00 46.17  ? 182  TRP A CA  1 
ATOM   1412 C C   . TRP A 1 182 ? 32.047 2.365   34.176  1.00 46.16  ? 182  TRP A C   1 
ATOM   1413 O O   . TRP A 1 182 ? 31.719 2.232   35.358  1.00 46.94  ? 182  TRP A O   1 
ATOM   1414 C CB  . TRP A 1 182 ? 33.836 4.037   33.682  1.00 44.95  ? 182  TRP A CB  1 
ATOM   1415 C CG  . TRP A 1 182 ? 33.717 4.800   34.999  1.00 45.34  ? 182  TRP A CG  1 
ATOM   1416 C CD1 . TRP A 1 182 ? 34.730 5.089   35.872  1.00 45.53  ? 182  TRP A CD1 1 
ATOM   1417 C CD2 . TRP A 1 182 ? 32.526 5.358   35.575  1.00 44.56  ? 182  TRP A CD2 1 
ATOM   1418 N NE1 . TRP A 1 182 ? 34.249 5.795   36.947  1.00 45.19  ? 182  TRP A NE1 1 
ATOM   1419 C CE2 . TRP A 1 182 ? 32.899 5.971   36.794  1.00 45.09  ? 182  TRP A CE2 1 
ATOM   1420 C CE3 . TRP A 1 182 ? 31.179 5.398   35.181  1.00 43.70  ? 182  TRP A CE3 1 
ATOM   1421 C CZ2 . TRP A 1 182 ? 31.973 6.618   37.626  1.00 45.30  ? 182  TRP A CZ2 1 
ATOM   1422 C CZ3 . TRP A 1 182 ? 30.262 6.045   36.004  1.00 44.22  ? 182  TRP A CZ3 1 
ATOM   1423 C CH2 . TRP A 1 182 ? 30.664 6.644   37.216  1.00 44.83  ? 182  TRP A CH2 1 
ATOM   1424 N N   . VAL A 1 183 ? 31.163 2.366   33.178  1.00 45.16  ? 183  VAL A N   1 
ATOM   1425 C CA  . VAL A 1 183 ? 29.739 2.145   33.452  1.00 44.88  ? 183  VAL A CA  1 
ATOM   1426 C C   . VAL A 1 183 ? 29.513 0.705   33.967  1.00 46.27  ? 183  VAL A C   1 
ATOM   1427 O O   . VAL A 1 183 ? 28.836 0.504   34.969  1.00 46.82  ? 183  VAL A O   1 
ATOM   1428 C CB  . VAL A 1 183 ? 28.855 2.503   32.234  1.00 43.88  ? 183  VAL A CB  1 
ATOM   1429 C CG1 . VAL A 1 183 ? 27.433 2.039   32.417  1.00 43.50  ? 183  VAL A CG1 1 
ATOM   1430 C CG2 . VAL A 1 183 ? 28.893 4.002   31.979  1.00 43.05  ? 183  VAL A CG2 1 
ATOM   1431 N N   . GLN A 1 184 ? 30.106 -0.287  33.310  1.00 46.76  ? 184  GLN A N   1 
ATOM   1432 C CA  . GLN A 1 184 ? 29.963 -1.677  33.762  1.00 48.37  ? 184  GLN A CA  1 
ATOM   1433 C C   . GLN A 1 184 ? 30.308 -1.824  35.241  1.00 49.57  ? 184  GLN A C   1 
ATOM   1434 O O   . GLN A 1 184 ? 29.498 -2.313  36.015  1.00 50.32  ? 184  GLN A O   1 
ATOM   1435 C CB  . GLN A 1 184 ? 30.819 -2.638  32.931  1.00 48.47  ? 184  GLN A CB  1 
ATOM   1436 C CG  . GLN A 1 184 ? 30.284 -2.935  31.554  1.00 47.49  ? 184  GLN A CG  1 
ATOM   1437 C CD  . GLN A 1 184 ? 28.841 -3.404  31.557  1.00 47.19  ? 184  GLN A CD  1 
ATOM   1438 O OE1 . GLN A 1 184 ? 27.949 -2.684  31.092  1.00 46.41  ? 184  GLN A OE1 1 
ATOM   1439 N NE2 . GLN A 1 184 ? 28.599 -4.603  32.083  1.00 46.81  ? 184  GLN A NE2 1 
ATOM   1440 N N   . GLU A 1 185 ? 31.502 -1.372  35.627  1.00 50.03  ? 185  GLU A N   1 
ATOM   1441 C CA  . GLU A 1 185 ? 31.959 -1.509  37.010  1.00 51.25  ? 185  GLU A CA  1 
ATOM   1442 C C   . GLU A 1 185 ? 31.198 -0.632  38.014  1.00 50.24  ? 185  GLU A C   1 
ATOM   1443 O O   . GLU A 1 185 ? 30.964 -1.064  39.138  1.00 51.24  ? 185  GLU A O   1 
ATOM   1444 C CB  . GLU A 1 185 ? 33.487 -1.319  37.116  1.00 51.75  ? 185  GLU A CB  1 
ATOM   1445 C CG  . GLU A 1 185 ? 33.962 -0.788  38.468  1.00 55.46  ? 185  GLU A CG  1 
ATOM   1446 C CD  . GLU A 1 185 ? 35.199 -1.482  39.020  1.00 60.92  ? 185  GLU A CD  1 
ATOM   1447 O OE1 . GLU A 1 185 ? 35.149 -1.953  40.183  1.00 63.65  ? 185  GLU A OE1 1 
ATOM   1448 O OE2 . GLU A 1 185 ? 36.224 -1.540  38.310  1.00 63.21  ? 185  GLU A OE2 1 
ATOM   1449 N N   . ASN A 1 186 ? 30.791 0.574   37.606  1.00 48.31  ? 186  ASN A N   1 
ATOM   1450 C CA  . ASN A 1 186 ? 30.347 1.594   38.573  1.00 47.47  ? 186  ASN A CA  1 
ATOM   1451 C C   . ASN A 1 186 ? 28.881 2.009   38.632  1.00 47.15  ? 186  ASN A C   1 
ATOM   1452 O O   . ASN A 1 186 ? 28.417 2.421   39.693  1.00 48.02  ? 186  ASN A O   1 
ATOM   1453 C CB  . ASN A 1 186 ? 31.222 2.847   38.473  1.00 46.13  ? 186  ASN A CB  1 
ATOM   1454 C CG  . ASN A 1 186 ? 32.697 2.541   38.670  1.00 46.16  ? 186  ASN A CG  1 
ATOM   1455 O OD1 . ASN A 1 186 ? 33.156 2.300   39.790  1.00 46.42  ? 186  ASN A OD1 1 
ATOM   1456 N ND2 . ASN A 1 186 ? 33.448 2.546   37.578  1.00 45.21  ? 186  ASN A ND2 1 
ATOM   1457 N N   . ILE A 1 187 ? 28.155 1.906   37.522  1.00 46.44  ? 187  ILE A N   1 
ATOM   1458 C CA  . ILE A 1 187 ? 26.801 2.482   37.405  1.00 45.94  ? 187  ILE A CA  1 
ATOM   1459 C C   . ILE A 1 187 ? 25.745 1.944   38.412  1.00 47.19  ? 187  ILE A C   1 
ATOM   1460 O O   . ILE A 1 187 ? 24.732 2.597   38.673  1.00 47.11  ? 187  ILE A O   1 
ATOM   1461 C CB  . ILE A 1 187 ? 26.273 2.391   35.930  1.00 45.30  ? 187  ILE A CB  1 
ATOM   1462 C CG1 . ILE A 1 187 ? 25.283 3.521   35.614  1.00 44.68  ? 187  ILE A CG1 1 
ATOM   1463 C CG2 . ILE A 1 187 ? 25.657 1.014   35.630  1.00 46.42  ? 187  ILE A CG2 1 
ATOM   1464 C CD1 . ILE A 1 187 ? 25.891 4.890   35.638  1.00 44.29  ? 187  ILE A CD1 1 
ATOM   1465 N N   . ALA A 1 188 ? 25.977 0.759   38.969  1.00 48.27  ? 188  ALA A N   1 
ATOM   1466 C CA  . ALA A 1 188 ? 25.068 0.201   39.956  1.00 49.48  ? 188  ALA A CA  1 
ATOM   1467 C C   . ALA A 1 188 ? 25.058 1.020   41.252  1.00 49.94  ? 188  ALA A C   1 
ATOM   1468 O O   . ALA A 1 188 ? 24.064 1.020   41.975  1.00 51.21  ? 188  ALA A O   1 
ATOM   1469 C CB  . ALA A 1 188 ? 25.411 -1.245  40.234  1.00 50.58  ? 188  ALA A CB  1 
ATOM   1470 N N   . ALA A 1 189 ? 26.158 1.714   41.538  1.00 49.43  ? 189  ALA A N   1 
ATOM   1471 C CA  . ALA A 1 189 ? 26.245 2.631   42.682  1.00 49.86  ? 189  ALA A CA  1 
ATOM   1472 C C   . ALA A 1 189 ? 25.274 3.814   42.546  1.00 49.71  ? 189  ALA A C   1 
ATOM   1473 O O   . ALA A 1 189 ? 24.963 4.496   43.525  1.00 50.84  ? 189  ALA A O   1 
ATOM   1474 C CB  . ALA A 1 189 ? 27.680 3.137   42.854  1.00 48.83  ? 189  ALA A CB  1 
ATOM   1475 N N   . PHE A 1 190 ? 24.800 4.046   41.328  1.00 48.93  ? 190  PHE A N   1 
ATOM   1476 C CA  . PHE A 1 190 ? 23.900 5.148   41.032  1.00 48.44  ? 190  PHE A CA  1 
ATOM   1477 C C   . PHE A 1 190 ? 22.474 4.647   40.817  1.00 49.79  ? 190  PHE A C   1 
ATOM   1478 O O   . PHE A 1 190 ? 21.565 5.453   40.606  1.00 50.24  ? 190  PHE A O   1 
ATOM   1479 C CB  . PHE A 1 190 ? 24.376 5.911   39.789  1.00 46.44  ? 190  PHE A CB  1 
ATOM   1480 C CG  . PHE A 1 190 ? 25.727 6.550   39.948  1.00 45.00  ? 190  PHE A CG  1 
ATOM   1481 C CD1 . PHE A 1 190 ? 26.888 5.833   39.675  1.00 45.28  ? 190  PHE A CD1 1 
ATOM   1482 C CD2 . PHE A 1 190 ? 25.843 7.863   40.376  1.00 43.77  ? 190  PHE A CD2 1 
ATOM   1483 C CE1 . PHE A 1 190 ? 28.144 6.423   39.826  1.00 44.46  ? 190  PHE A CE1 1 
ATOM   1484 C CE2 . PHE A 1 190 ? 27.088 8.453   40.531  1.00 42.82  ? 190  PHE A CE2 1 
ATOM   1485 C CZ  . PHE A 1 190 ? 28.237 7.735   40.254  1.00 44.19  ? 190  PHE A CZ  1 
ATOM   1486 N N   . GLY A 1 191 ? 22.282 3.327   40.864  1.00 50.56  ? 191  GLY A N   1 
ATOM   1487 C CA  . GLY A 1 191 ? 20.976 2.730   40.616  1.00 51.48  ? 191  GLY A CA  1 
ATOM   1488 C C   . GLY A 1 191 ? 20.764 2.244   39.191  1.00 51.34  ? 191  GLY A C   1 
ATOM   1489 O O   . GLY A 1 191 ? 19.698 1.726   38.858  1.00 52.64  ? 191  GLY A O   1 
ATOM   1490 N N   . GLY A 1 192 ? 21.772 2.402   38.343  1.00 50.20  ? 192  GLY A N   1 
ATOM   1491 C CA  . GLY A 1 192 ? 21.704 1.927   36.965  1.00 49.65  ? 192  GLY A CA  1 
ATOM   1492 C C   . GLY A 1 192 ? 21.953 0.435   36.818  1.00 50.81  ? 192  GLY A C   1 
ATOM   1493 O O   . GLY A 1 192 ? 22.625 -0.176  37.644  1.00 51.23  ? 192  GLY A O   1 
ATOM   1494 N N   . ASP A 1 193 ? 21.400 -0.139  35.751  1.00 51.20  ? 193  ASP A N   1 
ATOM   1495 C CA  . ASP A 1 193 ? 21.510 -1.553  35.449  1.00 52.57  ? 193  ASP A CA  1 
ATOM   1496 C C   . ASP A 1 193 ? 22.590 -1.810  34.395  1.00 52.19  ? 193  ASP A C   1 
ATOM   1497 O O   . ASP A 1 193 ? 22.385 -1.522  33.218  1.00 51.16  ? 193  ASP A O   1 
ATOM   1498 C CB  . ASP A 1 193 ? 20.164 -2.064  34.928  1.00 53.60  ? 193  ASP A CB  1 
ATOM   1499 C CG  . ASP A 1 193 ? 20.116 -3.580  34.782  1.00 55.23  ? 193  ASP A CG  1 
ATOM   1500 O OD1 . ASP A 1 193 ? 21.162 -4.249  34.976  1.00 54.58  ? 193  ASP A OD1 1 
ATOM   1501 O OD2 . ASP A 1 193 ? 19.019 -4.099  34.471  1.00 55.72  ? 193  ASP A OD2 1 
ATOM   1502 N N   . PRO A 1 194 ? 23.731 -2.402  34.805  1.00 52.97  ? 194  PRO A N   1 
ATOM   1503 C CA  . PRO A 1 194 ? 24.809 -2.632  33.824  1.00 52.48  ? 194  PRO A CA  1 
ATOM   1504 C C   . PRO A 1 194 ? 24.399 -3.655  32.760  1.00 53.56  ? 194  PRO A C   1 
ATOM   1505 O O   . PRO A 1 194 ? 25.015 -3.734  31.695  1.00 52.70  ? 194  PRO A O   1 
ATOM   1506 C CB  . PRO A 1 194 ? 25.970 -3.157  34.679  1.00 52.63  ? 194  PRO A CB  1 
ATOM   1507 C CG  . PRO A 1 194 ? 25.338 -3.693  35.900  1.00 53.87  ? 194  PRO A CG  1 
ATOM   1508 C CD  . PRO A 1 194 ? 24.081 -2.903  36.147  1.00 53.45  ? 194  PRO A CD  1 
ATOM   1509 N N   . MET A 1 195 ? 23.347 -4.412  33.051  1.00 55.42  ? 195  MET A N   1 
ATOM   1510 C CA  . MET A 1 195 ? 22.835 -5.406  32.120  1.00 57.36  ? 195  MET A CA  1 
ATOM   1511 C C   . MET A 1 195 ? 21.812 -4.845  31.129  1.00 56.22  ? 195  MET A C   1 
ATOM   1512 O O   . MET A 1 195 ? 21.306 -5.575  30.277  1.00 57.38  ? 195  MET A O   1 
ATOM   1513 C CB  . MET A 1 195 ? 22.303 -6.623  32.882  1.00 59.25  ? 195  MET A CB  1 
ATOM   1514 C CG  . MET A 1 195 ? 23.327 -7.753  32.932  1.00 61.49  ? 195  MET A CG  1 
ATOM   1515 S SD  . MET A 1 195 ? 23.184 -8.903  34.312  1.00 65.32  ? 195  MET A SD  1 
ATOM   1516 C CE  . MET A 1 195 ? 21.472 -9.462  34.184  1.00 67.50  ? 195  MET A CE  1 
ATOM   1517 N N   . SER A 1 196 ? 21.524 -3.548  31.230  1.00 54.46  ? 196  SER A N   1 
ATOM   1518 C CA  . SER A 1 196 ? 20.714 -2.865  30.229  1.00 53.02  ? 196  SER A CA  1 
ATOM   1519 C C   . SER A 1 196 ? 21.300 -1.495  29.897  1.00 51.13  ? 196  SER A C   1 
ATOM   1520 O O   . SER A 1 196 ? 20.933 -0.472  30.504  1.00 50.72  ? 196  SER A O   1 
ATOM   1521 C CB  . SER A 1 196 ? 19.263 -2.757  30.680  1.00 54.04  ? 196  SER A CB  1 
ATOM   1522 O OG  . SER A 1 196 ? 18.443 -2.283  29.630  1.00 53.61  ? 196  SER A OG  1 
ATOM   1523 N N   . VAL A 1 197 ? 22.214 -1.495  28.924  1.00 49.87  ? 197  VAL A N   1 
ATOM   1524 C CA  . VAL A 1 197 ? 22.925 -0.301  28.478  1.00 47.60  ? 197  VAL A CA  1 
ATOM   1525 C C   . VAL A 1 197 ? 22.705 -0.087  26.981  1.00 47.23  ? 197  VAL A C   1 
ATOM   1526 O O   . VAL A 1 197 ? 23.002 -0.970  26.165  1.00 48.02  ? 197  VAL A O   1 
ATOM   1527 C CB  . VAL A 1 197 ? 24.445 -0.410  28.784  1.00 47.26  ? 197  VAL A CB  1 
ATOM   1528 C CG1 . VAL A 1 197 ? 25.234 0.685   28.078  1.00 44.89  ? 197  VAL A CG1 1 
ATOM   1529 C CG2 . VAL A 1 197 ? 24.702 -0.375  30.280  1.00 46.60  ? 197  VAL A CG2 1 
ATOM   1530 N N   . THR A 1 198 ? 22.168 1.082   26.633  1.00 46.01  ? 198  THR A N   1 
ATOM   1531 C CA  . THR A 1 198 ? 21.923 1.472   25.246  1.00 44.95  ? 198  THR A CA  1 
ATOM   1532 C C   . THR A 1 198 ? 22.809 2.673   24.893  1.00 43.91  ? 198  THR A C   1 
ATOM   1533 O O   . THR A 1 198 ? 22.735 3.719   25.556  1.00 43.38  ? 198  THR A O   1 
ATOM   1534 C CB  . THR A 1 198 ? 20.448 1.877   25.043  1.00 45.13  ? 198  THR A CB  1 
ATOM   1535 O OG1 . THR A 1 198 ? 19.600 0.809   25.456  1.00 46.51  ? 198  THR A OG1 1 
ATOM   1536 C CG2 . THR A 1 198 ? 20.145 2.221   23.588  1.00 44.07  ? 198  THR A CG2 1 
ATOM   1537 N N   . LEU A 1 199 ? 23.649 2.518   23.870  1.00 43.21  ? 199  LEU A N   1 
ATOM   1538 C CA  . LEU A 1 199 ? 24.423 3.636   23.357  1.00 42.53  ? 199  LEU A CA  1 
ATOM   1539 C C   . LEU A 1 199 ? 23.550 4.456   22.419  1.00 42.39  ? 199  LEU A C   1 
ATOM   1540 O O   . LEU A 1 199 ? 22.730 3.897   21.694  1.00 43.77  ? 199  LEU A O   1 
ATOM   1541 C CB  . LEU A 1 199 ? 25.662 3.152   22.601  1.00 42.16  ? 199  LEU A CB  1 
ATOM   1542 C CG  . LEU A 1 199 ? 26.539 2.126   23.318  1.00 43.60  ? 199  LEU A CG  1 
ATOM   1543 C CD1 . LEU A 1 199 ? 27.654 1.647   22.401  1.00 43.26  ? 199  LEU A CD1 1 
ATOM   1544 C CD2 . LEU A 1 199 ? 27.102 2.695   24.622  1.00 44.05  ? 199  LEU A CD2 1 
ATOM   1545 N N   . PHE A 1 200 ? 23.709 5.775   22.435  1.00 41.03  ? 200  PHE A N   1 
ATOM   1546 C CA  . PHE A 1 200 ? 23.077 6.614   21.422  1.00 40.39  ? 200  PHE A CA  1 
ATOM   1547 C C   . PHE A 1 200 ? 23.929 7.839   21.105  1.00 39.36  ? 200  PHE A C   1 
ATOM   1548 O O   . PHE A 1 200 ? 24.652 8.347   21.974  1.00 39.01  ? 200  PHE A O   1 
ATOM   1549 C CB  . PHE A 1 200 ? 21.589 6.912   21.738  1.00 40.74  ? 200  PHE A CB  1 
ATOM   1550 C CG  . PHE A 1 200 ? 21.337 7.972   22.803  1.00 40.83  ? 200  PHE A CG  1 
ATOM   1551 C CD1 . PHE A 1 200 ? 21.937 7.915   24.057  1.00 40.13  ? 200  PHE A CD1 1 
ATOM   1552 C CD2 . PHE A 1 200 ? 20.403 8.984   22.570  1.00 41.99  ? 200  PHE A CD2 1 
ATOM   1553 C CE1 . PHE A 1 200 ? 21.673 8.881   25.034  1.00 39.77  ? 200  PHE A CE1 1 
ATOM   1554 C CE2 . PHE A 1 200 ? 20.111 9.955   23.566  1.00 42.39  ? 200  PHE A CE2 1 
ATOM   1555 C CZ  . PHE A 1 200 ? 20.756 9.901   24.797  1.00 40.13  ? 200  PHE A CZ  1 
ATOM   1556 N N   . GLY A 1 201 ? 23.885 8.279   19.852  1.00 38.85  ? 201  GLY A N   1 
ATOM   1557 C CA  . GLY A 1 201 ? 24.763 9.351   19.398  1.00 38.69  ? 201  GLY A CA  1 
ATOM   1558 C C   . GLY A 1 201 ? 24.334 9.939   18.075  1.00 38.97  ? 201  GLY A C   1 
ATOM   1559 O O   . GLY A 1 201 ? 23.654 9.284   17.298  1.00 39.79  ? 201  GLY A O   1 
ATOM   1560 N N   . GLU A 1 202 ? 24.721 11.182  17.825  1.00 38.63  ? 202  GLU A N   1 
ATOM   1561 C CA  . GLU A 1 202 ? 24.382 11.841  16.569  1.00 38.97  ? 202  GLU A CA  1 
ATOM   1562 C C   . GLU A 1 202 ? 25.640 12.202  15.773  1.00 38.85  ? 202  GLU A C   1 
ATOM   1563 O O   . GLU A 1 202 ? 26.694 12.479  16.372  1.00 38.69  ? 202  GLU A O   1 
ATOM   1564 C CB  . GLU A 1 202 ? 23.527 13.075  16.846  1.00 38.89  ? 202  GLU A CB  1 
ATOM   1565 C CG  . GLU A 1 202 ? 22.974 13.777  15.612  1.00 39.32  ? 202  GLU A CG  1 
ATOM   1566 C CD  . GLU A 1 202 ? 23.868 14.905  15.141  1.00 39.48  ? 202  GLU A CD  1 
ATOM   1567 O OE1 . GLU A 1 202 ? 24.834 15.236  15.872  1.00 39.46  ? 202  GLU A OE1 1 
ATOM   1568 O OE2 . GLU A 1 202 ? 23.611 15.450  14.041  1.00 37.78  ? 202  GLU A OE2 1 
ATOM   1569 N N   . ALA A 1 203 ? 25.527 12.196  14.434  1.00 38.80  ? 203  ALA A N   1 
ATOM   1570 C CA  . ALA A 1 203 ? 26.648 12.541  13.538  1.00 38.31  ? 203  ALA A CA  1 
ATOM   1571 C C   . ALA A 1 203 ? 27.896 11.633  13.792  1.00 38.20  ? 203  ALA A C   1 
ATOM   1572 O O   . ALA A 1 203 ? 27.764 10.403  13.747  1.00 38.12  ? 203  ALA A O   1 
ATOM   1573 C CB  . ALA A 1 203 ? 26.975 14.023  13.655  1.00 37.47  ? 203  ALA A CB  1 
ATOM   1574 N N   . ALA A 1 204 ? 29.075 12.207  14.075  1.00 37.80  ? 204  ALA A N   1 
ATOM   1575 C CA  . ALA A 1 204 ? 30.249 11.379  14.469  1.00 38.34  ? 204  ALA A CA  1 
ATOM   1576 C C   . ALA A 1 204 ? 30.020 10.535  15.737  1.00 38.91  ? 204  ALA A C   1 
ATOM   1577 O O   . ALA A 1 204 ? 30.746 9.573   15.982  1.00 39.42  ? 204  ALA A O   1 
ATOM   1578 C CB  . ALA A 1 204 ? 31.485 12.216  14.634  1.00 37.76  ? 204  ALA A CB  1 
ATOM   1579 N N   . GLY A 1 205 ? 29.017 10.905  16.538  1.00 39.02  ? 205  GLY A N   1 
ATOM   1580 C CA  . GLY A 1 205 ? 28.648 10.139  17.721  1.00 39.02  ? 205  GLY A CA  1 
ATOM   1581 C C   . GLY A 1 205 ? 28.007 8.858   17.255  1.00 39.97  ? 205  GLY A C   1 
ATOM   1582 O O   . GLY A 1 205 ? 28.365 7.773   17.723  1.00 40.84  ? 205  GLY A O   1 
ATOM   1583 N N   . ALA A 1 206 ? 27.073 8.988   16.311  1.00 39.93  ? 206  ALA A N   1 
ATOM   1584 C CA  . ALA A 1 206 ? 26.451 7.843   15.653  1.00 40.11  ? 206  ALA A CA  1 
ATOM   1585 C C   . ALA A 1 206 ? 27.475 6.902   15.025  1.00 40.40  ? 206  ALA A C   1 
ATOM   1586 O O   . ALA A 1 206 ? 27.377 5.680   15.181  1.00 41.37  ? 206  ALA A O   1 
ATOM   1587 C CB  . ALA A 1 206 ? 25.452 8.317   14.602  1.00 40.30  ? 206  ALA A CB  1 
ATOM   1588 N N   . ALA A 1 207 ? 28.460 7.453   14.321  1.00 39.73  ? 207  ALA A N   1 
ATOM   1589 C CA  . ALA A 1 207 ? 29.460 6.605   13.676  1.00 40.27  ? 207  ALA A CA  1 
ATOM   1590 C C   . ALA A 1 207 ? 30.294 5.841   14.729  1.00 40.85  ? 207  ALA A C   1 
ATOM   1591 O O   . ALA A 1 207 ? 30.639 4.649   14.552  1.00 41.65  ? 207  ALA A O   1 
ATOM   1592 C CB  . ALA A 1 207 ? 30.333 7.423   12.766  1.00 39.67  ? 207  ALA A CB  1 
ATOM   1593 N N   . SER A 1 208 ? 30.594 6.533   15.830  1.00 40.12  ? 208  SER A N   1 
ATOM   1594 C CA  . SER A 1 208 ? 31.255 5.928   16.975  1.00 40.49  ? 208  SER A CA  1 
ATOM   1595 C C   . SER A 1 208 ? 30.443 4.767   17.550  1.00 41.38  ? 208  SER A C   1 
ATOM   1596 O O   . SER A 1 208 ? 31.013 3.705   17.839  1.00 41.97  ? 208  SER A O   1 
ATOM   1597 C CB  . SER A 1 208 ? 31.538 6.976   18.046  1.00 39.67  ? 208  SER A CB  1 
ATOM   1598 O OG  . SER A 1 208 ? 32.408 7.964   17.525  1.00 40.06  ? 208  SER A OG  1 
ATOM   1599 N N   . VAL A 1 209 ? 29.122 4.958   17.701  1.00 41.15  ? 209  VAL A N   1 
ATOM   1600 C CA  . VAL A 1 209 ? 28.246 3.890   18.188  1.00 41.41  ? 209  VAL A CA  1 
ATOM   1601 C C   . VAL A 1 209 ? 28.440 2.689   17.264  1.00 43.07  ? 209  VAL A C   1 
ATOM   1602 O O   . VAL A 1 209 ? 28.697 1.561   17.721  1.00 43.81  ? 209  VAL A O   1 
ATOM   1603 C CB  . VAL A 1 209 ? 26.767 4.320   18.214  1.00 41.24  ? 209  VAL A CB  1 
ATOM   1604 C CG1 . VAL A 1 209 ? 25.846 3.110   18.366  1.00 41.69  ? 209  VAL A CG1 1 
ATOM   1605 C CG2 . VAL A 1 209 ? 26.508 5.337   19.328  1.00 39.84  ? 209  VAL A CG2 1 
ATOM   1606 N N   . GLY A 1 210 ? 28.360 2.962   15.959  1.00 43.28  ? 210  GLY A N   1 
ATOM   1607 C CA  . GLY A 1 210 ? 28.515 1.955   14.919  1.00 44.43  ? 210  GLY A CA  1 
ATOM   1608 C C   . GLY A 1 210 ? 29.844 1.246   14.989  1.00 45.40  ? 210  GLY A C   1 
ATOM   1609 O O   . GLY A 1 210 ? 29.914 0.038   14.772  1.00 46.92  ? 210  GLY A O   1 
ATOM   1610 N N   . MET A 1 211 ? 30.909 1.974   15.308  1.00 45.20  ? 211  MET A N   1 
ATOM   1611 C CA  . MET A 1 211 ? 32.224 1.323   15.438  1.00 46.06  ? 211  MET A CA  1 
ATOM   1612 C C   . MET A 1 211 ? 32.332 0.436   16.659  1.00 46.25  ? 211  MET A C   1 
ATOM   1613 O O   . MET A 1 211 ? 33.039 -0.579  16.644  1.00 47.17  ? 211  MET A O   1 
ATOM   1614 C CB  . MET A 1 211 ? 33.354 2.333   15.374  1.00 45.88  ? 211  MET A CB  1 
ATOM   1615 C CG  . MET A 1 211 ? 33.704 2.648   13.938  1.00 47.39  ? 211  MET A CG  1 
ATOM   1616 S SD  . MET A 1 211 ? 34.308 4.299   13.875  1.00 50.62  ? 211  MET A SD  1 
ATOM   1617 C CE  . MET A 1 211 ? 33.838 4.815   12.223  1.00 47.51  ? 211  MET A CE  1 
ATOM   1618 N N   . HIS A 1 212 ? 31.599 0.796   17.705  1.00 45.43  ? 212  HIS A N   1 
ATOM   1619 C CA  . HIS A 1 212 ? 31.504 -0.074  18.860  1.00 45.97  ? 212  HIS A CA  1 
ATOM   1620 C C   . HIS A 1 212 ? 30.736 -1.344  18.545  1.00 47.61  ? 212  HIS A C   1 
ATOM   1621 O O   . HIS A 1 212 ? 31.050 -2.401  19.093  1.00 49.32  ? 212  HIS A O   1 
ATOM   1622 C CB  . HIS A 1 212 ? 30.945 0.668   20.069  1.00 44.90  ? 212  HIS A CB  1 
ATOM   1623 C CG  . HIS A 1 212 ? 31.925 1.621   20.672  1.00 42.78  ? 212  HIS A CG  1 
ATOM   1624 N ND1 . HIS A 1 212 ? 31.705 2.979   20.734  1.00 43.04  ? 212  HIS A ND1 1 
ATOM   1625 C CD2 . HIS A 1 212 ? 33.154 1.417   21.196  1.00 42.47  ? 212  HIS A CD2 1 
ATOM   1626 C CE1 . HIS A 1 212 ? 32.750 3.570   21.286  1.00 41.74  ? 212  HIS A CE1 1 
ATOM   1627 N NE2 . HIS A 1 212 ? 33.643 2.641   21.577  1.00 43.12  ? 212  HIS A NE2 1 
ATOM   1628 N N   . ILE A 1 213 ? 29.762 -1.258  17.638  1.00 47.66  ? 213  ILE A N   1 
ATOM   1629 C CA  . ILE A 1 213 ? 29.057 -2.446  17.164  1.00 49.14  ? 213  ILE A CA  1 
ATOM   1630 C C   . ILE A 1 213 ? 29.998 -3.388  16.390  1.00 50.82  ? 213  ILE A C   1 
ATOM   1631 O O   . ILE A 1 213 ? 29.839 -4.606  16.438  1.00 52.38  ? 213  ILE A O   1 
ATOM   1632 C CB  . ILE A 1 213 ? 27.829 -2.076  16.291  1.00 49.10  ? 213  ILE A CB  1 
ATOM   1633 C CG1 . ILE A 1 213 ? 26.851 -1.196  17.080  1.00 47.93  ? 213  ILE A CG1 1 
ATOM   1634 C CG2 . ILE A 1 213 ? 27.137 -3.331  15.748  1.00 50.21  ? 213  ILE A CG2 1 
ATOM   1635 C CD1 . ILE A 1 213 ? 25.537 -0.957  16.398  1.00 47.21  ? 213  ILE A CD1 1 
ATOM   1636 N N   . LEU A 1 214 ? 30.984 -2.822  15.695  1.00 50.60  ? 214  LEU A N   1 
ATOM   1637 C CA  . LEU A 1 214 ? 31.842 -3.599  14.800  1.00 52.01  ? 214  LEU A CA  1 
ATOM   1638 C C   . LEU A 1 214 ? 33.172 -3.999  15.427  1.00 52.89  ? 214  LEU A C   1 
ATOM   1639 O O   . LEU A 1 214 ? 33.966 -4.716  14.809  1.00 53.98  ? 214  LEU A O   1 
ATOM   1640 C CB  . LEU A 1 214 ? 32.092 -2.832  13.498  1.00 51.50  ? 214  LEU A CB  1 
ATOM   1641 C CG  . LEU A 1 214 ? 30.891 -2.369  12.669  1.00 51.18  ? 214  LEU A CG  1 
ATOM   1642 C CD1 . LEU A 1 214 ? 31.346 -1.455  11.555  1.00 49.72  ? 214  LEU A CD1 1 
ATOM   1643 C CD2 . LEU A 1 214 ? 30.125 -3.553  12.117  1.00 52.41  ? 214  LEU A CD2 1 
ATOM   1644 N N   . SER A 1 215 ? 33.413 -3.536  16.650  1.00 52.58  ? 215  SER A N   1 
ATOM   1645 C CA  . SER A 1 215 ? 34.656 -3.848  17.363  1.00 53.20  ? 215  SER A CA  1 
ATOM   1646 C C   . SER A 1 215 ? 34.411 -4.789  18.540  1.00 54.97  ? 215  SER A C   1 
ATOM   1647 O O   . SER A 1 215 ? 33.718 -4.441  19.496  1.00 54.12  ? 215  SER A O   1 
ATOM   1648 C CB  . SER A 1 215 ? 35.314 -2.570  17.845  1.00 51.46  ? 215  SER A CB  1 
ATOM   1649 O OG  . SER A 1 215 ? 36.646 -2.811  18.208  1.00 50.49  ? 215  SER A OG  1 
ATOM   1650 N N   . LEU A 1 216 ? 35.003 -5.979  18.462  1.00 57.77  ? 216  LEU A N   1 
ATOM   1651 C CA  . LEU A 1 216 ? 34.696 -7.079  19.372  1.00 59.97  ? 216  LEU A CA  1 
ATOM   1652 C C   . LEU A 1 216 ? 34.781 -6.720  20.865  1.00 59.51  ? 216  LEU A C   1 
ATOM   1653 O O   . LEU A 1 216 ? 33.808 -6.930  21.601  1.00 59.87  ? 216  LEU A O   1 
ATOM   1654 C CB  . LEU A 1 216 ? 35.568 -8.295  19.042  1.00 62.43  ? 216  LEU A CB  1 
ATOM   1655 C CG  . LEU A 1 216 ? 34.874 -9.661  19.076  1.00 66.24  ? 216  LEU A CG  1 
ATOM   1656 C CD1 . LEU A 1 216 ? 35.435 -10.556 17.969  1.00 69.42  ? 216  LEU A CD1 1 
ATOM   1657 C CD2 . LEU A 1 216 ? 34.962 -10.346 20.456  1.00 69.08  ? 216  LEU A CD2 1 
ATOM   1658 N N   . PRO A 1 217 ? 35.920 -6.149  21.318  1.00 59.02  ? 217  PRO A N   1 
ATOM   1659 C CA  . PRO A 1 217 ? 36.014 -5.839  22.755  1.00 58.59  ? 217  PRO A CA  1 
ATOM   1660 C C   . PRO A 1 217 ? 34.972 -4.841  23.294  1.00 56.98  ? 217  PRO A C   1 
ATOM   1661 O O   . PRO A 1 217 ? 34.839 -4.720  24.509  1.00 57.30  ? 217  PRO A O   1 
ATOM   1662 C CB  . PRO A 1 217 ? 37.439 -5.275  22.903  1.00 58.47  ? 217  PRO A CB  1 
ATOM   1663 C CG  . PRO A 1 217 ? 38.188 -5.787  21.684  1.00 59.10  ? 217  PRO A CG  1 
ATOM   1664 C CD  . PRO A 1 217 ? 37.157 -5.775  20.600  1.00 58.68  ? 217  PRO A CD  1 
ATOM   1665 N N   . SER A 1 218 ? 34.253 -4.140  22.415  1.00 55.65  ? 218  SER A N   1 
ATOM   1666 C CA  . SER A 1 218 ? 33.181 -3.226  22.832  1.00 54.30  ? 218  SER A CA  1 
ATOM   1667 C C   . SER A 1 218 ? 31.851 -3.931  22.970  1.00 55.26  ? 218  SER A C   1 
ATOM   1668 O O   . SER A 1 218 ? 31.022 -3.537  23.785  1.00 54.69  ? 218  SER A O   1 
ATOM   1669 C CB  . SER A 1 218 ? 33.010 -2.068  21.845  1.00 52.89  ? 218  SER A CB  1 
ATOM   1670 O OG  . SER A 1 218 ? 34.028 -1.085  21.992  1.00 51.90  ? 218  SER A OG  1 
ATOM   1671 N N   . ARG A 1 219 ? 31.652 -4.980  22.173  1.00 57.19  ? 219  ARG A N   1 
ATOM   1672 C CA  . ARG A 1 219 ? 30.351 -5.651  22.077  1.00 58.60  ? 219  ARG A CA  1 
ATOM   1673 C C   . ARG A 1 219 ? 29.807 -6.153  23.422  1.00 58.54  ? 219  ARG A C   1 
ATOM   1674 O O   . ARG A 1 219 ? 28.593 -6.243  23.595  1.00 59.11  ? 219  ARG A O   1 
ATOM   1675 C CB  . ARG A 1 219 ? 30.365 -6.795  21.033  1.00 60.89  ? 219  ARG A CB  1 
ATOM   1676 C CG  . ARG A 1 219 ? 30.002 -6.403  19.562  1.00 63.37  ? 219  ARG A CG  1 
ATOM   1677 C CD  . ARG A 1 219 ? 28.579 -5.756  19.364  1.00 67.54  ? 219  ARG A CD  1 
ATOM   1678 N NE  . ARG A 1 219 ? 27.460 -6.697  19.158  1.00 72.76  ? 219  ARG A NE  1 
ATOM   1679 C CZ  . ARG A 1 219 ? 27.239 -7.424  18.050  1.00 76.42  ? 219  ARG A CZ  1 
ATOM   1680 N NH1 . ARG A 1 219 ? 28.067 -7.362  17.010  1.00 77.42  ? 219  ARG A NH1 1 
ATOM   1681 N NH2 . ARG A 1 219 ? 26.190 -8.246  17.983  1.00 77.64  ? 219  ARG A NH2 1 
ATOM   1682 N N   . SER A 1 220 ? 30.689 -6.466  24.366  1.00 57.86  ? 220  SER A N   1 
ATOM   1683 C CA  . SER A 1 220 ? 30.257 -6.960  25.672  1.00 57.81  ? 220  SER A CA  1 
ATOM   1684 C C   . SER A 1 220 ? 29.929 -5.848  26.688  1.00 55.68  ? 220  SER A C   1 
ATOM   1685 O O   . SER A 1 220 ? 29.652 -6.134  27.857  1.00 55.90  ? 220  SER A O   1 
ATOM   1686 C CB  . SER A 1 220 ? 31.301 -7.926  26.247  1.00 59.46  ? 220  SER A CB  1 
ATOM   1687 O OG  . SER A 1 220 ? 32.464 -7.234  26.669  1.00 59.28  ? 220  SER A OG  1 
ATOM   1688 N N   . LEU A 1 221 ? 29.940 -4.592  26.231  1.00 53.15  ? 221  LEU A N   1 
ATOM   1689 C CA  . LEU A 1 221 ? 29.798 -3.432  27.110  1.00 50.79  ? 221  LEU A CA  1 
ATOM   1690 C C   . LEU A 1 221 ? 28.490 -2.700  26.957  1.00 49.78  ? 221  LEU A C   1 
ATOM   1691 O O   . LEU A 1 221 ? 28.248 -1.718  27.679  1.00 49.39  ? 221  LEU A O   1 
ATOM   1692 C CB  . LEU A 1 221 ? 30.949 -2.443  26.901  1.00 49.41  ? 221  LEU A CB  1 
ATOM   1693 C CG  . LEU A 1 221 ? 32.379 -3.001  27.005  1.00 49.36  ? 221  LEU A CG  1 
ATOM   1694 C CD1 . LEU A 1 221 ? 33.391 -1.900  26.711  1.00 46.98  ? 221  LEU A CD1 1 
ATOM   1695 C CD2 . LEU A 1 221 ? 32.654 -3.674  28.354  1.00 45.63  ? 221  LEU A CD2 1 
ATOM   1696 N N   . PHE A 1 222 ? 27.652 -3.162  26.028  1.00 49.46  ? 222  PHE A N   1 
ATOM   1697 C CA  . PHE A 1 222 ? 26.335 -2.550  25.759  1.00 48.50  ? 222  PHE A CA  1 
ATOM   1698 C C   . PHE A 1 222 ? 25.417 -3.573  25.092  1.00 50.00  ? 222  PHE A C   1 
ATOM   1699 O O   . PHE A 1 222 ? 25.888 -4.589  24.584  1.00 50.97  ? 222  PHE A O   1 
ATOM   1700 C CB  . PHE A 1 222 ? 26.464 -1.284  24.895  1.00 46.33  ? 222  PHE A CB  1 
ATOM   1701 C CG  . PHE A 1 222 ? 26.898 -1.552  23.473  1.00 46.11  ? 222  PHE A CG  1 
ATOM   1702 C CD1 . PHE A 1 222 ? 28.251 -1.742  23.157  1.00 45.59  ? 222  PHE A CD1 1 
ATOM   1703 C CD2 . PHE A 1 222 ? 25.960 -1.613  22.444  1.00 46.08  ? 222  PHE A CD2 1 
ATOM   1704 C CE1 . PHE A 1 222 ? 28.661 -1.997  21.836  1.00 44.64  ? 222  PHE A CE1 1 
ATOM   1705 C CE2 . PHE A 1 222 ? 26.362 -1.869  21.122  1.00 46.43  ? 222  PHE A CE2 1 
ATOM   1706 C CZ  . PHE A 1 222 ? 27.716 -2.062  20.824  1.00 45.55  ? 222  PHE A CZ  1 
ATOM   1707 N N   . HIS A 1 223 ? 24.117 -3.298  25.075  1.00 50.22  ? 223  HIS A N   1 
ATOM   1708 C CA  . HIS A 1 223 ? 23.140 -4.273  24.592  1.00 52.24  ? 223  HIS A CA  1 
ATOM   1709 C C   . HIS A 1 223 ? 22.317 -3.784  23.390  1.00 52.01  ? 223  HIS A C   1 
ATOM   1710 O O   . HIS A 1 223 ? 21.876 -4.592  22.572  1.00 53.13  ? 223  HIS A O   1 
ATOM   1711 C CB  . HIS A 1 223 ? 22.240 -4.721  25.749  1.00 53.46  ? 223  HIS A CB  1 
ATOM   1712 C CG  . HIS A 1 223 ? 23.008 -5.114  26.976  1.00 55.18  ? 223  HIS A CG  1 
ATOM   1713 N ND1 . HIS A 1 223 ? 23.480 -4.189  27.888  1.00 54.19  ? 223  HIS A ND1 1 
ATOM   1714 C CD2 . HIS A 1 223 ? 23.428 -6.325  27.416  1.00 56.92  ? 223  HIS A CD2 1 
ATOM   1715 C CE1 . HIS A 1 223 ? 24.147 -4.814  28.841  1.00 55.06  ? 223  HIS A CE1 1 
ATOM   1716 N NE2 . HIS A 1 223 ? 24.129 -6.111  28.580  1.00 57.82  ? 223  HIS A NE2 1 
ATOM   1717 N N   . ARG A 1 224 ? 22.128 -2.469  23.283  1.00 50.57  ? 224  ARG A N   1 
ATOM   1718 C CA  . ARG A 1 224 ? 21.317 -1.883  22.215  1.00 50.32  ? 224  ARG A CA  1 
ATOM   1719 C C   . ARG A 1 224 ? 21.940 -0.576  21.714  1.00 48.37  ? 224  ARG A C   1 
ATOM   1720 O O   . ARG A 1 224 ? 22.731 0.055   22.420  1.00 47.47  ? 224  ARG A O   1 
ATOM   1721 C CB  . ARG A 1 224 ? 19.891 -1.653  22.704  1.00 51.24  ? 224  ARG A CB  1 
ATOM   1722 C CG  . ARG A 1 224 ? 19.023 -2.891  22.644  1.00 54.84  ? 224  ARG A CG  1 
ATOM   1723 C CD  . ARG A 1 224 ? 17.709 -2.728  23.405  1.00 58.57  ? 224  ARG A CD  1 
ATOM   1724 N NE  . ARG A 1 224 ? 17.918 -2.704  24.850  1.00 60.76  ? 224  ARG A NE  1 
ATOM   1725 C CZ  . ARG A 1 224 ? 18.045 -3.785  25.614  1.00 62.08  ? 224  ARG A CZ  1 
ATOM   1726 N NH1 . ARG A 1 224 ? 17.972 -4.998  25.081  1.00 63.69  ? 224  ARG A NH1 1 
ATOM   1727 N NH2 . ARG A 1 224 ? 18.250 -3.648  26.918  1.00 62.11  ? 224  ARG A NH2 1 
ATOM   1728 N N   . ALA A 1 225 ? 21.599 -0.174  20.495  1.00 47.52  ? 225  ALA A N   1 
ATOM   1729 C CA  . ALA A 1 225 ? 22.267 0.968   19.883  1.00 45.70  ? 225  ALA A CA  1 
ATOM   1730 C C   . ALA A 1 225 ? 21.310 1.849   19.096  1.00 45.18  ? 225  ALA A C   1 
ATOM   1731 O O   . ALA A 1 225 ? 20.422 1.349   18.404  1.00 46.27  ? 225  ALA A O   1 
ATOM   1732 C CB  . ALA A 1 225 ? 23.387 0.489   18.995  1.00 45.41  ? 225  ALA A CB  1 
ATOM   1733 N N   . VAL A 1 226 ? 21.505 3.157   19.213  1.00 43.81  ? 226  VAL A N   1 
ATOM   1734 C CA  . VAL A 1 226 ? 20.769 4.145   18.437  1.00 43.51  ? 226  VAL A CA  1 
ATOM   1735 C C   . VAL A 1 226 ? 21.748 5.022   17.644  1.00 42.68  ? 226  VAL A C   1 
ATOM   1736 O O   . VAL A 1 226 ? 22.658 5.625   18.226  1.00 41.93  ? 226  VAL A O   1 
ATOM   1737 C CB  . VAL A 1 226 ? 19.903 5.056   19.335  1.00 43.37  ? 226  VAL A CB  1 
ATOM   1738 C CG1 . VAL A 1 226 ? 19.211 6.122   18.483  1.00 43.61  ? 226  VAL A CG1 1 
ATOM   1739 C CG2 . VAL A 1 226 ? 18.872 4.260   20.114  1.00 43.15  ? 226  VAL A CG2 1 
ATOM   1740 N N   . LEU A 1 227 ? 21.554 5.101   16.325  1.00 42.92  ? 227  LEU A N   1 
ATOM   1741 C CA  . LEU A 1 227 ? 22.435 5.886   15.443  1.00 41.87  ? 227  LEU A CA  1 
ATOM   1742 C C   . LEU A 1 227 ? 21.688 7.015   14.748  1.00 41.64  ? 227  LEU A C   1 
ATOM   1743 O O   . LEU A 1 227 ? 20.912 6.784   13.815  1.00 42.56  ? 227  LEU A O   1 
ATOM   1744 C CB  . LEU A 1 227 ? 23.107 4.982   14.404  1.00 42.29  ? 227  LEU A CB  1 
ATOM   1745 C CG  . LEU A 1 227 ? 24.137 3.958   14.894  1.00 42.93  ? 227  LEU A CG  1 
ATOM   1746 C CD1 . LEU A 1 227 ? 23.457 2.710   15.423  1.00 43.79  ? 227  LEU A CD1 1 
ATOM   1747 C CD2 . LEU A 1 227 ? 25.076 3.586   13.773  1.00 43.07  ? 227  LEU A CD2 1 
ATOM   1748 N N   . GLN A 1 228 ? 21.923 8.243   15.194  1.00 40.77  ? 228  GLN A N   1 
ATOM   1749 C CA  . GLN A 1 228 ? 21.213 9.408   14.647  1.00 40.64  ? 228  GLN A CA  1 
ATOM   1750 C C   . GLN A 1 228 ? 22.065 10.145  13.629  1.00 39.72  ? 228  GLN A C   1 
ATOM   1751 O O   . GLN A 1 228 ? 23.118 10.665  13.981  1.00 39.65  ? 228  GLN A O   1 
ATOM   1752 C CB  . GLN A 1 228 ? 20.818 10.363  15.769  1.00 40.29  ? 228  GLN A CB  1 
ATOM   1753 C CG  . GLN A 1 228 ? 20.070 9.690   16.912  1.00 42.31  ? 228  GLN A CG  1 
ATOM   1754 C CD  . GLN A 1 228 ? 19.740 10.630  18.049  1.00 44.01  ? 228  GLN A CD  1 
ATOM   1755 O OE1 . GLN A 1 228 ? 19.350 10.192  19.125  1.00 45.58  ? 228  GLN A OE1 1 
ATOM   1756 N NE2 . GLN A 1 228 ? 19.896 11.933  17.820  1.00 45.47  ? 228  GLN A NE2 1 
ATOM   1757 N N   . SER A 1 229 ? 21.619 10.175  12.373  1.00 39.70  ? 229  SER A N   1 
ATOM   1758 C CA  . SER A 1 229 ? 22.275 10.931  11.299  1.00 38.98  ? 229  SER A CA  1 
ATOM   1759 C C   . SER A 1 229 ? 23.770 10.621  11.170  1.00 38.52  ? 229  SER A C   1 
ATOM   1760 O O   . SER A 1 229 ? 24.592 11.535  11.045  1.00 38.16  ? 229  SER A O   1 
ATOM   1761 C CB  . SER A 1 229 ? 22.064 12.454  11.482  1.00 38.87  ? 229  SER A CB  1 
ATOM   1762 O OG  . SER A 1 229 ? 20.688 12.811  11.614  1.00 39.27  ? 229  SER A OG  1 
ATOM   1763 N N   . GLY A 1 230 ? 24.131 9.340   11.204  1.00 38.74  ? 230  GLY A N   1 
ATOM   1764 C CA  . GLY A 1 230 ? 25.538 8.954   11.137  1.00 38.35  ? 230  GLY A CA  1 
ATOM   1765 C C   . GLY A 1 230 ? 25.762 7.460   11.103  1.00 39.32  ? 230  GLY A C   1 
ATOM   1766 O O   . GLY A 1 230 ? 24.925 6.682   11.592  1.00 40.39  ? 230  GLY A O   1 
ATOM   1767 N N   . THR A 1 231 ? 26.890 7.050   10.522  1.00 39.26  ? 231  THR A N   1 
ATOM   1768 C CA  . THR A 1 231 ? 27.186 5.629   10.315  1.00 39.85  ? 231  THR A CA  1 
ATOM   1769 C C   . THR A 1 231 ? 28.685 5.369   10.242  1.00 40.03  ? 231  THR A C   1 
ATOM   1770 O O   . THR A 1 231 ? 29.438 6.234   9.800   1.00 39.52  ? 231  THR A O   1 
ATOM   1771 C CB  . THR A 1 231 ? 26.550 5.074   9.012   1.00 40.81  ? 231  THR A CB  1 
ATOM   1772 O OG1 . THR A 1 231 ? 27.204 5.637   7.865   1.00 40.62  ? 231  THR A OG1 1 
ATOM   1773 C CG2 . THR A 1 231 ? 25.059 5.344   8.947   1.00 39.87  ? 231  THR A CG2 1 
ATOM   1774 N N   . PRO A 1 232 ? 29.130 4.175   10.685  1.00 40.99  ? 232  PRO A N   1 
ATOM   1775 C CA  . PRO A 1 232 ? 30.566 3.843   10.577  1.00 41.15  ? 232  PRO A CA  1 
ATOM   1776 C C   . PRO A 1 232 ? 31.042 3.706   9.121   1.00 41.84  ? 232  PRO A C   1 
ATOM   1777 O O   . PRO A 1 232 ? 32.180 4.037   8.819   1.00 41.66  ? 232  PRO A O   1 
ATOM   1778 C CB  . PRO A 1 232 ? 30.678 2.509   11.324  1.00 42.31  ? 232  PRO A CB  1 
ATOM   1779 C CG  . PRO A 1 232 ? 29.284 1.914   11.289  1.00 42.66  ? 232  PRO A CG  1 
ATOM   1780 C CD  . PRO A 1 232 ? 28.348 3.095   11.326  1.00 41.48  ? 232  PRO A CD  1 
ATOM   1781 N N   . ASN A 1 233 ? 30.164 3.226   8.240   1.00 42.76  ? 233  ASN A N   1 
ATOM   1782 C CA  . ASN A 1 233 ? 30.412 3.198   6.802   1.00 43.55  ? 233  ASN A CA  1 
ATOM   1783 C C   . ASN A 1 233 ? 30.158 4.582   6.191   1.00 43.47  ? 233  ASN A C   1 
ATOM   1784 O O   . ASN A 1 233 ? 29.616 5.472   6.863   1.00 42.60  ? 233  ASN A O   1 
ATOM   1785 C CB  . ASN A 1 233 ? 29.552 2.122   6.129   1.00 44.27  ? 233  ASN A CB  1 
ATOM   1786 C CG  . ASN A 1 233 ? 28.067 2.326   6.362   1.00 44.10  ? 233  ASN A CG  1 
ATOM   1787 O OD1 . ASN A 1 233 ? 27.608 2.383   7.501   1.00 43.08  ? 233  ASN A OD1 1 
ATOM   1788 N ND2 . ASN A 1 233 ? 27.303 2.427   5.276   1.00 44.00  ? 233  ASN A ND2 1 
ATOM   1789 N N   . GLY A 1 234 ? 30.563 4.774   4.935   1.00 44.40  ? 234  GLY A N   1 
ATOM   1790 C CA  . GLY A 1 234 ? 30.435 6.082   4.275   1.00 44.64  ? 234  GLY A CA  1 
ATOM   1791 C C   . GLY A 1 234 ? 31.778 6.770   4.030   1.00 44.89  ? 234  GLY A C   1 
ATOM   1792 O O   . GLY A 1 234 ? 32.820 6.243   4.414   1.00 45.37  ? 234  GLY A O   1 
ATOM   1793 N N   . PRO A 1 235 ? 31.763 7.964   3.404   1.00 44.61  ? 235  PRO A N   1 
ATOM   1794 C CA  . PRO A 1 235 ? 32.985 8.602   2.902   1.00 44.62  ? 235  PRO A CA  1 
ATOM   1795 C C   . PRO A 1 235 ? 33.810 9.437   3.905   1.00 43.99  ? 235  PRO A C   1 
ATOM   1796 O O   . PRO A 1 235 ? 34.957 9.815   3.595   1.00 44.47  ? 235  PRO A O   1 
ATOM   1797 C CB  . PRO A 1 235 ? 32.467 9.513   1.780   1.00 44.62  ? 235  PRO A CB  1 
ATOM   1798 C CG  . PRO A 1 235 ? 30.951 9.568   1.932   1.00 44.36  ? 235  PRO A CG  1 
ATOM   1799 C CD  . PRO A 1 235 ? 30.562 8.772   3.123   1.00 44.43  ? 235  PRO A CD  1 
ATOM   1800 N N   . TRP A 1 236 ? 33.258 9.733   5.078   1.00 42.52  ? 236  TRP A N   1 
ATOM   1801 C CA  . TRP A 1 236 ? 33.941 10.641  6.006   1.00 41.30  ? 236  TRP A CA  1 
ATOM   1802 C C   . TRP A 1 236 ? 34.343 10.008  7.335   1.00 41.16  ? 236  TRP A C   1 
ATOM   1803 O O   . TRP A 1 236 ? 35.204 10.535  8.022   1.00 41.23  ? 236  TRP A O   1 
ATOM   1804 C CB  . TRP A 1 236 ? 33.076 11.869  6.289   1.00 40.09  ? 236  TRP A CB  1 
ATOM   1805 C CG  . TRP A 1 236 ? 31.712 11.515  6.810   1.00 39.67  ? 236  TRP A CG  1 
ATOM   1806 C CD1 . TRP A 1 236 ? 30.588 11.294  6.068   1.00 39.79  ? 236  TRP A CD1 1 
ATOM   1807 C CD2 . TRP A 1 236 ? 31.328 11.324  8.183   1.00 39.73  ? 236  TRP A CD2 1 
ATOM   1808 N NE1 . TRP A 1 236 ? 29.528 10.982  6.891   1.00 39.70  ? 236  TRP A NE1 1 
ATOM   1809 C CE2 . TRP A 1 236 ? 29.956 10.990  8.193   1.00 39.17  ? 236  TRP A CE2 1 
ATOM   1810 C CE3 . TRP A 1 236 ? 32.007 11.419  9.408   1.00 40.19  ? 236  TRP A CE3 1 
ATOM   1811 C CZ2 . TRP A 1 236 ? 29.249 10.741  9.381   1.00 39.05  ? 236  TRP A CZ2 1 
ATOM   1812 C CZ3 . TRP A 1 236 ? 31.294 11.168  10.595  1.00 38.44  ? 236  TRP A CZ3 1 
ATOM   1813 C CH2 . TRP A 1 236 ? 29.936 10.832  10.564  1.00 38.21  ? 236  TRP A CH2 1 
ATOM   1814 N N   . ALA A 1 237 ? 33.718 8.893   7.712   1.00 41.09  ? 237  ALA A N   1 
ATOM   1815 C CA  . ALA A 1 237 ? 33.870 8.391   9.085   1.00 40.33  ? 237  ALA A CA  1 
ATOM   1816 C C   . ALA A 1 237 ? 35.182 7.653   9.355   1.00 40.43  ? 237  ALA A C   1 
ATOM   1817 O O   . ALA A 1 237 ? 35.597 7.545   10.510  1.00 40.17  ? 237  ALA A O   1 
ATOM   1818 C CB  . ALA A 1 237 ? 32.652 7.548   9.515   1.00 40.25  ? 237  ALA A CB  1 
ATOM   1819 N N   . THR A 1 238 ? 35.827 7.146   8.307   1.00 40.55  ? 238  THR A N   1 
ATOM   1820 C CA  . THR A 1 238 ? 37.101 6.445   8.467   1.00 41.21  ? 238  THR A CA  1 
ATOM   1821 C C   . THR A 1 238 ? 38.102 6.783   7.377   1.00 42.09  ? 238  THR A C   1 
ATOM   1822 O O   . THR A 1 238 ? 37.733 7.345   6.339   1.00 42.86  ? 238  THR A O   1 
ATOM   1823 C CB  . THR A 1 238 ? 36.938 4.912   8.467   1.00 42.09  ? 238  THR A CB  1 
ATOM   1824 O OG1 . THR A 1 238 ? 36.207 4.511   7.303   1.00 42.39  ? 238  THR A OG1 1 
ATOM   1825 C CG2 . THR A 1 238 ? 36.235 4.435   9.726   1.00 40.70  ? 238  THR A CG2 1 
ATOM   1826 N N   . VAL A 1 239 ? 39.368 6.442   7.620   1.00 42.15  ? 239  VAL A N   1 
ATOM   1827 C CA  . VAL A 1 239 ? 40.424 6.563   6.616   1.00 42.38  ? 239  VAL A CA  1 
ATOM   1828 C C   . VAL A 1 239 ? 41.299 5.300   6.627   1.00 44.09  ? 239  VAL A C   1 
ATOM   1829 O O   . VAL A 1 239 ? 41.369 4.602   7.632   1.00 43.67  ? 239  VAL A O   1 
ATOM   1830 C CB  . VAL A 1 239 ? 41.294 7.841   6.819   1.00 42.06  ? 239  VAL A CB  1 
ATOM   1831 C CG1 . VAL A 1 239 ? 40.523 9.088   6.377   1.00 40.87  ? 239  VAL A CG1 1 
ATOM   1832 C CG2 . VAL A 1 239 ? 41.818 7.964   8.273   1.00 39.40  ? 239  VAL A CG2 1 
ATOM   1833 N N   . SER A 1 240 ? 41.942 5.006   5.502   1.00 45.35  ? 240  SER A N   1 
ATOM   1834 C CA  . SER A 1 240 ? 42.868 3.882   5.411   1.00 47.58  ? 240  SER A CA  1 
ATOM   1835 C C   . SER A 1 240 ? 44.109 4.133   6.267   1.00 48.15  ? 240  SER A C   1 
ATOM   1836 O O   . SER A 1 240 ? 44.408 5.274   6.614   1.00 47.63  ? 240  SER A O   1 
ATOM   1837 C CB  . SER A 1 240 ? 43.276 3.651   3.954   1.00 48.52  ? 240  SER A CB  1 
ATOM   1838 O OG  . SER A 1 240 ? 43.846 4.830   3.401   1.00 48.23  ? 240  SER A OG  1 
ATOM   1839 N N   . ALA A 1 241 ? 44.822 3.070   6.610   1.00 49.80  ? 241  ALA A N   1 
ATOM   1840 C CA  . ALA A 1 241 ? 46.114 3.205   7.297   1.00 51.44  ? 241  ALA A CA  1 
ATOM   1841 C C   . ALA A 1 241 ? 47.057 4.147   6.529   1.00 52.05  ? 241  ALA A C   1 
ATOM   1842 O O   . ALA A 1 241 ? 47.669 5.036   7.118   1.00 51.92  ? 241  ALA A O   1 
ATOM   1843 C CB  . ALA A 1 241 ? 46.779 1.812   7.528   1.00 52.58  ? 241  ALA A CB  1 
ATOM   1844 N N   . GLY A 1 242 ? 47.143 3.955   5.214   1.00 53.22  ? 242  GLY A N   1 
ATOM   1845 C CA  . GLY A 1 242 ? 48.008 4.762   4.356   1.00 54.27  ? 242  GLY A CA  1 
ATOM   1846 C C   . GLY A 1 242 ? 47.687 6.247   4.379   1.00 53.28  ? 242  GLY A C   1 
ATOM   1847 O O   . GLY A 1 242 ? 48.598 7.089   4.422   1.00 53.77  ? 242  GLY A O   1 
ATOM   1848 N N   . GLU A 1 243 ? 46.397 6.576   4.353   1.00 51.66  ? 243  GLU A N   1 
ATOM   1849 C CA  . GLU A 1 243 ? 45.993 7.970   4.291   1.00 50.66  ? 243  GLU A CA  1 
ATOM   1850 C C   . GLU A 1 243 ? 46.203 8.658   5.647   1.00 49.95  ? 243  GLU A C   1 
ATOM   1851 O O   . GLU A 1 243 ? 46.545 9.842   5.703   1.00 49.90  ? 243  GLU A O   1 
ATOM   1852 C CB  . GLU A 1 243 ? 44.545 8.091   3.793   1.00 49.64  ? 243  GLU A CB  1 
ATOM   1853 C CG  . GLU A 1 243 ? 43.940 9.497   3.827   1.00 48.61  ? 243  GLU A CG  1 
ATOM   1854 C CD  . GLU A 1 243 ? 44.570 10.508  2.848   1.00 50.09  ? 243  GLU A CD  1 
ATOM   1855 O OE1 . GLU A 1 243 ? 44.103 11.674  2.864   1.00 49.95  ? 243  GLU A OE1 1 
ATOM   1856 O OE2 . GLU A 1 243 ? 45.505 10.172  2.072   1.00 49.87  ? 243  GLU A OE2 1 
ATOM   1857 N N   . ALA A 1 244 ? 46.012 7.905   6.730   1.00 49.45  ? 244  ALA A N   1 
ATOM   1858 C CA  . ALA A 1 244 ? 46.221 8.415   8.080   1.00 48.34  ? 244  ALA A CA  1 
ATOM   1859 C C   . ALA A 1 244 ? 47.696 8.712   8.306   1.00 49.41  ? 244  ALA A C   1 
ATOM   1860 O O   . ALA A 1 244 ? 48.028 9.701   8.950   1.00 49.27  ? 244  ALA A O   1 
ATOM   1861 C CB  . ALA A 1 244 ? 45.713 7.424   9.116   1.00 47.70  ? 244  ALA A CB  1 
ATOM   1862 N N   . ARG A 1 245 ? 48.571 7.854   7.774   1.00 50.68  ? 245  ARG A N   1 
ATOM   1863 C CA  . ARG A 1 245 ? 50.019 8.066   7.841   1.00 51.69  ? 245  ARG A CA  1 
ATOM   1864 C C   . ARG A 1 245 ? 50.379 9.313   7.051   1.00 51.86  ? 245  ARG A C   1 
ATOM   1865 O O   . ARG A 1 245 ? 51.172 10.133  7.506   1.00 52.37  ? 245  ARG A O   1 
ATOM   1866 C CB  . ARG A 1 245 ? 50.793 6.847   7.313   1.00 53.19  ? 245  ARG A CB  1 
ATOM   1867 C CG  . ARG A 1 245 ? 52.321 7.021   7.262   1.00 53.31  ? 245  ARG A CG  1 
ATOM   1868 C CD  . ARG A 1 245 ? 53.060 5.688   7.111   1.00 53.95  ? 245  ARG A CD  1 
ATOM   1869 N NE  . ARG A 1 245 ? 52.943 4.894   8.331   1.00 52.81  ? 245  ARG A NE  1 
ATOM   1870 C CZ  . ARG A 1 245 ? 53.748 5.010   9.386   1.00 53.40  ? 245  ARG A CZ  1 
ATOM   1871 N NH1 . ARG A 1 245 ? 54.765 5.869   9.378   1.00 52.94  ? 245  ARG A NH1 1 
ATOM   1872 N NH2 . ARG A 1 245 ? 53.536 4.260   10.460  1.00 52.71  ? 245  ARG A NH2 1 
ATOM   1873 N N   . ARG A 1 246 ? 49.778 9.448   5.874   1.00 51.47  ? 246  ARG A N   1 
ATOM   1874 C CA  . ARG A 1 246 ? 50.001 10.602  5.015   1.00 51.81  ? 246  ARG A CA  1 
ATOM   1875 C C   . ARG A 1 246 ? 49.619 11.909  5.727   1.00 50.39  ? 246  ARG A C   1 
ATOM   1876 O O   . ARG A 1 246 ? 50.401 12.864  5.751   1.00 50.78  ? 246  ARG A O   1 
ATOM   1877 C CB  . ARG A 1 246 ? 49.202 10.447  3.732   1.00 51.60  ? 246  ARG A CB  1 
ATOM   1878 C CG  . ARG A 1 246 ? 49.707 11.248  2.568   1.00 53.66  ? 246  ARG A CG  1 
ATOM   1879 C CD  . ARG A 1 246 ? 48.538 11.692  1.677   1.00 54.75  ? 246  ARG A CD  1 
ATOM   1880 N NE  . ARG A 1 246 ? 48.431 13.144  1.678   1.00 56.43  ? 246  ARG A NE  1 
ATOM   1881 C CZ  . ARG A 1 246 ? 47.377 13.845  2.089   1.00 56.05  ? 246  ARG A CZ  1 
ATOM   1882 N NH1 . ARG A 1 246 ? 46.277 13.252  2.523   1.00 54.54  ? 246  ARG A NH1 1 
ATOM   1883 N NH2 . ARG A 1 246 ? 47.420 15.165  2.029   1.00 57.85  ? 246  ARG A NH2 1 
ATOM   1884 N N   . ARG A 1 247 ? 48.432 11.939  6.330   1.00 48.48  ? 247  ARG A N   1 
ATOM   1885 C CA  . ARG A 1 247 ? 47.963 13.147  6.997   1.00 47.10  ? 247  ARG A CA  1 
ATOM   1886 C C   . ARG A 1 247 ? 48.774 13.493  8.240   1.00 47.56  ? 247  ARG A C   1 
ATOM   1887 O O   . ARG A 1 247 ? 49.032 14.671  8.502   1.00 47.28  ? 247  ARG A O   1 
ATOM   1888 C CB  . ARG A 1 247 ? 46.489 13.037  7.338   1.00 45.32  ? 247  ARG A CB  1 
ATOM   1889 C CG  . ARG A 1 247 ? 45.596 13.051  6.131   1.00 43.99  ? 247  ARG A CG  1 
ATOM   1890 C CD  . ARG A 1 247 ? 44.186 12.776  6.558   1.00 43.82  ? 247  ARG A CD  1 
ATOM   1891 N NE  . ARG A 1 247 ? 43.310 12.516  5.419   1.00 43.71  ? 247  ARG A NE  1 
ATOM   1892 C CZ  . ARG A 1 247 ? 41.983 12.559  5.468   1.00 41.08  ? 247  ARG A CZ  1 
ATOM   1893 N NH1 . ARG A 1 247 ? 41.341 12.872  6.596   1.00 38.96  ? 247  ARG A NH1 1 
ATOM   1894 N NH2 . ARG A 1 247 ? 41.302 12.308  4.374   1.00 40.22  ? 247  ARG A NH2 1 
ATOM   1895 N N   . ALA A 1 248 ? 49.180 12.463  8.986   1.00 48.02  ? 248  ALA A N   1 
ATOM   1896 C CA  . ALA A 1 248 ? 49.976 12.641  10.199  1.00 48.38  ? 248  ALA A CA  1 
ATOM   1897 C C   . ALA A 1 248 ? 51.351 13.219  9.905   1.00 50.21  ? 248  ALA A C   1 
ATOM   1898 O O   . ALA A 1 248 ? 51.800 14.114  10.614  1.00 50.17  ? 248  ALA A O   1 
ATOM   1899 C CB  . ALA A 1 248 ? 50.109 11.346  10.955  1.00 48.30  ? 248  ALA A CB  1 
ATOM   1900 N N   . THR A 1 249 ? 52.022 12.713  8.871   1.00 51.87  ? 249  THR A N   1 
ATOM   1901 C CA  . THR A 1 249 ? 53.361 13.196  8.583   1.00 54.16  ? 249  THR A CA  1 
ATOM   1902 C C   . THR A 1 249 ? 53.307 14.594  7.962   1.00 54.01  ? 249  THR A C   1 
ATOM   1903 O O   . THR A 1 249 ? 54.191 15.419  8.222   1.00 55.05  ? 249  THR A O   1 
ATOM   1904 C CB  . THR A 1 249 ? 54.291 12.166  7.807   1.00 56.37  ? 249  THR A CB  1 
ATOM   1905 O OG1 . THR A 1 249 ? 54.320 12.436  6.405   1.00 57.46  ? 249  THR A OG1 1 
ATOM   1906 C CG2 . THR A 1 249 ? 53.862 10.730  8.035   1.00 56.59  ? 249  THR A CG2 1 
ATOM   1907 N N   . LEU A 1 250 ? 52.254 14.868  7.189   1.00 52.97  ? 250  LEU A N   1 
ATOM   1908 C CA  . LEU A 1 250 ? 52.033 16.214  6.645   1.00 53.14  ? 250  LEU A CA  1 
ATOM   1909 C C   . LEU A 1 250 ? 51.851 17.240  7.767   1.00 53.05  ? 250  LEU A C   1 
ATOM   1910 O O   . LEU A 1 250 ? 52.527 18.288  7.778   1.00 53.96  ? 250  LEU A O   1 
ATOM   1911 C CB  . LEU A 1 250 ? 50.855 16.266  5.663   1.00 51.74  ? 250  LEU A CB  1 
ATOM   1912 C CG  . LEU A 1 250 ? 50.653 17.608  4.941   1.00 51.75  ? 250  LEU A CG  1 
ATOM   1913 C CD1 . LEU A 1 250 ? 51.922 18.025  4.186   1.00 52.82  ? 250  LEU A CD1 1 
ATOM   1914 C CD2 . LEU A 1 250 ? 49.457 17.592  4.001   1.00 49.31  ? 250  LEU A CD2 1 
ATOM   1915 N N   . LEU A 1 251 ? 50.955 16.930  8.709   1.00 52.00  ? 251  LEU A N   1 
ATOM   1916 C CA  . LEU A 1 251 ? 50.783 17.756  9.897   1.00 51.83  ? 251  LEU A CA  1 
ATOM   1917 C C   . LEU A 1 251 ? 52.119 18.023  10.597  1.00 53.69  ? 251  LEU A C   1 
ATOM   1918 O O   . LEU A 1 251 ? 52.417 19.163  10.947  1.00 54.26  ? 251  LEU A O   1 
ATOM   1919 C CB  . LEU A 1 251 ? 49.797 17.132  10.883  1.00 50.20  ? 251  LEU A CB  1 
ATOM   1920 C CG  . LEU A 1 251 ? 49.533 18.150  11.998  1.00 49.74  ? 251  LEU A CG  1 
ATOM   1921 C CD1 . LEU A 1 251 ? 48.340 19.044  11.683  1.00 47.18  ? 251  LEU A CD1 1 
ATOM   1922 C CD2 . LEU A 1 251 ? 49.380 17.496  13.329  1.00 49.50  ? 251  LEU A CD2 1 
ATOM   1923 N N   . ALA A 1 252 ? 52.915 16.970  10.777  1.00 55.01  ? 252  ALA A N   1 
ATOM   1924 C CA  . ALA A 1 252 ? 54.233 17.074  11.393  1.00 57.28  ? 252  ALA A CA  1 
ATOM   1925 C C   . ALA A 1 252 ? 55.134 18.085  10.678  1.00 59.27  ? 252  ALA A C   1 
ATOM   1926 O O   . ALA A 1 252 ? 55.681 18.985  11.313  1.00 59.70  ? 252  ALA A O   1 
ATOM   1927 C CB  . ALA A 1 252 ? 54.895 15.702  11.462  1.00 58.00  ? 252  ALA A CB  1 
ATOM   1928 N N   . ARG A 1 253 ? 55.272 17.940  9.359   1.00 60.76  ? 253  ARG A N   1 
ATOM   1929 C CA  . ARG A 1 253 ? 56.036 18.895  8.542   1.00 63.33  ? 253  ARG A CA  1 
ATOM   1930 C C   . ARG A 1 253 ? 55.563 20.339  8.779   1.00 62.47  ? 253  ARG A C   1 
ATOM   1931 O O   . ARG A 1 253 ? 56.362 21.206  9.104   1.00 63.93  ? 253  ARG A O   1 
ATOM   1932 C CB  . ARG A 1 253 ? 56.020 18.511  7.043   1.00 63.32  ? 253  ARG A CB  1 
ATOM   1933 C CG  . ARG A 1 253 ? 57.130 17.514  6.652   1.00 67.11  ? 253  ARG A CG  1 
ATOM   1934 C CD  . ARG A 1 253 ? 57.116 17.017  5.170   1.00 68.35  ? 253  ARG A CD  1 
ATOM   1935 N NE  . ARG A 1 253 ? 56.160 15.910  4.965   1.00 72.12  ? 253  ARG A NE  1 
ATOM   1936 C CZ  . ARG A 1 253 ? 55.193 15.882  4.041   1.00 71.69  ? 253  ARG A CZ  1 
ATOM   1937 N NH1 . ARG A 1 253 ? 54.376 14.834  3.969   1.00 70.31  ? 253  ARG A NH1 1 
ATOM   1938 N NH2 . ARG A 1 253 ? 55.039 16.889  3.178   1.00 72.19  ? 253  ARG A NH2 1 
ATOM   1939 N N   . LEU A 1 254 ? 54.255 20.565  8.673   1.00 60.85  ? 254  LEU A N   1 
ATOM   1940 C CA  . LEU A 1 254 ? 53.646 21.895  8.825   1.00 60.28  ? 254  LEU A CA  1 
ATOM   1941 C C   . LEU A 1 254 ? 53.865 22.592  10.173  1.00 60.54  ? 254  LEU A C   1 
ATOM   1942 O O   . LEU A 1 254 ? 53.796 23.818  10.244  1.00 60.60  ? 254  LEU A O   1 
ATOM   1943 C CB  . LEU A 1 254 ? 52.143 21.837  8.505   1.00 58.14  ? 254  LEU A CB  1 
ATOM   1944 C CG  . LEU A 1 254 ? 51.777 21.487  7.057   1.00 58.34  ? 254  LEU A CG  1 
ATOM   1945 C CD1 . LEU A 1 254 ? 50.281 21.350  6.874   1.00 56.32  ? 254  LEU A CD1 1 
ATOM   1946 C CD2 . LEU A 1 254 ? 52.350 22.505  6.073   1.00 60.32  ? 254  LEU A CD2 1 
ATOM   1947 N N   . VAL A 1 255 ? 54.105 21.822  11.231  1.00 60.85  ? 255  VAL A N   1 
ATOM   1948 C CA  . VAL A 1 255 ? 54.313 22.401  12.568  1.00 61.69  ? 255  VAL A CA  1 
ATOM   1949 C C   . VAL A 1 255 ? 55.775 22.443  13.022  1.00 64.54  ? 255  VAL A C   1 
ATOM   1950 O O   . VAL A 1 255 ? 56.058 22.861  14.147  1.00 65.47  ? 255  VAL A O   1 
ATOM   1951 C CB  . VAL A 1 255 ? 53.469 21.706  13.673  1.00 60.09  ? 255  VAL A CB  1 
ATOM   1952 C CG1 . VAL A 1 255 ? 51.966 21.923  13.444  1.00 56.97  ? 255  VAL A CG1 1 
ATOM   1953 C CG2 . VAL A 1 255 ? 53.835 20.238  13.798  1.00 59.50  ? 255  VAL A CG2 1 
ATOM   1954 N N   . GLY A 1 256 ? 56.691 22.007  12.160  1.00 66.17  ? 256  GLY A N   1 
ATOM   1955 C CA  . GLY A 1 256 ? 58.115 22.099  12.450  1.00 69.06  ? 256  GLY A CA  1 
ATOM   1956 C C   . GLY A 1 256 ? 58.783 20.800  12.857  1.00 70.23  ? 256  GLY A C   1 
ATOM   1957 O O   . GLY A 1 256 ? 59.897 20.815  13.377  1.00 72.08  ? 256  GLY A O   1 
ATOM   1958 N N   . CYS A 1 257 ? 58.108 19.677  12.616  1.00 69.36  ? 257  CYS A N   1 
ATOM   1959 C CA  . CYS A 1 257 ? 58.640 18.351  12.945  1.00 70.12  ? 257  CYS A CA  1 
ATOM   1960 C C   . CYS A 1 257 ? 58.964 17.573  11.669  1.00 71.95  ? 257  CYS A C   1 
ATOM   1961 O O   . CYS A 1 257 ? 58.073 16.973  11.062  1.00 70.56  ? 257  CYS A O   1 
ATOM   1962 C CB  . CYS A 1 257 ? 57.650 17.583  13.825  1.00 67.66  ? 257  CYS A CB  1 
ATOM   1963 S SG  . CYS A 1 257 ? 57.466 18.276  15.482  1.00 65.08  ? 257  CYS A SG  1 
ATOM   1964 N N   . PRO A 1 258 ? 60.251 17.553  11.270  1.00 75.45  ? 258  PRO A N   1 
ATOM   1965 C CA  . PRO A 1 258 ? 60.594 17.064  9.935   1.00 76.99  ? 258  PRO A CA  1 
ATOM   1966 C C   . PRO A 1 258 ? 60.921 15.561  9.943   1.00 78.05  ? 258  PRO A C   1 
ATOM   1967 O O   . PRO A 1 258 ? 60.039 14.742  10.244  1.00 76.90  ? 258  PRO A O   1 
ATOM   1968 C CB  . PRO A 1 258 ? 61.832 17.891  9.583   1.00 79.57  ? 258  PRO A CB  1 
ATOM   1969 C CG  . PRO A 1 258 ? 62.482 18.219  10.962  1.00 80.48  ? 258  PRO A CG  1 
ATOM   1970 C CD  . PRO A 1 258 ? 61.462 17.909  12.041  1.00 77.76  ? 258  PRO A CD  1 
ATOM   1971 N N   . ASN A 1 265 ? 61.891 6.951   11.038  1.00 79.61  ? 265  ASN A N   1 
ATOM   1972 C CA  . ASN A 1 265 ? 61.531 6.530   12.390  1.00 78.73  ? 265  ASN A CA  1 
ATOM   1973 C C   . ASN A 1 265 ? 60.316 7.314   12.899  1.00 75.63  ? 265  ASN A C   1 
ATOM   1974 O O   . ASN A 1 265 ? 60.294 8.542   12.839  1.00 75.07  ? 265  ASN A O   1 
ATOM   1975 C CB  . ASN A 1 265 ? 62.738 6.696   13.335  1.00 80.86  ? 265  ASN A CB  1 
ATOM   1976 C CG  . ASN A 1 265 ? 62.590 5.916   14.643  1.00 81.30  ? 265  ASN A CG  1 
ATOM   1977 O OD1 . ASN A 1 265 ? 61.553 5.982   15.305  1.00 78.89  ? 265  ASN A OD1 1 
ATOM   1978 N ND2 . ASN A 1 265 ? 63.644 5.180   15.026  1.00 83.63  ? 265  ASN A ND2 1 
ATOM   1979 N N   . ASP A 1 266 ? 59.311 6.591   13.394  1.00 73.74  ? 266  ASP A N   1 
ATOM   1980 C CA  . ASP A 1 266 ? 58.098 7.191   13.957  1.00 70.56  ? 266  ASP A CA  1 
ATOM   1981 C C   . ASP A 1 266 ? 58.281 7.753   15.364  1.00 70.00  ? 266  ASP A C   1 
ATOM   1982 O O   . ASP A 1 266 ? 57.649 8.744   15.715  1.00 68.90  ? 266  ASP A O   1 
ATOM   1983 C CB  . ASP A 1 266 ? 56.948 6.183   13.967  1.00 69.22  ? 266  ASP A CB  1 
ATOM   1984 C CG  . ASP A 1 266 ? 56.393 5.902   12.582  1.00 68.88  ? 266  ASP A CG  1 
ATOM   1985 O OD1 . ASP A 1 266 ? 56.709 6.637   11.621  1.00 69.67  ? 266  ASP A OD1 1 
ATOM   1986 O OD2 . ASP A 1 266 ? 55.621 4.933   12.453  1.00 68.62  ? 266  ASP A OD2 1 
ATOM   1987 N N   . THR A 1 267 ? 59.116 7.110   16.175  1.00 71.04  ? 267  THR A N   1 
ATOM   1988 C CA  . THR A 1 267 ? 59.402 7.587   17.529  1.00 70.63  ? 267  THR A CA  1 
ATOM   1989 C C   . THR A 1 267 ? 59.817 9.052   17.524  1.00 70.64  ? 267  THR A C   1 
ATOM   1990 O O   . THR A 1 267 ? 59.234 9.846   18.252  1.00 69.36  ? 267  THR A O   1 
ATOM   1991 C CB  . THR A 1 267 ? 60.499 6.741   18.232  1.00 72.79  ? 267  THR A CB  1 
ATOM   1992 O OG1 . THR A 1 267 ? 60.214 5.352   18.052  1.00 72.47  ? 267  THR A OG1 1 
ATOM   1993 C CG2 . THR A 1 267 ? 60.565 7.046   19.731  1.00 71.90  ? 267  THR A CG2 1 
ATOM   1994 N N   . GLU A 1 268 ? 60.816 9.393   16.703  1.00 72.33  ? 268  GLU A N   1 
ATOM   1995 C CA  . GLU A 1 268 ? 61.336 10.770  16.580  1.00 72.72  ? 268  GLU A CA  1 
ATOM   1996 C C   . GLU A 1 268 ? 60.236 11.771  16.214  1.00 69.89  ? 268  GLU A C   1 
ATOM   1997 O O   . GLU A 1 268 ? 60.145 12.852  16.799  1.00 69.64  ? 268  GLU A O   1 
ATOM   1998 C CB  . GLU A 1 268 ? 62.473 10.848  15.538  1.00 74.96  ? 268  GLU A CB  1 
ATOM   1999 C CG  . GLU A 1 268 ? 63.883 10.615  16.085  1.00 79.17  ? 268  GLU A CG  1 
ATOM   2000 C CD  . GLU A 1 268 ? 65.001 11.193  15.184  1.00 83.78  ? 268  GLU A CD  1 
ATOM   2001 O OE1 . GLU A 1 268 ? 64.733 12.117  14.368  1.00 83.59  ? 268  GLU A OE1 1 
ATOM   2002 O OE2 . GLU A 1 268 ? 66.161 10.726  15.300  1.00 86.02  ? 268  GLU A OE2 1 
ATOM   2003 N N   . LEU A 1 269 ? 59.406 11.397  15.246  1.00 67.67  ? 269  LEU A N   1 
ATOM   2004 C CA  . LEU A 1 269 ? 58.370 12.278  14.747  1.00 65.14  ? 269  LEU A CA  1 
ATOM   2005 C C   . LEU A 1 269 ? 57.292 12.524  15.807  1.00 62.82  ? 269  LEU A C   1 
ATOM   2006 O O   . LEU A 1 269 ? 56.871 13.668  16.005  1.00 62.30  ? 269  LEU A O   1 
ATOM   2007 C CB  . LEU A 1 269 ? 57.784 11.712  13.450  1.00 64.36  ? 269  LEU A CB  1 
ATOM   2008 C CG  . LEU A 1 269 ? 56.760 12.507  12.644  1.00 63.11  ? 269  LEU A CG  1 
ATOM   2009 C CD1 . LEU A 1 269 ? 56.844 12.114  11.186  1.00 65.11  ? 269  LEU A CD1 1 
ATOM   2010 C CD2 . LEU A 1 269 ? 55.340 12.283  13.148  1.00 61.97  ? 269  LEU A CD2 1 
ATOM   2011 N N   . ILE A 1 270 ? 56.856 11.461  16.484  1.00 61.30  ? 270  ILE A N   1 
ATOM   2012 C CA  . ILE A 1 270 ? 55.846 11.582  17.528  1.00 59.00  ? 270  ILE A CA  1 
ATOM   2013 C C   . ILE A 1 270 ? 56.406 12.346  18.719  1.00 59.40  ? 270  ILE A C   1 
ATOM   2014 O O   . ILE A 1 270 ? 55.743 13.221  19.256  1.00 58.49  ? 270  ILE A O   1 
ATOM   2015 C CB  . ILE A 1 270 ? 55.264 10.207  17.935  1.00 58.45  ? 270  ILE A CB  1 
ATOM   2016 C CG1 . ILE A 1 270 ? 54.380 9.667   16.822  1.00 57.76  ? 270  ILE A CG1 1 
ATOM   2017 C CG2 . ILE A 1 270 ? 54.430 10.289  19.206  1.00 56.30  ? 270  ILE A CG2 1 
ATOM   2018 C CD1 . ILE A 1 270 ? 54.555 8.185   16.599  1.00 60.27  ? 270  ILE A CD1 1 
ATOM   2019 N N   . ALA A 1 271 ? 57.635 12.044  19.111  1.00 61.15  ? 271  ALA A N   1 
ATOM   2020 C CA  . ALA A 1 271 ? 58.284 12.777  20.200  1.00 62.29  ? 271  ALA A CA  1 
ATOM   2021 C C   . ALA A 1 271 ? 58.319 14.294  19.947  1.00 62.00  ? 271  ALA A C   1 
ATOM   2022 O O   . ALA A 1 271 ? 58.115 15.083  20.872  1.00 61.77  ? 271  ALA A O   1 
ATOM   2023 C CB  . ALA A 1 271 ? 59.696 12.232  20.476  1.00 63.96  ? 271  ALA A CB  1 
ATOM   2024 N N   . CYS A 1 272 ? 58.573 14.691  18.702  1.00 62.20  ? 272  CYS A N   1 
ATOM   2025 C CA  . CYS A 1 272 ? 58.597 16.101  18.344  1.00 62.01  ? 272  CYS A CA  1 
ATOM   2026 C C   . CYS A 1 272 ? 57.174 16.688  18.328  1.00 59.36  ? 272  CYS A C   1 
ATOM   2027 O O   . CYS A 1 272 ? 56.958 17.805  18.801  1.00 58.80  ? 272  CYS A O   1 
ATOM   2028 C CB  . CYS A 1 272 ? 59.325 16.297  17.010  1.00 63.60  ? 272  CYS A CB  1 
ATOM   2029 S SG  . CYS A 1 272 ? 59.363 17.986  16.368  1.00 64.61  ? 272  CYS A SG  1 
ATOM   2030 N N   . LEU A 1 273 ? 56.208 15.932  17.810  1.00 57.38  ? 273  LEU A N   1 
ATOM   2031 C CA  . LEU A 1 273 ? 54.795 16.330  17.921  1.00 55.37  ? 273  LEU A CA  1 
ATOM   2032 C C   . LEU A 1 273 ? 54.360 16.579  19.367  1.00 54.54  ? 273  LEU A C   1 
ATOM   2033 O O   . LEU A 1 273 ? 53.601 17.512  19.641  1.00 53.50  ? 273  LEU A O   1 
ATOM   2034 C CB  . LEU A 1 273 ? 53.853 15.317  17.247  1.00 53.95  ? 273  LEU A CB  1 
ATOM   2035 C CG  . LEU A 1 273 ? 53.693 15.423  15.723  1.00 54.15  ? 273  LEU A CG  1 
ATOM   2036 C CD1 . LEU A 1 273 ? 52.868 14.276  15.161  1.00 53.43  ? 273  LEU A CD1 1 
ATOM   2037 C CD2 . LEU A 1 273 ? 53.084 16.753  15.321  1.00 53.16  ? 273  LEU A CD2 1 
ATOM   2038 N N   . ARG A 1 274 ? 54.861 15.759  20.286  1.00 55.06  ? 274  ARG A N   1 
ATOM   2039 C CA  . ARG A 1 274 ? 54.470 15.855  21.691  1.00 54.61  ? 274  ARG A CA  1 
ATOM   2040 C C   . ARG A 1 274 ? 55.045 17.090  22.367  1.00 55.57  ? 274  ARG A C   1 
ATOM   2041 O O   . ARG A 1 274 ? 54.539 17.514  23.406  1.00 55.15  ? 274  ARG A O   1 
ATOM   2042 C CB  . ARG A 1 274 ? 54.823 14.581  22.475  1.00 54.79  ? 274  ARG A CB  1 
ATOM   2043 C CG  . ARG A 1 274 ? 53.856 13.424  22.247  1.00 53.04  ? 274  ARG A CG  1 
ATOM   2044 C CD  . ARG A 1 274 ? 54.021 12.336  23.295  1.00 55.44  ? 274  ARG A CD  1 
ATOM   2045 N NE  . ARG A 1 274 ? 55.438 12.056  23.523  1.00 60.61  ? 274  ARG A NE  1 
ATOM   2046 C CZ  . ARG A 1 274 ? 56.104 11.003  23.051  1.00 61.17  ? 274  ARG A CZ  1 
ATOM   2047 N NH1 . ARG A 1 274 ? 55.462 10.076  22.341  1.00 59.17  ? 274  ARG A NH1 1 
ATOM   2048 N NH2 . ARG A 1 274 ? 57.413 10.879  23.307  1.00 61.15  ? 274  ARG A NH2 1 
ATOM   2049 N N   . THR A 1 275 ? 56.073 17.684  21.762  1.00 57.02  ? 275  THR A N   1 
ATOM   2050 C CA  . THR A 1 275 ? 56.633 18.934  22.282  1.00 58.42  ? 275  THR A CA  1 
ATOM   2051 C C   . THR A 1 275 ? 55.942 20.196  21.737  1.00 57.65  ? 275  THR A C   1 
ATOM   2052 O O   . THR A 1 275 ? 56.230 21.291  22.193  1.00 58.77  ? 275  THR A O   1 
ATOM   2053 C CB  . THR A 1 275 ? 58.197 19.031  22.121  1.00 60.76  ? 275  THR A CB  1 
ATOM   2054 O OG1 . THR A 1 275 ? 58.563 18.944  20.744  1.00 60.94  ? 275  THR A OG1 1 
ATOM   2055 C CG2 . THR A 1 275 ? 58.895 17.926  22.884  1.00 61.87  ? 275  THR A CG2 1 
ATOM   2056 N N   . ARG A 1 276 ? 55.028 20.054  20.780  1.00 56.41  ? 276  ARG A N   1 
ATOM   2057 C CA  . ARG A 1 276 ? 54.324 21.227  20.254  1.00 56.14  ? 276  ARG A CA  1 
ATOM   2058 C C   . ARG A 1 276 ? 53.121 21.600  21.132  1.00 54.77  ? 276  ARG A C   1 
ATOM   2059 O O   . ARG A 1 276 ? 52.436 20.722  21.665  1.00 53.65  ? 276  ARG A O   1 
ATOM   2060 C CB  . ARG A 1 276 ? 53.865 21.043  18.804  1.00 55.27  ? 276  ARG A CB  1 
ATOM   2061 C CG  . ARG A 1 276 ? 54.831 20.365  17.854  1.00 58.10  ? 276  ARG A CG  1 
ATOM   2062 C CD  . ARG A 1 276 ? 56.043 21.187  17.406  1.00 64.49  ? 276  ARG A CD  1 
ATOM   2063 N NE  . ARG A 1 276 ? 55.981 22.638  17.631  1.00 68.87  ? 276  ARG A NE  1 
ATOM   2064 C CZ  . ARG A 1 276 ? 56.913 23.322  18.312  1.00 72.98  ? 276  ARG A CZ  1 
ATOM   2065 N NH1 . ARG A 1 276 ? 57.970 22.686  18.839  1.00 73.52  ? 276  ARG A NH1 1 
ATOM   2066 N NH2 . ARG A 1 276 ? 56.800 24.643  18.472  1.00 73.12  ? 276  ARG A NH2 1 
ATOM   2067 N N   . PRO A 1 277 ? 52.867 22.909  21.293  1.00 54.96  ? 277  PRO A N   1 
ATOM   2068 C CA  . PRO A 1 277 ? 51.715 23.376  22.049  1.00 53.91  ? 277  PRO A CA  1 
ATOM   2069 C C   . PRO A 1 277 ? 50.423 22.934  21.390  1.00 52.23  ? 277  PRO A C   1 
ATOM   2070 O O   . PRO A 1 277 ? 50.353 22.888  20.164  1.00 52.63  ? 277  PRO A O   1 
ATOM   2071 C CB  . PRO A 1 277 ? 51.843 24.892  21.968  1.00 54.83  ? 277  PRO A CB  1 
ATOM   2072 C CG  . PRO A 1 277 ? 53.287 25.138  21.679  1.00 57.09  ? 277  PRO A CG  1 
ATOM   2073 C CD  . PRO A 1 277 ? 53.680 24.028  20.788  1.00 56.46  ? 277  PRO A CD  1 
ATOM   2074 N N   . ALA A 1 278 ? 49.413 22.616  22.195  1.00 50.93  ? 278  ALA A N   1 
ATOM   2075 C CA  . ALA A 1 278 ? 48.115 22.163  21.684  1.00 49.33  ? 278  ALA A CA  1 
ATOM   2076 C C   . ALA A 1 278 ? 47.547 23.046  20.579  1.00 48.91  ? 278  ALA A C   1 
ATOM   2077 O O   . ALA A 1 278 ? 47.035 22.548  19.578  1.00 47.90  ? 278  ALA A O   1 
ATOM   2078 C CB  . ALA A 1 278 ? 47.097 22.032  22.827  1.00 48.46  ? 278  ALA A CB  1 
ATOM   2079 N N   . GLN A 1 279 ? 47.636 24.357  20.764  1.00 50.02  ? 279  GLN A N   1 
ATOM   2080 C CA  . GLN A 1 279 ? 46.993 25.281  19.844  1.00 50.00  ? 279  GLN A CA  1 
ATOM   2081 C C   . GLN A 1 279 ? 47.644 25.238  18.458  1.00 51.30  ? 279  GLN A C   1 
ATOM   2082 O O   . GLN A 1 279 ? 46.949 25.395  17.448  1.00 51.37  ? 279  GLN A O   1 
ATOM   2083 C CB  . GLN A 1 279 ? 46.923 26.696  20.432  1.00 50.45  ? 279  GLN A CB  1 
ATOM   2084 C CG  . GLN A 1 279 ? 46.069 27.696  19.651  1.00 49.09  ? 279  GLN A CG  1 
ATOM   2085 C CD  . GLN A 1 279 ? 44.614 27.286  19.501  1.00 46.61  ? 279  GLN A CD  1 
ATOM   2086 O OE1 . GLN A 1 279 ? 43.917 26.997  20.485  1.00 45.43  ? 279  GLN A OE1 1 
ATOM   2087 N NE2 . GLN A 1 279 ? 44.137 27.282  18.262  1.00 43.69  ? 279  GLN A NE2 1 
ATOM   2088 N N   . ASP A 1 280 ? 48.952 24.986  18.398  1.00 52.83  ? 280  ASP A N   1 
ATOM   2089 C CA  . ASP A 1 280 ? 49.626 24.830  17.110  1.00 54.06  ? 280  ASP A CA  1 
ATOM   2090 C C   . ASP A 1 280 ? 49.077 23.652  16.298  1.00 52.56  ? 280  ASP A C   1 
ATOM   2091 O O   . ASP A 1 280 ? 48.886 23.771  15.089  1.00 52.56  ? 280  ASP A O   1 
ATOM   2092 C CB  . ASP A 1 280 ? 51.152 24.732  17.268  1.00 56.32  ? 280  ASP A CB  1 
ATOM   2093 C CG  . ASP A 1 280 ? 51.796 26.072  17.627  1.00 60.51  ? 280  ASP A CG  1 
ATOM   2094 O OD1 . ASP A 1 280 ? 51.047 27.051  17.913  1.00 61.45  ? 280  ASP A OD1 1 
ATOM   2095 O OD2 . ASP A 1 280 ? 53.058 26.141  17.631  1.00 64.12  ? 280  ASP A OD2 1 
ATOM   2096 N N   . LEU A 1 281 ? 48.814 22.526  16.952  1.00 51.34  ? 281  LEU A N   1 
ATOM   2097 C CA  . LEU A 1 281 ? 48.257 21.384  16.244  1.00 50.45  ? 281  LEU A CA  1 
ATOM   2098 C C   . LEU A 1 281 ? 46.888 21.749  15.655  1.00 49.44  ? 281  LEU A C   1 
ATOM   2099 O O   . LEU A 1 281 ? 46.646 21.520  14.460  1.00 49.58  ? 281  LEU A O   1 
ATOM   2100 C CB  . LEU A 1 281 ? 48.203 20.120  17.124  1.00 49.96  ? 281  LEU A CB  1 
ATOM   2101 C CG  . LEU A 1 281 ? 49.555 19.681  17.729  1.00 50.69  ? 281  LEU A CG  1 
ATOM   2102 C CD1 . LEU A 1 281 ? 49.398 18.534  18.678  1.00 48.88  ? 281  LEU A CD1 1 
ATOM   2103 C CD2 . LEU A 1 281 ? 50.594 19.340  16.682  1.00 51.24  ? 281  LEU A CD2 1 
ATOM   2104 N N   . VAL A 1 282 ? 46.027 22.366  16.464  1.00 48.46  ? 282  VAL A N   1 
ATOM   2105 C CA  . VAL A 1 282 ? 44.702 22.794  15.994  1.00 47.02  ? 282  VAL A CA  1 
ATOM   2106 C C   . VAL A 1 282 ? 44.822 23.798  14.839  1.00 47.93  ? 282  VAL A C   1 
ATOM   2107 O O   . VAL A 1 282 ? 44.128 23.665  13.828  1.00 47.10  ? 282  VAL A O   1 
ATOM   2108 C CB  . VAL A 1 282 ? 43.809 23.362  17.148  1.00 46.42  ? 282  VAL A CB  1 
ATOM   2109 C CG1 . VAL A 1 282 ? 42.546 23.993  16.601  1.00 44.35  ? 282  VAL A CG1 1 
ATOM   2110 C CG2 . VAL A 1 282 ? 43.461 22.268  18.156  1.00 44.45  ? 282  VAL A CG2 1 
ATOM   2111 N N   . ASP A 1 283 ? 45.711 24.782  14.983  1.00 49.32  ? 283  ASP A N   1 
ATOM   2112 C CA  . ASP A 1 283 ? 45.925 25.802  13.941  1.00 50.60  ? 283  ASP A CA  1 
ATOM   2113 C C   . ASP A 1 283 ? 46.223 25.233  12.539  1.00 50.58  ? 283  ASP A C   1 
ATOM   2114 O O   . ASP A 1 283 ? 46.011 25.917  11.543  1.00 50.59  ? 283  ASP A O   1 
ATOM   2115 C CB  . ASP A 1 283 ? 47.048 26.776  14.341  1.00 52.48  ? 283  ASP A CB  1 
ATOM   2116 C CG  . ASP A 1 283 ? 46.611 27.820  15.384  1.00 53.68  ? 283  ASP A CG  1 
ATOM   2117 O OD1 . ASP A 1 283 ? 45.405 27.882  15.747  1.00 51.75  ? 283  ASP A OD1 1 
ATOM   2118 O OD2 . ASP A 1 283 ? 47.503 28.585  15.838  1.00 55.57  ? 283  ASP A OD2 1 
ATOM   2119 N N   . HIS A 1 284 ? 46.691 23.986  12.476  1.00 50.62  ? 284  HIS A N   1 
ATOM   2120 C CA  . HIS A 1 284 ? 47.147 23.379  11.224  1.00 51.25  ? 284  HIS A CA  1 
ATOM   2121 C C   . HIS A 1 284 ? 46.335 22.163  10.777  1.00 50.49  ? 284  HIS A C   1 
ATOM   2122 O O   . HIS A 1 284 ? 46.521 21.648  9.681   1.00 50.39  ? 284  HIS A O   1 
ATOM   2123 C CB  . HIS A 1 284 ? 48.617 23.013  11.337  1.00 52.32  ? 284  HIS A CB  1 
ATOM   2124 C CG  . HIS A 1 284 ? 49.523 24.197  11.403  1.00 53.02  ? 284  HIS A CG  1 
ATOM   2125 N ND1 . HIS A 1 284 ? 49.932 24.875  10.277  1.00 53.89  ? 284  HIS A ND1 1 
ATOM   2126 C CD2 . HIS A 1 284 ? 50.095 24.829  12.455  1.00 52.96  ? 284  HIS A CD2 1 
ATOM   2127 C CE1 . HIS A 1 284 ? 50.718 25.875  10.631  1.00 54.93  ? 284  HIS A CE1 1 
ATOM   2128 N NE2 . HIS A 1 284 ? 50.836 25.868  11.947  1.00 54.33  ? 284  HIS A NE2 1 
ATOM   2129 N N   . GLU A 1 285 ? 45.432 21.730  11.642  1.00 50.29  ? 285  GLU A N   1 
ATOM   2130 C CA  . GLU A 1 285 ? 44.554 20.591  11.423  1.00 50.34  ? 285  GLU A CA  1 
ATOM   2131 C C   . GLU A 1 285 ? 43.892 20.537  10.031  1.00 50.45  ? 285  GLU A C   1 
ATOM   2132 O O   . GLU A 1 285 ? 43.927 19.502  9.352   1.00 50.37  ? 285  GLU A O   1 
ATOM   2133 C CB  . GLU A 1 285 ? 43.470 20.647  12.480  1.00 49.56  ? 285  GLU A CB  1 
ATOM   2134 C CG  . GLU A 1 285 ? 43.093 19.336  13.078  1.00 51.64  ? 285  GLU A CG  1 
ATOM   2135 C CD  . GLU A 1 285 ? 41.941 19.487  14.049  1.00 53.34  ? 285  GLU A CD  1 
ATOM   2136 O OE1 . GLU A 1 285 ? 42.022 20.354  14.938  1.00 54.58  ? 285  GLU A OE1 1 
ATOM   2137 O OE2 . GLU A 1 285 ? 40.948 18.749  13.917  1.00 54.78  ? 285  GLU A OE2 1 
ATOM   2138 N N   . TRP A 1 286 ? 43.288 21.642  9.607   1.00 50.62  ? 286  TRP A N   1 
ATOM   2139 C CA  . TRP A 1 286 ? 42.549 21.651  8.342   1.00 50.99  ? 286  TRP A CA  1 
ATOM   2140 C C   . TRP A 1 286 ? 43.408 21.658  7.070   1.00 52.56  ? 286  TRP A C   1 
ATOM   2141 O O   . TRP A 1 286 ? 42.887 21.396  5.982   1.00 52.94  ? 286  TRP A O   1 
ATOM   2142 C CB  . TRP A 1 286 ? 41.532 22.782  8.319   1.00 50.52  ? 286  TRP A CB  1 
ATOM   2143 C CG  . TRP A 1 286 ? 40.510 22.614  9.374   1.00 50.35  ? 286  TRP A CG  1 
ATOM   2144 C CD1 . TRP A 1 286 ? 40.549 23.120  10.644  1.00 50.61  ? 286  TRP A CD1 1 
ATOM   2145 C CD2 . TRP A 1 286 ? 39.305 21.844  9.286   1.00 49.32  ? 286  TRP A CD2 1 
ATOM   2146 N NE1 . TRP A 1 286 ? 39.431 22.731  11.344  1.00 49.30  ? 286  TRP A NE1 1 
ATOM   2147 C CE2 . TRP A 1 286 ? 38.649 21.953  10.534  1.00 48.86  ? 286  TRP A CE2 1 
ATOM   2148 C CE3 . TRP A 1 286 ? 38.707 21.089  8.269   1.00 49.57  ? 286  TRP A CE3 1 
ATOM   2149 C CZ2 . TRP A 1 286 ? 37.417 21.338  10.792  1.00 48.12  ? 286  TRP A CZ2 1 
ATOM   2150 C CZ3 . TRP A 1 286 ? 37.477 20.479  8.522   1.00 48.98  ? 286  TRP A CZ3 1 
ATOM   2151 C CH2 . TRP A 1 286 ? 36.846 20.613  9.775   1.00 48.45  ? 286  TRP A CH2 1 
ATOM   2152 N N   . HIS A 1 287 ? 44.709 21.931  7.208   1.00 53.57  ? 287  HIS A N   1 
ATOM   2153 C CA  . HIS A 1 287 ? 45.605 22.037  6.058   1.00 55.13  ? 287  HIS A CA  1 
ATOM   2154 C C   . HIS A 1 287 ? 46.052 20.690  5.457   1.00 54.90  ? 287  HIS A C   1 
ATOM   2155 O O   . HIS A 1 287 ? 46.791 20.659  4.480   1.00 56.02  ? 287  HIS A O   1 
ATOM   2156 C CB  . HIS A 1 287 ? 46.838 22.892  6.400   1.00 56.87  ? 287  HIS A CB  1 
ATOM   2157 C CG  . HIS A 1 287 ? 46.518 24.273  6.894   1.00 59.42  ? 287  HIS A CG  1 
ATOM   2158 N ND1 . HIS A 1 287 ? 47.423 25.035  7.604   1.00 61.86  ? 287  HIS A ND1 1 
ATOM   2159 C CD2 . HIS A 1 287 ? 45.397 25.028  6.790   1.00 61.51  ? 287  HIS A CD2 1 
ATOM   2160 C CE1 . HIS A 1 287 ? 46.880 26.201  7.905   1.00 62.40  ? 287  HIS A CE1 1 
ATOM   2161 N NE2 . HIS A 1 287 ? 45.649 26.220  7.428   1.00 63.18  ? 287  HIS A NE2 1 
ATOM   2162 N N   . VAL A 1 288 ? 45.608 19.579  6.025   1.00 53.63  ? 288  VAL A N   1 
ATOM   2163 C CA  . VAL A 1 288 ? 46.061 18.270  5.548   1.00 53.65  ? 288  VAL A CA  1 
ATOM   2164 C C   . VAL A 1 288 ? 45.059 17.523  4.639   1.00 53.07  ? 288  VAL A C   1 
ATOM   2165 O O   . VAL A 1 288 ? 45.374 16.460  4.114   1.00 53.13  ? 288  VAL A O   1 
ATOM   2166 C CB  . VAL A 1 288 ? 46.541 17.358  6.717   1.00 53.44  ? 288  VAL A CB  1 
ATOM   2167 C CG1 . VAL A 1 288 ? 47.671 18.029  7.506   1.00 53.86  ? 288  VAL A CG1 1 
ATOM   2168 C CG2 . VAL A 1 288 ? 45.387 16.984  7.624   1.00 51.65  ? 288  VAL A CG2 1 
ATOM   2169 N N   . LEU A 1 289 ? 43.868 18.087  4.448   1.00 52.56  ? 289  LEU A N   1 
ATOM   2170 C CA  . LEU A 1 289 ? 42.848 17.453  3.619   1.00 52.65  ? 289  LEU A CA  1 
ATOM   2171 C C   . LEU A 1 289 ? 43.280 17.450  2.162   1.00 54.21  ? 289  LEU A C   1 
ATOM   2172 O O   . LEU A 1 289 ? 43.732 18.481  1.656   1.00 54.63  ? 289  LEU A O   1 
ATOM   2173 C CB  . LEU A 1 289 ? 41.491 18.148  3.761   1.00 51.50  ? 289  LEU A CB  1 
ATOM   2174 C CG  . LEU A 1 289 ? 40.628 17.868  4.992   1.00 50.45  ? 289  LEU A CG  1 
ATOM   2175 C CD1 . LEU A 1 289 ? 39.398 18.763  4.944   1.00 48.32  ? 289  LEU A CD1 1 
ATOM   2176 C CD2 . LEU A 1 289 ? 40.232 16.370  5.129   1.00 49.61  ? 289  LEU A CD2 1 
ATOM   2177 N N   . PRO A 1 290 ? 43.131 16.289  1.483   1.00 55.00  ? 290  PRO A N   1 
ATOM   2178 C CA  . PRO A 1 290 ? 43.660 16.109  0.121   1.00 56.66  ? 290  PRO A CA  1 
ATOM   2179 C C   . PRO A 1 290 ? 42.974 16.959  -0.953  1.00 57.10  ? 290  PRO A C   1 
ATOM   2180 O O   . PRO A 1 290 ? 43.591 17.253  -1.970  1.00 58.35  ? 290  PRO A O   1 
ATOM   2181 C CB  . PRO A 1 290 ? 43.459 14.609  -0.155  1.00 57.01  ? 290  PRO A CB  1 
ATOM   2182 C CG  . PRO A 1 290 ? 42.426 14.153  0.813   1.00 55.04  ? 290  PRO A CG  1 
ATOM   2183 C CD  . PRO A 1 290 ? 42.451 15.079  1.989   1.00 53.92  ? 290  PRO A CD  1 
ATOM   2184 N N   . GLN A 1 291 ? 41.717 17.339  -0.733  1.00 56.68  ? 291  GLN A N   1 
ATOM   2185 C CA  . GLN A 1 291 ? 40.971 18.156  -1.698  1.00 57.73  ? 291  GLN A CA  1 
ATOM   2186 C C   . GLN A 1 291 ? 40.282 19.350  -1.015  1.00 57.25  ? 291  GLN A C   1 
ATOM   2187 O O   . GLN A 1 291 ? 40.190 19.401  0.216   1.00 56.38  ? 291  GLN A O   1 
ATOM   2188 C CB  . GLN A 1 291 ? 39.943 17.301  -2.460  1.00 57.70  ? 291  GLN A CB  1 
ATOM   2189 C CG  . GLN A 1 291 ? 40.532 16.149  -3.306  1.00 60.42  ? 291  GLN A CG  1 
ATOM   2190 C CD  . GLN A 1 291 ? 40.643 14.815  -2.538  1.00 63.89  ? 291  GLN A CD  1 
ATOM   2191 O OE1 . GLN A 1 291 ? 41.390 13.910  -2.949  1.00 66.15  ? 291  GLN A OE1 1 
ATOM   2192 N NE2 . GLN A 1 291 ? 39.891 14.683  -1.428  1.00 61.63  ? 291  GLN A NE2 1 
ATOM   2193 N N   . GLU A 1 292 ? 39.840 20.324  -1.814  1.00 57.90  ? 292  GLU A N   1 
ATOM   2194 C CA  . GLU A 1 292 ? 38.906 21.352  -1.349  1.00 57.93  ? 292  GLU A CA  1 
ATOM   2195 C C   . GLU A 1 292 ? 37.584 20.619  -1.100  1.00 56.36  ? 292  GLU A C   1 
ATOM   2196 O O   . GLU A 1 292 ? 37.072 19.938  -1.996  1.00 56.73  ? 292  GLU A O   1 
ATOM   2197 C CB  . GLU A 1 292 ? 38.752 22.444  -2.419  1.00 58.85  ? 292  GLU A CB  1 
ATOM   2198 C CG  . GLU A 1 292 ? 38.002 23.728  -1.980  1.00 60.54  ? 292  GLU A CG  1 
ATOM   2199 C CD  . GLU A 1 292 ? 37.733 24.721  -3.144  1.00 61.58  ? 292  GLU A CD  1 
ATOM   2200 O OE1 . GLU A 1 292 ? 38.343 24.575  -4.229  1.00 64.27  ? 292  GLU A OE1 1 
ATOM   2201 O OE2 . GLU A 1 292 ? 36.906 25.655  -2.972  1.00 63.78  ? 292  GLU A OE2 1 
ATOM   2202 N N   . SER A 1 293 ? 37.043 20.709  0.113   1.00 54.97  ? 293  SER A N   1 
ATOM   2203 C CA  . SER A 1 293 ? 35.891 19.856  0.452   1.00 53.57  ? 293  SER A CA  1 
ATOM   2204 C C   . SER A 1 293 ? 35.010 20.330  1.602   1.00 52.22  ? 293  SER A C   1 
ATOM   2205 O O   . SER A 1 293 ? 35.405 21.168  2.394   1.00 52.21  ? 293  SER A O   1 
ATOM   2206 C CB  . SER A 1 293 ? 36.368 18.433  0.740   1.00 53.30  ? 293  SER A CB  1 
ATOM   2207 O OG  . SER A 1 293 ? 37.295 18.419  1.807   1.00 53.44  ? 293  SER A OG  1 
ATOM   2208 N N   . ILE A 1 294 ? 33.796 19.791  1.662   1.00 51.21  ? 294  ILE A N   1 
ATOM   2209 C CA  . ILE A 1 294 ? 32.932 19.918  2.839   1.00 49.44  ? 294  ILE A CA  1 
ATOM   2210 C C   . ILE A 1 294 ? 32.554 18.508  3.279   1.00 48.45  ? 294  ILE A C   1 
ATOM   2211 O O   . ILE A 1 294 ? 32.652 17.569  2.485   1.00 48.51  ? 294  ILE A O   1 
ATOM   2212 C CB  . ILE A 1 294 ? 31.662 20.753  2.577   1.00 49.58  ? 294  ILE A CB  1 
ATOM   2213 C CG1 . ILE A 1 294 ? 30.852 20.193  1.397   1.00 49.69  ? 294  ILE A CG1 1 
ATOM   2214 C CG2 . ILE A 1 294 ? 32.028 22.214  2.349   1.00 50.34  ? 294  ILE A CG2 1 
ATOM   2215 C CD1 . ILE A 1 294 ? 29.461 20.780  1.267   1.00 49.42  ? 294  ILE A CD1 1 
ATOM   2216 N N   . PHE A 1 295 ? 32.132 18.377  4.541   1.00 46.93  ? 295  PHE A N   1 
ATOM   2217 C CA  . PHE A 1 295 ? 31.825 17.102  5.166   1.00 45.29  ? 295  PHE A CA  1 
ATOM   2218 C C   . PHE A 1 295 ? 33.018 16.136  5.067   1.00 44.99  ? 295  PHE A C   1 
ATOM   2219 O O   . PHE A 1 295 ? 32.850 14.934  4.838   1.00 45.28  ? 295  PHE A O   1 
ATOM   2220 C CB  . PHE A 1 295 ? 30.559 16.488  4.544   1.00 45.78  ? 295  PHE A CB  1 
ATOM   2221 C CG  . PHE A 1 295 ? 29.622 15.863  5.544   1.00 45.95  ? 295  PHE A CG  1 
ATOM   2222 C CD1 . PHE A 1 295 ? 30.099 14.996  6.537   1.00 45.98  ? 295  PHE A CD1 1 
ATOM   2223 C CD2 . PHE A 1 295 ? 28.257 16.138  5.492   1.00 45.86  ? 295  PHE A CD2 1 
ATOM   2224 C CE1 . PHE A 1 295 ? 29.227 14.425  7.466   1.00 46.24  ? 295  PHE A CE1 1 
ATOM   2225 C CE2 . PHE A 1 295 ? 27.372 15.555  6.408   1.00 46.05  ? 295  PHE A CE2 1 
ATOM   2226 C CZ  . PHE A 1 295 ? 27.859 14.701  7.397   1.00 45.97  ? 295  PHE A CZ  1 
ATOM   2227 N N   . ARG A 1 296 ? 34.226 16.676  5.211   1.00 44.19  ? 296  ARG A N   1 
ATOM   2228 C CA  . ARG A 1 296 ? 35.432 15.861  5.404   1.00 43.28  ? 296  ARG A CA  1 
ATOM   2229 C C   . ARG A 1 296 ? 36.223 16.418  6.570   1.00 42.67  ? 296  ARG A C   1 
ATOM   2230 O O   . ARG A 1 296 ? 36.320 17.627  6.756   1.00 43.08  ? 296  ARG A O   1 
ATOM   2231 C CB  . ARG A 1 296 ? 36.322 15.826  4.161   1.00 43.47  ? 296  ARG A CB  1 
ATOM   2232 C CG  . ARG A 1 296 ? 35.693 15.233  2.928   1.00 43.14  ? 296  ARG A CG  1 
ATOM   2233 C CD  . ARG A 1 296 ? 35.550 13.726  3.027   1.00 44.04  ? 296  ARG A CD  1 
ATOM   2234 N NE  . ARG A 1 296 ? 34.905 13.158  1.834   1.00 45.36  ? 296  ARG A NE  1 
ATOM   2235 C CZ  . ARG A 1 296 ? 33.588 13.098  1.631   1.00 44.11  ? 296  ARG A CZ  1 
ATOM   2236 N NH1 . ARG A 1 296 ? 32.728 13.573  2.533   1.00 43.09  ? 296  ARG A NH1 1 
ATOM   2237 N NH2 . ARG A 1 296 ? 33.130 12.565  0.512   1.00 43.98  ? 296  ARG A NH2 1 
ATOM   2238 N N   . PHE A 1 297 ? 36.800 15.525  7.355   1.00 42.38  ? 297  PHE A N   1 
ATOM   2239 C CA  . PHE A 1 297 ? 37.525 15.921  8.549   1.00 41.47  ? 297  PHE A CA  1 
ATOM   2240 C C   . PHE A 1 297 ? 38.899 15.260  8.548   1.00 41.86  ? 297  PHE A C   1 
ATOM   2241 O O   . PHE A 1 297 ? 39.069 14.150  8.033   1.00 42.24  ? 297  PHE A O   1 
ATOM   2242 C CB  . PHE A 1 297 ? 36.692 15.577  9.781   1.00 40.43  ? 297  PHE A CB  1 
ATOM   2243 C CG  . PHE A 1 297 ? 35.219 15.820  9.587   1.00 39.99  ? 297  PHE A CG  1 
ATOM   2244 C CD1 . PHE A 1 297 ? 34.710 17.123  9.526   1.00 40.02  ? 297  PHE A CD1 1 
ATOM   2245 C CD2 . PHE A 1 297 ? 34.339 14.754  9.423   1.00 38.91  ? 297  PHE A CD2 1 
ATOM   2246 C CE1 . PHE A 1 297 ? 33.337 17.361  9.315   1.00 38.06  ? 297  PHE A CE1 1 
ATOM   2247 C CE2 . PHE A 1 297 ? 32.972 14.991  9.221   1.00 39.13  ? 297  PHE A CE2 1 
ATOM   2248 C CZ  . PHE A 1 297 ? 32.476 16.307  9.179   1.00 37.55  ? 297  PHE A CZ  1 
ATOM   2249 N N   . SER A 1 298 ? 39.888 15.951  9.101   1.00 41.63  ? 298  SER A N   1 
ATOM   2250 C CA  . SER A 1 298 ? 41.271 15.521  8.936   1.00 42.08  ? 298  SER A CA  1 
ATOM   2251 C C   . SER A 1 298 ? 41.647 14.264  9.712   1.00 41.59  ? 298  SER A C   1 
ATOM   2252 O O   . SER A 1 298 ? 42.331 13.392  9.188   1.00 42.68  ? 298  SER A O   1 
ATOM   2253 C CB  . SER A 1 298 ? 42.207 16.659  9.274   1.00 42.29  ? 298  SER A CB  1 
ATOM   2254 O OG  . SER A 1 298 ? 42.101 17.635  8.262   1.00 44.84  ? 298  SER A OG  1 
ATOM   2255 N N   . PHE A 1 299 ? 41.174 14.166  10.947  1.00 40.00  ? 299  PHE A N   1 
ATOM   2256 C CA  . PHE A 1 299 ? 41.593 13.112  11.841  1.00 39.30  ? 299  PHE A CA  1 
ATOM   2257 C C   . PHE A 1 299 ? 40.385 12.365  12.357  1.00 38.98  ? 299  PHE A C   1 
ATOM   2258 O O   . PHE A 1 299 ? 39.628 12.873  13.195  1.00 39.09  ? 299  PHE A O   1 
ATOM   2259 C CB  . PHE A 1 299 ? 42.484 13.695  12.937  1.00 38.41  ? 299  PHE A CB  1 
ATOM   2260 C CG  . PHE A 1 299 ? 43.755 14.288  12.385  1.00 38.70  ? 299  PHE A CG  1 
ATOM   2261 C CD1 . PHE A 1 299 ? 44.830 13.465  12.031  1.00 38.18  ? 299  PHE A CD1 1 
ATOM   2262 C CD2 . PHE A 1 299 ? 43.860 15.656  12.148  1.00 37.38  ? 299  PHE A CD2 1 
ATOM   2263 C CE1 . PHE A 1 299 ? 46.001 14.007  11.488  1.00 40.45  ? 299  PHE A CE1 1 
ATOM   2264 C CE2 . PHE A 1 299 ? 45.031 16.205  11.592  1.00 38.22  ? 299  PHE A CE2 1 
ATOM   2265 C CZ  . PHE A 1 299 ? 46.101 15.382  11.267  1.00 39.34  ? 299  PHE A CZ  1 
ATOM   2266 N N   . VAL A 1 300 ? 40.192 11.166  11.812  1.00 38.97  ? 300  VAL A N   1 
ATOM   2267 C CA  . VAL A 1 300 ? 39.028 10.340  12.105  1.00 38.07  ? 300  VAL A CA  1 
ATOM   2268 C C   . VAL A 1 300 ? 39.488 8.897   12.399  1.00 39.21  ? 300  VAL A C   1 
ATOM   2269 O O   . VAL A 1 300 ? 40.684 8.588   12.266  1.00 40.11  ? 300  VAL A O   1 
ATOM   2270 C CB  . VAL A 1 300 ? 37.965 10.423  10.952  1.00 37.95  ? 300  VAL A CB  1 
ATOM   2271 C CG1 . VAL A 1 300 ? 37.474 11.865  10.754  1.00 35.08  ? 300  VAL A CG1 1 
ATOM   2272 C CG2 . VAL A 1 300 ? 38.507 9.876   9.628   1.00 39.00  ? 300  VAL A CG2 1 
ATOM   2273 N N   . PRO A 1 301 ? 38.567 8.021   12.861  1.00 39.08  ? 301  PRO A N   1 
ATOM   2274 C CA  . PRO A 1 301 ? 38.879 6.602   12.996  1.00 39.55  ? 301  PRO A CA  1 
ATOM   2275 C C   . PRO A 1 301 ? 39.619 6.035   11.797  1.00 41.00  ? 301  PRO A C   1 
ATOM   2276 O O   . PRO A 1 301 ? 39.308 6.371   10.653  1.00 41.26  ? 301  PRO A O   1 
ATOM   2277 C CB  . PRO A 1 301 ? 37.497 5.966   13.115  1.00 38.61  ? 301  PRO A CB  1 
ATOM   2278 C CG  . PRO A 1 301 ? 36.760 6.950   13.929  1.00 38.18  ? 301  PRO A CG  1 
ATOM   2279 C CD  . PRO A 1 301 ? 37.200 8.303   13.347  1.00 38.33  ? 301  PRO A CD  1 
ATOM   2280 N N   . VAL A 1 302 ? 40.595 5.180   12.068  1.00 42.22  ? 302  VAL A N   1 
ATOM   2281 C CA  . VAL A 1 302 ? 41.419 4.594   11.032  1.00 43.90  ? 302  VAL A CA  1 
ATOM   2282 C C   . VAL A 1 302 ? 41.255 3.060   11.008  1.00 45.58  ? 302  VAL A C   1 
ATOM   2283 O O   . VAL A 1 302 ? 41.113 2.425   12.053  1.00 45.98  ? 302  VAL A O   1 
ATOM   2284 C CB  . VAL A 1 302 ? 42.922 5.024   11.212  1.00 44.31  ? 302  VAL A CB  1 
ATOM   2285 C CG1 . VAL A 1 302 ? 43.427 4.684   12.605  1.00 44.11  ? 302  VAL A CG1 1 
ATOM   2286 C CG2 . VAL A 1 302 ? 43.817 4.383   10.165  1.00 46.26  ? 302  VAL A CG2 1 
ATOM   2287 N N   . VAL A 1 303 ? 41.276 2.478   9.813   1.00 46.81  ? 303  VAL A N   1 
ATOM   2288 C CA  . VAL A 1 303 ? 41.203 1.041   9.656   1.00 48.53  ? 303  VAL A CA  1 
ATOM   2289 C C   . VAL A 1 303 ? 42.606 0.454   9.904   1.00 50.94  ? 303  VAL A C   1 
ATOM   2290 O O   . VAL A 1 303 ? 43.451 0.379   8.995   1.00 52.03  ? 303  VAL A O   1 
ATOM   2291 C CB  . VAL A 1 303 ? 40.619 0.655   8.271   1.00 49.00  ? 303  VAL A CB  1 
ATOM   2292 C CG1 . VAL A 1 303 ? 40.564 -0.865  8.099   1.00 50.27  ? 303  VAL A CG1 1 
ATOM   2293 C CG2 . VAL A 1 303 ? 39.235 1.250   8.095   1.00 46.50  ? 303  VAL A CG2 1 
ATOM   2294 N N   . ASP A 1 304 ? 42.833 0.043   11.152  1.00 51.52  ? 304  ASP A N   1 
ATOM   2295 C CA  . ASP A 1 304 ? 44.158 -0.305  11.644  1.00 53.14  ? 304  ASP A CA  1 
ATOM   2296 C C   . ASP A 1 304 ? 44.376 -1.806  11.768  1.00 55.31  ? 304  ASP A C   1 
ATOM   2297 O O   . ASP A 1 304 ? 45.458 -2.237  12.158  1.00 56.63  ? 304  ASP A O   1 
ATOM   2298 C CB  . ASP A 1 304 ? 44.409 0.373   13.006  1.00 51.91  ? 304  ASP A CB  1 
ATOM   2299 C CG  . ASP A 1 304 ? 43.367 -0.008  14.063  1.00 52.02  ? 304  ASP A CG  1 
ATOM   2300 O OD1 . ASP A 1 304 ? 42.312 -0.580  13.693  1.00 51.10  ? 304  ASP A OD1 1 
ATOM   2301 O OD2 . ASP A 1 304 ? 43.598 0.273   15.272  1.00 52.39  ? 304  ASP A OD2 1 
ATOM   2302 N N   . GLY A 1 305 ? 43.346 -2.594  11.458  1.00 55.97  ? 305  GLY A N   1 
ATOM   2303 C CA  . GLY A 1 305 ? 43.372 -4.048  11.680  1.00 58.05  ? 305  GLY A CA  1 
ATOM   2304 C C   . GLY A 1 305 ? 43.360 -4.457  13.150  1.00 58.71  ? 305  GLY A C   1 
ATOM   2305 O O   . GLY A 1 305 ? 43.611 -5.622  13.473  1.00 60.58  ? 305  GLY A O   1 
ATOM   2306 N N   . ASP A 1 306 ? 43.078 -3.500  14.039  1.00 57.36  ? 306  ASP A N   1 
ATOM   2307 C CA  . ASP A 1 306 ? 43.041 -3.725  15.489  1.00 57.52  ? 306  ASP A CA  1 
ATOM   2308 C C   . ASP A 1 306 ? 41.651 -3.375  16.063  1.00 56.04  ? 306  ASP A C   1 
ATOM   2309 O O   . ASP A 1 306 ? 40.844 -4.275  16.327  1.00 56.74  ? 306  ASP A O   1 
ATOM   2310 C CB  . ASP A 1 306 ? 44.168 -2.931  16.168  1.00 57.57  ? 306  ASP A CB  1 
ATOM   2311 C CG  . ASP A 1 306 ? 44.251 -3.158  17.691  1.00 59.26  ? 306  ASP A CG  1 
ATOM   2312 O OD1 . ASP A 1 306 ? 43.639 -4.118  18.228  1.00 58.97  ? 306  ASP A OD1 1 
ATOM   2313 O OD2 . ASP A 1 306 ? 44.959 -2.353  18.353  1.00 60.19  ? 306  ASP A OD2 1 
ATOM   2314 N N   . PHE A 1 307 ? 41.369 -2.086  16.265  1.00 54.07  ? 307  PHE A N   1 
ATOM   2315 C CA  . PHE A 1 307 ? 40.026 -1.665  16.683  1.00 52.56  ? 307  PHE A CA  1 
ATOM   2316 C C   . PHE A 1 307 ? 39.009 -2.001  15.588  1.00 53.27  ? 307  PHE A C   1 
ATOM   2317 O O   . PHE A 1 307 ? 37.930 -2.539  15.865  1.00 53.34  ? 307  PHE A O   1 
ATOM   2318 C CB  . PHE A 1 307 ? 39.980 -0.172  16.987  1.00 50.12  ? 307  PHE A CB  1 
ATOM   2319 C CG  . PHE A 1 307 ? 38.779 0.247   17.777  1.00 47.37  ? 307  PHE A CG  1 
ATOM   2320 C CD1 . PHE A 1 307 ? 37.534 0.384   17.166  1.00 45.43  ? 307  PHE A CD1 1 
ATOM   2321 C CD2 . PHE A 1 307 ? 38.891 0.518   19.135  1.00 44.96  ? 307  PHE A CD2 1 
ATOM   2322 C CE1 . PHE A 1 307 ? 36.424 0.768   17.899  1.00 42.79  ? 307  PHE A CE1 1 
ATOM   2323 C CE2 . PHE A 1 307 ? 37.785 0.905   19.869  1.00 43.12  ? 307  PHE A CE2 1 
ATOM   2324 C CZ  . PHE A 1 307 ? 36.550 1.028   19.251  1.00 43.42  ? 307  PHE A CZ  1 
ATOM   2325 N N   . LEU A 1 308 ? 39.362 -1.664  14.348  1.00 53.72  ? 308  LEU A N   1 
ATOM   2326 C CA  . LEU A 1 308 ? 38.586 -2.061  13.190  1.00 54.25  ? 308  LEU A CA  1 
ATOM   2327 C C   . LEU A 1 308 ? 39.389 -3.099  12.430  1.00 56.71  ? 308  LEU A C   1 
ATOM   2328 O O   . LEU A 1 308 ? 40.402 -2.763  11.817  1.00 57.55  ? 308  LEU A O   1 
ATOM   2329 C CB  . LEU A 1 308 ? 38.302 -0.855  12.295  1.00 52.68  ? 308  LEU A CB  1 
ATOM   2330 C CG  . LEU A 1 308 ? 37.363 0.245   12.804  1.00 50.13  ? 308  LEU A CG  1 
ATOM   2331 C CD1 . LEU A 1 308 ? 37.317 1.338   11.757  1.00 47.98  ? 308  LEU A CD1 1 
ATOM   2332 C CD2 . LEU A 1 308 ? 35.952 -0.268  13.118  1.00 48.10  ? 308  LEU A CD2 1 
ATOM   2333 N N   . SER A 1 309 ? 38.951 -4.357  12.468  1.00 58.29  ? 309  SER A N   1 
ATOM   2334 C CA  . SER A 1 309 ? 39.708 -5.429  11.822  1.00 60.66  ? 309  SER A CA  1 
ATOM   2335 C C   . SER A 1 309 ? 39.676 -5.338  10.289  1.00 61.07  ? 309  SER A C   1 
ATOM   2336 O O   . SER A 1 309 ? 40.558 -5.846  9.613   1.00 62.51  ? 309  SER A O   1 
ATOM   2337 C CB  . SER A 1 309 ? 39.275 -6.814  12.329  1.00 62.34  ? 309  SER A CB  1 
ATOM   2338 O OG  . SER A 1 309 ? 37.881 -7.015  12.200  1.00 62.80  ? 309  SER A OG  1 
ATOM   2339 N N   . ASP A 1 310 ? 38.661 -4.673  9.755   1.00 60.18  ? 310  ASP A N   1 
ATOM   2340 C CA  . ASP A 1 310 ? 38.559 -4.417  8.323   1.00 60.43  ? 310  ASP A CA  1 
ATOM   2341 C C   . ASP A 1 310 ? 37.729 -3.143  8.122   1.00 58.53  ? 310  ASP A C   1 
ATOM   2342 O O   . ASP A 1 310 ? 37.344 -2.486  9.098   1.00 56.68  ? 310  ASP A O   1 
ATOM   2343 C CB  . ASP A 1 310 ? 37.898 -5.614  7.638   1.00 62.15  ? 310  ASP A CB  1 
ATOM   2344 C CG  . ASP A 1 310 ? 38.401 -5.842  6.218   1.00 63.91  ? 310  ASP A CG  1 
ATOM   2345 O OD1 . ASP A 1 310 ? 38.727 -4.865  5.490   1.00 63.45  ? 310  ASP A OD1 1 
ATOM   2346 O OD2 . ASP A 1 310 ? 38.456 -7.023  5.831   1.00 64.59  ? 310  ASP A OD2 1 
ATOM   2347 N N   . THR A 1 311 ? 37.457 -2.787  6.869   1.00 58.63  ? 311  THR A N   1 
ATOM   2348 C CA  . THR A 1 311 ? 36.644 -1.610  6.579   1.00 57.40  ? 311  THR A CA  1 
ATOM   2349 C C   . THR A 1 311 ? 35.238 -1.802  7.152   1.00 57.36  ? 311  THR A C   1 
ATOM   2350 O O   . THR A 1 311 ? 34.724 -2.924  7.152   1.00 58.40  ? 311  THR A O   1 
ATOM   2351 C CB  . THR A 1 311 ? 36.517 -1.355  5.062   1.00 57.85  ? 311  THR A CB  1 
ATOM   2352 O OG1 . THR A 1 311 ? 35.734 -2.400  4.464   1.00 59.23  ? 311  THR A OG1 1 
ATOM   2353 C CG2 . THR A 1 311 ? 37.900 -1.260  4.386   1.00 57.15  ? 311  THR A CG2 1 
ATOM   2354 N N   . PRO A 1 312 ? 34.617 -0.719  7.660   1.00 56.13  ? 312  PRO A N   1 
ATOM   2355 C CA  . PRO A 1 312 ? 33.213 -0.795  8.097   1.00 56.10  ? 312  PRO A CA  1 
ATOM   2356 C C   . PRO A 1 312 ? 32.298 -1.435  7.052   1.00 57.70  ? 312  PRO A C   1 
ATOM   2357 O O   . PRO A 1 312 ? 31.452 -2.256  7.404   1.00 58.39  ? 312  PRO A O   1 
ATOM   2358 C CB  . PRO A 1 312 ? 32.846 0.674   8.330   1.00 54.02  ? 312  PRO A CB  1 
ATOM   2359 C CG  . PRO A 1 312 ? 34.124 1.280   8.766   1.00 53.32  ? 312  PRO A CG  1 
ATOM   2360 C CD  . PRO A 1 312 ? 35.176 0.625   7.896   1.00 54.54  ? 312  PRO A CD  1 
ATOM   2361 N N   . GLU A 1 313 ? 32.499 -1.074  5.784   1.00 58.81  ? 313  GLU A N   1 
ATOM   2362 C CA  . GLU A 1 313 ? 31.786 -1.663  4.644   1.00 60.88  ? 313  GLU A CA  1 
ATOM   2363 C C   . GLU A 1 313 ? 31.890 -3.198  4.576   1.00 63.02  ? 313  GLU A C   1 
ATOM   2364 O O   . GLU A 1 313 ? 30.895 -3.866  4.316   1.00 64.21  ? 313  GLU A O   1 
ATOM   2365 C CB  . GLU A 1 313 ? 32.252 -1.031  3.318   1.00 61.13  ? 313  GLU A CB  1 
ATOM   2366 C CG  . GLU A 1 313 ? 31.829 0.457   3.106   1.00 61.35  ? 313  GLU A CG  1 
ATOM   2367 C CD  . GLU A 1 313 ? 32.674 1.504   3.892   1.00 60.51  ? 313  GLU A CD  1 
ATOM   2368 O OE1 . GLU A 1 313 ? 33.751 1.176   4.453   1.00 59.97  ? 313  GLU A OE1 1 
ATOM   2369 O OE2 . GLU A 1 313 ? 32.242 2.675   3.939   1.00 59.86  ? 313  GLU A OE2 1 
ATOM   2370 N N   . ALA A 1 314 ? 33.076 -3.755  4.816   1.00 63.84  ? 314  ALA A N   1 
ATOM   2371 C CA  . ALA A 1 314 ? 33.232 -5.207  4.797   1.00 66.21  ? 314  ALA A CA  1 
ATOM   2372 C C   . ALA A 1 314 ? 32.590 -5.870  6.012   1.00 66.91  ? 314  ALA A C   1 
ATOM   2373 O O   . ALA A 1 314 ? 31.993 -6.945  5.891   1.00 68.86  ? 314  ALA A O   1 
ATOM   2374 C CB  . ALA A 1 314 ? 34.700 -5.607  4.683   1.00 66.85  ? 314  ALA A CB  1 
ATOM   2375 N N   . LEU A 1 315 ? 32.709 -5.232  7.176   1.00 65.91  ? 315  LEU A N   1 
ATOM   2376 C CA  . LEU A 1 315 ? 32.219 -5.805  8.433   1.00 66.35  ? 315  LEU A CA  1 
ATOM   2377 C C   . LEU A 1 315 ? 30.689 -5.839  8.542   1.00 67.01  ? 315  LEU A C   1 
ATOM   2378 O O   . LEU A 1 315 ? 30.138 -6.744  9.164   1.00 68.25  ? 315  LEU A O   1 
ATOM   2379 C CB  . LEU A 1 315 ? 32.835 -5.096  9.642   1.00 64.61  ? 315  LEU A CB  1 
ATOM   2380 C CG  . LEU A 1 315 ? 34.358 -5.081  9.799   1.00 63.52  ? 315  LEU A CG  1 
ATOM   2381 C CD1 . LEU A 1 315 ? 34.748 -4.184  10.954  1.00 59.26  ? 315  LEU A CD1 1 
ATOM   2382 C CD2 . LEU A 1 315 ? 34.918 -6.481  9.993   1.00 64.46  ? 315  LEU A CD2 1 
ATOM   2383 N N   . ILE A 1 316 ? 30.009 -4.865  7.945   1.00 67.04  ? 316  ILE A N   1 
ATOM   2384 C CA  . ILE A 1 316 ? 28.542 -4.902  7.857   1.00 68.29  ? 316  ILE A CA  1 
ATOM   2385 C C   . ILE A 1 316 ? 28.050 -5.921  6.807   1.00 71.49  ? 316  ILE A C   1 
ATOM   2386 O O   . ILE A 1 316 ? 26.945 -6.458  6.932   1.00 72.70  ? 316  ILE A O   1 
ATOM   2387 C CB  . ILE A 1 316 ? 27.895 -3.494  7.631   1.00 66.38  ? 316  ILE A CB  1 
ATOM   2388 C CG1 . ILE A 1 316 ? 28.200 -2.940  6.230   1.00 66.60  ? 316  ILE A CG1 1 
ATOM   2389 C CG2 . ILE A 1 316 ? 28.339 -2.518  8.717   1.00 64.62  ? 316  ILE A CG2 1 
ATOM   2390 C CD1 . ILE A 1 316 ? 27.345 -1.720  5.796   1.00 65.15  ? 316  ILE A CD1 1 
ATOM   2391 N N   . ASN A 1 317 ? 28.871 -6.194  5.790   1.00 73.50  ? 317  ASN A N   1 
ATOM   2392 C CA  . ASN A 1 317 ? 28.506 -7.165  4.751   1.00 76.84  ? 317  ASN A CA  1 
ATOM   2393 C C   . ASN A 1 317 ? 28.663 -8.617  5.199   1.00 79.02  ? 317  ASN A C   1 
ATOM   2394 O O   . ASN A 1 317 ? 27.954 -9.480  4.699   1.00 81.07  ? 317  ASN A O   1 
ATOM   2395 C CB  . ASN A 1 317 ? 29.272 -6.932  3.430   1.00 77.55  ? 317  ASN A CB  1 
ATOM   2396 C CG  . ASN A 1 317 ? 28.911 -5.598  2.741   1.00 78.14  ? 317  ASN A CG  1 
ATOM   2397 O OD1 . ASN A 1 317 ? 28.215 -4.738  3.305   1.00 78.17  ? 317  ASN A OD1 1 
ATOM   2398 N ND2 . ASN A 1 317 ? 29.409 -5.420  1.514   1.00 79.85  ? 317  ASN A ND2 1 
ATOM   2399 N N   . THR A 1 318 ? 29.574 -8.895  6.132   1.00 79.23  ? 318  THR A N   1 
ATOM   2400 C CA  . THR A 1 318 ? 29.816 -10.291 6.550   1.00 81.76  ? 318  THR A CA  1 
ATOM   2401 C C   . THR A 1 318 ? 29.560 -10.620 8.029   1.00 81.47  ? 318  THR A C   1 
ATOM   2402 O O   . THR A 1 318 ? 29.675 -11.779 8.423   1.00 83.34  ? 318  THR A O   1 
ATOM   2403 C CB  . THR A 1 318 ? 31.244 -10.799 6.178   1.00 82.94  ? 318  THR A CB  1 
ATOM   2404 O OG1 . THR A 1 318 ? 32.229 -10.126 6.975   1.00 82.21  ? 318  THR A OG1 1 
ATOM   2405 C CG2 . THR A 1 318 ? 31.541 -10.595 4.695   1.00 84.10  ? 318  THR A CG2 1 
ATOM   2406 N N   . GLY A 1 319 ? 29.229 -9.619  8.842   1.00 79.48  ? 319  GLY A N   1 
ATOM   2407 C CA  . GLY A 1 319 ? 28.970 -9.847  10.271  1.00 79.32  ? 319  GLY A CA  1 
ATOM   2408 C C   . GLY A 1 319 ? 27.691 -10.629 10.554  1.00 80.54  ? 319  GLY A C   1 
ATOM   2409 O O   . GLY A 1 319 ? 26.770 -10.630 9.744   1.00 81.31  ? 319  GLY A O   1 
ATOM   2410 N N   . ASP A 1 320 ? 27.645 -11.314 11.695  1.00 80.99  ? 320  ASP A N   1 
ATOM   2411 C CA  . ASP A 1 320 ? 26.413 -11.939 12.182  1.00 81.73  ? 320  ASP A CA  1 
ATOM   2412 C C   . ASP A 1 320 ? 25.817 -11.009 13.242  1.00 79.44  ? 320  ASP A C   1 
ATOM   2413 O O   . ASP A 1 320 ? 26.433 -10.795 14.289  1.00 78.62  ? 320  ASP A O   1 
ATOM   2414 C CB  . ASP A 1 320 ? 26.722 -13.318 12.777  1.00 84.07  ? 320  ASP A CB  1 
ATOM   2415 C CG  . ASP A 1 320 ? 25.482 -14.027 13.338  1.00 86.45  ? 320  ASP A CG  1 
ATOM   2416 O OD1 . ASP A 1 320 ? 24.580 -13.357 13.891  1.00 85.75  ? 320  ASP A OD1 1 
ATOM   2417 O OD2 . ASP A 1 320 ? 25.422 -15.277 13.243  1.00 89.68  ? 320  ASP A OD2 1 
ATOM   2418 N N   . PHE A 1 321 ? 24.628 -10.462 12.975  1.00 78.25  ? 321  PHE A N   1 
ATOM   2419 C CA  . PHE A 1 321 ? 24.012 -9.473  13.878  1.00 75.95  ? 321  PHE A CA  1 
ATOM   2420 C C   . PHE A 1 321 ? 22.676 -9.911  14.482  1.00 76.96  ? 321  PHE A C   1 
ATOM   2421 O O   . PHE A 1 321 ? 21.833 -9.068  14.809  1.00 75.86  ? 321  PHE A O   1 
ATOM   2422 C CB  . PHE A 1 321 ? 23.846 -8.118  13.174  1.00 73.89  ? 321  PHE A CB  1 
ATOM   2423 C CG  . PHE A 1 321 ? 25.131 -7.524  12.698  1.00 71.72  ? 321  PHE A CG  1 
ATOM   2424 C CD1 . PHE A 1 321 ? 26.012 -6.933  13.596  1.00 70.25  ? 321  PHE A CD1 1 
ATOM   2425 C CD2 . PHE A 1 321 ? 25.466 -7.562  11.355  1.00 71.77  ? 321  PHE A CD2 1 
ATOM   2426 C CE1 . PHE A 1 321 ? 27.209 -6.384  13.166  1.00 68.91  ? 321  PHE A CE1 1 
ATOM   2427 C CE2 . PHE A 1 321 ? 26.657 -7.017  10.911  1.00 71.00  ? 321  PHE A CE2 1 
ATOM   2428 C CZ  . PHE A 1 321 ? 27.534 -6.424  11.821  1.00 69.82  ? 321  PHE A CZ  1 
ATOM   2429 N N   . GLN A 1 322 ? 22.500 -11.223 14.652  1.00 78.99  ? 322  GLN A N   1 
ATOM   2430 C CA  . GLN A 1 322 ? 21.251 -11.787 15.175  1.00 80.32  ? 322  GLN A CA  1 
ATOM   2431 C C   . GLN A 1 322 ? 20.836 -11.213 16.538  1.00 78.93  ? 322  GLN A C   1 
ATOM   2432 O O   . GLN A 1 322 ? 19.658 -10.939 16.770  1.00 79.04  ? 322  GLN A O   1 
ATOM   2433 C CB  . GLN A 1 322 ? 21.322 -13.317 15.220  1.00 83.10  ? 322  GLN A CB  1 
ATOM   2434 C CG  . GLN A 1 322 ? 21.159 -13.981 13.849  1.00 85.94  ? 322  GLN A CG  1 
ATOM   2435 C CD  . GLN A 1 322 ? 21.364 -15.502 13.874  1.00 89.67  ? 322  GLN A CD  1 
ATOM   2436 O OE1 . GLN A 1 322 ? 20.972 -16.190 14.823  1.00 91.07  ? 322  GLN A OE1 1 
ATOM   2437 N NE2 . GLN A 1 322 ? 21.973 -16.029 12.815  1.00 90.48  ? 322  GLN A NE2 1 
ATOM   2438 N N   . ASP A 1 323 ? 21.806 -10.997 17.421  1.00 77.44  ? 323  ASP A N   1 
ATOM   2439 C CA  . ASP A 1 323 ? 21.508 -10.500 18.770  1.00 76.46  ? 323  ASP A CA  1 
ATOM   2440 C C   . ASP A 1 323 ? 21.475 -8.963  18.903  1.00 72.85  ? 323  ASP A C   1 
ATOM   2441 O O   . ASP A 1 323 ? 21.666 -8.431  19.996  1.00 71.88  ? 323  ASP A O   1 
ATOM   2442 C CB  . ASP A 1 323 ? 22.478 -11.124 19.797  1.00 77.51  ? 323  ASP A CB  1 
ATOM   2443 C CG  . ASP A 1 323 ? 23.957 -11.009 19.373  1.00 78.79  ? 323  ASP A CG  1 
ATOM   2444 O OD1 . ASP A 1 323 ? 24.328 -10.010 18.690  1.00 78.46  ? 323  ASP A OD1 1 
ATOM   2445 O OD2 . ASP A 1 323 ? 24.746 -11.928 19.734  1.00 80.63  ? 323  ASP A OD2 1 
ATOM   2446 N N   . LEU A 1 324 ? 21.214 -8.256  17.806  1.00 70.68  ? 324  LEU A N   1 
ATOM   2447 C CA  . LEU A 1 324 ? 21.292 -6.795  17.811  1.00 67.23  ? 324  LEU A CA  1 
ATOM   2448 C C   . LEU A 1 324 ? 19.961 -6.084  17.559  1.00 66.21  ? 324  LEU A C   1 
ATOM   2449 O O   . LEU A 1 324 ? 19.265 -6.368  16.574  1.00 66.96  ? 324  LEU A O   1 
ATOM   2450 C CB  . LEU A 1 324 ? 22.339 -6.300  16.799  1.00 66.27  ? 324  LEU A CB  1 
ATOM   2451 C CG  . LEU A 1 324 ? 22.721 -4.808  16.881  1.00 64.17  ? 324  LEU A CG  1 
ATOM   2452 C CD1 . LEU A 1 324 ? 23.482 -4.489  18.166  1.00 62.71  ? 324  LEU A CD1 1 
ATOM   2453 C CD2 . LEU A 1 324 ? 23.517 -4.387  15.669  1.00 63.19  ? 324  LEU A CD2 1 
ATOM   2454 N N   . GLN A 1 325 ? 19.627 -5.154  18.451  1.00 63.84  ? 325  GLN A N   1 
ATOM   2455 C CA  . GLN A 1 325 ? 18.520 -4.230  18.222  1.00 62.52  ? 325  GLN A CA  1 
ATOM   2456 C C   . GLN A 1 325 ? 19.052 -2.831  17.958  1.00 59.40  ? 325  GLN A C   1 
ATOM   2457 O O   . GLN A 1 325 ? 19.831 -2.298  18.749  1.00 58.06  ? 325  GLN A O   1 
ATOM   2458 C CB  . GLN A 1 325 ? 17.553 -4.193  19.406  1.00 63.12  ? 325  GLN A CB  1 
ATOM   2459 C CG  . GLN A 1 325 ? 16.790 -5.477  19.642  1.00 66.31  ? 325  GLN A CG  1 
ATOM   2460 C CD  . GLN A 1 325 ? 17.358 -6.283  20.777  1.00 67.95  ? 325  GLN A CD  1 
ATOM   2461 O OE1 . GLN A 1 325 ? 17.640 -7.468  20.619  1.00 71.10  ? 325  GLN A OE1 1 
ATOM   2462 N NE2 . GLN A 1 325 ? 17.535 -5.649  21.936  1.00 66.39  ? 325  GLN A NE2 1 
ATOM   2463 N N   . VAL A 1 326 ? 18.614 -2.231  16.857  1.00 58.05  ? 326  VAL A N   1 
ATOM   2464 C CA  . VAL A 1 326 ? 19.110 -0.913  16.468  1.00 55.59  ? 326  VAL A CA  1 
ATOM   2465 C C   . VAL A 1 326 ? 18.005 0.027   15.995  1.00 54.62  ? 326  VAL A C   1 
ATOM   2466 O O   . VAL A 1 326 ? 17.098 -0.367  15.260  1.00 55.35  ? 326  VAL A O   1 
ATOM   2467 C CB  . VAL A 1 326 ? 20.261 -1.016  15.412  1.00 55.01  ? 326  VAL A CB  1 
ATOM   2468 C CG1 . VAL A 1 326 ? 20.430 0.259   14.670  1.00 54.46  ? 326  VAL A CG1 1 
ATOM   2469 C CG2 . VAL A 1 326 ? 21.561 -1.302  16.088  1.00 54.81  ? 326  VAL A CG2 1 
ATOM   2470 N N   . LEU A 1 327 ? 18.110 1.278   16.426  1.00 52.63  ? 327  LEU A N   1 
ATOM   2471 C CA  . LEU A 1 327 ? 17.255 2.349   15.951  1.00 51.88  ? 327  LEU A CA  1 
ATOM   2472 C C   . LEU A 1 327 ? 18.135 3.327   15.156  1.00 49.91  ? 327  LEU A C   1 
ATOM   2473 O O   . LEU A 1 327 ? 19.166 3.755   15.642  1.00 48.60  ? 327  LEU A O   1 
ATOM   2474 C CB  . LEU A 1 327 ? 16.560 2.995   17.156  1.00 51.94  ? 327  LEU A CB  1 
ATOM   2475 C CG  . LEU A 1 327 ? 15.631 4.221   17.127  1.00 53.35  ? 327  LEU A CG  1 
ATOM   2476 C CD1 . LEU A 1 327 ? 14.898 4.408   15.808  1.00 55.24  ? 327  LEU A CD1 1 
ATOM   2477 C CD2 . LEU A 1 327 ? 14.626 4.088   18.261  1.00 54.78  ? 327  LEU A CD2 1 
ATOM   2478 N N   . VAL A 1 328 ? 17.753 3.629   13.914  1.00 49.78  ? 328  VAL A N   1 
ATOM   2479 C CA  . VAL A 1 328 ? 18.552 4.498   13.022  1.00 48.14  ? 328  VAL A CA  1 
ATOM   2480 C C   . VAL A 1 328 ? 17.643 5.488   12.334  1.00 47.69  ? 328  VAL A C   1 
ATOM   2481 O O   . VAL A 1 328 ? 16.470 5.213   12.153  1.00 49.00  ? 328  VAL A O   1 
ATOM   2482 C CB  . VAL A 1 328 ? 19.341 3.703   11.910  1.00 48.69  ? 328  VAL A CB  1 
ATOM   2483 C CG1 . VAL A 1 328 ? 20.077 2.526   12.489  1.00 49.45  ? 328  VAL A CG1 1 
ATOM   2484 C CG2 . VAL A 1 328 ? 18.421 3.208   10.788  1.00 49.33  ? 328  VAL A CG2 1 
ATOM   2485 N N   . GLY A 1 329 ? 18.182 6.630   11.926  1.00 46.21  ? 329  GLY A N   1 
ATOM   2486 C CA  . GLY A 1 329 ? 17.377 7.611   11.218  1.00 45.79  ? 329  GLY A CA  1 
ATOM   2487 C C   . GLY A 1 329 ? 18.125 8.833   10.752  1.00 44.72  ? 329  GLY A C   1 
ATOM   2488 O O   . GLY A 1 329 ? 19.314 8.986   11.007  1.00 43.83  ? 329  GLY A O   1 
ATOM   2489 N N   . VAL A 1 330 ? 17.407 9.705   10.055  1.00 45.08  ? 330  VAL A N   1 
ATOM   2490 C CA  . VAL A 1 330 ? 17.980 10.903  9.453   1.00 44.36  ? 330  VAL A CA  1 
ATOM   2491 C C   . VAL A 1 330 ? 17.023 12.071  9.654   1.00 44.73  ? 330  VAL A C   1 
ATOM   2492 O O   . VAL A 1 330 ? 15.857 11.868  9.970   1.00 45.98  ? 330  VAL A O   1 
ATOM   2493 C CB  . VAL A 1 330 ? 18.254 10.702  7.918   1.00 44.91  ? 330  VAL A CB  1 
ATOM   2494 C CG1 . VAL A 1 330 ? 19.188 9.509   7.660   1.00 43.97  ? 330  VAL A CG1 1 
ATOM   2495 C CG2 . VAL A 1 330 ? 16.949 10.529  7.139   1.00 45.77  ? 330  VAL A CG2 1 
ATOM   2496 N N   . VAL A 1 331 ? 17.519 13.290  9.476   1.00 44.40  ? 331  VAL A N   1 
ATOM   2497 C CA  . VAL A 1 331 ? 16.670 14.480  9.460   1.00 44.82  ? 331  VAL A CA  1 
ATOM   2498 C C   . VAL A 1 331 ? 16.345 14.851  7.996   1.00 46.42  ? 331  VAL A C   1 
ATOM   2499 O O   . VAL A 1 331 ? 16.952 14.317  7.056   1.00 46.10  ? 331  VAL A O   1 
ATOM   2500 C CB  . VAL A 1 331 ? 17.306 15.673  10.258  1.00 44.07  ? 331  VAL A CB  1 
ATOM   2501 C CG1 . VAL A 1 331 ? 17.586 15.268  11.693  1.00 42.46  ? 331  VAL A CG1 1 
ATOM   2502 C CG2 . VAL A 1 331 ? 18.579 16.201  9.595   1.00 41.95  ? 331  VAL A CG2 1 
ATOM   2503 N N   . LYS A 1 332 ? 15.386 15.750  7.801   1.00 47.92  ? 332  LYS A N   1 
ATOM   2504 C CA  . LYS A 1 332 ? 14.875 16.054  6.462   1.00 49.66  ? 332  LYS A CA  1 
ATOM   2505 C C   . LYS A 1 332 ? 15.928 16.725  5.565   1.00 49.21  ? 332  LYS A C   1 
ATOM   2506 O O   . LYS A 1 332 ? 15.962 16.480  4.358   1.00 49.31  ? 332  LYS A O   1 
ATOM   2507 C CB  . LYS A 1 332 ? 13.600 16.903  6.571   1.00 51.35  ? 332  LYS A CB  1 
ATOM   2508 C CG  . LYS A 1 332 ? 12.854 17.190  5.271   1.00 54.32  ? 332  LYS A CG  1 
ATOM   2509 C CD  . LYS A 1 332 ? 11.502 17.847  5.590   1.00 59.79  ? 332  LYS A CD  1 
ATOM   2510 C CE  . LYS A 1 332 ? 11.211 19.085  4.711   1.00 64.62  ? 332  LYS A CE  1 
ATOM   2511 N NZ  . LYS A 1 332 ? 12.013 20.326  5.112   1.00 64.83  ? 332  LYS A NZ  1 
ATOM   2512 N N   . ASP A 1 333 ? 16.798 17.553  6.147   1.00 48.48  ? 333  ASP A N   1 
ATOM   2513 C CA  . ASP A 1 333 ? 17.772 18.292  5.335   1.00 48.27  ? 333  ASP A CA  1 
ATOM   2514 C C   . ASP A 1 333 ? 19.193 18.133  5.873   1.00 47.56  ? 333  ASP A C   1 
ATOM   2515 O O   . ASP A 1 333 ? 19.779 19.068  6.440   1.00 47.49  ? 333  ASP A O   1 
ATOM   2516 C CB  . ASP A 1 333 ? 17.358 19.764  5.205   1.00 48.68  ? 333  ASP A CB  1 
ATOM   2517 C CG  . ASP A 1 333 ? 15.933 19.924  4.660   1.00 50.33  ? 333  ASP A CG  1 
ATOM   2518 O OD1 . ASP A 1 333 ? 14.969 19.837  5.454   1.00 50.93  ? 333  ASP A OD1 1 
ATOM   2519 O OD2 . ASP A 1 333 ? 15.774 20.124  3.438   1.00 49.73  ? 333  ASP A OD2 1 
ATOM   2520 N N   . GLU A 1 334 ? 19.752 16.941  5.685   1.00 47.27  ? 334  GLU A N   1 
ATOM   2521 C CA  . GLU A 1 334 ? 21.050 16.613  6.262   1.00 46.72  ? 334  GLU A CA  1 
ATOM   2522 C C   . GLU A 1 334 ? 22.191 17.498  5.762   1.00 46.55  ? 334  GLU A C   1 
ATOM   2523 O O   . GLU A 1 334 ? 23.189 17.675  6.448   1.00 46.19  ? 334  GLU A O   1 
ATOM   2524 C CB  . GLU A 1 334 ? 21.393 15.136  6.022   1.00 46.50  ? 334  GLU A CB  1 
ATOM   2525 C CG  . GLU A 1 334 ? 20.589 14.157  6.860   1.00 46.93  ? 334  GLU A CG  1 
ATOM   2526 C CD  . GLU A 1 334 ? 21.026 14.116  8.326   1.00 47.22  ? 334  GLU A CD  1 
ATOM   2527 O OE1 . GLU A 1 334 ? 22.049 14.761  8.670   1.00 45.62  ? 334  GLU A OE1 1 
ATOM   2528 O OE2 . GLU A 1 334 ? 20.336 13.440  9.131   1.00 45.72  ? 334  GLU A OE2 1 
ATOM   2529 N N   . GLY A 1 335 ? 22.046 18.061  4.574   1.00 47.43  ? 335  GLY A N   1 
ATOM   2530 C CA  . GLY A 1 335 ? 23.189 18.665  3.919   1.00 48.01  ? 335  GLY A CA  1 
ATOM   2531 C C   . GLY A 1 335 ? 23.314 20.167  4.000   1.00 48.60  ? 335  GLY A C   1 
ATOM   2532 O O   . GLY A 1 335 ? 24.406 20.692  3.849   1.00 48.08  ? 335  GLY A O   1 
ATOM   2533 N N   . SER A 1 336 ? 22.197 20.852  4.247   1.00 49.77  ? 336  SER A N   1 
ATOM   2534 C CA  . SER A 1 336 ? 22.109 22.301  4.073   1.00 50.63  ? 336  SER A CA  1 
ATOM   2535 C C   . SER A 1 336 ? 23.113 23.056  4.929   1.00 50.64  ? 336  SER A C   1 
ATOM   2536 O O   . SER A 1 336 ? 23.691 24.042  4.492   1.00 50.96  ? 336  SER A O   1 
ATOM   2537 C CB  . SER A 1 336 ? 20.686 22.781  4.361   1.00 51.19  ? 336  SER A CB  1 
ATOM   2538 O OG  . SER A 1 336 ? 20.376 22.628  5.728   1.00 50.88  ? 336  SER A OG  1 
ATOM   2539 N N   . TYR A 1 337 ? 23.302 22.575  6.152   1.00 50.93  ? 337  TYR A N   1 
ATOM   2540 C CA  . TYR A 1 337 ? 24.264 23.120  7.121   1.00 51.25  ? 337  TYR A CA  1 
ATOM   2541 C C   . TYR A 1 337 ? 25.669 23.276  6.516   1.00 50.47  ? 337  TYR A C   1 
ATOM   2542 O O   . TYR A 1 337 ? 26.313 24.326  6.623   1.00 50.60  ? 337  TYR A O   1 
ATOM   2543 C CB  . TYR A 1 337 ? 24.323 22.152  8.314   1.00 52.17  ? 337  TYR A CB  1 
ATOM   2544 C CG  . TYR A 1 337 ? 25.008 22.677  9.531   1.00 53.44  ? 337  TYR A CG  1 
ATOM   2545 C CD1 . TYR A 1 337 ? 24.271 23.199  10.585  1.00 55.77  ? 337  TYR A CD1 1 
ATOM   2546 C CD2 . TYR A 1 337 ? 26.391 22.631  9.645   1.00 55.38  ? 337  TYR A CD2 1 
ATOM   2547 C CE1 . TYR A 1 337 ? 24.901 23.699  11.737  1.00 57.24  ? 337  TYR A CE1 1 
ATOM   2548 C CE2 . TYR A 1 337 ? 27.041 23.134  10.781  1.00 57.12  ? 337  TYR A CE2 1 
ATOM   2549 C CZ  . TYR A 1 337 ? 26.291 23.671  11.825  1.00 56.30  ? 337  TYR A CZ  1 
ATOM   2550 O OH  . TYR A 1 337 ? 26.932 24.167  12.949  1.00 55.05  ? 337  TYR A OH  1 
ATOM   2551 N N   . PHE A 1 338 ? 26.119 22.208  5.867   1.00 49.24  ? 338  PHE A N   1 
ATOM   2552 C CA  . PHE A 1 338 ? 27.473 22.081  5.366   1.00 48.36  ? 338  PHE A CA  1 
ATOM   2553 C C   . PHE A 1 338 ? 27.804 22.997  4.186   1.00 49.27  ? 338  PHE A C   1 
ATOM   2554 O O   . PHE A 1 338 ? 28.983 23.321  3.942   1.00 49.24  ? 338  PHE A O   1 
ATOM   2555 C CB  . PHE A 1 338 ? 27.739 20.610  5.048   1.00 47.51  ? 338  PHE A CB  1 
ATOM   2556 C CG  . PHE A 1 338 ? 27.733 19.742  6.272   1.00 46.45  ? 338  PHE A CG  1 
ATOM   2557 C CD1 . PHE A 1 338 ? 26.548 19.165  6.730   1.00 46.58  ? 338  PHE A CD1 1 
ATOM   2558 C CD2 . PHE A 1 338 ? 28.900 19.552  7.009   1.00 44.52  ? 338  PHE A CD2 1 
ATOM   2559 C CE1 . PHE A 1 338 ? 26.536 18.387  7.892   1.00 45.31  ? 338  PHE A CE1 1 
ATOM   2560 C CE2 . PHE A 1 338 ? 28.896 18.776  8.163   1.00 43.93  ? 338  PHE A CE2 1 
ATOM   2561 C CZ  . PHE A 1 338 ? 27.718 18.198  8.609   1.00 44.04  ? 338  PHE A CZ  1 
ATOM   2562 N N   . LEU A 1 339 ? 26.767 23.445  3.481   1.00 49.56  ? 339  LEU A N   1 
ATOM   2563 C CA  . LEU A 1 339 ? 26.969 24.241  2.287   1.00 50.01  ? 339  LEU A CA  1 
ATOM   2564 C C   . LEU A 1 339 ? 27.595 25.613  2.548   1.00 50.71  ? 339  LEU A C   1 
ATOM   2565 O O   . LEU A 1 339 ? 28.398 26.079  1.730   1.00 51.24  ? 339  LEU A O   1 
ATOM   2566 C CB  . LEU A 1 339 ? 25.669 24.364  1.508   1.00 50.73  ? 339  LEU A CB  1 
ATOM   2567 C CG  . LEU A 1 339 ? 24.978 23.054  1.134   1.00 49.94  ? 339  LEU A CG  1 
ATOM   2568 C CD1 . LEU A 1 339 ? 23.817 23.350  0.223   1.00 50.75  ? 339  LEU A CD1 1 
ATOM   2569 C CD2 . LEU A 1 339 ? 25.935 22.103  0.454   1.00 50.64  ? 339  LEU A CD2 1 
ATOM   2570 N N   . VAL A 1 340 ? 27.248 26.246  3.675   1.00 50.74  ? 340  VAL A N   1 
ATOM   2571 C CA  . VAL A 1 340 ? 27.723 27.611  3.987   1.00 51.58  ? 340  VAL A CA  1 
ATOM   2572 C C   . VAL A 1 340 ? 29.173 27.628  4.488   1.00 51.88  ? 340  VAL A C   1 
ATOM   2573 O O   . VAL A 1 340 ? 29.761 28.694  4.695   1.00 52.52  ? 340  VAL A O   1 
ATOM   2574 C CB  . VAL A 1 340 ? 26.806 28.357  4.995   1.00 51.84  ? 340  VAL A CB  1 
ATOM   2575 C CG1 . VAL A 1 340 ? 25.346 28.357  4.514   1.00 53.10  ? 340  VAL A CG1 1 
ATOM   2576 C CG2 . VAL A 1 340 ? 26.910 27.760  6.401   1.00 50.67  ? 340  VAL A CG2 1 
ATOM   2577 N N   . TYR A 1 341 ? 29.746 26.441  4.672   1.00 51.30  ? 341  TYR A N   1 
ATOM   2578 C CA  . TYR A 1 341 ? 31.118 26.318  5.126   1.00 51.75  ? 341  TYR A CA  1 
ATOM   2579 C C   . TYR A 1 341 ? 32.121 26.050  3.993   1.00 52.16  ? 341  TYR A C   1 
ATOM   2580 O O   . TYR A 1 341 ? 33.202 25.508  4.233   1.00 52.30  ? 341  TYR A O   1 
ATOM   2581 C CB  . TYR A 1 341 ? 31.216 25.222  6.205   1.00 51.41  ? 341  TYR A CB  1 
ATOM   2582 C CG  . TYR A 1 341 ? 30.792 25.703  7.573   1.00 52.04  ? 341  TYR A CG  1 
ATOM   2583 C CD1 . TYR A 1 341 ? 29.477 25.548  8.013   1.00 51.18  ? 341  TYR A CD1 1 
ATOM   2584 C CD2 . TYR A 1 341 ? 31.707 26.337  8.420   1.00 52.70  ? 341  TYR A CD2 1 
ATOM   2585 C CE1 . TYR A 1 341 ? 29.082 25.995  9.262   1.00 51.81  ? 341  TYR A CE1 1 
ATOM   2586 C CE2 . TYR A 1 341 ? 31.328 26.784  9.676   1.00 53.25  ? 341  TYR A CE2 1 
ATOM   2587 C CZ  . TYR A 1 341 ? 30.007 26.620  10.092  1.00 53.38  ? 341  TYR A CZ  1 
ATOM   2588 O OH  . TYR A 1 341 ? 29.623 27.078  11.344  1.00 53.39  ? 341  TYR A OH  1 
ATOM   2589 N N   . GLY A 1 342 ? 31.787 26.412  2.760   1.00 52.58  ? 342  GLY A N   1 
ATOM   2590 C CA  . GLY A 1 342 ? 32.727 26.149  1.677   1.00 52.55  ? 342  GLY A CA  1 
ATOM   2591 C C   . GLY A 1 342 ? 32.224 26.100  0.248   1.00 52.80  ? 342  GLY A C   1 
ATOM   2592 O O   . GLY A 1 342 ? 33.031 26.040  -0.680  1.00 53.80  ? 342  GLY A O   1 
ATOM   2593 N N   . VAL A 1 343 ? 30.912 26.123  0.042   1.00 52.07  ? 343  VAL A N   1 
ATOM   2594 C CA  . VAL A 1 343 ? 30.414 26.168  -1.332  1.00 52.13  ? 343  VAL A CA  1 
ATOM   2595 C C   . VAL A 1 343 ? 30.170 27.618  -1.821  1.00 53.00  ? 343  VAL A C   1 
ATOM   2596 O O   . VAL A 1 343 ? 29.283 28.308  -1.334  1.00 52.82  ? 343  VAL A O   1 
ATOM   2597 C CB  . VAL A 1 343 ? 29.201 25.232  -1.547  1.00 51.65  ? 343  VAL A CB  1 
ATOM   2598 C CG1 . VAL A 1 343 ? 28.878 25.125  -3.026  1.00 51.89  ? 343  VAL A CG1 1 
ATOM   2599 C CG2 . VAL A 1 343 ? 29.504 23.844  -0.996  1.00 49.83  ? 343  VAL A CG2 1 
ATOM   2600 N N   . PRO A 1 344 ? 30.982 28.090  -2.781  1.00 53.82  ? 344  PRO A N   1 
ATOM   2601 C CA  . PRO A 1 344 ? 30.742 29.447  -3.279  1.00 54.91  ? 344  PRO A CA  1 
ATOM   2602 C C   . PRO A 1 344 ? 29.276 29.601  -3.695  1.00 55.44  ? 344  PRO A C   1 
ATOM   2603 O O   . PRO A 1 344 ? 28.732 28.726  -4.388  1.00 55.30  ? 344  PRO A O   1 
ATOM   2604 C CB  . PRO A 1 344 ? 31.678 29.553  -4.492  1.00 55.49  ? 344  PRO A CB  1 
ATOM   2605 C CG  . PRO A 1 344 ? 32.766 28.591  -4.217  1.00 54.62  ? 344  PRO A CG  1 
ATOM   2606 C CD  . PRO A 1 344 ? 32.123 27.443  -3.459  1.00 53.94  ? 344  PRO A CD  1 
ATOM   2607 N N   . GLY A 1 345 ? 28.645 30.682  -3.232  1.00 56.07  ? 345  GLY A N   1 
ATOM   2608 C CA  . GLY A 1 345 ? 27.233 30.956  -3.510  1.00 56.26  ? 345  GLY A CA  1 
ATOM   2609 C C   . GLY A 1 345 ? 26.304 30.847  -2.312  1.00 55.57  ? 345  GLY A C   1 
ATOM   2610 O O   . GLY A 1 345 ? 25.240 31.455  -2.306  1.00 56.18  ? 345  GLY A O   1 
ATOM   2611 N N   . PHE A 1 346 ? 26.715 30.086  -1.295  1.00 54.42  ? 346  PHE A N   1 
ATOM   2612 C CA  . PHE A 1 346 ? 25.876 29.776  -0.124  1.00 53.48  ? 346  PHE A CA  1 
ATOM   2613 C C   . PHE A 1 346 ? 26.183 30.604  1.135   1.00 53.82  ? 346  PHE A C   1 
ATOM   2614 O O   . PHE A 1 346 ? 27.348 30.873  1.452   1.00 54.08  ? 346  PHE A O   1 
ATOM   2615 C CB  . PHE A 1 346 ? 25.969 28.284  0.188   1.00 51.87  ? 346  PHE A CB  1 
ATOM   2616 C CG  . PHE A 1 346 ? 25.341 27.404  -0.869  1.00 51.17  ? 346  PHE A CG  1 
ATOM   2617 C CD1 . PHE A 1 346 ? 26.048 27.049  -2.011  1.00 49.22  ? 346  PHE A CD1 1 
ATOM   2618 C CD2 . PHE A 1 346 ? 24.036 26.935  -0.716  1.00 50.25  ? 346  PHE A CD2 1 
ATOM   2619 C CE1 . PHE A 1 346 ? 25.469 26.246  -2.983  1.00 49.56  ? 346  PHE A CE1 1 
ATOM   2620 C CE2 . PHE A 1 346 ? 23.448 26.137  -1.682  1.00 50.02  ? 346  PHE A CE2 1 
ATOM   2621 C CZ  . PHE A 1 346 ? 24.165 25.788  -2.818  1.00 50.84  ? 346  PHE A CZ  1 
ATOM   2622 N N   . SER A 1 347 ? 25.127 31.008  1.842   1.00 54.24  ? 347  SER A N   1 
ATOM   2623 C CA  . SER A 1 347 ? 25.236 31.860  3.039   1.00 54.67  ? 347  SER A CA  1 
ATOM   2624 C C   . SER A 1 347 ? 23.992 31.742  3.921   1.00 54.64  ? 347  SER A C   1 
ATOM   2625 O O   . SER A 1 347 ? 22.921 31.403  3.428   1.00 55.50  ? 347  SER A O   1 
ATOM   2626 C CB  . SER A 1 347 ? 25.446 33.332  2.639   1.00 56.17  ? 347  SER A CB  1 
ATOM   2627 O OG  . SER A 1 347 ? 25.400 34.189  3.768   1.00 56.34  ? 347  SER A OG  1 
ATOM   2628 N N   . LYS A 1 348 ? 24.132 32.044  5.210   1.00 54.38  ? 348  LYS A N   1 
ATOM   2629 C CA  . LYS A 1 348 ? 23.000 32.033  6.136   1.00 54.51  ? 348  LYS A CA  1 
ATOM   2630 C C   . LYS A 1 348 ? 22.183 33.333  6.060   1.00 56.22  ? 348  LYS A C   1 
ATOM   2631 O O   . LYS A 1 348 ? 21.044 33.379  6.542   1.00 56.51  ? 348  LYS A O   1 
ATOM   2632 C CB  . LYS A 1 348 ? 23.473 31.801  7.579   1.00 53.81  ? 348  LYS A CB  1 
ATOM   2633 C CG  . LYS A 1 348 ? 23.819 33.089  8.362   1.00 55.44  ? 348  LYS A CG  1 
ATOM   2634 C CD  . LYS A 1 348 ? 24.001 32.829  9.859   1.00 55.44  ? 348  LYS A CD  1 
ATOM   2635 C CE  . LYS A 1 348 ? 24.234 34.121  10.643  1.00 57.37  ? 348  LYS A CE  1 
ATOM   2636 N NZ  . LYS A 1 348 ? 23.033 35.006  10.741  1.00 59.74  ? 348  LYS A NZ  1 
ATOM   2637 N N   . ASP A 1 349 ? 22.770 34.372  5.456   1.00 57.03  ? 349  ASP A N   1 
ATOM   2638 C CA  . ASP A 1 349 ? 22.206 35.736  5.493   1.00 59.04  ? 349  ASP A CA  1 
ATOM   2639 C C   . ASP A 1 349 ? 21.408 36.106  4.241   1.00 59.97  ? 349  ASP A C   1 
ATOM   2640 O O   . ASP A 1 349 ? 20.764 37.157  4.196   1.00 61.49  ? 349  ASP A O   1 
ATOM   2641 C CB  . ASP A 1 349 ? 23.297 36.793  5.778   1.00 59.78  ? 349  ASP A CB  1 
ATOM   2642 C CG  . ASP A 1 349 ? 23.985 36.583  7.131   1.00 60.20  ? 349  ASP A CG  1 
ATOM   2643 O OD1 . ASP A 1 349 ? 23.283 36.320  8.144   1.00 59.60  ? 349  ASP A OD1 1 
ATOM   2644 O OD2 . ASP A 1 349 ? 25.237 36.671  7.174   1.00 61.15  ? 349  ASP A OD2 1 
ATOM   2645 N N   . ASN A 1 350 ? 21.462 35.250  3.225   1.00 59.00  ? 350  ASN A N   1 
ATOM   2646 C CA  . ASN A 1 350 ? 20.529 35.361  2.103   1.00 59.68  ? 350  ASN A CA  1 
ATOM   2647 C C   . ASN A 1 350 ? 19.975 33.997  1.689   1.00 58.18  ? 350  ASN A C   1 
ATOM   2648 O O   . ASN A 1 350 ? 20.268 32.972  2.319   1.00 56.72  ? 350  ASN A O   1 
ATOM   2649 C CB  . ASN A 1 350 ? 21.107 36.174  0.922   1.00 60.62  ? 350  ASN A CB  1 
ATOM   2650 C CG  . ASN A 1 350 ? 22.251 35.468  0.205   1.00 60.60  ? 350  ASN A CG  1 
ATOM   2651 O OD1 . ASN A 1 350 ? 22.225 34.247  -0.006  1.00 60.22  ? 350  ASN A OD1 1 
ATOM   2652 N ND2 . ASN A 1 350 ? 23.259 36.242  -0.195  1.00 61.09  ? 350  ASN A ND2 1 
ATOM   2653 N N   . GLU A 1 351 ? 19.171 34.006  0.637   1.00 58.52  ? 351  GLU A N   1 
ATOM   2654 C CA  . GLU A 1 351 ? 18.384 32.862  0.229   1.00 58.01  ? 351  GLU A CA  1 
ATOM   2655 C C   . GLU A 1 351 ? 19.202 31.833  -0.572  1.00 56.10  ? 351  GLU A C   1 
ATOM   2656 O O   . GLU A 1 351 ? 18.726 30.729  -0.846  1.00 55.59  ? 351  GLU A O   1 
ATOM   2657 C CB  . GLU A 1 351 ? 17.116 33.345  -0.510  1.00 60.33  ? 351  GLU A CB  1 
ATOM   2658 C CG  . GLU A 1 351 ? 15.956 33.757  0.430   1.00 63.84  ? 351  GLU A CG  1 
ATOM   2659 C CD  . GLU A 1 351 ? 15.252 32.539  1.055   1.00 68.72  ? 351  GLU A CD  1 
ATOM   2660 O OE1 . GLU A 1 351 ? 14.493 31.849  0.320   1.00 71.07  ? 351  GLU A OE1 1 
ATOM   2661 O OE2 . GLU A 1 351 ? 15.461 32.253  2.271   1.00 69.03  ? 351  GLU A OE2 1 
ATOM   2662 N N   . SER A 1 352 ? 20.441 32.200  -0.909  1.00 55.05  ? 352  SER A N   1 
ATOM   2663 C CA  . SER A 1 352 ? 21.416 31.304  -1.548  1.00 53.60  ? 352  SER A CA  1 
ATOM   2664 C C   . SER A 1 352 ? 20.939 30.649  -2.871  1.00 53.83  ? 352  SER A C   1 
ATOM   2665 O O   . SER A 1 352 ? 21.225 29.467  -3.154  1.00 52.65  ? 352  SER A O   1 
ATOM   2666 C CB  . SER A 1 352 ? 21.921 30.244  -0.544  1.00 52.31  ? 352  SER A CB  1 
ATOM   2667 O OG  . SER A 1 352 ? 22.282 30.829  0.704   1.00 51.51  ? 352  SER A OG  1 
ATOM   2668 N N   . LEU A 1 353 ? 20.213 31.427  -3.671  1.00 54.59  ? 353  LEU A N   1 
ATOM   2669 C CA  . LEU A 1 353 ? 19.854 31.030  -5.023  1.00 55.08  ? 353  LEU A CA  1 
ATOM   2670 C C   . LEU A 1 353 ? 21.118 31.015  -5.898  1.00 54.92  ? 353  LEU A C   1 
ATOM   2671 O O   . LEU A 1 353 ? 21.806 32.027  -6.019  1.00 56.05  ? 353  LEU A O   1 
ATOM   2672 C CB  . LEU A 1 353 ? 18.807 31.993  -5.592  1.00 56.70  ? 353  LEU A CB  1 
ATOM   2673 C CG  . LEU A 1 353 ? 17.500 32.209  -4.808  1.00 56.83  ? 353  LEU A CG  1 
ATOM   2674 C CD1 . LEU A 1 353 ? 16.622 33.236  -5.498  1.00 56.76  ? 353  LEU A CD1 1 
ATOM   2675 C CD2 . LEU A 1 353 ? 16.723 30.906  -4.566  1.00 54.98  ? 353  LEU A CD2 1 
ATOM   2676 N N   . ILE A 1 354 ? 21.429 29.860  -6.482  1.00 53.81  ? 354  ILE A N   1 
ATOM   2677 C CA  . ILE A 1 354 ? 22.660 29.679  -7.253  1.00 52.99  ? 354  ILE A CA  1 
ATOM   2678 C C   . ILE A 1 354 ? 22.426 29.333  -8.728  1.00 53.64  ? 354  ILE A C   1 
ATOM   2679 O O   . ILE A 1 354 ? 21.304 29.048  -9.140  1.00 54.32  ? 354  ILE A O   1 
ATOM   2680 C CB  . ILE A 1 354 ? 23.549 28.579  -6.631  1.00 51.73  ? 354  ILE A CB  1 
ATOM   2681 C CG1 . ILE A 1 354 ? 22.761 27.275  -6.476  1.00 49.94  ? 354  ILE A CG1 1 
ATOM   2682 C CG2 . ILE A 1 354 ? 24.147 29.055  -5.303  1.00 50.70  ? 354  ILE A CG2 1 
ATOM   2683 C CD1 . ILE A 1 354 ? 23.623 26.051  -6.377  1.00 48.59  ? 354  ILE A CD1 1 
ATOM   2684 N N   . SER A 1 355 ? 23.504 29.342  -9.507  1.00 53.35  ? 355  SER A N   1 
ATOM   2685 C CA  . SER A 1 355 ? 23.464 29.036  -10.943 1.00 54.02  ? 355  SER A CA  1 
ATOM   2686 C C   . SER A 1 355 ? 23.908 27.590  -11.246 1.00 53.10  ? 355  SER A C   1 
ATOM   2687 O O   . SER A 1 355 ? 24.390 26.875  -10.351 1.00 51.62  ? 355  SER A O   1 
ATOM   2688 C CB  . SER A 1 355 ? 24.356 30.033  -11.684 1.00 55.00  ? 355  SER A CB  1 
ATOM   2689 O OG  . SER A 1 355 ? 25.701 29.940  -11.225 1.00 54.25  ? 355  SER A OG  1 
ATOM   2690 N N   . ARG A 1 356 ? 23.749 27.155  -12.496 1.00 53.91  ? 356  ARG A N   1 
ATOM   2691 C CA  . ARG A 1 356 ? 24.264 25.841  -12.906 1.00 53.83  ? 356  ARG A CA  1 
ATOM   2692 C C   . ARG A 1 356 ? 25.758 25.696  -12.644 1.00 52.77  ? 356  ARG A C   1 
ATOM   2693 O O   . ARG A 1 356 ? 26.197 24.680  -12.076 1.00 51.11  ? 356  ARG A O   1 
ATOM   2694 C CB  . ARG A 1 356 ? 23.961 25.518  -14.373 1.00 55.48  ? 356  ARG A CB  1 
ATOM   2695 C CG  . ARG A 1 356 ? 22.632 24.830  -14.567 1.00 57.42  ? 356  ARG A CG  1 
ATOM   2696 C CD  . ARG A 1 356 ? 22.555 24.022  -15.857 1.00 60.60  ? 356  ARG A CD  1 
ATOM   2697 N NE  . ARG A 1 356 ? 23.106 22.666  -15.736 1.00 62.24  ? 356  ARG A NE  1 
ATOM   2698 C CZ  . ARG A 1 356 ? 22.546 21.655  -15.057 1.00 61.54  ? 356  ARG A CZ  1 
ATOM   2699 N NH1 . ARG A 1 356 ? 21.411 21.819  -14.378 1.00 61.06  ? 356  ARG A NH1 1 
ATOM   2700 N NH2 . ARG A 1 356 ? 23.138 20.468  -15.043 1.00 59.60  ? 356  ARG A NH2 1 
ATOM   2701 N N   . ALA A 1 357 ? 26.524 26.717  -13.046 1.00 53.15  ? 357  ALA A N   1 
ATOM   2702 C CA  . ALA A 1 357 ? 27.974 26.714  -12.853 1.00 52.50  ? 357  ALA A CA  1 
ATOM   2703 C C   . ALA A 1 357 ? 28.286 26.536  -11.375 1.00 50.93  ? 357  ALA A C   1 
ATOM   2704 O O   . ALA A 1 357 ? 29.127 25.714  -11.015 1.00 50.10  ? 357  ALA A O   1 
ATOM   2705 C CB  . ALA A 1 357 ? 28.619 27.986  -13.406 1.00 53.13  ? 357  ALA A CB  1 
ATOM   2706 N N   . GLN A 1 358 ? 27.576 27.271  -10.525 1.00 50.56  ? 358  GLN A N   1 
ATOM   2707 C CA  . GLN A 1 358 ? 27.795 27.174  -9.089  1.00 49.76  ? 358  GLN A CA  1 
ATOM   2708 C C   . GLN A 1 358 ? 27.418 25.795  -8.549  1.00 48.66  ? 358  GLN A C   1 
ATOM   2709 O O   . GLN A 1 358 ? 28.018 25.305  -7.601  1.00 47.19  ? 358  GLN A O   1 
ATOM   2710 C CB  . GLN A 1 358 ? 27.055 28.296  -8.348  1.00 50.12  ? 358  GLN A CB  1 
ATOM   2711 C CG  . GLN A 1 358 ? 27.635 29.702  -8.599  1.00 52.00  ? 358  GLN A CG  1 
ATOM   2712 C CD  . GLN A 1 358 ? 26.898 30.796  -7.838  1.00 54.66  ? 358  GLN A CD  1 
ATOM   2713 O OE1 . GLN A 1 358 ? 25.671 30.909  -7.910  1.00 57.21  ? 358  GLN A OE1 1 
ATOM   2714 N NE2 . GLN A 1 358 ? 27.644 31.612  -7.109  1.00 54.55  ? 358  GLN A NE2 1 
ATOM   2715 N N   . PHE A 1 359 ? 26.427 25.169  -9.181  1.00 49.57  ? 359  PHE A N   1 
ATOM   2716 C CA  . PHE A 1 359 ? 26.016 23.815  -8.832  1.00 48.63  ? 359  PHE A CA  1 
ATOM   2717 C C   . PHE A 1 359 ? 27.082 22.786  -9.202  1.00 48.57  ? 359  PHE A C   1 
ATOM   2718 O O   . PHE A 1 359 ? 27.433 21.963  -8.372  1.00 47.87  ? 359  PHE A O   1 
ATOM   2719 C CB  . PHE A 1 359 ? 24.658 23.487  -9.465  1.00 49.22  ? 359  PHE A CB  1 
ATOM   2720 C CG  . PHE A 1 359 ? 24.204 22.071  -9.252  1.00 47.50  ? 359  PHE A CG  1 
ATOM   2721 C CD1 . PHE A 1 359 ? 24.070 21.209  -10.331 1.00 47.25  ? 359  PHE A CD1 1 
ATOM   2722 C CD2 . PHE A 1 359 ? 23.911 21.601  -7.980  1.00 46.45  ? 359  PHE A CD2 1 
ATOM   2723 C CE1 . PHE A 1 359 ? 23.644 19.897  -10.152 1.00 47.55  ? 359  PHE A CE1 1 
ATOM   2724 C CE2 . PHE A 1 359 ? 23.486 20.283  -7.787  1.00 46.44  ? 359  PHE A CE2 1 
ATOM   2725 C CZ  . PHE A 1 359 ? 23.350 19.433  -8.875  1.00 47.14  ? 359  PHE A CZ  1 
ATOM   2726 N N   . LEU A 1 360 ? 27.604 22.835  -10.427 1.00 50.12  ? 360  LEU A N   1 
ATOM   2727 C CA  . LEU A 1 360 ? 28.660 21.900  -10.845 1.00 50.69  ? 360  LEU A CA  1 
ATOM   2728 C C   . LEU A 1 360 ? 29.925 22.072  -9.996  1.00 49.82  ? 360  LEU A C   1 
ATOM   2729 O O   . LEU A 1 360 ? 30.580 21.098  -9.654  1.00 49.69  ? 360  LEU A O   1 
ATOM   2730 C CB  . LEU A 1 360 ? 28.990 22.025  -12.345 1.00 52.63  ? 360  LEU A CB  1 
ATOM   2731 C CG  . LEU A 1 360 ? 27.893 22.200  -13.430 1.00 55.57  ? 360  LEU A CG  1 
ATOM   2732 C CD1 . LEU A 1 360 ? 28.484 22.373  -14.835 1.00 58.37  ? 360  LEU A CD1 1 
ATOM   2733 C CD2 . LEU A 1 360 ? 26.851 21.081  -13.462 1.00 56.29  ? 360  LEU A CD2 1 
ATOM   2734 N N   . ALA A 1 361 ? 30.249 23.315  -9.652  1.00 49.90  ? 361  ALA A N   1 
ATOM   2735 C CA  . ALA A 1 361 ? 31.411 23.634  -8.817  1.00 49.25  ? 361  ALA A CA  1 
ATOM   2736 C C   . ALA A 1 361 ? 31.242 23.104  -7.399  1.00 48.26  ? 361  ALA A C   1 
ATOM   2737 O O   . ALA A 1 361 ? 32.191 22.572  -6.815  1.00 48.43  ? 361  ALA A O   1 
ATOM   2738 C CB  . ALA A 1 361 ? 31.669 25.137  -8.801  1.00 49.01  ? 361  ALA A CB  1 
ATOM   2739 N N   . GLY A 1 362 ? 30.034 23.244  -6.855  1.00 47.77  ? 362  GLY A N   1 
ATOM   2740 C CA  . GLY A 1 362 ? 29.705 22.702  -5.548  1.00 46.50  ? 362  GLY A CA  1 
ATOM   2741 C C   . GLY A 1 362 ? 29.694 21.178  -5.486  1.00 46.26  ? 362  GLY A C   1 
ATOM   2742 O O   . GLY A 1 362 ? 29.956 20.607  -4.431  1.00 45.36  ? 362  GLY A O   1 
ATOM   2743 N N   . VAL A 1 363 ? 29.372 20.520  -6.597  1.00 46.96  ? 363  VAL A N   1 
ATOM   2744 C CA  . VAL A 1 363 ? 29.398 19.058  -6.650  1.00 47.41  ? 363  VAL A CA  1 
ATOM   2745 C C   . VAL A 1 363 ? 30.842 18.520  -6.511  1.00 48.11  ? 363  VAL A C   1 
ATOM   2746 O O   . VAL A 1 363 ? 31.057 17.497  -5.845  1.00 47.16  ? 363  VAL A O   1 
ATOM   2747 C CB  . VAL A 1 363 ? 28.693 18.497  -7.928  1.00 48.15  ? 363  VAL A CB  1 
ATOM   2748 C CG1 . VAL A 1 363 ? 28.995 17.016  -8.135  1.00 46.94  ? 363  VAL A CG1 1 
ATOM   2749 C CG2 . VAL A 1 363 ? 27.196 18.703  -7.841  1.00 48.41  ? 363  VAL A CG2 1 
ATOM   2750 N N   . ARG A 1 364 ? 31.813 19.215  -7.121  1.00 49.34  ? 364  ARG A N   1 
ATOM   2751 C CA  . ARG A 1 364 ? 33.226 18.824  -7.018  1.00 50.40  ? 364  ARG A CA  1 
ATOM   2752 C C   . ARG A 1 364 ? 33.719 18.930  -5.583  1.00 49.81  ? 364  ARG A C   1 
ATOM   2753 O O   . ARG A 1 364 ? 34.555 18.146  -5.155  1.00 50.01  ? 364  ARG A O   1 
ATOM   2754 C CB  . ARG A 1 364 ? 34.132 19.658  -7.934  1.00 51.54  ? 364  ARG A CB  1 
ATOM   2755 C CG  . ARG A 1 364 ? 33.751 19.668  -9.423  1.00 53.89  ? 364  ARG A CG  1 
ATOM   2756 C CD  . ARG A 1 364 ? 33.308 18.283  -9.941  1.00 56.58  ? 364  ARG A CD  1 
ATOM   2757 N NE  . ARG A 1 364 ? 34.379 17.280  -9.935  1.00 58.40  ? 364  ARG A NE  1 
ATOM   2758 C CZ  . ARG A 1 364 ? 35.213 17.059  -10.954 1.00 60.60  ? 364  ARG A CZ  1 
ATOM   2759 N NH1 . ARG A 1 364 ? 35.106 17.766  -12.080 1.00 60.87  ? 364  ARG A NH1 1 
ATOM   2760 N NH2 . ARG A 1 364 ? 36.156 16.126  -10.850 1.00 60.12  ? 364  ARG A NH2 1 
ATOM   2761 N N   . ILE A 1 365 ? 33.176 19.892  -4.841  1.00 49.71  ? 365  ILE A N   1 
ATOM   2762 C CA  . ILE A 1 365 ? 33.547 20.116  -3.452  1.00 48.82  ? 365  ILE A CA  1 
ATOM   2763 C C   . ILE A 1 365 ? 32.799 19.155  -2.525  1.00 48.81  ? 365  ILE A C   1 
ATOM   2764 O O   . ILE A 1 365 ? 33.378 18.612  -1.562  1.00 48.55  ? 365  ILE A O   1 
ATOM   2765 C CB  . ILE A 1 365 ? 33.291 21.581  -3.069  1.00 48.76  ? 365  ILE A CB  1 
ATOM   2766 C CG1 . ILE A 1 365 ? 34.218 22.495  -3.882  1.00 48.71  ? 365  ILE A CG1 1 
ATOM   2767 C CG2 . ILE A 1 365 ? 33.439 21.811  -1.551  1.00 47.47  ? 365  ILE A CG2 1 
ATOM   2768 C CD1 . ILE A 1 365 ? 33.798 23.929  -3.876  1.00 48.36  ? 365  ILE A CD1 1 
ATOM   2769 N N   . GLY A 1 366 ? 31.518 18.949  -2.814  1.00 49.00  ? 366  GLY A N   1 
ATOM   2770 C CA  . GLY A 1 366 ? 30.688 18.041  -2.037  1.00 48.96  ? 366  GLY A CA  1 
ATOM   2771 C C   . GLY A 1 366 ? 31.037 16.575  -2.244  1.00 49.63  ? 366  GLY A C   1 
ATOM   2772 O O   . GLY A 1 366 ? 30.880 15.763  -1.341  1.00 49.77  ? 366  GLY A O   1 
ATOM   2773 N N   . VAL A 1 367 ? 31.494 16.226  -3.438  1.00 50.63  ? 367  VAL A N   1 
ATOM   2774 C CA  . VAL A 1 367 ? 31.890 14.858  -3.731  1.00 50.98  ? 367  VAL A CA  1 
ATOM   2775 C C   . VAL A 1 367 ? 33.357 14.921  -4.162  1.00 52.29  ? 367  VAL A C   1 
ATOM   2776 O O   . VAL A 1 367 ? 33.670 14.743  -5.344  1.00 53.36  ? 367  VAL A O   1 
ATOM   2777 C CB  . VAL A 1 367 ? 30.995 14.240  -4.847  1.00 51.90  ? 367  VAL A CB  1 
ATOM   2778 C CG1 . VAL A 1 367 ? 31.070 12.730  -4.823  1.00 51.44  ? 367  VAL A CG1 1 
ATOM   2779 C CG2 . VAL A 1 367 ? 29.533 14.692  -4.701  1.00 50.61  ? 367  VAL A CG2 1 
ATOM   2780 N N   . PRO A 1 368 ? 34.267 15.226  -3.210  1.00 52.39  ? 368  PRO A N   1 
ATOM   2781 C CA  . PRO A 1 368 ? 35.672 15.503  -3.566  1.00 53.27  ? 368  PRO A CA  1 
ATOM   2782 C C   . PRO A 1 368 ? 36.458 14.343  -4.167  1.00 54.84  ? 368  PRO A C   1 
ATOM   2783 O O   . PRO A 1 368 ? 37.408 14.587  -4.905  1.00 55.82  ? 368  PRO A O   1 
ATOM   2784 C CB  . PRO A 1 368 ? 36.305 15.952  -2.251  1.00 52.14  ? 368  PRO A CB  1 
ATOM   2785 C CG  . PRO A 1 368 ? 35.393 15.533  -1.194  1.00 51.49  ? 368  PRO A CG  1 
ATOM   2786 C CD  . PRO A 1 368 ? 34.023 15.364  -1.764  1.00 51.25  ? 368  PRO A CD  1 
ATOM   2787 N N   . GLN A 1 369 ? 36.062 13.104  -3.882  1.00 55.70  ? 369  GLN A N   1 
ATOM   2788 C CA  . GLN A 1 369 ? 36.761 11.936  -4.445  1.00 57.81  ? 369  GLN A CA  1 
ATOM   2789 C C   . GLN A 1 369 ? 36.352 11.571  -5.873  1.00 58.93  ? 369  GLN A C   1 
ATOM   2790 O O   . GLN A 1 369 ? 36.960 10.687  -6.481  1.00 60.63  ? 369  GLN A O   1 
ATOM   2791 C CB  . GLN A 1 369 ? 36.691 10.690  -3.531  1.00 57.92  ? 369  GLN A CB  1 
ATOM   2792 C CG  . GLN A 1 369 ? 35.689 10.714  -2.364  1.00 59.63  ? 369  GLN A CG  1 
ATOM   2793 C CD  . GLN A 1 369 ? 34.218 10.781  -2.780  1.00 62.40  ? 369  GLN A CD  1 
ATOM   2794 O OE1 . GLN A 1 369 ? 33.480 11.662  -2.324  1.00 61.75  ? 369  GLN A OE1 1 
ATOM   2795 N NE2 . GLN A 1 369 ? 33.786 9.846   -3.630  1.00 63.88  ? 369  GLN A NE2 1 
ATOM   2796 N N   . ALA A 1 370 ? 35.342 12.250  -6.407  1.00 58.59  ? 370  ALA A N   1 
ATOM   2797 C CA  . ALA A 1 370 ? 34.802 11.925  -7.724  1.00 59.51  ? 370  ALA A CA  1 
ATOM   2798 C C   . ALA A 1 370 ? 35.678 12.389  -8.890  1.00 60.68  ? 370  ALA A C   1 
ATOM   2799 O O   . ALA A 1 370 ? 36.178 13.515  -8.896  1.00 60.48  ? 370  ALA A O   1 
ATOM   2800 C CB  . ALA A 1 370 ? 33.391 12.497  -7.872  1.00 58.96  ? 370  ALA A CB  1 
ATOM   2801 N N   . SER A 1 371 ? 35.837 11.518  -9.884  1.00 61.80  ? 371  SER A N   1 
ATOM   2802 C CA  . SER A 1 371 ? 36.386 11.911  -11.177 1.00 63.17  ? 371  SER A CA  1 
ATOM   2803 C C   . SER A 1 371 ? 35.391 12.805  -11.923 1.00 63.17  ? 371  SER A C   1 
ATOM   2804 O O   . SER A 1 371 ? 34.302 13.074  -11.427 1.00 62.23  ? 371  SER A O   1 
ATOM   2805 C CB  . SER A 1 371 ? 36.663 10.673  -12.014 1.00 64.75  ? 371  SER A CB  1 
ATOM   2806 O OG  . SER A 1 371 ? 35.445 10.026  -12.349 1.00 65.68  ? 371  SER A OG  1 
ATOM   2807 N N   . ASP A 1 372 ? 35.772 13.254  -13.116 1.00 64.32  ? 372  ASP A N   1 
ATOM   2808 C CA  . ASP A 1 372 ? 34.887 14.042  -13.968 1.00 64.83  ? 372  ASP A CA  1 
ATOM   2809 C C   . ASP A 1 372 ? 33.631 13.274  -14.409 1.00 64.95  ? 372  ASP A C   1 
ATOM   2810 O O   . ASP A 1 372 ? 32.534 13.836  -14.432 1.00 64.64  ? 372  ASP A O   1 
ATOM   2811 C CB  . ASP A 1 372 ? 35.648 14.573  -15.190 1.00 66.48  ? 372  ASP A CB  1 
ATOM   2812 C CG  . ASP A 1 372 ? 36.649 15.656  -14.831 1.00 66.97  ? 372  ASP A CG  1 
ATOM   2813 O OD1 . ASP A 1 372 ? 36.865 15.918  -13.625 1.00 67.35  ? 372  ASP A OD1 1 
ATOM   2814 O OD2 . ASP A 1 372 ? 37.225 16.250  -15.758 1.00 68.83  ? 372  ASP A OD2 1 
ATOM   2815 N N   . LEU A 1 373 ? 33.795 11.998  -14.755 1.00 65.39  ? 373  LEU A N   1 
ATOM   2816 C CA  . LEU A 1 373 ? 32.664 11.165  -15.153 1.00 65.56  ? 373  LEU A CA  1 
ATOM   2817 C C   . LEU A 1 373 ? 31.622 11.048  -14.038 1.00 63.84  ? 373  LEU A C   1 
ATOM   2818 O O   . LEU A 1 373 ? 30.437 11.312  -14.254 1.00 63.97  ? 373  LEU A O   1 
ATOM   2819 C CB  . LEU A 1 373 ? 33.132 9.776   -15.591 1.00 66.84  ? 373  LEU A CB  1 
ATOM   2820 C CG  . LEU A 1 373 ? 32.142 8.989   -16.455 1.00 68.25  ? 373  LEU A CG  1 
ATOM   2821 C CD1 . LEU A 1 373 ? 31.655 9.818   -17.650 1.00 69.30  ? 373  LEU A CD1 1 
ATOM   2822 C CD2 . LEU A 1 373 ? 32.759 7.679   -16.922 1.00 69.78  ? 373  LEU A CD2 1 
ATOM   2823 N N   . ALA A 1 374 ? 32.080 10.674  -12.849 1.00 62.12  ? 374  ALA A N   1 
ATOM   2824 C CA  . ALA A 1 374 ? 31.207 10.491  -11.697 1.00 60.32  ? 374  ALA A CA  1 
ATOM   2825 C C   . ALA A 1 374 ? 30.469 11.774  -11.336 1.00 58.88  ? 374  ALA A C   1 
ATOM   2826 O O   . ALA A 1 374 ? 29.308 11.733  -10.946 1.00 58.37  ? 374  ALA A O   1 
ATOM   2827 C CB  . ALA A 1 374 ? 32.009 9.976   -10.501 1.00 59.42  ? 374  ALA A CB  1 
ATOM   2828 N N   . ALA A 1 375 ? 31.149 12.909  -11.475 1.00 58.17  ? 375  ALA A N   1 
ATOM   2829 C CA  . ALA A 1 375 ? 30.573 14.201  -11.116 1.00 56.88  ? 375  ALA A CA  1 
ATOM   2830 C C   . ALA A 1 375 ? 29.449 14.590  -12.078 1.00 57.62  ? 375  ALA A C   1 
ATOM   2831 O O   . ALA A 1 375 ? 28.426 15.128  -11.649 1.00 57.36  ? 375  ALA A O   1 
ATOM   2832 C CB  . ALA A 1 375 ? 31.647 15.283  -11.056 1.00 56.08  ? 375  ALA A CB  1 
ATOM   2833 N N   . GLU A 1 376 ? 29.621 14.312  -13.368 1.00 58.63  ? 376  GLU A N   1 
ATOM   2834 C CA  . GLU A 1 376 ? 28.526 14.551  -14.307 1.00 59.77  ? 376  GLU A CA  1 
ATOM   2835 C C   . GLU A 1 376 ? 27.373 13.561  -14.077 1.00 58.98  ? 376  GLU A C   1 
ATOM   2836 O O   . GLU A 1 376 ? 26.217 13.932  -14.207 1.00 59.28  ? 376  GLU A O   1 
ATOM   2837 C CB  . GLU A 1 376 ? 28.988 14.620  -15.777 1.00 61.45  ? 376  GLU A CB  1 
ATOM   2838 C CG  . GLU A 1 376 ? 29.420 16.047  -16.232 1.00 65.06  ? 376  GLU A CG  1 
ATOM   2839 C CD  . GLU A 1 376 ? 28.241 17.026  -16.552 1.00 68.65  ? 376  GLU A CD  1 
ATOM   2840 O OE1 . GLU A 1 376 ? 28.209 18.168  -16.008 1.00 66.31  ? 376  GLU A OE1 1 
ATOM   2841 O OE2 . GLU A 1 376 ? 27.360 16.656  -17.372 1.00 71.87  ? 376  GLU A OE2 1 
ATOM   2842 N N   . ALA A 1 377 ? 27.686 12.327  -13.698 1.00 57.80  ? 377  ALA A N   1 
ATOM   2843 C CA  . ALA A 1 377 ? 26.652 11.400  -13.259 1.00 57.19  ? 377  ALA A CA  1 
ATOM   2844 C C   . ALA A 1 377 ? 25.786 12.015  -12.143 1.00 55.69  ? 377  ALA A C   1 
ATOM   2845 O O   . ALA A 1 377 ? 24.555 12.028  -12.255 1.00 56.03  ? 377  ALA A O   1 
ATOM   2846 C CB  . ALA A 1 377 ? 27.254 10.079  -12.824 1.00 56.69  ? 377  ALA A CB  1 
ATOM   2847 N N   . VAL A 1 378 ? 26.434 12.534  -11.096 1.00 53.79  ? 378  VAL A N   1 
ATOM   2848 C CA  . VAL A 1 378 ? 25.756 13.209  -9.979  1.00 52.13  ? 378  VAL A CA  1 
ATOM   2849 C C   . VAL A 1 378 ? 24.897 14.378  -10.471 1.00 52.79  ? 378  VAL A C   1 
ATOM   2850 O O   . VAL A 1 378 ? 23.704 14.480  -10.147 1.00 52.93  ? 378  VAL A O   1 
ATOM   2851 C CB  . VAL A 1 378 ? 26.769 13.732  -8.916  1.00 50.67  ? 378  VAL A CB  1 
ATOM   2852 C CG1 . VAL A 1 378 ? 26.067 14.558  -7.859  1.00 48.70  ? 378  VAL A CG1 1 
ATOM   2853 C CG2 . VAL A 1 378 ? 27.534 12.570  -8.252  1.00 49.39  ? 378  VAL A CG2 1 
ATOM   2854 N N   . VAL A 1 379 ? 25.511 15.252  -11.263 1.00 52.91  ? 379  VAL A N   1 
ATOM   2855 C CA  . VAL A 1 379 ? 24.841 16.442  -11.761 1.00 53.26  ? 379  VAL A CA  1 
ATOM   2856 C C   . VAL A 1 379 ? 23.616 16.094  -12.613 1.00 55.08  ? 379  VAL A C   1 
ATOM   2857 O O   . VAL A 1 379 ? 22.552 16.715  -12.487 1.00 55.43  ? 379  VAL A O   1 
ATOM   2858 C CB  . VAL A 1 379 ? 25.807 17.323  -12.561 1.00 53.28  ? 379  VAL A CB  1 
ATOM   2859 C CG1 . VAL A 1 379 ? 25.038 18.247  -13.489 1.00 53.96  ? 379  VAL A CG1 1 
ATOM   2860 C CG2 . VAL A 1 379 ? 26.698 18.106  -11.614 1.00 51.57  ? 379  VAL A CG2 1 
ATOM   2861 N N   . LEU A 1 380 ? 23.769 15.091  -13.467 1.00 56.20  ? 380  LEU A N   1 
ATOM   2862 C CA  . LEU A 1 380 ? 22.712 14.725  -14.379 1.00 57.99  ? 380  LEU A CA  1 
ATOM   2863 C C   . LEU A 1 380 ? 21.562 14.076  -13.607 1.00 57.83  ? 380  LEU A C   1 
ATOM   2864 O O   . LEU A 1 380 ? 20.386 14.351  -13.871 1.00 58.62  ? 380  LEU A O   1 
ATOM   2865 C CB  . LEU A 1 380 ? 23.260 13.861  -15.531 1.00 59.93  ? 380  LEU A CB  1 
ATOM   2866 C CG  . LEU A 1 380 ? 24.429 14.458  -16.369 1.00 60.91  ? 380  LEU A CG  1 
ATOM   2867 C CD1 . LEU A 1 380 ? 24.921 13.521  -17.455 1.00 63.22  ? 380  LEU A CD1 1 
ATOM   2868 C CD2 . LEU A 1 380 ? 24.109 15.824  -16.992 1.00 63.55  ? 380  LEU A CD2 1 
ATOM   2869 N N   . HIS A 1 381 ? 21.915 13.261  -12.620 1.00 56.49  ? 381  HIS A N   1 
ATOM   2870 C CA  . HIS A 1 381 ? 20.947 12.631  -11.743 1.00 56.23  ? 381  HIS A CA  1 
ATOM   2871 C C   . HIS A 1 381 ? 20.162 13.626  -10.889 1.00 54.80  ? 381  HIS A C   1 
ATOM   2872 O O   . HIS A 1 381 ? 18.986 13.419  -10.614 1.00 55.27  ? 381  HIS A O   1 
ATOM   2873 C CB  . HIS A 1 381 ? 21.656 11.642  -10.825 1.00 55.99  ? 381  HIS A CB  1 
ATOM   2874 C CG  . HIS A 1 381 ? 20.730 10.710  -10.116 1.00 58.47  ? 381  HIS A CG  1 
ATOM   2875 N ND1 . HIS A 1 381 ? 20.357 9.490   -10.643 1.00 63.33  ? 381  HIS A ND1 1 
ATOM   2876 C CD2 . HIS A 1 381 ? 20.090 10.822  -8.928  1.00 59.77  ? 381  HIS A CD2 1 
ATOM   2877 C CE1 . HIS A 1 381 ? 19.529 8.888   -9.805  1.00 64.46  ? 381  HIS A CE1 1 
ATOM   2878 N NE2 . HIS A 1 381 ? 19.353 9.673   -8.754  1.00 62.93  ? 381  HIS A NE2 1 
ATOM   2879 N N   . TYR A 1 382 ? 20.811 14.696  -10.450 1.00 53.04  ? 382  TYR A N   1 
ATOM   2880 C CA  . TYR A 1 382 ? 20.155 15.652  -9.556  1.00 51.47  ? 382  TYR A CA  1 
ATOM   2881 C C   . TYR A 1 382 ? 19.517 16.841  -10.246 1.00 52.39  ? 382  TYR A C   1 
ATOM   2882 O O   . TYR A 1 382 ? 18.818 17.598  -9.585  1.00 52.56  ? 382  TYR A O   1 
ATOM   2883 C CB  . TYR A 1 382 ? 21.110 16.128  -8.462  1.00 49.32  ? 382  TYR A CB  1 
ATOM   2884 C CG  . TYR A 1 382 ? 21.209 15.158  -7.319  1.00 47.51  ? 382  TYR A CG  1 
ATOM   2885 C CD1 . TYR A 1 382 ? 22.102 14.080  -7.365  1.00 45.61  ? 382  TYR A CD1 1 
ATOM   2886 C CD2 . TYR A 1 382 ? 20.394 15.299  -6.197  1.00 45.88  ? 382  TYR A CD2 1 
ATOM   2887 C CE1 . TYR A 1 382 ? 22.177 13.167  -6.321  1.00 44.39  ? 382  TYR A CE1 1 
ATOM   2888 C CE2 . TYR A 1 382 ? 20.467 14.398  -5.144  1.00 45.69  ? 382  TYR A CE2 1 
ATOM   2889 C CZ  . TYR A 1 382 ? 21.362 13.333  -5.213  1.00 45.61  ? 382  TYR A CZ  1 
ATOM   2890 O OH  . TYR A 1 382 ? 21.436 12.448  -4.166  1.00 45.45  ? 382  TYR A OH  1 
ATOM   2891 N N   . THR A 1 383 ? 19.756 17.013  -11.551 1.00 53.36  ? 383  THR A N   1 
ATOM   2892 C CA  . THR A 1 383 ? 19.101 18.061  -12.332 1.00 54.50  ? 383  THR A CA  1 
ATOM   2893 C C   . THR A 1 383 ? 17.618 17.734  -12.488 1.00 56.25  ? 383  THR A C   1 
ATOM   2894 O O   . THR A 1 383 ? 17.254 16.571  -12.649 1.00 57.25  ? 383  THR A O   1 
ATOM   2895 C CB  . THR A 1 383 ? 19.755 18.227  -13.735 1.00 55.43  ? 383  THR A CB  1 
ATOM   2896 O OG1 . THR A 1 383 ? 21.090 18.703  -13.596 1.00 54.56  ? 383  THR A OG1 1 
ATOM   2897 C CG2 . THR A 1 383 ? 19.007 19.224  -14.610 1.00 56.29  ? 383  THR A CG2 1 
ATOM   2898 N N   . ASP A 1 384 ? 16.770 18.755  -12.401 1.00 57.23  ? 384  ASP A N   1 
ATOM   2899 C CA  . ASP A 1 384 ? 15.396 18.670  -12.863 1.00 59.50  ? 384  ASP A CA  1 
ATOM   2900 C C   . ASP A 1 384 ? 15.365 19.187  -14.304 1.00 61.24  ? 384  ASP A C   1 
ATOM   2901 O O   . ASP A 1 384 ? 15.435 20.392  -14.523 1.00 61.79  ? 384  ASP A O   1 
ATOM   2902 C CB  . ASP A 1 384 ? 14.486 19.514  -11.966 1.00 59.69  ? 384  ASP A CB  1 
ATOM   2903 C CG  . ASP A 1 384 ? 13.091 19.753  -12.573 1.00 63.08  ? 384  ASP A CG  1 
ATOM   2904 O OD1 . ASP A 1 384 ? 12.743 19.137  -13.608 1.00 65.32  ? 384  ASP A OD1 1 
ATOM   2905 O OD2 . ASP A 1 384 ? 12.339 20.579  -12.009 1.00 65.00  ? 384  ASP A OD2 1 
ATOM   2906 N N   . TRP A 1 385 ? 15.241 18.284  -15.277 1.00 62.43  ? 385  TRP A N   1 
ATOM   2907 C CA  . TRP A 1 385 ? 15.396 18.643  -16.691 1.00 63.88  ? 385  TRP A CA  1 
ATOM   2908 C C   . TRP A 1 385 ? 14.220 19.438  -17.276 1.00 66.10  ? 385  TRP A C   1 
ATOM   2909 O O   . TRP A 1 385 ? 14.227 19.807  -18.457 1.00 67.39  ? 385  TRP A O   1 
ATOM   2910 C CB  . TRP A 1 385 ? 15.779 17.416  -17.534 1.00 64.16  ? 385  TRP A CB  1 
ATOM   2911 C CG  . TRP A 1 385 ? 17.067 16.839  -17.060 1.00 62.38  ? 385  TRP A CG  1 
ATOM   2912 C CD1 . TRP A 1 385 ? 17.234 15.869  -16.112 1.00 60.60  ? 385  TRP A CD1 1 
ATOM   2913 C CD2 . TRP A 1 385 ? 18.381 17.238  -17.459 1.00 60.83  ? 385  TRP A CD2 1 
ATOM   2914 N NE1 . TRP A 1 385 ? 18.569 15.630  -15.906 1.00 58.84  ? 385  TRP A NE1 1 
ATOM   2915 C CE2 . TRP A 1 385 ? 19.298 16.456  -16.717 1.00 58.59  ? 385  TRP A CE2 1 
ATOM   2916 C CE3 . TRP A 1 385 ? 18.872 18.180  -18.369 1.00 61.27  ? 385  TRP A CE3 1 
ATOM   2917 C CZ2 . TRP A 1 385 ? 20.678 16.579  -16.859 1.00 58.52  ? 385  TRP A CZ2 1 
ATOM   2918 C CZ3 . TRP A 1 385 ? 20.251 18.314  -18.506 1.00 61.42  ? 385  TRP A CZ3 1 
ATOM   2919 C CH2 . TRP A 1 385 ? 21.140 17.508  -17.754 1.00 60.33  ? 385  TRP A CH2 1 
ATOM   2920 N N   . LEU A 1 386 ? 13.229 19.715  -16.433 1.00 66.58  ? 386  LEU A N   1 
ATOM   2921 C CA  . LEU A 1 386 ? 12.119 20.590  -16.805 1.00 68.82  ? 386  LEU A CA  1 
ATOM   2922 C C   . LEU A 1 386 ? 12.382 22.053  -16.449 1.00 68.55  ? 386  LEU A C   1 
ATOM   2923 O O   . LEU A 1 386 ? 11.810 22.958  -17.058 1.00 70.24  ? 386  LEU A O   1 
ATOM   2924 C CB  . LEU A 1 386 ? 10.812 20.118  -16.160 1.00 69.44  ? 386  LEU A CB  1 
ATOM   2925 C CG  . LEU A 1 386 ? 10.023 19.085  -16.956 1.00 71.84  ? 386  LEU A CG  1 
ATOM   2926 C CD1 . LEU A 1 386 ? 8.851  18.563  -16.138 1.00 73.85  ? 386  LEU A CD1 1 
ATOM   2927 C CD2 . LEU A 1 386 ? 9.547  19.680  -18.281 1.00 74.29  ? 386  LEU A CD2 1 
ATOM   2928 N N   . HIS A 1 387 ? 13.218 22.272  -15.436 1.00 66.81  ? 387  HIS A N   1 
ATOM   2929 C CA  . HIS A 1 387 ? 13.680 23.609  -15.062 1.00 66.49  ? 387  HIS A CA  1 
ATOM   2930 C C   . HIS A 1 387 ? 15.160 23.518  -14.674 1.00 64.36  ? 387  HIS A C   1 
ATOM   2931 O O   . HIS A 1 387 ? 15.518 23.811  -13.526 1.00 62.88  ? 387  HIS A O   1 
ATOM   2932 C CB  . HIS A 1 387 ? 12.878 24.169  -13.876 1.00 66.69  ? 387  HIS A CB  1 
ATOM   2933 C CG  . HIS A 1 387 ? 11.387 24.064  -14.022 1.00 69.75  ? 387  HIS A CG  1 
ATOM   2934 N ND1 . HIS A 1 387 ? 10.654 23.041  -13.455 1.00 70.64  ? 387  HIS A ND1 1 
ATOM   2935 C CD2 . HIS A 1 387 ? 10.492 24.864  -14.647 1.00 72.19  ? 387  HIS A CD2 1 
ATOM   2936 C CE1 . HIS A 1 387 ? 9.374  23.209  -13.733 1.00 72.39  ? 387  HIS A CE1 1 
ATOM   2937 N NE2 . HIS A 1 387 ? 9.248  24.308  -14.455 1.00 74.46  ? 387  HIS A NE2 1 
ATOM   2938 N N   . PRO A 1 388 ? 16.035 23.128  -15.627 1.00 64.15  ? 388  PRO A N   1 
ATOM   2939 C CA  . PRO A 1 388 ? 17.432 22.823  -15.289 1.00 62.29  ? 388  PRO A CA  1 
ATOM   2940 C C   . PRO A 1 388 ? 18.279 24.029  -14.838 1.00 61.36  ? 388  PRO A C   1 
ATOM   2941 O O   . PRO A 1 388 ? 19.433 23.849  -14.455 1.00 60.15  ? 388  PRO A O   1 
ATOM   2942 C CB  . PRO A 1 388 ? 17.984 22.229  -16.593 1.00 62.93  ? 388  PRO A CB  1 
ATOM   2943 C CG  . PRO A 1 388 ? 17.158 22.811  -17.652 1.00 64.93  ? 388  PRO A CG  1 
ATOM   2944 C CD  . PRO A 1 388 ? 15.782 22.979  -17.074 1.00 65.77  ? 388  PRO A CD  1 
ATOM   2945 N N   . GLU A 1 389 ? 17.697 25.226  -14.863 1.00 62.09  ? 389  GLU A N   1 
ATOM   2946 C CA  . GLU A 1 389 ? 18.405 26.476  -14.564 1.00 62.01  ? 389  GLU A CA  1 
ATOM   2947 C C   . GLU A 1 389 ? 17.764 27.253  -13.411 1.00 60.84  ? 389  GLU A C   1 
ATOM   2948 O O   . GLU A 1 389 ? 18.159 28.394  -13.135 1.00 60.98  ? 389  GLU A O   1 
ATOM   2949 C CB  . GLU A 1 389 ? 18.425 27.393  -15.801 1.00 64.20  ? 389  GLU A CB  1 
ATOM   2950 C CG  . GLU A 1 389 ? 19.116 26.809  -17.042 1.00 67.58  ? 389  GLU A CG  1 
ATOM   2951 C CD  . GLU A 1 389 ? 20.569 27.240  -17.195 1.00 69.44  ? 389  GLU A CD  1 
ATOM   2952 O OE1 . GLU A 1 389 ? 21.261 27.468  -16.173 1.00 70.35  ? 389  GLU A OE1 1 
ATOM   2953 O OE2 . GLU A 1 389 ? 21.020 27.348  -18.352 1.00 70.32  ? 389  GLU A OE2 1 
ATOM   2954 N N   . ASP A 1 390 ? 16.765 26.653  -12.767 1.00 59.57  ? 390  ASP A N   1 
ATOM   2955 C CA  . ASP A 1 390 ? 16.026 27.310  -11.694 1.00 58.60  ? 390  ASP A CA  1 
ATOM   2956 C C   . ASP A 1 390 ? 16.901 27.352  -10.441 1.00 56.49  ? 390  ASP A C   1 
ATOM   2957 O O   . ASP A 1 390 ? 17.254 26.316  -9.891  1.00 54.20  ? 390  ASP A O   1 
ATOM   2958 C CB  . ASP A 1 390 ? 14.698 26.587  -11.438 1.00 58.88  ? 390  ASP A CB  1 
ATOM   2959 C CG  . ASP A 1 390 ? 13.879 27.229  -10.337 1.00 58.75  ? 390  ASP A CG  1 
ATOM   2960 O OD1 . ASP A 1 390 ? 12.848 27.837  -10.640 1.00 61.58  ? 390  ASP A OD1 1 
ATOM   2961 O OD2 . ASP A 1 390 ? 14.248 27.138  -9.158  1.00 58.08  ? 390  ASP A OD2 1 
ATOM   2962 N N   . PRO A 1 391 ? 17.281 28.563  -10.009 1.00 56.73  ? 391  PRO A N   1 
ATOM   2963 C CA  . PRO A 1 391 ? 18.191 28.703  -8.876  1.00 55.41  ? 391  PRO A CA  1 
ATOM   2964 C C   . PRO A 1 391 ? 17.681 28.128  -7.552  1.00 54.66  ? 391  PRO A C   1 
ATOM   2965 O O   . PRO A 1 391 ? 18.498 27.709  -6.738  1.00 53.54  ? 391  PRO A O   1 
ATOM   2966 C CB  . PRO A 1 391 ? 18.415 30.220  -8.779  1.00 56.07  ? 391  PRO A CB  1 
ATOM   2967 C CG  . PRO A 1 391 ? 17.323 30.833  -9.517  1.00 57.64  ? 391  PRO A CG  1 
ATOM   2968 C CD  . PRO A 1 391 ? 16.917 29.871  -10.581 1.00 58.17  ? 391  PRO A CD  1 
ATOM   2969 N N   . THR A 1 392 ? 16.365 28.097  -7.339  1.00 55.75  ? 392  THR A N   1 
ATOM   2970 C CA  . THR A 1 392 ? 15.795 27.470  -6.137  1.00 55.07  ? 392  THR A CA  1 
ATOM   2971 C C   . THR A 1 392 ? 15.983 25.961  -6.197  1.00 54.18  ? 392  THR A C   1 
ATOM   2972 O O   . THR A 1 392 ? 16.435 25.361  -5.217  1.00 52.78  ? 392  THR A O   1 
ATOM   2973 C CB  . THR A 1 392 ? 14.280 27.805  -5.910  1.00 56.45  ? 392  THR A CB  1 
ATOM   2974 O OG1 . THR A 1 392 ? 14.108 29.213  -5.744  1.00 57.60  ? 392  THR A OG1 1 
ATOM   2975 C CG2 . THR A 1 392 ? 13.754 27.123  -4.664  1.00 55.85  ? 392  THR A CG2 1 
ATOM   2976 N N   . HIS A 1 393 ? 15.641 25.339  -7.327  1.00 55.14  ? 393  HIS A N   1 
ATOM   2977 C CA  . HIS A 1 393 ? 15.887 23.911  -7.437  1.00 55.07  ? 393  HIS A CA  1 
ATOM   2978 C C   . HIS A 1 393 ? 17.369 23.534  -7.300  1.00 52.83  ? 393  HIS A C   1 
ATOM   2979 O O   . HIS A 1 393 ? 17.684 22.542  -6.645  1.00 52.01  ? 393  HIS A O   1 
ATOM   2980 C CB  . HIS A 1 393 ? 15.289 23.249  -8.684  1.00 57.11  ? 393  HIS A CB  1 
ATOM   2981 C CG  . HIS A 1 393 ? 15.481 21.758  -8.677  1.00 60.92  ? 393  HIS A CG  1 
ATOM   2982 N ND1 . HIS A 1 393 ? 16.545 21.137  -9.308  1.00 63.11  ? 393  HIS A ND1 1 
ATOM   2983 C CD2 . HIS A 1 393 ? 14.818 20.779  -8.007  1.00 63.26  ? 393  HIS A CD2 1 
ATOM   2984 C CE1 . HIS A 1 393 ? 16.491 19.835  -9.075  1.00 64.20  ? 393  HIS A CE1 1 
ATOM   2985 N NE2 . HIS A 1 393 ? 15.454 19.591  -8.288  1.00 64.35  ? 393  HIS A NE2 1 
ATOM   2986 N N   . LEU A 1 394 ? 18.258 24.327  -7.900  1.00 52.17  ? 394  LEU A N   1 
ATOM   2987 C CA  . LEU A 1 394 ? 19.696 24.068  -7.857  1.00 50.61  ? 394  LEU A CA  1 
ATOM   2988 C C   . LEU A 1 394 ? 20.264 24.167  -6.441  1.00 49.23  ? 394  LEU A C   1 
ATOM   2989 O O   . LEU A 1 394 ? 21.081 23.345  -6.038  1.00 47.73  ? 394  LEU A O   1 
ATOM   2990 C CB  . LEU A 1 394 ? 20.463 24.972  -8.829  1.00 50.79  ? 394  LEU A CB  1 
ATOM   2991 C CG  . LEU A 1 394 ? 20.245 24.654  -10.317 1.00 52.04  ? 394  LEU A CG  1 
ATOM   2992 C CD1 . LEU A 1 394 ? 20.846 25.720  -11.240 1.00 51.06  ? 394  LEU A CD1 1 
ATOM   2993 C CD2 . LEU A 1 394 ? 20.751 23.254  -10.690 1.00 50.71  ? 394  LEU A CD2 1 
ATOM   2994 N N   . ARG A 1 395 ? 19.805 25.159  -5.689  1.00 49.42  ? 395  ARG A N   1 
ATOM   2995 C CA  . ARG A 1 395 ? 20.165 25.280  -4.292  1.00 48.62  ? 395  ARG A CA  1 
ATOM   2996 C C   . ARG A 1 395 ? 19.750 24.035  -3.505  1.00 48.18  ? 395  ARG A C   1 
ATOM   2997 O O   . ARG A 1 395 ? 20.538 23.487  -2.733  1.00 47.18  ? 395  ARG A O   1 
ATOM   2998 C CB  . ARG A 1 395 ? 19.530 26.540  -3.698  1.00 49.26  ? 395  ARG A CB  1 
ATOM   2999 C CG  . ARG A 1 395 ? 19.693 26.683  -2.186  1.00 47.82  ? 395  ARG A CG  1 
ATOM   3000 C CD  . ARG A 1 395 ? 18.343 26.599  -1.523  1.00 47.05  ? 395  ARG A CD  1 
ATOM   3001 N NE  . ARG A 1 395 ? 17.731 27.911  -1.431  1.00 46.90  ? 395  ARG A NE  1 
ATOM   3002 C CZ  . ARG A 1 395 ? 16.424 28.140  -1.334  1.00 48.89  ? 395  ARG A CZ  1 
ATOM   3003 N NH1 . ARG A 1 395 ? 15.543 27.138  -1.322  1.00 47.00  ? 395  ARG A NH1 1 
ATOM   3004 N NH2 . ARG A 1 395 ? 16.001 29.398  -1.255  1.00 50.89  ? 395  ARG A NH2 1 
ATOM   3005 N N   . ASP A 1 396 ? 18.517 23.585  -3.719  1.00 49.18  ? 396  ASP A N   1 
ATOM   3006 C CA  . ASP A 1 396 ? 17.984 22.449  -2.985  1.00 48.82  ? 396  ASP A CA  1 
ATOM   3007 C C   . ASP A 1 396 ? 18.650 21.142  -3.401  1.00 47.97  ? 396  ASP A C   1 
ATOM   3008 O O   . ASP A 1 396 ? 18.900 20.290  -2.557  1.00 47.16  ? 396  ASP A O   1 
ATOM   3009 C CB  . ASP A 1 396 ? 16.456 22.380  -3.116  1.00 50.16  ? 396  ASP A CB  1 
ATOM   3010 C CG  . ASP A 1 396 ? 15.752 23.563  -2.443  1.00 52.02  ? 396  ASP A CG  1 
ATOM   3011 O OD1 . ASP A 1 396 ? 16.358 24.201  -1.551  1.00 51.95  ? 396  ASP A OD1 1 
ATOM   3012 O OD2 . ASP A 1 396 ? 14.582 23.854  -2.794  1.00 55.12  ? 396  ASP A OD2 1 
ATOM   3013 N N   . ALA A 1 397 ? 18.952 20.991  -4.689  1.00 48.35  ? 397  ALA A N   1 
ATOM   3014 C CA  . ALA A 1 397 ? 19.666 19.799  -5.161  1.00 47.98  ? 397  ALA A CA  1 
ATOM   3015 C C   . ALA A 1 397 ? 21.085 19.709  -4.569  1.00 46.80  ? 397  ALA A C   1 
ATOM   3016 O O   . ALA A 1 397 ? 21.543 18.620  -4.213  1.00 46.42  ? 397  ALA A O   1 
ATOM   3017 C CB  . ALA A 1 397 ? 19.707 19.752  -6.670  1.00 48.55  ? 397  ALA A CB  1 
ATOM   3018 N N   . MET A 1 398 ? 21.762 20.852  -4.450  1.00 46.16  ? 398  MET A N   1 
ATOM   3019 C CA  . MET A 1 398 ? 23.089 20.901  -3.862  1.00 45.05  ? 398  MET A CA  1 
ATOM   3020 C C   . MET A 1 398 ? 23.067 20.408  -2.409  1.00 44.12  ? 398  MET A C   1 
ATOM   3021 O O   . MET A 1 398 ? 23.956 19.667  -1.977  1.00 43.48  ? 398  MET A O   1 
ATOM   3022 C CB  . MET A 1 398 ? 23.662 22.316  -3.943  1.00 44.98  ? 398  MET A CB  1 
ATOM   3023 C CG  . MET A 1 398 ? 25.134 22.438  -3.559  1.00 43.66  ? 398  MET A CG  1 
ATOM   3024 S SD  . MET A 1 398 ? 26.229 21.577  -4.699  1.00 42.77  ? 398  MET A SD  1 
ATOM   3025 C CE  . MET A 1 398 ? 26.791 20.228  -3.675  1.00 43.18  ? 398  MET A CE  1 
ATOM   3026 N N   . SER A 1 399 ? 22.047 20.826  -1.673  1.00 44.04  ? 399  SER A N   1 
ATOM   3027 C CA  . SER A 1 399 ? 21.847 20.410  -0.295  1.00 43.25  ? 399  SER A CA  1 
ATOM   3028 C C   . SER A 1 399 ? 21.560 18.904  -0.252  1.00 43.05  ? 399  SER A C   1 
ATOM   3029 O O   . SER A 1 399 ? 22.111 18.175  0.577   1.00 42.33  ? 399  SER A O   1 
ATOM   3030 C CB  . SER A 1 399 ? 20.708 21.237  0.316   1.00 43.69  ? 399  SER A CB  1 
ATOM   3031 O OG  . SER A 1 399 ? 20.131 20.634  1.458   1.00 44.14  ? 399  SER A OG  1 
ATOM   3032 N N   . ALA A 1 400 ? 20.717 18.445  -1.166  1.00 43.68  ? 400  ALA A N   1 
ATOM   3033 C CA  . ALA A 1 400 ? 20.375 17.028  -1.261  1.00 44.08  ? 400  ALA A CA  1 
ATOM   3034 C C   . ALA A 1 400 ? 21.575 16.125  -1.640  1.00 43.72  ? 400  ALA A C   1 
ATOM   3035 O O   . ALA A 1 400 ? 21.698 15.019  -1.133  1.00 43.16  ? 400  ALA A O   1 
ATOM   3036 C CB  . ALA A 1 400 ? 19.206 16.827  -2.238  1.00 45.02  ? 400  ALA A CB  1 
ATOM   3037 N N   . VAL A 1 401 ? 22.443 16.601  -2.534  1.00 43.97  ? 401  VAL A N   1 
ATOM   3038 C CA  . VAL A 1 401 ? 23.644 15.862  -2.923  1.00 43.76  ? 401  VAL A CA  1 
ATOM   3039 C C   . VAL A 1 401 ? 24.515 15.563  -1.699  1.00 43.05  ? 401  VAL A C   1 
ATOM   3040 O O   . VAL A 1 401 ? 24.843 14.401  -1.434  1.00 42.97  ? 401  VAL A O   1 
ATOM   3041 C CB  . VAL A 1 401 ? 24.463 16.620  -4.019  1.00 44.32  ? 401  VAL A CB  1 
ATOM   3042 C CG1 . VAL A 1 401 ? 25.907 16.102  -4.102  1.00 42.03  ? 401  VAL A CG1 1 
ATOM   3043 C CG2 . VAL A 1 401 ? 23.759 16.533  -5.377  1.00 44.24  ? 401  VAL A CG2 1 
ATOM   3044 N N   . VAL A 1 402 ? 24.856 16.608  -0.946  1.00 42.50  ? 402  VAL A N   1 
ATOM   3045 C CA  . VAL A 1 402 ? 25.717 16.468  0.224   1.00 41.70  ? 402  VAL A CA  1 
ATOM   3046 C C   . VAL A 1 402 ? 25.033 15.659  1.330   1.00 42.06  ? 402  VAL A C   1 
ATOM   3047 O O   . VAL A 1 402 ? 25.683 14.813  1.981   1.00 41.97  ? 402  VAL A O   1 
ATOM   3048 C CB  . VAL A 1 402 ? 26.176 17.836  0.761   1.00 41.17  ? 402  VAL A CB  1 
ATOM   3049 C CG1 . VAL A 1 402 ? 26.894 17.681  2.084   1.00 38.04  ? 402  VAL A CG1 1 
ATOM   3050 C CG2 . VAL A 1 402 ? 27.061 18.525  -0.272  1.00 40.91  ? 402  VAL A CG2 1 
ATOM   3051 N N   . GLY A 1 403 ? 23.735 15.920  1.527   1.00 42.10  ? 403  GLY A N   1 
ATOM   3052 C CA  . GLY A 1 403 ? 22.913 15.173  2.480   1.00 41.81  ? 403  GLY A CA  1 
ATOM   3053 C C   . GLY A 1 403 ? 22.860 13.687  2.163   1.00 42.54  ? 403  GLY A C   1 
ATOM   3054 O O   . GLY A 1 403 ? 23.097 12.854  3.046   1.00 42.32  ? 403  GLY A O   1 
ATOM   3055 N N   . ASP A 1 404 ? 22.574 13.355  0.901   1.00 43.31  ? 404  ASP A N   1 
ATOM   3056 C CA  . ASP A 1 404 ? 22.384 11.969  0.472   1.00 44.33  ? 404  ASP A CA  1 
ATOM   3057 C C   . ASP A 1 404 ? 23.667 11.156  0.499   1.00 44.31  ? 404  ASP A C   1 
ATOM   3058 O O   . ASP A 1 404 ? 23.665 9.982   0.862   1.00 44.85  ? 404  ASP A O   1 
ATOM   3059 C CB  . ASP A 1 404 ? 21.812 11.904  -0.942  1.00 45.42  ? 404  ASP A CB  1 
ATOM   3060 C CG  . ASP A 1 404 ? 20.376 12.405  -1.030  1.00 47.40  ? 404  ASP A CG  1 
ATOM   3061 O OD1 . ASP A 1 404 ? 19.751 12.666  0.028   1.00 47.76  ? 404  ASP A OD1 1 
ATOM   3062 O OD2 . ASP A 1 404 ? 19.871 12.539  -2.175  1.00 49.02  ? 404  ASP A OD2 1 
ATOM   3063 N N   . HIS A 1 405 ? 24.761 11.781  0.092   1.00 43.97  ? 405  HIS A N   1 
ATOM   3064 C CA  . HIS A 1 405 ? 26.016 11.078  -0.100  1.00 43.73  ? 405  HIS A CA  1 
ATOM   3065 C C   . HIS A 1 405 ? 26.710 10.788  1.230   1.00 43.20  ? 405  HIS A C   1 
ATOM   3066 O O   . HIS A 1 405 ? 27.347 9.746   1.377   1.00 44.05  ? 405  HIS A O   1 
ATOM   3067 C CB  . HIS A 1 405 ? 26.884 11.904  -1.044  1.00 43.39  ? 405  HIS A CB  1 
ATOM   3068 C CG  . HIS A 1 405 ? 28.338 11.559  -1.024  1.00 42.21  ? 405  HIS A CG  1 
ATOM   3069 N ND1 . HIS A 1 405 ? 28.827 10.356  -1.486  1.00 41.17  ? 405  HIS A ND1 1 
ATOM   3070 C CD2 . HIS A 1 405 ? 29.418 12.296  -0.671  1.00 40.90  ? 405  HIS A CD2 1 
ATOM   3071 C CE1 . HIS A 1 405 ? 30.143 10.354  -1.388  1.00 41.51  ? 405  HIS A CE1 1 
ATOM   3072 N NE2 . HIS A 1 405 ? 30.527 11.522  -0.900  1.00 41.86  ? 405  HIS A NE2 1 
ATOM   3073 N N   . ASN A 1 406 ? 26.556 11.687  2.202   1.00 42.20  ? 406  ASN A N   1 
ATOM   3074 C CA  . ASN A 1 406 ? 27.267 11.581  3.478   1.00 41.13  ? 406  ASN A CA  1 
ATOM   3075 C C   . ASN A 1 406 ? 26.486 10.923  4.611   1.00 40.96  ? 406  ASN A C   1 
ATOM   3076 O O   . ASN A 1 406 ? 27.076 10.286  5.494   1.00 40.96  ? 406  ASN A O   1 
ATOM   3077 C CB  . ASN A 1 406 ? 27.735 12.957  3.937   1.00 40.20  ? 406  ASN A CB  1 
ATOM   3078 C CG  . ASN A 1 406 ? 28.861 13.497  3.093   1.00 40.60  ? 406  ASN A CG  1 
ATOM   3079 O OD1 . ASN A 1 406 ? 29.950 12.908  3.021   1.00 41.00  ? 406  ASN A OD1 1 
ATOM   3080 N ND2 . ASN A 1 406 ? 28.614 14.628  2.450   1.00 39.63  ? 406  ASN A ND2 1 
ATOM   3081 N N   . VAL A 1 407 ? 25.169 11.100  4.605   1.00 41.09  ? 407  VAL A N   1 
ATOM   3082 C CA  . VAL A 1 407 ? 24.338 10.606  5.694   1.00 40.75  ? 407  VAL A CA  1 
ATOM   3083 C C   . VAL A 1 407 ? 23.260 9.649   5.219   1.00 42.13  ? 407  VAL A C   1 
ATOM   3084 O O   . VAL A 1 407 ? 23.267 8.484   5.605   1.00 42.96  ? 407  VAL A O   1 
ATOM   3085 C CB  . VAL A 1 407 ? 23.683 11.753  6.514   1.00 40.24  ? 407  VAL A CB  1 
ATOM   3086 C CG1 . VAL A 1 407 ? 22.847 11.170  7.659   1.00 39.12  ? 407  VAL A CG1 1 
ATOM   3087 C CG2 . VAL A 1 407 ? 24.737 12.714  7.049   1.00 37.78  ? 407  VAL A CG2 1 
ATOM   3088 N N   . VAL A 1 408 ? 22.350 10.127  4.373   1.00 42.74  ? 408  VAL A N   1 
ATOM   3089 C CA  . VAL A 1 408 ? 21.127 9.378   4.093   1.00 43.84  ? 408  VAL A CA  1 
ATOM   3090 C C   . VAL A 1 408 ? 21.394 8.016   3.446   1.00 45.34  ? 408  VAL A C   1 
ATOM   3091 O O   . VAL A 1 408 ? 20.824 7.000   3.869   1.00 46.21  ? 408  VAL A O   1 
ATOM   3092 C CB  . VAL A 1 408 ? 20.087 10.204  3.289   1.00 44.19  ? 408  VAL A CB  1 
ATOM   3093 C CG1 . VAL A 1 408 ? 18.838 9.358   2.983   1.00 44.50  ? 408  VAL A CG1 1 
ATOM   3094 C CG2 . VAL A 1 408 ? 19.697 11.457  4.063   1.00 42.86  ? 408  VAL A CG2 1 
ATOM   3095 N N   . CYS A 1 409 ? 22.261 7.978   2.442   1.00 45.71  ? 409  CYS A N   1 
ATOM   3096 C CA  . CYS A 1 409 ? 22.504 6.705   1.759   1.00 47.40  ? 409  CYS A CA  1 
ATOM   3097 C C   . CYS A 1 409 ? 23.402 5.714   2.527   1.00 47.36  ? 409  CYS A C   1 
ATOM   3098 O O   . CYS A 1 409 ? 23.139 4.509   2.481   1.00 48.84  ? 409  CYS A O   1 
ATOM   3099 C CB  . CYS A 1 409 ? 22.924 6.911   0.305   1.00 47.67  ? 409  CYS A CB  1 
ATOM   3100 S SG  . CYS A 1 409 ? 21.599 7.719   -0.650  1.00 49.27  ? 409  CYS A SG  1 
ATOM   3101 N N   . PRO A 1 410 ? 24.460 6.202   3.215   1.00 46.10  ? 410  PRO A N   1 
ATOM   3102 C CA  . PRO A 1 410 ? 25.119 5.360   4.218   1.00 45.83  ? 410  PRO A CA  1 
ATOM   3103 C C   . PRO A 1 410 ? 24.165 4.751   5.260   1.00 46.22  ? 410  PRO A C   1 
ATOM   3104 O O   . PRO A 1 410 ? 24.270 3.549   5.559   1.00 47.29  ? 410  PRO A O   1 
ATOM   3105 C CB  . PRO A 1 410 ? 26.107 6.321   4.880   1.00 44.59  ? 410  PRO A CB  1 
ATOM   3106 C CG  . PRO A 1 410 ? 26.451 7.280   3.794   1.00 44.36  ? 410  PRO A CG  1 
ATOM   3107 C CD  . PRO A 1 410 ? 25.163 7.491   3.048   1.00 45.07  ? 410  PRO A CD  1 
ATOM   3108 N N   . VAL A 1 411 ? 23.249 5.551   5.807   1.00 45.48  ? 411  VAL A N   1 
ATOM   3109 C CA  . VAL A 1 411 ? 22.211 5.015   6.699   1.00 45.58  ? 411  VAL A CA  1 
ATOM   3110 C C   . VAL A 1 411 ? 21.360 3.925   6.019   1.00 47.43  ? 411  VAL A C   1 
ATOM   3111 O O   . VAL A 1 411 ? 21.146 2.843   6.593   1.00 48.44  ? 411  VAL A O   1 
ATOM   3112 C CB  . VAL A 1 411 ? 21.318 6.127   7.290   1.00 45.07  ? 411  VAL A CB  1 
ATOM   3113 C CG1 . VAL A 1 411 ? 20.043 5.539   7.928   1.00 44.65  ? 411  VAL A CG1 1 
ATOM   3114 C CG2 . VAL A 1 411 ? 22.103 6.953   8.305   1.00 42.81  ? 411  VAL A CG2 1 
ATOM   3115 N N   . ALA A 1 412 ? 20.900 4.192   4.799   1.00 47.86  ? 412  ALA A N   1 
ATOM   3116 C CA  . ALA A 1 412 ? 20.103 3.214   4.058   1.00 49.69  ? 412  ALA A CA  1 
ATOM   3117 C C   . ALA A 1 412 ? 20.882 1.920   3.839   1.00 50.86  ? 412  ALA A C   1 
ATOM   3118 O O   . ALA A 1 412 ? 20.352 0.833   4.067   1.00 52.35  ? 412  ALA A O   1 
ATOM   3119 C CB  . ALA A 1 412 ? 19.614 3.788   2.737   1.00 49.99  ? 412  ALA A CB  1 
ATOM   3120 N N   . GLN A 1 413 ? 22.141 2.029   3.420   1.00 50.67  ? 413  GLN A N   1 
ATOM   3121 C CA  . GLN A 1 413 ? 22.989 0.848   3.311   1.00 52.07  ? 413  GLN A CA  1 
ATOM   3122 C C   . GLN A 1 413 ? 23.104 0.112   4.662   1.00 52.05  ? 413  GLN A C   1 
ATOM   3123 O O   . GLN A 1 413 ? 22.921 -1.104  4.717   1.00 53.26  ? 413  GLN A O   1 
ATOM   3124 C CB  . GLN A 1 413 ? 24.369 1.192   2.758   1.00 51.46  ? 413  GLN A CB  1 
ATOM   3125 C CG  . GLN A 1 413 ? 25.204 -0.031  2.475   1.00 54.73  ? 413  GLN A CG  1 
ATOM   3126 C CD  . GLN A 1 413 ? 25.409 -0.288  0.999   1.00 60.73  ? 413  GLN A CD  1 
ATOM   3127 O OE1 . GLN A 1 413 ? 24.622 -1.014  0.318   1.00 62.98  ? 413  GLN A OE1 1 
ATOM   3128 N NE2 . GLN A 1 413 ? 26.484 0.308   0.472   1.00 60.95  ? 413  GLN A NE2 1 
ATOM   3129 N N   . LEU A 1 414 ? 23.389 0.848   5.740   1.00 50.53  ? 414  LEU A N   1 
ATOM   3130 C CA  . LEU A 1 414 ? 23.500 0.250   7.069   1.00 50.24  ? 414  LEU A CA  1 
ATOM   3131 C C   . LEU A 1 414 ? 22.229 -0.520  7.467   1.00 51.44  ? 414  LEU A C   1 
ATOM   3132 O O   . LEU A 1 414 ? 22.306 -1.714  7.774   1.00 52.39  ? 414  LEU A O   1 
ATOM   3133 C CB  . LEU A 1 414 ? 23.859 1.298   8.120   1.00 48.70  ? 414  LEU A CB  1 
ATOM   3134 C CG  . LEU A 1 414 ? 24.284 0.795   9.510   1.00 49.45  ? 414  LEU A CG  1 
ATOM   3135 C CD1 . LEU A 1 414 ? 25.608 0.032   9.450   1.00 51.22  ? 414  LEU A CD1 1 
ATOM   3136 C CD2 . LEU A 1 414 ? 24.404 1.943   10.495  1.00 47.64  ? 414  LEU A CD2 1 
ATOM   3137 N N   . ALA A 1 415 ? 21.072 0.150   7.435   1.00 51.08  ? 415  ALA A N   1 
ATOM   3138 C CA  . ALA A 1 415 ? 19.789 -0.500  7.757   1.00 52.03  ? 415  ALA A CA  1 
ATOM   3139 C C   . ALA A 1 415 ? 19.563 -1.785  6.938   1.00 54.00  ? 415  ALA A C   1 
ATOM   3140 O O   . ALA A 1 415 ? 19.148 -2.809  7.482   1.00 55.13  ? 415  ALA A O   1 
ATOM   3141 C CB  . ALA A 1 415 ? 18.627 0.470   7.581   1.00 51.16  ? 415  ALA A CB  1 
ATOM   3142 N N   . GLY A 1 416 ? 19.860 -1.721  5.642   1.00 54.48  ? 416  GLY A N   1 
ATOM   3143 C CA  . GLY A 1 416 ? 19.740 -2.862  4.738   1.00 56.67  ? 416  GLY A CA  1 
ATOM   3144 C C   . GLY A 1 416 ? 20.645 -4.028  5.096   1.00 57.84  ? 416  GLY A C   1 
ATOM   3145 O O   . GLY A 1 416 ? 20.195 -5.175  5.155   1.00 59.58  ? 416  GLY A O   1 
ATOM   3146 N N   . ARG A 1 417 ? 21.919 -3.742  5.353   1.00 56.96  ? 417  ARG A N   1 
ATOM   3147 C CA  . ARG A 1 417 ? 22.874 -4.802  5.644   1.00 58.30  ? 417  ARG A CA  1 
ATOM   3148 C C   . ARG A 1 417 ? 22.628 -5.464  7.005   1.00 58.46  ? 417  ARG A C   1 
ATOM   3149 O O   . ARG A 1 417 ? 22.697 -6.694  7.118   1.00 60.17  ? 417  ARG A O   1 
ATOM   3150 C CB  . ARG A 1 417 ? 24.320 -4.321  5.497   1.00 57.49  ? 417  ARG A CB  1 
ATOM   3151 C CG  . ARG A 1 417 ? 24.731 -3.909  4.068   1.00 60.29  ? 417  ARG A CG  1 
ATOM   3152 C CD  . ARG A 1 417 ? 24.404 -4.964  3.007   1.00 67.62  ? 417  ARG A CD  1 
ATOM   3153 N NE  . ARG A 1 417 ? 24.953 -6.280  3.338   1.00 73.48  ? 417  ARG A NE  1 
ATOM   3154 C CZ  . ARG A 1 417 ? 24.476 -7.442  2.885   1.00 77.92  ? 417  ARG A CZ  1 
ATOM   3155 N NH1 . ARG A 1 417 ? 23.422 -7.472  2.067   1.00 79.55  ? 417  ARG A NH1 1 
ATOM   3156 N NH2 . ARG A 1 417 ? 25.052 -8.583  3.260   1.00 78.96  ? 417  ARG A NH2 1 
ATOM   3157 N N   . LEU A 1 418 ? 22.318 -4.661  8.020   1.00 56.80  ? 418  LEU A N   1 
ATOM   3158 C CA  . LEU A 1 418 ? 22.001 -5.195  9.342   1.00 56.82  ? 418  LEU A CA  1 
ATOM   3159 C C   . LEU A 1 418 ? 20.717 -6.036  9.305   1.00 58.58  ? 418  LEU A C   1 
ATOM   3160 O O   . LEU A 1 418 ? 20.668 -7.121  9.875   1.00 59.65  ? 418  LEU A O   1 
ATOM   3161 C CB  . LEU A 1 418 ? 21.911 -4.081  10.401  1.00 54.98  ? 418  LEU A CB  1 
ATOM   3162 C CG  . LEU A 1 418 ? 23.089 -3.121  10.650  1.00 52.90  ? 418  LEU A CG  1 
ATOM   3163 C CD1 . LEU A 1 418 ? 22.684 -2.052  11.636  1.00 50.23  ? 418  LEU A CD1 1 
ATOM   3164 C CD2 . LEU A 1 418 ? 24.353 -3.821  11.135  1.00 53.11  ? 418  LEU A CD2 1 
ATOM   3165 N N   . ALA A 1 419 ? 19.694 -5.551  8.611   1.00 58.97  ? 419  ALA A N   1 
ATOM   3166 C CA  . ALA A 1 419 ? 18.436 -6.295  8.489   1.00 60.99  ? 419  ALA A CA  1 
ATOM   3167 C C   . ALA A 1 419 ? 18.638 -7.634  7.764   1.00 63.53  ? 419  ALA A C   1 
ATOM   3168 O O   . ALA A 1 419 ? 18.040 -8.650  8.128   1.00 65.17  ? 419  ALA A O   1 
ATOM   3169 C CB  . ALA A 1 419 ? 17.379 -5.453  7.782   1.00 60.43  ? 419  ALA A CB  1 
ATOM   3170 N N   . ALA A 1 420 ? 19.487 -7.626  6.740   1.00 63.92  ? 420  ALA A N   1 
ATOM   3171 C CA  . ALA A 1 420 ? 19.765 -8.826  5.958   1.00 66.48  ? 420  ALA A CA  1 
ATOM   3172 C C   . ALA A 1 420 ? 20.594 -9.821  6.759   1.00 67.57  ? 420  ALA A C   1 
ATOM   3173 O O   . ALA A 1 420 ? 20.574 -11.017 6.483   1.00 69.88  ? 420  ALA A O   1 
ATOM   3174 C CB  . ALA A 1 420 ? 20.476 -8.464  4.658   1.00 66.09  ? 420  ALA A CB  1 
ATOM   3175 N N   . GLN A 1 421 ? 21.318 -9.309  7.748   1.00 66.53  ? 421  GLN A N   1 
ATOM   3176 C CA  . GLN A 1 421 ? 22.199 -10.112 8.589   1.00 67.55  ? 421  GLN A CA  1 
ATOM   3177 C C   . GLN A 1 421 ? 21.615 -10.439 9.976   1.00 67.48  ? 421  GLN A C   1 
ATOM   3178 O O   . GLN A 1 421 ? 22.352 -10.831 10.888  1.00 67.50  ? 421  GLN A O   1 
ATOM   3179 C CB  . GLN A 1 421 ? 23.572 -9.430  8.720   1.00 66.18  ? 421  GLN A CB  1 
ATOM   3180 C CG  . GLN A 1 421 ? 24.656 -10.086 7.870   1.00 69.11  ? 421  GLN A CG  1 
ATOM   3181 C CD  . GLN A 1 421 ? 24.664 -9.608  6.438   1.00 71.49  ? 421  GLN A CD  1 
ATOM   3182 O OE1 . GLN A 1 421 ? 24.262 -10.337 5.531   1.00 73.91  ? 421  GLN A OE1 1 
ATOM   3183 N NE2 . GLN A 1 421 ? 25.126 -8.376  6.223   1.00 70.17  ? 421  GLN A NE2 1 
ATOM   3184 N N   . GLY A 1 422 ? 20.305 -10.258 10.136  1.00 67.51  ? 422  GLY A N   1 
ATOM   3185 C CA  . GLY A 1 422 ? 19.593 -10.773 11.307  1.00 67.92  ? 422  GLY A CA  1 
ATOM   3186 C C   . GLY A 1 422 ? 19.195 -9.813  12.412  1.00 65.98  ? 422  GLY A C   1 
ATOM   3187 O O   . GLY A 1 422 ? 18.523 -10.217 13.367  1.00 67.05  ? 422  GLY A O   1 
ATOM   3188 N N   . ALA A 1 423 ? 19.597 -8.551  12.285  1.00 63.39  ? 423  ALA A N   1 
ATOM   3189 C CA  . ALA A 1 423 ? 19.303 -7.516  13.283  1.00 61.18  ? 423  ALA A CA  1 
ATOM   3190 C C   . ALA A 1 423 ? 17.832 -7.129  13.302  1.00 61.25  ? 423  ALA A C   1 
ATOM   3191 O O   . ALA A 1 423 ? 17.110 -7.358  12.330  1.00 62.16  ? 423  ALA A O   1 
ATOM   3192 C CB  . ALA A 1 423 ? 20.161 -6.280  13.027  1.00 58.86  ? 423  ALA A CB  1 
ATOM   3193 N N   . ARG A 1 424 ? 17.391 -6.555  14.419  1.00 59.99  ? 424  ARG A N   1 
ATOM   3194 C CA  . ARG A 1 424 ? 16.102 -5.888  14.463  1.00 59.73  ? 424  ARG A CA  1 
ATOM   3195 C C   . ARG A 1 424 ? 16.346 -4.386  14.371  1.00 56.57  ? 424  ARG A C   1 
ATOM   3196 O O   . ARG A 1 424 ? 16.959 -3.793  15.258  1.00 54.84  ? 424  ARG A O   1 
ATOM   3197 C CB  . ARG A 1 424 ? 15.322 -6.253  15.726  1.00 61.19  ? 424  ARG A CB  1 
ATOM   3198 C CG  . ARG A 1 424 ? 14.028 -5.453  15.883  1.00 64.24  ? 424  ARG A CG  1 
ATOM   3199 C CD  . ARG A 1 424 ? 12.939 -6.229  16.603  1.00 71.70  ? 424  ARG A CD  1 
ATOM   3200 N NE  . ARG A 1 424 ? 13.161 -6.298  18.051  1.00 75.68  ? 424  ARG A NE  1 
ATOM   3201 C CZ  . ARG A 1 424 ? 13.089 -7.420  18.773  1.00 79.20  ? 424  ARG A CZ  1 
ATOM   3202 N NH1 . ARG A 1 424 ? 12.792 -8.579  18.189  1.00 80.70  ? 424  ARG A NH1 1 
ATOM   3203 N NH2 . ARG A 1 424 ? 13.299 -7.380  20.086  1.00 79.49  ? 424  ARG A NH2 1 
ATOM   3204 N N   . VAL A 1 425 ? 15.861 -3.790  13.286  1.00 55.65  ? 425  VAL A N   1 
ATOM   3205 C CA  . VAL A 1 425 ? 16.155 -2.404  12.924  1.00 52.79  ? 425  VAL A CA  1 
ATOM   3206 C C   . VAL A 1 425 ? 14.873 -1.578  12.888  1.00 52.72  ? 425  VAL A C   1 
ATOM   3207 O O   . VAL A 1 425 ? 13.865 -2.023  12.335  1.00 53.97  ? 425  VAL A O   1 
ATOM   3208 C CB  . VAL A 1 425 ? 16.796 -2.328  11.515  1.00 52.67  ? 425  VAL A CB  1 
ATOM   3209 C CG1 . VAL A 1 425 ? 17.169 -0.882  11.161  1.00 50.50  ? 425  VAL A CG1 1 
ATOM   3210 C CG2 . VAL A 1 425 ? 18.003 -3.257  11.402  1.00 52.00  ? 425  VAL A CG2 1 
ATOM   3211 N N   . TYR A 1 426 ? 14.915 -0.380  13.474  1.00 50.71  ? 426  TYR A N   1 
ATOM   3212 C CA  . TYR A 1 426 ? 13.824 0.593   13.338  1.00 50.29  ? 426  TYR A CA  1 
ATOM   3213 C C   . TYR A 1 426 ? 14.370 1.859   12.694  1.00 48.83  ? 426  TYR A C   1 
ATOM   3214 O O   . TYR A 1 426 ? 15.432 2.362   13.085  1.00 47.17  ? 426  TYR A O   1 
ATOM   3215 C CB  . TYR A 1 426 ? 13.185 0.917   14.687  1.00 50.08  ? 426  TYR A CB  1 
ATOM   3216 C CG  . TYR A 1 426 ? 12.501 -0.252  15.339  1.00 51.92  ? 426  TYR A CG  1 
ATOM   3217 C CD1 . TYR A 1 426 ? 13.194 -1.091  16.218  1.00 51.89  ? 426  TYR A CD1 1 
ATOM   3218 C CD2 . TYR A 1 426 ? 11.155 -0.534  15.076  1.00 53.77  ? 426  TYR A CD2 1 
ATOM   3219 C CE1 . TYR A 1 426 ? 12.559 -2.186  16.816  1.00 53.35  ? 426  TYR A CE1 1 
ATOM   3220 C CE2 . TYR A 1 426 ? 10.518 -1.624  15.657  1.00 54.55  ? 426  TYR A CE2 1 
ATOM   3221 C CZ  . TYR A 1 426 ? 11.223 -2.441  16.529  1.00 55.08  ? 426  TYR A CZ  1 
ATOM   3222 O OH  . TYR A 1 426 ? 10.588 -3.512  17.114  1.00 57.81  ? 426  TYR A OH  1 
ATOM   3223 N N   . ALA A 1 427 ? 13.638 2.370   11.710  1.00 49.27  ? 427  ALA A N   1 
ATOM   3224 C CA  . ALA A 1 427 ? 14.116 3.465   10.889  1.00 48.52  ? 427  ALA A CA  1 
ATOM   3225 C C   . ALA A 1 427 ? 13.172 4.658   10.942  1.00 49.06  ? 427  ALA A C   1 
ATOM   3226 O O   . ALA A 1 427 ? 11.943 4.482   10.917  1.00 51.17  ? 427  ALA A O   1 
ATOM   3227 C CB  . ALA A 1 427 ? 14.295 2.992   9.462   1.00 49.15  ? 427  ALA A CB  1 
ATOM   3228 N N   . TYR A 1 428 ? 13.733 5.866   11.025  1.00 47.65  ? 428  TYR A N   1 
ATOM   3229 C CA  . TYR A 1 428 ? 12.918 7.085   11.026  1.00 48.03  ? 428  TYR A CA  1 
ATOM   3230 C C   . TYR A 1 428 ? 13.478 8.156   10.095  1.00 47.81  ? 428  TYR A C   1 
ATOM   3231 O O   . TYR A 1 428 ? 14.654 8.134   9.736   1.00 46.90  ? 428  TYR A O   1 
ATOM   3232 C CB  . TYR A 1 428 ? 12.769 7.662   12.448  1.00 46.87  ? 428  TYR A CB  1 
ATOM   3233 C CG  . TYR A 1 428 ? 14.065 8.196   13.020  1.00 45.48  ? 428  TYR A CG  1 
ATOM   3234 C CD1 . TYR A 1 428 ? 14.509 9.497   12.727  1.00 43.49  ? 428  TYR A CD1 1 
ATOM   3235 C CD2 . TYR A 1 428 ? 14.864 7.398   13.840  1.00 43.82  ? 428  TYR A CD2 1 
ATOM   3236 C CE1 . TYR A 1 428 ? 15.715 9.976   13.236  1.00 41.12  ? 428  TYR A CE1 1 
ATOM   3237 C CE2 . TYR A 1 428 ? 16.064 7.871   14.358  1.00 42.13  ? 428  TYR A CE2 1 
ATOM   3238 C CZ  . TYR A 1 428 ? 16.486 9.156   14.054  1.00 41.72  ? 428  TYR A CZ  1 
ATOM   3239 O OH  . TYR A 1 428 ? 17.685 9.608   14.564  1.00 40.68  ? 428  TYR A OH  1 
ATOM   3240 N N   . ILE A 1 429 ? 12.615 9.091   9.705   1.00 49.05  ? 429  ILE A N   1 
ATOM   3241 C CA  . ILE A 1 429 ? 13.049 10.376  9.170   1.00 48.43  ? 429  ILE A CA  1 
ATOM   3242 C C   . ILE A 1 429 ? 12.409 11.456  10.056  1.00 48.83  ? 429  ILE A C   1 
ATOM   3243 O O   . ILE A 1 429 ? 11.184 11.457  10.255  1.00 50.14  ? 429  ILE A O   1 
ATOM   3244 C CB  . ILE A 1 429 ? 12.659 10.540  7.686   1.00 49.36  ? 429  ILE A CB  1 
ATOM   3245 C CG1 . ILE A 1 429 ? 13.182 11.871  7.125   1.00 48.38  ? 429  ILE A CG1 1 
ATOM   3246 C CG2 . ILE A 1 429 ? 11.147 10.418  7.501   1.00 50.91  ? 429  ILE A CG2 1 
ATOM   3247 C CD1 . ILE A 1 429 ? 13.102 11.965  5.596   1.00 48.50  ? 429  ILE A CD1 1 
ATOM   3248 N N   . PHE A 1 430 ? 13.237 12.342  10.607  1.00 47.48  ? 430  PHE A N   1 
ATOM   3249 C CA  . PHE A 1 430 ? 12.779 13.421  11.483  1.00 47.82  ? 430  PHE A CA  1 
ATOM   3250 C C   . PHE A 1 430 ? 12.513 14.669  10.650  1.00 48.68  ? 430  PHE A C   1 
ATOM   3251 O O   . PHE A 1 430 ? 13.411 15.157  9.975   1.00 48.24  ? 430  PHE A O   1 
ATOM   3252 C CB  . PHE A 1 430 ? 13.850 13.715  12.529  1.00 46.33  ? 430  PHE A CB  1 
ATOM   3253 C CG  . PHE A 1 430 ? 13.438 14.707  13.567  1.00 46.30  ? 430  PHE A CG  1 
ATOM   3254 C CD1 . PHE A 1 430 ? 13.658 16.066  13.378  1.00 45.53  ? 430  PHE A CD1 1 
ATOM   3255 C CD2 . PHE A 1 430 ? 12.851 14.285  14.753  1.00 46.67  ? 430  PHE A CD2 1 
ATOM   3256 C CE1 . PHE A 1 430 ? 13.278 16.994  14.353  1.00 45.38  ? 430  PHE A CE1 1 
ATOM   3257 C CE2 . PHE A 1 430 ? 12.474 15.212  15.728  1.00 47.12  ? 430  PHE A CE2 1 
ATOM   3258 C CZ  . PHE A 1 430 ? 12.689 16.564  15.525  1.00 45.69  ? 430  PHE A CZ  1 
ATOM   3259 N N   . GLU A 1 431 ? 11.289 15.190  10.699  1.00 50.39  ? 431  GLU A N   1 
ATOM   3260 C CA  . GLU A 1 431 ? 10.880 16.236  9.763   1.00 51.51  ? 431  GLU A CA  1 
ATOM   3261 C C   . GLU A 1 431 ? 10.396 17.551  10.385  1.00 51.89  ? 431  GLU A C   1 
ATOM   3262 O O   . GLU A 1 431 ? 9.835  18.397  9.680   1.00 52.52  ? 431  GLU A O   1 
ATOM   3263 C CB  . GLU A 1 431 ? 9.776  15.713  8.849   1.00 53.23  ? 431  GLU A CB  1 
ATOM   3264 C CG  . GLU A 1 431 ? 10.133 14.491  8.060   1.00 55.06  ? 431  GLU A CG  1 
ATOM   3265 C CD  . GLU A 1 431 ? 9.089  14.170  7.009   1.00 59.35  ? 431  GLU A CD  1 
ATOM   3266 O OE1 . GLU A 1 431 ? 7.889  14.030  7.361   1.00 59.97  ? 431  GLU A OE1 1 
ATOM   3267 O OE2 . GLU A 1 431 ? 9.483  14.059  5.826   1.00 61.49  ? 431  GLU A OE2 1 
ATOM   3268 N N   . HIS A 1 432 ? 10.592 17.735  11.685  1.00 51.45  ? 432  HIS A N   1 
ATOM   3269 C CA  . HIS A 1 432 ? 10.058 18.931  12.330  1.00 52.30  ? 432  HIS A CA  1 
ATOM   3270 C C   . HIS A 1 432 ? 11.100 20.024  12.543  1.00 51.33  ? 432  HIS A C   1 
ATOM   3271 O O   . HIS A 1 432 ? 12.100 19.807  13.225  1.00 49.83  ? 432  HIS A O   1 
ATOM   3272 C CB  . HIS A 1 432 ? 9.358  18.591  13.643  1.00 52.92  ? 432  HIS A CB  1 
ATOM   3273 C CG  . HIS A 1 432 ? 8.882  19.797  14.394  1.00 54.34  ? 432  HIS A CG  1 
ATOM   3274 N ND1 . HIS A 1 432 ? 7.901  20.638  13.909  1.00 55.48  ? 432  HIS A ND1 1 
ATOM   3275 C CD2 . HIS A 1 432 ? 9.267  20.315  15.584  1.00 53.44  ? 432  HIS A CD2 1 
ATOM   3276 C CE1 . HIS A 1 432 ? 7.695  21.614  14.773  1.00 55.41  ? 432  HIS A CE1 1 
ATOM   3277 N NE2 . HIS A 1 432 ? 8.506  21.437  15.801  1.00 54.86  ? 432  HIS A NE2 1 
ATOM   3278 N N   . ARG A 1 433 ? 10.857 21.189  11.943  1.00 52.27  ? 433  ARG A N   1 
ATOM   3279 C CA  . ARG A 1 433 ? 11.708 22.358  12.150  1.00 52.45  ? 433  ARG A CA  1 
ATOM   3280 C C   . ARG A 1 433 ? 11.307 23.057  13.455  1.00 53.17  ? 433  ARG A C   1 
ATOM   3281 O O   . ARG A 1 433 ? 10.173 23.532  13.592  1.00 54.95  ? 433  ARG A O   1 
ATOM   3282 C CB  . ARG A 1 433 ? 11.653 23.326  10.952  1.00 52.63  ? 433  ARG A CB  1 
ATOM   3283 C CG  . ARG A 1 433 ? 12.175 24.734  11.270  1.00 54.34  ? 433  ARG A CG  1 
ATOM   3284 C CD  . ARG A 1 433 ? 12.064 25.754  10.122  1.00 54.66  ? 433  ARG A CD  1 
ATOM   3285 N NE  . ARG A 1 433 ? 13.358 25.870  9.483   1.00 57.52  ? 433  ARG A NE  1 
ATOM   3286 C CZ  . ARG A 1 433 ? 14.204 26.889  9.614   1.00 58.70  ? 433  ARG A CZ  1 
ATOM   3287 N NH1 . ARG A 1 433 ? 13.886 27.964  10.327  1.00 58.19  ? 433  ARG A NH1 1 
ATOM   3288 N NH2 . ARG A 1 433 ? 15.376 26.829  8.986   1.00 58.33  ? 433  ARG A NH2 1 
ATOM   3289 N N   . ALA A 1 434 ? 12.245 23.110  14.402  1.00 52.07  ? 434  ALA A N   1 
ATOM   3290 C CA  . ALA A 1 434 ? 12.050 23.797  15.667  1.00 52.73  ? 434  ALA A CA  1 
ATOM   3291 C C   . ALA A 1 434 ? 11.562 25.211  15.403  1.00 54.31  ? 434  ALA A C   1 
ATOM   3292 O O   . ALA A 1 434 ? 12.072 25.890  14.506  1.00 54.15  ? 434  ALA A O   1 
ATOM   3293 C CB  . ALA A 1 434 ? 13.358 23.830  16.457  1.00 51.28  ? 434  ALA A CB  1 
ATOM   3294 N N   . SER A 1 435 ? 10.571 25.654  16.172  1.00 56.07  ? 435  SER A N   1 
ATOM   3295 C CA  . SER A 1 435 ? 10.072 27.026  16.042  1.00 58.03  ? 435  SER A CA  1 
ATOM   3296 C C   . SER A 1 435 ? 11.130 28.047  16.484  1.00 57.69  ? 435  SER A C   1 
ATOM   3297 O O   . SER A 1 435 ? 11.071 29.205  16.089  1.00 58.60  ? 435  SER A O   1 
ATOM   3298 C CB  . SER A 1 435 ? 8.775  27.216  16.829  1.00 59.59  ? 435  SER A CB  1 
ATOM   3299 O OG  . SER A 1 435 ? 9.030  27.232  18.220  1.00 60.31  ? 435  SER A OG  1 
ATOM   3300 N N   . THR A 1 436 ? 12.097 27.597  17.284  1.00 56.44  ? 436  THR A N   1 
ATOM   3301 C CA  . THR A 1 436 ? 13.151 28.462  17.829  1.00 56.51  ? 436  THR A CA  1 
ATOM   3302 C C   . THR A 1 436 ? 14.420 28.529  16.976  1.00 55.21  ? 436  THR A C   1 
ATOM   3303 O O   . THR A 1 436 ? 15.384 29.185  17.370  1.00 55.23  ? 436  THR A O   1 
ATOM   3304 C CB  . THR A 1 436 ? 13.599 27.997  19.237  1.00 55.86  ? 436  THR A CB  1 
ATOM   3305 O OG1 . THR A 1 436 ? 14.044 26.635  19.170  1.00 55.69  ? 436  THR A OG1 1 
ATOM   3306 C CG2 . THR A 1 436 ? 12.469 28.105  20.235  1.00 57.17  ? 436  THR A CG2 1 
ATOM   3307 N N   . LEU A 1 437 ? 14.431 27.846  15.831  1.00 54.43  ? 437  LEU A N   1 
ATOM   3308 C CA  . LEU A 1 437 ? 15.607 27.785  14.952  1.00 53.10  ? 437  LEU A CA  1 
ATOM   3309 C C   . LEU A 1 437 ? 16.022 29.162  14.429  1.00 53.63  ? 437  LEU A C   1 
ATOM   3310 O O   . LEU A 1 437 ? 15.174 29.971  14.024  1.00 55.06  ? 437  LEU A O   1 
ATOM   3311 C CB  . LEU A 1 437 ? 15.331 26.836  13.780  1.00 52.98  ? 437  LEU A CB  1 
ATOM   3312 C CG  . LEU A 1 437 ? 16.446 25.973  13.169  1.00 52.54  ? 437  LEU A CG  1 
ATOM   3313 C CD1 . LEU A 1 437 ? 17.660 25.831  14.051  1.00 52.67  ? 437  LEU A CD1 1 
ATOM   3314 C CD2 . LEU A 1 437 ? 15.894 24.600  12.881  1.00 53.75  ? 437  LEU A CD2 1 
ATOM   3315 N N   . THR A 1 438 ? 17.326 29.421  14.444  1.00 52.43  ? 438  THR A N   1 
ATOM   3316 C CA  . THR A 1 438 ? 17.864 30.722  14.038  1.00 52.77  ? 438  THR A CA  1 
ATOM   3317 C C   . THR A 1 438 ? 18.478 30.672  12.650  1.00 52.49  ? 438  THR A C   1 
ATOM   3318 O O   . THR A 1 438 ? 18.786 31.722  12.070  1.00 53.64  ? 438  THR A O   1 
ATOM   3319 C CB  . THR A 1 438 ? 18.916 31.257  15.037  1.00 52.56  ? 438  THR A CB  1 
ATOM   3320 O OG1 . THR A 1 438 ? 19.915 30.251  15.274  1.00 50.16  ? 438  THR A OG1 1 
ATOM   3321 C CG2 . THR A 1 438 ? 18.249 31.642  16.356  1.00 52.50  ? 438  THR A CG2 1 
ATOM   3322 N N   . TRP A 1 439 ? 18.665 29.455  12.128  1.00 51.02  ? 439  TRP A N   1 
ATOM   3323 C CA  . TRP A 1 439 ? 19.098 29.242  10.751  1.00 50.00  ? 439  TRP A CA  1 
ATOM   3324 C C   . TRP A 1 439 ? 17.963 29.662  9.826   1.00 51.36  ? 439  TRP A C   1 
ATOM   3325 O O   . TRP A 1 439 ? 16.793 29.558  10.208  1.00 51.97  ? 439  TRP A O   1 
ATOM   3326 C CB  . TRP A 1 439 ? 19.445 27.777  10.514  1.00 48.28  ? 439  TRP A CB  1 
ATOM   3327 C CG  . TRP A 1 439 ? 20.687 27.325  11.206  1.00 46.69  ? 439  TRP A CG  1 
ATOM   3328 C CD1 . TRP A 1 439 ? 20.764 26.560  12.329  1.00 45.70  ? 439  TRP A CD1 1 
ATOM   3329 C CD2 . TRP A 1 439 ? 22.039 27.610  10.824  1.00 46.22  ? 439  TRP A CD2 1 
ATOM   3330 N NE1 . TRP A 1 439 ? 22.075 26.359  12.683  1.00 44.23  ? 439  TRP A NE1 1 
ATOM   3331 C CE2 . TRP A 1 439 ? 22.880 26.991  11.773  1.00 45.36  ? 439  TRP A CE2 1 
ATOM   3332 C CE3 . TRP A 1 439 ? 22.621 28.337  9.778   1.00 45.29  ? 439  TRP A CE3 1 
ATOM   3333 C CZ2 . TRP A 1 439 ? 24.277 27.071  11.702  1.00 45.11  ? 439  TRP A CZ2 1 
ATOM   3334 C CZ3 . TRP A 1 439 ? 23.995 28.409  9.700   1.00 45.04  ? 439  TRP A CZ3 1 
ATOM   3335 C CH2 . TRP A 1 439 ? 24.813 27.781  10.658  1.00 45.50  ? 439  TRP A CH2 1 
ATOM   3336 N N   . PRO A 1 440 ? 18.295 30.152  8.613   1.00 51.89  ? 440  PRO A N   1 
ATOM   3337 C CA  . PRO A 1 440 ? 17.251 30.626  7.702   1.00 53.37  ? 440  PRO A CA  1 
ATOM   3338 C C   . PRO A 1 440 ? 16.354 29.487  7.232   1.00 53.43  ? 440  PRO A C   1 
ATOM   3339 O O   . PRO A 1 440 ? 16.777 28.324  7.252   1.00 52.41  ? 440  PRO A O   1 
ATOM   3340 C CB  . PRO A 1 440 ? 18.042 31.207  6.519   1.00 53.44  ? 440  PRO A CB  1 
ATOM   3341 C CG  . PRO A 1 440 ? 19.343 30.534  6.559   1.00 52.15  ? 440  PRO A CG  1 
ATOM   3342 C CD  . PRO A 1 440 ? 19.637 30.278  8.016   1.00 51.35  ? 440  PRO A CD  1 
ATOM   3343 N N   . LEU A 1 441 ? 15.141 29.834  6.806   1.00 54.86  ? 441  LEU A N   1 
ATOM   3344 C CA  . LEU A 1 441 ? 14.144 28.865  6.384   1.00 55.53  ? 441  LEU A CA  1 
ATOM   3345 C C   . LEU A 1 441 ? 14.588 27.891  5.291   1.00 54.51  ? 441  LEU A C   1 
ATOM   3346 O O   . LEU A 1 441 ? 14.205 26.721  5.339   1.00 54.58  ? 441  LEU A O   1 
ATOM   3347 C CB  . LEU A 1 441 ? 12.859 29.570  5.943   1.00 57.97  ? 441  LEU A CB  1 
ATOM   3348 C CG  . LEU A 1 441 ? 11.904 30.024  7.047   1.00 60.55  ? 441  LEU A CG  1 
ATOM   3349 C CD1 . LEU A 1 441 ? 10.904 31.046  6.488   1.00 64.18  ? 441  LEU A CD1 1 
ATOM   3350 C CD2 . LEU A 1 441 ? 11.183 28.826  7.684   1.00 60.82  ? 441  LEU A CD2 1 
ATOM   3351 N N   . TRP A 1 442 ? 15.376 28.353  4.315   1.00 53.72  ? 442  TRP A N   1 
ATOM   3352 C CA  . TRP A 1 442 ? 15.776 27.478  3.200   1.00 52.70  ? 442  TRP A CA  1 
ATOM   3353 C C   . TRP A 1 442 ? 16.522 26.220  3.655   1.00 51.15  ? 442  TRP A C   1 
ATOM   3354 O O   . TRP A 1 442 ? 16.487 25.198  2.980   1.00 50.81  ? 442  TRP A O   1 
ATOM   3355 C CB  . TRP A 1 442 ? 16.556 28.224  2.107   1.00 52.40  ? 442  TRP A CB  1 
ATOM   3356 C CG  . TRP A 1 442 ? 17.953 28.678  2.464   1.00 51.35  ? 442  TRP A CG  1 
ATOM   3357 C CD1 . TRP A 1 442 ? 18.333 29.938  2.859   1.00 52.14  ? 442  TRP A CD1 1 
ATOM   3358 C CD2 . TRP A 1 442 ? 19.160 27.899  2.411   1.00 49.93  ? 442  TRP A CD2 1 
ATOM   3359 N NE1 . TRP A 1 442 ? 19.694 29.983  3.073   1.00 50.98  ? 442  TRP A NE1 1 
ATOM   3360 C CE2 . TRP A 1 442 ? 20.225 28.748  2.808   1.00 49.33  ? 442  TRP A CE2 1 
ATOM   3361 C CE3 . TRP A 1 442 ? 19.446 26.563  2.078   1.00 48.72  ? 442  TRP A CE3 1 
ATOM   3362 C CZ2 . TRP A 1 442 ? 21.542 28.303  2.889   1.00 47.60  ? 442  TRP A CZ2 1 
ATOM   3363 C CZ3 . TRP A 1 442 ? 20.760 26.128  2.148   1.00 47.43  ? 442  TRP A CZ3 1 
ATOM   3364 C CH2 . TRP A 1 442 ? 21.790 26.995  2.557   1.00 47.84  ? 442  TRP A CH2 1 
ATOM   3365 N N   . MET A 1 443 ? 17.174 26.295  4.810   1.00 50.20  ? 443  MET A N   1 
ATOM   3366 C CA  . MET A 1 443 ? 17.954 25.169  5.316   1.00 48.80  ? 443  MET A CA  1 
ATOM   3367 C C   . MET A 1 443 ? 17.104 24.041  5.886   1.00 48.13  ? 443  MET A C   1 
ATOM   3368 O O   . MET A 1 443 ? 17.653 23.034  6.349   1.00 47.18  ? 443  MET A O   1 
ATOM   3369 C CB  . MET A 1 443 ? 18.965 25.634  6.355   1.00 48.00  ? 443  MET A CB  1 
ATOM   3370 C CG  . MET A 1 443 ? 20.120 26.410  5.774   1.00 47.85  ? 443  MET A CG  1 
ATOM   3371 S SD  . MET A 1 443 ? 21.420 26.582  7.006   1.00 48.55  ? 443  MET A SD  1 
ATOM   3372 C CE  . MET A 1 443 ? 22.209 28.064  6.430   1.00 49.50  ? 443  MET A CE  1 
ATOM   3373 N N   . GLY A 1 444 ? 15.779 24.209  5.853   1.00 48.52  ? 444  GLY A N   1 
ATOM   3374 C CA  . GLY A 1 444 ? 14.847 23.168  6.281   1.00 47.93  ? 444  GLY A CA  1 
ATOM   3375 C C   . GLY A 1 444 ? 15.072 22.707  7.703   1.00 46.86  ? 444  GLY A C   1 
ATOM   3376 O O   . GLY A 1 444 ? 15.112 23.523  8.616   1.00 46.99  ? 444  GLY A O   1 
ATOM   3377 N N   . VAL A 1 445 ? 15.232 21.397  7.884   1.00 46.18  ? 445  VAL A N   1 
ATOM   3378 C CA  . VAL A 1 445 ? 15.493 20.796  9.201   1.00 45.03  ? 445  VAL A CA  1 
ATOM   3379 C C   . VAL A 1 445 ? 16.917 20.286  9.167   1.00 43.87  ? 445  VAL A C   1 
ATOM   3380 O O   . VAL A 1 445 ? 17.156 19.172  8.701   1.00 44.33  ? 445  VAL A O   1 
ATOM   3381 C CB  . VAL A 1 445 ? 14.541 19.592  9.510   1.00 45.50  ? 445  VAL A CB  1 
ATOM   3382 C CG1 . VAL A 1 445 ? 14.900 18.955  10.865  1.00 44.63  ? 445  VAL A CG1 1 
ATOM   3383 C CG2 . VAL A 1 445 ? 13.068 20.006  9.472   1.00 45.27  ? 445  VAL A CG2 1 
ATOM   3384 N N   . PRO A 1 446 ? 17.878 21.103  9.618   1.00 43.25  ? 446  PRO A N   1 
ATOM   3385 C CA  . PRO A 1 446 ? 19.291 20.792  9.398   1.00 42.07  ? 446  PRO A CA  1 
ATOM   3386 C C   . PRO A 1 446 ? 19.868 19.701  10.313  1.00 41.40  ? 446  PRO A C   1 
ATOM   3387 O O   . PRO A 1 446 ? 19.291 19.370  11.353  1.00 41.60  ? 446  PRO A O   1 
ATOM   3388 C CB  . PRO A 1 446 ? 19.994 22.135  9.665   1.00 41.64  ? 446  PRO A CB  1 
ATOM   3389 C CG  . PRO A 1 446 ? 18.886 23.160  9.801   1.00 42.95  ? 446  PRO A CG  1 
ATOM   3390 C CD  . PRO A 1 446 ? 17.720 22.383  10.322  1.00 43.93  ? 446  PRO A CD  1 
ATOM   3391 N N   . HIS A 1 447 ? 20.999 19.154  9.884   1.00 40.59  ? 447  HIS A N   1 
ATOM   3392 C CA  . HIS A 1 447 ? 21.810 18.222  10.634  1.00 40.25  ? 447  HIS A CA  1 
ATOM   3393 C C   . HIS A 1 447 ? 21.918 18.710  12.069  1.00 40.12  ? 447  HIS A C   1 
ATOM   3394 O O   . HIS A 1 447 ? 22.315 19.842  12.306  1.00 40.36  ? 447  HIS A O   1 
ATOM   3395 C CB  . HIS A 1 447 ? 23.194 18.211  9.977   1.00 40.00  ? 447  HIS A CB  1 
ATOM   3396 C CG  . HIS A 1 447 ? 24.101 17.111  10.433  1.00 40.05  ? 447  HIS A CG  1 
ATOM   3397 N ND1 . HIS A 1 447 ? 23.790 15.774  10.285  1.00 41.38  ? 447  HIS A ND1 1 
ATOM   3398 C CD2 . HIS A 1 447 ? 25.346 17.149  10.961  1.00 40.36  ? 447  HIS A CD2 1 
ATOM   3399 C CE1 . HIS A 1 447 ? 24.793 15.037  10.732  1.00 40.19  ? 447  HIS A CE1 1 
ATOM   3400 N NE2 . HIS A 1 447 ? 25.751 15.847  11.146  1.00 40.67  ? 447  HIS A NE2 1 
ATOM   3401 N N   . GLY A 1 448 ? 21.536 17.865  13.023  1.00 40.43  ? 448  GLY A N   1 
ATOM   3402 C CA  . GLY A 1 448 ? 21.696 18.164  14.443  1.00 40.10  ? 448  GLY A CA  1 
ATOM   3403 C C   . GLY A 1 448 ? 20.473 18.683  15.172  1.00 41.17  ? 448  GLY A C   1 
ATOM   3404 O O   . GLY A 1 448 ? 20.475 18.766  16.410  1.00 41.46  ? 448  GLY A O   1 
ATOM   3405 N N   . TYR A 1 449 ? 19.411 19.014  14.445  1.00 41.79  ? 449  TYR A N   1 
ATOM   3406 C CA  . TYR A 1 449 ? 18.283 19.683  15.106  1.00 42.82  ? 449  TYR A CA  1 
ATOM   3407 C C   . TYR A 1 449 ? 17.123 18.801  15.565  1.00 43.33  ? 449  TYR A C   1 
ATOM   3408 O O   . TYR A 1 449 ? 16.046 19.293  15.868  1.00 44.37  ? 449  TYR A O   1 
ATOM   3409 C CB  . TYR A 1 449 ? 17.861 20.957  14.355  1.00 43.31  ? 449  TYR A CB  1 
ATOM   3410 C CG  . TYR A 1 449 ? 18.941 22.017  14.505  1.00 43.63  ? 449  TYR A CG  1 
ATOM   3411 C CD1 . TYR A 1 449 ? 20.004 22.107  13.592  1.00 41.98  ? 449  TYR A CD1 1 
ATOM   3412 C CD2 . TYR A 1 449 ? 18.936 22.891  15.589  1.00 43.13  ? 449  TYR A CD2 1 
ATOM   3413 C CE1 . TYR A 1 449 ? 20.998 23.050  13.743  1.00 40.72  ? 449  TYR A CE1 1 
ATOM   3414 C CE2 . TYR A 1 449 ? 19.924 23.840  15.741  1.00 42.74  ? 449  TYR A CE2 1 
ATOM   3415 C CZ  . TYR A 1 449 ? 20.951 23.915  14.819  1.00 42.76  ? 449  TYR A CZ  1 
ATOM   3416 O OH  . TYR A 1 449 ? 21.945 24.859  14.997  1.00 44.56  ? 449  TYR A OH  1 
ATOM   3417 N N   . GLU A 1 450 ? 17.368 17.496  15.658  1.00 43.14  ? 450  GLU A N   1 
ATOM   3418 C CA  . GLU A 1 450 ? 16.432 16.593  16.338  1.00 43.83  ? 450  GLU A CA  1 
ATOM   3419 C C   . GLU A 1 450 ? 16.866 16.379  17.777  1.00 43.19  ? 450  GLU A C   1 
ATOM   3420 O O   . GLU A 1 450 ? 16.051 16.056  18.628  1.00 44.45  ? 450  GLU A O   1 
ATOM   3421 C CB  . GLU A 1 450 ? 16.303 15.248  15.615  1.00 43.80  ? 450  GLU A CB  1 
ATOM   3422 C CG  . GLU A 1 450 ? 17.376 14.223  15.935  1.00 43.72  ? 450  GLU A CG  1 
ATOM   3423 C CD  . GLU A 1 450 ? 18.760 14.601  15.418  1.00 44.18  ? 450  GLU A CD  1 
ATOM   3424 O OE1 . GLU A 1 450 ? 19.001 15.790  15.107  1.00 43.82  ? 450  GLU A OE1 1 
ATOM   3425 O OE2 . GLU A 1 450 ? 19.616 13.693  15.324  1.00 44.82  ? 450  GLU A OE2 1 
ATOM   3426 N N   . ILE A 1 451 ? 18.149 16.586  18.041  1.00 42.01  ? 451  ILE A N   1 
ATOM   3427 C CA  . ILE A 1 451 ? 18.727 16.286  19.347  1.00 41.42  ? 451  ILE A CA  1 
ATOM   3428 C C   . ILE A 1 451 ? 17.958 16.945  20.492  1.00 42.38  ? 451  ILE A C   1 
ATOM   3429 O O   . ILE A 1 451 ? 17.597 16.262  21.456  1.00 43.49  ? 451  ILE A O   1 
ATOM   3430 C CB  . ILE A 1 451 ? 20.239 16.655  19.422  1.00 39.99  ? 451  ILE A CB  1 
ATOM   3431 C CG1 . ILE A 1 451 ? 21.010 15.987  18.282  1.00 39.30  ? 451  ILE A CG1 1 
ATOM   3432 C CG2 . ILE A 1 451 ? 20.810 16.252  20.752  1.00 38.31  ? 451  ILE A CG2 1 
ATOM   3433 C CD1 . ILE A 1 451 ? 22.516 16.260  18.294  1.00 39.78  ? 451  ILE A CD1 1 
ATOM   3434 N N   . GLU A 1 452 ? 17.709 18.251  20.386  1.00 42.36  ? 452  GLU A N   1 
ATOM   3435 C CA  . GLU A 1 452 ? 17.058 19.005  21.462  1.00 43.25  ? 452  GLU A CA  1 
ATOM   3436 C C   . GLU A 1 452 ? 15.673 18.437  21.810  1.00 44.03  ? 452  GLU A C   1 
ATOM   3437 O O   . GLU A 1 452 ? 15.215 18.557  22.949  1.00 44.97  ? 452  GLU A O   1 
ATOM   3438 C CB  . GLU A 1 452 ? 16.994 20.512  21.133  1.00 43.67  ? 452  GLU A CB  1 
ATOM   3439 C CG  . GLU A 1 452 ? 16.084 20.875  19.944  1.00 45.98  ? 452  GLU A CG  1 
ATOM   3440 C CD  . GLU A 1 452 ? 16.518 22.133  19.205  1.00 47.26  ? 452  GLU A CD  1 
ATOM   3441 O OE1 . GLU A 1 452 ? 15.730 23.079  19.138  1.00 49.21  ? 452  GLU A OE1 1 
ATOM   3442 O OE2 . GLU A 1 452 ? 17.649 22.193  18.690  1.00 49.36  ? 452  GLU A OE2 1 
ATOM   3443 N N   . PHE A 1 453 ? 15.022 17.804  20.837  1.00 43.70  ? 453  PHE A N   1 
ATOM   3444 C CA  . PHE A 1 453 ? 13.748 17.160  21.080  1.00 44.43  ? 453  PHE A CA  1 
ATOM   3445 C C   . PHE A 1 453 ? 13.877 15.822  21.792  1.00 44.43  ? 453  PHE A C   1 
ATOM   3446 O O   . PHE A 1 453 ? 13.096 15.547  22.705  1.00 45.41  ? 453  PHE A O   1 
ATOM   3447 C CB  . PHE A 1 453 ? 12.953 17.031  19.787  1.00 45.26  ? 453  PHE A CB  1 
ATOM   3448 C CG  . PHE A 1 453 ? 12.435 18.346  19.269  1.00 45.16  ? 453  PHE A CG  1 
ATOM   3449 C CD1 . PHE A 1 453 ? 11.237 18.863  19.732  1.00 44.50  ? 453  PHE A CD1 1 
ATOM   3450 C CD2 . PHE A 1 453 ? 13.166 19.077  18.349  1.00 44.22  ? 453  PHE A CD2 1 
ATOM   3451 C CE1 . PHE A 1 453 ? 10.768 20.080  19.276  1.00 45.80  ? 453  PHE A CE1 1 
ATOM   3452 C CE2 . PHE A 1 453 ? 12.699 20.295  17.878  1.00 45.37  ? 453  PHE A CE2 1 
ATOM   3453 C CZ  . PHE A 1 453 ? 11.491 20.797  18.344  1.00 46.20  ? 453  PHE A CZ  1 
ATOM   3454 N N   . ILE A 1 454 ? 14.857 15.007  21.388  1.00 43.31  ? 454  ILE A N   1 
ATOM   3455 C CA  . ILE A 1 454 ? 15.136 13.710  22.025  1.00 43.29  ? 454  ILE A CA  1 
ATOM   3456 C C   . ILE A 1 454 ? 15.507 13.879  23.493  1.00 43.50  ? 454  ILE A C   1 
ATOM   3457 O O   . ILE A 1 454 ? 15.164 13.046  24.317  1.00 44.10  ? 454  ILE A O   1 
ATOM   3458 C CB  . ILE A 1 454 ? 16.313 12.950  21.327  1.00 42.68  ? 454  ILE A CB  1 
ATOM   3459 C CG1 . ILE A 1 454 ? 16.091 12.792  19.810  1.00 42.86  ? 454  ILE A CG1 1 
ATOM   3460 C CG2 . ILE A 1 454 ? 16.613 11.606  22.010  1.00 41.46  ? 454  ILE A CG2 1 
ATOM   3461 C CD1 . ILE A 1 454 ? 14.919 11.981  19.442  1.00 45.62  ? 454  ILE A CD1 1 
ATOM   3462 N N   . PHE A 1 455 ? 16.237 14.945  23.809  1.00 43.37  ? 455  PHE A N   1 
ATOM   3463 C CA  . PHE A 1 455 ? 16.657 15.224  25.188  1.00 43.59  ? 455  PHE A CA  1 
ATOM   3464 C C   . PHE A 1 455 ? 15.574 15.943  26.006  1.00 45.32  ? 455  PHE A C   1 
ATOM   3465 O O   . PHE A 1 455 ? 15.700 16.071  27.231  1.00 45.76  ? 455  PHE A O   1 
ATOM   3466 C CB  . PHE A 1 455 ? 17.967 16.019  25.213  1.00 42.44  ? 455  PHE A CB  1 
ATOM   3467 C CG  . PHE A 1 455 ? 19.205 15.165  25.109  1.00 41.24  ? 455  PHE A CG  1 
ATOM   3468 C CD1 . PHE A 1 455 ? 19.675 14.746  23.876  1.00 40.65  ? 455  PHE A CD1 1 
ATOM   3469 C CD2 . PHE A 1 455 ? 19.910 14.800  26.247  1.00 41.23  ? 455  PHE A CD2 1 
ATOM   3470 C CE1 . PHE A 1 455 ? 20.824 13.954  23.771  1.00 40.18  ? 455  PHE A CE1 1 
ATOM   3471 C CE2 . PHE A 1 455 ? 21.065 14.014  26.160  1.00 41.30  ? 455  PHE A CE2 1 
ATOM   3472 C CZ  . PHE A 1 455 ? 21.518 13.587  24.913  1.00 40.78  ? 455  PHE A CZ  1 
ATOM   3473 N N   . GLY A 1 456 ? 14.520 16.408  25.330  1.00 46.16  ? 456  GLY A N   1 
ATOM   3474 C CA  . GLY A 1 456 ? 13.365 16.967  26.010  1.00 48.00  ? 456  GLY A CA  1 
ATOM   3475 C C   . GLY A 1 456 ? 13.496 18.426  26.415  1.00 49.02  ? 456  GLY A C   1 
ATOM   3476 O O   . GLY A 1 456 ? 12.775 18.899  27.303  1.00 49.85  ? 456  GLY A O   1 
ATOM   3477 N N   . LEU A 1 457 ? 14.399 19.155  25.760  1.00 48.68  ? 457  LEU A N   1 
ATOM   3478 C CA  . LEU A 1 457 ? 14.567 20.586  26.044  1.00 49.56  ? 457  LEU A CA  1 
ATOM   3479 C C   . LEU A 1 457 ? 13.276 21.433  25.956  1.00 51.68  ? 457  LEU A C   1 
ATOM   3480 O O   . LEU A 1 457 ? 13.112 22.349  26.748  1.00 52.62  ? 457  LEU A O   1 
ATOM   3481 C CB  . LEU A 1 457 ? 15.704 21.197  25.220  1.00 48.25  ? 457  LEU A CB  1 
ATOM   3482 C CG  . LEU A 1 457 ? 17.107 21.185  25.847  1.00 47.38  ? 457  LEU A CG  1 
ATOM   3483 C CD1 . LEU A 1 457 ? 17.731 19.782  25.892  1.00 46.04  ? 457  LEU A CD1 1 
ATOM   3484 C CD2 . LEU A 1 457 ? 18.033 22.153  25.123  1.00 46.07  ? 457  LEU A CD2 1 
ATOM   3485 N N   . PRO A 1 458 ? 12.348 21.121  25.019  1.00 52.86  ? 458  PRO A N   1 
ATOM   3486 C CA  . PRO A 1 458 ? 11.097 21.894  24.991  1.00 55.08  ? 458  PRO A CA  1 
ATOM   3487 C C   . PRO A 1 458 ? 10.252 21.844  26.268  1.00 57.18  ? 458  PRO A C   1 
ATOM   3488 O O   . PRO A 1 458 ? 9.347  22.670  26.427  1.00 59.11  ? 458  PRO A O   1 
ATOM   3489 C CB  . PRO A 1 458 ? 10.325 21.270  23.817  1.00 55.09  ? 458  PRO A CB  1 
ATOM   3490 C CG  . PRO A 1 458 ? 11.384 20.716  22.939  1.00 53.32  ? 458  PRO A CG  1 
ATOM   3491 C CD  . PRO A 1 458 ? 12.371 20.133  23.923  1.00 52.14  ? 458  PRO A CD  1 
ATOM   3492 N N   . LEU A 1 459 ? 10.540 20.897  27.163  1.00 57.63  ? 459  LEU A N   1 
ATOM   3493 C CA  . LEU A 1 459 ? 9.801  20.764  28.431  1.00 59.44  ? 459  LEU A CA  1 
ATOM   3494 C C   . LEU A 1 459 ? 10.131 21.905  29.392  1.00 60.40  ? 459  LEU A C   1 
ATOM   3495 O O   . LEU A 1 459 ? 9.403  22.153  30.358  1.00 61.77  ? 459  LEU A O   1 
ATOM   3496 C CB  . LEU A 1 459 ? 10.087 19.419  29.105  1.00 58.72  ? 459  LEU A CB  1 
ATOM   3497 C CG  . LEU A 1 459 ? 9.626  18.108  28.465  1.00 58.91  ? 459  LEU A CG  1 
ATOM   3498 C CD1 . LEU A 1 459 ? 10.350 16.943  29.112  1.00 59.48  ? 459  LEU A CD1 1 
ATOM   3499 C CD2 . LEU A 1 459 ? 8.157  17.908  28.636  1.00 62.31  ? 459  LEU A CD2 1 
ATOM   3500 N N   . ASP A 1 460 ? 11.243 22.581  29.119  1.00 60.02  ? 460  ASP A N   1 
ATOM   3501 C CA  . ASP A 1 460 ? 11.662 23.742  29.876  1.00 61.65  ? 460  ASP A CA  1 
ATOM   3502 C C   . ASP A 1 460 ? 10.871 24.964  29.389  1.00 63.71  ? 460  ASP A C   1 
ATOM   3503 O O   . ASP A 1 460 ? 10.990 25.362  28.221  1.00 63.54  ? 460  ASP A O   1 
ATOM   3504 C CB  . ASP A 1 460 ? 13.167 23.954  29.687  1.00 60.33  ? 460  ASP A CB  1 
ATOM   3505 C CG  . ASP A 1 460 ? 13.744 25.002  30.625  1.00 61.43  ? 460  ASP A CG  1 
ATOM   3506 O OD1 . ASP A 1 460 ? 12.975 25.785  31.232  1.00 64.07  ? 460  ASP A OD1 1 
ATOM   3507 O OD2 . ASP A 1 460 ? 14.984 25.037  30.747  1.00 60.72  ? 460  ASP A OD2 1 
ATOM   3508 N N   . PRO A 1 461 ? 10.059 25.570  30.277  1.00 66.11  ? 461  PRO A N   1 
ATOM   3509 C CA  . PRO A 1 461 ? 9.159  26.638  29.796  1.00 68.02  ? 461  PRO A CA  1 
ATOM   3510 C C   . PRO A 1 461 ? 9.930  27.905  29.418  1.00 67.91  ? 461  PRO A C   1 
ATOM   3511 O O   . PRO A 1 461 ? 9.495  28.662  28.546  1.00 68.77  ? 461  PRO A O   1 
ATOM   3512 C CB  . PRO A 1 461 ? 8.230  26.890  30.987  1.00 69.93  ? 461  PRO A CB  1 
ATOM   3513 C CG  . PRO A 1 461 ? 9.012  26.445  32.190  1.00 69.33  ? 461  PRO A CG  1 
ATOM   3514 C CD  . PRO A 1 461 ? 9.939  25.343  31.731  1.00 67.07  ? 461  PRO A CD  1 
ATOM   3515 N N   . SER A 1 462 ? 11.085 28.096  30.047  1.00 66.83  ? 462  SER A N   1 
ATOM   3516 C CA  . SER A 1 462 ? 11.910 29.264  29.806  1.00 66.95  ? 462  SER A CA  1 
ATOM   3517 C C   . SER A 1 462 ? 12.614 29.252  28.436  1.00 65.64  ? 462  SER A C   1 
ATOM   3518 O O   . SER A 1 462 ? 13.391 30.165  28.149  1.00 65.68  ? 462  SER A O   1 
ATOM   3519 C CB  . SER A 1 462 ? 12.944 29.415  30.932  1.00 66.69  ? 462  SER A CB  1 
ATOM   3520 O OG  . SER A 1 462 ? 14.086 28.605  30.689  1.00 64.63  ? 462  SER A OG  1 
ATOM   3521 N N   . LEU A 1 463 ? 12.355 28.237  27.601  1.00 64.33  ? 463  LEU A N   1 
ATOM   3522 C CA  . LEU A 1 463 ? 13.019 28.143  26.290  1.00 62.58  ? 463  LEU A CA  1 
ATOM   3523 C C   . LEU A 1 463 ? 12.161 28.542  25.075  1.00 63.20  ? 463  LEU A C   1 
ATOM   3524 O O   . LEU A 1 463 ? 12.665 28.579  23.950  1.00 62.70  ? 463  LEU A O   1 
ATOM   3525 C CB  . LEU A 1 463 ? 13.688 26.779  26.077  1.00 60.56  ? 463  LEU A CB  1 
ATOM   3526 C CG  . LEU A 1 463 ? 14.918 26.441  26.928  1.00 59.69  ? 463  LEU A CG  1 
ATOM   3527 C CD1 . LEU A 1 463 ? 15.370 25.010  26.648  1.00 57.99  ? 463  LEU A CD1 1 
ATOM   3528 C CD2 . LEU A 1 463 ? 16.085 27.420  26.737  1.00 57.85  ? 463  LEU A CD2 1 
ATOM   3529 N N   . ASN A 1 464 ? 10.884 28.839  25.296  1.00 64.48  ? 464  ASN A N   1 
ATOM   3530 C CA  . ASN A 1 464 ? 10.021 29.441  24.252  1.00 65.21  ? 464  ASN A CA  1 
ATOM   3531 C C   . ASN A 1 464 ? 9.570  28.503  23.110  1.00 63.49  ? 464  ASN A C   1 
ATOM   3532 O O   . ASN A 1 464 ? 9.133  28.976  22.053  1.00 64.31  ? 464  ASN A O   1 
ATOM   3533 C CB  . ASN A 1 464 ? 10.642 30.746  23.676  1.00 65.73  ? 464  ASN A CB  1 
ATOM   3534 C CG  . ASN A 1 464 ? 10.715 31.886  24.705  1.00 68.59  ? 464  ASN A CG  1 
ATOM   3535 O OD1 . ASN A 1 464 ? 9.900  31.968  25.631  1.00 70.54  ? 464  ASN A OD1 1 
ATOM   3536 N ND2 . ASN A 1 464 ? 11.694 32.779  24.530  1.00 69.37  ? 464  ASN A ND2 1 
ATOM   3537 N N   . TYR A 1 465 ? 9.664  27.190  23.318  1.00 60.83  ? 465  TYR A N   1 
ATOM   3538 C CA  . TYR A 1 465 ? 9.066  26.223  22.385  1.00 59.28  ? 465  TYR A CA  1 
ATOM   3539 C C   . TYR A 1 465 ? 7.540  26.248  22.525  1.00 60.77  ? 465  TYR A C   1 
ATOM   3540 O O   . TYR A 1 465 ? 7.039  26.581  23.592  1.00 61.58  ? 465  TYR A O   1 
ATOM   3541 C CB  . TYR A 1 465 ? 9.565  24.802  22.661  1.00 57.00  ? 465  TYR A CB  1 
ATOM   3542 C CG  . TYR A 1 465 ? 11.030 24.540  22.401  1.00 54.60  ? 465  TYR A CG  1 
ATOM   3543 C CD1 . TYR A 1 465 ? 11.471 24.098  21.155  1.00 53.55  ? 465  TYR A CD1 1 
ATOM   3544 C CD2 . TYR A 1 465 ? 11.979 24.697  23.414  1.00 53.28  ? 465  TYR A CD2 1 
ATOM   3545 C CE1 . TYR A 1 465 ? 12.820 23.835  20.920  1.00 50.57  ? 465  TYR A CE1 1 
ATOM   3546 C CE2 . TYR A 1 465 ? 13.312 24.437  23.193  1.00 50.28  ? 465  TYR A CE2 1 
ATOM   3547 C CZ  . TYR A 1 465 ? 13.732 24.008  21.947  1.00 50.58  ? 465  TYR A CZ  1 
ATOM   3548 O OH  . TYR A 1 465 ? 15.072 23.747  21.729  1.00 49.15  ? 465  TYR A OH  1 
ATOM   3549 N N   . THR A 1 466 ? 6.814  25.884  21.462  1.00 61.17  ? 466  THR A N   1 
ATOM   3550 C CA  . THR A 1 466 ? 5.337  25.847  21.480  1.00 63.32  ? 466  THR A CA  1 
ATOM   3551 C C   . THR A 1 466 ? 4.821  24.673  22.283  1.00 63.59  ? 466  THR A C   1 
ATOM   3552 O O   . THR A 1 466 ? 5.549  23.732  22.538  1.00 62.37  ? 466  THR A O   1 
ATOM   3553 C CB  . THR A 1 466 ? 4.686  25.760  20.060  1.00 63.90  ? 466  THR A CB  1 
ATOM   3554 O OG1 . THR A 1 466 ? 5.003  24.502  19.443  1.00 62.34  ? 466  THR A OG1 1 
ATOM   3555 C CG2 . THR A 1 466 ? 5.117  26.912  19.166  1.00 63.56  ? 466  THR A CG2 1 
ATOM   3556 N N   . THR A 1 467 ? 3.550  24.731  22.663  1.00 66.15  ? 467  THR A N   1 
ATOM   3557 C CA  . THR A 1 467 ? 2.908  23.658  23.425  1.00 66.96  ? 467  THR A CA  1 
ATOM   3558 C C   . THR A 1 467 ? 2.930  22.303  22.688  1.00 66.20  ? 467  THR A C   1 
ATOM   3559 O O   . THR A 1 467 ? 3.166  21.253  23.301  1.00 65.25  ? 467  THR A O   1 
ATOM   3560 C CB  . THR A 1 467 ? 1.481  24.092  23.872  1.00 69.71  ? 467  THR A CB  1 
ATOM   3561 O OG1 . THR A 1 467 ? 1.585  24.822  25.101  1.00 70.09  ? 467  THR A OG1 1 
ATOM   3562 C CG2 . THR A 1 467 ? 0.554  22.894  24.090  1.00 70.82  ? 467  THR A CG2 1 
ATOM   3563 N N   . GLU A 1 468 ? 2.703  22.343  21.375  1.00 66.52  ? 468  GLU A N   1 
ATOM   3564 C CA  . GLU A 1 468 ? 2.744  21.148  20.535  1.00 66.14  ? 468  GLU A CA  1 
ATOM   3565 C C   . GLU A 1 468 ? 4.136  20.520  20.567  1.00 63.32  ? 468  GLU A C   1 
ATOM   3566 O O   . GLU A 1 468 ? 4.271  19.297  20.583  1.00 62.66  ? 468  GLU A O   1 
ATOM   3567 C CB  . GLU A 1 468 ? 2.334  21.488  19.097  1.00 66.99  ? 468  GLU A CB  1 
ATOM   3568 C CG  . GLU A 1 468 ? 0.840  21.818  18.916  1.00 72.45  ? 468  GLU A CG  1 
ATOM   3569 C CD  . GLU A 1 468 ? 0.422  23.192  19.491  1.00 76.60  ? 468  GLU A CD  1 
ATOM   3570 O OE1 . GLU A 1 468 ? 1.045  24.226  19.128  1.00 76.08  ? 468  GLU A OE1 1 
ATOM   3571 O OE2 . GLU A 1 468 ? -0.542 23.230  20.301  1.00 78.73  ? 468  GLU A OE2 1 
ATOM   3572 N N   . GLU A 1 469 ? 5.160  21.373  20.595  1.00 61.82  ? 469  GLU A N   1 
ATOM   3573 C CA  . GLU A 1 469 ? 6.555  20.943  20.691  1.00 59.47  ? 469  GLU A CA  1 
ATOM   3574 C C   . GLU A 1 469 ? 6.895  20.236  22.011  1.00 58.90  ? 469  GLU A C   1 
ATOM   3575 O O   . GLU A 1 469 ? 7.795  19.399  22.049  1.00 57.24  ? 469  GLU A O   1 
ATOM   3576 C CB  . GLU A 1 469 ? 7.505  22.118  20.409  1.00 58.35  ? 469  GLU A CB  1 
ATOM   3577 C CG  . GLU A 1 469 ? 7.622  22.436  18.915  1.00 58.31  ? 469  GLU A CG  1 
ATOM   3578 C CD  . GLU A 1 469 ? 8.424  23.689  18.608  1.00 58.09  ? 469  GLU A CD  1 
ATOM   3579 O OE1 . GLU A 1 469 ? 8.281  24.697  19.335  1.00 58.79  ? 469  GLU A OE1 1 
ATOM   3580 O OE2 . GLU A 1 469 ? 9.187  23.675  17.617  1.00 56.85  ? 469  GLU A OE2 1 
ATOM   3581 N N   . ARG A 1 470 ? 6.178  20.563  23.085  1.00 60.23  ? 470  ARG A N   1 
ATOM   3582 C CA  . ARG A 1 470 ? 6.314  19.817  24.334  1.00 60.66  ? 470  ARG A CA  1 
ATOM   3583 C C   . ARG A 1 470 ? 5.707  18.407  24.215  1.00 60.50  ? 470  ARG A C   1 
ATOM   3584 O O   . ARG A 1 470 ? 6.350  17.416  24.578  1.00 59.38  ? 470  ARG A O   1 
ATOM   3585 C CB  . ARG A 1 470 ? 5.717  20.590  25.520  1.00 62.76  ? 470  ARG A CB  1 
ATOM   3586 C CG  . ARG A 1 470 ? 6.641  21.669  26.085  1.00 65.34  ? 470  ARG A CG  1 
ATOM   3587 C CD  . ARG A 1 470 ? 5.885  22.769  26.863  1.00 73.17  ? 470  ARG A CD  1 
ATOM   3588 N NE  . ARG A 1 470 ? 6.570  24.069  26.756  1.00 75.96  ? 470  ARG A NE  1 
ATOM   3589 C CZ  . ARG A 1 470 ? 5.963  25.260  26.741  1.00 78.67  ? 470  ARG A CZ  1 
ATOM   3590 N NH1 . ARG A 1 470 ? 4.637  25.356  26.826  1.00 81.48  ? 470  ARG A NH1 1 
ATOM   3591 N NH2 . ARG A 1 470 ? 6.687  26.367  26.632  1.00 78.83  ? 470  ARG A NH2 1 
ATOM   3592 N N   . ILE A 1 471 ? 4.480  18.322  23.697  1.00 61.34  ? 471  ILE A N   1 
ATOM   3593 C CA  . ILE A 1 471 ? 3.812  17.033  23.475  1.00 61.34  ? 471  ILE A CA  1 
ATOM   3594 C C   . ILE A 1 471 ? 4.670  16.140  22.565  1.00 59.03  ? 471  ILE A C   1 
ATOM   3595 O O   . ILE A 1 471 ? 4.775  14.929  22.772  1.00 58.59  ? 471  ILE A O   1 
ATOM   3596 C CB  . ILE A 1 471 ? 2.365  17.246  22.922  1.00 63.70  ? 471  ILE A CB  1 
ATOM   3597 C CG1 . ILE A 1 471 ? 1.463  17.804  24.031  1.00 65.66  ? 471  ILE A CG1 1 
ATOM   3598 C CG2 . ILE A 1 471 ? 1.759  15.950  22.361  1.00 64.38  ? 471  ILE A CG2 1 
ATOM   3599 C CD1 . ILE A 1 471 ? 0.365  18.761  23.544  1.00 67.71  ? 471  ILE A CD1 1 
ATOM   3600 N N   . PHE A 1 472 ? 5.311  16.770  21.588  1.00 57.30  ? 472  PHE A N   1 
ATOM   3601 C CA  . PHE A 1 472 ? 6.137  16.082  20.608  1.00 55.27  ? 472  PHE A CA  1 
ATOM   3602 C C   . PHE A 1 472 ? 7.440  15.565  21.230  1.00 53.59  ? 472  PHE A C   1 
ATOM   3603 O O   . PHE A 1 472 ? 7.799  14.396  21.027  1.00 53.36  ? 472  PHE A O   1 
ATOM   3604 C CB  . PHE A 1 472 ? 6.385  17.008  19.418  1.00 54.34  ? 472  PHE A CB  1 
ATOM   3605 C CG  . PHE A 1 472 ? 7.274  16.435  18.361  1.00 52.71  ? 472  PHE A CG  1 
ATOM   3606 C CD1 . PHE A 1 472 ? 7.002  15.193  17.790  1.00 52.96  ? 472  PHE A CD1 1 
ATOM   3607 C CD2 . PHE A 1 472 ? 8.382  17.163  17.904  1.00 50.02  ? 472  PHE A CD2 1 
ATOM   3608 C CE1 . PHE A 1 472 ? 7.843  14.666  16.785  1.00 53.02  ? 472  PHE A CE1 1 
ATOM   3609 C CE2 . PHE A 1 472 ? 9.213  16.655  16.903  1.00 49.41  ? 472  PHE A CE2 1 
ATOM   3610 C CZ  . PHE A 1 472 ? 8.952  15.402  16.344  1.00 49.93  ? 472  PHE A CZ  1 
ATOM   3611 N N   . ALA A 1 473 ? 8.130  16.412  21.999  1.00 52.28  ? 473  ALA A N   1 
ATOM   3612 C CA  . ALA A 1 473 ? 9.336  15.982  22.707  1.00 51.01  ? 473  ALA A CA  1 
ATOM   3613 C C   . ALA A 1 473 ? 9.051  14.820  23.666  1.00 51.78  ? 473  ALA A C   1 
ATOM   3614 O O   . ALA A 1 473 ? 9.836  13.871  23.766  1.00 50.74  ? 473  ALA A O   1 
ATOM   3615 C CB  . ALA A 1 473 ? 9.988  17.139  23.433  1.00 50.10  ? 473  ALA A CB  1 
ATOM   3616 N N   . GLN A 1 474 ? 7.909  14.885  24.346  1.00 53.64  ? 474  GLN A N   1 
ATOM   3617 C CA  . GLN A 1 474 ? 7.492  13.809  25.238  1.00 54.77  ? 474  GLN A CA  1 
ATOM   3618 C C   . GLN A 1 474 ? 7.267  12.504  24.487  1.00 54.94  ? 474  GLN A C   1 
ATOM   3619 O O   . GLN A 1 474 ? 7.594  11.430  24.999  1.00 54.99  ? 474  GLN A O   1 
ATOM   3620 C CB  . GLN A 1 474 ? 6.238  14.194  26.010  1.00 56.76  ? 474  GLN A CB  1 
ATOM   3621 C CG  . GLN A 1 474 ? 6.476  15.283  27.025  1.00 58.35  ? 474  GLN A CG  1 
ATOM   3622 C CD  . GLN A 1 474 ? 5.251  15.575  27.850  1.00 62.33  ? 474  GLN A CD  1 
ATOM   3623 O OE1 . GLN A 1 474 ? 4.220  16.001  27.329  1.00 65.05  ? 474  GLN A OE1 1 
ATOM   3624 N NE2 . GLN A 1 474 ? 5.351  15.339  29.151  1.00 63.65  ? 474  GLN A NE2 1 
ATOM   3625 N N   . ARG A 1 475 ? 6.720  12.591  23.275  1.00 55.13  ? 475  ARG A N   1 
ATOM   3626 C CA  . ARG A 1 475 ? 6.558  11.400  22.444  1.00 55.38  ? 475  ARG A CA  1 
ATOM   3627 C C   . ARG A 1 475 ? 7.899  10.735  22.110  1.00 53.66  ? 475  ARG A C   1 
ATOM   3628 O O   . ARG A 1 475 ? 8.053  9.527   22.305  1.00 53.57  ? 475  ARG A O   1 
ATOM   3629 C CB  . ARG A 1 475 ? 5.801  11.727  21.162  1.00 56.11  ? 475  ARG A CB  1 
ATOM   3630 C CG  . ARG A 1 475 ? 4.415  11.148  21.095  1.00 57.96  ? 475  ARG A CG  1 
ATOM   3631 C CD  . ARG A 1 475 ? 3.723  11.655  19.839  1.00 58.26  ? 475  ARG A CD  1 
ATOM   3632 N NE  . ARG A 1 475 ? 4.262  11.050  18.626  1.00 55.63  ? 475  ARG A NE  1 
ATOM   3633 C CZ  . ARG A 1 475 ? 4.368  11.677  17.460  1.00 55.11  ? 475  ARG A CZ  1 
ATOM   3634 N NH1 . ARG A 1 475 ? 3.983  12.945  17.332  1.00 53.70  ? 475  ARG A NH1 1 
ATOM   3635 N NH2 . ARG A 1 475 ? 4.872  11.030  16.417  1.00 55.57  ? 475  ARG A NH2 1 
ATOM   3636 N N   . LEU A 1 476 ? 8.859  11.528  21.619  1.00 52.12  ? 476  LEU A N   1 
ATOM   3637 C CA  . LEU A 1 476 ? 10.168 11.008  21.221  1.00 50.64  ? 476  LEU A CA  1 
ATOM   3638 C C   . LEU A 1 476 ? 10.940 10.427  22.394  1.00 50.07  ? 476  LEU A C   1 
ATOM   3639 O O   . LEU A 1 476 ? 11.574 9.383   22.261  1.00 49.79  ? 476  LEU A O   1 
ATOM   3640 C CB  . LEU A 1 476 ? 11.011 12.084  20.530  1.00 49.55  ? 476  LEU A CB  1 
ATOM   3641 C CG  . LEU A 1 476 ? 10.435 12.774  19.297  1.00 49.91  ? 476  LEU A CG  1 
ATOM   3642 C CD1 . LEU A 1 476 ? 11.497 13.658  18.702  1.00 48.57  ? 476  LEU A CD1 1 
ATOM   3643 C CD2 . LEU A 1 476 ? 9.928  11.773  18.275  1.00 49.76  ? 476  LEU A CD2 1 
ATOM   3644 N N   . MET A 1 477 ? 10.883 11.099  23.541  1.00 50.17  ? 477  MET A N   1 
ATOM   3645 C CA  . MET A 1 477 ? 11.533 10.591  24.742  1.00 50.15  ? 477  MET A CA  1 
ATOM   3646 C C   . MET A 1 477 ? 10.984 9.213   25.086  1.00 50.83  ? 477  MET A C   1 
ATOM   3647 O O   . MET A 1 477 ? 11.730 8.342   25.521  1.00 50.37  ? 477  MET A O   1 
ATOM   3648 C CB  . MET A 1 477 ? 11.347 11.544  25.917  1.00 50.16  ? 477  MET A CB  1 
ATOM   3649 C CG  . MET A 1 477 ? 12.081 12.858  25.780  1.00 49.34  ? 477  MET A CG  1 
ATOM   3650 S SD  . MET A 1 477 ? 11.494 14.056  27.004  1.00 52.33  ? 477  MET A SD  1 
ATOM   3651 C CE  . MET A 1 477 ? 12.584 13.649  28.368  1.00 51.17  ? 477  MET A CE  1 
ATOM   3652 N N   . LYS A 1 478 ? 9.683  9.019   24.874  1.00 52.38  ? 478  LYS A N   1 
ATOM   3653 C CA  . LYS A 1 478 ? 9.066  7.710   25.084  1.00 53.78  ? 478  LYS A CA  1 
ATOM   3654 C C   . LYS A 1 478 ? 9.546  6.661   24.079  1.00 52.72  ? 478  LYS A C   1 
ATOM   3655 O O   . LYS A 1 478 ? 9.912  5.567   24.494  1.00 52.52  ? 478  LYS A O   1 
ATOM   3656 C CB  . LYS A 1 478 ? 7.523  7.773   25.191  1.00 55.93  ? 478  LYS A CB  1 
ATOM   3657 C CG  . LYS A 1 478 ? 7.047  8.549   26.416  1.00 58.56  ? 478  LYS A CG  1 
ATOM   3658 C CD  . LYS A 1 478 ? 5.705  8.073   26.972  1.00 65.10  ? 478  LYS A CD  1 
ATOM   3659 C CE  . LYS A 1 478 ? 5.878  7.076   28.146  1.00 67.98  ? 478  LYS A CE  1 
ATOM   3660 N NZ  . LYS A 1 478 ? 6.579  7.616   29.371  1.00 67.06  ? 478  LYS A NZ  1 
ATOM   3661 N N   . TYR A 1 479 ? 9.570  6.985   22.785  1.00 51.89  ? 479  TYR A N   1 
ATOM   3662 C CA  . TYR A 1 479 ? 10.123 6.048   21.797  1.00 51.64  ? 479  TYR A CA  1 
ATOM   3663 C C   . TYR A 1 479 ? 11.562 5.632   22.166  1.00 50.27  ? 479  TYR A C   1 
ATOM   3664 O O   . TYR A 1 479 ? 11.859 4.422   22.258  1.00 50.29  ? 479  TYR A O   1 
ATOM   3665 C CB  . TYR A 1 479 ? 10.121 6.627   20.379  1.00 51.25  ? 479  TYR A CB  1 
ATOM   3666 C CG  . TYR A 1 479 ? 8.769  6.929   19.781  1.00 52.86  ? 479  TYR A CG  1 
ATOM   3667 C CD1 . TYR A 1 479 ? 7.693  6.035   19.912  1.00 55.41  ? 479  TYR A CD1 1 
ATOM   3668 C CD2 . TYR A 1 479 ? 8.575  8.091   19.040  1.00 51.69  ? 479  TYR A CD2 1 
ATOM   3669 C CE1 . TYR A 1 479 ? 6.457  6.317   19.343  1.00 56.17  ? 479  TYR A CE1 1 
ATOM   3670 C CE2 . TYR A 1 479 ? 7.351  8.385   18.476  1.00 53.69  ? 479  TYR A CE2 1 
ATOM   3671 C CZ  . TYR A 1 479 ? 6.297  7.498   18.619  1.00 56.37  ? 479  TYR A CZ  1 
ATOM   3672 O OH  . TYR A 1 479 ? 5.080  7.814   18.047  1.00 58.61  ? 479  TYR A OH  1 
ATOM   3673 N N   . TRP A 1 480 ? 12.429 6.631   22.388  1.00 48.17  ? 480  TRP A N   1 
ATOM   3674 C CA  . TRP A 1 480 ? 13.839 6.393   22.711  1.00 47.30  ? 480  TRP A CA  1 
ATOM   3675 C C   . TRP A 1 480 ? 14.032 5.517   23.953  1.00 48.02  ? 480  TRP A C   1 
ATOM   3676 O O   . TRP A 1 480 ? 14.834 4.573   23.925  1.00 47.96  ? 480  TRP A O   1 
ATOM   3677 C CB  . TRP A 1 480 ? 14.637 7.710   22.839  1.00 45.60  ? 480  TRP A CB  1 
ATOM   3678 C CG  . TRP A 1 480 ? 15.458 8.085   21.610  1.00 44.41  ? 480  TRP A CG  1 
ATOM   3679 C CD1 . TRP A 1 480 ? 16.819 8.257   21.551  1.00 43.01  ? 480  TRP A CD1 1 
ATOM   3680 C CD2 . TRP A 1 480 ? 14.971 8.344   20.280  1.00 44.26  ? 480  TRP A CD2 1 
ATOM   3681 N NE1 . TRP A 1 480 ? 17.206 8.601   20.273  1.00 41.11  ? 480  TRP A NE1 1 
ATOM   3682 C CE2 . TRP A 1 480 ? 16.094 8.660   19.475  1.00 42.89  ? 480  TRP A CE2 1 
ATOM   3683 C CE3 . TRP A 1 480 ? 13.697 8.332   19.689  1.00 45.11  ? 480  TRP A CE3 1 
ATOM   3684 C CZ2 . TRP A 1 480 ? 15.978 8.953   18.113  1.00 43.27  ? 480  TRP A CZ2 1 
ATOM   3685 C CZ3 . TRP A 1 480 ? 13.581 8.626   18.343  1.00 44.77  ? 480  TRP A CZ3 1 
ATOM   3686 C CH2 . TRP A 1 480 ? 14.716 8.936   17.567  1.00 44.63  ? 480  TRP A CH2 1 
ATOM   3687 N N   . THR A 1 481 ? 13.297 5.815   25.027  1.00 49.00  ? 481  THR A N   1 
ATOM   3688 C CA  . THR A 1 481 ? 13.454 5.076   26.289  1.00 49.68  ? 481  THR A CA  1 
ATOM   3689 C C   . THR A 1 481 ? 12.715 3.748   26.313  1.00 51.26  ? 481  THR A C   1 
ATOM   3690 O O   . THR A 1 481 ? 13.127 2.843   27.034  1.00 52.15  ? 481  THR A O   1 
ATOM   3691 C CB  . THR A 1 481 ? 13.092 5.902   27.544  1.00 49.64  ? 481  THR A CB  1 
ATOM   3692 O OG1 . THR A 1 481 ? 11.755 6.394   27.432  1.00 52.06  ? 481  THR A OG1 1 
ATOM   3693 C CG2 . THR A 1 481 ? 14.033 7.070   27.701  1.00 48.90  ? 481  THR A CG2 1 
ATOM   3694 N N   . ASN A 1 482 ? 11.634 3.618   25.546  1.00 52.40  ? 482  ASN A N   1 
ATOM   3695 C CA  . ASN A 1 482 ? 10.997 2.307   25.374  1.00 53.92  ? 482  ASN A CA  1 
ATOM   3696 C C   . ASN A 1 482 ? 11.973 1.375   24.681  1.00 53.55  ? 482  ASN A C   1 
ATOM   3697 O O   . ASN A 1 482 ? 12.127 0.213   25.085  1.00 54.28  ? 482  ASN A O   1 
ATOM   3698 C CB  . ASN A 1 482 ? 9.710  2.394   24.556  1.00 55.11  ? 482  ASN A CB  1 
ATOM   3699 C CG  . ASN A 1 482 ? 8.542  2.910   25.361  1.00 56.86  ? 482  ASN A CG  1 
ATOM   3700 O OD1 . ASN A 1 482 ? 8.562  2.882   26.590  1.00 59.14  ? 482  ASN A OD1 1 
ATOM   3701 N ND2 . ASN A 1 482 ? 7.517  3.391   24.671  1.00 57.15  ? 482  ASN A ND2 1 
ATOM   3702 N N   . PHE A 1 483 ? 12.633 1.906   23.647  1.00 52.17  ? 483  PHE A N   1 
ATOM   3703 C CA  . PHE A 1 483 ? 13.636 1.168   22.895  1.00 51.81  ? 483  PHE A CA  1 
ATOM   3704 C C   . PHE A 1 483 ? 14.802 0.718   23.776  1.00 52.00  ? 483  PHE A C   1 
ATOM   3705 O O   . PHE A 1 483 ? 15.244 -0.440  23.691  1.00 52.43  ? 483  PHE A O   1 
ATOM   3706 C CB  . PHE A 1 483 ? 14.172 1.976   21.708  1.00 49.79  ? 483  PHE A CB  1 
ATOM   3707 C CG  . PHE A 1 483 ? 15.246 1.256   20.951  1.00 48.58  ? 483  PHE A CG  1 
ATOM   3708 C CD1 . PHE A 1 483 ? 14.920 0.229   20.069  1.00 47.52  ? 483  PHE A CD1 1 
ATOM   3709 C CD2 . PHE A 1 483 ? 16.587 1.557   21.161  1.00 46.07  ? 483  PHE A CD2 1 
ATOM   3710 C CE1 . PHE A 1 483 ? 15.907 -0.468  19.393  1.00 46.92  ? 483  PHE A CE1 1 
ATOM   3711 C CE2 . PHE A 1 483 ? 17.583 0.854   20.486  1.00 44.90  ? 483  PHE A CE2 1 
ATOM   3712 C CZ  . PHE A 1 483 ? 17.240 -0.154  19.595  1.00 45.88  ? 483  PHE A CZ  1 
ATOM   3713 N N   . ALA A 1 484 ? 15.308 1.642   24.600  1.00 51.70  ? 484  ALA A N   1 
ATOM   3714 C CA  . ALA A 1 484 ? 16.383 1.334   25.541  1.00 51.86  ? 484  ALA A CA  1 
ATOM   3715 C C   . ALA A 1 484 ? 15.955 0.191   26.456  1.00 54.08  ? 484  ALA A C   1 
ATOM   3716 O O   . ALA A 1 484 ? 16.698 -0.771  26.650  1.00 54.70  ? 484  ALA A O   1 
ATOM   3717 C CB  . ALA A 1 484 ? 16.749 2.554   26.348  1.00 50.47  ? 484  ALA A CB  1 
ATOM   3718 N N   . ARG A 1 485 ? 14.732 0.293   26.964  1.00 55.68  ? 485  ARG A N   1 
ATOM   3719 C CA  . ARG A 1 485 ? 14.187 -0.626  27.947  1.00 58.38  ? 485  ARG A CA  1 
ATOM   3720 C C   . ARG A 1 485 ? 13.945 -2.037  27.390  1.00 59.49  ? 485  ARG A C   1 
ATOM   3721 O O   . ARG A 1 485 ? 14.228 -3.019  28.063  1.00 60.08  ? 485  ARG A O   1 
ATOM   3722 C CB  . ARG A 1 485 ? 12.875 -0.046  28.497  1.00 58.92  ? 485  ARG A CB  1 
ATOM   3723 C CG  . ARG A 1 485 ? 12.527 -0.434  29.936  1.00 61.97  ? 485  ARG A CG  1 
ATOM   3724 C CD  . ARG A 1 485 ? 11.098 0.041   30.373  1.00 64.28  ? 485  ARG A CD  1 
ATOM   3725 N NE  . ARG A 1 485 ? 10.658 1.314   29.760  1.00 67.99  ? 485  ARG A NE  1 
ATOM   3726 C CZ  . ARG A 1 485 ? 11.099 2.531   30.093  1.00 67.52  ? 485  ARG A CZ  1 
ATOM   3727 N NH1 . ARG A 1 485 ? 12.015 2.685   31.049  1.00 67.02  ? 485  ARG A NH1 1 
ATOM   3728 N NH2 . ARG A 1 485 ? 10.624 3.604   29.457  1.00 67.67  ? 485  ARG A NH2 1 
ATOM   3729 N N   . THR A 1 486 ? 13.438 -2.126  26.160  1.00 60.04  ? 486  THR A N   1 
ATOM   3730 C CA  . THR A 1 486 ? 12.870 -3.375  25.642  1.00 61.84  ? 486  THR A CA  1 
ATOM   3731 C C   . THR A 1 486 ? 13.414 -3.823  24.282  1.00 61.63  ? 486  THR A C   1 
ATOM   3732 O O   . THR A 1 486 ? 13.213 -4.970  23.880  1.00 62.94  ? 486  THR A O   1 
ATOM   3733 C CB  . THR A 1 486 ? 11.331 -3.266  25.503  1.00 63.49  ? 486  THR A CB  1 
ATOM   3734 O OG1 . THR A 1 486 ? 11.015 -2.215  24.579  1.00 63.15  ? 486  THR A OG1 1 
ATOM   3735 C CG2 . THR A 1 486 ? 10.659 -2.985  26.850  1.00 63.23  ? 486  THR A CG2 1 
ATOM   3736 N N   . GLY A 1 487 ? 14.091 -2.922  23.578  1.00 60.19  ? 487  GLY A N   1 
ATOM   3737 C CA  . GLY A 1 487 ? 14.507 -3.171  22.201  1.00 60.13  ? 487  GLY A CA  1 
ATOM   3738 C C   . GLY A 1 487 ? 13.411 -2.841  21.208  1.00 61.20  ? 487  GLY A C   1 
ATOM   3739 O O   . GLY A 1 487 ? 13.499 -3.223  20.046  1.00 61.65  ? 487  GLY A O   1 
ATOM   3740 N N   . ASP A 1 488 ? 12.382 -2.125  21.668  1.00 61.99  ? 488  ASP A N   1 
ATOM   3741 C CA  . ASP A 1 488 ? 11.184 -1.838  20.875  1.00 63.58  ? 488  ASP A CA  1 
ATOM   3742 C C   . ASP A 1 488 ? 10.651 -0.442  21.225  1.00 63.44  ? 488  ASP A C   1 
ATOM   3743 O O   . ASP A 1 488 ? 10.312 -0.185  22.375  1.00 63.69  ? 488  ASP A O   1 
ATOM   3744 C CB  . ASP A 1 488 ? 10.125 -2.920  21.142  1.00 65.92  ? 488  ASP A CB  1 
ATOM   3745 C CG  . ASP A 1 488 ? 8.873  -2.780  20.270  1.00 67.36  ? 488  ASP A CG  1 
ATOM   3746 O OD1 . ASP A 1 488 ? 8.731  -1.788  19.529  1.00 66.49  ? 488  ASP A OD1 1 
ATOM   3747 O OD2 . ASP A 1 488 ? 8.008  -3.686  20.330  1.00 69.79  ? 488  ASP A OD2 1 
ATOM   3748 N N   . PRO A 1 489 ? 10.568 0.465   20.231  1.00 63.52  ? 489  PRO A N   1 
ATOM   3749 C CA  . PRO A 1 489 ? 10.117 1.836   20.482  1.00 63.79  ? 489  PRO A CA  1 
ATOM   3750 C C   . PRO A 1 489 ? 8.636  1.955   20.855  1.00 66.50  ? 489  PRO A C   1 
ATOM   3751 O O   . PRO A 1 489 ? 8.224  2.954   21.459  1.00 66.26  ? 489  PRO A O   1 
ATOM   3752 C CB  . PRO A 1 489 ? 10.389 2.536   19.149  1.00 62.79  ? 489  PRO A CB  1 
ATOM   3753 C CG  . PRO A 1 489 ? 10.312 1.437   18.136  1.00 63.29  ? 489  PRO A CG  1 
ATOM   3754 C CD  . PRO A 1 489 ? 10.911 0.258   18.812  1.00 63.39  ? 489  PRO A CD  1 
ATOM   3755 N N   . ASN A 1 490 ? 7.856  0.939   20.505  1.00 69.77  ? 490  ASN A N   1 
ATOM   3756 C CA  . ASN A 1 490 ? 6.411  0.972   20.683  1.00 73.19  ? 490  ASN A CA  1 
ATOM   3757 C C   . ASN A 1 490 ? 5.979  0.775   22.129  1.00 75.86  ? 490  ASN A C   1 
ATOM   3758 O O   . ASN A 1 490 ? 6.593  0.017   22.886  1.00 75.62  ? 490  ASN A O   1 
ATOM   3759 C CB  . ASN A 1 490 ? 5.747  -0.067  19.781  1.00 74.58  ? 490  ASN A CB  1 
ATOM   3760 C CG  . ASN A 1 490 ? 5.904  0.257   18.313  1.00 72.93  ? 490  ASN A CG  1 
ATOM   3761 O OD1 . ASN A 1 490 ? 5.284  1.194   17.805  1.00 71.91  ? 490  ASN A OD1 1 
ATOM   3762 N ND2 . ASN A 1 490 ? 6.735  -0.516  17.619  1.00 69.67  ? 490  ASN A ND2 1 
ATOM   3763 N N   . ASP A 1 491 ? 4.911  1.475   22.500  1.00 79.37  ? 491  ASP A N   1 
ATOM   3764 C CA  . ASP A 1 491 ? 4.341  1.383   23.837  1.00 82.71  ? 491  ASP A CA  1 
ATOM   3765 C C   . ASP A 1 491 ? 3.462  0.136   23.952  1.00 86.43  ? 491  ASP A C   1 
ATOM   3766 O O   . ASP A 1 491 ? 2.427  0.047   23.282  1.00 88.10  ? 491  ASP A O   1 
ATOM   3767 C CB  . ASP A 1 491 ? 3.536  2.651   24.156  1.00 83.41  ? 491  ASP A CB  1 
ATOM   3768 C CG  . ASP A 1 491 ? 3.363  2.878   25.656  1.00 85.15  ? 491  ASP A CG  1 
ATOM   3769 O OD1 . ASP A 1 491 ? 4.102  3.731   26.211  1.00 84.89  ? 491  ASP A OD1 1 
ATOM   3770 O OD2 . ASP A 1 491 ? 2.499  2.203   26.273  1.00 87.58  ? 491  ASP A OD2 1 
ATOM   3771 N N   . PRO A 1 492 ? 3.874  -0.829  24.802  1.00 88.27  ? 492  PRO A N   1 
ATOM   3772 C CA  . PRO A 1 492 ? 3.170  -2.112  25.005  1.00 91.76  ? 492  PRO A CA  1 
ATOM   3773 C C   . PRO A 1 492 ? 1.671  -1.974  25.304  1.00 95.14  ? 492  PRO A C   1 
ATOM   3774 O O   . PRO A 1 492 ? 0.878  -2.802  24.843  1.00 97.34  ? 492  PRO A O   1 
ATOM   3775 C CB  . PRO A 1 492 ? 3.892  -2.731  26.216  1.00 91.51  ? 492  PRO A CB  1 
ATOM   3776 C CG  . PRO A 1 492 ? 4.728  -1.603  26.811  1.00 88.97  ? 492  PRO A CG  1 
ATOM   3777 C CD  . PRO A 1 492 ? 5.079  -0.736  25.649  1.00 86.57  ? 492  PRO A CD  1 
ATOM   3778 N N   . ARG A 1 493 ? 1.299  -0.943  26.072  1.00 96.02  ? 493  ARG A N   1 
ATOM   3779 C CA  . ARG A 1 493 ? -0.109 -0.664  26.409  1.00 99.36  ? 493  ARG A CA  1 
ATOM   3780 C C   . ARG A 1 493 ? -0.875 -0.146  25.191  1.00 100.21 ? 493  ARG A C   1 
ATOM   3781 O O   . ARG A 1 493 ? -1.834 -0.772  24.726  1.00 102.51 ? 493  ARG A O   1 
ATOM   3782 C CB  . ARG A 1 493 ? -0.231 0.376   27.542  1.00 99.10  ? 493  ARG A CB  1 
ATOM   3783 C CG  . ARG A 1 493 ? 0.455  0.037   28.871  1.00 100.24 ? 493  ARG A CG  1 
ATOM   3784 C CD  . ARG A 1 493 ? 1.698  0.908   29.093  1.00 99.48  ? 493  ARG A CD  1 
ATOM   3785 N NE  . ARG A 1 493 ? 1.931  1.176   30.514  1.00 100.83 ? 493  ARG A NE  1 
ATOM   3786 C CZ  . ARG A 1 493 ? 2.635  2.203   30.990  1.00 99.77  ? 493  ARG A CZ  1 
ATOM   3787 N NH1 . ARG A 1 493 ? 3.194  3.087   30.165  1.00 97.83  ? 493  ARG A NH1 1 
ATOM   3788 N NH2 . ARG A 1 493 ? 2.777  2.350   32.302  1.00 99.77  ? 493  ARG A NH2 1 
ATOM   3789 N N   . ASP A 1 494 ? -0.418 1.002   24.690  1.00 98.65  ? 494  ASP A N   1 
ATOM   3790 C CA  . ASP A 1 494 ? -1.084 1.772   23.643  1.00 99.32  ? 494  ASP A CA  1 
ATOM   3791 C C   . ASP A 1 494 ? -1.250 0.994   22.332  1.00 100.10 ? 494  ASP A C   1 
ATOM   3792 O O   . ASP A 1 494 ? -0.281 0.730   21.608  1.00 98.55  ? 494  ASP A O   1 
ATOM   3793 C CB  . ASP A 1 494 ? -0.322 3.083   23.410  1.00 97.19  ? 494  ASP A CB  1 
ATOM   3794 C CG  . ASP A 1 494 ? -1.150 4.133   22.680  1.00 98.50  ? 494  ASP A CG  1 
ATOM   3795 O OD1 . ASP A 1 494 ? -0.690 5.297   22.623  1.00 97.02  ? 494  ASP A OD1 1 
ATOM   3796 O OD2 . ASP A 1 494 ? -2.247 3.808   22.164  1.00 101.30 ? 494  ASP A OD2 1 
ATOM   3797 N N   . SER A 1 495 ? -2.497 0.633   22.046  1.00 102.61 ? 495  SER A N   1 
ATOM   3798 C CA  . SER A 1 495 ? -2.843 -0.090  20.830  1.00 103.61 ? 495  SER A CA  1 
ATOM   3799 C C   . SER A 1 495 ? -3.430 0.872   19.790  1.00 103.46 ? 495  SER A C   1 
ATOM   3800 O O   . SER A 1 495 ? -3.253 0.677   18.580  1.00 103.46 ? 495  SER A O   1 
ATOM   3801 C CB  . SER A 1 495 ? -3.832 -1.213  21.155  1.00 106.82 ? 495  SER A CB  1 
ATOM   3802 O OG  . SER A 1 495 ? -3.861 -2.186  20.126  1.00 108.49 ? 495  SER A OG  1 
ATOM   3803 N N   . LYS A 1 496 ? -4.117 1.910   20.278  1.00 103.12 ? 496  LYS A N   1 
ATOM   3804 C CA  . LYS A 1 496 ? -4.737 2.939   19.429  1.00 102.54 ? 496  LYS A CA  1 
ATOM   3805 C C   . LYS A 1 496 ? -3.711 3.751   18.615  1.00 98.89  ? 496  LYS A C   1 
ATOM   3806 O O   . LYS A 1 496 ? -3.910 3.983   17.414  1.00 99.11  ? 496  LYS A O   1 
ATOM   3807 C CB  . LYS A 1 496 ? -5.630 3.861   20.275  1.00 103.88 ? 496  LYS A CB  1 
ATOM   3808 N N   . SER A 1 497 ? -2.627 4.175   19.273  1.00 95.04  ? 497  SER A N   1 
ATOM   3809 C CA  . SER A 1 497 ? -1.483 4.795   18.592  1.00 91.17  ? 497  SER A CA  1 
ATOM   3810 C C   . SER A 1 497 ? -1.001 3.938   17.430  1.00 89.60  ? 497  SER A C   1 
ATOM   3811 O O   . SER A 1 497 ? -0.943 2.704   17.546  1.00 90.52  ? 497  SER A O   1 
ATOM   3812 C CB  . SER A 1 497 ? -0.309 4.996   19.551  1.00 89.06  ? 497  SER A CB  1 
ATOM   3813 O OG  . SER A 1 497 ? -0.178 6.349   19.947  1.00 88.62  ? 497  SER A OG  1 
ATOM   3814 N N   . PRO A 1 498 ? -0.644 4.585   16.306  1.00 87.07  ? 498  PRO A N   1 
ATOM   3815 C CA  . PRO A 1 498 ? -0.126 3.810   15.178  1.00 85.36  ? 498  PRO A CA  1 
ATOM   3816 C C   . PRO A 1 498 ? 1.237  3.210   15.530  1.00 81.62  ? 498  PRO A C   1 
ATOM   3817 O O   . PRO A 1 498 ? 2.025  3.838   16.239  1.00 79.21  ? 498  PRO A O   1 
ATOM   3818 C CB  . PRO A 1 498 ? -0.022 4.845   14.050  1.00 84.85  ? 498  PRO A CB  1 
ATOM   3819 C CG  . PRO A 1 498 ? 0.056  6.168   14.743  1.00 84.33  ? 498  PRO A CG  1 
ATOM   3820 C CD  . PRO A 1 498 ? -0.699 6.033   16.025  1.00 86.11  ? 498  PRO A CD  1 
ATOM   3821 N N   . GLN A 1 499 ? 1.481  1.988   15.063  1.00 80.42  ? 499  GLN A N   1 
ATOM   3822 C CA  . GLN A 1 499 ? 2.697  1.246   15.413  1.00 76.83  ? 499  GLN A CA  1 
ATOM   3823 C C   . GLN A 1 499 ? 3.883  1.615   14.519  1.00 73.06  ? 499  GLN A C   1 
ATOM   3824 O O   . GLN A 1 499 ? 3.705  2.123   13.411  1.00 73.15  ? 499  GLN A O   1 
ATOM   3825 C CB  . GLN A 1 499 ? 2.434  -0.268  15.378  1.00 78.71  ? 499  GLN A CB  1 
ATOM   3826 C CG  . GLN A 1 499 ? 1.386  -0.743  16.392  1.00 81.52  ? 499  GLN A CG  1 
ATOM   3827 C CD  . GLN A 1 499 ? 1.812  -0.521  17.845  1.00 80.96  ? 499  GLN A CD  1 
ATOM   3828 O OE1 . GLN A 1 499 ? 2.754  -1.151  18.334  1.00 79.92  ? 499  GLN A OE1 1 
ATOM   3829 N NE2 . GLN A 1 499 ? 1.109  0.373   18.538  1.00 80.76  ? 499  GLN A NE2 1 
ATOM   3830 N N   . TRP A 1 500 ? 5.086  1.364   15.027  1.00 68.97  ? 500  TRP A N   1 
ATOM   3831 C CA  . TRP A 1 500 ? 6.331  1.572   14.306  1.00 64.92  ? 500  TRP A CA  1 
ATOM   3832 C C   . TRP A 1 500 ? 6.824  0.184   13.904  1.00 64.79  ? 500  TRP A C   1 
ATOM   3833 O O   . TRP A 1 500 ? 7.294  -0.572  14.755  1.00 64.43  ? 500  TRP A O   1 
ATOM   3834 C CB  . TRP A 1 500 ? 7.337  2.243   15.246  1.00 61.93  ? 500  TRP A CB  1 
ATOM   3835 C CG  . TRP A 1 500 ? 8.650  2.682   14.662  1.00 58.98  ? 500  TRP A CG  1 
ATOM   3836 C CD1 . TRP A 1 500 ? 9.293  2.173   13.562  1.00 58.32  ? 500  TRP A CD1 1 
ATOM   3837 C CD2 . TRP A 1 500 ? 9.508  3.703   15.187  1.00 55.96  ? 500  TRP A CD2 1 
ATOM   3838 N NE1 . TRP A 1 500 ? 10.485 2.834   13.361  1.00 55.84  ? 500  TRP A NE1 1 
ATOM   3839 C CE2 . TRP A 1 500 ? 10.640 3.773   14.349  1.00 54.70  ? 500  TRP A CE2 1 
ATOM   3840 C CE3 . TRP A 1 500 ? 9.424  4.572   16.281  1.00 54.29  ? 500  TRP A CE3 1 
ATOM   3841 C CZ2 . TRP A 1 500 ? 11.671 4.680   14.572  1.00 53.09  ? 500  TRP A CZ2 1 
ATOM   3842 C CZ3 . TRP A 1 500 ? 10.444 5.464   16.498  1.00 53.24  ? 500  TRP A CZ3 1 
ATOM   3843 C CH2 . TRP A 1 500 ? 11.554 5.516   15.651  1.00 52.38  ? 500  TRP A CH2 1 
ATOM   3844 N N   . PRO A 1 501 ? 6.684  -0.178  12.614  1.00 64.94  ? 501  PRO A N   1 
ATOM   3845 C CA  . PRO A 1 501 ? 7.183  -1.486  12.199  1.00 65.20  ? 501  PRO A CA  1 
ATOM   3846 C C   . PRO A 1 501 ? 8.706  -1.503  12.042  1.00 62.84  ? 501  PRO A C   1 
ATOM   3847 O O   . PRO A 1 501 ? 9.297  -0.467  11.720  1.00 60.85  ? 501  PRO A O   1 
ATOM   3848 C CB  . PRO A 1 501 ? 6.497  -1.713  10.849  1.00 66.66  ? 501  PRO A CB  1 
ATOM   3849 C CG  . PRO A 1 501 ? 6.210  -0.351  10.324  1.00 65.78  ? 501  PRO A CG  1 
ATOM   3850 C CD  . PRO A 1 501 ? 6.050  0.558   11.503  1.00 65.33  ? 501  PRO A CD  1 
ATOM   3851 N N   . PRO A 1 502 ? 9.337  -2.669  12.286  1.00 62.92  ? 502  PRO A N   1 
ATOM   3852 C CA  . PRO A 1 502 ? 10.755 -2.866  11.983  1.00 61.34  ? 502  PRO A CA  1 
ATOM   3853 C C   . PRO A 1 502 ? 11.061 -2.624  10.501  1.00 61.38  ? 502  PRO A C   1 
ATOM   3854 O O   . PRO A 1 502 ? 10.206 -2.862  9.648   1.00 63.25  ? 502  PRO A O   1 
ATOM   3855 C CB  . PRO A 1 502 ? 10.984 -4.346  12.310  1.00 62.71  ? 502  PRO A CB  1 
ATOM   3856 C CG  . PRO A 1 502 ? 9.900  -4.705  13.282  1.00 64.13  ? 502  PRO A CG  1 
ATOM   3857 C CD  . PRO A 1 502 ? 8.723  -3.870  12.891  1.00 64.71  ? 502  PRO A CD  1 
ATOM   3858 N N   . TYR A 1 503 ? 12.270 -2.148  10.209  1.00 59.57  ? 503  TYR A N   1 
ATOM   3859 C CA  . TYR A 1 503 ? 12.769 -2.045  8.847   1.00 59.35  ? 503  TYR A CA  1 
ATOM   3860 C C   . TYR A 1 503 ? 13.234 -3.414  8.315   1.00 60.62  ? 503  TYR A C   1 
ATOM   3861 O O   . TYR A 1 503 ? 14.028 -4.092  8.952   1.00 60.28  ? 503  TYR A O   1 
ATOM   3862 C CB  . TYR A 1 503 ? 13.919 -1.023  8.789   1.00 57.21  ? 503  TYR A CB  1 
ATOM   3863 C CG  . TYR A 1 503 ? 14.554 -0.890  7.417   1.00 57.19  ? 503  TYR A CG  1 
ATOM   3864 C CD1 . TYR A 1 503 ? 15.587 -1.740  7.022   1.00 57.38  ? 503  TYR A CD1 1 
ATOM   3865 C CD2 . TYR A 1 503 ? 14.111 0.072   6.511   1.00 57.19  ? 503  TYR A CD2 1 
ATOM   3866 C CE1 . TYR A 1 503 ? 16.168 -1.641  5.768   1.00 57.37  ? 503  TYR A CE1 1 
ATOM   3867 C CE2 . TYR A 1 503 ? 14.691 0.187   5.249   1.00 57.89  ? 503  TYR A CE2 1 
ATOM   3868 C CZ  . TYR A 1 503 ? 15.720 -0.678  4.883   1.00 57.83  ? 503  TYR A CZ  1 
ATOM   3869 O OH  . TYR A 1 503 ? 16.302 -0.592  3.631   1.00 58.17  ? 503  TYR A OH  1 
ATOM   3870 N N   . THR A 1 504 ? 12.742 -3.810  7.145   1.00 62.42  ? 504  THR A N   1 
ATOM   3871 C CA  . THR A 1 504 ? 13.196 -5.049  6.492   1.00 64.34  ? 504  THR A CA  1 
ATOM   3872 C C   . THR A 1 504 ? 13.693 -4.772  5.072   1.00 64.50  ? 504  THR A C   1 
ATOM   3873 O O   . THR A 1 504 ? 13.496 -3.676  4.546   1.00 63.42  ? 504  THR A O   1 
ATOM   3874 C CB  . THR A 1 504 ? 12.091 -6.127  6.430   1.00 66.85  ? 504  THR A CB  1 
ATOM   3875 O OG1 . THR A 1 504 ? 10.972 -5.618  5.697   1.00 68.35  ? 504  THR A OG1 1 
ATOM   3876 C CG2 . THR A 1 504 ? 11.646 -6.554  7.835   1.00 66.66  ? 504  THR A CG2 1 
ATOM   3877 N N   . THR A 1 505 ? 14.339 -5.759  4.451   1.00 65.84  ? 505  THR A N   1 
ATOM   3878 C CA  . THR A 1 505 ? 14.752 -5.596  3.055   1.00 66.37  ? 505  THR A CA  1 
ATOM   3879 C C   . THR A 1 505 ? 13.555 -5.718  2.100   1.00 68.11  ? 505  THR A C   1 
ATOM   3880 O O   . THR A 1 505 ? 13.490 -5.013  1.097   1.00 68.03  ? 505  THR A O   1 
ATOM   3881 C CB  . THR A 1 505 ? 15.911 -6.553  2.635   1.00 67.23  ? 505  THR A CB  1 
ATOM   3882 O OG1 . THR A 1 505 ? 15.526 -7.910  2.847   1.00 68.87  ? 505  THR A OG1 1 
ATOM   3883 C CG2 . THR A 1 505 ? 17.195 -6.252  3.431   1.00 65.35  ? 505  THR A CG2 1 
ATOM   3884 N N   . ALA A 1 506 ? 12.603 -6.585  2.434   1.00 69.65  ? 506  ALA A N   1 
ATOM   3885 C CA  . ALA A 1 506 ? 11.438 -6.820  1.573   1.00 71.98  ? 506  ALA A CA  1 
ATOM   3886 C C   . ALA A 1 506 ? 10.441 -5.657  1.553   1.00 71.29  ? 506  ALA A C   1 
ATOM   3887 O O   . ALA A 1 506 ? 9.878  -5.330  0.500   1.00 72.25  ? 506  ALA A O   1 
ATOM   3888 C CB  . ALA A 1 506 ? 10.718 -8.143  1.960   1.00 74.55  ? 506  ALA A CB  1 
ATOM   3889 N N   . ALA A 1 507 ? 10.218 -5.045  2.716   1.00 69.56  ? 507  ALA A N   1 
ATOM   3890 C CA  . ALA A 1 507 ? 9.211  -3.993  2.838   1.00 68.73  ? 507  ALA A CA  1 
ATOM   3891 C C   . ALA A 1 507 ? 9.806  -2.585  3.026   1.00 65.66  ? 507  ALA A C   1 
ATOM   3892 O O   . ALA A 1 507 ? 9.140  -1.590  2.742   1.00 65.49  ? 507  ALA A O   1 
ATOM   3893 C CB  . ALA A 1 507 ? 8.202  -4.338  3.940   1.00 69.50  ? 507  ALA A CB  1 
ATOM   3894 N N   . GLN A 1 508 ? 11.052 -2.504  3.484   1.00 63.40  ? 508  GLN A N   1 
ATOM   3895 C CA  . GLN A 1 508 ? 11.760 -1.212  3.634   1.00 61.28  ? 508  GLN A CA  1 
ATOM   3896 C C   . GLN A 1 508 ? 10.961 -0.116  4.359   1.00 60.37  ? 508  GLN A C   1 
ATOM   3897 O O   . GLN A 1 508 ? 11.034 1.060   3.984   1.00 59.44  ? 508  GLN A O   1 
ATOM   3898 C CB  . GLN A 1 508 ? 12.236 -0.673  2.273   1.00 60.91  ? 508  GLN A CB  1 
ATOM   3899 C CG  . GLN A 1 508 ? 13.224 -1.549  1.525   1.00 61.71  ? 508  GLN A CG  1 
ATOM   3900 C CD  . GLN A 1 508 ? 13.527 -1.029  0.134   1.00 62.21  ? 508  GLN A CD  1 
ATOM   3901 O OE1 . GLN A 1 508 ? 14.185 0.007   -0.033  1.00 60.39  ? 508  GLN A OE1 1 
ATOM   3902 N NE2 . GLN A 1 508 ? 13.052 -1.748  -0.879  1.00 64.47  ? 508  GLN A NE2 1 
ATOM   3903 N N   . GLN A 1 509 ? 10.221 -0.506  5.395   1.00 60.85  ? 509  GLN A N   1 
ATOM   3904 C CA  . GLN A 1 509 ? 9.376  0.409   6.168   1.00 60.41  ? 509  GLN A CA  1 
ATOM   3905 C C   . GLN A 1 509 ? 10.146 1.277   7.172   1.00 58.05  ? 509  GLN A C   1 
ATOM   3906 O O   . GLN A 1 509 ? 11.065 0.806   7.848   1.00 57.19  ? 509  GLN A O   1 
ATOM   3907 C CB  . GLN A 1 509 ? 8.291  -0.378  6.901   1.00 62.30  ? 509  GLN A CB  1 
ATOM   3908 C CG  . GLN A 1 509 ? 7.379  -1.156  5.971   1.00 65.56  ? 509  GLN A CG  1 
ATOM   3909 C CD  . GLN A 1 509 ? 6.258  -1.853  6.697   1.00 68.12  ? 509  GLN A CD  1 
ATOM   3910 O OE1 . GLN A 1 509 ? 6.487  -2.731  7.528   1.00 68.50  ? 509  GLN A OE1 1 
ATOM   3911 N NE2 . GLN A 1 509 ? 5.029  -1.473  6.378   1.00 70.06  ? 509  GLN A NE2 1 
ATOM   3912 N N   . TYR A 1 510 ? 9.758  2.546   7.255   1.00 57.02  ? 510  TYR A N   1 
ATOM   3913 C CA  . TYR A 1 510 ? 10.276 3.478   8.252   1.00 55.22  ? 510  TYR A CA  1 
ATOM   3914 C C   . TYR A 1 510 ? 9.186  4.503   8.574   1.00 55.63  ? 510  TYR A C   1 
ATOM   3915 O O   . TYR A 1 510 ? 8.220  4.635   7.812   1.00 57.57  ? 510  TYR A O   1 
ATOM   3916 C CB  . TYR A 1 510 ? 11.528 4.176   7.723   1.00 53.88  ? 510  TYR A CB  1 
ATOM   3917 C CG  . TYR A 1 510 ? 11.266 5.107   6.567   1.00 54.27  ? 510  TYR A CG  1 
ATOM   3918 C CD1 . TYR A 1 510 ? 11.111 4.617   5.266   1.00 55.81  ? 510  TYR A CD1 1 
ATOM   3919 C CD2 . TYR A 1 510 ? 11.172 6.480   6.773   1.00 53.28  ? 510  TYR A CD2 1 
ATOM   3920 C CE1 . TYR A 1 510 ? 10.863 5.475   4.203   1.00 56.17  ? 510  TYR A CE1 1 
ATOM   3921 C CE2 . TYR A 1 510 ? 10.934 7.343   5.722   1.00 54.61  ? 510  TYR A CE2 1 
ATOM   3922 C CZ  . TYR A 1 510 ? 10.777 6.836   4.440   1.00 55.79  ? 510  TYR A CZ  1 
ATOM   3923 O OH  . TYR A 1 510 ? 10.540 7.708   3.404   1.00 56.60  ? 510  TYR A OH  1 
ATOM   3924 N N   . VAL A 1 511 ? 9.328  5.232   9.680   1.00 54.11  ? 511  VAL A N   1 
ATOM   3925 C CA  . VAL A 1 511 ? 8.284  6.179   10.092  1.00 54.21  ? 511  VAL A CA  1 
ATOM   3926 C C   . VAL A 1 511 ? 8.724  7.630   10.014  1.00 52.88  ? 511  VAL A C   1 
ATOM   3927 O O   . VAL A 1 511 ? 9.908  7.928   10.119  1.00 51.55  ? 511  VAL A O   1 
ATOM   3928 C CB  . VAL A 1 511 ? 7.767  5.894   11.521  1.00 54.76  ? 511  VAL A CB  1 
ATOM   3929 C CG1 . VAL A 1 511 ? 7.185  4.482   11.616  1.00 56.64  ? 511  VAL A CG1 1 
ATOM   3930 C CG2 . VAL A 1 511 ? 8.863  6.121   12.563  1.00 52.05  ? 511  VAL A CG2 1 
ATOM   3931 N N   . SER A 1 512 ? 7.763  8.528   9.823   1.00 53.70  ? 512  SER A N   1 
ATOM   3932 C CA  . SER A 1 512 ? 8.017  9.963   9.913   1.00 52.76  ? 512  SER A CA  1 
ATOM   3933 C C   . SER A 1 512 ? 7.867  10.424  11.359  1.00 52.58  ? 512  SER A C   1 
ATOM   3934 O O   . SER A 1 512 ? 6.973  9.963   12.076  1.00 53.94  ? 512  SER A O   1 
ATOM   3935 C CB  . SER A 1 512 ? 7.057  10.747  9.015   1.00 53.77  ? 512  SER A CB  1 
ATOM   3936 O OG  . SER A 1 512 ? 5.713  10.591  9.446   1.00 56.74  ? 512  SER A OG  1 
ATOM   3937 N N   . LEU A 1 513 ? 8.754  11.320  11.784  1.00 51.27  ? 513  LEU A N   1 
ATOM   3938 C CA  . LEU A 1 513 ? 8.667  11.953  13.091  1.00 51.02  ? 513  LEU A CA  1 
ATOM   3939 C C   . LEU A 1 513 ? 8.392  13.451  12.933  1.00 51.87  ? 513  LEU A C   1 
ATOM   3940 O O   . LEU A 1 513 ? 9.276  14.237  12.552  1.00 50.78  ? 513  LEU A O   1 
ATOM   3941 C CB  . LEU A 1 513 ? 9.939  11.701  13.900  1.00 49.01  ? 513  LEU A CB  1 
ATOM   3942 C CG  . LEU A 1 513 ? 10.296 10.264  14.299  1.00 47.98  ? 513  LEU A CG  1 
ATOM   3943 C CD1 . LEU A 1 513 ? 11.643 10.262  15.011  1.00 43.63  ? 513  LEU A CD1 1 
ATOM   3944 C CD2 . LEU A 1 513 ? 9.216  9.618   15.176  1.00 46.96  ? 513  LEU A CD2 1 
ATOM   3945 N N   . ASN A 1 514 ? 7.139  13.824  13.182  1.00 54.26  ? 514  ASN A N   1 
ATOM   3946 C CA  . ASN A 1 514 ? 6.682  15.217  13.132  1.00 55.51  ? 514  ASN A CA  1 
ATOM   3947 C C   . ASN A 1 514 ? 5.521  15.428  14.101  1.00 57.46  ? 514  ASN A C   1 
ATOM   3948 O O   . ASN A 1 514 ? 5.228  14.551  14.923  1.00 58.05  ? 514  ASN A O   1 
ATOM   3949 C CB  . ASN A 1 514 ? 6.311  15.651  11.699  1.00 56.44  ? 514  ASN A CB  1 
ATOM   3950 C CG  . ASN A 1 514 ? 5.430  14.618  10.950  1.00 58.71  ? 514  ASN A CG  1 
ATOM   3951 O OD1 . ASN A 1 514 ? 5.765  14.198  9.837   1.00 59.38  ? 514  ASN A OD1 1 
ATOM   3952 N ND2 . ASN A 1 514 ? 4.311  14.225  11.552  1.00 60.38  ? 514  ASN A ND2 1 
ATOM   3953 N N   . LEU A 1 515 ? 4.854  16.578  14.005  1.00 59.01  ? 515  LEU A N   1 
ATOM   3954 C CA  . LEU A 1 515 ? 3.773  16.912  14.942  1.00 60.84  ? 515  LEU A CA  1 
ATOM   3955 C C   . LEU A 1 515 ? 2.564  16.003  14.792  1.00 63.17  ? 515  LEU A C   1 
ATOM   3956 O O   . LEU A 1 515 ? 1.841  15.785  15.756  1.00 64.47  ? 515  LEU A O   1 
ATOM   3957 C CB  . LEU A 1 515 ? 3.372  18.386  14.823  1.00 61.31  ? 515  LEU A CB  1 
ATOM   3958 C CG  . LEU A 1 515 ? 4.494  19.408  15.058  1.00 59.35  ? 515  LEU A CG  1 
ATOM   3959 C CD1 . LEU A 1 515 ? 3.969  20.828  14.953  1.00 58.51  ? 515  LEU A CD1 1 
ATOM   3960 C CD2 . LEU A 1 515 ? 5.197  19.182  16.413  1.00 56.63  ? 515  LEU A CD2 1 
ATOM   3961 N N   . LYS A 1 516 ? 2.362  15.473  13.582  1.00 64.32  ? 516  LYS A N   1 
ATOM   3962 C CA  . LYS A 1 516 ? 1.294  14.508  13.286  1.00 66.63  ? 516  LYS A CA  1 
ATOM   3963 C C   . LYS A 1 516 ? 1.656  13.133  13.859  1.00 65.87  ? 516  LYS A C   1 
ATOM   3964 O O   . LYS A 1 516 ? 2.828  12.858  14.091  1.00 64.04  ? 516  LYS A O   1 
ATOM   3965 C CB  . LYS A 1 516 ? 1.083  14.390  11.772  1.00 67.55  ? 516  LYS A CB  1 
ATOM   3966 C CG  . LYS A 1 516 ? 0.600  15.662  11.081  1.00 70.42  ? 516  LYS A CG  1 
ATOM   3967 C CD  . LYS A 1 516 ? 0.839  15.610  9.553   1.00 73.73  ? 516  LYS A CD  1 
ATOM   3968 C CE  . LYS A 1 516 ? -0.256 14.806  8.821   1.00 78.52  ? 516  LYS A CE  1 
ATOM   3969 N NZ  . LYS A 1 516 ? -0.331 15.072  7.340   1.00 79.52  ? 516  LYS A NZ  1 
ATOM   3970 N N   . PRO A 1 517 ? 0.651  12.265  14.095  1.00 67.58  ? 517  PRO A N   1 
ATOM   3971 C CA  . PRO A 1 517 ? 0.917  10.890  14.540  1.00 67.18  ? 517  PRO A CA  1 
ATOM   3972 C C   . PRO A 1 517 ? 1.798  10.112  13.554  1.00 65.95  ? 517  PRO A C   1 
ATOM   3973 O O   . PRO A 1 517 ? 1.829  10.450  12.365  1.00 66.01  ? 517  PRO A O   1 
ATOM   3974 C CB  . PRO A 1 517 ? -0.487 10.262  14.582  1.00 69.75  ? 517  PRO A CB  1 
ATOM   3975 C CG  . PRO A 1 517 ? -1.411 11.400  14.740  1.00 70.95  ? 517  PRO A CG  1 
ATOM   3976 C CD  . PRO A 1 517 ? -0.797 12.522  13.965  1.00 69.86  ? 517  PRO A CD  1 
ATOM   3977 N N   . LEU A 1 518 ? 2.494  9.080   14.040  1.00 64.92  ? 518  LEU A N   1 
ATOM   3978 C CA  . LEU A 1 518 ? 3.371  8.254   13.188  1.00 63.95  ? 518  LEU A CA  1 
ATOM   3979 C C   . LEU A 1 518 ? 2.736  7.854   11.854  1.00 65.51  ? 518  LEU A C   1 
ATOM   3980 O O   . LEU A 1 518 ? 1.593  7.384   11.806  1.00 67.37  ? 518  LEU A O   1 
ATOM   3981 C CB  . LEU A 1 518 ? 3.804  6.972   13.902  1.00 63.61  ? 518  LEU A CB  1 
ATOM   3982 C CG  . LEU A 1 518 ? 4.888  6.918   14.970  1.00 61.95  ? 518  LEU A CG  1 
ATOM   3983 C CD1 . LEU A 1 518 ? 5.176  5.447   15.288  1.00 62.21  ? 518  LEU A CD1 1 
ATOM   3984 C CD2 . LEU A 1 518 ? 6.160  7.639   14.576  1.00 58.45  ? 518  LEU A CD2 1 
ATOM   3985 N N   . GLU A 1 519 ? 3.504  8.030   10.784  1.00 64.53  ? 519  GLU A N   1 
ATOM   3986 C CA  . GLU A 1 519 ? 3.104  7.598   9.451   1.00 66.01  ? 519  GLU A CA  1 
ATOM   3987 C C   . GLU A 1 519 ? 4.179  6.679   8.865   1.00 64.76  ? 519  GLU A C   1 
ATOM   3988 O O   . GLU A 1 519 ? 5.368  7.017   8.863   1.00 62.85  ? 519  GLU A O   1 
ATOM   3989 C CB  . GLU A 1 519 ? 2.856  8.817   8.557   1.00 66.07  ? 519  GLU A CB  1 
ATOM   3990 C CG  . GLU A 1 519 ? 2.953  8.553   7.067   1.00 68.89  ? 519  GLU A CG  1 
ATOM   3991 C CD  . GLU A 1 519 ? 2.514  9.746   6.234   1.00 72.94  ? 519  GLU A CD  1 
ATOM   3992 O OE1 . GLU A 1 519 ? 1.401  10.260  6.501   1.00 76.42  ? 519  GLU A OE1 1 
ATOM   3993 O OE2 . GLU A 1 519 ? 3.268  10.163  5.313   1.00 71.75  ? 519  GLU A OE2 1 
ATOM   3994 N N   . VAL A 1 520 ? 3.750  5.516   8.385   1.00 65.91  ? 520  VAL A N   1 
ATOM   3995 C CA  . VAL A 1 520 ? 4.639  4.529   7.788   1.00 65.19  ? 520  VAL A CA  1 
ATOM   3996 C C   . VAL A 1 520 ? 4.873  4.846   6.313   1.00 65.53  ? 520  VAL A C   1 
ATOM   3997 O O   . VAL A 1 520 ? 3.933  4.956   5.526   1.00 67.00  ? 520  VAL A O   1 
ATOM   3998 C CB  . VAL A 1 520 ? 4.064  3.103   7.945   1.00 67.07  ? 520  VAL A CB  1 
ATOM   3999 C CG1 . VAL A 1 520 ? 4.926  2.068   7.230   1.00 66.58  ? 520  VAL A CG1 1 
ATOM   4000 C CG2 . VAL A 1 520 ? 3.913  2.752   9.428   1.00 66.89  ? 520  VAL A CG2 1 
ATOM   4001 N N   . ARG A 1 521 ? 6.140  5.014   5.955   1.00 64.11  ? 521  ARG A N   1 
ATOM   4002 C CA  . ARG A 1 521 ? 6.535  5.219   4.568   1.00 64.53  ? 521  ARG A CA  1 
ATOM   4003 C C   . ARG A 1 521 ? 7.397  4.043   4.133   1.00 64.76  ? 521  ARG A C   1 
ATOM   4004 O O   . ARG A 1 521 ? 8.024  3.397   4.970   1.00 63.98  ? 521  ARG A O   1 
ATOM   4005 C CB  . ARG A 1 521 ? 7.289  6.546   4.421   1.00 62.70  ? 521  ARG A CB  1 
ATOM   4006 C CG  . ARG A 1 521 ? 6.403  7.746   4.664   1.00 62.83  ? 521  ARG A CG  1 
ATOM   4007 C CD  . ARG A 1 521 ? 7.139  9.055   4.536   1.00 61.55  ? 521  ARG A CD  1 
ATOM   4008 N NE  . ARG A 1 521 ? 6.352  10.133  5.132   1.00 61.61  ? 521  ARG A NE  1 
ATOM   4009 C CZ  . ARG A 1 521 ? 6.832  11.326  5.474   1.00 61.15  ? 521  ARG A CZ  1 
ATOM   4010 N NH1 . ARG A 1 521 ? 8.114  11.630  5.287   1.00 58.88  ? 521  ARG A NH1 1 
ATOM   4011 N NH2 . ARG A 1 521 ? 6.024  12.220  6.019   1.00 62.57  ? 521  ARG A NH2 1 
ATOM   4012 N N   . ARG A 1 522 ? 7.425  3.754   2.837   1.00 66.16  ? 522  ARG A N   1 
ATOM   4013 C CA  . ARG A 1 522 ? 8.205  2.616   2.356   1.00 67.40  ? 522  ARG A CA  1 
ATOM   4014 C C   . ARG A 1 522 ? 9.364  3.064   1.473   1.00 66.25  ? 522  ARG A C   1 
ATOM   4015 O O   . ARG A 1 522 ? 9.186  3.903   0.589   1.00 66.73  ? 522  ARG A O   1 
ATOM   4016 C CB  . ARG A 1 522 ? 7.325  1.606   1.613   1.00 70.28  ? 522  ARG A CB  1 
ATOM   4017 C CG  . ARG A 1 522 ? 5.893  1.422   2.169   1.00 74.91  ? 522  ARG A CG  1 
ATOM   4018 C CD  . ARG A 1 522 ? 5.533  -0.049  2.291   1.00 80.96  ? 522  ARG A CD  1 
ATOM   4019 N NE  . ARG A 1 522 ? 6.399  -0.861  1.437   1.00 84.41  ? 522  ARG A NE  1 
ATOM   4020 C CZ  . ARG A 1 522 ? 5.982  -1.641  0.443   1.00 88.49  ? 522  ARG A CZ  1 
ATOM   4021 N NH1 . ARG A 1 522 ? 4.680  -1.764  0.169   1.00 91.24  ? 522  ARG A NH1 1 
ATOM   4022 N NH2 . ARG A 1 522 ? 6.880  -2.317  -0.270  1.00 88.94  ? 522  ARG A NH2 1 
ATOM   4023 N N   . GLY A 1 523 ? 10.551 2.517   1.728   1.00 65.25  ? 523  GLY A N   1 
ATOM   4024 C CA  . GLY A 1 523 ? 11.726 2.789   0.896   1.00 64.83  ? 523  GLY A CA  1 
ATOM   4025 C C   . GLY A 1 523 ? 12.433 4.084   1.245   1.00 63.29  ? 523  GLY A C   1 
ATOM   4026 O O   . GLY A 1 523 ? 11.875 5.171   1.082   1.00 63.29  ? 523  GLY A O   1 
ATOM   4027 N N   . LEU A 1 524 ? 13.675 3.960   1.707   1.00 62.31  ? 524  LEU A N   1 
ATOM   4028 C CA  . LEU A 1 524 ? 14.443 5.087   2.225   1.00 60.99  ? 524  LEU A CA  1 
ATOM   4029 C C   . LEU A 1 524 ? 15.319 5.713   1.138   1.00 60.51  ? 524  LEU A C   1 
ATOM   4030 O O   . LEU A 1 524 ? 16.457 5.285   0.929   1.00 59.91  ? 524  LEU A O   1 
ATOM   4031 C CB  . LEU A 1 524 ? 15.289 4.603   3.404   1.00 60.04  ? 524  LEU A CB  1 
ATOM   4032 C CG  . LEU A 1 524 ? 15.726 5.564   4.515   1.00 60.27  ? 524  LEU A CG  1 
ATOM   4033 C CD1 . LEU A 1 524 ? 14.832 6.821   4.644   1.00 61.00  ? 524  LEU A CD1 1 
ATOM   4034 C CD2 . LEU A 1 524 ? 15.803 4.788   5.846   1.00 61.04  ? 524  LEU A CD2 1 
ATOM   4035 N N   . ARG A 1 525 ? 14.775 6.723   0.453   1.00 60.82  ? 525  ARG A N   1 
ATOM   4036 C CA  . ARG A 1 525 ? 15.347 7.242   -0.804  1.00 61.19  ? 525  ARG A CA  1 
ATOM   4037 C C   . ARG A 1 525 ? 15.861 6.117   -1.715  1.00 61.52  ? 525  ARG A C   1 
ATOM   4038 O O   . ARG A 1 525 ? 16.981 6.186   -2.220  1.00 61.10  ? 525  ARG A O   1 
ATOM   4039 C CB  . ARG A 1 525 ? 16.462 8.266   -0.537  1.00 59.89  ? 525  ARG A CB  1 
ATOM   4040 C CG  . ARG A 1 525 ? 16.025 9.463   0.307   1.00 62.15  ? 525  ARG A CG  1 
ATOM   4041 C CD  . ARG A 1 525 ? 15.561 10.654  -0.517  1.00 65.70  ? 525  ARG A CD  1 
ATOM   4042 N NE  . ARG A 1 525 ? 16.483 11.780  -0.379  1.00 67.47  ? 525  ARG A NE  1 
ATOM   4043 C CZ  . ARG A 1 525 ? 16.401 12.725  0.562   1.00 68.08  ? 525  ARG A CZ  1 
ATOM   4044 N NH1 . ARG A 1 525 ? 15.435 12.701  1.476   1.00 68.90  ? 525  ARG A NH1 1 
ATOM   4045 N NH2 . ARG A 1 525 ? 17.295 13.709  0.591   1.00 67.86  ? 525  ARG A NH2 1 
ATOM   4046 N N   . ALA A 1 526 ? 15.034 5.094   -1.924  1.00 62.46  ? 526  ALA A N   1 
ATOM   4047 C CA  . ALA A 1 526 ? 15.453 3.860   -2.598  1.00 62.98  ? 526  ALA A CA  1 
ATOM   4048 C C   . ALA A 1 526 ? 16.113 4.070   -3.970  1.00 62.93  ? 526  ALA A C   1 
ATOM   4049 O O   . ALA A 1 526 ? 17.208 3.573   -4.203  1.00 62.62  ? 526  ALA A O   1 
ATOM   4050 C CB  . ALA A 1 526 ? 14.289 2.886   -2.702  1.00 64.84  ? 526  ALA A CB  1 
ATOM   4051 N N   . GLN A 1 527 ? 15.457 4.822   -4.851  1.00 63.03  ? 527  GLN A N   1 
ATOM   4052 C CA  . GLN A 1 527 ? 15.951 5.048   -6.213  1.00 63.27  ? 527  GLN A CA  1 
ATOM   4053 C C   . GLN A 1 527 ? 17.292 5.794   -6.243  1.00 61.18  ? 527  GLN A C   1 
ATOM   4054 O O   . GLN A 1 527 ? 18.240 5.361   -6.902  1.00 61.41  ? 527  GLN A O   1 
ATOM   4055 C CB  . GLN A 1 527 ? 14.892 5.786   -7.041  1.00 64.36  ? 527  GLN A CB  1 
ATOM   4056 C CG  . GLN A 1 527 ? 14.855 5.425   -8.519  1.00 66.40  ? 527  GLN A CG  1 
ATOM   4057 C CD  . GLN A 1 527 ? 14.489 3.958   -8.810  1.00 68.85  ? 527  GLN A CD  1 
ATOM   4058 O OE1 . GLN A 1 527 ? 13.884 3.256   -7.987  1.00 68.83  ? 527  GLN A OE1 1 
ATOM   4059 N NE2 . GLN A 1 527 ? 14.853 3.501   -10.004 1.00 69.93  ? 527  GLN A NE2 1 
ATOM   4060 N N   . THR A 1 528 ? 17.359 6.901   -5.507  1.00 59.19  ? 528  THR A N   1 
ATOM   4061 C CA  . THR A 1 528 ? 18.558 7.734   -5.399  1.00 56.87  ? 528  THR A CA  1 
ATOM   4062 C C   . THR A 1 528 ? 19.713 7.026   -4.688  1.00 55.58  ? 528  THR A C   1 
ATOM   4063 O O   . THR A 1 528 ? 20.866 7.147   -5.095  1.00 54.76  ? 528  THR A O   1 
ATOM   4064 C CB  . THR A 1 528 ? 18.205 9.055   -4.678  1.00 56.08  ? 528  THR A CB  1 
ATOM   4065 O OG1 . THR A 1 528 ? 17.240 9.767   -5.464  1.00 57.23  ? 528  THR A OG1 1 
ATOM   4066 C CG2 . THR A 1 528 ? 19.444 9.949   -4.421  1.00 53.37  ? 528  THR A CG2 1 
ATOM   4067 N N   . CYS A 1 529 ? 19.408 6.274   -3.635  1.00 55.19  ? 529  CYS A N   1 
ATOM   4068 C CA  . CYS A 1 529 ? 20.464 5.573   -2.892  1.00 54.14  ? 529  CYS A CA  1 
ATOM   4069 C C   . CYS A 1 529 ? 21.046 4.386   -3.664  1.00 54.80  ? 529  CYS A C   1 
ATOM   4070 O O   . CYS A 1 529 ? 22.172 3.973   -3.408  1.00 54.29  ? 529  CYS A O   1 
ATOM   4071 C CB  . CYS A 1 529 ? 20.007 5.188   -1.478  1.00 53.49  ? 529  CYS A CB  1 
ATOM   4072 S SG  . CYS A 1 529 ? 19.887 6.631   -0.335  1.00 52.06  ? 529  CYS A SG  1 
ATOM   4073 N N   . ALA A 1 530 ? 20.292 3.865   -4.627  1.00 56.05  ? 530  ALA A N   1 
ATOM   4074 C CA  . ALA A 1 530 ? 20.826 2.868   -5.545  1.00 57.34  ? 530  ALA A CA  1 
ATOM   4075 C C   . ALA A 1 530 ? 21.962 3.455   -6.387  1.00 57.21  ? 530  ALA A C   1 
ATOM   4076 O O   . ALA A 1 530 ? 22.907 2.746   -6.728  1.00 57.93  ? 530  ALA A O   1 
ATOM   4077 C CB  . ALA A 1 530 ? 19.748 2.330   -6.433  1.00 58.81  ? 530  ALA A CB  1 
ATOM   4078 N N   . PHE A 1 531 ? 21.864 4.741   -6.727  1.00 56.19  ? 531  PHE A N   1 
ATOM   4079 C CA  . PHE A 1 531 ? 22.930 5.417   -7.443  1.00 55.85  ? 531  PHE A CA  1 
ATOM   4080 C C   . PHE A 1 531 ? 24.211 5.495   -6.590  1.00 54.66  ? 531  PHE A C   1 
ATOM   4081 O O   . PHE A 1 531 ? 25.267 5.032   -7.019  1.00 54.90  ? 531  PHE A O   1 
ATOM   4082 C CB  . PHE A 1 531 ? 22.459 6.803   -7.922  1.00 55.70  ? 531  PHE A CB  1 
ATOM   4083 C CG  . PHE A 1 531 ? 23.570 7.700   -8.407  1.00 54.91  ? 531  PHE A CG  1 
ATOM   4084 C CD1 . PHE A 1 531 ? 24.094 7.556   -9.693  1.00 56.64  ? 531  PHE A CD1 1 
ATOM   4085 C CD2 . PHE A 1 531 ? 24.087 8.693   -7.579  1.00 53.79  ? 531  PHE A CD2 1 
ATOM   4086 C CE1 . PHE A 1 531 ? 25.114 8.384   -10.154 1.00 55.85  ? 531  PHE A CE1 1 
ATOM   4087 C CE2 . PHE A 1 531 ? 25.113 9.530   -8.023  1.00 53.68  ? 531  PHE A CE2 1 
ATOM   4088 C CZ  . PHE A 1 531 ? 25.632 9.369   -9.313  1.00 54.84  ? 531  PHE A CZ  1 
ATOM   4089 N N   . TRP A 1 532 ? 24.101 6.059   -5.385  1.00 53.17  ? 532  TRP A N   1 
ATOM   4090 C CA  . TRP A 1 532 ? 25.245 6.229   -4.485  1.00 52.16  ? 532  TRP A CA  1 
ATOM   4091 C C   . TRP A 1 532 ? 25.870 4.926   -3.983  1.00 53.55  ? 532  TRP A C   1 
ATOM   4092 O O   . TRP A 1 532 ? 27.094 4.819   -3.893  1.00 53.81  ? 532  TRP A O   1 
ATOM   4093 C CB  . TRP A 1 532 ? 24.884 7.115   -3.284  1.00 49.62  ? 532  TRP A CB  1 
ATOM   4094 C CG  . TRP A 1 532 ? 24.528 8.538   -3.629  1.00 47.91  ? 532  TRP A CG  1 
ATOM   4095 C CD1 . TRP A 1 532 ? 23.280 9.089   -3.638  1.00 46.86  ? 532  TRP A CD1 1 
ATOM   4096 C CD2 . TRP A 1 532 ? 25.428 9.586   -4.008  1.00 46.50  ? 532  TRP A CD2 1 
ATOM   4097 N NE1 . TRP A 1 532 ? 23.341 10.408  -4.002  1.00 45.53  ? 532  TRP A NE1 1 
ATOM   4098 C CE2 . TRP A 1 532 ? 24.649 10.743  -4.234  1.00 46.17  ? 532  TRP A CE2 1 
ATOM   4099 C CE3 . TRP A 1 532 ? 26.818 9.663   -4.178  1.00 46.46  ? 532  TRP A CE3 1 
ATOM   4100 C CZ2 . TRP A 1 532 ? 25.214 11.965  -4.625  1.00 46.17  ? 532  TRP A CZ2 1 
ATOM   4101 C CZ3 . TRP A 1 532 ? 27.381 10.884  -4.552  1.00 45.47  ? 532  TRP A CZ3 1 
ATOM   4102 C CH2 . TRP A 1 532 ? 26.578 12.013  -4.774  1.00 46.04  ? 532  TRP A CH2 1 
ATOM   4103 N N   . ASN A 1 533 ? 25.045 3.936   -3.658  1.00 55.38  ? 533  ASN A N   1 
ATOM   4104 C CA  . ASN A 1 533 ? 25.546 2.707   -3.035  1.00 56.77  ? 533  ASN A CA  1 
ATOM   4105 C C   . ASN A 1 533 ? 25.898 1.581   -4.008  1.00 59.52  ? 533  ASN A C   1 
ATOM   4106 O O   . ASN A 1 533 ? 26.726 0.735   -3.695  1.00 60.00  ? 533  ASN A O   1 
ATOM   4107 C CB  . ASN A 1 533 ? 24.558 2.198   -1.985  1.00 56.48  ? 533  ASN A CB  1 
ATOM   4108 C CG  . ASN A 1 533 ? 24.290 3.211   -0.893  1.00 55.06  ? 533  ASN A CG  1 
ATOM   4109 O OD1 . ASN A 1 533 ? 25.178 3.980   -0.506  1.00 54.80  ? 533  ASN A OD1 1 
ATOM   4110 N ND2 . ASN A 1 533 ? 23.061 3.217   -0.379  1.00 54.49  ? 533  ASN A ND2 1 
ATOM   4111 N N   . ARG A 1 534 ? 25.275 1.571   -5.184  1.00 61.92  ? 534  ARG A N   1 
ATOM   4112 C CA  . ARG A 1 534 ? 25.462 0.473   -6.130  1.00 65.02  ? 534  ARG A CA  1 
ATOM   4113 C C   . ARG A 1 534 ? 26.222 0.871   -7.386  1.00 66.53  ? 534  ARG A C   1 
ATOM   4114 O O   . ARG A 1 534 ? 27.154 0.170   -7.791  1.00 67.99  ? 534  ARG A O   1 
ATOM   4115 C CB  . ARG A 1 534 ? 24.124 -0.167  -6.505  1.00 66.33  ? 534  ARG A CB  1 
ATOM   4116 C CG  . ARG A 1 534 ? 23.503 -0.977  -5.384  1.00 66.99  ? 534  ARG A CG  1 
ATOM   4117 C CD  . ARG A 1 534 ? 22.013 -1.173  -5.597  1.00 67.79  ? 534  ARG A CD  1 
ATOM   4118 N NE  . ARG A 1 534 ? 21.344 -1.655  -4.387  1.00 68.17  ? 534  ARG A NE  1 
ATOM   4119 C CZ  . ARG A 1 534 ? 21.183 -2.941  -4.072  1.00 70.78  ? 534  ARG A CZ  1 
ATOM   4120 N NH1 . ARG A 1 534 ? 21.649 -3.901  -4.871  1.00 71.88  ? 534  ARG A NH1 1 
ATOM   4121 N NH2 . ARG A 1 534 ? 20.546 -3.271  -2.953  1.00 70.74  ? 534  ARG A NH2 1 
ATOM   4122 N N   . PHE A 1 535 ? 25.837 1.987   -8.002  1.00 66.94  ? 535  PHE A N   1 
ATOM   4123 C CA  . PHE A 1 535 ? 26.433 2.372   -9.277  1.00 68.34  ? 535  PHE A CA  1 
ATOM   4124 C C   . PHE A 1 535 ? 27.750 3.113   -9.130  1.00 68.27  ? 535  PHE A C   1 
ATOM   4125 O O   . PHE A 1 535 ? 28.751 2.719   -9.730  1.00 69.39  ? 535  PHE A O   1 
ATOM   4126 C CB  . PHE A 1 535 ? 25.464 3.167   -10.151 1.00 68.17  ? 535  PHE A CB  1 
ATOM   4127 C CG  . PHE A 1 535 ? 26.036 3.532   -11.488 1.00 68.29  ? 535  PHE A CG  1 
ATOM   4128 C CD1 . PHE A 1 535 ? 26.254 2.560   -12.452 1.00 69.34  ? 535  PHE A CD1 1 
ATOM   4129 C CD2 . PHE A 1 535 ? 26.382 4.844   -11.775 1.00 66.75  ? 535  PHE A CD2 1 
ATOM   4130 C CE1 . PHE A 1 535 ? 26.798 2.888   -13.671 1.00 70.00  ? 535  PHE A CE1 1 
ATOM   4131 C CE2 . PHE A 1 535 ? 26.926 5.180   -13.000 1.00 67.04  ? 535  PHE A CE2 1 
ATOM   4132 C CZ  . PHE A 1 535 ? 27.131 4.203   -13.948 1.00 69.70  ? 535  PHE A CZ  1 
ATOM   4133 N N   . LEU A 1 536 ? 27.741 4.186   -8.346  1.00 67.89  ? 536  LEU A N   1 
ATOM   4134 C CA  . LEU A 1 536 ? 28.918 5.035   -8.159  1.00 68.26  ? 536  LEU A CA  1 
ATOM   4135 C C   . LEU A 1 536 ? 30.206 4.241   -7.862  1.00 69.86  ? 536  LEU A C   1 
ATOM   4136 O O   . LEU A 1 536 ? 31.217 4.463   -8.532  1.00 70.39  ? 536  LEU A O   1 
ATOM   4137 C CB  . LEU A 1 536 ? 28.644 6.097   -7.091  1.00 66.33  ? 536  LEU A CB  1 
ATOM   4138 C CG  . LEU A 1 536 ? 29.009 7.571   -7.333  1.00 66.16  ? 536  LEU A CG  1 
ATOM   4139 C CD1 . LEU A 1 536 ? 30.214 8.028   -6.507  1.00 65.42  ? 536  LEU A CD1 1 
ATOM   4140 C CD2 . LEU A 1 536 ? 29.189 7.897   -8.822  1.00 68.42  ? 536  LEU A CD2 1 
ATOM   4141 N N   . PRO A 1 537 ? 30.179 3.308   -6.875  1.00 71.12  ? 537  PRO A N   1 
ATOM   4142 C CA  . PRO A 1 537 ? 31.388 2.519   -6.651  1.00 72.67  ? 537  PRO A CA  1 
ATOM   4143 C C   . PRO A 1 537 ? 31.912 1.901   -7.938  1.00 75.76  ? 537  PRO A C   1 
ATOM   4144 O O   . PRO A 1 537 ? 33.061 2.156   -8.304  1.00 76.50  ? 537  PRO A O   1 
ATOM   4145 C CB  . PRO A 1 537 ? 30.921 1.438   -5.674  1.00 72.80  ? 537  PRO A CB  1 
ATOM   4146 C CG  . PRO A 1 537 ? 29.859 2.109   -4.895  1.00 70.95  ? 537  PRO A CG  1 
ATOM   4147 C CD  . PRO A 1 537 ? 29.119 2.931   -5.916  1.00 70.76  ? 537  PRO A CD  1 
ATOM   4148 N N   . LYS A 1 538 ? 31.068 1.128   -8.625  1.00 78.43  ? 538  LYS A N   1 
ATOM   4149 C CA  . LYS A 1 538 ? 31.402 0.505   -9.913  1.00 81.52  ? 538  LYS A CA  1 
ATOM   4150 C C   . LYS A 1 538 ? 31.912 1.493   -10.978 1.00 82.36  ? 538  LYS A C   1 
ATOM   4151 O O   . LYS A 1 538 ? 32.701 1.124   -11.844 1.00 84.01  ? 538  LYS A O   1 
ATOM   4152 C CB  . LYS A 1 538 ? 30.201 -0.289  -10.446 1.00 82.98  ? 538  LYS A CB  1 
ATOM   4153 C CG  . LYS A 1 538 ? 30.196 -1.776  -10.057 1.00 85.08  ? 538  LYS A CG  1 
ATOM   4154 C CD  . LYS A 1 538 ? 28.797 -2.299  -9.731  1.00 86.33  ? 538  LYS A CD  1 
ATOM   4155 C CE  . LYS A 1 538 ? 27.886 -2.360  -10.958 1.00 88.33  ? 538  LYS A CE  1 
ATOM   4156 N NZ  . LYS A 1 538 ? 27.843 -3.716  -11.580 1.00 92.32  ? 538  LYS A NZ  1 
ATOM   4157 N N   . LEU A 1 539 ? 31.466 2.742   -10.905 1.00 82.03  ? 539  LEU A N   1 
ATOM   4158 C CA  . LEU A 1 539 ? 31.920 3.777   -11.832 1.00 83.03  ? 539  LEU A CA  1 
ATOM   4159 C C   . LEU A 1 539 ? 33.309 4.295   -11.459 1.00 83.43  ? 539  LEU A C   1 
ATOM   4160 O O   . LEU A 1 539 ? 34.134 4.561   -12.339 1.00 84.46  ? 539  LEU A O   1 
ATOM   4161 C CB  . LEU A 1 539 ? 30.911 4.927   -11.888 1.00 81.62  ? 539  LEU A CB  1 
ATOM   4162 C CG  . LEU A 1 539 ? 31.187 6.109   -12.818 1.00 80.91  ? 539  LEU A CG  1 
ATOM   4163 C CD1 . LEU A 1 539 ? 31.425 5.636   -14.239 1.00 81.79  ? 539  LEU A CD1 1 
ATOM   4164 C CD2 . LEU A 1 539 ? 30.031 7.098   -12.762 1.00 79.15  ? 539  LEU A CD2 1 
ATOM   4165 N N   . LEU A 1 540 ? 33.559 4.442   -10.157 1.00 83.22  ? 540  LEU A N   1 
ATOM   4166 C CA  . LEU A 1 540 ? 34.873 4.863   -9.666  1.00 83.83  ? 540  LEU A CA  1 
ATOM   4167 C C   . LEU A 1 540 ? 35.965 3.770   -9.770  1.00 85.98  ? 540  LEU A C   1 
ATOM   4168 O O   . LEU A 1 540 ? 37.156 4.091   -9.804  1.00 86.46  ? 540  LEU A O   1 
ATOM   4169 C CB  . LEU A 1 540 ? 34.773 5.438   -8.243  1.00 82.03  ? 540  LEU A CB  1 
ATOM   4170 C CG  . LEU A 1 540 ? 34.170 6.856   -8.104  1.00 80.89  ? 540  LEU A CG  1 
ATOM   4171 C CD1 . LEU A 1 540 ? 33.909 7.234   -6.632  1.00 78.49  ? 540  LEU A CD1 1 
ATOM   4172 C CD2 . LEU A 1 540 ? 35.035 7.921   -8.793  1.00 80.34  ? 540  LEU A CD2 1 
ATOM   4173 N N   . SER A 1 541 ? 35.556 2.498   -9.852  1.00 87.74  ? 541  SER A N   1 
ATOM   4174 C CA  . SER A 1 541 ? 36.478 1.364   -10.055 1.00 89.92  ? 541  SER A CA  1 
ATOM   4175 C C   . SER A 1 541 ? 37.121 1.333   -11.451 1.00 92.14  ? 541  SER A C   1 
ATOM   4176 O O   . SER A 1 541 ? 37.769 0.342   -11.817 1.00 94.16  ? 541  SER A O   1 
ATOM   4177 C CB  . SER A 1 541 ? 35.760 0.026   -9.817  1.00 90.90  ? 541  SER A CB  1 
ATOM   4178 O OG  . SER A 1 541 ? 35.541 -0.213  -8.443  1.00 89.90  ? 541  SER A OG  1 
ATOM   4179 N N   . ALA A 1 542 ? 36.923 2.399   -12.228 1.00 92.05  ? 542  ALA A N   1 
ATOM   4180 C CA  . ALA A 1 542 ? 37.468 2.510   -13.584 1.00 93.88  ? 542  ALA A CA  1 
ATOM   4181 C C   . ALA A 1 542 ? 37.555 3.981   -14.017 1.00 93.06  ? 542  ALA A C   1 
ATOM   4182 O O   . ALA A 1 542 ? 38.062 4.834   -13.284 1.00 91.64  ? 542  ALA A O   1 
ATOM   4183 C CB  . ALA A 1 542 ? 36.624 1.685   -14.580 1.00 95.55  ? 542  ALA A CB  1 
ATOM   4184 N N   . GLU B 1 4   ? 22.403 50.972  69.886  1.00 94.93  ? 4    GLU B N   1 
ATOM   4185 C CA  . GLU B 1 4   ? 23.616 50.311  69.315  1.00 92.38  ? 4    GLU B CA  1 
ATOM   4186 C C   . GLU B 1 4   ? 23.255 49.040  68.531  1.00 91.93  ? 4    GLU B C   1 
ATOM   4187 O O   . GLU B 1 4   ? 22.666 48.108  69.080  1.00 93.74  ? 4    GLU B O   1 
ATOM   4188 C CB  . GLU B 1 4   ? 24.621 49.990  70.433  1.00 91.97  ? 4    GLU B CB  1 
ATOM   4189 C CG  . GLU B 1 4   ? 25.803 49.112  70.009  1.00 90.91  ? 4    GLU B CG  1 
ATOM   4190 C CD  . GLU B 1 4   ? 27.092 49.894  69.780  1.00 90.57  ? 4    GLU B CD  1 
ATOM   4191 O OE1 . GLU B 1 4   ? 27.678 49.796  68.668  1.00 89.66  ? 4    GLU B OE1 1 
ATOM   4192 O OE2 . GLU B 1 4   ? 27.529 50.596  70.719  1.00 90.36  ? 4    GLU B OE2 1 
ATOM   4193 N N   . ASP B 1 5   ? 23.621 49.020  67.250  1.00 89.62  ? 5    ASP B N   1 
ATOM   4194 C CA  . ASP B 1 5   ? 23.447 47.860  66.370  1.00 88.58  ? 5    ASP B CA  1 
ATOM   4195 C C   . ASP B 1 5   ? 24.588 46.856  66.588  1.00 86.64  ? 5    ASP B C   1 
ATOM   4196 O O   . ASP B 1 5   ? 25.743 47.177  66.316  1.00 84.71  ? 5    ASP B O   1 
ATOM   4197 C CB  . ASP B 1 5   ? 23.427 48.337  64.914  1.00 87.21  ? 5    ASP B CB  1 
ATOM   4198 C CG  . ASP B 1 5   ? 22.924 47.284  63.942  1.00 87.11  ? 5    ASP B CG  1 
ATOM   4199 O OD1 . ASP B 1 5   ? 22.542 47.674  62.819  1.00 85.92  ? 5    ASP B OD1 1 
ATOM   4200 O OD2 . ASP B 1 5   ? 22.914 46.080  64.279  1.00 87.32  ? 5    ASP B OD2 1 
ATOM   4201 N N   . PRO B 1 6   ? 24.275 45.642  67.088  1.00 87.53  ? 6    PRO B N   1 
ATOM   4202 C CA  . PRO B 1 6   ? 25.321 44.657  67.402  1.00 86.03  ? 6    PRO B CA  1 
ATOM   4203 C C   . PRO B 1 6   ? 26.076 44.112  66.191  1.00 83.56  ? 6    PRO B C   1 
ATOM   4204 O O   . PRO B 1 6   ? 27.168 43.568  66.354  1.00 82.47  ? 6    PRO B O   1 
ATOM   4205 C CB  . PRO B 1 6   ? 24.556 43.533  68.108  1.00 88.56  ? 6    PRO B CB  1 
ATOM   4206 C CG  . PRO B 1 6   ? 23.156 43.670  67.649  1.00 90.66  ? 6    PRO B CG  1 
ATOM   4207 C CD  . PRO B 1 6   ? 22.928 45.132  67.407  1.00 90.44  ? 6    PRO B CD  1 
ATOM   4208 N N   . GLN B 1 7   ? 25.504 44.262  64.997  1.00 82.79  ? 7    GLN B N   1 
ATOM   4209 C CA  . GLN B 1 7   ? 26.180 43.904  63.749  1.00 79.99  ? 7    GLN B CA  1 
ATOM   4210 C C   . GLN B 1 7   ? 27.320 44.855  63.457  1.00 77.29  ? 7    GLN B C   1 
ATOM   4211 O O   . GLN B 1 7   ? 28.212 44.528  62.668  1.00 75.54  ? 7    GLN B O   1 
ATOM   4212 C CB  . GLN B 1 7   ? 25.210 43.954  62.566  1.00 80.89  ? 7    GLN B CB  1 
ATOM   4213 C CG  . GLN B 1 7   ? 24.193 42.817  62.500  1.00 83.10  ? 7    GLN B CG  1 
ATOM   4214 C CD  . GLN B 1 7   ? 24.823 41.480  62.168  1.00 82.29  ? 7    GLN B CD  1 
ATOM   4215 O OE1 . GLN B 1 7   ? 25.734 41.386  61.343  1.00 79.33  ? 7    GLN B OE1 1 
ATOM   4216 N NE2 . GLN B 1 7   ? 24.335 40.434  62.814  1.00 84.53  ? 7    GLN B NE2 1 
ATOM   4217 N N   . LEU B 1 8   ? 27.281 46.036  64.076  1.00 76.71  ? 8    LEU B N   1 
ATOM   4218 C CA  . LEU B 1 8   ? 28.286 47.078  63.830  1.00 74.38  ? 8    LEU B CA  1 
ATOM   4219 C C   . LEU B 1 8   ? 29.374 47.131  64.906  1.00 73.36  ? 8    LEU B C   1 
ATOM   4220 O O   . LEU B 1 8   ? 30.156 48.078  64.960  1.00 72.29  ? 8    LEU B O   1 
ATOM   4221 C CB  . LEU B 1 8   ? 27.624 48.455  63.645  1.00 74.80  ? 8    LEU B CB  1 
ATOM   4222 C CG  . LEU B 1 8   ? 26.608 48.634  62.501  1.00 75.46  ? 8    LEU B CG  1 
ATOM   4223 C CD1 . LEU B 1 8   ? 25.903 49.989  62.581  1.00 76.13  ? 8    LEU B CD1 1 
ATOM   4224 C CD2 . LEU B 1 8   ? 27.247 48.449  61.129  1.00 72.75  ? 8    LEU B CD2 1 
ATOM   4225 N N   . LEU B 1 9   ? 29.422 46.108  65.752  1.00 73.83  ? 9    LEU B N   1 
ATOM   4226 C CA  . LEU B 1 9   ? 30.450 45.996  66.782  1.00 73.02  ? 9    LEU B CA  1 
ATOM   4227 C C   . LEU B 1 9   ? 31.369 44.819  66.505  1.00 71.76  ? 9    LEU B C   1 
ATOM   4228 O O   . LEU B 1 9   ? 30.906 43.687  66.349  1.00 72.93  ? 9    LEU B O   1 
ATOM   4229 C CB  . LEU B 1 9   ? 29.823 45.831  68.164  1.00 75.06  ? 9    LEU B CB  1 
ATOM   4230 C CG  . LEU B 1 9   ? 29.723 47.059  69.063  1.00 76.06  ? 9    LEU B CG  1 
ATOM   4231 C CD1 . LEU B 1 9   ? 28.743 46.776  70.198  1.00 79.25  ? 9    LEU B CD1 1 
ATOM   4232 C CD2 . LEU B 1 9   ? 31.092 47.435  69.616  1.00 74.43  ? 9    LEU B CD2 1 
ATOM   4233 N N   . VAL B 1 10  ? 32.668 45.090  66.446  1.00 69.49  ? 10   VAL B N   1 
ATOM   4234 C CA  . VAL B 1 10  ? 33.654 44.056  66.184  1.00 68.19  ? 10   VAL B CA  1 
ATOM   4235 C C   . VAL B 1 10  ? 34.817 44.152  67.166  1.00 67.88  ? 10   VAL B C   1 
ATOM   4236 O O   . VAL B 1 10  ? 35.318 45.245  67.452  1.00 67.37  ? 10   VAL B O   1 
ATOM   4237 C CB  . VAL B 1 10  ? 34.190 44.145  64.739  1.00 66.28  ? 10   VAL B CB  1 
ATOM   4238 C CG1 . VAL B 1 10  ? 35.199 43.051  64.469  1.00 65.00  ? 10   VAL B CG1 1 
ATOM   4239 C CG2 . VAL B 1 10  ? 33.047 44.047  63.748  1.00 67.03  ? 10   VAL B CG2 1 
ATOM   4240 N N   . ARG B 1 11  ? 35.224 42.998  67.689  1.00 68.28  ? 11   ARG B N   1 
ATOM   4241 C CA  . ARG B 1 11  ? 36.462 42.881  68.443  1.00 67.90  ? 11   ARG B CA  1 
ATOM   4242 C C   . ARG B 1 11  ? 37.581 42.354  67.537  1.00 65.77  ? 11   ARG B C   1 
ATOM   4243 O O   . ARG B 1 11  ? 37.523 41.231  67.045  1.00 65.78  ? 11   ARG B O   1 
ATOM   4244 C CB  . ARG B 1 11  ? 36.280 42.004  69.695  1.00 70.04  ? 11   ARG B CB  1 
ATOM   4245 C CG  . ARG B 1 11  ? 37.589 41.531  70.330  1.00 71.62  ? 11   ARG B CG  1 
ATOM   4246 C CD  . ARG B 1 11  ? 37.454 41.224  71.816  1.00 77.34  ? 11   ARG B CD  1 
ATOM   4247 N NE  . ARG B 1 11  ? 37.662 42.422  72.638  1.00 80.69  ? 11   ARG B NE  1 
ATOM   4248 C CZ  . ARG B 1 11  ? 36.779 42.904  73.512  1.00 82.56  ? 11   ARG B CZ  1 
ATOM   4249 N NH1 . ARG B 1 11  ? 35.619 42.287  73.705  1.00 85.28  ? 11   ARG B NH1 1 
ATOM   4250 N NH2 . ARG B 1 11  ? 37.062 43.999  74.202  1.00 82.11  ? 11   ARG B NH2 1 
ATOM   4251 N N   . VAL B 1 12  ? 38.579 43.201  67.308  1.00 63.90  ? 12   VAL B N   1 
ATOM   4252 C CA  . VAL B 1 12  ? 39.813 42.815  66.633  1.00 62.06  ? 12   VAL B CA  1 
ATOM   4253 C C   . VAL B 1 12  ? 40.911 42.725  67.700  1.00 62.67  ? 12   VAL B C   1 
ATOM   4254 O O   . VAL B 1 12  ? 40.675 43.092  68.852  1.00 63.82  ? 12   VAL B O   1 
ATOM   4255 C CB  . VAL B 1 12  ? 40.188 43.806  65.501  1.00 60.02  ? 12   VAL B CB  1 
ATOM   4256 C CG1 . VAL B 1 12  ? 39.093 43.857  64.453  1.00 58.96  ? 12   VAL B CG1 1 
ATOM   4257 C CG2 . VAL B 1 12  ? 40.452 45.190  66.051  1.00 59.55  ? 12   VAL B CG2 1 
ATOM   4258 N N   . ARG B 1 13  ? 42.100 42.250  67.331  1.00 61.98  ? 13   ARG B N   1 
ATOM   4259 C CA  . ARG B 1 13  ? 43.152 41.995  68.322  1.00 63.03  ? 13   ARG B CA  1 
ATOM   4260 C C   . ARG B 1 13  ? 43.538 43.200  69.179  1.00 62.19  ? 13   ARG B C   1 
ATOM   4261 O O   . ARG B 1 13  ? 43.893 43.039  70.344  1.00 63.48  ? 13   ARG B O   1 
ATOM   4262 C CB  . ARG B 1 13  ? 44.388 41.351  67.679  1.00 62.99  ? 13   ARG B CB  1 
ATOM   4263 C CG  . ARG B 1 13  ? 44.216 39.848  67.487  1.00 67.87  ? 13   ARG B CG  1 
ATOM   4264 C CD  . ARG B 1 13  ? 45.445 39.156  66.903  1.00 74.13  ? 13   ARG B CD  1 
ATOM   4265 N NE  . ARG B 1 13  ? 45.051 37.895  66.266  1.00 79.44  ? 13   ARG B NE  1 
ATOM   4266 C CZ  . ARG B 1 13  ? 45.855 37.098  65.555  1.00 82.09  ? 13   ARG B CZ  1 
ATOM   4267 N NH1 . ARG B 1 13  ? 47.139 37.402  65.375  1.00 81.88  ? 13   ARG B NH1 1 
ATOM   4268 N NH2 . ARG B 1 13  ? 45.367 35.981  65.019  1.00 83.34  ? 13   ARG B NH2 1 
ATOM   4269 N N   . GLY B 1 14  ? 43.450 44.396  68.607  1.00 60.01  ? 14   GLY B N   1 
ATOM   4270 C CA  . GLY B 1 14  ? 43.798 45.615  69.317  1.00 59.28  ? 14   GLY B CA  1 
ATOM   4271 C C   . GLY B 1 14  ? 42.668 46.290  70.075  1.00 59.60  ? 14   GLY B C   1 
ATOM   4272 O O   . GLY B 1 14  ? 42.867 47.358  70.643  1.00 59.68  ? 14   GLY B O   1 
ATOM   4273 N N   . GLY B 1 15  ? 41.483 45.679  70.087  1.00 59.95  ? 15   GLY B N   1 
ATOM   4274 C CA  . GLY B 1 15  ? 40.324 46.238  70.802  1.00 60.58  ? 15   GLY B CA  1 
ATOM   4275 C C   . GLY B 1 15  ? 39.033 46.283  69.996  1.00 60.32  ? 15   GLY B C   1 
ATOM   4276 O O   . GLY B 1 15  ? 38.933 45.664  68.921  1.00 59.40  ? 15   GLY B O   1 
ATOM   4277 N N   . GLN B 1 16  ? 38.049 47.024  70.512  1.00 60.79  ? 16   GLN B N   1 
ATOM   4278 C CA  . GLN B 1 16  ? 36.701 47.092  69.922  1.00 61.08  ? 16   GLN B CA  1 
ATOM   4279 C C   . GLN B 1 16  ? 36.528 48.219  68.899  1.00 59.50  ? 16   GLN B C   1 
ATOM   4280 O O   . GLN B 1 16  ? 37.152 49.278  69.018  1.00 59.37  ? 16   GLN B O   1 
ATOM   4281 C CB  . GLN B 1 16  ? 35.641 47.232  71.022  1.00 63.29  ? 16   GLN B CB  1 
ATOM   4282 C CG  . GLN B 1 16  ? 35.377 45.964  71.826  1.00 66.22  ? 16   GLN B CG  1 
ATOM   4283 C CD  . GLN B 1 16  ? 34.490 46.222  73.041  1.00 70.74  ? 16   GLN B CD  1 
ATOM   4284 O OE1 . GLN B 1 16  ? 34.924 46.801  74.046  1.00 71.42  ? 16   GLN B OE1 1 
ATOM   4285 N NE2 . GLN B 1 16  ? 33.240 45.791  72.953  1.00 72.48  ? 16   GLN B NE2 1 
ATOM   4286 N N   . LEU B 1 17  ? 35.671 47.982  67.904  1.00 58.73  ? 17   LEU B N   1 
ATOM   4287 C CA  . LEU B 1 17  ? 35.393 48.948  66.837  1.00 57.46  ? 17   LEU B CA  1 
ATOM   4288 C C   . LEU B 1 17  ? 33.901 49.123  66.630  1.00 58.50  ? 17   LEU B C   1 
ATOM   4289 O O   . LEU B 1 17  ? 33.129 48.182  66.815  1.00 59.48  ? 17   LEU B O   1 
ATOM   4290 C CB  . LEU B 1 17  ? 35.990 48.467  65.510  1.00 56.07  ? 17   LEU B CB  1 
ATOM   4291 C CG  . LEU B 1 17  ? 37.505 48.321  65.396  1.00 55.48  ? 17   LEU B CG  1 
ATOM   4292 C CD1 . LEU B 1 17  ? 37.866 47.488  64.183  1.00 53.96  ? 17   LEU B CD1 1 
ATOM   4293 C CD2 . LEU B 1 17  ? 38.193 49.699  65.375  1.00 55.38  ? 17   LEU B CD2 1 
ATOM   4294 N N   . ARG B 1 18  ? 33.503 50.325  66.224  1.00 58.39  ? 18   ARG B N   1 
ATOM   4295 C CA  . ARG B 1 18  ? 32.122 50.593  65.836  1.00 59.31  ? 18   ARG B CA  1 
ATOM   4296 C C   . ARG B 1 18  ? 32.085 51.075  64.397  1.00 58.12  ? 18   ARG B C   1 
ATOM   4297 O O   . ARG B 1 18  ? 32.704 52.091  64.050  1.00 57.33  ? 18   ARG B O   1 
ATOM   4298 C CB  . ARG B 1 18  ? 31.500 51.652  66.739  1.00 61.06  ? 18   ARG B CB  1 
ATOM   4299 C CG  . ARG B 1 18  ? 29.974 51.772  66.629  1.00 63.25  ? 18   ARG B CG  1 
ATOM   4300 C CD  . ARG B 1 18  ? 29.452 53.111  67.192  1.00 66.62  ? 18   ARG B CD  1 
ATOM   4301 N NE  . ARG B 1 18  ? 30.193 53.614  68.363  1.00 67.05  ? 18   ARG B NE  1 
ATOM   4302 C CZ  . ARG B 1 18  ? 30.000 53.216  69.621  1.00 68.70  ? 18   ARG B CZ  1 
ATOM   4303 N NH1 . ARG B 1 18  ? 29.098 52.290  69.916  1.00 69.81  ? 18   ARG B NH1 1 
ATOM   4304 N NH2 . ARG B 1 18  ? 30.725 53.741  70.595  1.00 70.35  ? 18   ARG B NH2 1 
ATOM   4305 N N   . GLY B 1 19  ? 31.356 50.349  63.564  1.00 57.67  ? 19   GLY B N   1 
ATOM   4306 C CA  . GLY B 1 19  ? 31.176 50.756  62.190  1.00 57.03  ? 19   GLY B CA  1 
ATOM   4307 C C   . GLY B 1 19  ? 29.902 51.534  61.946  1.00 58.79  ? 19   GLY B C   1 
ATOM   4308 O O   . GLY B 1 19  ? 29.182 51.909  62.881  1.00 60.70  ? 19   GLY B O   1 
ATOM   4309 N N   . ILE B 1 20  ? 29.623 51.774  60.674  1.00 58.63  ? 20   ILE B N   1 
ATOM   4310 C CA  . ILE B 1 20  ? 28.439 52.504  60.268  1.00 60.54  ? 20   ILE B CA  1 
ATOM   4311 C C   . ILE B 1 20  ? 27.729 51.736  59.160  1.00 61.45  ? 20   ILE B C   1 
ATOM   4312 O O   . ILE B 1 20  ? 28.372 51.238  58.232  1.00 60.36  ? 20   ILE B O   1 
ATOM   4313 C CB  . ILE B 1 20  ? 28.799 53.933  59.800  1.00 60.09  ? 20   ILE B CB  1 
ATOM   4314 C CG1 . ILE B 1 20  ? 27.534 54.698  59.381  1.00 61.79  ? 20   ILE B CG1 1 
ATOM   4315 C CG2 . ILE B 1 20  ? 29.888 53.899  58.700  1.00 57.45  ? 20   ILE B CG2 1 
ATOM   4316 C CD1 . ILE B 1 20  ? 27.754 56.153  59.017  1.00 62.57  ? 20   ILE B CD1 1 
ATOM   4317 N N   . ARG B 1 21  ? 26.411 51.629  59.270  1.00 64.11  ? 21   ARG B N   1 
ATOM   4318 C CA  . ARG B 1 21  ? 25.601 51.004  58.233  1.00 65.58  ? 21   ARG B CA  1 
ATOM   4319 C C   . ARG B 1 21  ? 25.378 51.983  57.092  1.00 65.69  ? 21   ARG B C   1 
ATOM   4320 O O   . ARG B 1 21  ? 24.882 53.092  57.298  1.00 66.88  ? 21   ARG B O   1 
ATOM   4321 C CB  . ARG B 1 21  ? 24.256 50.528  58.804  1.00 68.41  ? 21   ARG B CB  1 
ATOM   4322 C CG  . ARG B 1 21  ? 23.322 49.926  57.766  1.00 71.14  ? 21   ARG B CG  1 
ATOM   4323 C CD  . ARG B 1 21  ? 22.176 49.179  58.395  1.00 76.73  ? 21   ARG B CD  1 
ATOM   4324 N NE  . ARG B 1 21  ? 21.182 50.074  58.980  1.00 81.68  ? 21   ARG B NE  1 
ATOM   4325 C CZ  . ARG B 1 21  ? 20.134 50.575  58.329  1.00 84.75  ? 21   ARG B CZ  1 
ATOM   4326 N NH1 . ARG B 1 21  ? 19.927 50.282  57.045  1.00 84.98  ? 21   ARG B NH1 1 
ATOM   4327 N NH2 . ARG B 1 21  ? 19.292 51.379  58.970  1.00 87.29  ? 21   ARG B NH2 1 
ATOM   4328 N N   . LEU B 1 22  ? 25.749 51.560  55.892  1.00 64.97  ? 22   LEU B N   1 
ATOM   4329 C CA  . LEU B 1 22  ? 25.552 52.358  54.690  1.00 65.82  ? 22   LEU B CA  1 
ATOM   4330 C C   . LEU B 1 22  ? 24.452 51.734  53.849  1.00 67.78  ? 22   LEU B C   1 
ATOM   4331 O O   . LEU B 1 22  ? 24.281 50.510  53.842  1.00 68.06  ? 22   LEU B O   1 
ATOM   4332 C CB  . LEU B 1 22  ? 26.849 52.425  53.874  1.00 63.57  ? 22   LEU B CB  1 
ATOM   4333 C CG  . LEU B 1 22  ? 28.134 52.927  54.550  1.00 62.38  ? 22   LEU B CG  1 
ATOM   4334 C CD1 . LEU B 1 22  ? 29.272 53.035  53.547  1.00 61.05  ? 22   LEU B CD1 1 
ATOM   4335 C CD2 . LEU B 1 22  ? 27.922 54.270  55.245  1.00 63.63  ? 22   LEU B CD2 1 
ATOM   4336 N N   . LYS B 1 23  ? 23.687 52.567  53.152  1.00 69.75  ? 23   LYS B N   1 
ATOM   4337 C CA  . LYS B 1 23  ? 22.715 52.036  52.202  1.00 71.50  ? 23   LYS B CA  1 
ATOM   4338 C C   . LYS B 1 23  ? 23.412 51.897  50.860  1.00 70.25  ? 23   LYS B C   1 
ATOM   4339 O O   . LYS B 1 23  ? 24.220 52.745  50.473  1.00 69.12  ? 23   LYS B O   1 
ATOM   4340 C CB  . LYS B 1 23  ? 21.436 52.888  52.110  1.00 74.11  ? 23   LYS B CB  1 
ATOM   4341 C CG  . LYS B 1 23  ? 20.253 52.211  51.338  1.00 75.97  ? 23   LYS B CG  1 
ATOM   4342 C CD  . LYS B 1 23  ? 19.046 51.752  52.208  1.00 76.57  ? 23   LYS B CD  1 
ATOM   4343 C CE  . LYS B 1 23  ? 19.050 50.265  52.593  1.00 73.60  ? 23   LYS B CE  1 
ATOM   4344 N NZ  . LYS B 1 23  ? 19.511 50.075  54.000  1.00 70.49  ? 23   LYS B NZ  1 
ATOM   4345 N N   . ALA B 1 24  ? 23.148 50.771  50.207  1.00 70.78  ? 24   ALA B N   1 
ATOM   4346 C CA  . ALA B 1 24  ? 23.542 50.519  48.830  1.00 69.88  ? 24   ALA B CA  1 
ATOM   4347 C C   . ALA B 1 24  ? 22.237 50.223  48.088  1.00 72.48  ? 24   ALA B C   1 
ATOM   4348 O O   . ALA B 1 24  ? 21.287 49.717  48.694  1.00 74.36  ? 24   ALA B O   1 
ATOM   4349 C CB  . ALA B 1 24  ? 24.483 49.340  48.768  1.00 68.01  ? 24   ALA B CB  1 
ATOM   4350 N N   . PRO B 1 25  ? 22.165 50.555  46.784  1.00 72.80  ? 25   PRO B N   1 
ATOM   4351 C CA  . PRO B 1 25  ? 20.874 50.492  46.061  1.00 75.20  ? 25   PRO B CA  1 
ATOM   4352 C C   . PRO B 1 25  ? 20.058 49.210  46.307  1.00 76.47  ? 25   PRO B C   1 
ATOM   4353 O O   . PRO B 1 25  ? 18.834 49.280  46.412  1.00 79.26  ? 25   PRO B O   1 
ATOM   4354 C CB  . PRO B 1 25  ? 21.288 50.604  44.585  1.00 74.48  ? 25   PRO B CB  1 
ATOM   4355 C CG  . PRO B 1 25  ? 22.813 50.412  44.578  1.00 71.58  ? 25   PRO B CG  1 
ATOM   4356 C CD  . PRO B 1 25  ? 23.254 50.979  45.891  1.00 70.59  ? 25   PRO B CD  1 
ATOM   4357 N N   . GLY B 1 26  ? 20.734 48.066  46.424  1.00 74.70  ? 26   GLY B N   1 
ATOM   4358 C CA  . GLY B 1 26  ? 20.069 46.782  46.678  1.00 75.70  ? 26   GLY B CA  1 
ATOM   4359 C C   . GLY B 1 26  ? 19.798 46.416  48.137  1.00 76.26  ? 26   GLY B C   1 
ATOM   4360 O O   . GLY B 1 26  ? 19.094 45.442  48.411  1.00 77.90  ? 26   GLY B O   1 
ATOM   4361 N N   . GLY B 1 27  ? 20.350 47.186  49.074  1.00 74.81  ? 27   GLY B N   1 
ATOM   4362 C CA  . GLY B 1 27  ? 20.231 46.884  50.503  1.00 75.01  ? 27   GLY B CA  1 
ATOM   4363 C C   . GLY B 1 27  ? 21.381 47.446  51.326  1.00 72.75  ? 27   GLY B C   1 
ATOM   4364 O O   . GLY B 1 27  ? 22.236 48.138  50.787  1.00 71.12  ? 27   GLY B O   1 
ATOM   4365 N N   . PRO B 1 28  ? 21.401 47.168  52.644  1.00 72.94  ? 28   PRO B N   1 
ATOM   4366 C CA  . PRO B 1 28  ? 22.444 47.674  53.546  1.00 70.94  ? 28   PRO B CA  1 
ATOM   4367 C C   . PRO B 1 28  ? 23.782 46.914  53.526  1.00 68.28  ? 28   PRO B C   1 
ATOM   4368 O O   . PRO B 1 28  ? 23.815 45.727  53.203  1.00 68.33  ? 28   PRO B O   1 
ATOM   4369 C CB  . PRO B 1 28  ? 21.788 47.555  54.925  1.00 72.91  ? 28   PRO B CB  1 
ATOM   4370 C CG  . PRO B 1 28  ? 20.843 46.418  54.803  1.00 74.58  ? 28   PRO B CG  1 
ATOM   4371 C CD  . PRO B 1 28  ? 20.376 46.388  53.369  1.00 75.45  ? 28   PRO B CD  1 
ATOM   4372 N N   . VAL B 1 29  ? 24.864 47.628  53.856  1.00 66.09  ? 29   VAL B N   1 
ATOM   4373 C CA  . VAL B 1 29  ? 26.209 47.062  54.080  1.00 63.59  ? 29   VAL B CA  1 
ATOM   4374 C C   . VAL B 1 29  ? 26.804 47.617  55.373  1.00 62.69  ? 29   VAL B C   1 
ATOM   4375 O O   . VAL B 1 29  ? 26.396 48.683  55.845  1.00 63.43  ? 29   VAL B O   1 
ATOM   4376 C CB  . VAL B 1 29  ? 27.214 47.402  52.944  1.00 61.72  ? 29   VAL B CB  1 
ATOM   4377 C CG1 . VAL B 1 29  ? 26.796 46.762  51.625  1.00 62.43  ? 29   VAL B CG1 1 
ATOM   4378 C CG2 . VAL B 1 29  ? 27.372 48.905  52.791  1.00 61.58  ? 29   VAL B CG2 1 
ATOM   4379 N N   . SER B 1 30  ? 27.769 46.895  55.935  1.00 61.03  ? 30   SER B N   1 
ATOM   4380 C CA  . SER B 1 30  ? 28.492 47.346  57.114  1.00 60.09  ? 30   SER B CA  1 
ATOM   4381 C C   . SER B 1 30  ? 29.826 47.931  56.674  1.00 57.71  ? 30   SER B C   1 
ATOM   4382 O O   . SER B 1 30  ? 30.612 47.257  56.010  1.00 57.05  ? 30   SER B O   1 
ATOM   4383 C CB  . SER B 1 30  ? 28.725 46.178  58.079  1.00 60.50  ? 30   SER B CB  1 
ATOM   4384 O OG  . SER B 1 30  ? 27.502 45.596  58.515  1.00 62.80  ? 30   SER B OG  1 
ATOM   4385 N N   . ALA B 1 31  ? 30.086 49.184  57.022  1.00 56.94  ? 31   ALA B N   1 
ATOM   4386 C CA  . ALA B 1 31  ? 31.400 49.778  56.754  1.00 54.41  ? 31   ALA B CA  1 
ATOM   4387 C C   . ALA B 1 31  ? 32.151 50.050  58.045  1.00 53.59  ? 31   ALA B C   1 
ATOM   4388 O O   . ALA B 1 31  ? 31.579 50.527  59.022  1.00 54.68  ? 31   ALA B O   1 
ATOM   4389 C CB  . ALA B 1 31  ? 31.270 51.055  55.934  1.00 54.41  ? 31   ALA B CB  1 
ATOM   4390 N N   . PHE B 1 32  ? 33.434 49.716  58.037  1.00 51.60  ? 32   PHE B N   1 
ATOM   4391 C CA  . PHE B 1 32  ? 34.338 49.993  59.143  1.00 50.58  ? 32   PHE B CA  1 
ATOM   4392 C C   . PHE B 1 32  ? 35.485 50.800  58.566  1.00 49.02  ? 32   PHE B C   1 
ATOM   4393 O O   . PHE B 1 32  ? 36.389 50.259  57.945  1.00 47.72  ? 32   PHE B O   1 
ATOM   4394 C CB  . PHE B 1 32  ? 34.832 48.695  59.772  1.00 49.93  ? 32   PHE B CB  1 
ATOM   4395 C CG  . PHE B 1 32  ? 33.730 47.820  60.267  1.00 51.48  ? 32   PHE B CG  1 
ATOM   4396 C CD1 . PHE B 1 32  ? 33.155 46.858  59.436  1.00 51.59  ? 32   PHE B CD1 1 
ATOM   4397 C CD2 . PHE B 1 32  ? 33.241 47.963  61.558  1.00 52.39  ? 32   PHE B CD2 1 
ATOM   4398 C CE1 . PHE B 1 32  ? 32.126 46.053  59.893  1.00 52.06  ? 32   PHE B CE1 1 
ATOM   4399 C CE2 . PHE B 1 32  ? 32.205 47.163  62.023  1.00 52.97  ? 32   PHE B CE2 1 
ATOM   4400 C CZ  . PHE B 1 32  ? 31.653 46.206  61.191  1.00 53.72  ? 32   PHE B CZ  1 
ATOM   4401 N N   . LEU B 1 33  ? 35.422 52.107  58.757  1.00 49.45  ? 33   LEU B N   1 
ATOM   4402 C CA  . LEU B 1 33  ? 36.320 53.020  58.070  1.00 48.63  ? 33   LEU B CA  1 
ATOM   4403 C C   . LEU B 1 33  ? 37.326 53.665  59.032  1.00 48.79  ? 33   LEU B C   1 
ATOM   4404 O O   . LEU B 1 33  ? 36.990 53.972  60.175  1.00 50.06  ? 33   LEU B O   1 
ATOM   4405 C CB  . LEU B 1 33  ? 35.493 54.073  57.320  1.00 48.94  ? 33   LEU B CB  1 
ATOM   4406 C CG  . LEU B 1 33  ? 34.308 53.510  56.519  1.00 48.43  ? 33   LEU B CG  1 
ATOM   4407 C CD1 . LEU B 1 33  ? 33.378 54.605  56.055  1.00 48.12  ? 33   LEU B CD1 1 
ATOM   4408 C CD2 . LEU B 1 33  ? 34.784 52.667  55.333  1.00 46.17  ? 33   LEU B CD2 1 
ATOM   4409 N N   . GLY B 1 34  ? 38.561 53.851  58.572  1.00 47.75  ? 34   GLY B N   1 
ATOM   4410 C CA  . GLY B 1 34  ? 39.590 54.505  59.385  1.00 47.65  ? 34   GLY B CA  1 
ATOM   4411 C C   . GLY B 1 34  ? 40.146 53.670  60.530  1.00 47.80  ? 34   GLY B C   1 
ATOM   4412 O O   . GLY B 1 34  ? 40.397 54.199  61.611  1.00 48.48  ? 34   GLY B O   1 
ATOM   4413 N N   . ILE B 1 35  ? 40.355 52.373  60.295  1.00 47.17  ? 35   ILE B N   1 
ATOM   4414 C CA  . ILE B 1 35  ? 40.929 51.488  61.310  1.00 47.36  ? 35   ILE B CA  1 
ATOM   4415 C C   . ILE B 1 35  ? 42.455 51.576  61.313  1.00 47.07  ? 35   ILE B C   1 
ATOM   4416 O O   . ILE B 1 35  ? 43.086 51.324  60.298  1.00 46.82  ? 35   ILE B O   1 
ATOM   4417 C CB  . ILE B 1 35  ? 40.524 50.014  61.085  1.00 47.18  ? 35   ILE B CB  1 
ATOM   4418 C CG1 . ILE B 1 35  ? 39.005 49.881  60.882  1.00 46.67  ? 35   ILE B CG1 1 
ATOM   4419 C CG2 . ILE B 1 35  ? 41.033 49.147  62.248  1.00 47.94  ? 35   ILE B CG2 1 
ATOM   4420 C CD1 . ILE B 1 35  ? 38.533 48.495  60.527  1.00 43.36  ? 35   ILE B CD1 1 
ATOM   4421 N N   . PRO B 1 36  ? 43.065 51.920  62.457  1.00 47.99  ? 36   PRO B N   1 
ATOM   4422 C CA  . PRO B 1 36  ? 44.529 52.009  62.433  1.00 47.42  ? 36   PRO B CA  1 
ATOM   4423 C C   . PRO B 1 36  ? 45.167 50.630  62.351  1.00 47.38  ? 36   PRO B C   1 
ATOM   4424 O O   . PRO B 1 36  ? 44.738 49.715  63.064  1.00 48.42  ? 36   PRO B O   1 
ATOM   4425 C CB  . PRO B 1 36  ? 44.861 52.662  63.767  1.00 47.69  ? 36   PRO B CB  1 
ATOM   4426 C CG  . PRO B 1 36  ? 43.721 52.342  64.646  1.00 49.18  ? 36   PRO B CG  1 
ATOM   4427 C CD  . PRO B 1 36  ? 42.505 52.223  63.787  1.00 48.95  ? 36   PRO B CD  1 
ATOM   4428 N N   . PHE B 1 37  ? 46.162 50.472  61.480  1.00 46.63  ? 37   PHE B N   1 
ATOM   4429 C CA  . PHE B 1 37  ? 46.893 49.197  61.399  1.00 46.56  ? 37   PHE B CA  1 
ATOM   4430 C C   . PHE B 1 37  ? 48.355 49.347  61.787  1.00 47.01  ? 37   PHE B C   1 
ATOM   4431 O O   . PHE B 1 37  ? 49.103 48.360  61.831  1.00 47.19  ? 37   PHE B O   1 
ATOM   4432 C CB  . PHE B 1 37  ? 46.737 48.507  60.024  1.00 45.56  ? 37   PHE B CB  1 
ATOM   4433 C CG  . PHE B 1 37  ? 47.331 49.272  58.860  1.00 44.32  ? 37   PHE B CG  1 
ATOM   4434 C CD1 . PHE B 1 37  ? 48.672 49.143  58.531  1.00 45.08  ? 37   PHE B CD1 1 
ATOM   4435 C CD2 . PHE B 1 37  ? 46.534 50.085  58.067  1.00 43.16  ? 37   PHE B CD2 1 
ATOM   4436 C CE1 . PHE B 1 37  ? 49.216 49.848  57.445  1.00 44.27  ? 37   PHE B CE1 1 
ATOM   4437 C CE2 . PHE B 1 37  ? 47.063 50.779  56.985  1.00 41.92  ? 37   PHE B CE2 1 
ATOM   4438 C CZ  . PHE B 1 37  ? 48.404 50.658  56.670  1.00 42.23  ? 37   PHE B CZ  1 
ATOM   4439 N N   . ALA B 1 38  ? 48.749 50.585  62.088  1.00 47.38  ? 38   ALA B N   1 
ATOM   4440 C CA  . ALA B 1 38  ? 50.130 50.900  62.447  1.00 47.84  ? 38   ALA B CA  1 
ATOM   4441 C C   . ALA B 1 38  ? 50.205 52.152  63.310  1.00 48.74  ? 38   ALA B C   1 
ATOM   4442 O O   . ALA B 1 38  ? 49.282 52.968  63.320  1.00 48.79  ? 38   ALA B O   1 
ATOM   4443 C CB  . ALA B 1 38  ? 50.978 51.073  61.188  1.00 46.87  ? 38   ALA B CB  1 
ATOM   4444 N N   . GLU B 1 39  ? 51.309 52.289  64.039  1.00 49.66  ? 39   GLU B N   1 
ATOM   4445 C CA  . GLU B 1 39  ? 51.625 53.517  64.756  1.00 50.53  ? 39   GLU B CA  1 
ATOM   4446 C C   . GLU B 1 39  ? 51.837 54.642  63.742  1.00 50.39  ? 39   GLU B C   1 
ATOM   4447 O O   . GLU B 1 39  ? 52.511 54.445  62.730  1.00 49.98  ? 39   GLU B O   1 
ATOM   4448 C CB  . GLU B 1 39  ? 52.881 53.331  65.610  1.00 51.19  ? 39   GLU B CB  1 
ATOM   4449 C CG  . GLU B 1 39  ? 52.719 52.328  66.722  1.00 51.89  ? 39   GLU B CG  1 
ATOM   4450 C CD  . GLU B 1 39  ? 51.832 52.844  67.849  1.00 54.11  ? 39   GLU B CD  1 
ATOM   4451 O OE1 . GLU B 1 39  ? 52.344 53.615  68.693  1.00 55.78  ? 39   GLU B OE1 1 
ATOM   4452 O OE2 . GLU B 1 39  ? 50.632 52.467  67.900  1.00 52.72  ? 39   GLU B OE2 1 
ATOM   4453 N N   . PRO B 1 40  ? 51.247 55.822  63.995  1.00 51.02  ? 40   PRO B N   1 
ATOM   4454 C CA  . PRO B 1 40  ? 51.435 56.948  63.064  1.00 51.03  ? 40   PRO B CA  1 
ATOM   4455 C C   . PRO B 1 40  ? 52.918 57.188  62.745  1.00 51.51  ? 40   PRO B C   1 
ATOM   4456 O O   . PRO B 1 40  ? 53.699 57.456  63.658  1.00 52.97  ? 40   PRO B O   1 
ATOM   4457 C CB  . PRO B 1 40  ? 50.859 58.135  63.841  1.00 52.17  ? 40   PRO B CB  1 
ATOM   4458 C CG  . PRO B 1 40  ? 49.840 57.503  64.769  1.00 51.85  ? 40   PRO B CG  1 
ATOM   4459 C CD  . PRO B 1 40  ? 50.389 56.171  65.144  1.00 51.16  ? 40   PRO B CD  1 
ATOM   4460 N N   . PRO B 1 41  ? 53.305 57.114  61.455  1.00 50.82  ? 41   PRO B N   1 
ATOM   4461 C CA  . PRO B 1 41  ? 54.722 57.137  61.077  1.00 51.16  ? 41   PRO B CA  1 
ATOM   4462 C C   . PRO B 1 41  ? 55.307 58.543  61.092  1.00 52.39  ? 41   PRO B C   1 
ATOM   4463 O O   . PRO B 1 41  ? 55.853 59.001  60.083  1.00 52.44  ? 41   PRO B O   1 
ATOM   4464 C CB  . PRO B 1 41  ? 54.704 56.587  59.656  1.00 49.86  ? 41   PRO B CB  1 
ATOM   4465 C CG  . PRO B 1 41  ? 53.396 57.022  59.123  1.00 49.17  ? 41   PRO B CG  1 
ATOM   4466 C CD  . PRO B 1 41  ? 52.428 57.047  60.273  1.00 49.41  ? 41   PRO B CD  1 
ATOM   4467 N N   . VAL B 1 42  ? 55.230 59.195  62.249  1.00 53.85  ? 42   VAL B N   1 
ATOM   4468 C CA  . VAL B 1 42  ? 55.565 60.612  62.379  1.00 55.11  ? 42   VAL B CA  1 
ATOM   4469 C C   . VAL B 1 42  ? 56.805 60.891  63.237  1.00 56.91  ? 42   VAL B C   1 
ATOM   4470 O O   . VAL B 1 42  ? 57.292 60.019  63.955  1.00 57.34  ? 42   VAL B O   1 
ATOM   4471 C CB  . VAL B 1 42  ? 54.350 61.417  62.907  1.00 55.54  ? 42   VAL B CB  1 
ATOM   4472 C CG1 . VAL B 1 42  ? 53.127 61.196  61.992  1.00 53.60  ? 42   VAL B CG1 1 
ATOM   4473 C CG2 . VAL B 1 42  ? 54.039 61.052  64.341  1.00 55.22  ? 42   VAL B CG2 1 
ATOM   4474 N N   . GLY B 1 43  ? 57.304 62.120  63.153  1.00 58.37  ? 43   GLY B N   1 
ATOM   4475 C CA  . GLY B 1 43  ? 58.501 62.523  63.877  1.00 60.34  ? 43   GLY B CA  1 
ATOM   4476 C C   . GLY B 1 43  ? 59.684 61.668  63.462  1.00 60.77  ? 43   GLY B C   1 
ATOM   4477 O O   . GLY B 1 43  ? 60.129 61.718  62.309  1.00 60.43  ? 43   GLY B O   1 
ATOM   4478 N N   . SER B 1 44  ? 60.176 60.868  64.405  1.00 61.66  ? 44   SER B N   1 
ATOM   4479 C CA  . SER B 1 44  ? 61.358 60.033  64.186  1.00 62.14  ? 44   SER B CA  1 
ATOM   4480 C C   . SER B 1 44  ? 61.010 58.800  63.367  1.00 60.17  ? 44   SER B C   1 
ATOM   4481 O O   . SER B 1 44  ? 61.887 58.167  62.782  1.00 60.25  ? 44   SER B O   1 
ATOM   4482 C CB  . SER B 1 44  ? 61.995 59.624  65.521  1.00 63.82  ? 44   SER B CB  1 
ATOM   4483 O OG  . SER B 1 44  ? 61.239 58.607  66.162  1.00 63.55  ? 44   SER B OG  1 
ATOM   4484 N N   . ARG B 1 45  ? 59.725 58.465  63.319  1.00 58.60  ? 45   ARG B N   1 
ATOM   4485 C CA  . ARG B 1 45  ? 59.278 57.316  62.533  1.00 56.64  ? 45   ARG B CA  1 
ATOM   4486 C C   . ARG B 1 45  ? 59.179 57.610  61.034  1.00 55.26  ? 45   ARG B C   1 
ATOM   4487 O O   . ARG B 1 45  ? 58.928 56.704  60.254  1.00 54.89  ? 45   ARG B O   1 
ATOM   4488 C CB  . ARG B 1 45  ? 57.972 56.740  63.082  1.00 55.78  ? 45   ARG B CB  1 
ATOM   4489 C CG  . ARG B 1 45  ? 58.118 56.058  64.442  1.00 57.50  ? 45   ARG B CG  1 
ATOM   4490 C CD  . ARG B 1 45  ? 56.819 55.382  64.904  1.00 60.06  ? 45   ARG B CD  1 
ATOM   4491 N NE  . ARG B 1 45  ? 56.662 55.435  66.365  1.00 64.46  ? 45   ARG B NE  1 
ATOM   4492 C CZ  . ARG B 1 45  ? 55.668 56.057  67.012  1.00 64.96  ? 45   ARG B CZ  1 
ATOM   4493 N NH1 . ARG B 1 45  ? 54.687 56.669  66.342  1.00 62.81  ? 45   ARG B NH1 1 
ATOM   4494 N NH2 . ARG B 1 45  ? 55.648 56.055  68.342  1.00 65.96  ? 45   ARG B NH2 1 
ATOM   4495 N N   . ARG B 1 46  ? 59.399 58.858  60.628  1.00 55.22  ? 46   ARG B N   1 
ATOM   4496 C CA  . ARG B 1 46  ? 59.428 59.226  59.206  1.00 53.91  ? 46   ARG B CA  1 
ATOM   4497 C C   . ARG B 1 46  ? 60.528 58.471  58.453  1.00 54.13  ? 46   ARG B C   1 
ATOM   4498 O O   . ARG B 1 46  ? 61.666 58.376  58.947  1.00 55.24  ? 46   ARG B O   1 
ATOM   4499 C CB  . ARG B 1 46  ? 59.628 60.741  59.030  1.00 54.62  ? 46   ARG B CB  1 
ATOM   4500 C CG  . ARG B 1 46  ? 59.458 61.211  57.596  1.00 52.29  ? 46   ARG B CG  1 
ATOM   4501 C CD  . ARG B 1 46  ? 59.873 62.638  57.428  1.00 52.73  ? 46   ARG B CD  1 
ATOM   4502 N NE  . ARG B 1 46  ? 58.763 63.574  57.571  1.00 53.03  ? 46   ARG B NE  1 
ATOM   4503 C CZ  . ARG B 1 46  ? 58.900 64.898  57.588  1.00 53.24  ? 46   ARG B CZ  1 
ATOM   4504 N NH1 . ARG B 1 46  ? 60.104 65.438  57.476  1.00 55.26  ? 46   ARG B NH1 1 
ATOM   4505 N NH2 . ARG B 1 46  ? 57.838 65.682  57.720  1.00 52.36  ? 46   ARG B NH2 1 
ATOM   4506 N N   . PHE B 1 47  ? 60.176 57.952  57.265  1.00 52.72  ? 47   PHE B N   1 
ATOM   4507 C CA  . PHE B 1 47  ? 61.071 57.153  56.393  1.00 52.46  ? 47   PHE B CA  1 
ATOM   4508 C C   . PHE B 1 47  ? 61.337 55.733  56.912  1.00 53.16  ? 47   PHE B C   1 
ATOM   4509 O O   . PHE B 1 47  ? 62.058 54.956  56.274  1.00 53.37  ? 47   PHE B O   1 
ATOM   4510 C CB  . PHE B 1 47  ? 62.430 57.846  56.132  1.00 53.12  ? 47   PHE B CB  1 
ATOM   4511 C CG  . PHE B 1 47  ? 62.331 59.275  55.671  1.00 51.78  ? 47   PHE B CG  1 
ATOM   4512 C CD1 . PHE B 1 47  ? 61.558 59.623  54.560  1.00 49.68  ? 47   PHE B CD1 1 
ATOM   4513 C CD2 . PHE B 1 47  ? 63.048 60.274  56.334  1.00 51.70  ? 47   PHE B CD2 1 
ATOM   4514 C CE1 . PHE B 1 47  ? 61.480 60.951  54.123  1.00 50.25  ? 47   PHE B CE1 1 
ATOM   4515 C CE2 . PHE B 1 47  ? 62.989 61.607  55.908  1.00 51.86  ? 47   PHE B CE2 1 
ATOM   4516 C CZ  . PHE B 1 47  ? 62.205 61.948  54.800  1.00 52.69  ? 47   PHE B CZ  1 
ATOM   4517 N N   . MET B 1 48  ? 60.766 55.395  58.067  1.00 54.04  ? 48   MET B N   1 
ATOM   4518 C CA  . MET B 1 48  ? 61.032 54.103  58.711  1.00 55.14  ? 48   MET B CA  1 
ATOM   4519 C C   . MET B 1 48  ? 59.982 53.032  58.381  1.00 53.23  ? 48   MET B C   1 
ATOM   4520 O O   . MET B 1 48  ? 58.839 53.360  58.054  1.00 51.86  ? 48   MET B O   1 
ATOM   4521 C CB  . MET B 1 48  ? 61.123 54.293  60.221  1.00 56.77  ? 48   MET B CB  1 
ATOM   4522 C CG  . MET B 1 48  ? 62.231 55.225  60.635  1.00 61.74  ? 48   MET B CG  1 
ATOM   4523 S SD  . MET B 1 48  ? 63.729 54.364  61.144  1.00 70.69  ? 48   MET B SD  1 
ATOM   4524 C CE  . MET B 1 48  ? 63.609 54.673  62.913  1.00 69.68  ? 48   MET B CE  1 
ATOM   4525 N N   . PRO B 1 49  ? 60.375 51.744  58.463  1.00 53.22  ? 49   PRO B N   1 
ATOM   4526 C CA  . PRO B 1 49  ? 59.396 50.656  58.386  1.00 52.11  ? 49   PRO B CA  1 
ATOM   4527 C C   . PRO B 1 49  ? 58.305 50.885  59.429  1.00 51.78  ? 49   PRO B C   1 
ATOM   4528 O O   . PRO B 1 49  ? 58.611 51.358  60.526  1.00 52.60  ? 49   PRO B O   1 
ATOM   4529 C CB  . PRO B 1 49  ? 60.213 49.411  58.763  1.00 52.90  ? 49   PRO B CB  1 
ATOM   4530 C CG  . PRO B 1 49  ? 61.606 49.759  58.489  1.00 53.80  ? 49   PRO B CG  1 
ATOM   4531 C CD  . PRO B 1 49  ? 61.749 51.241  58.638  1.00 54.32  ? 49   PRO B CD  1 
ATOM   4532 N N   . PRO B 1 50  ? 57.042 50.567  59.091  1.00 50.69  ? 50   PRO B N   1 
ATOM   4533 C CA  . PRO B 1 50  ? 55.940 50.796  60.032  1.00 50.69  ? 50   PRO B CA  1 
ATOM   4534 C C   . PRO B 1 50  ? 55.984 49.823  61.199  1.00 51.87  ? 50   PRO B C   1 
ATOM   4535 O O   . PRO B 1 50  ? 56.482 48.715  61.051  1.00 52.57  ? 50   PRO B O   1 
ATOM   4536 C CB  . PRO B 1 50  ? 54.689 50.550  59.181  1.00 48.98  ? 50   PRO B CB  1 
ATOM   4537 C CG  . PRO B 1 50  ? 55.126 49.668  58.099  1.00 48.51  ? 50   PRO B CG  1 
ATOM   4538 C CD  . PRO B 1 50  ? 56.573 49.981  57.822  1.00 49.33  ? 50   PRO B CD  1 
ATOM   4539 N N   . GLU B 1 51  ? 55.479 50.245  62.350  1.00 53.05  ? 51   GLU B N   1 
ATOM   4540 C CA  . GLU B 1 51  ? 55.346 49.375  63.516  1.00 54.67  ? 51   GLU B CA  1 
ATOM   4541 C C   . GLU B 1 51  ? 53.863 49.066  63.753  1.00 53.35  ? 51   GLU B C   1 
ATOM   4542 O O   . GLU B 1 51  ? 53.013 49.931  63.555  1.00 52.47  ? 51   GLU B O   1 
ATOM   4543 C CB  . GLU B 1 51  ? 55.967 50.044  64.748  1.00 56.68  ? 51   GLU B CB  1 
ATOM   4544 C CG  . GLU B 1 51  ? 57.461 50.366  64.594  1.00 61.97  ? 51   GLU B CG  1 
ATOM   4545 C CD  . GLU B 1 51  ? 57.968 51.446  65.574  1.00 69.63  ? 51   GLU B CD  1 
ATOM   4546 O OE1 . GLU B 1 51  ? 58.765 52.320  65.133  1.00 72.10  ? 51   GLU B OE1 1 
ATOM   4547 O OE2 . GLU B 1 51  ? 57.578 51.424  66.776  1.00 71.58  ? 51   GLU B OE2 1 
ATOM   4548 N N   . PRO B 1 52  ? 53.545 47.825  64.154  1.00 53.50  ? 52   PRO B N   1 
ATOM   4549 C CA  . PRO B 1 52  ? 52.143 47.470  64.425  1.00 53.10  ? 52   PRO B CA  1 
ATOM   4550 C C   . PRO B 1 52  ? 51.498 48.346  65.502  1.00 53.33  ? 52   PRO B C   1 
ATOM   4551 O O   . PRO B 1 52  ? 52.133 48.669  66.501  1.00 54.03  ? 52   PRO B O   1 
ATOM   4552 C CB  . PRO B 1 52  ? 52.218 46.005  64.894  1.00 54.06  ? 52   PRO B CB  1 
ATOM   4553 C CG  . PRO B 1 52  ? 53.679 45.773  65.258  1.00 55.28  ? 52   PRO B CG  1 
ATOM   4554 C CD  . PRO B 1 52  ? 54.462 46.684  64.357  1.00 54.46  ? 52   PRO B CD  1 
ATOM   4555 N N   . LYS B 1 53  ? 50.239 48.712  65.272  1.00 52.51  ? 53   LYS B N   1 
ATOM   4556 C CA  . LYS B 1 53  ? 49.477 49.603  66.142  1.00 52.70  ? 53   LYS B CA  1 
ATOM   4557 C C   . LYS B 1 53  ? 49.265 48.996  67.528  1.00 54.21  ? 53   LYS B C   1 
ATOM   4558 O O   . LYS B 1 53  ? 48.834 47.846  67.645  1.00 54.58  ? 53   LYS B O   1 
ATOM   4559 C CB  . LYS B 1 53  ? 48.127 49.948  65.486  1.00 51.45  ? 53   LYS B CB  1 
ATOM   4560 C CG  . LYS B 1 53  ? 47.145 50.733  66.350  1.00 50.95  ? 53   LYS B CG  1 
ATOM   4561 C CD  . LYS B 1 53  ? 47.473 52.232  66.421  1.00 49.25  ? 53   LYS B CD  1 
ATOM   4562 C CE  . LYS B 1 53  ? 46.448 53.004  67.281  1.00 47.93  ? 53   LYS B CE  1 
ATOM   4563 N NZ  . LYS B 1 53  ? 46.551 52.686  68.745  1.00 46.26  ? 53   LYS B NZ  1 
ATOM   4564 N N   . ARG B 1 54  ? 49.584 49.775  68.566  1.00 54.93  ? 54   ARG B N   1 
ATOM   4565 C CA  . ARG B 1 54  ? 49.323 49.381  69.950  1.00 56.18  ? 54   ARG B CA  1 
ATOM   4566 C C   . ARG B 1 54  ? 47.811 49.292  70.199  1.00 55.95  ? 54   ARG B C   1 
ATOM   4567 O O   . ARG B 1 54  ? 47.036 50.015  69.575  1.00 55.03  ? 54   ARG B O   1 
ATOM   4568 C CB  . ARG B 1 54  ? 49.956 50.380  70.928  1.00 57.16  ? 54   ARG B CB  1 
ATOM   4569 C CG  . ARG B 1 54  ? 51.454 50.608  70.731  1.00 57.69  ? 54   ARG B CG  1 
ATOM   4570 C CD  . ARG B 1 54  ? 51.971 51.763  71.577  1.00 58.21  ? 54   ARG B CD  1 
ATOM   4571 N NE  . ARG B 1 54  ? 51.329 53.023  71.209  1.00 58.67  ? 54   ARG B NE  1 
ATOM   4572 C CZ  . ARG B 1 54  ? 50.551 53.742  72.016  1.00 59.35  ? 54   ARG B CZ  1 
ATOM   4573 N NH1 . ARG B 1 54  ? 50.010 54.864  71.570  1.00 57.85  ? 54   ARG B NH1 1 
ATOM   4574 N NH2 . ARG B 1 54  ? 50.329 53.356  73.268  1.00 59.79  ? 54   ARG B NH2 1 
ATOM   4575 N N   . PRO B 1 55  ? 47.387 48.405  71.109  1.00 56.88  ? 55   PRO B N   1 
ATOM   4576 C CA  . PRO B 1 55  ? 45.962 48.289  71.459  1.00 57.16  ? 55   PRO B CA  1 
ATOM   4577 C C   . PRO B 1 55  ? 45.352 49.564  72.053  1.00 57.20  ? 55   PRO B C   1 
ATOM   4578 O O   . PRO B 1 55  ? 46.079 50.440  72.513  1.00 57.71  ? 55   PRO B O   1 
ATOM   4579 C CB  . PRO B 1 55  ? 45.938 47.147  72.484  1.00 58.67  ? 55   PRO B CB  1 
ATOM   4580 C CG  . PRO B 1 55  ? 47.342 47.063  73.007  1.00 59.86  ? 55   PRO B CG  1 
ATOM   4581 C CD  . PRO B 1 55  ? 48.215 47.430  71.842  1.00 58.14  ? 55   PRO B CD  1 
ATOM   4582 N N   . TRP B 1 56  ? 44.022 49.654  72.026  1.00 56.77  ? 56   TRP B N   1 
ATOM   4583 C CA  . TRP B 1 56  ? 43.281 50.824  72.511  1.00 56.43  ? 56   TRP B CA  1 
ATOM   4584 C C   . TRP B 1 56  ? 42.183 50.398  73.475  1.00 57.61  ? 56   TRP B C   1 
ATOM   4585 O O   . TRP B 1 56  ? 41.720 49.259  73.424  1.00 57.90  ? 56   TRP B O   1 
ATOM   4586 C CB  . TRP B 1 56  ? 42.660 51.581  71.339  1.00 54.75  ? 56   TRP B CB  1 
ATOM   4587 C CG  . TRP B 1 56  ? 41.751 50.731  70.497  1.00 54.27  ? 56   TRP B CG  1 
ATOM   4588 C CD1 . TRP B 1 56  ? 40.429 50.465  70.723  1.00 54.87  ? 56   TRP B CD1 1 
ATOM   4589 C CD2 . TRP B 1 56  ? 42.095 50.041  69.289  1.00 53.08  ? 56   TRP B CD2 1 
ATOM   4590 N NE1 . TRP B 1 56  ? 39.931 49.652  69.738  1.00 53.48  ? 56   TRP B NE1 1 
ATOM   4591 C CE2 . TRP B 1 56  ? 40.933 49.372  68.846  1.00 52.65  ? 56   TRP B CE2 1 
ATOM   4592 C CE3 . TRP B 1 56  ? 43.276 49.914  68.542  1.00 51.76  ? 56   TRP B CE3 1 
ATOM   4593 C CZ2 . TRP B 1 56  ? 40.913 48.596  67.682  1.00 51.28  ? 56   TRP B CZ2 1 
ATOM   4594 C CZ3 . TRP B 1 56  ? 43.254 49.138  67.394  1.00 50.50  ? 56   TRP B CZ3 1 
ATOM   4595 C CH2 . TRP B 1 56  ? 42.076 48.494  66.973  1.00 50.05  ? 56   TRP B CH2 1 
ATOM   4596 N N   . SER B 1 57  ? 41.768 51.313  74.347  1.00 58.18  ? 57   SER B N   1 
ATOM   4597 C CA  . SER B 1 57  ? 40.688 51.045  75.292  1.00 59.31  ? 57   SER B CA  1 
ATOM   4598 C C   . SER B 1 57  ? 39.333 51.437  74.705  1.00 58.98  ? 57   SER B C   1 
ATOM   4599 O O   . SER B 1 57  ? 39.270 52.230  73.758  1.00 57.71  ? 57   SER B O   1 
ATOM   4600 C CB  . SER B 1 57  ? 40.918 51.813  76.590  1.00 60.84  ? 57   SER B CB  1 
ATOM   4601 O OG  . SER B 1 57  ? 40.597 53.189  76.419  1.00 61.40  ? 57   SER B OG  1 
ATOM   4602 N N   . GLY B 1 58  ? 38.259 50.883  75.271  1.00 59.89  ? 58   GLY B N   1 
ATOM   4603 C CA  . GLY B 1 58  ? 36.900 51.254  74.892  1.00 60.32  ? 58   GLY B CA  1 
ATOM   4604 C C   . GLY B 1 58  ? 36.546 50.902  73.460  1.00 59.40  ? 58   GLY B C   1 
ATOM   4605 O O   . GLY B 1 58  ? 37.090 49.949  72.883  1.00 58.28  ? 58   GLY B O   1 
ATOM   4606 N N   . VAL B 1 59  ? 35.641 51.683  72.874  1.00 59.71  ? 59   VAL B N   1 
ATOM   4607 C CA  . VAL B 1 59  ? 35.145 51.405  71.526  1.00 58.79  ? 59   VAL B CA  1 
ATOM   4608 C C   . VAL B 1 59  ? 35.648 52.470  70.577  1.00 57.73  ? 59   VAL B C   1 
ATOM   4609 O O   . VAL B 1 59  ? 35.245 53.623  70.670  1.00 58.18  ? 59   VAL B O   1 
ATOM   4610 C CB  . VAL B 1 59  ? 33.569 51.336  71.474  1.00 60.38  ? 59   VAL B CB  1 
ATOM   4611 C CG1 . VAL B 1 59  ? 33.078 50.822  70.108  1.00 58.28  ? 59   VAL B CG1 1 
ATOM   4612 C CG2 . VAL B 1 59  ? 33.021 50.469  72.594  1.00 60.66  ? 59   VAL B CG2 1 
ATOM   4613 N N   . LEU B 1 60  ? 36.521 52.072  69.656  1.00 57.08  ? 60   LEU B N   1 
ATOM   4614 C CA  . LEU B 1 60  ? 37.109 53.001  68.682  1.00 56.32  ? 60   LEU B CA  1 
ATOM   4615 C C   . LEU B 1 60  ? 36.138 53.302  67.560  1.00 56.58  ? 60   LEU B C   1 
ATOM   4616 O O   . LEU B 1 60  ? 35.640 52.389  66.905  1.00 56.35  ? 60   LEU B O   1 
ATOM   4617 C CB  . LEU B 1 60  ? 38.410 52.443  68.108  1.00 54.69  ? 60   LEU B CB  1 
ATOM   4618 C CG  . LEU B 1 60  ? 39.248 53.354  67.198  1.00 53.97  ? 60   LEU B CG  1 
ATOM   4619 C CD1 . LEU B 1 60  ? 39.772 54.574  67.956  1.00 55.30  ? 60   LEU B CD1 1 
ATOM   4620 C CD2 . LEU B 1 60  ? 40.406 52.581  66.608  1.00 51.96  ? 60   LEU B CD2 1 
ATOM   4621 N N   . ASP B 1 61  ? 35.870 54.589  67.357  1.00 57.73  ? 61   ASP B N   1 
ATOM   4622 C CA  . ASP B 1 61  ? 34.977 55.050  66.306  1.00 58.88  ? 61   ASP B CA  1 
ATOM   4623 C C   . ASP B 1 61  ? 35.582 54.809  64.916  1.00 57.70  ? 61   ASP B C   1 
ATOM   4624 O O   . ASP B 1 61  ? 36.618 55.393  64.567  1.00 57.19  ? 61   ASP B O   1 
ATOM   4625 C CB  . ASP B 1 61  ? 34.643 56.526  66.517  1.00 60.08  ? 61   ASP B CB  1 
ATOM   4626 C CG  . ASP B 1 61  ? 33.850 57.118  65.369  1.00 61.69  ? 61   ASP B CG  1 
ATOM   4627 O OD1 . ASP B 1 61  ? 34.451 57.402  64.306  1.00 62.09  ? 61   ASP B OD1 1 
ATOM   4628 O OD2 . ASP B 1 61  ? 32.626 57.300  65.537  1.00 64.55  ? 61   ASP B OD2 1 
ATOM   4629 N N   . ALA B 1 62  ? 34.929 53.940  64.142  1.00 57.65  ? 62   ALA B N   1 
ATOM   4630 C CA  . ALA B 1 62  ? 35.357 53.599  62.784  1.00 56.28  ? 62   ALA B CA  1 
ATOM   4631 C C   . ALA B 1 62  ? 34.200 53.785  61.790  1.00 56.97  ? 62   ALA B C   1 
ATOM   4632 O O   . ALA B 1 62  ? 33.838 52.867  61.045  1.00 56.65  ? 62   ALA B O   1 
ATOM   4633 C CB  . ALA B 1 62  ? 35.894 52.172  62.738  1.00 55.34  ? 62   ALA B CB  1 
ATOM   4634 N N   . THR B 1 63  ? 33.627 54.987  61.799  1.00 58.09  ? 63   THR B N   1 
ATOM   4635 C CA  . THR B 1 63  ? 32.438 55.308  61.012  1.00 59.03  ? 63   THR B CA  1 
ATOM   4636 C C   . THR B 1 63  ? 32.765 56.334  59.933  1.00 58.57  ? 63   THR B C   1 
ATOM   4637 O O   . THR B 1 63  ? 31.886 56.819  59.231  1.00 59.31  ? 63   THR B O   1 
ATOM   4638 C CB  . THR B 1 63  ? 31.300 55.879  61.917  1.00 61.40  ? 63   THR B CB  1 
ATOM   4639 O OG1 . THR B 1 63  ? 31.784 57.008  62.658  1.00 61.18  ? 63   THR B OG1 1 
ATOM   4640 C CG2 . THR B 1 63  ? 30.786 54.824  62.897  1.00 62.02  ? 63   THR B CG2 1 
ATOM   4641 N N   . THR B 1 64  ? 34.046 56.637  59.787  1.00 57.78  ? 64   THR B N   1 
ATOM   4642 C CA  . THR B 1 64  ? 34.478 57.788  59.011  1.00 57.98  ? 64   THR B CA  1 
ATOM   4643 C C   . THR B 1 64  ? 35.885 57.531  58.436  1.00 55.76  ? 64   THR B C   1 
ATOM   4644 O O   . THR B 1 64  ? 36.685 56.827  59.051  1.00 54.88  ? 64   THR B O   1 
ATOM   4645 C CB  . THR B 1 64  ? 34.405 59.057  59.926  1.00 59.91  ? 64   THR B CB  1 
ATOM   4646 O OG1 . THR B 1 64  ? 33.849 60.160  59.204  1.00 61.94  ? 64   THR B OG1 1 
ATOM   4647 C CG2 . THR B 1 64  ? 35.773 59.420  60.553  1.00 59.82  ? 64   THR B CG2 1 
ATOM   4648 N N   . PHE B 1 65  ? 36.169 58.056  57.242  1.00 54.88  ? 65   PHE B N   1 
ATOM   4649 C CA  . PHE B 1 65  ? 37.503 57.915  56.624  1.00 52.56  ? 65   PHE B CA  1 
ATOM   4650 C C   . PHE B 1 65  ? 38.547 58.741  57.357  1.00 52.38  ? 65   PHE B C   1 
ATOM   4651 O O   . PHE B 1 65  ? 38.270 59.845  57.840  1.00 53.48  ? 65   PHE B O   1 
ATOM   4652 C CB  . PHE B 1 65  ? 37.499 58.355  55.155  1.00 51.75  ? 65   PHE B CB  1 
ATOM   4653 C CG  . PHE B 1 65  ? 36.891 57.359  54.206  1.00 51.03  ? 65   PHE B CG  1 
ATOM   4654 C CD1 . PHE B 1 65  ? 37.445 56.080  54.052  1.00 47.74  ? 65   PHE B CD1 1 
ATOM   4655 C CD2 . PHE B 1 65  ? 35.774 57.710  53.433  1.00 51.07  ? 65   PHE B CD2 1 
ATOM   4656 C CE1 . PHE B 1 65  ? 36.880 55.163  53.161  1.00 46.29  ? 65   PHE B CE1 1 
ATOM   4657 C CE2 . PHE B 1 65  ? 35.218 56.804  52.529  1.00 49.22  ? 65   PHE B CE2 1 
ATOM   4658 C CZ  . PHE B 1 65  ? 35.776 55.525  52.397  1.00 48.39  ? 65   PHE B CZ  1 
ATOM   4659 N N   . GLN B 1 66  ? 39.757 58.212  57.425  1.00 51.06  ? 66   GLN B N   1 
ATOM   4660 C CA  . GLN B 1 66  ? 40.852 58.932  58.067  1.00 50.95  ? 66   GLN B CA  1 
ATOM   4661 C C   . GLN B 1 66  ? 41.623 59.769  57.050  1.00 50.34  ? 66   GLN B C   1 
ATOM   4662 O O   . GLN B 1 66  ? 41.308 59.762  55.855  1.00 49.72  ? 66   GLN B O   1 
ATOM   4663 C CB  . GLN B 1 66  ? 41.781 57.960  58.787  1.00 50.23  ? 66   GLN B CB  1 
ATOM   4664 C CG  . GLN B 1 66  ? 41.314 57.590  60.169  1.00 51.51  ? 66   GLN B CG  1 
ATOM   4665 C CD  . GLN B 1 66  ? 41.731 58.609  61.213  1.00 53.87  ? 66   GLN B CD  1 
ATOM   4666 O OE1 . GLN B 1 66  ? 42.450 59.570  60.918  1.00 56.03  ? 66   GLN B OE1 1 
ATOM   4667 N NE2 . GLN B 1 66  ? 41.294 58.397  62.441  1.00 52.95  ? 66   GLN B NE2 1 
ATOM   4668 N N   . ASN B 1 67  ? 42.627 60.488  57.539  1.00 50.22  ? 67   ASN B N   1 
ATOM   4669 C CA  . ASN B 1 67  ? 43.440 61.359  56.709  1.00 50.12  ? 67   ASN B CA  1 
ATOM   4670 C C   . ASN B 1 67  ? 44.121 60.673  55.538  1.00 48.78  ? 67   ASN B C   1 
ATOM   4671 O O   . ASN B 1 67  ? 44.457 59.494  55.600  1.00 48.60  ? 67   ASN B O   1 
ATOM   4672 C CB  . ASN B 1 67  ? 44.479 62.065  57.573  1.00 50.87  ? 67   ASN B CB  1 
ATOM   4673 C CG  . ASN B 1 67  ? 43.846 63.035  58.562  1.00 52.65  ? 67   ASN B CG  1 
ATOM   4674 O OD1 . ASN B 1 67  ? 42.834 63.664  58.261  1.00 52.07  ? 67   ASN B OD1 1 
ATOM   4675 N ND2 . ASN B 1 67  ? 44.448 63.164  59.745  1.00 53.33  ? 67   ASN B ND2 1 
ATOM   4676 N N   . VAL B 1 68  ? 44.305 61.429  54.466  1.00 48.78  ? 68   VAL B N   1 
ATOM   4677 C CA  . VAL B 1 68  ? 45.060 61.012  53.303  1.00 47.96  ? 68   VAL B CA  1 
ATOM   4678 C C   . VAL B 1 68  ? 46.552 61.226  53.565  1.00 48.28  ? 68   VAL B C   1 
ATOM   4679 O O   . VAL B 1 68  ? 46.953 62.263  54.108  1.00 49.43  ? 68   VAL B O   1 
ATOM   4680 C CB  . VAL B 1 68  ? 44.620 61.847  52.080  1.00 48.55  ? 68   VAL B CB  1 
ATOM   4681 C CG1 . VAL B 1 68  ? 45.560 61.664  50.898  1.00 47.19  ? 68   VAL B CG1 1 
ATOM   4682 C CG2 . VAL B 1 68  ? 43.202 61.499  51.693  1.00 48.70  ? 68   VAL B CG2 1 
ATOM   4683 N N   . CYS B 1 69  ? 47.375 60.251  53.186  1.00 47.66  ? 69   CYS B N   1 
ATOM   4684 C CA  . CYS B 1 69  ? 48.824 60.405  53.309  1.00 48.16  ? 69   CYS B CA  1 
ATOM   4685 C C   . CYS B 1 69  ? 49.290 61.666  52.603  1.00 49.23  ? 69   CYS B C   1 
ATOM   4686 O O   . CYS B 1 69  ? 48.794 61.997  51.523  1.00 49.26  ? 69   CYS B O   1 
ATOM   4687 C CB  . CYS B 1 69  ? 49.561 59.186  52.774  1.00 46.68  ? 69   CYS B CB  1 
ATOM   4688 S SG  . CYS B 1 69  ? 49.322 57.687  53.779  1.00 48.34  ? 69   CYS B SG  1 
ATOM   4689 N N   . TYR B 1 70  ? 50.231 62.372  53.232  1.00 50.35  ? 70   TYR B N   1 
ATOM   4690 C CA  . TYR B 1 70  ? 50.737 63.626  52.695  1.00 51.43  ? 70   TYR B CA  1 
ATOM   4691 C C   . TYR B 1 70  ? 51.310 63.425  51.305  1.00 51.35  ? 70   TYR B C   1 
ATOM   4692 O O   . TYR B 1 70  ? 52.178 62.583  51.101  1.00 50.69  ? 70   TYR B O   1 
ATOM   4693 C CB  . TYR B 1 70  ? 51.765 64.293  53.629  1.00 52.07  ? 70   TYR B CB  1 
ATOM   4694 C CG  . TYR B 1 70  ? 51.673 65.795  53.544  1.00 52.62  ? 70   TYR B CG  1 
ATOM   4695 C CD1 . TYR B 1 70  ? 50.847 66.511  54.401  1.00 52.84  ? 70   TYR B CD1 1 
ATOM   4696 C CD2 . TYR B 1 70  ? 52.365 66.493  52.562  1.00 53.33  ? 70   TYR B CD2 1 
ATOM   4697 C CE1 . TYR B 1 70  ? 50.744 67.900  54.300  1.00 54.95  ? 70   TYR B CE1 1 
ATOM   4698 C CE2 . TYR B 1 70  ? 52.267 67.866  52.452  1.00 54.11  ? 70   TYR B CE2 1 
ATOM   4699 C CZ  . TYR B 1 70  ? 51.455 68.562  53.314  1.00 55.21  ? 70   TYR B CZ  1 
ATOM   4700 O OH  . TYR B 1 70  ? 51.358 69.919  53.178  1.00 56.91  ? 70   TYR B OH  1 
ATOM   4701 N N   . GLN B 1 71  ? 50.792 64.201  50.359  1.00 52.65  ? 71   GLN B N   1 
ATOM   4702 C CA  . GLN B 1 71  ? 51.097 64.047  48.940  1.00 53.35  ? 71   GLN B CA  1 
ATOM   4703 C C   . GLN B 1 71  ? 50.897 65.355  48.203  1.00 55.43  ? 71   GLN B C   1 
ATOM   4704 O O   . GLN B 1 71  ? 50.102 66.204  48.623  1.00 55.85  ? 71   GLN B O   1 
ATOM   4705 C CB  . GLN B 1 71  ? 50.200 62.973  48.291  1.00 51.84  ? 71   GLN B CB  1 
ATOM   4706 C CG  . GLN B 1 71  ? 48.697 63.263  48.358  1.00 52.64  ? 71   GLN B CG  1 
ATOM   4707 C CD  . GLN B 1 71  ? 47.848 62.108  47.865  1.00 53.93  ? 71   GLN B CD  1 
ATOM   4708 O OE1 . GLN B 1 71  ? 47.262 62.169  46.781  1.00 55.89  ? 71   GLN B OE1 1 
ATOM   4709 N NE2 . GLN B 1 71  ? 47.782 61.041  48.654  1.00 52.30  ? 71   GLN B NE2 1 
ATOM   4710 N N   . TYR B 1 72  ? 51.620 65.478  47.090  1.00 56.96  ? 72   TYR B N   1 
ATOM   4711 C CA  . TYR B 1 72  ? 51.410 66.507  46.075  1.00 59.24  ? 72   TYR B CA  1 
ATOM   4712 C C   . TYR B 1 72  ? 49.949 66.589  45.646  1.00 59.73  ? 72   TYR B C   1 
ATOM   4713 O O   . TYR B 1 72  ? 49.294 65.566  45.471  1.00 58.89  ? 72   TYR B O   1 
ATOM   4714 C CB  . TYR B 1 72  ? 52.286 66.174  44.870  1.00 59.29  ? 72   TYR B CB  1 
ATOM   4715 C CG  . TYR B 1 72  ? 52.115 67.091  43.687  1.00 61.20  ? 72   TYR B CG  1 
ATOM   4716 C CD1 . TYR B 1 72  ? 51.408 66.665  42.553  1.00 61.04  ? 72   TYR B CD1 1 
ATOM   4717 C CD2 . TYR B 1 72  ? 52.663 68.383  43.691  1.00 62.42  ? 72   TYR B CD2 1 
ATOM   4718 C CE1 . TYR B 1 72  ? 51.245 67.501  41.449  1.00 62.74  ? 72   TYR B CE1 1 
ATOM   4719 C CE2 . TYR B 1 72  ? 52.508 69.230  42.596  1.00 64.69  ? 72   TYR B CE2 1 
ATOM   4720 C CZ  . TYR B 1 72  ? 51.800 68.778  41.474  1.00 64.76  ? 72   TYR B CZ  1 
ATOM   4721 O OH  . TYR B 1 72  ? 51.642 69.599  40.384  1.00 65.93  ? 72   TYR B OH  1 
ATOM   4722 N N   . VAL B 1 73  ? 49.443 67.806  45.481  1.00 62.15  ? 73   VAL B N   1 
ATOM   4723 C CA  . VAL B 1 73  ? 48.063 68.017  45.037  1.00 63.36  ? 73   VAL B CA  1 
ATOM   4724 C C   . VAL B 1 73  ? 48.047 68.622  43.629  1.00 65.07  ? 73   VAL B C   1 
ATOM   4725 O O   . VAL B 1 73  ? 48.675 69.665  43.379  1.00 66.51  ? 73   VAL B O   1 
ATOM   4726 C CB  . VAL B 1 73  ? 47.276 68.928  46.020  1.00 64.53  ? 73   VAL B CB  1 
ATOM   4727 C CG1 . VAL B 1 73  ? 45.818 69.118  45.566  1.00 64.82  ? 73   VAL B CG1 1 
ATOM   4728 C CG2 . VAL B 1 73  ? 47.326 68.370  47.431  1.00 63.88  ? 73   VAL B CG2 1 
ATOM   4729 N N   . ASP B 1 74  ? 47.320 67.970  42.719  1.00 65.10  ? 74   ASP B N   1 
ATOM   4730 C CA  . ASP B 1 74  ? 47.280 68.388  41.311  1.00 66.55  ? 74   ASP B CA  1 
ATOM   4731 C C   . ASP B 1 74  ? 46.626 69.758  41.073  1.00 68.75  ? 74   ASP B C   1 
ATOM   4732 O O   . ASP B 1 74  ? 45.585 70.074  41.654  1.00 69.65  ? 74   ASP B O   1 
ATOM   4733 C CB  . ASP B 1 74  ? 46.617 67.323  40.439  1.00 65.35  ? 74   ASP B CB  1 
ATOM   4734 C CG  . ASP B 1 74  ? 47.022 67.439  38.993  1.00 66.42  ? 74   ASP B CG  1 
ATOM   4735 O OD1 . ASP B 1 74  ? 46.417 68.242  38.243  1.00 68.14  ? 74   ASP B OD1 1 
ATOM   4736 O OD2 . ASP B 1 74  ? 47.975 66.736  38.611  1.00 66.92  ? 74   ASP B OD2 1 
ATOM   4737 N N   . THR B 1 75  ? 47.250 70.553  40.204  1.00 69.84  ? 75   THR B N   1 
ATOM   4738 C CA  . THR B 1 75  ? 46.822 71.930  39.939  1.00 72.12  ? 75   THR B CA  1 
ATOM   4739 C C   . THR B 1 75  ? 46.822 72.286  38.449  1.00 73.10  ? 75   THR B C   1 
ATOM   4740 O O   . THR B 1 75  ? 46.779 73.459  38.086  1.00 75.42  ? 75   THR B O   1 
ATOM   4741 C CB  . THR B 1 75  ? 47.710 72.969  40.696  1.00 73.58  ? 75   THR B CB  1 
ATOM   4742 O OG1 . THR B 1 75  ? 49.099 72.701  40.444  1.00 73.08  ? 75   THR B OG1 1 
ATOM   4743 C CG2 . THR B 1 75  ? 47.431 72.954  42.204  1.00 72.82  ? 75   THR B CG2 1 
ATOM   4744 N N   . LEU B 1 76  ? 46.864 71.282  37.581  1.00 71.68  ? 76   LEU B N   1 
ATOM   4745 C CA  . LEU B 1 76  ? 46.849 71.544  36.147  1.00 72.46  ? 76   LEU B CA  1 
ATOM   4746 C C   . LEU B 1 76  ? 45.520 72.164  35.693  1.00 74.14  ? 76   LEU B C   1 
ATOM   4747 O O   . LEU B 1 76  ? 45.513 73.133  34.922  1.00 76.12  ? 76   LEU B O   1 
ATOM   4748 C CB  . LEU B 1 76  ? 47.171 70.277  35.353  1.00 70.48  ? 76   LEU B CB  1 
ATOM   4749 C CG  . LEU B 1 76  ? 47.365 70.452  33.843  1.00 71.37  ? 76   LEU B CG  1 
ATOM   4750 C CD1 . LEU B 1 76  ? 48.670 71.200  33.516  1.00 71.81  ? 76   LEU B CD1 1 
ATOM   4751 C CD2 . LEU B 1 76  ? 47.320 69.091  33.168  1.00 69.49  ? 76   LEU B CD2 1 
ATOM   4752 N N   . TYR B 1 77  ? 44.411 71.610  36.188  1.00 73.38  ? 77   TYR B N   1 
ATOM   4753 C CA  . TYR B 1 77  ? 43.066 72.070  35.826  1.00 74.95  ? 77   TYR B CA  1 
ATOM   4754 C C   . TYR B 1 77  ? 42.144 72.262  37.045  1.00 75.09  ? 77   TYR B C   1 
ATOM   4755 O O   . TYR B 1 77  ? 41.221 71.472  37.247  1.00 74.14  ? 77   TYR B O   1 
ATOM   4756 C CB  . TYR B 1 77  ? 42.410 71.070  34.870  1.00 74.01  ? 77   TYR B CB  1 
ATOM   4757 C CG  . TYR B 1 77  ? 43.105 70.851  33.547  1.00 73.93  ? 77   TYR B CG  1 
ATOM   4758 C CD1 . TYR B 1 77  ? 43.247 71.888  32.628  1.00 75.70  ? 77   TYR B CD1 1 
ATOM   4759 C CD2 . TYR B 1 77  ? 43.575 69.581  33.190  1.00 71.83  ? 77   TYR B CD2 1 
ATOM   4760 C CE1 . TYR B 1 77  ? 43.870 71.680  31.403  1.00 76.12  ? 77   TYR B CE1 1 
ATOM   4761 C CE2 . TYR B 1 77  ? 44.190 69.359  31.968  1.00 71.30  ? 77   TYR B CE2 1 
ATOM   4762 C CZ  . TYR B 1 77  ? 44.338 70.410  31.078  1.00 74.36  ? 77   TYR B CZ  1 
ATOM   4763 O OH  . TYR B 1 77  ? 44.949 70.197  29.857  1.00 74.54  ? 77   TYR B OH  1 
ATOM   4764 N N   . PRO B 1 78  ? 42.355 73.331  37.835  1.00 76.53  ? 78   PRO B N   1 
ATOM   4765 C CA  . PRO B 1 78  ? 41.605 73.465  39.109  1.00 76.64  ? 78   PRO B CA  1 
ATOM   4766 C C   . PRO B 1 78  ? 40.081 73.491  38.927  1.00 77.51  ? 78   PRO B C   1 
ATOM   4767 O O   . PRO B 1 78  ? 39.573 74.244  38.099  1.00 79.54  ? 78   PRO B O   1 
ATOM   4768 C CB  . PRO B 1 78  ? 42.114 74.795  39.695  1.00 78.37  ? 78   PRO B CB  1 
ATOM   4769 C CG  . PRO B 1 78  ? 42.730 75.528  38.531  1.00 80.17  ? 78   PRO B CG  1 
ATOM   4770 C CD  . PRO B 1 78  ? 43.249 74.480  37.586  1.00 78.31  ? 78   PRO B CD  1 
ATOM   4771 N N   . GLY B 1 79  ? 39.374 72.650  39.679  1.00 76.23  ? 79   GLY B N   1 
ATOM   4772 C CA  . GLY B 1 79  ? 37.911 72.560  39.595  1.00 77.54  ? 79   GLY B CA  1 
ATOM   4773 C C   . GLY B 1 79  ? 37.346 71.544  38.603  1.00 76.88  ? 79   GLY B C   1 
ATOM   4774 O O   . GLY B 1 79  ? 36.146 71.246  38.627  1.00 77.27  ? 79   GLY B O   1 
ATOM   4775 N N   . PHE B 1 80  ? 38.208 71.016  37.732  1.00 75.64  ? 80   PHE B N   1 
ATOM   4776 C CA  . PHE B 1 80  ? 37.803 70.081  36.684  1.00 75.09  ? 80   PHE B CA  1 
ATOM   4777 C C   . PHE B 1 80  ? 37.607 68.675  37.263  1.00 73.20  ? 80   PHE B C   1 
ATOM   4778 O O   . PHE B 1 80  ? 38.495 68.141  37.931  1.00 71.54  ? 80   PHE B O   1 
ATOM   4779 C CB  . PHE B 1 80  ? 38.838 70.105  35.545  1.00 74.55  ? 80   PHE B CB  1 
ATOM   4780 C CG  . PHE B 1 80  ? 38.635 69.046  34.488  1.00 73.22  ? 80   PHE B CG  1 
ATOM   4781 C CD1 . PHE B 1 80  ? 37.490 69.031  33.698  1.00 74.20  ? 80   PHE B CD1 1 
ATOM   4782 C CD2 . PHE B 1 80  ? 39.610 68.084  34.261  1.00 70.86  ? 80   PHE B CD2 1 
ATOM   4783 C CE1 . PHE B 1 80  ? 37.311 68.062  32.717  1.00 72.85  ? 80   PHE B CE1 1 
ATOM   4784 C CE2 . PHE B 1 80  ? 39.441 67.112  33.276  1.00 70.08  ? 80   PHE B CE2 1 
ATOM   4785 C CZ  . PHE B 1 80  ? 38.284 67.101  32.507  1.00 71.31  ? 80   PHE B CZ  1 
ATOM   4786 N N   . GLU B 1 81  ? 36.440 68.087  37.014  1.00 73.68  ? 81   GLU B N   1 
ATOM   4787 C CA  . GLU B 1 81  ? 36.074 66.802  37.615  1.00 72.45  ? 81   GLU B CA  1 
ATOM   4788 C C   . GLU B 1 81  ? 37.028 65.657  37.258  1.00 69.81  ? 81   GLU B C   1 
ATOM   4789 O O   . GLU B 1 81  ? 37.299 64.788  38.094  1.00 68.22  ? 81   GLU B O   1 
ATOM   4790 C CB  . GLU B 1 81  ? 34.639 66.425  37.245  1.00 74.00  ? 81   GLU B CB  1 
ATOM   4791 C CG  . GLU B 1 81  ? 33.974 65.464  38.223  1.00 75.71  ? 81   GLU B CG  1 
ATOM   4792 C CD  . GLU B 1 81  ? 32.555 65.096  37.815  1.00 80.57  ? 81   GLU B CD  1 
ATOM   4793 O OE1 . GLU B 1 81  ? 31.658 65.980  37.874  1.00 83.06  ? 81   GLU B OE1 1 
ATOM   4794 O OE2 . GLU B 1 81  ? 32.347 63.916  37.440  1.00 80.44  ? 81   GLU B OE2 1 
ATOM   4795 N N   . GLY B 1 82  ? 37.538 65.668  36.025  1.00 69.33  ? 82   GLY B N   1 
ATOM   4796 C CA  . GLY B 1 82  ? 38.441 64.631  35.538  1.00 66.47  ? 82   GLY B CA  1 
ATOM   4797 C C   . GLY B 1 82  ? 39.791 64.566  36.226  1.00 64.59  ? 82   GLY B C   1 
ATOM   4798 O O   . GLY B 1 82  ? 40.508 63.566  36.091  1.00 62.95  ? 82   GLY B O   1 
ATOM   4799 N N   . THR B 1 83  ? 40.154 65.625  36.948  1.00 64.93  ? 83   THR B N   1 
ATOM   4800 C CA  . THR B 1 83  ? 41.375 65.613  37.760  1.00 63.58  ? 83   THR B CA  1 
ATOM   4801 C C   . THR B 1 83  ? 41.085 65.603  39.258  1.00 63.25  ? 83   THR B C   1 
ATOM   4802 O O   . THR B 1 83  ? 41.768 64.908  40.020  1.00 62.01  ? 83   THR B O   1 
ATOM   4803 C CB  . THR B 1 83  ? 42.367 66.764  37.421  1.00 64.51  ? 83   THR B CB  1 
ATOM   4804 O OG1 . THR B 1 83  ? 41.683 68.027  37.394  1.00 66.94  ? 83   THR B OG1 1 
ATOM   4805 C CG2 . THR B 1 83  ? 43.055 66.520  36.092  1.00 63.75  ? 83   THR B CG2 1 
ATOM   4806 N N   . GLU B 1 84  ? 40.076 66.358  39.682  1.00 64.71  ? 84   GLU B N   1 
ATOM   4807 C CA  . GLU B 1 84  ? 39.770 66.473  41.105  1.00 64.82  ? 84   GLU B CA  1 
ATOM   4808 C C   . GLU B 1 84  ? 39.278 65.155  41.687  1.00 63.06  ? 84   GLU B C   1 
ATOM   4809 O O   . GLU B 1 84  ? 39.388 64.936  42.891  1.00 62.54  ? 84   GLU B O   1 
ATOM   4810 C CB  . GLU B 1 84  ? 38.749 67.582  41.369  1.00 67.28  ? 84   GLU B CB  1 
ATOM   4811 C CG  . GLU B 1 84  ? 39.202 69.002  40.973  1.00 70.99  ? 84   GLU B CG  1 
ATOM   4812 C CD  . GLU B 1 84  ? 40.246 69.628  41.909  1.00 73.08  ? 84   GLU B CD  1 
ATOM   4813 O OE1 . GLU B 1 84  ? 40.563 69.036  42.971  1.00 72.92  ? 84   GLU B OE1 1 
ATOM   4814 O OE2 . GLU B 1 84  ? 40.748 70.730  41.573  1.00 74.13  ? 84   GLU B OE2 1 
ATOM   4815 N N   . MET B 1 85  ? 38.762 64.269  40.828  1.00 62.22  ? 85   MET B N   1 
ATOM   4816 C CA  . MET B 1 85  ? 38.254 62.959  41.260  1.00 60.40  ? 85   MET B CA  1 
ATOM   4817 C C   . MET B 1 85  ? 39.365 62.058  41.781  1.00 57.63  ? 85   MET B C   1 
ATOM   4818 O O   . MET B 1 85  ? 39.095 61.067  42.466  1.00 56.68  ? 85   MET B O   1 
ATOM   4819 C CB  . MET B 1 85  ? 37.470 62.256  40.146  1.00 60.56  ? 85   MET B CB  1 
ATOM   4820 C CG  . MET B 1 85  ? 38.309 61.784  38.979  1.00 60.08  ? 85   MET B CG  1 
ATOM   4821 S SD  . MET B 1 85  ? 37.365 60.850  37.760  1.00 60.86  ? 85   MET B SD  1 
ATOM   4822 C CE  . MET B 1 85  ? 37.454 59.196  38.432  1.00 58.22  ? 85   MET B CE  1 
ATOM   4823 N N   . TRP B 1 86  ? 40.605 62.419  41.456  1.00 56.21  ? 86   TRP B N   1 
ATOM   4824 C CA  . TRP B 1 86  ? 41.784 61.699  41.930  1.00 54.05  ? 86   TRP B CA  1 
ATOM   4825 C C   . TRP B 1 86  ? 42.531 62.459  43.039  1.00 53.83  ? 86   TRP B C   1 
ATOM   4826 O O   . TRP B 1 86  ? 43.485 61.928  43.618  1.00 52.17  ? 86   TRP B O   1 
ATOM   4827 C CB  . TRP B 1 86  ? 42.744 61.403  40.773  1.00 52.93  ? 86   TRP B CB  1 
ATOM   4828 C CG  . TRP B 1 86  ? 42.108 60.774  39.581  1.00 53.02  ? 86   TRP B CG  1 
ATOM   4829 C CD1 . TRP B 1 86  ? 41.803 61.386  38.403  1.00 53.51  ? 86   TRP B CD1 1 
ATOM   4830 C CD2 . TRP B 1 86  ? 41.703 59.407  39.439  1.00 51.57  ? 86   TRP B CD2 1 
ATOM   4831 N NE1 . TRP B 1 86  ? 41.239 60.490  37.538  1.00 52.92  ? 86   TRP B NE1 1 
ATOM   4832 C CE2 . TRP B 1 86  ? 41.167 59.266  38.146  1.00 51.74  ? 86   TRP B CE2 1 
ATOM   4833 C CE3 . TRP B 1 86  ? 41.758 58.285  40.273  1.00 50.48  ? 86   TRP B CE3 1 
ATOM   4834 C CZ2 . TRP B 1 86  ? 40.684 58.043  37.662  1.00 51.51  ? 86   TRP B CZ2 1 
ATOM   4835 C CZ3 . TRP B 1 86  ? 41.273 57.078  39.800  1.00 49.88  ? 86   TRP B CZ3 1 
ATOM   4836 C CH2 . TRP B 1 86  ? 40.733 56.969  38.504  1.00 50.50  ? 86   TRP B CH2 1 
ATOM   4837 N N   . ASN B 1 87  ? 42.116 63.701  43.302  1.00 54.89  ? 87   ASN B N   1 
ATOM   4838 C CA  . ASN B 1 87  ? 42.734 64.520  44.347  1.00 55.36  ? 87   ASN B CA  1 
ATOM   4839 C C   . ASN B 1 87  ? 42.281 64.091  45.757  1.00 54.90  ? 87   ASN B C   1 
ATOM   4840 O O   . ASN B 1 87  ? 41.201 63.495  45.910  1.00 54.62  ? 87   ASN B O   1 
ATOM   4841 C CB  . ASN B 1 87  ? 42.448 66.013  44.107  1.00 57.48  ? 87   ASN B CB  1 
ATOM   4842 C CG  . ASN B 1 87  ? 43.508 66.701  43.222  1.00 58.42  ? 87   ASN B CG  1 
ATOM   4843 O OD1 . ASN B 1 87  ? 44.657 66.245  43.108  1.00 56.87  ? 87   ASN B OD1 1 
ATOM   4844 N ND2 . ASN B 1 87  ? 43.118 67.818  42.606  1.00 59.26  ? 87   ASN B ND2 1 
ATOM   4845 N N   . PRO B 1 88  ? 43.106 64.379  46.793  1.00 54.74  ? 88   PRO B N   1 
ATOM   4846 C CA  . PRO B 1 88  ? 42.729 64.043  48.179  1.00 54.63  ? 88   PRO B CA  1 
ATOM   4847 C C   . PRO B 1 88  ? 41.374 64.643  48.587  1.00 56.17  ? 88   PRO B C   1 
ATOM   4848 O O   . PRO B 1 88  ? 41.158 65.856  48.437  1.00 57.42  ? 88   PRO B O   1 
ATOM   4849 C CB  . PRO B 1 88  ? 43.856 64.659  49.008  1.00 54.48  ? 88   PRO B CB  1 
ATOM   4850 C CG  . PRO B 1 88  ? 45.000 64.727  48.088  1.00 54.30  ? 88   PRO B CG  1 
ATOM   4851 C CD  . PRO B 1 88  ? 44.437 65.011  46.735  1.00 54.91  ? 88   PRO B CD  1 
ATOM   4852 N N   . ASN B 1 89  ? 40.473 63.782  49.070  1.00 55.71  ? 89   ASN B N   1 
ATOM   4853 C CA  . ASN B 1 89  ? 39.138 64.197  49.498  1.00 56.82  ? 89   ASN B CA  1 
ATOM   4854 C C   . ASN B 1 89  ? 38.988 64.265  51.014  1.00 57.01  ? 89   ASN B C   1 
ATOM   4855 O O   . ASN B 1 89  ? 37.898 64.528  51.514  1.00 58.47  ? 89   ASN B O   1 
ATOM   4856 C CB  . ASN B 1 89  ? 38.045 63.307  48.879  1.00 56.69  ? 89   ASN B CB  1 
ATOM   4857 C CG  . ASN B 1 89  ? 38.093 61.868  49.381  1.00 55.90  ? 89   ASN B CG  1 
ATOM   4858 O OD1 . ASN B 1 89  ? 39.086 61.416  49.961  1.00 56.78  ? 89   ASN B OD1 1 
ATOM   4859 N ND2 . ASN B 1 89  ? 37.021 61.136  49.143  1.00 56.38  ? 89   ASN B ND2 1 
ATOM   4860 N N   . ARG B 1 90  ? 40.079 64.019  51.734  1.00 55.86  ? 90   ARG B N   1 
ATOM   4861 C CA  . ARG B 1 90  ? 40.158 64.288  53.177  1.00 56.37  ? 90   ARG B CA  1 
ATOM   4862 C C   . ARG B 1 90  ? 41.394 65.161  53.464  1.00 56.77  ? 90   ARG B C   1 
ATOM   4863 O O   . ARG B 1 90  ? 42.142 65.499  52.540  1.00 56.68  ? 90   ARG B O   1 
ATOM   4864 C CB  . ARG B 1 90  ? 40.194 62.974  53.984  1.00 55.12  ? 90   ARG B CB  1 
ATOM   4865 C CG  . ARG B 1 90  ? 38.886 62.161  53.979  1.00 55.01  ? 90   ARG B CG  1 
ATOM   4866 C CD  . ARG B 1 90  ? 37.708 63.004  54.500  1.00 58.35  ? 90   ARG B CD  1 
ATOM   4867 N NE  . ARG B 1 90  ? 36.463 62.251  54.644  1.00 59.07  ? 90   ARG B NE  1 
ATOM   4868 C CZ  . ARG B 1 90  ? 35.648 61.922  53.640  1.00 59.93  ? 90   ARG B CZ  1 
ATOM   4869 N NH1 . ARG B 1 90  ? 35.937 62.264  52.388  1.00 59.24  ? 90   ARG B NH1 1 
ATOM   4870 N NH2 . ARG B 1 90  ? 34.542 61.233  53.889  1.00 59.67  ? 90   ARG B NH2 1 
ATOM   4871 N N   . GLU B 1 91  ? 41.606 65.532  54.727  1.00 57.51  ? 91   GLU B N   1 
ATOM   4872 C CA  . GLU B 1 91  ? 42.779 66.335  55.113  1.00 57.92  ? 91   GLU B CA  1 
ATOM   4873 C C   . GLU B 1 91  ? 44.073 65.566  54.910  1.00 55.74  ? 91   GLU B C   1 
ATOM   4874 O O   . GLU B 1 91  ? 44.124 64.350  55.123  1.00 53.86  ? 91   GLU B O   1 
ATOM   4875 C CB  . GLU B 1 91  ? 42.717 66.773  56.587  1.00 59.38  ? 91   GLU B CB  1 
ATOM   4876 C CG  . GLU B 1 91  ? 41.640 67.792  56.948  1.00 63.42  ? 91   GLU B CG  1 
ATOM   4877 C CD  . GLU B 1 91  ? 41.937 69.212  56.467  1.00 67.38  ? 91   GLU B CD  1 
ATOM   4878 O OE1 . GLU B 1 91  ? 42.954 69.451  55.768  1.00 67.08  ? 91   GLU B OE1 1 
ATOM   4879 O OE2 . GLU B 1 91  ? 41.124 70.100  56.799  1.00 70.85  ? 91   GLU B OE2 1 
ATOM   4880 N N   . LEU B 1 92  ? 45.117 66.291  54.517  1.00 55.37  ? 92   LEU B N   1 
ATOM   4881 C CA  . LEU B 1 92  ? 46.438 65.702  54.368  1.00 53.90  ? 92   LEU B CA  1 
ATOM   4882 C C   . LEU B 1 92  ? 47.149 65.630  55.711  1.00 54.16  ? 92   LEU B C   1 
ATOM   4883 O O   . LEU B 1 92  ? 47.163 66.606  56.467  1.00 55.40  ? 92   LEU B O   1 
ATOM   4884 C CB  . LEU B 1 92  ? 47.284 66.518  53.396  1.00 54.12  ? 92   LEU B CB  1 
ATOM   4885 C CG  . LEU B 1 92  ? 46.859 66.645  51.939  1.00 53.89  ? 92   LEU B CG  1 
ATOM   4886 C CD1 . LEU B 1 92  ? 47.815 67.583  51.225  1.00 54.25  ? 92   LEU B CD1 1 
ATOM   4887 C CD2 . LEU B 1 92  ? 46.823 65.288  51.251  1.00 50.96  ? 92   LEU B CD2 1 
ATOM   4888 N N   . SER B 1 93  ? 47.745 64.475  55.996  1.00 52.81  ? 93   SER B N   1 
ATOM   4889 C CA  . SER B 1 93  ? 48.522 64.282  57.214  1.00 52.86  ? 93   SER B CA  1 
ATOM   4890 C C   . SER B 1 93  ? 49.504 63.136  57.049  1.00 51.47  ? 93   SER B C   1 
ATOM   4891 O O   . SER B 1 93  ? 49.206 62.158  56.361  1.00 50.43  ? 93   SER B O   1 
ATOM   4892 C CB  . SER B 1 93  ? 47.590 63.984  58.391  1.00 53.15  ? 93   SER B CB  1 
ATOM   4893 O OG  . SER B 1 93  ? 48.314 63.425  59.472  1.00 53.50  ? 93   SER B OG  1 
ATOM   4894 N N   . GLU B 1 94  ? 50.663 63.242  57.697  1.00 51.72  ? 94   GLU B N   1 
ATOM   4895 C CA  . GLU B 1 94  ? 51.611 62.118  57.760  1.00 50.57  ? 94   GLU B CA  1 
ATOM   4896 C C   . GLU B 1 94  ? 51.038 60.979  58.602  1.00 49.48  ? 94   GLU B C   1 
ATOM   4897 O O   . GLU B 1 94  ? 51.488 59.841  58.506  1.00 48.57  ? 94   GLU B O   1 
ATOM   4898 C CB  . GLU B 1 94  ? 52.983 62.551  58.309  1.00 51.48  ? 94   GLU B CB  1 
ATOM   4899 C CG  . GLU B 1 94  ? 53.834 63.350  57.323  1.00 52.42  ? 94   GLU B CG  1 
ATOM   4900 C CD  . GLU B 1 94  ? 55.220 63.671  57.865  1.00 55.10  ? 94   GLU B CD  1 
ATOM   4901 O OE1 . GLU B 1 94  ? 56.100 62.784  57.823  1.00 54.94  ? 94   GLU B OE1 1 
ATOM   4902 O OE2 . GLU B 1 94  ? 55.435 64.817  58.330  1.00 57.04  ? 94   GLU B OE2 1 
ATOM   4903 N N   . ASP B 1 95  ? 50.053 61.301  59.435  1.00 49.52  ? 95   ASP B N   1 
ATOM   4904 C CA  . ASP B 1 95  ? 49.377 60.302  60.244  1.00 49.13  ? 95   ASP B CA  1 
ATOM   4905 C C   . ASP B 1 95  ? 48.237 59.717  59.405  1.00 47.98  ? 95   ASP B C   1 
ATOM   4906 O O   . ASP B 1 95  ? 47.123 60.229  59.420  1.00 48.58  ? 95   ASP B O   1 
ATOM   4907 C CB  . ASP B 1 95  ? 48.887 60.951  61.546  1.00 50.02  ? 95   ASP B CB  1 
ATOM   4908 C CG  . ASP B 1 95  ? 48.042 60.020  62.416  1.00 50.25  ? 95   ASP B CG  1 
ATOM   4909 O OD1 . ASP B 1 95  ? 47.709 58.881  62.001  1.00 48.24  ? 95   ASP B OD1 1 
ATOM   4910 O OD2 . ASP B 1 95  ? 47.699 60.455  63.539  1.00 50.78  ? 95   ASP B OD2 1 
ATOM   4911 N N   . CYS B 1 96  ? 48.523 58.646  58.666  1.00 46.72  ? 96   CYS B N   1 
ATOM   4912 C CA  . CYS B 1 96  ? 47.590 58.149  57.638  1.00 45.72  ? 96   CYS B CA  1 
ATOM   4913 C C   . CYS B 1 96  ? 47.481 56.625  57.502  1.00 44.29  ? 96   CYS B C   1 
ATOM   4914 O O   . CYS B 1 96  ? 46.796 56.122  56.624  1.00 43.12  ? 96   CYS B O   1 
ATOM   4915 C CB  . CYS B 1 96  ? 47.980 58.741  56.284  1.00 45.65  ? 96   CYS B CB  1 
ATOM   4916 S SG  . CYS B 1 96  ? 49.648 58.274  55.740  1.00 45.88  ? 96   CYS B SG  1 
ATOM   4917 N N   . LEU B 1 97  ? 48.158 55.885  58.365  1.00 44.23  ? 97   LEU B N   1 
ATOM   4918 C CA  . LEU B 1 97  ? 48.155 54.437  58.246  1.00 43.26  ? 97   LEU B CA  1 
ATOM   4919 C C   . LEU B 1 97  ? 46.863 53.827  58.823  1.00 43.93  ? 97   LEU B C   1 
ATOM   4920 O O   . LEU B 1 97  ? 46.786 53.381  59.987  1.00 44.70  ? 97   LEU B O   1 
ATOM   4921 C CB  . LEU B 1 97  ? 49.448 53.854  58.821  1.00 42.93  ? 97   LEU B CB  1 
ATOM   4922 C CG  . LEU B 1 97  ? 50.717 54.352  58.105  1.00 42.78  ? 97   LEU B CG  1 
ATOM   4923 C CD1 . LEU B 1 97  ? 51.947 53.583  58.568  1.00 42.98  ? 97   LEU B CD1 1 
ATOM   4924 C CD2 . LEU B 1 97  ? 50.616 54.303  56.563  1.00 39.88  ? 97   LEU B CD2 1 
ATOM   4925 N N   . TYR B 1 98  ? 45.833 53.855  57.983  1.00 43.73  ? 98   TYR B N   1 
ATOM   4926 C CA  . TYR B 1 98  ? 44.518 53.346  58.330  1.00 44.09  ? 98   TYR B CA  1 
ATOM   4927 C C   . TYR B 1 98  ? 43.987 52.522  57.172  1.00 43.59  ? 98   TYR B C   1 
ATOM   4928 O O   . TYR B 1 98  ? 44.382 52.745  56.017  1.00 43.12  ? 98   TYR B O   1 
ATOM   4929 C CB  . TYR B 1 98  ? 43.564 54.497  58.662  1.00 44.63  ? 98   TYR B CB  1 
ATOM   4930 C CG  . TYR B 1 98  ? 44.056 55.366  59.804  1.00 46.12  ? 98   TYR B CG  1 
ATOM   4931 C CD1 . TYR B 1 98  ? 43.733 55.066  61.130  1.00 46.13  ? 98   TYR B CD1 1 
ATOM   4932 C CD2 . TYR B 1 98  ? 44.858 56.481  59.560  1.00 46.39  ? 98   TYR B CD2 1 
ATOM   4933 C CE1 . TYR B 1 98  ? 44.194 55.849  62.167  1.00 46.44  ? 98   TYR B CE1 1 
ATOM   4934 C CE2 . TYR B 1 98  ? 45.322 57.269  60.591  1.00 46.39  ? 98   TYR B CE2 1 
ATOM   4935 C CZ  . TYR B 1 98  ? 44.989 56.948  61.890  1.00 47.18  ? 98   TYR B CZ  1 
ATOM   4936 O OH  . TYR B 1 98  ? 45.463 57.730  62.914  1.00 48.64  ? 98   TYR B OH  1 
ATOM   4937 N N   . LEU B 1 99  ? 43.107 51.566  57.484  1.00 43.80  ? 99   LEU B N   1 
ATOM   4938 C CA  . LEU B 1 99  ? 42.459 50.760  56.461  1.00 43.52  ? 99   LEU B CA  1 
ATOM   4939 C C   . LEU B 1 99  ? 40.938 50.743  56.620  1.00 44.50  ? 99   LEU B C   1 
ATOM   4940 O O   . LEU B 1 99  ? 40.408 51.103  57.686  1.00 45.81  ? 99   LEU B O   1 
ATOM   4941 C CB  . LEU B 1 99  ? 43.042 49.338  56.421  1.00 43.25  ? 99   LEU B CB  1 
ATOM   4942 C CG  . LEU B 1 99  ? 43.031 48.410  57.642  1.00 44.25  ? 99   LEU B CG  1 
ATOM   4943 C CD1 . LEU B 1 99  ? 41.653 47.819  57.948  1.00 42.86  ? 99   LEU B CD1 1 
ATOM   4944 C CD2 . LEU B 1 99  ? 44.024 47.290  57.393  1.00 44.43  ? 99   LEU B CD2 1 
ATOM   4945 N N   . ASN B 1 100 ? 40.252 50.312  55.559  1.00 44.04  ? 100  ASN B N   1 
ATOM   4946 C CA  . ASN B 1 100 ? 38.792 50.284  55.501  1.00 44.87  ? 100  ASN B CA  1 
ATOM   4947 C C   . ASN B 1 100 ? 38.273 48.908  55.105  1.00 45.48  ? 100  ASN B C   1 
ATOM   4948 O O   . ASN B 1 100 ? 38.840 48.244  54.228  1.00 44.74  ? 100  ASN B O   1 
ATOM   4949 C CB  . ASN B 1 100 ? 38.282 51.326  54.508  1.00 44.41  ? 100  ASN B CB  1 
ATOM   4950 C CG  . ASN B 1 100 ? 39.027 52.642  54.618  1.00 44.40  ? 100  ASN B CG  1 
ATOM   4951 O OD1 . ASN B 1 100 ? 39.042 53.275  55.680  1.00 45.37  ? 100  ASN B OD1 1 
ATOM   4952 N ND2 . ASN B 1 100 ? 39.657 53.061  53.522  1.00 41.80  ? 100  ASN B ND2 1 
ATOM   4953 N N   . VAL B 1 101 ? 37.192 48.485  55.756  1.00 46.76  ? 101  VAL B N   1 
ATOM   4954 C CA  . VAL B 1 101 ? 36.569 47.201  55.474  1.00 47.38  ? 101  VAL B CA  1 
ATOM   4955 C C   . VAL B 1 101 ? 35.076 47.396  55.214  1.00 49.19  ? 101  VAL B C   1 
ATOM   4956 O O   . VAL B 1 101 ? 34.378 48.020  56.016  1.00 50.36  ? 101  VAL B O   1 
ATOM   4957 C CB  . VAL B 1 101 ? 36.746 46.200  56.651  1.00 48.01  ? 101  VAL B CB  1 
ATOM   4958 C CG1 . VAL B 1 101 ? 36.093 44.860  56.330  1.00 47.62  ? 101  VAL B CG1 1 
ATOM   4959 C CG2 . VAL B 1 101 ? 38.217 46.011  57.017  1.00 45.94  ? 101  VAL B CG2 1 
ATOM   4960 N N   . TRP B 1 102 ? 34.595 46.871  54.087  1.00 49.66  ? 102  TRP B N   1 
ATOM   4961 C CA  . TRP B 1 102 ? 33.159 46.766  53.832  1.00 51.18  ? 102  TRP B CA  1 
ATOM   4962 C C   . TRP B 1 102 ? 32.784 45.294  53.883  1.00 52.58  ? 102  TRP B C   1 
ATOM   4963 O O   . TRP B 1 102 ? 33.534 44.441  53.384  1.00 52.02  ? 102  TRP B O   1 
ATOM   4964 C CB  . TRP B 1 102 ? 32.823 47.277  52.441  1.00 50.66  ? 102  TRP B CB  1 
ATOM   4965 C CG  . TRP B 1 102 ? 32.840 48.741  52.267  1.00 49.80  ? 102  TRP B CG  1 
ATOM   4966 C CD1 . TRP B 1 102 ? 31.773 49.589  52.363  1.00 51.71  ? 102  TRP B CD1 1 
ATOM   4967 C CD2 . TRP B 1 102 ? 33.962 49.543  51.911  1.00 48.46  ? 102  TRP B CD2 1 
ATOM   4968 N NE1 . TRP B 1 102 ? 32.170 50.881  52.111  1.00 52.30  ? 102  TRP B NE1 1 
ATOM   4969 C CE2 . TRP B 1 102 ? 33.513 50.878  51.830  1.00 49.86  ? 102  TRP B CE2 1 
ATOM   4970 C CE3 . TRP B 1 102 ? 35.312 49.268  51.667  1.00 47.29  ? 102  TRP B CE3 1 
ATOM   4971 C CZ2 . TRP B 1 102 ? 34.363 51.931  51.508  1.00 48.56  ? 102  TRP B CZ2 1 
ATOM   4972 C CZ3 . TRP B 1 102 ? 36.148 50.309  51.340  1.00 47.04  ? 102  TRP B CZ3 1 
ATOM   4973 C CH2 . TRP B 1 102 ? 35.671 51.628  51.263  1.00 47.46  ? 102  TRP B CH2 1 
ATOM   4974 N N   . THR B 1 103 ? 31.635 44.984  54.469  1.00 54.61  ? 103  THR B N   1 
ATOM   4975 C CA  . THR B 1 103 ? 31.107 43.612  54.433  1.00 56.43  ? 103  THR B CA  1 
ATOM   4976 C C   . THR B 1 103 ? 29.604 43.644  54.180  1.00 58.61  ? 103  THR B C   1 
ATOM   4977 O O   . THR B 1 103 ? 28.988 44.699  54.321  1.00 59.47  ? 103  THR B O   1 
ATOM   4978 C CB  . THR B 1 103 ? 31.370 42.833  55.752  1.00 57.13  ? 103  THR B CB  1 
ATOM   4979 O OG1 . THR B 1 103 ? 30.524 43.339  56.790  1.00 59.35  ? 103  THR B OG1 1 
ATOM   4980 C CG2 . THR B 1 103 ? 32.817 42.954  56.188  1.00 55.81  ? 103  THR B CG2 1 
ATOM   4981 N N   . PRO B 1 104 ? 29.009 42.501  53.780  1.00 60.16  ? 104  PRO B N   1 
ATOM   4982 C CA  . PRO B 1 104 ? 27.546 42.360  53.743  1.00 62.45  ? 104  PRO B CA  1 
ATOM   4983 C C   . PRO B 1 104 ? 26.906 42.600  55.107  1.00 64.45  ? 104  PRO B C   1 
ATOM   4984 O O   . PRO B 1 104 ? 27.553 42.389  56.141  1.00 63.87  ? 104  PRO B O   1 
ATOM   4985 C CB  . PRO B 1 104 ? 27.350 40.901  53.346  1.00 63.02  ? 104  PRO B CB  1 
ATOM   4986 C CG  . PRO B 1 104 ? 28.580 40.562  52.591  1.00 61.17  ? 104  PRO B CG  1 
ATOM   4987 C CD  . PRO B 1 104 ? 29.679 41.285  53.285  1.00 59.59  ? 104  PRO B CD  1 
ATOM   4988 N N   . TYR B 1 105 ? 25.650 43.056  55.089  1.00 67.07  ? 105  TYR B N   1 
ATOM   4989 C CA  . TYR B 1 105 ? 24.838 43.251  56.286  1.00 69.28  ? 105  TYR B CA  1 
ATOM   4990 C C   . TYR B 1 105 ? 23.629 42.348  56.128  1.00 72.65  ? 105  TYR B C   1 
ATOM   4991 O O   . TYR B 1 105 ? 22.875 42.498  55.168  1.00 74.00  ? 105  TYR B O   1 
ATOM   4992 C CB  . TYR B 1 105 ? 24.395 44.713  56.410  1.00 69.43  ? 105  TYR B CB  1 
ATOM   4993 C CG  . TYR B 1 105 ? 23.622 45.054  57.676  1.00 71.26  ? 105  TYR B CG  1 
ATOM   4994 C CD1 . TYR B 1 105 ? 24.190 45.849  58.673  1.00 70.57  ? 105  TYR B CD1 1 
ATOM   4995 C CD2 . TYR B 1 105 ? 22.317 44.591  57.870  1.00 74.08  ? 105  TYR B CD2 1 
ATOM   4996 C CE1 . TYR B 1 105 ? 23.484 46.164  59.835  1.00 72.07  ? 105  TYR B CE1 1 
ATOM   4997 C CE2 . TYR B 1 105 ? 21.605 44.897  59.019  1.00 75.80  ? 105  TYR B CE2 1 
ATOM   4998 C CZ  . TYR B 1 105 ? 22.189 45.685  60.000  1.00 75.53  ? 105  TYR B CZ  1 
ATOM   4999 O OH  . TYR B 1 105 ? 21.464 45.983  61.141  1.00 77.23  ? 105  TYR B OH  1 
ATOM   5000 N N   . PRO B 1 106 ? 23.413 41.414  57.070  1.00 74.93  ? 106  PRO B N   1 
ATOM   5001 C CA  . PRO B 1 106 ? 24.246 41.133  58.248  1.00 74.84  ? 106  PRO B CA  1 
ATOM   5002 C C   . PRO B 1 106 ? 25.585 40.474  57.895  1.00 73.45  ? 106  PRO B C   1 
ATOM   5003 O O   . PRO B 1 106 ? 25.757 39.973  56.777  1.00 72.78  ? 106  PRO B O   1 
ATOM   5004 C CB  . PRO B 1 106 ? 23.376 40.164  59.063  1.00 77.51  ? 106  PRO B CB  1 
ATOM   5005 C CG  . PRO B 1 106 ? 22.497 39.491  58.033  1.00 78.47  ? 106  PRO B CG  1 
ATOM   5006 C CD  . PRO B 1 106 ? 22.215 40.549  57.012  1.00 77.26  ? 106  PRO B CD  1 
ATOM   5007 N N   . ARG B 1 107 ? 26.510 40.499  58.857  1.00 73.34  ? 107  ARG B N   1 
ATOM   5008 C CA  . ARG B 1 107 ? 27.808 39.823  58.786  1.00 72.65  ? 107  ARG B CA  1 
ATOM   5009 C C   . ARG B 1 107 ? 27.654 38.427  58.185  1.00 73.76  ? 107  ARG B C   1 
ATOM   5010 O O   . ARG B 1 107 ? 26.815 37.653  58.647  1.00 76.20  ? 107  ARG B O   1 
ATOM   5011 C CB  . ARG B 1 107 ? 28.391 39.701  60.202  1.00 72.98  ? 107  ARG B CB  1 
ATOM   5012 C CG  . ARG B 1 107 ? 29.915 39.698  60.287  1.00 72.61  ? 107  ARG B CG  1 
ATOM   5013 C CD  . ARG B 1 107 ? 30.507 41.119  60.470  1.00 73.15  ? 107  ARG B CD  1 
ATOM   5014 N NE  . ARG B 1 107 ? 30.076 41.796  61.706  1.00 75.61  ? 107  ARG B NE  1 
ATOM   5015 C CZ  . ARG B 1 107 ? 30.333 41.379  62.952  1.00 76.76  ? 107  ARG B CZ  1 
ATOM   5016 N NH1 . ARG B 1 107 ? 30.998 40.251  63.174  1.00 77.14  ? 107  ARG B NH1 1 
ATOM   5017 N NH2 . ARG B 1 107 ? 29.906 42.085  63.991  1.00 77.64  ? 107  ARG B NH2 1 
ATOM   5018 N N   . PRO B 1 108 ? 28.452 38.099  57.151  1.00 72.55  ? 108  PRO B N   1 
ATOM   5019 C CA  . PRO B 1 108 ? 28.381 36.789  56.495  1.00 73.51  ? 108  PRO B CA  1 
ATOM   5020 C C   . PRO B 1 108 ? 28.425 35.612  57.476  1.00 75.27  ? 108  PRO B C   1 
ATOM   5021 O O   . PRO B 1 108 ? 29.271 35.585  58.376  1.00 74.68  ? 108  PRO B O   1 
ATOM   5022 C CB  . PRO B 1 108 ? 29.631 36.773  55.617  1.00 71.35  ? 108  PRO B CB  1 
ATOM   5023 C CG  . PRO B 1 108 ? 29.895 38.202  55.321  1.00 69.84  ? 108  PRO B CG  1 
ATOM   5024 C CD  . PRO B 1 108 ? 29.473 38.968  56.537  1.00 70.30  ? 108  PRO B CD  1 
ATOM   5025 N N   . ALA B 1 109 ? 27.521 34.650  57.281  1.00 77.57  ? 109  ALA B N   1 
ATOM   5026 C CA  . ALA B 1 109 ? 27.422 33.461  58.136  1.00 79.55  ? 109  ALA B CA  1 
ATOM   5027 C C   . ALA B 1 109 ? 28.633 32.514  58.030  1.00 78.69  ? 109  ALA B C   1 
ATOM   5028 O O   . ALA B 1 109 ? 29.079 31.965  59.037  1.00 79.50  ? 109  ALA B O   1 
ATOM   5029 C CB  . ALA B 1 109 ? 26.116 32.708  57.854  1.00 82.25  ? 109  ALA B CB  1 
ATOM   5030 N N   . SER B 1 110 ? 29.151 32.316  56.818  1.00 77.11  ? 110  SER B N   1 
ATOM   5031 C CA  . SER B 1 110 ? 30.378 31.534  56.630  1.00 75.99  ? 110  SER B CA  1 
ATOM   5032 C C   . SER B 1 110 ? 31.495 32.381  55.989  1.00 72.97  ? 110  SER B C   1 
ATOM   5033 O O   . SER B 1 110 ? 31.203 33.381  55.326  1.00 72.12  ? 110  SER B O   1 
ATOM   5034 C CB  . SER B 1 110 ? 30.088 30.280  55.808  1.00 77.47  ? 110  SER B CB  1 
ATOM   5035 O OG  . SER B 1 110 ? 29.580 30.617  54.537  1.00 77.15  ? 110  SER B OG  1 
ATOM   5036 N N   . PRO B 1 111 ? 32.775 31.991  56.189  1.00 71.53  ? 111  PRO B N   1 
ATOM   5037 C CA  . PRO B 1 111 ? 33.938 32.764  55.705  1.00 68.47  ? 111  PRO B CA  1 
ATOM   5038 C C   . PRO B 1 111 ? 33.897 33.113  54.207  1.00 66.58  ? 111  PRO B C   1 
ATOM   5039 O O   . PRO B 1 111 ? 33.754 32.228  53.369  1.00 67.25  ? 111  PRO B O   1 
ATOM   5040 C CB  . PRO B 1 111 ? 35.122 31.838  56.006  1.00 68.69  ? 111  PRO B CB  1 
ATOM   5041 C CG  . PRO B 1 111 ? 34.655 30.980  57.135  1.00 71.24  ? 111  PRO B CG  1 
ATOM   5042 C CD  . PRO B 1 111 ? 33.192 30.766  56.903  1.00 72.93  ? 111  PRO B CD  1 
ATOM   5043 N N   . THR B 1 112 ? 34.040 34.399  53.889  1.00 64.15  ? 112  THR B N   1 
ATOM   5044 C CA  . THR B 1 112 ? 33.867 34.906  52.529  1.00 62.38  ? 112  THR B CA  1 
ATOM   5045 C C   . THR B 1 112 ? 35.185 35.362  51.912  1.00 59.81  ? 112  THR B C   1 
ATOM   5046 O O   . THR B 1 112 ? 35.974 36.019  52.581  1.00 59.01  ? 112  THR B O   1 
ATOM   5047 C CB  . THR B 1 112 ? 32.941 36.120  52.518  1.00 62.22  ? 112  THR B CB  1 
ATOM   5048 O OG1 . THR B 1 112 ? 32.018 36.022  53.604  1.00 64.61  ? 112  THR B OG1 1 
ATOM   5049 C CG2 . THR B 1 112 ? 32.175 36.202  51.202  1.00 63.02  ? 112  THR B CG2 1 
ATOM   5050 N N   . PRO B 1 113 ? 35.422 35.030  50.624  1.00 58.75  ? 113  PRO B N   1 
ATOM   5051 C CA  . PRO B 1 113 ? 36.616 35.532  49.943  1.00 56.18  ? 113  PRO B CA  1 
ATOM   5052 C C   . PRO B 1 113 ? 36.810 37.019  50.176  1.00 54.36  ? 113  PRO B C   1 
ATOM   5053 O O   . PRO B 1 113 ? 35.842 37.771  50.166  1.00 54.44  ? 113  PRO B O   1 
ATOM   5054 C CB  . PRO B 1 113 ? 36.315 35.263  48.469  1.00 56.18  ? 113  PRO B CB  1 
ATOM   5055 C CG  . PRO B 1 113 ? 35.467 34.028  48.502  1.00 58.90  ? 113  PRO B CG  1 
ATOM   5056 C CD  . PRO B 1 113 ? 34.615 34.151  49.747  1.00 59.74  ? 113  PRO B CD  1 
ATOM   5057 N N   . VAL B 1 114 ? 38.064 37.417  50.386  1.00 52.57  ? 114  VAL B N   1 
ATOM   5058 C CA  . VAL B 1 114 ? 38.424 38.789  50.684  1.00 51.10  ? 114  VAL B CA  1 
ATOM   5059 C C   . VAL B 1 114 ? 39.100 39.408  49.476  1.00 49.91  ? 114  VAL B C   1 
ATOM   5060 O O   . VAL B 1 114 ? 40.000 38.819  48.906  1.00 49.93  ? 114  VAL B O   1 
ATOM   5061 C CB  . VAL B 1 114 ? 39.403 38.854  51.891  1.00 50.97  ? 114  VAL B CB  1 
ATOM   5062 C CG1 . VAL B 1 114 ? 39.793 40.293  52.216  1.00 49.15  ? 114  VAL B CG1 1 
ATOM   5063 C CG2 . VAL B 1 114 ? 38.798 38.172  53.113  1.00 51.76  ? 114  VAL B CG2 1 
ATOM   5064 N N   . LEU B 1 115 ? 38.670 40.602  49.085  1.00 49.53  ? 115  LEU B N   1 
ATOM   5065 C CA  . LEU B 1 115 ? 39.387 41.375  48.074  1.00 48.24  ? 115  LEU B CA  1 
ATOM   5066 C C   . LEU B 1 115 ? 40.098 42.550  48.754  1.00 47.39  ? 115  LEU B C   1 
ATOM   5067 O O   . LEU B 1 115 ? 39.500 43.259  49.576  1.00 48.38  ? 115  LEU B O   1 
ATOM   5068 C CB  . LEU B 1 115 ? 38.417 41.895  47.018  1.00 48.73  ? 115  LEU B CB  1 
ATOM   5069 C CG  . LEU B 1 115 ? 37.824 40.960  45.963  1.00 49.09  ? 115  LEU B CG  1 
ATOM   5070 C CD1 . LEU B 1 115 ? 36.479 41.461  45.532  1.00 48.75  ? 115  LEU B CD1 1 
ATOM   5071 C CD2 . LEU B 1 115 ? 38.740 40.904  44.775  1.00 49.93  ? 115  LEU B CD2 1 
ATOM   5072 N N   . ILE B 1 116 ? 41.372 42.745  48.436  1.00 45.71  ? 116  ILE B N   1 
ATOM   5073 C CA  . ILE B 1 116 ? 42.120 43.854  49.002  1.00 44.63  ? 116  ILE B CA  1 
ATOM   5074 C C   . ILE B 1 116 ? 42.544 44.771  47.867  1.00 43.77  ? 116  ILE B C   1 
ATOM   5075 O O   . ILE B 1 116 ? 43.277 44.352  46.968  1.00 43.88  ? 116  ILE B O   1 
ATOM   5076 C CB  . ILE B 1 116 ? 43.362 43.370  49.814  1.00 44.65  ? 116  ILE B CB  1 
ATOM   5077 C CG1 . ILE B 1 116 ? 42.939 42.411  50.937  1.00 45.18  ? 116  ILE B CG1 1 
ATOM   5078 C CG2 . ILE B 1 116 ? 44.129 44.561  50.403  1.00 44.22  ? 116  ILE B CG2 1 
ATOM   5079 C CD1 . ILE B 1 116 ? 44.081 41.752  51.692  1.00 43.27  ? 116  ILE B CD1 1 
ATOM   5080 N N   . TRP B 1 117 ? 42.076 46.014  47.912  1.00 43.30  ? 117  TRP B N   1 
ATOM   5081 C CA  . TRP B 1 117 ? 42.424 47.038  46.927  1.00 42.83  ? 117  TRP B CA  1 
ATOM   5082 C C   . TRP B 1 117 ? 43.651 47.880  47.320  1.00 42.64  ? 117  TRP B C   1 
ATOM   5083 O O   . TRP B 1 117 ? 43.744 48.382  48.440  1.00 42.38  ? 117  TRP B O   1 
ATOM   5084 C CB  . TRP B 1 117 ? 41.226 47.952  46.681  1.00 43.15  ? 117  TRP B CB  1 
ATOM   5085 C CG  . TRP B 1 117 ? 41.500 49.109  45.777  1.00 42.63  ? 117  TRP B CG  1 
ATOM   5086 C CD1 . TRP B 1 117 ? 41.668 50.408  46.143  1.00 42.81  ? 117  TRP B CD1 1 
ATOM   5087 C CD2 . TRP B 1 117 ? 41.615 49.075  44.352  1.00 42.87  ? 117  TRP B CD2 1 
ATOM   5088 N NE1 . TRP B 1 117 ? 41.885 51.193  45.035  1.00 42.31  ? 117  TRP B NE1 1 
ATOM   5089 C CE2 . TRP B 1 117 ? 41.865 50.399  43.922  1.00 42.60  ? 117  TRP B CE2 1 
ATOM   5090 C CE3 . TRP B 1 117 ? 41.531 48.052  43.390  1.00 43.18  ? 117  TRP B CE3 1 
ATOM   5091 C CZ2 . TRP B 1 117 ? 42.034 50.731  42.573  1.00 42.55  ? 117  TRP B CZ2 1 
ATOM   5092 C CZ3 . TRP B 1 117 ? 41.703 48.379  42.051  1.00 42.69  ? 117  TRP B CZ3 1 
ATOM   5093 C CH2 . TRP B 1 117 ? 41.957 49.711  41.655  1.00 42.87  ? 117  TRP B CH2 1 
ATOM   5094 N N   . ILE B 1 118 ? 44.582 48.021  46.376  1.00 42.73  ? 118  ILE B N   1 
ATOM   5095 C CA  . ILE B 1 118 ? 45.737 48.921  46.514  1.00 42.63  ? 118  ILE B CA  1 
ATOM   5096 C C   . ILE B 1 118 ? 45.697 49.981  45.409  1.00 42.99  ? 118  ILE B C   1 
ATOM   5097 O O   . ILE B 1 118 ? 45.937 49.665  44.244  1.00 44.03  ? 118  ILE B O   1 
ATOM   5098 C CB  . ILE B 1 118 ? 47.077 48.164  46.417  1.00 41.60  ? 118  ILE B CB  1 
ATOM   5099 C CG1 . ILE B 1 118 ? 47.170 47.074  47.474  1.00 41.57  ? 118  ILE B CG1 1 
ATOM   5100 C CG2 . ILE B 1 118 ? 48.236 49.127  46.580  1.00 42.28  ? 118  ILE B CG2 1 
ATOM   5101 C CD1 . ILE B 1 118 ? 48.309 46.094  47.242  1.00 39.35  ? 118  ILE B CD1 1 
ATOM   5102 N N   . TYR B 1 119 ? 45.410 51.226  45.762  1.00 43.14  ? 119  TYR B N   1 
ATOM   5103 C CA  . TYR B 1 119 ? 45.316 52.306  44.772  1.00 43.38  ? 119  TYR B CA  1 
ATOM   5104 C C   . TYR B 1 119 ? 46.626 52.640  44.054  1.00 43.64  ? 119  TYR B C   1 
ATOM   5105 O O   . TYR B 1 119 ? 47.721 52.283  44.515  1.00 43.55  ? 119  TYR B O   1 
ATOM   5106 C CB  . TYR B 1 119 ? 44.765 53.581  45.427  1.00 44.05  ? 119  TYR B CB  1 
ATOM   5107 C CG  . TYR B 1 119 ? 45.573 54.095  46.613  1.00 43.41  ? 119  TYR B CG  1 
ATOM   5108 C CD1 . TYR B 1 119 ? 46.802 54.716  46.426  1.00 42.55  ? 119  TYR B CD1 1 
ATOM   5109 C CD2 . TYR B 1 119 ? 45.084 53.994  47.910  1.00 43.05  ? 119  TYR B CD2 1 
ATOM   5110 C CE1 . TYR B 1 119 ? 47.536 55.211  47.504  1.00 43.63  ? 119  TYR B CE1 1 
ATOM   5111 C CE2 . TYR B 1 119 ? 45.811 54.481  49.000  1.00 43.73  ? 119  TYR B CE2 1 
ATOM   5112 C CZ  . TYR B 1 119 ? 47.042 55.089  48.788  1.00 44.05  ? 119  TYR B CZ  1 
ATOM   5113 O OH  . TYR B 1 119 ? 47.789 55.569  49.849  1.00 44.70  ? 119  TYR B OH  1 
ATOM   5114 N N   . GLY B 1 120 ? 46.496 53.348  42.929  1.00 44.27  ? 120  GLY B N   1 
ATOM   5115 C CA  . GLY B 1 120 ? 47.634 53.935  42.206  1.00 44.12  ? 120  GLY B CA  1 
ATOM   5116 C C   . GLY B 1 120 ? 47.764 55.431  42.464  1.00 44.92  ? 120  GLY B C   1 
ATOM   5117 O O   . GLY B 1 120 ? 47.102 55.976  43.360  1.00 45.30  ? 120  GLY B O   1 
ATOM   5118 N N   . GLY B 1 121 ? 48.614 56.087  41.675  1.00 44.89  ? 121  GLY B N   1 
ATOM   5119 C CA  . GLY B 1 121 ? 48.958 57.496  41.858  1.00 45.37  ? 121  GLY B CA  1 
ATOM   5120 C C   . GLY B 1 121 ? 50.460 57.717  41.696  1.00 45.98  ? 121  GLY B C   1 
ATOM   5121 O O   . GLY B 1 121 ? 51.035 58.649  42.294  1.00 46.49  ? 121  GLY B O   1 
ATOM   5122 N N   . GLY B 1 122 ? 51.097 56.833  40.916  1.00 45.17  ? 122  GLY B N   1 
ATOM   5123 C CA  . GLY B 1 122 ? 52.518 56.915  40.580  1.00 44.93  ? 122  GLY B CA  1 
ATOM   5124 C C   . GLY B 1 122 ? 53.454 56.810  41.763  1.00 44.98  ? 122  GLY B C   1 
ATOM   5125 O O   . GLY B 1 122 ? 54.602 57.251  41.686  1.00 45.53  ? 122  GLY B O   1 
ATOM   5126 N N   . PHE B 1 123 ? 52.960 56.225  42.857  1.00 44.32  ? 123  PHE B N   1 
ATOM   5127 C CA  . PHE B 1 123 ? 53.668 56.182  44.140  1.00 44.17  ? 123  PHE B CA  1 
ATOM   5128 C C   . PHE B 1 123 ? 53.871 57.581  44.742  1.00 45.38  ? 123  PHE B C   1 
ATOM   5129 O O   . PHE B 1 123 ? 54.553 57.720  45.749  1.00 45.98  ? 123  PHE B O   1 
ATOM   5130 C CB  . PHE B 1 123 ? 55.017 55.449  44.022  1.00 44.07  ? 123  PHE B CB  1 
ATOM   5131 C CG  . PHE B 1 123 ? 54.909 53.997  43.606  1.00 42.82  ? 123  PHE B CG  1 
ATOM   5132 C CD1 . PHE B 1 123 ? 54.506 53.010  44.529  1.00 41.38  ? 123  PHE B CD1 1 
ATOM   5133 C CD2 . PHE B 1 123 ? 55.246 53.604  42.312  1.00 41.43  ? 123  PHE B CD2 1 
ATOM   5134 C CE1 . PHE B 1 123 ? 54.413 51.658  44.158  1.00 39.41  ? 123  PHE B CE1 1 
ATOM   5135 C CE2 . PHE B 1 123 ? 55.167 52.249  41.925  1.00 40.67  ? 123  PHE B CE2 1 
ATOM   5136 C CZ  . PHE B 1 123 ? 54.742 51.275  42.852  1.00 40.67  ? 123  PHE B CZ  1 
ATOM   5137 N N   . TYR B 1 124 ? 53.284 58.617  44.137  1.00 46.00  ? 124  TYR B N   1 
ATOM   5138 C CA  . TYR B 1 124 ? 53.373 59.979  44.702  1.00 47.15  ? 124  TYR B CA  1 
ATOM   5139 C C   . TYR B 1 124 ? 52.005 60.480  45.212  1.00 47.20  ? 124  TYR B C   1 
ATOM   5140 O O   . TYR B 1 124 ? 51.921 61.562  45.800  1.00 48.28  ? 124  TYR B O   1 
ATOM   5141 C CB  . TYR B 1 124 ? 54.006 60.989  43.697  1.00 48.19  ? 124  TYR B CB  1 
ATOM   5142 C CG  . TYR B 1 124 ? 53.086 61.349  42.553  1.00 48.00  ? 124  TYR B CG  1 
ATOM   5143 C CD1 . TYR B 1 124 ? 52.082 62.301  42.723  1.00 48.07  ? 124  TYR B CD1 1 
ATOM   5144 C CD2 . TYR B 1 124 ? 53.188 60.706  41.316  1.00 48.27  ? 124  TYR B CD2 1 
ATOM   5145 C CE1 . TYR B 1 124 ? 51.204 62.619  41.703  1.00 49.10  ? 124  TYR B CE1 1 
ATOM   5146 C CE2 . TYR B 1 124 ? 52.302 61.016  40.266  1.00 49.16  ? 124  TYR B CE2 1 
ATOM   5147 C CZ  . TYR B 1 124 ? 51.311 61.982  40.478  1.00 49.66  ? 124  TYR B CZ  1 
ATOM   5148 O OH  . TYR B 1 124 ? 50.423 62.319  39.479  1.00 49.65  ? 124  TYR B OH  1 
ATOM   5149 N N   . SER B 1 125 ? 50.942 59.700  44.988  1.00 46.08  ? 125  SER B N   1 
ATOM   5150 C CA  . SER B 1 125 ? 49.580 60.116  45.362  1.00 46.03  ? 125  SER B CA  1 
ATOM   5151 C C   . SER B 1 125 ? 48.604 58.949  45.457  1.00 45.50  ? 125  SER B C   1 
ATOM   5152 O O   . SER B 1 125 ? 48.940 57.811  45.130  1.00 44.83  ? 125  SER B O   1 
ATOM   5153 C CB  . SER B 1 125 ? 49.036 61.165  44.385  1.00 46.71  ? 125  SER B CB  1 
ATOM   5154 O OG  . SER B 1 125 ? 49.047 60.702  43.040  1.00 45.52  ? 125  SER B OG  1 
ATOM   5155 N N   . GLY B 1 126 ? 47.388 59.247  45.903  1.00 46.02  ? 126  GLY B N   1 
ATOM   5156 C CA  . GLY B 1 126 ? 46.344 58.247  46.054  1.00 45.35  ? 126  GLY B CA  1 
ATOM   5157 C C   . GLY B 1 126 ? 45.739 58.257  47.440  1.00 45.88  ? 126  GLY B C   1 
ATOM   5158 O O   . GLY B 1 126 ? 46.274 58.869  48.360  1.00 46.34  ? 126  GLY B O   1 
ATOM   5159 N N   . ALA B 1 127 ? 44.610 57.573  47.583  1.00 45.96  ? 127  ALA B N   1 
ATOM   5160 C CA  . ALA B 1 127 ? 43.899 57.480  48.859  1.00 46.71  ? 127  ALA B CA  1 
ATOM   5161 C C   . ALA B 1 127 ? 42.826 56.418  48.727  1.00 46.40  ? 127  ALA B C   1 
ATOM   5162 O O   . ALA B 1 127 ? 42.188 56.326  47.691  1.00 46.75  ? 127  ALA B O   1 
ATOM   5163 C CB  . ALA B 1 127 ? 43.274 58.823  49.240  1.00 47.52  ? 127  ALA B CB  1 
ATOM   5164 N N   . ALA B 1 128 ? 42.625 55.635  49.781  1.00 46.54  ? 128  ALA B N   1 
ATOM   5165 C CA  . ALA B 1 128 ? 41.630 54.556  49.785  1.00 46.65  ? 128  ALA B CA  1 
ATOM   5166 C C   . ALA B 1 128 ? 40.207 55.097  49.905  1.00 48.28  ? 128  ALA B C   1 
ATOM   5167 O O   . ALA B 1 128 ? 39.245 54.333  49.787  1.00 49.06  ? 128  ALA B O   1 
ATOM   5168 C CB  . ALA B 1 128 ? 41.913 53.583  50.903  1.00 45.83  ? 128  ALA B CB  1 
ATOM   5169 N N   . SER B 1 129 ? 40.089 56.414  50.115  1.00 49.12  ? 129  SER B N   1 
ATOM   5170 C CA  . SER B 1 129 ? 38.820 57.072  50.409  1.00 50.23  ? 129  SER B CA  1 
ATOM   5171 C C   . SER B 1 129 ? 38.133 57.728  49.203  1.00 51.21  ? 129  SER B C   1 
ATOM   5172 O O   . SER B 1 129 ? 37.066 58.350  49.354  1.00 52.29  ? 129  SER B O   1 
ATOM   5173 C CB  . SER B 1 129 ? 39.032 58.118  51.507  1.00 50.97  ? 129  SER B CB  1 
ATOM   5174 O OG  . SER B 1 129 ? 40.003 59.077  51.128  1.00 50.45  ? 129  SER B OG  1 
ATOM   5175 N N   . LEU B 1 130 ? 38.739 57.606  48.022  1.00 50.44  ? 130  LEU B N   1 
ATOM   5176 C CA  . LEU B 1 130 ? 38.179 58.210  46.814  1.00 51.69  ? 130  LEU B CA  1 
ATOM   5177 C C   . LEU B 1 130 ? 36.858 57.531  46.439  1.00 52.71  ? 130  LEU B C   1 
ATOM   5178 O O   . LEU B 1 130 ? 36.671 56.335  46.703  1.00 52.39  ? 130  LEU B O   1 
ATOM   5179 C CB  . LEU B 1 130 ? 39.166 58.128  45.643  1.00 50.90  ? 130  LEU B CB  1 
ATOM   5180 C CG  . LEU B 1 130 ? 40.545 58.804  45.726  1.00 51.08  ? 130  LEU B CG  1 
ATOM   5181 C CD1 . LEU B 1 130 ? 41.285 58.642  44.402  1.00 49.58  ? 130  LEU B CD1 1 
ATOM   5182 C CD2 . LEU B 1 130 ? 40.439 60.276  46.101  1.00 51.43  ? 130  LEU B CD2 1 
ATOM   5183 N N   . ASP B 1 131 ? 35.954 58.285  45.820  1.00 54.07  ? 131  ASP B N   1 
ATOM   5184 C CA  . ASP B 1 131 ? 34.645 57.757  45.464  1.00 55.52  ? 131  ASP B CA  1 
ATOM   5185 C C   . ASP B 1 131 ? 34.725 56.527  44.546  1.00 54.83  ? 131  ASP B C   1 
ATOM   5186 O O   . ASP B 1 131 ? 33.944 55.595  44.705  1.00 55.46  ? 131  ASP B O   1 
ATOM   5187 C CB  . ASP B 1 131 ? 33.750 58.841  44.841  1.00 57.51  ? 131  ASP B CB  1 
ATOM   5188 C CG  . ASP B 1 131 ? 33.306 59.923  45.852  1.00 59.79  ? 131  ASP B CG  1 
ATOM   5189 O OD1 . ASP B 1 131 ? 33.609 59.855  47.071  1.00 58.67  ? 131  ASP B OD1 1 
ATOM   5190 O OD2 . ASP B 1 131 ? 32.637 60.870  45.400  1.00 63.04  ? 131  ASP B OD2 1 
ATOM   5191 N N   . VAL B 1 132 ? 35.666 56.506  43.606  1.00 53.80  ? 132  VAL B N   1 
ATOM   5192 C CA  . VAL B 1 132 ? 35.783 55.354  42.697  1.00 53.19  ? 132  VAL B CA  1 
ATOM   5193 C C   . VAL B 1 132 ? 36.214 54.049  43.381  1.00 51.98  ? 132  VAL B C   1 
ATOM   5194 O O   . VAL B 1 132 ? 36.052 52.962  42.800  1.00 51.73  ? 132  VAL B O   1 
ATOM   5195 C CB  . VAL B 1 132 ? 36.675 55.638  41.453  1.00 52.74  ? 132  VAL B CB  1 
ATOM   5196 C CG1 . VAL B 1 132 ? 35.951 56.577  40.495  1.00 54.62  ? 132  VAL B CG1 1 
ATOM   5197 C CG2 . VAL B 1 132 ? 38.037 56.215  41.857  1.00 52.17  ? 132  VAL B CG2 1 
ATOM   5198 N N   . TYR B 1 133 ? 36.746 54.151  44.605  1.00 51.05  ? 133  TYR B N   1 
ATOM   5199 C CA  . TYR B 1 133 ? 37.142 52.956  45.361  1.00 49.81  ? 133  TYR B CA  1 
ATOM   5200 C C   . TYR B 1 133 ? 36.117 52.532  46.411  1.00 50.57  ? 133  TYR B C   1 
ATOM   5201 O O   . TYR B 1 133 ? 36.425 51.750  47.294  1.00 50.40  ? 133  TYR B O   1 
ATOM   5202 C CB  . TYR B 1 133 ? 38.516 53.129  46.016  1.00 48.59  ? 133  TYR B CB  1 
ATOM   5203 C CG  . TYR B 1 133 ? 39.593 53.716  45.128  1.00 47.28  ? 133  TYR B CG  1 
ATOM   5204 C CD1 . TYR B 1 133 ? 39.663 53.416  43.769  1.00 46.05  ? 133  TYR B CD1 1 
ATOM   5205 C CD2 . TYR B 1 133 ? 40.553 54.563  45.664  1.00 46.72  ? 133  TYR B CD2 1 
ATOM   5206 C CE1 . TYR B 1 133 ? 40.653 53.966  42.965  1.00 46.35  ? 133  TYR B CE1 1 
ATOM   5207 C CE2 . TYR B 1 133 ? 41.555 55.113  44.873  1.00 46.84  ? 133  TYR B CE2 1 
ATOM   5208 C CZ  . TYR B 1 133 ? 41.603 54.812  43.531  1.00 46.73  ? 133  TYR B CZ  1 
ATOM   5209 O OH  . TYR B 1 133 ? 42.590 55.377  42.766  1.00 45.81  ? 133  TYR B OH  1 
ATOM   5210 N N   . ASP B 1 134 ? 34.903 53.060  46.303  1.00 52.06  ? 134  ASP B N   1 
ATOM   5211 C CA  . ASP B 1 134 ? 33.800 52.744  47.196  1.00 52.99  ? 134  ASP B CA  1 
ATOM   5212 C C   . ASP B 1 134 ? 33.463 51.248  47.144  1.00 53.07  ? 134  ASP B C   1 
ATOM   5213 O O   . ASP B 1 134 ? 32.972 50.744  46.124  1.00 53.52  ? 134  ASP B O   1 
ATOM   5214 C CB  . ASP B 1 134 ? 32.598 53.591  46.787  1.00 54.69  ? 134  ASP B CB  1 
ATOM   5215 C CG  . ASP B 1 134 ? 31.448 53.517  47.775  1.00 56.90  ? 134  ASP B CG  1 
ATOM   5216 O OD1 . ASP B 1 134 ? 31.525 52.744  48.760  1.00 56.80  ? 134  ASP B OD1 1 
ATOM   5217 O OD2 . ASP B 1 134 ? 30.453 54.243  47.550  1.00 57.34  ? 134  ASP B OD2 1 
ATOM   5218 N N   . GLY B 1 135 ? 33.737 50.549  48.247  1.00 52.87  ? 135  GLY B N   1 
ATOM   5219 C CA  . GLY B 1 135 ? 33.531 49.095  48.353  1.00 52.69  ? 135  GLY B CA  1 
ATOM   5220 C C   . GLY B 1 135 ? 32.096 48.616  48.569  1.00 54.43  ? 135  GLY B C   1 
ATOM   5221 O O   . GLY B 1 135 ? 31.827 47.405  48.556  1.00 54.67  ? 135  GLY B O   1 
ATOM   5222 N N   . ARG B 1 136 ? 31.167 49.552  48.746  1.00 55.52  ? 136  ARG B N   1 
ATOM   5223 C CA  . ARG B 1 136 ? 29.801 49.194  49.123  1.00 57.78  ? 136  ARG B CA  1 
ATOM   5224 C C   . ARG B 1 136 ? 29.093 48.298  48.085  1.00 58.13  ? 136  ARG B C   1 
ATOM   5225 O O   . ARG B 1 136 ? 28.436 47.319  48.456  1.00 59.52  ? 136  ARG B O   1 
ATOM   5226 C CB  . ARG B 1 136 ? 28.983 50.452  49.519  1.00 59.48  ? 136  ARG B CB  1 
ATOM   5227 C CG  . ARG B 1 136 ? 28.009 50.980  48.485  1.00 62.78  ? 136  ARG B CG  1 
ATOM   5228 C CD  . ARG B 1 136 ? 28.094 52.498  48.287  1.00 65.80  ? 136  ARG B CD  1 
ATOM   5229 N NE  . ARG B 1 136 ? 27.448 53.291  49.328  1.00 68.61  ? 136  ARG B NE  1 
ATOM   5230 C CZ  . ARG B 1 136 ? 28.090 54.139  50.135  1.00 69.45  ? 136  ARG B CZ  1 
ATOM   5231 N NH1 . ARG B 1 136 ? 29.404 54.313  50.028  1.00 68.02  ? 136  ARG B NH1 1 
ATOM   5232 N NH2 . ARG B 1 136 ? 27.417 54.825  51.052  1.00 70.18  ? 136  ARG B NH2 1 
ATOM   5233 N N   . PHE B 1 137 ? 29.259 48.603  46.799  1.00 57.30  ? 137  PHE B N   1 
ATOM   5234 C CA  . PHE B 1 137 ? 28.584 47.857  45.729  1.00 57.70  ? 137  PHE B CA  1 
ATOM   5235 C C   . PHE B 1 137 ? 29.003 46.391  45.668  1.00 57.26  ? 137  PHE B C   1 
ATOM   5236 O O   . PHE B 1 137 ? 28.137 45.516  45.674  1.00 59.20  ? 137  PHE B O   1 
ATOM   5237 C CB  . PHE B 1 137 ? 28.749 48.554  44.375  1.00 57.21  ? 137  PHE B CB  1 
ATOM   5238 C CG  . PHE B 1 137 ? 28.340 49.988  44.398  1.00 57.86  ? 137  PHE B CG  1 
ATOM   5239 C CD1 . PHE B 1 137 ? 26.986 50.340  44.335  1.00 60.38  ? 137  PHE B CD1 1 
ATOM   5240 C CD2 . PHE B 1 137 ? 29.295 50.992  44.535  1.00 56.76  ? 137  PHE B CD2 1 
ATOM   5241 C CE1 . PHE B 1 137 ? 26.588 51.677  44.387  1.00 61.10  ? 137  PHE B CE1 1 
ATOM   5242 C CE2 . PHE B 1 137 ? 28.919 52.340  44.593  1.00 58.30  ? 137  PHE B CE2 1 
ATOM   5243 C CZ  . PHE B 1 137 ? 27.557 52.686  44.517  1.00 60.49  ? 137  PHE B CZ  1 
ATOM   5244 N N   . LEU B 1 138 ? 30.314 46.129  45.632  1.00 55.33  ? 138  LEU B N   1 
ATOM   5245 C CA  . LEU B 1 138 ? 30.866 44.761  45.652  1.00 54.69  ? 138  LEU B CA  1 
ATOM   5246 C C   . LEU B 1 138 ? 30.495 43.973  46.912  1.00 55.82  ? 138  LEU B C   1 
ATOM   5247 O O   . LEU B 1 138 ? 30.346 42.746  46.869  1.00 56.54  ? 138  LEU B O   1 
ATOM   5248 C CB  . LEU B 1 138 ? 32.402 44.768  45.486  1.00 52.60  ? 138  LEU B CB  1 
ATOM   5249 C CG  . LEU B 1 138 ? 32.975 44.981  44.081  1.00 50.80  ? 138  LEU B CG  1 
ATOM   5250 C CD1 . LEU B 1 138 ? 34.440 45.374  44.109  1.00 48.04  ? 138  LEU B CD1 1 
ATOM   5251 C CD2 . LEU B 1 138 ? 32.771 43.756  43.217  1.00 49.92  ? 138  LEU B CD2 1 
ATOM   5252 N N   . ALA B 1 139 ? 30.360 44.671  48.033  1.00 56.26  ? 139  ALA B N   1 
ATOM   5253 C CA  . ALA B 1 139 ? 29.938 44.027  49.271  1.00 57.55  ? 139  ALA B CA  1 
ATOM   5254 C C   . ALA B 1 139 ? 28.482 43.557  49.166  1.00 59.99  ? 139  ALA B C   1 
ATOM   5255 O O   . ALA B 1 139 ? 28.175 42.396  49.462  1.00 60.77  ? 139  ALA B O   1 
ATOM   5256 C CB  . ALA B 1 139 ? 30.131 44.967  50.465  1.00 57.29  ? 139  ALA B CB  1 
ATOM   5257 N N   . GLN B 1 140 ? 27.602 44.450  48.714  1.00 61.26  ? 140  GLN B N   1 
ATOM   5258 C CA  . GLN B 1 140 ? 26.164 44.180  48.683  1.00 63.89  ? 140  GLN B CA  1 
ATOM   5259 C C   . GLN B 1 140 ? 25.739 43.210  47.575  1.00 65.05  ? 140  GLN B C   1 
ATOM   5260 O O   . GLN B 1 140 ? 24.929 42.322  47.815  1.00 66.82  ? 140  GLN B O   1 
ATOM   5261 C CB  . GLN B 1 140 ? 25.386 45.491  48.567  1.00 64.97  ? 140  GLN B CB  1 
ATOM   5262 C CG  . GLN B 1 140 ? 23.920 45.390  48.939  1.00 66.96  ? 140  GLN B CG  1 
ATOM   5263 C CD  . GLN B 1 140 ? 23.045 44.984  47.772  1.00 68.64  ? 140  GLN B CD  1 
ATOM   5264 O OE1 . GLN B 1 140 ? 23.231 45.448  46.639  1.00 67.83  ? 140  GLN B OE1 1 
ATOM   5265 N NE2 . GLN B 1 140 ? 22.075 44.120  48.043  1.00 70.20  ? 140  GLN B NE2 1 
ATOM   5266 N N   . VAL B 1 141 ? 26.269 43.381  46.367  1.00 64.37  ? 141  VAL B N   1 
ATOM   5267 C CA  . VAL B 1 141 ? 25.825 42.555  45.240  1.00 65.64  ? 141  VAL B CA  1 
ATOM   5268 C C   . VAL B 1 141 ? 26.458 41.161  45.267  1.00 65.45  ? 141  VAL B C   1 
ATOM   5269 O O   . VAL B 1 141 ? 25.739 40.154  45.236  1.00 67.41  ? 141  VAL B O   1 
ATOM   5270 C CB  . VAL B 1 141 ? 26.074 43.238  43.866  1.00 65.17  ? 141  VAL B CB  1 
ATOM   5271 C CG1 . VAL B 1 141 ? 25.553 42.362  42.732  1.00 65.24  ? 141  VAL B CG1 1 
ATOM   5272 C CG2 . VAL B 1 141 ? 25.420 44.619  43.823  1.00 65.29  ? 141  VAL B CG2 1 
ATOM   5273 N N   . GLU B 1 142 ? 27.789 41.115  45.344  1.00 63.28  ? 142  GLU B N   1 
ATOM   5274 C CA  . GLU B 1 142 ? 28.536 39.862  45.258  1.00 63.00  ? 142  GLU B CA  1 
ATOM   5275 C C   . GLU B 1 142 ? 28.796 39.192  46.607  1.00 62.98  ? 142  GLU B C   1 
ATOM   5276 O O   . GLU B 1 142 ? 29.345 38.086  46.661  1.00 63.07  ? 142  GLU B O   1 
ATOM   5277 C CB  . GLU B 1 142 ? 29.867 40.080  44.524  1.00 61.16  ? 142  GLU B CB  1 
ATOM   5278 C CG  . GLU B 1 142 ? 29.723 40.522  43.062  1.00 63.03  ? 142  GLU B CG  1 
ATOM   5279 C CD  . GLU B 1 142 ? 28.852 39.586  42.214  1.00 67.27  ? 142  GLU B CD  1 
ATOM   5280 O OE1 . GLU B 1 142 ? 28.849 38.355  42.463  1.00 69.94  ? 142  GLU B OE1 1 
ATOM   5281 O OE2 . GLU B 1 142 ? 28.176 40.083  41.281  1.00 68.44  ? 142  GLU B OE2 1 
ATOM   5282 N N   . GLY B 1 143 ? 28.411 39.860  47.690  1.00 63.18  ? 143  GLY B N   1 
ATOM   5283 C CA  . GLY B 1 143 ? 28.638 39.345  49.038  1.00 63.08  ? 143  GLY B CA  1 
ATOM   5284 C C   . GLY B 1 143 ? 30.094 39.368  49.493  1.00 61.13  ? 143  GLY B C   1 
ATOM   5285 O O   . GLY B 1 143 ? 30.441 38.697  50.469  1.00 61.96  ? 143  GLY B O   1 
ATOM   5286 N N   . ALA B 1 144 ? 30.937 40.144  48.805  1.00 58.58  ? 144  ALA B N   1 
ATOM   5287 C CA  . ALA B 1 144 ? 32.374 40.193  49.085  1.00 56.28  ? 144  ALA B CA  1 
ATOM   5288 C C   . ALA B 1 144 ? 32.729 40.976  50.344  1.00 55.57  ? 144  ALA B C   1 
ATOM   5289 O O   . ALA B 1 144 ? 31.981 41.861  50.769  1.00 55.65  ? 144  ALA B O   1 
ATOM   5290 C CB  . ALA B 1 144 ? 33.133 40.775  47.884  1.00 54.63  ? 144  ALA B CB  1 
ATOM   5291 N N   . VAL B 1 145 ? 33.881 40.637  50.926  1.00 54.39  ? 145  VAL B N   1 
ATOM   5292 C CA  . VAL B 1 145 ? 34.488 41.440  51.974  1.00 53.51  ? 145  VAL B CA  1 
ATOM   5293 C C   . VAL B 1 145 ? 35.581 42.221  51.285  1.00 52.12  ? 145  VAL B C   1 
ATOM   5294 O O   . VAL B 1 145 ? 36.584 41.645  50.857  1.00 51.83  ? 145  VAL B O   1 
ATOM   5295 C CB  . VAL B 1 145 ? 35.085 40.582  53.131  1.00 54.00  ? 145  VAL B CB  1 
ATOM   5296 C CG1 . VAL B 1 145 ? 35.972 41.432  54.063  1.00 52.18  ? 145  VAL B CG1 1 
ATOM   5297 C CG2 . VAL B 1 145 ? 33.987 39.906  53.924  1.00 54.61  ? 145  VAL B CG2 1 
ATOM   5298 N N   . LEU B 1 146 ? 35.377 43.525  51.148  1.00 51.78  ? 146  LEU B N   1 
ATOM   5299 C CA  . LEU B 1 146 ? 36.365 44.389  50.515  1.00 50.52  ? 146  LEU B CA  1 
ATOM   5300 C C   . LEU B 1 146 ? 37.180 45.200  51.534  1.00 49.63  ? 146  LEU B C   1 
ATOM   5301 O O   . LEU B 1 146 ? 36.619 45.847  52.438  1.00 50.29  ? 146  LEU B O   1 
ATOM   5302 C CB  . LEU B 1 146 ? 35.697 45.312  49.485  1.00 50.89  ? 146  LEU B CB  1 
ATOM   5303 C CG  . LEU B 1 146 ? 36.649 45.806  48.383  1.00 51.28  ? 146  LEU B CG  1 
ATOM   5304 C CD1 . LEU B 1 146 ? 35.932 45.962  47.071  1.00 51.84  ? 146  LEU B CD1 1 
ATOM   5305 C CD2 . LEU B 1 146 ? 37.380 47.111  48.756  1.00 52.74  ? 146  LEU B CD2 1 
ATOM   5306 N N   . VAL B 1 147 ? 38.503 45.166  51.364  1.00 47.96  ? 147  VAL B N   1 
ATOM   5307 C CA  . VAL B 1 147 ? 39.442 45.888  52.230  1.00 46.87  ? 147  VAL B CA  1 
ATOM   5308 C C   . VAL B 1 147 ? 40.270 46.873  51.388  1.00 46.20  ? 147  VAL B C   1 
ATOM   5309 O O   . VAL B 1 147 ? 40.628 46.560  50.258  1.00 46.30  ? 147  VAL B O   1 
ATOM   5310 C CB  . VAL B 1 147 ? 40.382 44.890  52.976  1.00 46.54  ? 147  VAL B CB  1 
ATOM   5311 C CG1 . VAL B 1 147 ? 41.310 45.599  53.926  1.00 44.71  ? 147  VAL B CG1 1 
ATOM   5312 C CG2 . VAL B 1 147 ? 39.567 43.837  53.734  1.00 46.98  ? 147  VAL B CG2 1 
ATOM   5313 N N   . SER B 1 148 ? 40.559 48.061  51.918  1.00 45.98  ? 148  SER B N   1 
ATOM   5314 C CA  . SER B 1 148 ? 41.513 48.986  51.280  1.00 44.67  ? 148  SER B CA  1 
ATOM   5315 C C   . SER B 1 148 ? 42.320 49.755  52.327  1.00 44.63  ? 148  SER B C   1 
ATOM   5316 O O   . SER B 1 148 ? 41.770 50.152  53.348  1.00 45.52  ? 148  SER B O   1 
ATOM   5317 C CB  . SER B 1 148 ? 40.803 49.964  50.337  1.00 44.45  ? 148  SER B CB  1 
ATOM   5318 O OG  . SER B 1 148 ? 39.816 50.715  51.017  1.00 44.24  ? 148  SER B OG  1 
ATOM   5319 N N   . MET B 1 149 ? 43.612 49.971  52.064  1.00 43.68  ? 149  MET B N   1 
ATOM   5320 C CA  . MET B 1 149 ? 44.490 50.671  53.008  1.00 43.66  ? 149  MET B CA  1 
ATOM   5321 C C   . MET B 1 149 ? 45.115 51.927  52.423  1.00 43.74  ? 149  MET B C   1 
ATOM   5322 O O   . MET B 1 149 ? 45.335 52.024  51.207  1.00 43.68  ? 149  MET B O   1 
ATOM   5323 C CB  . MET B 1 149 ? 45.612 49.740  53.481  1.00 43.35  ? 149  MET B CB  1 
ATOM   5324 C CG  . MET B 1 149 ? 46.846 49.689  52.571  1.00 42.65  ? 149  MET B CG  1 
ATOM   5325 S SD  . MET B 1 149 ? 46.597 48.887  50.968  1.00 43.53  ? 149  MET B SD  1 
ATOM   5326 C CE  . MET B 1 149 ? 46.731 47.158  51.415  1.00 40.79  ? 149  MET B CE  1 
ATOM   5327 N N   . ASN B 1 150 ? 45.407 52.894  53.286  1.00 44.13  ? 150  ASN B N   1 
ATOM   5328 C CA  . ASN B 1 150 ? 46.342 53.946  52.912  1.00 44.02  ? 150  ASN B CA  1 
ATOM   5329 C C   . ASN B 1 150 ? 47.765 53.409  53.081  1.00 43.87  ? 150  ASN B C   1 
ATOM   5330 O O   . ASN B 1 150 ? 48.019 52.564  53.949  1.00 43.74  ? 150  ASN B O   1 
ATOM   5331 C CB  . ASN B 1 150 ? 46.135 55.199  53.750  1.00 44.12  ? 150  ASN B CB  1 
ATOM   5332 C CG  . ASN B 1 150 ? 44.880 55.949  53.374  1.00 45.86  ? 150  ASN B CG  1 
ATOM   5333 O OD1 . ASN B 1 150 ? 44.205 55.591  52.406  1.00 46.50  ? 150  ASN B OD1 1 
ATOM   5334 N ND2 . ASN B 1 150 ? 44.549 57.006  54.141  1.00 46.12  ? 150  ASN B ND2 1 
ATOM   5335 N N   . TYR B 1 151 ? 48.674 53.884  52.234  1.00 43.43  ? 151  TYR B N   1 
ATOM   5336 C CA  . TYR B 1 151 ? 50.090 53.598  52.376  1.00 43.55  ? 151  TYR B CA  1 
ATOM   5337 C C   . TYR B 1 151 ? 50.844 54.880  51.997  1.00 44.18  ? 151  TYR B C   1 
ATOM   5338 O O   . TYR B 1 151 ? 50.345 55.674  51.183  1.00 44.49  ? 151  TYR B O   1 
ATOM   5339 C CB  . TYR B 1 151 ? 50.501 52.389  51.510  1.00 43.06  ? 151  TYR B CB  1 
ATOM   5340 C CG  . TYR B 1 151 ? 50.392 52.612  50.016  1.00 42.29  ? 151  TYR B CG  1 
ATOM   5341 C CD1 . TYR B 1 151 ? 49.201 52.376  49.346  1.00 41.25  ? 151  TYR B CD1 1 
ATOM   5342 C CD2 . TYR B 1 151 ? 51.487 53.072  49.276  1.00 42.91  ? 151  TYR B CD2 1 
ATOM   5343 C CE1 . TYR B 1 151 ? 49.093 52.579  47.975  1.00 41.85  ? 151  TYR B CE1 1 
ATOM   5344 C CE2 . TYR B 1 151 ? 51.392 53.288  47.899  1.00 43.04  ? 151  TYR B CE2 1 
ATOM   5345 C CZ  . TYR B 1 151 ? 50.184 53.043  47.255  1.00 43.00  ? 151  TYR B CZ  1 
ATOM   5346 O OH  . TYR B 1 151 ? 50.062 53.259  45.893  1.00 42.35  ? 151  TYR B OH  1 
ATOM   5347 N N   . ARG B 1 152 ? 52.016 55.093  52.597  1.00 44.26  ? 152  ARG B N   1 
ATOM   5348 C CA  . ARG B 1 152 ? 52.769 56.335  52.403  1.00 44.62  ? 152  ARG B CA  1 
ATOM   5349 C C   . ARG B 1 152 ? 53.270 56.498  50.964  1.00 43.87  ? 152  ARG B C   1 
ATOM   5350 O O   . ARG B 1 152 ? 53.695 55.544  50.345  1.00 42.66  ? 152  ARG B O   1 
ATOM   5351 C CB  . ARG B 1 152 ? 53.950 56.404  53.374  1.00 45.57  ? 152  ARG B CB  1 
ATOM   5352 C CG  . ARG B 1 152 ? 53.582 56.778  54.789  1.00 45.60  ? 152  ARG B CG  1 
ATOM   5353 C CD  . ARG B 1 152 ? 54.779 56.650  55.706  1.00 45.39  ? 152  ARG B CD  1 
ATOM   5354 N NE  . ARG B 1 152 ? 55.056 55.251  56.026  1.00 45.26  ? 152  ARG B NE  1 
ATOM   5355 C CZ  . ARG B 1 152 ? 56.100 54.825  56.733  1.00 45.15  ? 152  ARG B CZ  1 
ATOM   5356 N NH1 . ARG B 1 152 ? 56.995 55.687  57.216  1.00 44.15  ? 152  ARG B NH1 1 
ATOM   5357 N NH2 . ARG B 1 152 ? 56.238 53.527  56.964  1.00 43.96  ? 152  ARG B NH2 1 
ATOM   5358 N N   . VAL B 1 153 ? 53.200 57.716  50.444  1.00 44.37  ? 153  VAL B N   1 
ATOM   5359 C CA  . VAL B 1 153 ? 53.618 58.001  49.067  1.00 44.37  ? 153  VAL B CA  1 
ATOM   5360 C C   . VAL B 1 153 ? 54.752 59.027  49.040  1.00 45.61  ? 153  VAL B C   1 
ATOM   5361 O O   . VAL B 1 153 ? 55.147 59.547  50.090  1.00 46.52  ? 153  VAL B O   1 
ATOM   5362 C CB  . VAL B 1 153 ? 52.440 58.509  48.192  1.00 44.20  ? 153  VAL B CB  1 
ATOM   5363 C CG1 . VAL B 1 153 ? 51.439 57.412  47.946  1.00 43.19  ? 153  VAL B CG1 1 
ATOM   5364 C CG2 . VAL B 1 153 ? 51.758 59.735  48.818  1.00 44.39  ? 153  VAL B CG2 1 
ATOM   5365 N N   . GLY B 1 154 ? 55.266 59.314  47.841  1.00 45.93  ? 154  GLY B N   1 
ATOM   5366 C CA  . GLY B 1 154 ? 56.315 60.322  47.643  1.00 47.10  ? 154  GLY B CA  1 
ATOM   5367 C C   . GLY B 1 154 ? 57.507 60.092  48.550  1.00 48.17  ? 154  GLY B C   1 
ATOM   5368 O O   . GLY B 1 154 ? 57.897 58.945  48.801  1.00 48.14  ? 154  GLY B O   1 
ATOM   5369 N N   . THR B 1 155 ? 58.086 61.168  49.069  1.00 49.47  ? 155  THR B N   1 
ATOM   5370 C CA  . THR B 1 155 ? 59.268 61.033  49.914  1.00 50.45  ? 155  THR B CA  1 
ATOM   5371 C C   . THR B 1 155 ? 58.997 60.129  51.112  1.00 50.00  ? 155  THR B C   1 
ATOM   5372 O O   . THR B 1 155 ? 59.818 59.274  51.443  1.00 50.89  ? 155  THR B O   1 
ATOM   5373 C CB  . THR B 1 155 ? 59.741 62.370  50.434  1.00 51.72  ? 155  THR B CB  1 
ATOM   5374 O OG1 . THR B 1 155 ? 58.625 63.044  51.017  1.00 51.33  ? 155  THR B OG1 1 
ATOM   5375 C CG2 . THR B 1 155 ? 60.315 63.196  49.303  1.00 52.64  ? 155  THR B CG2 1 
ATOM   5376 N N   . PHE B 1 156 ? 57.834 60.304  51.731  1.00 48.99  ? 156  PHE B N   1 
ATOM   5377 C CA  . PHE B 1 156 ? 57.530 59.653  52.993  1.00 48.49  ? 156  PHE B CA  1 
ATOM   5378 C C   . PHE B 1 156 ? 57.475 58.142  52.857  1.00 47.59  ? 156  PHE B C   1 
ATOM   5379 O O   . PHE B 1 156 ? 57.848 57.425  53.780  1.00 48.04  ? 156  PHE B O   1 
ATOM   5380 C CB  . PHE B 1 156 ? 56.220 60.192  53.579  1.00 48.43  ? 156  PHE B CB  1 
ATOM   5381 C CG  . PHE B 1 156 ? 56.098 61.691  53.509  1.00 48.99  ? 156  PHE B CG  1 
ATOM   5382 C CD1 . PHE B 1 156 ? 56.724 62.498  54.453  1.00 49.93  ? 156  PHE B CD1 1 
ATOM   5383 C CD2 . PHE B 1 156 ? 55.376 62.292  52.485  1.00 48.42  ? 156  PHE B CD2 1 
ATOM   5384 C CE1 . PHE B 1 156 ? 56.625 63.892  54.383  1.00 52.17  ? 156  PHE B CE1 1 
ATOM   5385 C CE2 . PHE B 1 156 ? 55.262 63.683  52.407  1.00 50.92  ? 156  PHE B CE2 1 
ATOM   5386 C CZ  . PHE B 1 156 ? 55.889 64.488  53.357  1.00 51.93  ? 156  PHE B CZ  1 
ATOM   5387 N N   . GLY B 1 157 ? 57.030 57.658  51.701  1.00 46.50  ? 157  GLY B N   1 
ATOM   5388 C CA  . GLY B 1 157 ? 56.925 56.220  51.467  1.00 45.23  ? 157  GLY B CA  1 
ATOM   5389 C C   . GLY B 1 157 ? 58.100 55.596  50.732  1.00 45.28  ? 157  GLY B C   1 
ATOM   5390 O O   . GLY B 1 157 ? 58.326 54.395  50.844  1.00 44.99  ? 157  GLY B O   1 
ATOM   5391 N N   . PHE B 1 158 ? 58.864 56.396  49.991  1.00 45.74  ? 158  PHE B N   1 
ATOM   5392 C CA  . PHE B 1 158 ? 59.837 55.814  49.073  1.00 45.94  ? 158  PHE B CA  1 
ATOM   5393 C C   . PHE B 1 158 ? 61.212 56.480  48.971  1.00 47.95  ? 158  PHE B C   1 
ATOM   5394 O O   . PHE B 1 158 ? 62.046 56.043  48.183  1.00 48.22  ? 158  PHE B O   1 
ATOM   5395 C CB  . PHE B 1 158 ? 59.200 55.592  47.693  1.00 44.48  ? 158  PHE B CB  1 
ATOM   5396 C CG  . PHE B 1 158 ? 58.039 54.638  47.725  1.00 42.85  ? 158  PHE B CG  1 
ATOM   5397 C CD1 . PHE B 1 158 ? 58.252 53.260  47.820  1.00 42.49  ? 158  PHE B CD1 1 
ATOM   5398 C CD2 . PHE B 1 158 ? 56.730 55.112  47.705  1.00 42.13  ? 158  PHE B CD2 1 
ATOM   5399 C CE1 . PHE B 1 158 ? 57.181 52.365  47.873  1.00 42.30  ? 158  PHE B CE1 1 
ATOM   5400 C CE2 . PHE B 1 158 ? 55.639 54.225  47.754  1.00 40.89  ? 158  PHE B CE2 1 
ATOM   5401 C CZ  . PHE B 1 158 ? 55.859 52.858  47.845  1.00 41.66  ? 158  PHE B CZ  1 
ATOM   5402 N N   . LEU B 1 159 ? 61.457 57.519  49.771  1.00 49.90  ? 159  LEU B N   1 
ATOM   5403 C CA  . LEU B 1 159 ? 62.794 58.113  49.842  1.00 51.88  ? 159  LEU B CA  1 
ATOM   5404 C C   . LEU B 1 159 ? 63.725 57.087  50.473  1.00 53.07  ? 159  LEU B C   1 
ATOM   5405 O O   . LEU B 1 159 ? 63.428 56.520  51.525  1.00 53.05  ? 159  LEU B O   1 
ATOM   5406 C CB  . LEU B 1 159 ? 62.798 59.420  50.627  1.00 52.54  ? 159  LEU B CB  1 
ATOM   5407 C CG  . LEU B 1 159 ? 64.123 60.207  50.624  1.00 54.69  ? 159  LEU B CG  1 
ATOM   5408 C CD1 . LEU B 1 159 ? 63.911 61.693  50.339  1.00 53.50  ? 159  LEU B CD1 1 
ATOM   5409 C CD2 . LEU B 1 159 ? 64.885 60.025  51.929  1.00 55.88  ? 159  LEU B CD2 1 
ATOM   5410 N N   . ALA B 1 160 ? 64.840 56.830  49.803  1.00 54.63  ? 160  ALA B N   1 
ATOM   5411 C CA  . ALA B 1 160 ? 65.752 55.790  50.229  1.00 55.70  ? 160  ALA B CA  1 
ATOM   5412 C C   . ALA B 1 160 ? 67.178 56.291  50.230  1.00 58.28  ? 160  ALA B C   1 
ATOM   5413 O O   . ALA B 1 160 ? 67.623 56.971  49.300  1.00 58.86  ? 160  ALA B O   1 
ATOM   5414 C CB  . ALA B 1 160 ? 65.631 54.575  49.318  1.00 54.80  ? 160  ALA B CB  1 
ATOM   5415 N N   . LEU B 1 161 ? 67.882 55.958  51.298  1.00 59.88  ? 161  LEU B N   1 
ATOM   5416 C CA  . LEU B 1 161 ? 69.319 55.932  51.269  1.00 62.49  ? 161  LEU B CA  1 
ATOM   5417 C C   . LEU B 1 161 ? 69.724 54.476  51.490  1.00 63.07  ? 161  LEU B C   1 
ATOM   5418 O O   . LEU B 1 161 ? 69.944 54.057  52.621  1.00 63.71  ? 161  LEU B O   1 
ATOM   5419 C CB  . LEU B 1 161 ? 69.895 56.886  52.316  1.00 64.25  ? 161  LEU B CB  1 
ATOM   5420 C CG  . LEU B 1 161 ? 69.737 58.358  51.912  1.00 65.09  ? 161  LEU B CG  1 
ATOM   5421 C CD1 . LEU B 1 161 ? 70.149 59.266  53.026  1.00 67.54  ? 161  LEU B CD1 1 
ATOM   5422 C CD2 . LEU B 1 161 ? 70.550 58.689  50.660  1.00 65.92  ? 161  LEU B CD2 1 
ATOM   5423 N N   . PRO B 1 162 ? 69.795 53.690  50.398  1.00 63.12  ? 162  PRO B N   1 
ATOM   5424 C CA  . PRO B 1 162 ? 69.992 52.235  50.463  1.00 63.65  ? 162  PRO B CA  1 
ATOM   5425 C C   . PRO B 1 162 ? 71.165 51.835  51.348  1.00 66.02  ? 162  PRO B C   1 
ATOM   5426 O O   . PRO B 1 162 ? 72.227 52.440  51.258  1.00 68.16  ? 162  PRO B O   1 
ATOM   5427 C CB  . PRO B 1 162 ? 70.271 51.856  49.003  1.00 63.60  ? 162  PRO B CB  1 
ATOM   5428 C CG  . PRO B 1 162 ? 69.527 52.883  48.215  1.00 62.43  ? 162  PRO B CG  1 
ATOM   5429 C CD  . PRO B 1 162 ? 69.703 54.161  49.003  1.00 62.99  ? 162  PRO B CD  1 
ATOM   5430 N N   . GLY B 1 163 ? 70.949 50.841  52.208  1.00 66.30  ? 163  GLY B N   1 
ATOM   5431 C CA  . GLY B 1 163 ? 71.955 50.377  53.159  1.00 68.61  ? 163  GLY B CA  1 
ATOM   5432 C C   . GLY B 1 163 ? 71.916 51.101  54.495  1.00 69.78  ? 163  GLY B C   1 
ATOM   5433 O O   . GLY B 1 163 ? 72.558 50.674  55.456  1.00 71.27  ? 163  GLY B O   1 
ATOM   5434 N N   . SER B 1 164 ? 71.179 52.207  54.559  1.00 69.16  ? 164  SER B N   1 
ATOM   5435 C CA  . SER B 1 164 ? 71.016 52.946  55.811  1.00 70.15  ? 164  SER B CA  1 
ATOM   5436 C C   . SER B 1 164 ? 69.965 52.299  56.704  1.00 69.46  ? 164  SER B C   1 
ATOM   5437 O O   . SER B 1 164 ? 68.996 51.712  56.212  1.00 67.29  ? 164  SER B O   1 
ATOM   5438 C CB  . SER B 1 164 ? 70.649 54.410  55.546  1.00 69.59  ? 164  SER B CB  1 
ATOM   5439 O OG  . SER B 1 164 ? 69.307 54.543  55.103  1.00 67.07  ? 164  SER B OG  1 
ATOM   5440 N N   . ARG B 1 165 ? 70.160 52.416  58.015  1.00 71.57  ? 165  ARG B N   1 
ATOM   5441 C CA  . ARG B 1 165 ? 69.196 51.903  58.984  1.00 71.78  ? 165  ARG B CA  1 
ATOM   5442 C C   . ARG B 1 165 ? 67.990 52.835  59.106  1.00 69.81  ? 165  ARG B C   1 
ATOM   5443 O O   . ARG B 1 165 ? 66.894 52.399  59.466  1.00 68.63  ? 165  ARG B O   1 
ATOM   5444 C CB  . ARG B 1 165 ? 69.844 51.703  60.368  1.00 74.41  ? 165  ARG B CB  1 
ATOM   5445 C CG  . ARG B 1 165 ? 69.122 50.636  61.234  1.00 77.20  ? 165  ARG B CG  1 
ATOM   5446 C CD  . ARG B 1 165 ? 69.151 50.929  62.754  1.00 82.71  ? 165  ARG B CD  1 
ATOM   5447 N NE  . ARG B 1 165 ? 67.946 51.643  63.206  1.00 83.84  ? 165  ARG B NE  1 
ATOM   5448 C CZ  . ARG B 1 165 ? 67.942 52.829  63.826  1.00 85.50  ? 165  ARG B CZ  1 
ATOM   5449 N NH1 . ARG B 1 165 ? 69.084 53.458  64.099  1.00 87.17  ? 165  ARG B NH1 1 
ATOM   5450 N NH2 . ARG B 1 165 ? 66.789 53.386  64.184  1.00 83.76  ? 165  ARG B NH2 1 
ATOM   5451 N N   . GLU B 1 166 ? 68.188 54.111  58.789  1.00 69.78  ? 166  GLU B N   1 
ATOM   5452 C CA  . GLU B 1 166 ? 67.169 55.121  59.084  1.00 68.67  ? 166  GLU B CA  1 
ATOM   5453 C C   . GLU B 1 166 ? 66.291 55.547  57.890  1.00 66.07  ? 166  GLU B C   1 
ATOM   5454 O O   . GLU B 1 166 ? 65.334 56.313  58.056  1.00 65.39  ? 166  GLU B O   1 
ATOM   5455 C CB  . GLU B 1 166 ? 67.787 56.320  59.840  1.00 70.77  ? 166  GLU B CB  1 
ATOM   5456 C CG  . GLU B 1 166 ? 69.142 56.783  59.324  1.00 74.67  ? 166  GLU B CG  1 
ATOM   5457 C CD  . GLU B 1 166 ? 70.346 56.116  60.013  1.00 79.16  ? 166  GLU B CD  1 
ATOM   5458 O OE1 . GLU B 1 166 ? 70.517 56.295  61.244  1.00 80.10  ? 166  GLU B OE1 1 
ATOM   5459 O OE2 . GLU B 1 166 ? 71.144 55.446  59.306  1.00 80.28  ? 166  GLU B OE2 1 
ATOM   5460 N N   . ALA B 1 167 ? 66.615 55.030  56.706  1.00 64.71  ? 167  ALA B N   1 
ATOM   5461 C CA  . ALA B 1 167 ? 65.820 55.205  55.482  1.00 62.21  ? 167  ALA B CA  1 
ATOM   5462 C C   . ALA B 1 167 ? 66.158 54.084  54.497  1.00 61.28  ? 167  ALA B C   1 
ATOM   5463 O O   . ALA B 1 167 ? 66.826 54.324  53.488  1.00 61.46  ? 167  ALA B O   1 
ATOM   5464 C CB  . ALA B 1 167 ? 66.080 56.567  54.843  1.00 62.56  ? 167  ALA B CB  1 
ATOM   5465 N N   . PRO B 1 168 ? 65.701 52.850  54.793  1.00 60.01  ? 168  PRO B N   1 
ATOM   5466 C CA  . PRO B 1 168 ? 66.129 51.666  54.043  1.00 59.52  ? 168  PRO B CA  1 
ATOM   5467 C C   . PRO B 1 168 ? 65.442 51.486  52.694  1.00 57.74  ? 168  PRO B C   1 
ATOM   5468 O O   . PRO B 1 168 ? 65.866 50.637  51.903  1.00 58.04  ? 168  PRO B O   1 
ATOM   5469 C CB  . PRO B 1 168 ? 65.770 50.513  54.982  1.00 59.21  ? 168  PRO B CB  1 
ATOM   5470 C CG  . PRO B 1 168 ? 64.593 51.015  55.743  1.00 58.72  ? 168  PRO B CG  1 
ATOM   5471 C CD  . PRO B 1 168 ? 64.759 52.507  55.877  1.00 59.33  ? 168  PRO B CD  1 
ATOM   5472 N N   . GLY B 1 169 ? 64.400 52.273  52.438  1.00 55.94  ? 169  GLY B N   1 
ATOM   5473 C CA  . GLY B 1 169 ? 63.658 52.173  51.192  1.00 53.77  ? 169  GLY B CA  1 
ATOM   5474 C C   . GLY B 1 169 ? 62.430 51.290  51.305  1.00 52.09  ? 169  GLY B C   1 
ATOM   5475 O O   . GLY B 1 169 ? 62.313 50.488  52.239  1.00 52.15  ? 169  GLY B O   1 
ATOM   5476 N N   . ASN B 1 170 ? 61.513 51.470  50.352  1.00 50.47  ? 170  ASN B N   1 
ATOM   5477 C CA  . ASN B 1 170 ? 60.299 50.659  50.190  1.00 48.81  ? 170  ASN B CA  1 
ATOM   5478 C C   . ASN B 1 170 ? 59.291 50.612  51.370  1.00 47.98  ? 170  ASN B C   1 
ATOM   5479 O O   . ASN B 1 170 ? 58.476 49.684  51.457  1.00 47.13  ? 170  ASN B O   1 
ATOM   5480 C CB  . ASN B 1 170 ? 60.661 49.246  49.722  1.00 49.04  ? 170  ASN B CB  1 
ATOM   5481 C CG  . ASN B 1 170 ? 61.466 49.240  48.420  1.00 50.57  ? 170  ASN B CG  1 
ATOM   5482 O OD1 . ASN B 1 170 ? 61.130 49.934  47.464  1.00 50.00  ? 170  ASN B OD1 1 
ATOM   5483 N ND2 . ASN B 1 170 ? 62.520 48.425  48.377  1.00 52.57  ? 170  ASN B ND2 1 
ATOM   5484 N N   . VAL B 1 171 ? 59.310 51.620  52.243  1.00 47.64  ? 171  VAL B N   1 
ATOM   5485 C CA  . VAL B 1 171 ? 58.435 51.591  53.420  1.00 46.58  ? 171  VAL B CA  1 
ATOM   5486 C C   . VAL B 1 171 ? 56.932 51.684  53.095  1.00 45.29  ? 171  VAL B C   1 
ATOM   5487 O O   . VAL B 1 171 ? 56.097 51.141  53.831  1.00 44.90  ? 171  VAL B O   1 
ATOM   5488 C CB  . VAL B 1 171 ? 58.857 52.602  54.522  1.00 47.62  ? 171  VAL B CB  1 
ATOM   5489 C CG1 . VAL B 1 171 ? 60.280 52.330  54.961  1.00 48.21  ? 171  VAL B CG1 1 
ATOM   5490 C CG2 . VAL B 1 171 ? 58.674 54.048  54.073  1.00 47.03  ? 171  VAL B CG2 1 
ATOM   5491 N N   . GLY B 1 172 ? 56.589 52.346  51.992  1.00 44.42  ? 172  GLY B N   1 
ATOM   5492 C CA  . GLY B 1 172 ? 55.210 52.355  51.509  1.00 43.19  ? 172  GLY B CA  1 
ATOM   5493 C C   . GLY B 1 172 ? 54.729 50.965  51.108  1.00 42.81  ? 172  GLY B C   1 
ATOM   5494 O O   . GLY B 1 172 ? 53.543 50.653  51.245  1.00 42.07  ? 172  GLY B O   1 
ATOM   5495 N N   . LEU B 1 173 ? 55.642 50.124  50.602  1.00 42.77  ? 173  LEU B N   1 
ATOM   5496 C CA  . LEU B 1 173 ? 55.294 48.733  50.311  1.00 42.11  ? 173  LEU B CA  1 
ATOM   5497 C C   . LEU B 1 173 ? 55.156 47.954  51.612  1.00 42.81  ? 173  LEU B C   1 
ATOM   5498 O O   . LEU B 1 173 ? 54.292 47.081  51.728  1.00 42.81  ? 173  LEU B O   1 
ATOM   5499 C CB  . LEU B 1 173 ? 56.312 48.061  49.376  1.00 42.10  ? 173  LEU B CB  1 
ATOM   5500 C CG  . LEU B 1 173 ? 56.396 48.491  47.905  1.00 40.54  ? 173  LEU B CG  1 
ATOM   5501 C CD1 . LEU B 1 173 ? 57.638 47.901  47.229  1.00 39.87  ? 173  LEU B CD1 1 
ATOM   5502 C CD2 . LEU B 1 173 ? 55.149 48.118  47.134  1.00 38.21  ? 173  LEU B CD2 1 
ATOM   5503 N N   . LEU B 1 174 ? 56.000 48.273  52.591  1.00 43.65  ? 174  LEU B N   1 
ATOM   5504 C CA  . LEU B 1 174 ? 55.926 47.628  53.895  1.00 44.65  ? 174  LEU B CA  1 
ATOM   5505 C C   . LEU B 1 174 ? 54.642 47.980  54.657  1.00 44.82  ? 174  LEU B C   1 
ATOM   5506 O O   . LEU B 1 174 ? 54.123 47.148  55.402  1.00 45.44  ? 174  LEU B O   1 
ATOM   5507 C CB  . LEU B 1 174 ? 57.170 47.925  54.728  1.00 45.62  ? 174  LEU B CB  1 
ATOM   5508 C CG  . LEU B 1 174 ? 58.461 47.199  54.303  1.00 46.63  ? 174  LEU B CG  1 
ATOM   5509 C CD1 . LEU B 1 174 ? 59.668 47.650  55.145  1.00 45.30  ? 174  LEU B CD1 1 
ATOM   5510 C CD2 . LEU B 1 174 ? 58.299 45.673  54.342  1.00 45.54  ? 174  LEU B CD2 1 
ATOM   5511 N N   . ASP B 1 175 ? 54.135 49.203  54.459  1.00 44.74  ? 175  ASP B N   1 
ATOM   5512 C CA  . ASP B 1 175 ? 52.816 49.605  54.954  1.00 44.43  ? 175  ASP B CA  1 
ATOM   5513 C C   . ASP B 1 175 ? 51.769 48.650  54.398  1.00 44.05  ? 175  ASP B C   1 
ATOM   5514 O O   . ASP B 1 175 ? 50.978 48.080  55.154  1.00 44.26  ? 175  ASP B O   1 
ATOM   5515 C CB  . ASP B 1 175 ? 52.463 51.040  54.527  1.00 44.12  ? 175  ASP B CB  1 
ATOM   5516 C CG  . ASP B 1 175 ? 53.362 52.089  55.161  1.00 45.21  ? 175  ASP B CG  1 
ATOM   5517 O OD1 . ASP B 1 175 ? 54.095 51.762  56.114  1.00 46.00  ? 175  ASP B OD1 1 
ATOM   5518 O OD2 . ASP B 1 175 ? 53.338 53.254  54.703  1.00 45.68  ? 175  ASP B OD2 1 
ATOM   5519 N N   . GLN B 1 176 ? 51.779 48.475  53.075  1.00 43.67  ? 176  GLN B N   1 
ATOM   5520 C CA  . GLN B 1 176 ? 50.858 47.564  52.398  1.00 43.46  ? 176  GLN B CA  1 
ATOM   5521 C C   . GLN B 1 176 ? 50.975 46.170  52.998  1.00 44.36  ? 176  GLN B C   1 
ATOM   5522 O O   . GLN B 1 176 ? 49.959 45.549  53.327  1.00 44.74  ? 176  GLN B O   1 
ATOM   5523 C CB  . GLN B 1 176 ? 51.119 47.508  50.895  1.00 42.78  ? 176  GLN B CB  1 
ATOM   5524 C CG  . GLN B 1 176 ? 50.936 48.828  50.134  1.00 42.55  ? 176  GLN B CG  1 
ATOM   5525 C CD  . GLN B 1 176 ? 51.409 48.726  48.682  1.00 42.85  ? 176  GLN B CD  1 
ATOM   5526 O OE1 . GLN B 1 176 ? 51.589 47.630  48.163  1.00 42.91  ? 176  GLN B OE1 1 
ATOM   5527 N NE2 . GLN B 1 176 ? 51.604 49.868  48.026  1.00 43.78  ? 176  GLN B NE2 1 
ATOM   5528 N N   . ARG B 1 177 ? 52.211 45.699  53.178  1.00 44.96  ? 177  ARG B N   1 
ATOM   5529 C CA  . ARG B 1 177 ? 52.447 44.396  53.796  1.00 45.78  ? 177  ARG B CA  1 
ATOM   5530 C C   . ARG B 1 177 ? 51.850 44.264  55.199  1.00 46.32  ? 177  ARG B C   1 
ATOM   5531 O O   . ARG B 1 177 ? 51.305 43.214  55.545  1.00 46.54  ? 177  ARG B O   1 
ATOM   5532 C CB  . ARG B 1 177 ? 53.935 44.055  53.830  1.00 46.63  ? 177  ARG B CB  1 
ATOM   5533 C CG  . ARG B 1 177 ? 54.213 42.657  54.381  1.00 48.60  ? 177  ARG B CG  1 
ATOM   5534 C CD  . ARG B 1 177 ? 55.653 42.322  54.356  1.00 50.98  ? 177  ARG B CD  1 
ATOM   5535 N NE  . ARG B 1 177 ? 56.044 41.984  52.996  1.00 55.47  ? 177  ARG B NE  1 
ATOM   5536 C CZ  . ARG B 1 177 ? 57.303 41.919  52.566  1.00 56.70  ? 177  ARG B CZ  1 
ATOM   5537 N NH1 . ARG B 1 177 ? 58.312 42.189  53.401  1.00 57.80  ? 177  ARG B NH1 1 
ATOM   5538 N NH2 . ARG B 1 177 ? 57.544 41.589  51.301  1.00 54.29  ? 177  ARG B NH2 1 
ATOM   5539 N N   . LEU B 1 178 ? 51.963 45.319  56.006  1.00 46.63  ? 178  LEU B N   1 
ATOM   5540 C CA  . LEU B 1 178 ? 51.400 45.295  57.357  1.00 47.23  ? 178  LEU B CA  1 
ATOM   5541 C C   . LEU B 1 178 ? 49.860 45.190  57.323  1.00 47.01  ? 178  LEU B C   1 
ATOM   5542 O O   . LEU B 1 178 ? 49.267 44.410  58.072  1.00 47.88  ? 178  LEU B O   1 
ATOM   5543 C CB  . LEU B 1 178 ? 51.896 46.485  58.183  1.00 47.30  ? 178  LEU B CB  1 
ATOM   5544 C CG  . LEU B 1 178 ? 51.571 46.615  59.685  1.00 47.89  ? 178  LEU B CG  1 
ATOM   5545 C CD1 . LEU B 1 178 ? 51.987 45.415  60.499  1.00 48.05  ? 178  LEU B CD1 1 
ATOM   5546 C CD2 . LEU B 1 178 ? 52.249 47.858  60.250  1.00 47.59  ? 178  LEU B CD2 1 
ATOM   5547 N N   . ALA B 1 179 ? 49.220 45.940  56.432  1.00 46.38  ? 179  ALA B N   1 
ATOM   5548 C CA  . ALA B 1 179 ? 47.764 45.832  56.244  1.00 46.16  ? 179  ALA B CA  1 
ATOM   5549 C C   . ALA B 1 179 ? 47.375 44.418  55.823  1.00 46.33  ? 179  ALA B C   1 
ATOM   5550 O O   . ALA B 1 179 ? 46.357 43.907  56.255  1.00 47.03  ? 179  ALA B O   1 
ATOM   5551 C CB  . ALA B 1 179 ? 47.264 46.861  55.228  1.00 45.06  ? 179  ALA B CB  1 
ATOM   5552 N N   . LEU B 1 180 ? 48.200 43.791  54.984  1.00 46.38  ? 180  LEU B N   1 
ATOM   5553 C CA  . LEU B 1 180 ? 48.001 42.397  54.579  1.00 46.46  ? 180  LEU B CA  1 
ATOM   5554 C C   . LEU B 1 180 ? 48.036 41.455  55.779  1.00 47.93  ? 180  LEU B C   1 
ATOM   5555 O O   . LEU B 1 180 ? 47.128 40.642  55.930  1.00 48.69  ? 180  LEU B O   1 
ATOM   5556 C CB  . LEU B 1 180 ? 49.004 41.984  53.499  1.00 45.59  ? 180  LEU B CB  1 
ATOM   5557 C CG  . LEU B 1 180 ? 48.568 42.093  52.027  1.00 45.28  ? 180  LEU B CG  1 
ATOM   5558 C CD1 . LEU B 1 180 ? 48.080 43.487  51.612  1.00 44.19  ? 180  LEU B CD1 1 
ATOM   5559 C CD2 . LEU B 1 180 ? 49.675 41.611  51.081  1.00 44.79  ? 180  LEU B CD2 1 
ATOM   5560 N N   . GLN B 1 181 ? 49.063 41.581  56.630  1.00 48.76  ? 181  GLN B N   1 
ATOM   5561 C CA  . GLN B 1 181 ? 49.176 40.814  57.877  1.00 50.88  ? 181  GLN B CA  1 
ATOM   5562 C C   . GLN B 1 181 ? 47.974 41.086  58.805  1.00 50.53  ? 181  GLN B C   1 
ATOM   5563 O O   . GLN B 1 181 ? 47.494 40.170  59.492  1.00 51.43  ? 181  GLN B O   1 
ATOM   5564 C CB  . GLN B 1 181 ? 50.496 41.117  58.607  1.00 51.10  ? 181  GLN B CB  1 
ATOM   5565 C CG  . GLN B 1 181 ? 51.756 40.573  57.905  1.00 54.80  ? 181  GLN B CG  1 
ATOM   5566 C CD  . GLN B 1 181 ? 53.102 41.096  58.497  1.00 55.13  ? 181  GLN B CD  1 
ATOM   5567 O OE1 . GLN B 1 181 ? 53.612 42.162  58.112  1.00 57.71  ? 181  GLN B OE1 1 
ATOM   5568 N NE2 . GLN B 1 181 ? 53.681 40.320  59.409  1.00 59.09  ? 181  GLN B NE2 1 
ATOM   5569 N N   . TRP B 1 182 ? 47.500 42.337  58.813  1.00 49.09  ? 182  TRP B N   1 
ATOM   5570 C CA  . TRP B 1 182 ? 46.326 42.734  59.604  1.00 48.93  ? 182  TRP B CA  1 
ATOM   5571 C C   . TRP B 1 182 ? 45.093 41.960  59.169  1.00 48.65  ? 182  TRP B C   1 
ATOM   5572 O O   . TRP B 1 182 ? 44.312 41.522  60.009  1.00 49.80  ? 182  TRP B O   1 
ATOM   5573 C CB  . TRP B 1 182 ? 46.059 44.245  59.508  1.00 48.10  ? 182  TRP B CB  1 
ATOM   5574 C CG  . TRP B 1 182 ? 45.014 44.752  60.476  1.00 48.86  ? 182  TRP B CG  1 
ATOM   5575 C CD1 . TRP B 1 182 ? 45.238 45.310  61.705  1.00 49.03  ? 182  TRP B CD1 1 
ATOM   5576 C CD2 . TRP B 1 182 ? 43.586 44.756  60.290  1.00 48.99  ? 182  TRP B CD2 1 
ATOM   5577 N NE1 . TRP B 1 182 ? 44.045 45.657  62.296  1.00 49.05  ? 182  TRP B NE1 1 
ATOM   5578 C CE2 . TRP B 1 182 ? 43.016 45.330  61.453  1.00 49.17  ? 182  TRP B CE2 1 
ATOM   5579 C CE3 . TRP B 1 182 ? 42.736 44.320  59.261  1.00 48.58  ? 182  TRP B CE3 1 
ATOM   5580 C CZ2 . TRP B 1 182 ? 41.639 45.482  61.617  1.00 49.90  ? 182  TRP B CZ2 1 
ATOM   5581 C CZ3 . TRP B 1 182 ? 41.363 44.469  59.422  1.00 48.89  ? 182  TRP B CZ3 1 
ATOM   5582 C CH2 . TRP B 1 182 ? 40.829 45.053  60.593  1.00 50.47  ? 182  TRP B CH2 1 
ATOM   5583 N N   . VAL B 1 183 ? 44.935 41.796  57.860  1.00 47.28  ? 183  VAL B N   1 
ATOM   5584 C CA  . VAL B 1 183 ? 43.844 41.016  57.296  1.00 47.49  ? 183  VAL B CA  1 
ATOM   5585 C C   . VAL B 1 183 ? 43.887 39.552  57.778  1.00 49.03  ? 183  VAL B C   1 
ATOM   5586 O O   . VAL B 1 183 ? 42.859 39.026  58.216  1.00 50.08  ? 183  VAL B O   1 
ATOM   5587 C CB  . VAL B 1 183 ? 43.775 41.150  55.733  1.00 46.39  ? 183  VAL B CB  1 
ATOM   5588 C CG1 . VAL B 1 183 ? 42.888 40.080  55.096  1.00 45.87  ? 183  VAL B CG1 1 
ATOM   5589 C CG2 . VAL B 1 183 ? 43.289 42.530  55.355  1.00 44.87  ? 183  VAL B CG2 1 
ATOM   5590 N N   . GLN B 1 184 ? 45.060 38.917  57.724  1.00 49.19  ? 184  GLN B N   1 
ATOM   5591 C CA  . GLN B 1 184 ? 45.217 37.537  58.198  1.00 51.05  ? 184  GLN B CA  1 
ATOM   5592 C C   . GLN B 1 184 ? 44.861 37.412  59.672  1.00 52.55  ? 184  GLN B C   1 
ATOM   5593 O O   . GLN B 1 184 ? 44.200 36.465  60.078  1.00 54.01  ? 184  GLN B O   1 
ATOM   5594 C CB  . GLN B 1 184 ? 46.650 37.036  58.001  1.00 51.25  ? 184  GLN B CB  1 
ATOM   5595 C CG  . GLN B 1 184 ? 47.056 36.781  56.567  1.00 51.52  ? 184  GLN B CG  1 
ATOM   5596 C CD  . GLN B 1 184 ? 46.250 35.660  55.908  1.00 52.93  ? 184  GLN B CD  1 
ATOM   5597 O OE1 . GLN B 1 184 ? 45.533 35.893  54.927  1.00 51.88  ? 184  GLN B OE1 1 
ATOM   5598 N NE2 . GLN B 1 184 ? 46.366 34.447  56.445  1.00 52.74  ? 184  GLN B NE2 1 
ATOM   5599 N N   . GLU B 1 185 ? 45.306 38.370  60.471  1.00 52.74  ? 185  GLU B N   1 
ATOM   5600 C CA  . GLU B 1 185 ? 45.074 38.326  61.903  1.00 54.89  ? 185  GLU B CA  1 
ATOM   5601 C C   . GLU B 1 185 ? 43.623 38.664  62.283  1.00 54.77  ? 185  GLU B C   1 
ATOM   5602 O O   . GLU B 1 185 ? 43.131 38.168  63.292  1.00 56.15  ? 185  GLU B O   1 
ATOM   5603 C CB  . GLU B 1 185 ? 46.047 39.256  62.648  1.00 54.35  ? 185  GLU B CB  1 
ATOM   5604 C CG  . GLU B 1 185 ? 47.529 38.853  62.583  1.00 56.34  ? 185  GLU B CG  1 
ATOM   5605 C CD  . GLU B 1 185 ? 48.444 39.774  63.426  1.00 57.39  ? 185  GLU B CD  1 
ATOM   5606 O OE1 . GLU B 1 185 ? 48.342 39.757  64.687  1.00 61.35  ? 185  GLU B OE1 1 
ATOM   5607 O OE2 . GLU B 1 185 ? 49.263 40.517  62.826  1.00 58.16  ? 185  GLU B OE2 1 
ATOM   5608 N N   . ASN B 1 186 ? 42.940 39.489  61.483  1.00 53.20  ? 186  ASN B N   1 
ATOM   5609 C CA  . ASN B 1 186 ? 41.674 40.082  61.933  1.00 53.17  ? 186  ASN B CA  1 
ATOM   5610 C C   . ASN B 1 186 ? 40.425 39.886  61.083  1.00 52.87  ? 186  ASN B C   1 
ATOM   5611 O O   . ASN B 1 186 ? 39.317 39.985  61.615  1.00 53.86  ? 186  ASN B O   1 
ATOM   5612 C CB  . ASN B 1 186 ? 41.855 41.584  62.215  1.00 52.66  ? 186  ASN B CB  1 
ATOM   5613 C CG  . ASN B 1 186 ? 42.834 41.845  63.336  1.00 52.90  ? 186  ASN B CG  1 
ATOM   5614 O OD1 . ASN B 1 186 ? 42.520 41.643  64.513  1.00 54.04  ? 186  ASN B OD1 1 
ATOM   5615 N ND2 . ASN B 1 186 ? 44.034 42.287  62.977  1.00 51.61  ? 186  ASN B ND2 1 
ATOM   5616 N N   . ILE B 1 187 ? 40.584 39.611  59.788  1.00 51.51  ? 187  ILE B N   1 
ATOM   5617 C CA  . ILE B 1 187 ? 39.433 39.592  58.881  1.00 51.08  ? 187  ILE B CA  1 
ATOM   5618 C C   . ILE B 1 187 ? 38.357 38.559  59.248  1.00 52.81  ? 187  ILE B C   1 
ATOM   5619 O O   . ILE B 1 187 ? 37.174 38.786  58.982  1.00 53.36  ? 187  ILE B O   1 
ATOM   5620 C CB  . ILE B 1 187 ? 39.852 39.511  57.372  1.00 50.16  ? 187  ILE B CB  1 
ATOM   5621 C CG1 . ILE B 1 187 ? 38.904 40.340  56.483  1.00 49.17  ? 187  ILE B CG1 1 
ATOM   5622 C CG2 . ILE B 1 187 ? 39.950 38.068  56.882  1.00 50.70  ? 187  ILE B CG2 1 
ATOM   5623 C CD1 . ILE B 1 187 ? 38.781 41.812  56.886  1.00 46.43  ? 187  ILE B CD1 1 
ATOM   5624 N N   . ALA B 1 188 ? 38.753 37.448  59.877  1.00 53.78  ? 188  ALA B N   1 
ATOM   5625 C CA  . ALA B 1 188 ? 37.782 36.433  60.325  1.00 55.72  ? 188  ALA B CA  1 
ATOM   5626 C C   . ALA B 1 188 ? 36.711 37.019  61.250  1.00 56.71  ? 188  ALA B C   1 
ATOM   5627 O O   . ALA B 1 188 ? 35.544 36.665  61.150  1.00 57.94  ? 188  ALA B O   1 
ATOM   5628 C CB  . ALA B 1 188 ? 38.484 35.223  60.986  1.00 56.58  ? 188  ALA B CB  1 
ATOM   5629 N N   . ALA B 1 189 ? 37.111 37.932  62.129  1.00 56.69  ? 189  ALA B N   1 
ATOM   5630 C CA  . ALA B 1 189 ? 36.169 38.641  63.001  1.00 57.79  ? 189  ALA B CA  1 
ATOM   5631 C C   . ALA B 1 189 ? 35.053 39.339  62.219  1.00 57.85  ? 189  ALA B C   1 
ATOM   5632 O O   . ALA B 1 189 ? 33.978 39.569  62.764  1.00 59.29  ? 189  ALA B O   1 
ATOM   5633 C CB  . ALA B 1 189 ? 36.911 39.653  63.879  1.00 57.12  ? 189  ALA B CB  1 
ATOM   5634 N N   . PHE B 1 190 ? 35.325 39.686  60.956  1.00 56.57  ? 190  PHE B N   1 
ATOM   5635 C CA  . PHE B 1 190 ? 34.360 40.365  60.081  1.00 56.52  ? 190  PHE B CA  1 
ATOM   5636 C C   . PHE B 1 190 ? 33.622 39.386  59.154  1.00 57.62  ? 190  PHE B C   1 
ATOM   5637 O O   . PHE B 1 190 ? 32.771 39.796  58.347  1.00 57.73  ? 190  PHE B O   1 
ATOM   5638 C CB  . PHE B 1 190 ? 35.066 41.395  59.196  1.00 54.36  ? 190  PHE B CB  1 
ATOM   5639 C CG  . PHE B 1 190 ? 35.698 42.535  59.937  1.00 53.69  ? 190  PHE B CG  1 
ATOM   5640 C CD1 . PHE B 1 190 ? 36.989 42.425  60.446  1.00 52.52  ? 190  PHE B CD1 1 
ATOM   5641 C CD2 . PHE B 1 190 ? 35.035 43.749  60.065  1.00 53.86  ? 190  PHE B CD2 1 
ATOM   5642 C CE1 . PHE B 1 190 ? 37.594 43.483  61.103  1.00 51.00  ? 190  PHE B CE1 1 
ATOM   5643 C CE2 . PHE B 1 190 ? 35.640 44.820  60.726  1.00 53.46  ? 190  PHE B CE2 1 
ATOM   5644 C CZ  . PHE B 1 190 ? 36.922 44.680  61.247  1.00 52.15  ? 190  PHE B CZ  1 
ATOM   5645 N N   . GLY B 1 191 ? 33.980 38.104  59.245  1.00 58.44  ? 191  GLY B N   1 
ATOM   5646 C CA  . GLY B 1 191 ? 33.426 37.070  58.377  1.00 59.18  ? 191  GLY B CA  1 
ATOM   5647 C C   . GLY B 1 191 ? 34.227 36.855  57.103  1.00 58.09  ? 191  GLY B C   1 
ATOM   5648 O O   . GLY B 1 191 ? 33.809 36.104  56.219  1.00 58.61  ? 191  GLY B O   1 
ATOM   5649 N N   . GLY B 1 192 ? 35.376 37.517  56.987  1.00 56.65  ? 192  GLY B N   1 
ATOM   5650 C CA  . GLY B 1 192 ? 36.296 37.246  55.871  1.00 55.40  ? 192  GLY B CA  1 
ATOM   5651 C C   . GLY B 1 192 ? 36.971 35.887  56.001  1.00 56.08  ? 192  GLY B C   1 
ATOM   5652 O O   . GLY B 1 192 ? 37.058 35.330  57.097  1.00 57.28  ? 192  GLY B O   1 
ATOM   5653 N N   . ASP B 1 193 ? 37.428 35.349  54.874  1.00 55.84  ? 193  ASP B N   1 
ATOM   5654 C CA  . ASP B 1 193 ? 38.199 34.100  54.825  1.00 56.81  ? 193  ASP B CA  1 
ATOM   5655 C C   . ASP B 1 193 ? 39.676 34.423  54.620  1.00 55.71  ? 193  ASP B C   1 
ATOM   5656 O O   . ASP B 1 193 ? 40.085 34.720  53.498  1.00 54.85  ? 193  ASP B O   1 
ATOM   5657 C CB  . ASP B 1 193 ? 37.711 33.225  53.666  1.00 57.41  ? 193  ASP B CB  1 
ATOM   5658 C CG  . ASP B 1 193 ? 38.244 31.788  53.727  1.00 59.34  ? 193  ASP B CG  1 
ATOM   5659 O OD1 . ASP B 1 193 ? 39.098 31.486  54.590  1.00 59.44  ? 193  ASP B OD1 1 
ATOM   5660 O OD2 . ASP B 1 193 ? 37.794 30.952  52.899  1.00 61.12  ? 193  ASP B OD2 1 
ATOM   5661 N N   . PRO B 1 194 ? 40.492 34.349  55.690  1.00 56.11  ? 194  PRO B N   1 
ATOM   5662 C CA  . PRO B 1 194 ? 41.900 34.718  55.507  1.00 55.18  ? 194  PRO B CA  1 
ATOM   5663 C C   . PRO B 1 194 ? 42.620 33.699  54.606  1.00 55.85  ? 194  PRO B C   1 
ATOM   5664 O O   . PRO B 1 194 ? 43.742 33.939  54.156  1.00 54.86  ? 194  PRO B O   1 
ATOM   5665 C CB  . PRO B 1 194 ? 42.465 34.680  56.929  1.00 55.80  ? 194  PRO B CB  1 
ATOM   5666 C CG  . PRO B 1 194 ? 41.565 33.723  57.676  1.00 57.51  ? 194  PRO B CG  1 
ATOM   5667 C CD  . PRO B 1 194 ? 40.202 33.894  57.065  1.00 57.51  ? 194  PRO B CD  1 
ATOM   5668 N N   . MET B 1 195 ? 41.963 32.575  54.333  1.00 57.48  ? 195  MET B N   1 
ATOM   5669 C CA  . MET B 1 195 ? 42.540 31.557  53.459  1.00 58.70  ? 195  MET B CA  1 
ATOM   5670 C C   . MET B 1 195 ? 42.176 31.768  51.996  1.00 57.04  ? 195  MET B C   1 
ATOM   5671 O O   . MET B 1 195 ? 42.538 30.954  51.145  1.00 57.48  ? 195  MET B O   1 
ATOM   5672 C CB  . MET B 1 195 ? 42.166 30.155  53.921  1.00 60.52  ? 195  MET B CB  1 
ATOM   5673 C CG  . MET B 1 195 ? 42.595 29.887  55.345  1.00 62.61  ? 195  MET B CG  1 
ATOM   5674 S SD  . MET B 1 195 ? 42.790 28.138  55.691  1.00 67.07  ? 195  MET B SD  1 
ATOM   5675 C CE  . MET B 1 195 ? 41.221 27.441  55.133  1.00 68.73  ? 195  MET B CE  1 
ATOM   5676 N N   . SER B 1 196 ? 41.479 32.868  51.716  1.00 55.31  ? 196  SER B N   1 
ATOM   5677 C CA  . SER B 1 196 ? 41.175 33.265  50.352  1.00 54.01  ? 196  SER B CA  1 
ATOM   5678 C C   . SER B 1 196 ? 41.241 34.787  50.188  1.00 52.13  ? 196  SER B C   1 
ATOM   5679 O O   . SER B 1 196 ? 40.237 35.498  50.306  1.00 51.89  ? 196  SER B O   1 
ATOM   5680 C CB  . SER B 1 196 ? 39.820 32.722  49.908  1.00 55.08  ? 196  SER B CB  1 
ATOM   5681 O OG  . SER B 1 196 ? 39.581 33.075  48.559  1.00 55.04  ? 196  SER B OG  1 
ATOM   5682 N N   . VAL B 1 197 ? 42.439 35.272  49.902  1.00 50.53  ? 197  VAL B N   1 
ATOM   5683 C CA  . VAL B 1 197 ? 42.679 36.696  49.796  1.00 48.90  ? 197  VAL B CA  1 
ATOM   5684 C C   . VAL B 1 197 ? 43.170 37.023  48.396  1.00 47.79  ? 197  VAL B C   1 
ATOM   5685 O O   . VAL B 1 197 ? 44.180 36.473  47.933  1.00 47.90  ? 197  VAL B O   1 
ATOM   5686 C CB  . VAL B 1 197 ? 43.691 37.158  50.870  1.00 48.80  ? 197  VAL B CB  1 
ATOM   5687 C CG1 . VAL B 1 197 ? 44.201 38.555  50.577  1.00 46.63  ? 197  VAL B CG1 1 
ATOM   5688 C CG2 . VAL B 1 197 ? 43.053 37.073  52.254  1.00 49.02  ? 197  VAL B CG2 1 
ATOM   5689 N N   . THR B 1 198 ? 42.435 37.896  47.719  1.00 46.65  ? 198  THR B N   1 
ATOM   5690 C CA  . THR B 1 198 ? 42.798 38.337  46.383  1.00 45.92  ? 198  THR B CA  1 
ATOM   5691 C C   . THR B 1 198 ? 43.247 39.788  46.426  1.00 44.84  ? 198  THR B C   1 
ATOM   5692 O O   . THR B 1 198 ? 42.470 40.673  46.813  1.00 45.00  ? 198  THR B O   1 
ATOM   5693 C CB  . THR B 1 198 ? 41.600 38.212  45.424  1.00 46.35  ? 198  THR B CB  1 
ATOM   5694 O OG1 . THR B 1 198 ? 41.132 36.862  45.438  1.00 48.56  ? 198  THR B OG1 1 
ATOM   5695 C CG2 . THR B 1 198 ? 41.977 38.608  43.996  1.00 44.83  ? 198  THR B CG2 1 
ATOM   5696 N N   . LEU B 1 199 ? 44.498 40.041  46.051  1.00 43.93  ? 199  LEU B N   1 
ATOM   5697 C CA  . LEU B 1 199 ? 44.943 41.426  45.893  1.00 43.31  ? 199  LEU B CA  1 
ATOM   5698 C C   . LEU B 1 199 ? 44.487 41.938  44.552  1.00 42.88  ? 199  LEU B C   1 
ATOM   5699 O O   . LEU B 1 199 ? 44.431 41.173  43.591  1.00 43.36  ? 199  LEU B O   1 
ATOM   5700 C CB  . LEU B 1 199 ? 46.458 41.550  45.969  1.00 42.67  ? 199  LEU B CB  1 
ATOM   5701 C CG  . LEU B 1 199 ? 47.141 40.997  47.209  1.00 43.68  ? 199  LEU B CG  1 
ATOM   5702 C CD1 . LEU B 1 199 ? 48.649 41.249  47.081  1.00 43.26  ? 199  LEU B CD1 1 
ATOM   5703 C CD2 . LEU B 1 199 ? 46.568 41.610  48.480  1.00 43.27  ? 199  LEU B CD2 1 
ATOM   5704 N N   . PHE B 1 200 ? 44.145 43.219  44.485  1.00 42.37  ? 200  PHE B N   1 
ATOM   5705 C CA  . PHE B 1 200 ? 43.946 43.877  43.190  1.00 42.13  ? 200  PHE B CA  1 
ATOM   5706 C C   . PHE B 1 200 ? 44.245 45.358  43.270  1.00 41.93  ? 200  PHE B C   1 
ATOM   5707 O O   . PHE B 1 200 ? 44.047 45.983  44.311  1.00 42.24  ? 200  PHE B O   1 
ATOM   5708 C CB  . PHE B 1 200 ? 42.572 43.560  42.549  1.00 42.11  ? 200  PHE B CB  1 
ATOM   5709 C CG  . PHE B 1 200 ? 41.388 44.273  43.162  1.00 42.01  ? 200  PHE B CG  1 
ATOM   5710 C CD1 . PHE B 1 200 ? 41.201 44.336  44.541  1.00 42.15  ? 200  PHE B CD1 1 
ATOM   5711 C CD2 . PHE B 1 200 ? 40.398 44.807  42.332  1.00 41.52  ? 200  PHE B CD2 1 
ATOM   5712 C CE1 . PHE B 1 200 ? 40.062 44.976  45.090  1.00 42.08  ? 200  PHE B CE1 1 
ATOM   5713 C CE2 . PHE B 1 200 ? 39.272 45.435  42.856  1.00 41.33  ? 200  PHE B CE2 1 
ATOM   5714 C CZ  . PHE B 1 200 ? 39.104 45.528  44.246  1.00 42.55  ? 200  PHE B CZ  1 
ATOM   5715 N N   . GLY B 1 201 ? 44.760 45.904  42.174  1.00 41.72  ? 201  GLY B N   1 
ATOM   5716 C CA  . GLY B 1 201 ? 45.132 47.308  42.117  1.00 41.47  ? 201  GLY B CA  1 
ATOM   5717 C C   . GLY B 1 201 ? 45.255 47.781  40.691  1.00 41.64  ? 201  GLY B C   1 
ATOM   5718 O O   . GLY B 1 201 ? 45.292 46.973  39.752  1.00 41.55  ? 201  GLY B O   1 
ATOM   5719 N N   . GLU B 1 202 ? 45.314 49.098  40.535  1.00 41.78  ? 202  GLU B N   1 
ATOM   5720 C CA  . GLU B 1 202 ? 45.481 49.713  39.230  1.00 42.07  ? 202  GLU B CA  1 
ATOM   5721 C C   . GLU B 1 202 ? 46.714 50.625  39.204  1.00 41.98  ? 202  GLU B C   1 
ATOM   5722 O O   . GLU B 1 202 ? 47.018 51.296  40.189  1.00 41.79  ? 202  GLU B O   1 
ATOM   5723 C CB  . GLU B 1 202 ? 44.207 50.470  38.835  1.00 42.41  ? 202  GLU B CB  1 
ATOM   5724 C CG  . GLU B 1 202 ? 44.183 50.999  37.402  1.00 43.47  ? 202  GLU B CG  1 
ATOM   5725 C CD  . GLU B 1 202 ? 44.658 52.439  37.299  1.00 45.64  ? 202  GLU B CD  1 
ATOM   5726 O OE1 . GLU B 1 202 ? 44.851 53.067  38.356  1.00 46.13  ? 202  GLU B OE1 1 
ATOM   5727 O OE2 . GLU B 1 202 ? 44.840 52.949  36.166  1.00 46.82  ? 202  GLU B OE2 1 
ATOM   5728 N N   . ALA B 1 203 ? 47.420 50.631  38.071  1.00 42.18  ? 203  ALA B N   1 
ATOM   5729 C CA  . ALA B 1 203 ? 48.556 51.525  37.856  1.00 42.51  ? 203  ALA B CA  1 
ATOM   5730 C C   . ALA B 1 203 ? 49.654 51.219  38.887  1.00 42.34  ? 203  ALA B C   1 
ATOM   5731 O O   . ALA B 1 203 ? 50.037 50.044  39.033  1.00 42.07  ? 203  ALA B O   1 
ATOM   5732 C CB  . ALA B 1 203 ? 48.094 52.995  37.909  1.00 42.84  ? 203  ALA B CB  1 
ATOM   5733 N N   . ALA B 1 204 ? 50.143 52.236  39.609  1.00 42.44  ? 204  ALA B N   1 
ATOM   5734 C CA  . ALA B 1 204 ? 51.108 52.012  40.704  1.00 42.65  ? 204  ALA B CA  1 
ATOM   5735 C C   . ALA B 1 204 ? 50.621 50.943  41.698  1.00 42.40  ? 204  ALA B C   1 
ATOM   5736 O O   . ALA B 1 204 ? 51.428 50.190  42.254  1.00 42.63  ? 204  ALA B O   1 
ATOM   5737 C CB  . ALA B 1 204 ? 51.440 53.307  41.424  1.00 42.98  ? 204  ALA B CB  1 
ATOM   5738 N N   . GLY B 1 205 ? 49.308 50.869  41.900  1.00 42.16  ? 205  GLY B N   1 
ATOM   5739 C CA  . GLY B 1 205 ? 48.718 49.801  42.713  1.00 42.11  ? 205  GLY B CA  1 
ATOM   5740 C C   . GLY B 1 205 ? 48.917 48.399  42.147  1.00 41.90  ? 205  GLY B C   1 
ATOM   5741 O O   . GLY B 1 205 ? 49.071 47.439  42.904  1.00 41.98  ? 205  GLY B O   1 
ATOM   5742 N N   . ALA B 1 206 ? 48.908 48.277  40.821  1.00 41.42  ? 206  ALA B N   1 
ATOM   5743 C CA  . ALA B 1 206 ? 49.110 46.991  40.173  1.00 41.27  ? 206  ALA B CA  1 
ATOM   5744 C C   . ALA B 1 206 ? 50.579 46.559  40.270  1.00 41.45  ? 206  ALA B C   1 
ATOM   5745 O O   . ALA B 1 206 ? 50.874 45.386  40.520  1.00 41.33  ? 206  ALA B O   1 
ATOM   5746 C CB  . ALA B 1 206 ? 48.664 47.054  38.735  1.00 41.55  ? 206  ALA B CB  1 
ATOM   5747 N N   . ALA B 1 207 ? 51.487 47.521  40.096  1.00 41.36  ? 207  ALA B N   1 
ATOM   5748 C CA  . ALA B 1 207 ? 52.905 47.294  40.306  1.00 41.46  ? 207  ALA B CA  1 
ATOM   5749 C C   . ALA B 1 207 ? 53.181 46.850  41.748  1.00 41.86  ? 207  ALA B C   1 
ATOM   5750 O O   . ALA B 1 207 ? 53.990 45.925  41.982  1.00 42.13  ? 207  ALA B O   1 
ATOM   5751 C CB  . ALA B 1 207 ? 53.685 48.534  39.965  1.00 41.61  ? 207  ALA B CB  1 
ATOM   5752 N N   . SER B 1 208 ? 52.495 47.484  42.707  1.00 41.50  ? 208  SER B N   1 
ATOM   5753 C CA  . SER B 1 208 ? 52.579 47.071  44.116  1.00 41.78  ? 208  SER B CA  1 
ATOM   5754 C C   . SER B 1 208 ? 52.128 45.620  44.312  1.00 42.00  ? 208  SER B C   1 
ATOM   5755 O O   . SER B 1 208 ? 52.791 44.850  44.999  1.00 42.69  ? 208  SER B O   1 
ATOM   5756 C CB  . SER B 1 208 ? 51.765 47.998  45.010  1.00 41.86  ? 208  SER B CB  1 
ATOM   5757 O OG  . SER B 1 208 ? 52.305 49.311  45.040  1.00 42.64  ? 208  SER B OG  1 
ATOM   5758 N N   . VAL B 1 209 ? 51.008 45.248  43.700  1.00 41.59  ? 209  VAL B N   1 
ATOM   5759 C CA  . VAL B 1 209 ? 50.544 43.870  43.732  1.00 41.89  ? 209  VAL B CA  1 
ATOM   5760 C C   . VAL B 1 209 ? 51.634 42.959  43.139  1.00 43.12  ? 209  VAL B C   1 
ATOM   5761 O O   . VAL B 1 209 ? 51.988 41.911  43.717  1.00 43.54  ? 209  VAL B O   1 
ATOM   5762 C CB  . VAL B 1 209 ? 49.193 43.716  42.973  1.00 41.52  ? 209  VAL B CB  1 
ATOM   5763 C CG1 . VAL B 1 209 ? 48.884 42.268  42.685  1.00 40.89  ? 209  VAL B CG1 1 
ATOM   5764 C CG2 . VAL B 1 209 ? 48.053 44.363  43.754  1.00 40.37  ? 209  VAL B CG2 1 
ATOM   5765 N N   . GLY B 1 210 ? 52.181 43.372  41.997  1.00 43.48  ? 210  GLY B N   1 
ATOM   5766 C CA  . GLY B 1 210 ? 53.261 42.614  41.347  1.00 44.87  ? 210  GLY B CA  1 
ATOM   5767 C C   . GLY B 1 210 ? 54.475 42.467  42.248  1.00 45.87  ? 210  GLY B C   1 
ATOM   5768 O O   . GLY B 1 210 ? 55.069 41.397  42.336  1.00 46.39  ? 210  GLY B O   1 
ATOM   5769 N N   . MET B 1 211 ? 54.830 43.544  42.945  1.00 46.36  ? 211  MET B N   1 
ATOM   5770 C CA  . MET B 1 211 ? 55.952 43.483  43.877  1.00 47.97  ? 211  MET B CA  1 
ATOM   5771 C C   . MET B 1 211 ? 55.706 42.518  45.038  1.00 47.40  ? 211  MET B C   1 
ATOM   5772 O O   . MET B 1 211 ? 56.638 41.847  45.493  1.00 48.23  ? 211  MET B O   1 
ATOM   5773 C CB  . MET B 1 211 ? 56.406 44.882  44.316  1.00 47.42  ? 211  MET B CB  1 
ATOM   5774 C CG  . MET B 1 211 ? 57.376 45.491  43.290  1.00 48.77  ? 211  MET B CG  1 
ATOM   5775 S SD  . MET B 1 211 ? 57.349 47.296  43.264  1.00 52.37  ? 211  MET B SD  1 
ATOM   5776 C CE  . MET B 1 211 ? 57.530 47.652  41.516  1.00 49.69  ? 211  MET B CE  1 
ATOM   5777 N N   . HIS B 1 212 ? 54.451 42.388  45.473  1.00 46.27  ? 212  HIS B N   1 
ATOM   5778 C CA  . HIS B 1 212 ? 54.157 41.422  46.516  1.00 46.22  ? 212  HIS B CA  1 
ATOM   5779 C C   . HIS B 1 212 ? 54.314 40.002  46.006  1.00 47.07  ? 212  HIS B C   1 
ATOM   5780 O O   . HIS B 1 212 ? 54.765 39.139  46.752  1.00 48.21  ? 212  HIS B O   1 
ATOM   5781 C CB  . HIS B 1 212 ? 52.802 41.672  47.177  1.00 45.06  ? 212  HIS B CB  1 
ATOM   5782 C CG  . HIS B 1 212 ? 52.794 42.871  48.076  1.00 45.10  ? 212  HIS B CG  1 
ATOM   5783 N ND1 . HIS B 1 212 ? 52.094 44.024  47.782  1.00 44.66  ? 212  HIS B ND1 1 
ATOM   5784 C CD2 . HIS B 1 212 ? 53.429 43.108  49.248  1.00 44.33  ? 212  HIS B CD2 1 
ATOM   5785 C CE1 . HIS B 1 212 ? 52.287 44.913  48.740  1.00 43.57  ? 212  HIS B CE1 1 
ATOM   5786 N NE2 . HIS B 1 212 ? 53.097 44.383  49.640  1.00 44.76  ? 212  HIS B NE2 1 
ATOM   5787 N N   . ILE B 1 213 ? 53.963 39.766  44.737  1.00 47.01  ? 213  ILE B N   1 
ATOM   5788 C CA  . ILE B 1 213 ? 54.178 38.460  44.095  1.00 47.78  ? 213  ILE B CA  1 
ATOM   5789 C C   . ILE B 1 213 ? 55.670 38.100  44.104  1.00 48.80  ? 213  ILE B C   1 
ATOM   5790 O O   . ILE B 1 213 ? 56.040 36.946  44.348  1.00 49.38  ? 213  ILE B O   1 
ATOM   5791 C CB  . ILE B 1 213 ? 53.609 38.417  42.642  1.00 47.50  ? 213  ILE B CB  1 
ATOM   5792 C CG1 . ILE B 1 213 ? 52.080 38.491  42.656  1.00 47.22  ? 213  ILE B CG1 1 
ATOM   5793 C CG2 . ILE B 1 213 ? 54.042 37.154  41.900  1.00 47.79  ? 213  ILE B CG2 1 
ATOM   5794 C CD1 . ILE B 1 213 ? 51.460 38.775  41.299  1.00 47.33  ? 213  ILE B CD1 1 
ATOM   5795 N N   . LEU B 1 214 ? 56.509 39.112  43.879  1.00 48.92  ? 214  LEU B N   1 
ATOM   5796 C CA  . LEU B 1 214 ? 57.960 38.934  43.752  1.00 50.03  ? 214  LEU B CA  1 
ATOM   5797 C C   . LEU B 1 214 ? 58.730 39.032  45.067  1.00 50.95  ? 214  LEU B C   1 
ATOM   5798 O O   . LEU B 1 214 ? 59.956 39.007  45.064  1.00 52.16  ? 214  LEU B O   1 
ATOM   5799 C CB  . LEU B 1 214 ? 58.522 39.946  42.749  1.00 49.57  ? 214  LEU B CB  1 
ATOM   5800 C CG  . LEU B 1 214 ? 57.943 39.887  41.332  1.00 49.21  ? 214  LEU B CG  1 
ATOM   5801 C CD1 . LEU B 1 214 ? 58.440 41.077  40.528  1.00 47.71  ? 214  LEU B CD1 1 
ATOM   5802 C CD2 . LEU B 1 214 ? 58.302 38.554  40.657  1.00 49.53  ? 214  LEU B CD2 1 
ATOM   5803 N N   . SER B 1 215 ? 58.018 39.145  46.184  1.00 50.86  ? 215  SER B N   1 
ATOM   5804 C CA  . SER B 1 215 ? 58.658 39.252  47.489  1.00 52.04  ? 215  SER B CA  1 
ATOM   5805 C C   . SER B 1 215 ? 58.153 38.185  48.455  1.00 53.36  ? 215  SER B C   1 
ATOM   5806 O O   . SER B 1 215 ? 56.991 38.196  48.875  1.00 52.48  ? 215  SER B O   1 
ATOM   5807 C CB  . SER B 1 215 ? 58.451 40.652  48.068  1.00 51.34  ? 215  SER B CB  1 
ATOM   5808 O OG  . SER B 1 215 ? 59.274 40.863  49.202  1.00 52.33  ? 215  SER B OG  1 
ATOM   5809 N N   . LEU B 1 216 ? 59.058 37.276  48.815  1.00 55.83  ? 216  LEU B N   1 
ATOM   5810 C CA  . LEU B 1 216 ? 58.742 36.072  49.591  1.00 57.70  ? 216  LEU B CA  1 
ATOM   5811 C C   . LEU B 1 216 ? 57.897 36.245  50.868  1.00 57.49  ? 216  LEU B C   1 
ATOM   5812 O O   . LEU B 1 216 ? 56.900 35.537  51.027  1.00 57.97  ? 216  LEU B O   1 
ATOM   5813 C CB  . LEU B 1 216 ? 60.012 35.280  49.908  1.00 59.82  ? 216  LEU B CB  1 
ATOM   5814 C CG  . LEU B 1 216 ? 59.786 33.776  49.774  1.00 63.29  ? 216  LEU B CG  1 
ATOM   5815 C CD1 . LEU B 1 216 ? 59.979 33.371  48.288  1.00 65.36  ? 216  LEU B CD1 1 
ATOM   5816 C CD2 . LEU B 1 216 ? 60.709 32.965  50.706  1.00 66.94  ? 216  LEU B CD2 1 
ATOM   5817 N N   . PRO B 1 217 ? 58.294 37.156  51.788  1.00 57.34  ? 217  PRO B N   1 
ATOM   5818 C CA  . PRO B 1 217 ? 57.470 37.364  52.995  1.00 57.19  ? 217  PRO B CA  1 
ATOM   5819 C C   . PRO B 1 217 ? 56.028 37.811  52.729  1.00 56.04  ? 217  PRO B C   1 
ATOM   5820 O O   . PRO B 1 217 ? 55.173 37.664  53.606  1.00 56.72  ? 217  PRO B O   1 
ATOM   5821 C CB  . PRO B 1 217 ? 58.221 38.467  53.747  1.00 57.16  ? 217  PRO B CB  1 
ATOM   5822 C CG  . PRO B 1 217 ? 59.634 38.344  53.267  1.00 57.80  ? 217  PRO B CG  1 
ATOM   5823 C CD  . PRO B 1 217 ? 59.501 38.006  51.815  1.00 57.29  ? 217  PRO B CD  1 
ATOM   5824 N N   . SER B 1 218 ? 55.756 38.349  51.544  1.00 54.94  ? 218  SER B N   1 
ATOM   5825 C CA  . SER B 1 218 ? 54.404 38.786  51.202  1.00 53.75  ? 218  SER B CA  1 
ATOM   5826 C C   . SER B 1 218 ? 53.549 37.647  50.696  1.00 54.43  ? 218  SER B C   1 
ATOM   5827 O O   . SER B 1 218 ? 52.324 37.714  50.792  1.00 54.55  ? 218  SER B O   1 
ATOM   5828 C CB  . SER B 1 218 ? 54.430 39.887  50.146  1.00 52.50  ? 218  SER B CB  1 
ATOM   5829 O OG  . SER B 1 218 ? 54.777 41.133  50.713  1.00 51.40  ? 218  SER B OG  1 
ATOM   5830 N N   . ARG B 1 219 ? 54.196 36.608  50.166  1.00 55.37  ? 219  ARG B N   1 
ATOM   5831 C CA  . ARG B 1 219 ? 53.513 35.513  49.476  1.00 56.00  ? 219  ARG B CA  1 
ATOM   5832 C C   . ARG B 1 219 ? 52.644 34.664  50.397  1.00 56.53  ? 219  ARG B C   1 
ATOM   5833 O O   . ARG B 1 219 ? 51.757 33.951  49.938  1.00 57.43  ? 219  ARG B O   1 
ATOM   5834 C CB  . ARG B 1 219 ? 54.512 34.613  48.726  1.00 57.16  ? 219  ARG B CB  1 
ATOM   5835 C CG  . ARG B 1 219 ? 55.055 35.183  47.417  1.00 58.33  ? 219  ARG B CG  1 
ATOM   5836 C CD  . ARG B 1 219 ? 53.973 35.337  46.315  1.00 62.18  ? 219  ARG B CD  1 
ATOM   5837 N NE  . ARG B 1 219 ? 53.507 34.069  45.735  1.00 66.39  ? 219  ARG B NE  1 
ATOM   5838 C CZ  . ARG B 1 219 ? 54.152 33.360  44.802  1.00 69.28  ? 219  ARG B CZ  1 
ATOM   5839 N NH1 . ARG B 1 219 ? 55.321 33.776  44.312  1.00 70.59  ? 219  ARG B NH1 1 
ATOM   5840 N NH2 . ARG B 1 219 ? 53.629 32.219  44.351  1.00 70.19  ? 219  ARG B NH2 1 
ATOM   5841 N N   . SER B 1 220 ? 52.891 34.727  51.694  1.00 56.51  ? 220  SER B N   1 
ATOM   5842 C CA  . SER B 1 220 ? 52.101 33.931  52.614  1.00 56.74  ? 220  SER B CA  1 
ATOM   5843 C C   . SER B 1 220 ? 50.861 34.692  53.072  1.00 54.97  ? 220  SER B C   1 
ATOM   5844 O O   . SER B 1 220 ? 50.173 34.255  53.987  1.00 55.79  ? 220  SER B O   1 
ATOM   5845 C CB  . SER B 1 220 ? 52.951 33.499  53.815  1.00 58.45  ? 220  SER B CB  1 
ATOM   5846 O OG  . SER B 1 220 ? 53.067 34.556  54.753  1.00 58.85  ? 220  SER B OG  1 
ATOM   5847 N N   . LEU B 1 221 ? 50.579 35.826  52.432  1.00 52.58  ? 221  LEU B N   1 
ATOM   5848 C CA  . LEU B 1 221 ? 49.492 36.715  52.855  1.00 50.77  ? 221  LEU B CA  1 
ATOM   5849 C C   . LEU B 1 221 ? 48.380 36.904  51.811  1.00 49.56  ? 221  LEU B C   1 
ATOM   5850 O O   . LEU B 1 221 ? 47.441 37.663  52.037  1.00 49.07  ? 221  LEU B O   1 
ATOM   5851 C CB  . LEU B 1 221 ? 50.059 38.081  53.280  1.00 49.90  ? 221  LEU B CB  1 
ATOM   5852 C CG  . LEU B 1 221 ? 51.299 38.150  54.192  1.00 49.95  ? 221  LEU B CG  1 
ATOM   5853 C CD1 . LEU B 1 221 ? 51.745 39.599  54.369  1.00 47.93  ? 221  LEU B CD1 1 
ATOM   5854 C CD2 . LEU B 1 221 ? 51.055 37.495  55.549  1.00 48.08  ? 221  LEU B CD2 1 
ATOM   5855 N N   . PHE B 1 222 ? 48.500 36.233  50.665  1.00 49.08  ? 222  PHE B N   1 
ATOM   5856 C CA  . PHE B 1 222 ? 47.458 36.236  49.626  1.00 48.26  ? 222  PHE B CA  1 
ATOM   5857 C C   . PHE B 1 222 ? 47.570 34.995  48.747  1.00 49.04  ? 222  PHE B C   1 
ATOM   5858 O O   . PHE B 1 222 ? 48.500 34.201  48.883  1.00 49.54  ? 222  PHE B O   1 
ATOM   5859 C CB  . PHE B 1 222 ? 47.466 37.526  48.784  1.00 46.79  ? 222  PHE B CB  1 
ATOM   5860 C CG  . PHE B 1 222 ? 48.683 37.694  47.916  1.00 45.88  ? 222  PHE B CG  1 
ATOM   5861 C CD1 . PHE B 1 222 ? 49.903 38.109  48.467  1.00 45.45  ? 222  PHE B CD1 1 
ATOM   5862 C CD2 . PHE B 1 222 ? 48.606 37.462  46.535  1.00 45.29  ? 222  PHE B CD2 1 
ATOM   5863 C CE1 . PHE B 1 222 ? 51.041 38.279  47.655  1.00 46.46  ? 222  PHE B CE1 1 
ATOM   5864 C CE2 . PHE B 1 222 ? 49.732 37.617  45.707  1.00 44.91  ? 222  PHE B CE2 1 
ATOM   5865 C CZ  . PHE B 1 222 ? 50.960 38.031  46.269  1.00 45.50  ? 222  PHE B CZ  1 
ATOM   5866 N N   . HIS B 1 223 ? 46.608 34.825  47.852  1.00 49.29  ? 223  HIS B N   1 
ATOM   5867 C CA  . HIS B 1 223 ? 46.507 33.602  47.077  1.00 50.50  ? 223  HIS B CA  1 
ATOM   5868 C C   . HIS B 1 223 ? 46.328 33.912  45.596  1.00 49.93  ? 223  HIS B C   1 
ATOM   5869 O O   . HIS B 1 223 ? 46.711 33.123  44.741  1.00 50.86  ? 223  HIS B O   1 
ATOM   5870 C CB  . HIS B 1 223 ? 45.362 32.727  47.617  1.00 51.80  ? 223  HIS B CB  1 
ATOM   5871 C CG  . HIS B 1 223 ? 45.384 32.566  49.109  1.00 52.89  ? 223  HIS B CG  1 
ATOM   5872 N ND1 . HIS B 1 223 ? 44.698 33.411  49.959  1.00 52.63  ? 223  HIS B ND1 1 
ATOM   5873 C CD2 . HIS B 1 223 ? 46.028 31.677  49.904  1.00 54.93  ? 223  HIS B CD2 1 
ATOM   5874 C CE1 . HIS B 1 223 ? 44.920 33.050  51.212  1.00 53.60  ? 223  HIS B CE1 1 
ATOM   5875 N NE2 . HIS B 1 223 ? 45.719 31.997  51.207  1.00 55.40  ? 223  HIS B NE2 1 
ATOM   5876 N N   . ARG B 1 224 ? 45.755 35.070  45.295  1.00 48.78  ? 224  ARG B N   1 
ATOM   5877 C CA  . ARG B 1 224 ? 45.507 35.463  43.912  1.00 48.49  ? 224  ARG B CA  1 
ATOM   5878 C C   . ARG B 1 224 ? 45.786 36.959  43.740  1.00 46.77  ? 224  ARG B C   1 
ATOM   5879 O O   . ARG B 1 224 ? 45.789 37.713  44.721  1.00 46.23  ? 224  ARG B O   1 
ATOM   5880 C CB  . ARG B 1 224 ? 44.058 35.126  43.515  1.00 49.52  ? 224  ARG B CB  1 
ATOM   5881 C CG  . ARG B 1 224 ? 43.828 33.646  43.239  1.00 53.02  ? 224  ARG B CG  1 
ATOM   5882 C CD  . ARG B 1 224 ? 42.347 33.272  43.184  1.00 56.19  ? 224  ARG B CD  1 
ATOM   5883 N NE  . ARG B 1 224 ? 41.774 33.105  44.516  1.00 58.81  ? 224  ARG B NE  1 
ATOM   5884 C CZ  . ARG B 1 224 ? 41.978 32.044  45.292  1.00 61.16  ? 224  ARG B CZ  1 
ATOM   5885 N NH1 . ARG B 1 224 ? 42.751 31.052  44.869  1.00 61.48  ? 224  ARG B NH1 1 
ATOM   5886 N NH2 . ARG B 1 224 ? 41.414 31.977  46.498  1.00 62.23  ? 224  ARG B NH2 1 
ATOM   5887 N N   . ALA B 1 225 ? 46.007 37.381  42.497  1.00 45.46  ? 225  ALA B N   1 
ATOM   5888 C CA  . ALA B 1 225 ? 46.371 38.755  42.207  1.00 44.06  ? 225  ALA B CA  1 
ATOM   5889 C C   . ALA B 1 225 ? 45.706 39.238  40.934  1.00 43.78  ? 225  ALA B C   1 
ATOM   5890 O O   . ALA B 1 225 ? 45.542 38.472  39.989  1.00 44.58  ? 225  ALA B O   1 
ATOM   5891 C CB  . ALA B 1 225 ? 47.876 38.868  42.083  1.00 43.79  ? 225  ALA B CB  1 
ATOM   5892 N N   . VAL B 1 226 ? 45.315 40.507  40.927  1.00 42.83  ? 226  VAL B N   1 
ATOM   5893 C CA  . VAL B 1 226 ? 44.824 41.184  39.735  1.00 42.52  ? 226  VAL B CA  1 
ATOM   5894 C C   . VAL B 1 226 ? 45.660 42.451  39.561  1.00 42.31  ? 226  VAL B C   1 
ATOM   5895 O O   . VAL B 1 226 ? 45.784 43.261  40.498  1.00 41.67  ? 226  VAL B O   1 
ATOM   5896 C CB  . VAL B 1 226 ? 43.336 41.613  39.859  1.00 42.81  ? 226  VAL B CB  1 
ATOM   5897 C CG1 . VAL B 1 226 ? 42.867 42.313  38.590  1.00 41.92  ? 226  VAL B CG1 1 
ATOM   5898 C CG2 . VAL B 1 226 ? 42.417 40.431  40.215  1.00 43.45  ? 226  VAL B CG2 1 
ATOM   5899 N N   . LEU B 1 227 ? 46.237 42.613  38.370  1.00 42.36  ? 227  LEU B N   1 
ATOM   5900 C CA  . LEU B 1 227 ? 47.076 43.777  38.060  1.00 41.98  ? 227  LEU B CA  1 
ATOM   5901 C C   . LEU B 1 227 ? 46.428 44.518  36.910  1.00 42.00  ? 227  LEU B C   1 
ATOM   5902 O O   . LEU B 1 227 ? 46.418 44.025  35.775  1.00 42.19  ? 227  LEU B O   1 
ATOM   5903 C CB  . LEU B 1 227 ? 48.511 43.368  37.686  1.00 41.69  ? 227  LEU B CB  1 
ATOM   5904 C CG  . LEU B 1 227 ? 49.430 42.704  38.727  1.00 42.87  ? 227  LEU B CG  1 
ATOM   5905 C CD1 . LEU B 1 227 ? 49.101 41.213  38.920  1.00 42.55  ? 227  LEU B CD1 1 
ATOM   5906 C CD2 . LEU B 1 227 ? 50.930 42.860  38.355  1.00 42.12  ? 227  LEU B CD2 1 
ATOM   5907 N N   . GLN B 1 228 ? 45.868 45.689  37.212  1.00 41.60  ? 228  GLN B N   1 
ATOM   5908 C CA  . GLN B 1 228 ? 45.172 46.477  36.211  1.00 41.85  ? 228  GLN B CA  1 
ATOM   5909 C C   . GLN B 1 228 ? 46.047 47.647  35.777  1.00 41.82  ? 228  GLN B C   1 
ATOM   5910 O O   . GLN B 1 228 ? 46.324 48.549  36.566  1.00 41.83  ? 228  GLN B O   1 
ATOM   5911 C CB  . GLN B 1 228 ? 43.849 47.006  36.763  1.00 42.30  ? 228  GLN B CB  1 
ATOM   5912 C CG  . GLN B 1 228 ? 42.938 45.968  37.419  1.00 43.05  ? 228  GLN B CG  1 
ATOM   5913 C CD  . GLN B 1 228 ? 41.702 46.606  38.064  1.00 44.47  ? 228  GLN B CD  1 
ATOM   5914 O OE1 . GLN B 1 228 ? 41.072 46.014  38.944  1.00 44.79  ? 228  GLN B OE1 1 
ATOM   5915 N NE2 . GLN B 1 228 ? 41.352 47.813  37.623  1.00 43.65  ? 228  GLN B NE2 1 
ATOM   5916 N N   . SER B 1 229 ? 46.490 47.619  34.522  1.00 41.91  ? 229  SER B N   1 
ATOM   5917 C CA  . SER B 1 229 ? 47.247 48.722  33.910  1.00 41.56  ? 229  SER B CA  1 
ATOM   5918 C C   . SER B 1 229 ? 48.545 49.097  34.631  1.00 40.98  ? 229  SER B C   1 
ATOM   5919 O O   . SER B 1 229 ? 48.853 50.288  34.779  1.00 41.23  ? 229  SER B O   1 
ATOM   5920 C CB  . SER B 1 229 ? 46.363 49.966  33.764  1.00 42.06  ? 229  SER B CB  1 
ATOM   5921 O OG  . SER B 1 229 ? 45.238 49.704  32.954  1.00 42.02  ? 229  SER B OG  1 
ATOM   5922 N N   . GLY B 1 230 ? 49.296 48.098  35.073  1.00 40.15  ? 230  GLY B N   1 
ATOM   5923 C CA  . GLY B 1 230 ? 50.546 48.342  35.780  1.00 40.23  ? 230  GLY B CA  1 
ATOM   5924 C C   . GLY B 1 230 ? 51.255 47.058  36.145  1.00 40.51  ? 230  GLY B C   1 
ATOM   5925 O O   . GLY B 1 230 ? 50.625 46.014  36.295  1.00 40.36  ? 230  GLY B O   1 
ATOM   5926 N N   . THR B 1 231 ? 52.576 47.142  36.290  1.00 41.21  ? 231  THR B N   1 
ATOM   5927 C CA  . THR B 1 231 ? 53.431 45.961  36.418  1.00 41.69  ? 231  THR B CA  1 
ATOM   5928 C C   . THR B 1 231 ? 54.632 46.305  37.263  1.00 42.04  ? 231  THR B C   1 
ATOM   5929 O O   . THR B 1 231 ? 55.049 47.457  37.279  1.00 42.05  ? 231  THR B O   1 
ATOM   5930 C CB  . THR B 1 231 ? 53.971 45.497  35.043  1.00 42.29  ? 231  THR B CB  1 
ATOM   5931 O OG1 . THR B 1 231 ? 54.497 46.624  34.336  1.00 43.18  ? 231  THR B OG1 1 
ATOM   5932 C CG2 . THR B 1 231 ? 52.881 44.855  34.205  1.00 42.19  ? 231  THR B CG2 1 
ATOM   5933 N N   . PRO B 1 232 ? 55.202 45.305  37.964  1.00 42.58  ? 232  PRO B N   1 
ATOM   5934 C CA  . PRO B 1 232 ? 56.418 45.572  38.731  1.00 43.22  ? 232  PRO B CA  1 
ATOM   5935 C C   . PRO B 1 232 ? 57.602 45.826  37.799  1.00 44.39  ? 232  PRO B C   1 
ATOM   5936 O O   . PRO B 1 232 ? 58.477 46.622  38.111  1.00 45.45  ? 232  PRO B O   1 
ATOM   5937 C CB  . PRO B 1 232 ? 56.618 44.287  39.542  1.00 43.52  ? 232  PRO B CB  1 
ATOM   5938 C CG  . PRO B 1 232 ? 55.891 43.226  38.785  1.00 43.03  ? 232  PRO B CG  1 
ATOM   5939 C CD  . PRO B 1 232 ? 54.753 43.903  38.092  1.00 42.54  ? 232  PRO B CD  1 
ATOM   5940 N N   . ASN B 1 233 ? 57.622 45.149  36.659  1.00 44.97  ? 233  ASN B N   1 
ATOM   5941 C CA  . ASN B 1 233 ? 58.614 45.413  35.623  1.00 46.00  ? 233  ASN B CA  1 
ATOM   5942 C C   . ASN B 1 233 ? 58.237 46.678  34.841  1.00 46.09  ? 233  ASN B C   1 
ATOM   5943 O O   . ASN B 1 233 ? 57.127 47.224  35.003  1.00 45.29  ? 233  ASN B O   1 
ATOM   5944 C CB  . ASN B 1 233 ? 58.747 44.195  34.685  1.00 46.39  ? 233  ASN B CB  1 
ATOM   5945 C CG  . ASN B 1 233 ? 57.422 43.808  34.025  1.00 46.03  ? 233  ASN B CG  1 
ATOM   5946 O OD1 . ASN B 1 233 ? 56.457 43.439  34.694  1.00 44.08  ? 233  ASN B OD1 1 
ATOM   5947 N ND2 . ASN B 1 233 ? 57.379 43.894  32.701  1.00 48.10  ? 233  ASN B ND2 1 
ATOM   5948 N N   . GLY B 1 234 ? 59.159 47.147  34.008  1.00 46.90  ? 234  GLY B N   1 
ATOM   5949 C CA  . GLY B 1 234 ? 58.923 48.336  33.200  1.00 47.58  ? 234  GLY B CA  1 
ATOM   5950 C C   . GLY B 1 234 ? 59.793 49.523  33.582  1.00 48.61  ? 234  GLY B C   1 
ATOM   5951 O O   . GLY B 1 234 ? 60.600 49.437  34.517  1.00 49.10  ? 234  GLY B O   1 
ATOM   5952 N N   . PRO B 1 235 ? 59.618 50.656  32.873  1.00 49.18  ? 235  PRO B N   1 
ATOM   5953 C CA  . PRO B 1 235 ? 60.525 51.811  33.003  1.00 49.79  ? 235  PRO B CA  1 
ATOM   5954 C C   . PRO B 1 235 ? 60.303 52.726  34.216  1.00 49.44  ? 235  PRO B C   1 
ATOM   5955 O O   . PRO B 1 235 ? 61.226 53.472  34.587  1.00 50.46  ? 235  PRO B O   1 
ATOM   5956 C CB  . PRO B 1 235 ? 60.281 52.603  31.709  1.00 50.52  ? 235  PRO B CB  1 
ATOM   5957 C CG  . PRO B 1 235 ? 59.150 51.912  30.978  1.00 49.72  ? 235  PRO B CG  1 
ATOM   5958 C CD  . PRO B 1 235 ? 58.545 50.899  31.891  1.00 48.66  ? 235  PRO B CD  1 
ATOM   5959 N N   . TRP B 1 236 ? 59.111 52.682  34.822  1.00 47.67  ? 236  TRP B N   1 
ATOM   5960 C CA  . TRP B 1 236 ? 58.727 53.690  35.830  1.00 46.83  ? 236  TRP B CA  1 
ATOM   5961 C C   . TRP B 1 236 ? 58.549 53.163  37.251  1.00 46.06  ? 236  TRP B C   1 
ATOM   5962 O O   . TRP B 1 236 ? 58.473 53.948  38.199  1.00 46.18  ? 236  TRP B O   1 
ATOM   5963 C CB  . TRP B 1 236 ? 57.452 54.412  35.400  1.00 46.17  ? 236  TRP B CB  1 
ATOM   5964 C CG  . TRP B 1 236 ? 56.309 53.478  35.180  1.00 45.30  ? 236  TRP B CG  1 
ATOM   5965 C CD1 . TRP B 1 236 ? 55.963 52.860  34.008  1.00 44.87  ? 236  TRP B CD1 1 
ATOM   5966 C CD2 . TRP B 1 236 ? 55.377 53.025  36.161  1.00 44.69  ? 236  TRP B CD2 1 
ATOM   5967 N NE1 . TRP B 1 236 ? 54.876 52.051  34.200  1.00 43.14  ? 236  TRP B NE1 1 
ATOM   5968 C CE2 . TRP B 1 236 ? 54.488 52.135  35.510  1.00 43.94  ? 236  TRP B CE2 1 
ATOM   5969 C CE3 . TRP B 1 236 ? 55.202 53.284  37.532  1.00 44.30  ? 236  TRP B CE3 1 
ATOM   5970 C CZ2 . TRP B 1 236 ? 53.424 51.511  36.179  1.00 44.01  ? 236  TRP B CZ2 1 
ATOM   5971 C CZ3 . TRP B 1 236 ? 54.152 52.660  38.205  1.00 43.24  ? 236  TRP B CZ3 1 
ATOM   5972 C CH2 . TRP B 1 236 ? 53.276 51.778  37.526  1.00 43.61  ? 236  TRP B CH2 1 
ATOM   5973 N N   . ALA B 1 237 ? 58.495 51.842  37.407  1.00 45.22  ? 237  ALA B N   1 
ATOM   5974 C CA  . ALA B 1 237 ? 58.039 51.248  38.675  1.00 44.22  ? 237  ALA B CA  1 
ATOM   5975 C C   . ALA B 1 237 ? 59.125 51.029  39.729  1.00 44.34  ? 237  ALA B C   1 
ATOM   5976 O O   . ALA B 1 237 ? 58.826 50.923  40.915  1.00 44.26  ? 237  ALA B O   1 
ATOM   5977 C CB  . ALA B 1 237 ? 57.253 49.961  38.424  1.00 43.26  ? 237  ALA B CB  1 
ATOM   5978 N N   . THR B 1 238 ? 60.378 50.966  39.300  1.00 44.77  ? 238  THR B N   1 
ATOM   5979 C CA  . THR B 1 238 ? 61.489 50.783  40.221  1.00 45.31  ? 238  THR B CA  1 
ATOM   5980 C C   . THR B 1 238 ? 62.662 51.665  39.837  1.00 47.03  ? 238  THR B C   1 
ATOM   5981 O O   . THR B 1 238 ? 62.770 52.099  38.693  1.00 47.75  ? 238  THR B O   1 
ATOM   5982 C CB  . THR B 1 238 ? 62.008 49.338  40.229  1.00 45.18  ? 238  THR B CB  1 
ATOM   5983 O OG1 . THR B 1 238 ? 62.246 48.916  38.881  1.00 44.94  ? 238  THR B OG1 1 
ATOM   5984 C CG2 . THR B 1 238 ? 61.023 48.425  40.883  1.00 43.36  ? 238  THR B CG2 1 
ATOM   5985 N N   . VAL B 1 239 ? 63.531 51.929  40.806  1.00 47.87  ? 239  VAL B N   1 
ATOM   5986 C CA  . VAL B 1 239 ? 64.840 52.493  40.523  1.00 49.75  ? 239  VAL B CA  1 
ATOM   5987 C C   . VAL B 1 239 ? 65.945 51.595  41.102  1.00 50.97  ? 239  VAL B C   1 
ATOM   5988 O O   . VAL B 1 239 ? 65.684 50.737  41.962  1.00 50.38  ? 239  VAL B O   1 
ATOM   5989 C CB  . VAL B 1 239 ? 64.975 53.974  41.014  1.00 50.61  ? 239  VAL B CB  1 
ATOM   5990 C CG1 . VAL B 1 239 ? 64.149 54.902  40.126  1.00 50.61  ? 239  VAL B CG1 1 
ATOM   5991 C CG2 . VAL B 1 239 ? 64.570 54.126  42.484  1.00 49.18  ? 239  VAL B CG2 1 
ATOM   5992 N N   . SER B 1 240 ? 67.168 51.779  40.612  1.00 52.54  ? 240  SER B N   1 
ATOM   5993 C CA  . SER B 1 240 ? 68.324 51.103  41.182  1.00 54.24  ? 240  SER B CA  1 
ATOM   5994 C C   . SER B 1 240 ? 68.642 51.745  42.529  1.00 54.86  ? 240  SER B C   1 
ATOM   5995 O O   . SER B 1 240 ? 68.187 52.857  42.807  1.00 54.53  ? 240  SER B O   1 
ATOM   5996 C CB  . SER B 1 240 ? 69.514 51.245  40.250  1.00 55.83  ? 240  SER B CB  1 
ATOM   5997 O OG  . SER B 1 240 ? 69.908 52.604  40.197  1.00 57.76  ? 240  SER B OG  1 
ATOM   5998 N N   . ALA B 1 241 ? 69.413 51.043  43.357  1.00 56.20  ? 241  ALA B N   1 
ATOM   5999 C CA  . ALA B 1 241 ? 69.871 51.579  44.643  1.00 57.43  ? 241  ALA B CA  1 
ATOM   6000 C C   . ALA B 1 241 ? 70.673 52.863  44.432  1.00 59.53  ? 241  ALA B C   1 
ATOM   6001 O O   . ALA B 1 241 ? 70.414 53.865  45.093  1.00 59.88  ? 241  ALA B O   1 
ATOM   6002 C CB  . ALA B 1 241 ? 70.692 50.545  45.406  1.00 58.19  ? 241  ALA B CB  1 
ATOM   6003 N N   . GLY B 1 242 ? 71.621 52.827  43.490  1.00 61.34  ? 242  GLY B N   1 
ATOM   6004 C CA  . GLY B 1 242 ? 72.425 53.989  43.118  1.00 63.30  ? 242  GLY B CA  1 
ATOM   6005 C C   . GLY B 1 242 ? 71.614 55.213  42.734  1.00 62.73  ? 242  GLY B C   1 
ATOM   6006 O O   . GLY B 1 242 ? 71.927 56.323  43.159  1.00 63.85  ? 242  GLY B O   1 
ATOM   6007 N N   . GLU B 1 243 ? 70.565 55.013  41.940  1.00 61.41  ? 243  GLU B N   1 
ATOM   6008 C CA  . GLU B 1 243 ? 69.699 56.122  41.515  1.00 60.90  ? 243  GLU B CA  1 
ATOM   6009 C C   . GLU B 1 243 ? 68.789 56.682  42.622  1.00 59.73  ? 243  GLU B C   1 
ATOM   6010 O O   . GLU B 1 243 ? 68.451 57.867  42.593  1.00 60.31  ? 243  GLU B O   1 
ATOM   6011 C CB  . GLU B 1 243 ? 68.893 55.748  40.261  1.00 59.71  ? 243  GLU B CB  1 
ATOM   6012 C CG  . GLU B 1 243 ? 67.862 56.803  39.784  1.00 59.46  ? 243  GLU B CG  1 
ATOM   6013 C CD  . GLU B 1 243 ? 68.489 58.052  39.160  1.00 60.86  ? 243  GLU B CD  1 
ATOM   6014 O OE1 . GLU B 1 243 ? 67.734 58.890  38.616  1.00 59.93  ? 243  GLU B OE1 1 
ATOM   6015 O OE2 . GLU B 1 243 ? 69.727 58.208  39.218  1.00 62.93  ? 243  GLU B OE2 1 
ATOM   6016 N N   . ALA B 1 244 ? 68.393 55.851  43.586  1.00 58.52  ? 244  ALA B N   1 
ATOM   6017 C CA  . ALA B 1 244 ? 67.595 56.340  44.733  1.00 57.37  ? 244  ALA B CA  1 
ATOM   6018 C C   . ALA B 1 244 ? 68.474 57.214  45.630  1.00 59.27  ? 244  ALA B C   1 
ATOM   6019 O O   . ALA B 1 244 ? 68.078 58.313  46.037  1.00 59.35  ? 244  ALA B O   1 
ATOM   6020 C CB  . ALA B 1 244 ? 67.013 55.194  45.519  1.00 55.89  ? 244  ALA B CB  1 
ATOM   6021 N N   . ARG B 1 245 ? 69.685 56.724  45.902  1.00 60.71  ? 245  ARG B N   1 
ATOM   6022 C CA  . ARG B 1 245 ? 70.645 57.446  46.705  1.00 62.54  ? 245  ARG B CA  1 
ATOM   6023 C C   . ARG B 1 245 ? 70.831 58.838  46.129  1.00 63.99  ? 245  ARG B C   1 
ATOM   6024 O O   . ARG B 1 245 ? 70.781 59.819  46.869  1.00 65.23  ? 245  ARG B O   1 
ATOM   6025 C CB  . ARG B 1 245 ? 71.974 56.697  46.774  1.00 64.34  ? 245  ARG B CB  1 
ATOM   6026 C CG  . ARG B 1 245 ? 73.068 57.442  47.550  1.00 65.98  ? 245  ARG B CG  1 
ATOM   6027 C CD  . ARG B 1 245 ? 74.172 56.507  48.020  1.00 66.48  ? 245  ARG B CD  1 
ATOM   6028 N NE  . ARG B 1 245 ? 73.753 55.661  49.135  1.00 64.97  ? 245  ARG B NE  1 
ATOM   6029 C CZ  . ARG B 1 245 ? 73.740 56.045  50.412  1.00 65.95  ? 245  ARG B CZ  1 
ATOM   6030 N NH1 . ARG B 1 245 ? 73.340 55.203  51.360  1.00 64.30  ? 245  ARG B NH1 1 
ATOM   6031 N NH2 . ARG B 1 245 ? 74.122 57.273  50.746  1.00 66.72  ? 245  ARG B NH2 1 
ATOM   6032 N N   . ARG B 1 246 ? 71.009 58.923  44.810  1.00 64.18  ? 246  ARG B N   1 
ATOM   6033 C CA  . ARG B 1 246 ? 71.217 60.201  44.120  1.00 65.19  ? 246  ARG B CA  1 
ATOM   6034 C C   . ARG B 1 246 ? 70.052 61.157  44.359  1.00 63.86  ? 246  ARG B C   1 
ATOM   6035 O O   . ARG B 1 246 ? 70.254 62.311  44.741  1.00 65.11  ? 246  ARG B O   1 
ATOM   6036 C CB  . ARG B 1 246 ? 71.393 59.974  42.616  1.00 65.55  ? 246  ARG B CB  1 
ATOM   6037 C CG  . ARG B 1 246 ? 72.136 61.074  41.883  1.00 68.29  ? 246  ARG B CG  1 
ATOM   6038 C CD  . ARG B 1 246 ? 71.737 61.113  40.407  1.00 70.36  ? 246  ARG B CD  1 
ATOM   6039 N NE  . ARG B 1 246 ? 70.855 62.243  40.117  1.00 72.08  ? 246  ARG B NE  1 
ATOM   6040 C CZ  . ARG B 1 246 ? 69.605 62.149  39.663  1.00 71.71  ? 246  ARG B CZ  1 
ATOM   6041 N NH1 . ARG B 1 246 ? 69.055 60.970  39.411  1.00 70.03  ? 246  ARG B NH1 1 
ATOM   6042 N NH2 . ARG B 1 246 ? 68.903 63.251  39.442  1.00 73.35  ? 246  ARG B NH2 1 
ATOM   6043 N N   . ARG B 1 247 ? 68.834 60.664  44.155  1.00 61.41  ? 247  ARG B N   1 
ATOM   6044 C CA  . ARG B 1 247 ? 67.643 61.507  44.257  1.00 60.41  ? 247  ARG B CA  1 
ATOM   6045 C C   . ARG B 1 247 ? 67.381 62.017  45.670  1.00 60.46  ? 247  ARG B C   1 
ATOM   6046 O O   . ARG B 1 247 ? 66.958 63.156  45.855  1.00 60.78  ? 247  ARG B O   1 
ATOM   6047 C CB  . ARG B 1 247 ? 66.420 60.763  43.729  1.00 58.18  ? 247  ARG B CB  1 
ATOM   6048 C CG  . ARG B 1 247 ? 66.563 60.318  42.289  1.00 57.99  ? 247  ARG B CG  1 
ATOM   6049 C CD  . ARG B 1 247 ? 65.244 59.881  41.729  1.00 56.85  ? 247  ARG B CD  1 
ATOM   6050 N NE  . ARG B 1 247 ? 65.409 59.259  40.424  1.00 58.66  ? 247  ARG B NE  1 
ATOM   6051 C CZ  . ARG B 1 247 ? 64.412 58.778  39.690  1.00 58.56  ? 247  ARG B CZ  1 
ATOM   6052 N NH1 . ARG B 1 247 ? 63.154 58.844  40.133  1.00 57.69  ? 247  ARG B NH1 1 
ATOM   6053 N NH2 . ARG B 1 247 ? 64.676 58.229  38.510  1.00 58.34  ? 247  ARG B NH2 1 
ATOM   6054 N N   . ALA B 1 248 ? 67.637 61.164  46.660  1.00 60.36  ? 248  ALA B N   1 
ATOM   6055 C CA  . ALA B 1 248 ? 67.382 61.493  48.053  1.00 60.31  ? 248  ALA B CA  1 
ATOM   6056 C C   . ALA B 1 248 ? 68.373 62.533  48.513  1.00 62.99  ? 248  ALA B C   1 
ATOM   6057 O O   . ALA B 1 248 ? 67.991 63.491  49.194  1.00 63.74  ? 248  ALA B O   1 
ATOM   6058 C CB  . ALA B 1 248 ? 67.470 60.260  48.916  1.00 59.58  ? 248  ALA B CB  1 
ATOM   6059 N N   . THR B 1 249 ? 69.643 62.358  48.136  1.00 64.64  ? 249  THR B N   1 
ATOM   6060 C CA  . THR B 1 249 ? 70.653 63.356  48.473  1.00 67.18  ? 249  THR B CA  1 
ATOM   6061 C C   . THR B 1 249 ? 70.476 64.661  47.687  1.00 68.45  ? 249  THR B C   1 
ATOM   6062 O O   . THR B 1 249 ? 70.799 65.739  48.202  1.00 70.65  ? 249  THR B O   1 
ATOM   6063 C CB  . THR B 1 249 ? 72.134 62.815  48.468  1.00 69.12  ? 249  THR B CB  1 
ATOM   6064 O OG1 . THR B 1 249 ? 72.984 63.709  47.741  1.00 70.19  ? 249  THR B OG1 1 
ATOM   6065 C CG2 . THR B 1 249 ? 72.238 61.441  47.871  1.00 67.06  ? 249  THR B CG2 1 
ATOM   6066 N N   . LEU B 1 250 ? 69.947 64.579  46.468  1.00 67.46  ? 250  LEU B N   1 
ATOM   6067 C CA  . LEU B 1 250 ? 69.638 65.793  45.710  1.00 68.56  ? 250  LEU B CA  1 
ATOM   6068 C C   . LEU B 1 250 ? 68.506 66.574  46.378  1.00 68.29  ? 250  LEU B C   1 
ATOM   6069 O O   . LEU B 1 250 ? 68.608 67.796  46.558  1.00 69.93  ? 250  LEU B O   1 
ATOM   6070 C CB  . LEU B 1 250 ? 69.303 65.489  44.242  1.00 67.68  ? 250  LEU B CB  1 
ATOM   6071 C CG  . LEU B 1 250 ? 68.932 66.679  43.334  1.00 68.76  ? 250  LEU B CG  1 
ATOM   6072 C CD1 . LEU B 1 250 ? 69.964 67.816  43.397  1.00 70.53  ? 250  LEU B CD1 1 
ATOM   6073 C CD2 . LEU B 1 250 ? 68.687 66.248  41.886  1.00 67.49  ? 250  LEU B CD2 1 
ATOM   6074 N N   . LEU B 1 251 ? 67.442 65.870  46.757  1.00 66.38  ? 251  LEU B N   1 
ATOM   6075 C CA  . LEU B 1 251 ? 66.308 66.507  47.422  1.00 66.22  ? 251  LEU B CA  1 
ATOM   6076 C C   . LEU B 1 251 ? 66.759 67.156  48.721  1.00 68.14  ? 251  LEU B C   1 
ATOM   6077 O O   . LEU B 1 251 ? 66.325 68.262  49.048  1.00 69.36  ? 251  LEU B O   1 
ATOM   6078 C CB  . LEU B 1 251 ? 65.179 65.510  47.690  1.00 63.57  ? 251  LEU B CB  1 
ATOM   6079 C CG  . LEU B 1 251 ? 63.949 66.142  48.342  1.00 63.08  ? 251  LEU B CG  1 
ATOM   6080 C CD1 . LEU B 1 251 ? 62.969 66.655  47.293  1.00 62.02  ? 251  LEU B CD1 1 
ATOM   6081 C CD2 . LEU B 1 251 ? 63.282 65.152  49.260  1.00 61.47  ? 251  LEU B CD2 1 
ATOM   6082 N N   . ALA B 1 252 ? 67.650 66.473  49.440  1.00 69.10  ? 252  ALA B N   1 
ATOM   6083 C CA  . ALA B 1 252 ? 68.195 66.982  50.698  1.00 70.89  ? 252  ALA B CA  1 
ATOM   6084 C C   . ALA B 1 252 ? 68.982 68.263  50.491  1.00 73.89  ? 252  ALA B C   1 
ATOM   6085 O O   . ALA B 1 252 ? 68.939 69.144  51.339  1.00 75.19  ? 252  ALA B O   1 
ATOM   6086 C CB  . ALA B 1 252 ? 69.053 65.940  51.370  1.00 71.00  ? 252  ALA B CB  1 
ATOM   6087 N N   . ARG B 1 253 ? 69.693 68.368  49.368  1.00 75.67  ? 253  ARG B N   1 
ATOM   6088 C CA  . ARG B 1 253 ? 70.424 69.600  49.034  1.00 79.15  ? 253  ARG B CA  1 
ATOM   6089 C C   . ARG B 1 253 ? 69.427 70.732  48.790  1.00 79.15  ? 253  ARG B C   1 
ATOM   6090 O O   . ARG B 1 253 ? 69.634 71.854  49.241  1.00 80.90  ? 253  ARG B O   1 
ATOM   6091 C CB  . ARG B 1 253 ? 71.334 69.410  47.810  1.00 80.45  ? 253  ARG B CB  1 
ATOM   6092 C CG  . ARG B 1 253 ? 72.509 70.383  47.749  1.00 85.94  ? 253  ARG B CG  1 
ATOM   6093 C CD  . ARG B 1 253 ? 73.146 70.483  46.350  1.00 90.98  ? 253  ARG B CD  1 
ATOM   6094 N NE  . ARG B 1 253 ? 72.519 71.503  45.494  1.00 93.55  ? 253  ARG B NE  1 
ATOM   6095 C CZ  . ARG B 1 253 ? 72.077 71.298  44.249  1.00 92.78  ? 253  ARG B CZ  1 
ATOM   6096 N NH1 . ARG B 1 253 ? 72.198 70.106  43.670  1.00 91.49  ? 253  ARG B NH1 1 
ATOM   6097 N NH2 . ARG B 1 253 ? 71.524 72.298  43.571  1.00 92.93  ? 253  ARG B NH2 1 
ATOM   6098 N N   . LEU B 1 254 ? 68.329 70.413  48.104  1.00 77.34  ? 254  LEU B N   1 
ATOM   6099 C CA  . LEU B 1 254 ? 67.298 71.396  47.765  1.00 77.58  ? 254  LEU B CA  1 
ATOM   6100 C C   . LEU B 1 254 ? 66.555 71.971  48.976  1.00 77.78  ? 254  LEU B C   1 
ATOM   6101 O O   . LEU B 1 254 ? 66.055 73.094  48.916  1.00 78.64  ? 254  LEU B O   1 
ATOM   6102 C CB  . LEU B 1 254 ? 66.299 70.806  46.767  1.00 75.34  ? 254  LEU B CB  1 
ATOM   6103 C CG  . LEU B 1 254 ? 66.778 70.523  45.339  1.00 76.02  ? 254  LEU B CG  1 
ATOM   6104 C CD1 . LEU B 1 254 ? 65.750 69.662  44.604  1.00 73.48  ? 254  LEU B CD1 1 
ATOM   6105 C CD2 . LEU B 1 254 ? 67.078 71.818  44.563  1.00 78.30  ? 254  LEU B CD2 1 
ATOM   6106 N N   . VAL B 1 255 ? 66.479 71.205  50.063  1.00 77.05  ? 255  VAL B N   1 
ATOM   6107 C CA  . VAL B 1 255 ? 65.842 71.698  51.292  1.00 77.68  ? 255  VAL B CA  1 
ATOM   6108 C C   . VAL B 1 255 ? 66.839 72.041  52.416  1.00 80.28  ? 255  VAL B C   1 
ATOM   6109 O O   . VAL B 1 255 ? 66.444 72.210  53.575  1.00 80.67  ? 255  VAL B O   1 
ATOM   6110 C CB  . VAL B 1 255 ? 64.689 70.772  51.795  1.00 75.00  ? 255  VAL B CB  1 
ATOM   6111 C CG1 . VAL B 1 255 ? 63.548 70.740  50.783  1.00 73.32  ? 255  VAL B CG1 1 
ATOM   6112 C CG2 . VAL B 1 255 ? 65.182 69.363  52.095  1.00 73.42  ? 255  VAL B CG2 1 
ATOM   6113 N N   . GLY B 1 256 ? 68.120 72.146  52.061  1.00 82.57  ? 256  GLY B N   1 
ATOM   6114 C CA  . GLY B 1 256 ? 69.162 72.637  52.970  1.00 85.77  ? 256  GLY B CA  1 
ATOM   6115 C C   . GLY B 1 256 ? 69.882 71.640  53.870  1.00 86.20  ? 256  GLY B C   1 
ATOM   6116 O O   . GLY B 1 256 ? 70.593 72.044  54.786  1.00 88.28  ? 256  GLY B O   1 
ATOM   6117 N N   . CYS B 1 257 ? 69.718 70.345  53.613  1.00 84.69  ? 257  CYS B N   1 
ATOM   6118 C CA  . CYS B 1 257 ? 70.342 69.303  54.439  1.00 85.21  ? 257  CYS B CA  1 
ATOM   6119 C C   . CYS B 1 257 ? 71.672 68.778  53.865  1.00 87.48  ? 257  CYS B C   1 
ATOM   6120 O O   . CYS B 1 257 ? 71.813 68.659  52.641  1.00 87.53  ? 257  CYS B O   1 
ATOM   6121 C CB  . CYS B 1 257 ? 69.360 68.153  54.661  1.00 81.73  ? 257  CYS B CB  1 
ATOM   6122 S SG  . CYS B 1 257 ? 67.919 68.605  55.675  1.00 80.35  ? 257  CYS B SG  1 
ATOM   6123 N N   . PRO B 1 258 ? 72.645 68.436  54.746  1.00 89.72  ? 258  PRO B N   1 
ATOM   6124 C CA  . PRO B 1 258 ? 72.566 68.437  56.212  1.00 90.48  ? 258  PRO B CA  1 
ATOM   6125 C C   . PRO B 1 258 ? 73.060 69.742  56.854  1.00 93.66  ? 258  PRO B C   1 
ATOM   6126 O O   . PRO B 1 258 ? 73.276 70.742  56.159  1.00 95.43  ? 258  PRO B O   1 
ATOM   6127 C CB  . PRO B 1 258 ? 73.478 67.263  56.611  1.00 90.70  ? 258  PRO B CB  1 
ATOM   6128 C CG  . PRO B 1 258 ? 74.365 66.995  55.393  1.00 91.66  ? 258  PRO B CG  1 
ATOM   6129 C CD  . PRO B 1 258 ? 73.971 67.970  54.299  1.00 91.50  ? 258  PRO B CD  1 
ATOM   6130 N N   . ASN B 1 265 ? 77.416 61.293  55.469  1.00 88.70  ? 265  ASN B N   1 
ATOM   6131 C CA  . ASN B 1 265 ? 76.938 60.512  56.606  1.00 87.97  ? 265  ASN B CA  1 
ATOM   6132 C C   . ASN B 1 265 ? 75.403 60.456  56.632  1.00 84.83  ? 265  ASN B C   1 
ATOM   6133 O O   . ASN B 1 265 ? 74.740 61.439  56.989  1.00 84.40  ? 265  ASN B O   1 
ATOM   6134 C CB  . ASN B 1 265 ? 77.501 61.087  57.918  1.00 90.24  ? 265  ASN B CB  1 
ATOM   6135 C CG  . ASN B 1 265 ? 77.217 60.205  59.133  1.00 89.94  ? 265  ASN B CG  1 
ATOM   6136 O OD1 . ASN B 1 265 ? 76.130 59.639  59.273  1.00 87.36  ? 265  ASN B OD1 1 
ATOM   6137 N ND2 . ASN B 1 265 ? 78.196 60.109  60.035  1.00 92.72  ? 265  ASN B ND2 1 
ATOM   6138 N N   . ASP B 1 266 ? 74.857 59.295  56.264  1.00 82.70  ? 266  ASP B N   1 
ATOM   6139 C CA  . ASP B 1 266 ? 73.404 59.090  56.144  1.00 79.64  ? 266  ASP B CA  1 
ATOM   6140 C C   . ASP B 1 266 ? 72.594 59.514  57.369  1.00 78.94  ? 266  ASP B C   1 
ATOM   6141 O O   . ASP B 1 266 ? 71.542 60.148  57.232  1.00 77.50  ? 266  ASP B O   1 
ATOM   6142 C CB  . ASP B 1 266 ? 73.091 57.630  55.798  1.00 78.21  ? 266  ASP B CB  1 
ATOM   6143 C CG  . ASP B 1 266 ? 73.521 57.254  54.389  1.00 78.87  ? 266  ASP B CG  1 
ATOM   6144 O OD1 . ASP B 1 266 ? 73.855 58.159  53.589  1.00 80.61  ? 266  ASP B OD1 1 
ATOM   6145 O OD2 . ASP B 1 266 ? 73.526 56.044  54.082  1.00 78.35  ? 266  ASP B OD2 1 
ATOM   6146 N N   . THR B 1 267 ? 73.086 59.158  58.556  1.00 79.99  ? 267  THR B N   1 
ATOM   6147 C CA  . THR B 1 267 ? 72.441 59.519  59.818  1.00 79.42  ? 267  THR B CA  1 
ATOM   6148 C C   . THR B 1 267 ? 72.219 61.030  59.907  1.00 79.88  ? 267  THR B C   1 
ATOM   6149 O O   . THR B 1 267 ? 71.091 61.477  60.138  1.00 78.52  ? 267  THR B O   1 
ATOM   6150 C CB  . THR B 1 267 ? 73.254 59.003  61.028  1.00 81.54  ? 267  THR B CB  1 
ATOM   6151 O OG1 . THR B 1 267 ? 73.383 57.581  60.930  1.00 80.97  ? 267  THR B OG1 1 
ATOM   6152 C CG2 . THR B 1 267 ? 72.577 59.357  62.361  1.00 81.18  ? 267  THR B CG2 1 
ATOM   6153 N N   . GLU B 1 268 ? 73.290 61.800  59.702  1.00 81.87  ? 268  GLU B N   1 
ATOM   6154 C CA  . GLU B 1 268 ? 73.219 63.265  59.686  1.00 82.80  ? 268  GLU B CA  1 
ATOM   6155 C C   . GLU B 1 268 ? 72.161 63.774  58.699  1.00 79.98  ? 268  GLU B C   1 
ATOM   6156 O O   . GLU B 1 268 ? 71.295 64.574  59.068  1.00 79.51  ? 268  GLU B O   1 
ATOM   6157 C CB  . GLU B 1 268 ? 74.590 63.884  59.359  1.00 85.60  ? 268  GLU B CB  1 
ATOM   6158 C CG  . GLU B 1 268 ? 75.545 64.013  60.552  1.00 89.12  ? 268  GLU B CG  1 
ATOM   6159 C CD  . GLU B 1 268 ? 76.893 64.679  60.194  1.00 92.67  ? 268  GLU B CD  1 
ATOM   6160 O OE1 . GLU B 1 268 ? 77.501 65.307  61.097  1.00 95.95  ? 268  GLU B OE1 1 
ATOM   6161 O OE2 . GLU B 1 268 ? 77.349 64.578  59.021  1.00 93.60  ? 268  GLU B OE2 1 
ATOM   6162 N N   . LEU B 1 269 ? 72.232 63.289  57.458  1.00 78.15  ? 269  LEU B N   1 
ATOM   6163 C CA  . LEU B 1 269 ? 71.354 63.737  56.380  1.00 75.70  ? 269  LEU B CA  1 
ATOM   6164 C C   . LEU B 1 269 ? 69.882 63.450  56.684  1.00 72.97  ? 269  LEU B C   1 
ATOM   6165 O O   . LEU B 1 269 ? 69.040 64.343  56.563  1.00 72.40  ? 269  LEU B O   1 
ATOM   6166 C CB  . LEU B 1 269 ? 71.778 63.112  55.043  1.00 75.06  ? 269  LEU B CB  1 
ATOM   6167 C CG  . LEU B 1 269 ? 71.170 63.643  53.739  1.00 73.86  ? 269  LEU B CG  1 
ATOM   6168 C CD1 . LEU B 1 269 ? 72.098 63.370  52.579  1.00 75.23  ? 269  LEU B CD1 1 
ATOM   6169 C CD2 . LEU B 1 269 ? 69.809 63.023  53.456  1.00 71.83  ? 269  LEU B CD2 1 
ATOM   6170 N N   . ILE B 1 270 ? 69.582 62.214  57.085  1.00 71.06  ? 270  ILE B N   1 
ATOM   6171 C CA  . ILE B 1 270 ? 68.207 61.816  57.370  1.00 68.54  ? 270  ILE B CA  1 
ATOM   6172 C C   . ILE B 1 270 ? 67.650 62.527  58.611  1.00 68.84  ? 270  ILE B C   1 
ATOM   6173 O O   . ILE B 1 270 ? 66.465 62.898  58.633  1.00 67.62  ? 270  ILE B O   1 
ATOM   6174 C CB  . ILE B 1 270 ? 68.054 60.274  57.457  1.00 67.40  ? 270  ILE B CB  1 
ATOM   6175 C CG1 . ILE B 1 270 ? 68.367 59.649  56.094  1.00 67.22  ? 270  ILE B CG1 1 
ATOM   6176 C CG2 . ILE B 1 270 ? 66.631 59.877  57.845  1.00 65.03  ? 270  ILE B CG2 1 
ATOM   6177 C CD1 . ILE B 1 270 ? 69.064 58.309  56.162  1.00 67.52  ? 270  ILE B CD1 1 
ATOM   6178 N N   . ALA B 1 271 ? 68.497 62.743  59.619  1.00 70.21  ? 271  ALA B N   1 
ATOM   6179 C CA  . ALA B 1 271 ? 68.075 63.482  60.811  1.00 70.77  ? 271  ALA B CA  1 
ATOM   6180 C C   . ALA B 1 271 ? 67.612 64.893  60.465  1.00 70.87  ? 271  ALA B C   1 
ATOM   6181 O O   . ALA B 1 271 ? 66.652 65.391  61.048  1.00 69.94  ? 271  ALA B O   1 
ATOM   6182 C CB  . ALA B 1 271 ? 69.179 63.518  61.862  1.00 73.04  ? 271  ALA B CB  1 
ATOM   6183 N N   . CYS B 1 272 ? 68.293 65.524  59.511  1.00 72.34  ? 272  CYS B N   1 
ATOM   6184 C CA  . CYS B 1 272 ? 67.944 66.884  59.083  1.00 73.03  ? 272  CYS B CA  1 
ATOM   6185 C C   . CYS B 1 272 ? 66.656 66.897  58.255  1.00 70.41  ? 272  CYS B C   1 
ATOM   6186 O O   . CYS B 1 272 ? 65.831 67.800  58.401  1.00 70.57  ? 272  CYS B O   1 
ATOM   6187 C CB  . CYS B 1 272 ? 69.107 67.557  58.334  1.00 75.44  ? 272  CYS B CB  1 
ATOM   6188 S SG  . CYS B 1 272 ? 68.718 69.157  57.516  1.00 77.66  ? 272  CYS B SG  1 
ATOM   6189 N N   . LEU B 1 273 ? 66.487 65.893  57.396  1.00 68.04  ? 273  LEU B N   1 
ATOM   6190 C CA  . LEU B 1 273 ? 65.247 65.722  56.647  1.00 65.36  ? 273  LEU B CA  1 
ATOM   6191 C C   . LEU B 1 273 ? 64.040 65.558  57.567  1.00 64.16  ? 273  LEU B C   1 
ATOM   6192 O O   . LEU B 1 273 ? 62.942 66.019  57.246  1.00 63.37  ? 273  LEU B O   1 
ATOM   6193 C CB  . LEU B 1 273 ? 65.343 64.530  55.691  1.00 63.73  ? 273  LEU B CB  1 
ATOM   6194 C CG  . LEU B 1 273 ? 65.988 64.757  54.326  1.00 63.60  ? 273  LEU B CG  1 
ATOM   6195 C CD1 . LEU B 1 273 ? 65.889 63.502  53.498  1.00 61.53  ? 273  LEU B CD1 1 
ATOM   6196 C CD2 . LEU B 1 273 ? 65.351 65.926  53.587  1.00 63.61  ? 273  LEU B CD2 1 
ATOM   6197 N N   . ARG B 1 274 ? 64.247 64.911  58.711  1.00 64.09  ? 274  ARG B N   1 
ATOM   6198 C CA  . ARG B 1 274 ? 63.167 64.714  59.684  1.00 63.16  ? 274  ARG B CA  1 
ATOM   6199 C C   . ARG B 1 274 ? 62.675 66.006  60.351  1.00 64.04  ? 274  ARG B C   1 
ATOM   6200 O O   . ARG B 1 274 ? 61.523 66.093  60.771  1.00 63.28  ? 274  ARG B O   1 
ATOM   6201 C CB  . ARG B 1 274 ? 63.547 63.649  60.716  1.00 63.10  ? 274  ARG B CB  1 
ATOM   6202 C CG  . ARG B 1 274 ? 63.527 62.239  60.129  1.00 62.56  ? 274  ARG B CG  1 
ATOM   6203 C CD  . ARG B 1 274 ? 63.440 61.185  61.202  1.00 64.05  ? 274  ARG B CD  1 
ATOM   6204 N NE  . ARG B 1 274 ? 64.599 61.235  62.091  1.00 67.72  ? 274  ARG B NE  1 
ATOM   6205 C CZ  . ARG B 1 274 ? 65.494 60.258  62.214  1.00 69.52  ? 274  ARG B CZ  1 
ATOM   6206 N NH1 . ARG B 1 274 ? 65.366 59.127  61.508  1.00 68.19  ? 274  ARG B NH1 1 
ATOM   6207 N NH2 . ARG B 1 274 ? 66.514 60.409  63.052  1.00 70.99  ? 274  ARG B NH2 1 
ATOM   6208 N N   . THR B 1 275 ? 63.534 67.016  60.420  1.00 65.97  ? 275  THR B N   1 
ATOM   6209 C CA  . THR B 1 275 ? 63.140 68.318  60.976  1.00 67.35  ? 275  THR B CA  1 
ATOM   6210 C C   . THR B 1 275 ? 62.281 69.147  60.011  1.00 66.97  ? 275  THR B C   1 
ATOM   6211 O O   . THR B 1 275 ? 61.678 70.135  60.410  1.00 68.00  ? 275  THR B O   1 
ATOM   6212 C CB  . THR B 1 275 ? 64.364 69.164  61.392  1.00 69.84  ? 275  THR B CB  1 
ATOM   6213 O OG1 . THR B 1 275 ? 65.093 69.565  60.224  1.00 70.04  ? 275  THR B OG1 1 
ATOM   6214 C CG2 . THR B 1 275 ? 65.278 68.379  62.341  1.00 70.51  ? 275  THR B CG2 1 
ATOM   6215 N N   . ARG B 1 276 ? 62.228 68.741  58.747  1.00 65.84  ? 276  ARG B N   1 
ATOM   6216 C CA  . ARG B 1 276 ? 61.531 69.514  57.732  1.00 65.65  ? 276  ARG B CA  1 
ATOM   6217 C C   . ARG B 1 276 ? 60.021 69.279  57.726  1.00 64.03  ? 276  ARG B C   1 
ATOM   6218 O O   . ARG B 1 276 ? 59.569 68.125  57.743  1.00 62.14  ? 276  ARG B O   1 
ATOM   6219 C CB  . ARG B 1 276 ? 62.121 69.232  56.347  1.00 65.08  ? 276  ARG B CB  1 
ATOM   6220 C CG  . ARG B 1 276 ? 63.504 69.818  56.125  1.00 68.31  ? 276  ARG B CG  1 
ATOM   6221 C CD  . ARG B 1 276 ? 63.498 71.353  56.209  1.00 72.06  ? 276  ARG B CD  1 
ATOM   6222 N NE  . ARG B 1 276 ? 64.831 71.906  56.020  1.00 76.05  ? 276  ARG B NE  1 
ATOM   6223 C CZ  . ARG B 1 276 ? 65.733 72.046  56.990  1.00 79.32  ? 276  ARG B CZ  1 
ATOM   6224 N NH1 . ARG B 1 276 ? 65.450 71.666  58.232  1.00 79.10  ? 276  ARG B NH1 1 
ATOM   6225 N NH2 . ARG B 1 276 ? 66.927 72.561  56.716  1.00 81.16  ? 276  ARG B NH2 1 
ATOM   6226 N N   . PRO B 1 277 ? 59.236 70.373  57.719  1.00 64.70  ? 277  PRO B N   1 
ATOM   6227 C CA  . PRO B 1 277 ? 57.800 70.309  57.446  1.00 63.50  ? 277  PRO B CA  1 
ATOM   6228 C C   . PRO B 1 277 ? 57.503 69.499  56.191  1.00 61.75  ? 277  PRO B C   1 
ATOM   6229 O O   . PRO B 1 277 ? 58.244 69.580  55.219  1.00 62.13  ? 277  PRO B O   1 
ATOM   6230 C CB  . PRO B 1 277 ? 57.419 71.773  57.215  1.00 65.30  ? 277  PRO B CB  1 
ATOM   6231 C CG  . PRO B 1 277 ? 58.406 72.550  58.026  1.00 67.53  ? 277  PRO B CG  1 
ATOM   6232 C CD  . PRO B 1 277 ? 59.683 71.747  58.019  1.00 67.26  ? 277  PRO B CD  1 
ATOM   6233 N N   . ALA B 1 278 ? 56.420 68.728  56.227  1.00 60.40  ? 278  ALA B N   1 
ATOM   6234 C CA  . ALA B 1 278 ? 55.995 67.888  55.109  1.00 58.73  ? 278  ALA B CA  1 
ATOM   6235 C C   . ALA B 1 278 ? 56.009 68.614  53.757  1.00 59.46  ? 278  ALA B C   1 
ATOM   6236 O O   . ALA B 1 278 ? 56.599 68.119  52.789  1.00 58.69  ? 278  ALA B O   1 
ATOM   6237 C CB  . ALA B 1 278 ? 54.621 67.299  55.393  1.00 57.09  ? 278  ALA B CB  1 
ATOM   6238 N N   . GLN B 1 279 ? 55.387 69.795  53.704  1.00 61.23  ? 279  GLN B N   1 
ATOM   6239 C CA  . GLN B 1 279 ? 55.229 70.546  52.444  1.00 62.11  ? 279  GLN B CA  1 
ATOM   6240 C C   . GLN B 1 279 ? 56.563 71.007  51.855  1.00 63.60  ? 279  GLN B C   1 
ATOM   6241 O O   . GLN B 1 279 ? 56.680 71.141  50.638  1.00 63.80  ? 279  GLN B O   1 
ATOM   6242 C CB  . GLN B 1 279 ? 54.237 71.711  52.603  1.00 63.38  ? 279  GLN B CB  1 
ATOM   6243 C CG  . GLN B 1 279 ? 53.714 72.309  51.291  1.00 63.85  ? 279  GLN B CG  1 
ATOM   6244 C CD  . GLN B 1 279 ? 53.110 71.282  50.342  1.00 62.88  ? 279  GLN B CD  1 
ATOM   6245 O OE1 . GLN B 1 279 ? 52.297 70.443  50.734  1.00 61.46  ? 279  GLN B OE1 1 
ATOM   6246 N NE2 . GLN B 1 279 ? 53.503 71.355  49.078  1.00 63.37  ? 279  GLN B NE2 1 
ATOM   6247 N N   . ASP B 1 280 ? 57.562 71.230  52.713  1.00 65.05  ? 280  ASP B N   1 
ATOM   6248 C CA  . ASP B 1 280 ? 58.930 71.514  52.258  1.00 66.92  ? 280  ASP B CA  1 
ATOM   6249 C C   . ASP B 1 280 ? 59.452 70.389  51.345  1.00 65.68  ? 280  ASP B C   1 
ATOM   6250 O O   . ASP B 1 280 ? 60.033 70.665  50.295  1.00 66.57  ? 280  ASP B O   1 
ATOM   6251 C CB  . ASP B 1 280 ? 59.894 71.704  53.440  1.00 68.23  ? 280  ASP B CB  1 
ATOM   6252 C CG  . ASP B 1 280 ? 59.759 73.064  54.121  1.00 71.10  ? 280  ASP B CG  1 
ATOM   6253 O OD1 . ASP B 1 280 ? 58.658 73.662  54.116  1.00 72.50  ? 280  ASP B OD1 1 
ATOM   6254 O OD2 . ASP B 1 280 ? 60.772 73.527  54.692  1.00 72.98  ? 280  ASP B OD2 1 
ATOM   6255 N N   . LEU B 1 281 ? 59.235 69.133  51.744  1.00 63.87  ? 281  LEU B N   1 
ATOM   6256 C CA  . LEU B 1 281 ? 59.673 67.973  50.952  1.00 62.46  ? 281  LEU B CA  1 
ATOM   6257 C C   . LEU B 1 281 ? 58.902 67.859  49.637  1.00 61.41  ? 281  LEU B C   1 
ATOM   6258 O O   . LEU B 1 281 ? 59.504 67.762  48.573  1.00 61.70  ? 281  LEU B O   1 
ATOM   6259 C CB  . LEU B 1 281 ? 59.586 66.669  51.762  1.00 60.82  ? 281  LEU B CB  1 
ATOM   6260 C CG  . LEU B 1 281 ? 60.325 66.624  53.111  1.00 61.72  ? 281  LEU B CG  1 
ATOM   6261 C CD1 . LEU B 1 281 ? 60.082 65.302  53.812  1.00 60.80  ? 281  LEU B CD1 1 
ATOM   6262 C CD2 . LEU B 1 281 ? 61.808 66.855  52.954  1.00 62.43  ? 281  LEU B CD2 1 
ATOM   6263 N N   . VAL B 1 282 ? 57.575 67.903  49.718  1.00 60.45  ? 282  VAL B N   1 
ATOM   6264 C CA  . VAL B 1 282 ? 56.709 67.853  48.536  1.00 59.65  ? 282  VAL B CA  1 
ATOM   6265 C C   . VAL B 1 282 ? 57.017 68.983  47.532  1.00 61.61  ? 282  VAL B C   1 
ATOM   6266 O O   . VAL B 1 282 ? 57.017 68.753  46.323  1.00 60.94  ? 282  VAL B O   1 
ATOM   6267 C CB  . VAL B 1 282 ? 55.204 67.854  48.948  1.00 58.89  ? 282  VAL B CB  1 
ATOM   6268 C CG1 . VAL B 1 282 ? 54.291 68.034  47.746  1.00 58.59  ? 282  VAL B CG1 1 
ATOM   6269 C CG2 . VAL B 1 282 ? 54.849 66.567  49.680  1.00 56.27  ? 282  VAL B CG2 1 
ATOM   6270 N N   . ASP B 1 283 ? 57.285 70.191  48.042  1.00 63.98  ? 283  ASP B N   1 
ATOM   6271 C CA  . ASP B 1 283 ? 57.670 71.349  47.215  1.00 66.34  ? 283  ASP B CA  1 
ATOM   6272 C C   . ASP B 1 283 ? 58.733 71.037  46.151  1.00 67.01  ? 283  ASP B C   1 
ATOM   6273 O O   . ASP B 1 283 ? 58.660 71.544  45.029  1.00 67.82  ? 283  ASP B O   1 
ATOM   6274 C CB  . ASP B 1 283 ? 58.204 72.490  48.093  1.00 68.51  ? 283  ASP B CB  1 
ATOM   6275 C CG  . ASP B 1 283 ? 57.119 73.450  48.567  1.00 69.18  ? 283  ASP B CG  1 
ATOM   6276 O OD1 . ASP B 1 283 ? 55.934 73.288  48.199  1.00 67.83  ? 283  ASP B OD1 1 
ATOM   6277 O OD2 . ASP B 1 283 ? 57.472 74.379  49.325  1.00 70.20  ? 283  ASP B OD2 1 
ATOM   6278 N N   . HIS B 1 284 ? 59.723 70.221  46.515  1.00 66.88  ? 284  HIS B N   1 
ATOM   6279 C CA  . HIS B 1 284 ? 60.861 69.951  45.638  1.00 67.99  ? 284  HIS B CA  1 
ATOM   6280 C C   . HIS B 1 284 ? 60.857 68.534  45.037  1.00 66.48  ? 284  HIS B C   1 
ATOM   6281 O O   . HIS B 1 284 ? 61.761 68.158  44.286  1.00 66.92  ? 284  HIS B O   1 
ATOM   6282 C CB  . HIS B 1 284 ? 62.167 70.243  46.381  1.00 69.56  ? 284  HIS B CB  1 
ATOM   6283 C CG  . HIS B 1 284 ? 62.358 71.691  46.709  1.00 72.33  ? 284  HIS B CG  1 
ATOM   6284 N ND1 . HIS B 1 284 ? 62.874 72.598  45.805  1.00 74.22  ? 284  HIS B ND1 1 
ATOM   6285 C CD2 . HIS B 1 284 ? 62.090 72.392  47.835  1.00 72.79  ? 284  HIS B CD2 1 
ATOM   6286 C CE1 . HIS B 1 284 ? 62.919 73.795  46.363  1.00 75.76  ? 284  HIS B CE1 1 
ATOM   6287 N NE2 . HIS B 1 284 ? 62.453 73.696  47.595  1.00 75.57  ? 284  HIS B NE2 1 
ATOM   6288 N N   . GLU B 1 285 ? 59.815 67.773  45.349  1.00 65.11  ? 285  GLU B N   1 
ATOM   6289 C CA  . GLU B 1 285 ? 59.687 66.378  44.949  1.00 63.87  ? 285  GLU B CA  1 
ATOM   6290 C C   . GLU B 1 285 ? 59.937 66.150  43.458  1.00 64.46  ? 285  GLU B C   1 
ATOM   6291 O O   . GLU B 1 285 ? 60.543 65.150  43.065  1.00 63.52  ? 285  GLU B O   1 
ATOM   6292 C CB  . GLU B 1 285 ? 58.284 65.910  45.299  1.00 62.35  ? 285  GLU B CB  1 
ATOM   6293 C CG  . GLU B 1 285 ? 58.124 64.434  45.383  1.00 61.16  ? 285  GLU B CG  1 
ATOM   6294 C CD  . GLU B 1 285 ? 56.705 64.037  45.644  1.00 60.75  ? 285  GLU B CD  1 
ATOM   6295 O OE1 . GLU B 1 285 ? 56.244 63.064  45.006  1.00 62.14  ? 285  GLU B OE1 1 
ATOM   6296 O OE2 . GLU B 1 285 ? 56.052 64.692  46.481  1.00 60.63  ? 285  GLU B OE2 1 
ATOM   6297 N N   . TRP B 1 286 ? 59.470 67.089  42.639  1.00 66.19  ? 286  TRP B N   1 
ATOM   6298 C CA  . TRP B 1 286 ? 59.513 66.952  41.183  1.00 66.97  ? 286  TRP B CA  1 
ATOM   6299 C C   . TRP B 1 286 ? 60.809 67.472  40.551  1.00 68.70  ? 286  TRP B C   1 
ATOM   6300 O O   . TRP B 1 286 ? 61.018 67.331  39.346  1.00 69.39  ? 286  TRP B O   1 
ATOM   6301 C CB  . TRP B 1 286 ? 58.290 67.628  40.551  1.00 67.71  ? 286  TRP B CB  1 
ATOM   6302 C CG  . TRP B 1 286 ? 57.016 66.891  40.836  1.00 67.04  ? 286  TRP B CG  1 
ATOM   6303 C CD1 . TRP B 1 286 ? 56.067 67.213  41.771  1.00 66.94  ? 286  TRP B CD1 1 
ATOM   6304 C CD2 . TRP B 1 286 ? 56.557 65.690  40.193  1.00 65.97  ? 286  TRP B CD2 1 
ATOM   6305 N NE1 . TRP B 1 286 ? 55.044 66.290  41.740  1.00 65.46  ? 286  TRP B NE1 1 
ATOM   6306 C CE2 . TRP B 1 286 ? 55.319 65.346  40.784  1.00 64.91  ? 286  TRP B CE2 1 
ATOM   6307 C CE3 . TRP B 1 286 ? 57.069 64.876  39.169  1.00 65.59  ? 286  TRP B CE3 1 
ATOM   6308 C CZ2 . TRP B 1 286 ? 54.579 64.218  40.381  1.00 63.86  ? 286  TRP B CZ2 1 
ATOM   6309 C CZ3 . TRP B 1 286 ? 56.337 63.755  38.769  1.00 64.14  ? 286  TRP B CZ3 1 
ATOM   6310 C CH2 . TRP B 1 286 ? 55.102 63.439  39.376  1.00 63.02  ? 286  TRP B CH2 1 
ATOM   6311 N N   . HIS B 1 287 ? 61.684 68.052  41.362  1.00 69.86  ? 287  HIS B N   1 
ATOM   6312 C CA  . HIS B 1 287 ? 62.893 68.681  40.834  1.00 71.78  ? 287  HIS B CA  1 
ATOM   6313 C C   . HIS B 1 287 ? 64.100 67.744  40.806  1.00 71.26  ? 287  HIS B C   1 
ATOM   6314 O O   . HIS B 1 287 ? 65.209 68.182  40.506  1.00 73.26  ? 287  HIS B O   1 
ATOM   6315 C CB  . HIS B 1 287 ? 63.228 69.966  41.609  1.00 73.96  ? 287  HIS B CB  1 
ATOM   6316 C CG  . HIS B 1 287 ? 62.123 70.980  41.615  1.00 75.94  ? 287  HIS B CG  1 
ATOM   6317 N ND1 . HIS B 1 287 ? 62.089 72.037  42.502  1.00 79.25  ? 287  HIS B ND1 1 
ATOM   6318 C CD2 . HIS B 1 287 ? 61.004 71.090  40.858  1.00 76.59  ? 287  HIS B CD2 1 
ATOM   6319 C CE1 . HIS B 1 287 ? 61.008 72.763  42.279  1.00 80.04  ? 287  HIS B CE1 1 
ATOM   6320 N NE2 . HIS B 1 287 ? 60.330 72.206  41.290  1.00 79.02  ? 287  HIS B NE2 1 
ATOM   6321 N N   . VAL B 1 288 ? 63.889 66.462  41.101  1.00 68.88  ? 288  VAL B N   1 
ATOM   6322 C CA  . VAL B 1 288 ? 64.999 65.500  41.181  1.00 68.40  ? 288  VAL B CA  1 
ATOM   6323 C C   . VAL B 1 288 ? 65.098 64.521  40.001  1.00 67.68  ? 288  VAL B C   1 
ATOM   6324 O O   . VAL B 1 288 ? 66.034 63.725  39.948  1.00 67.99  ? 288  VAL B O   1 
ATOM   6325 C CB  . VAL B 1 288 ? 65.000 64.704  42.518  1.00 67.13  ? 288  VAL B CB  1 
ATOM   6326 C CG1 . VAL B 1 288 ? 65.222 65.626  43.695  1.00 68.02  ? 288  VAL B CG1 1 
ATOM   6327 C CG2 . VAL B 1 288 ? 63.710 63.926  42.687  1.00 64.89  ? 288  VAL B CG2 1 
ATOM   6328 N N   . LEU B 1 289 ? 64.147 64.566  39.068  1.00 66.93  ? 289  LEU B N   1 
ATOM   6329 C CA  . LEU B 1 289 ? 64.196 63.684  37.904  1.00 66.81  ? 289  LEU B CA  1 
ATOM   6330 C C   . LEU B 1 289 ? 65.365 64.057  36.964  1.00 69.36  ? 289  LEU B C   1 
ATOM   6331 O O   . LEU B 1 289 ? 65.640 65.246  36.756  1.00 70.96  ? 289  LEU B O   1 
ATOM   6332 C CB  . LEU B 1 289 ? 62.860 63.684  37.149  1.00 65.65  ? 289  LEU B CB  1 
ATOM   6333 C CG  . LEU B 1 289 ? 61.653 62.926  37.718  1.00 63.25  ? 289  LEU B CG  1 
ATOM   6334 C CD1 . LEU B 1 289 ? 60.375 63.370  37.023  1.00 62.45  ? 289  LEU B CD1 1 
ATOM   6335 C CD2 . LEU B 1 289 ? 61.825 61.426  37.595  1.00 61.35  ? 289  LEU B CD2 1 
ATOM   6336 N N   . PRO B 1 290 ? 66.063 63.042  36.404  1.00 69.58  ? 290  PRO B N   1 
ATOM   6337 C CA  . PRO B 1 290 ? 67.251 63.307  35.573  1.00 71.93  ? 290  PRO B CA  1 
ATOM   6338 C C   . PRO B 1 290 ? 66.947 63.938  34.208  1.00 73.18  ? 290  PRO B C   1 
ATOM   6339 O O   . PRO B 1 290 ? 67.833 64.547  33.607  1.00 75.46  ? 290  PRO B O   1 
ATOM   6340 C CB  . PRO B 1 290 ? 67.872 61.916  35.393  1.00 71.29  ? 290  PRO B CB  1 
ATOM   6341 C CG  . PRO B 1 290 ? 66.722 60.968  35.533  1.00 68.69  ? 290  PRO B CG  1 
ATOM   6342 C CD  . PRO B 1 290 ? 65.780 61.598  36.522  1.00 67.61  ? 290  PRO B CD  1 
ATOM   6343 N N   . GLN B 1 291 ? 65.711 63.790  33.734  1.00 72.25  ? 291  GLN B N   1 
ATOM   6344 C CA  . GLN B 1 291 ? 65.306 64.259  32.409  1.00 73.59  ? 291  GLN B CA  1 
ATOM   6345 C C   . GLN B 1 291 ? 63.939 64.953  32.421  1.00 73.19  ? 291  GLN B C   1 
ATOM   6346 O O   . GLN B 1 291 ? 63.122 64.736  33.331  1.00 71.78  ? 291  GLN B O   1 
ATOM   6347 C CB  . GLN B 1 291 ? 65.255 63.078  31.425  1.00 72.69  ? 291  GLN B CB  1 
ATOM   6348 C CG  . GLN B 1 291 ? 66.602 62.663  30.818  1.00 75.53  ? 291  GLN B CG  1 
ATOM   6349 C CD  . GLN B 1 291 ? 67.195 61.383  31.417  1.00 76.27  ? 291  GLN B CD  1 
ATOM   6350 O OE1 . GLN B 1 291 ? 68.414 61.244  31.498  1.00 78.79  ? 291  GLN B OE1 1 
ATOM   6351 N NE2 . GLN B 1 291 ? 66.339 60.439  31.814  1.00 74.19  ? 291  GLN B NE2 1 
ATOM   6352 N N   . GLU B 1 292 ? 63.698 65.787  31.410  1.00 74.60  ? 292  GLU B N   1 
ATOM   6353 C CA  . GLU B 1 292 ? 62.349 66.279  31.109  1.00 74.72  ? 292  GLU B CA  1 
ATOM   6354 C C   . GLU B 1 292 ? 61.513 65.072  30.661  1.00 72.08  ? 292  GLU B C   1 
ATOM   6355 O O   . GLU B 1 292 ? 61.805 64.453  29.630  1.00 72.38  ? 292  GLU B O   1 
ATOM   6356 C CB  . GLU B 1 292 ? 62.415 67.342  30.003  1.00 76.89  ? 292  GLU B CB  1 
ATOM   6357 C CG  . GLU B 1 292 ? 61.076 67.997  29.602  1.00 78.32  ? 292  GLU B CG  1 
ATOM   6358 C CD  . GLU B 1 292 ? 61.223 69.024  28.450  1.00 81.36  ? 292  GLU B CD  1 
ATOM   6359 O OE1 . GLU B 1 292 ? 62.256 69.011  27.722  1.00 83.85  ? 292  GLU B OE1 1 
ATOM   6360 O OE2 . GLU B 1 292 ? 60.294 69.852  28.271  1.00 84.46  ? 292  GLU B OE2 1 
ATOM   6361 N N   . SER B 1 293 ? 60.495 64.711  31.436  1.00 69.63  ? 293  SER B N   1 
ATOM   6362 C CA  . SER B 1 293 ? 59.756 63.493  31.140  1.00 66.93  ? 293  SER B CA  1 
ATOM   6363 C C   . SER B 1 293 ? 58.293 63.519  31.539  1.00 65.33  ? 293  SER B C   1 
ATOM   6364 O O   . SER B 1 293 ? 57.858 64.376  32.294  1.00 65.62  ? 293  SER B O   1 
ATOM   6365 C CB  . SER B 1 293 ? 60.445 62.290  31.786  1.00 65.78  ? 293  SER B CB  1 
ATOM   6366 O OG  . SER B 1 293 ? 60.622 62.492  33.173  1.00 65.40  ? 293  SER B OG  1 
ATOM   6367 N N   . ILE B 1 294 ? 57.544 62.568  30.982  1.00 63.79  ? 294  ILE B N   1 
ATOM   6368 C CA  . ILE B 1 294 ? 56.194 62.217  31.444  1.00 61.75  ? 294  ILE B CA  1 
ATOM   6369 C C   . ILE B 1 294 ? 56.170 60.723  31.762  1.00 59.13  ? 294  ILE B C   1 
ATOM   6370 O O   . ILE B 1 294 ? 57.027 59.982  31.296  1.00 58.80  ? 294  ILE B O   1 
ATOM   6371 C CB  . ILE B 1 294 ? 55.097 62.559  30.405  1.00 62.48  ? 294  ILE B CB  1 
ATOM   6372 C CG1 . ILE B 1 294 ? 55.377 61.878  29.063  1.00 62.36  ? 294  ILE B CG1 1 
ATOM   6373 C CG2 . ILE B 1 294 ? 54.962 64.082  30.236  1.00 64.69  ? 294  ILE B CG2 1 
ATOM   6374 C CD1 . ILE B 1 294 ? 54.151 61.785  28.173  1.00 63.00  ? 294  ILE B CD1 1 
ATOM   6375 N N   . PHE B 1 295 ? 55.194 60.304  32.565  1.00 57.15  ? 295  PHE B N   1 
ATOM   6376 C CA  . PHE B 1 295 ? 55.108 58.943  33.096  1.00 54.80  ? 295  PHE B CA  1 
ATOM   6377 C C   . PHE B 1 295 ? 56.399 58.519  33.809  1.00 54.59  ? 295  PHE B C   1 
ATOM   6378 O O   . PHE B 1 295 ? 56.874 57.381  33.647  1.00 54.14  ? 295  PHE B O   1 
ATOM   6379 C CB  . PHE B 1 295 ? 54.743 57.938  31.992  1.00 54.11  ? 295  PHE B CB  1 
ATOM   6380 C CG  . PHE B 1 295 ? 53.750 56.878  32.418  1.00 52.72  ? 295  PHE B CG  1 
ATOM   6381 C CD1 . PHE B 1 295 ? 53.928 56.154  33.599  1.00 50.48  ? 295  PHE B CD1 1 
ATOM   6382 C CD2 . PHE B 1 295 ? 52.638 56.596  31.621  1.00 51.98  ? 295  PHE B CD2 1 
ATOM   6383 C CE1 . PHE B 1 295 ? 53.030 55.185  33.975  1.00 48.55  ? 295  PHE B CE1 1 
ATOM   6384 C CE2 . PHE B 1 295 ? 51.735 55.615  31.991  1.00 50.97  ? 295  PHE B CE2 1 
ATOM   6385 C CZ  . PHE B 1 295 ? 51.932 54.910  33.176  1.00 49.67  ? 295  PHE B CZ  1 
ATOM   6386 N N   . ARG B 1 296 ? 56.970 59.443  34.578  1.00 54.78  ? 296  ARG B N   1 
ATOM   6387 C CA  . ARG B 1 296 ? 58.088 59.132  35.460  1.00 54.36  ? 296  ARG B CA  1 
ATOM   6388 C C   . ARG B 1 296 ? 57.892 59.815  36.802  1.00 54.16  ? 296  ARG B C   1 
ATOM   6389 O O   . ARG B 1 296 ? 57.439 60.963  36.875  1.00 55.06  ? 296  ARG B O   1 
ATOM   6390 C CB  . ARG B 1 296 ? 59.413 59.569  34.856  1.00 56.00  ? 296  ARG B CB  1 
ATOM   6391 C CG  . ARG B 1 296 ? 59.803 58.865  33.578  1.00 56.51  ? 296  ARG B CG  1 
ATOM   6392 C CD  . ARG B 1 296 ? 60.420 57.513  33.829  1.00 56.65  ? 296  ARG B CD  1 
ATOM   6393 N NE  . ARG B 1 296 ? 60.876 56.905  32.578  1.00 58.99  ? 296  ARG B NE  1 
ATOM   6394 C CZ  . ARG B 1 296 ? 60.075 56.357  31.664  1.00 58.63  ? 296  ARG B CZ  1 
ATOM   6395 N NH1 . ARG B 1 296 ? 58.756 56.339  31.836  1.00 57.29  ? 296  ARG B NH1 1 
ATOM   6396 N NH2 . ARG B 1 296 ? 60.598 55.830  30.566  1.00 59.81  ? 296  ARG B NH2 1 
ATOM   6397 N N   . PHE B 1 297 ? 58.244 59.107  37.868  1.00 52.81  ? 297  PHE B N   1 
ATOM   6398 C CA  . PHE B 1 297 ? 57.984 59.592  39.213  1.00 51.77  ? 297  PHE B CA  1 
ATOM   6399 C C   . PHE B 1 297 ? 59.245 59.511  40.050  1.00 51.99  ? 297  PHE B C   1 
ATOM   6400 O O   . PHE B 1 297 ? 60.058 58.593  39.880  1.00 51.58  ? 297  PHE B O   1 
ATOM   6401 C CB  . PHE B 1 297 ? 56.830 58.811  39.831  1.00 50.37  ? 297  PHE B CB  1 
ATOM   6402 C CG  . PHE B 1 297 ? 55.750 58.452  38.839  1.00 49.95  ? 297  PHE B CG  1 
ATOM   6403 C CD1 . PHE B 1 297 ? 54.898 59.429  38.327  1.00 50.83  ? 297  PHE B CD1 1 
ATOM   6404 C CD2 . PHE B 1 297 ? 55.605 57.139  38.392  1.00 48.50  ? 297  PHE B CD2 1 
ATOM   6405 C CE1 . PHE B 1 297 ? 53.903 59.099  37.402  1.00 50.58  ? 297  PHE B CE1 1 
ATOM   6406 C CE2 . PHE B 1 297 ? 54.617 56.807  37.465  1.00 47.79  ? 297  PHE B CE2 1 
ATOM   6407 C CZ  . PHE B 1 297 ? 53.761 57.786  36.976  1.00 48.27  ? 297  PHE B CZ  1 
ATOM   6408 N N   . SER B 1 298 ? 59.401 60.482  40.948  1.00 52.27  ? 298  SER B N   1 
ATOM   6409 C CA  . SER B 1 298 ? 60.678 60.709  41.631  1.00 52.93  ? 298  SER B CA  1 
ATOM   6410 C C   . SER B 1 298 ? 61.031 59.656  42.671  1.00 51.51  ? 298  SER B C   1 
ATOM   6411 O O   . SER B 1 298 ? 62.194 59.256  42.776  1.00 52.52  ? 298  SER B O   1 
ATOM   6412 C CB  . SER B 1 298 ? 60.684 62.085  42.284  1.00 54.29  ? 298  SER B CB  1 
ATOM   6413 O OG  . SER B 1 298 ? 60.488 63.096  41.315  1.00 56.78  ? 298  SER B OG  1 
ATOM   6414 N N   . PHE B 1 299 ? 60.030 59.218  43.437  1.00 49.22  ? 299  PHE B N   1 
ATOM   6415 C CA  . PHE B 1 299 ? 60.255 58.292  44.538  1.00 47.87  ? 299  PHE B CA  1 
ATOM   6416 C C   . PHE B 1 299 ? 59.351 57.082  44.419  1.00 46.47  ? 299  PHE B C   1 
ATOM   6417 O O   . PHE B 1 299 ? 58.133 57.163  44.626  1.00 45.84  ? 299  PHE B O   1 
ATOM   6418 C CB  . PHE B 1 299 ? 60.116 59.000  45.893  1.00 47.64  ? 299  PHE B CB  1 
ATOM   6419 C CG  . PHE B 1 299 ? 61.154 60.058  46.113  1.00 48.03  ? 299  PHE B CG  1 
ATOM   6420 C CD1 . PHE B 1 299 ? 62.403 59.725  46.623  1.00 47.38  ? 299  PHE B CD1 1 
ATOM   6421 C CD2 . PHE B 1 299 ? 60.894 61.386  45.776  1.00 48.12  ? 299  PHE B CD2 1 
ATOM   6422 C CE1 . PHE B 1 299 ? 63.382 60.697  46.791  1.00 50.57  ? 299  PHE B CE1 1 
ATOM   6423 C CE2 . PHE B 1 299 ? 61.868 62.370  45.937  1.00 50.10  ? 299  PHE B CE2 1 
ATOM   6424 C CZ  . PHE B 1 299 ? 63.113 62.029  46.446  1.00 51.08  ? 299  PHE B CZ  1 
ATOM   6425 N N   . VAL B 1 300 ? 59.978 55.963  44.069  1.00 46.07  ? 300  VAL B N   1 
ATOM   6426 C CA  . VAL B 1 300 ? 59.290 54.718  43.732  1.00 44.98  ? 300  VAL B CA  1 
ATOM   6427 C C   . VAL B 1 300 ? 60.049 53.556  44.396  1.00 45.32  ? 300  VAL B C   1 
ATOM   6428 O O   . VAL B 1 300 ? 61.147 53.763  44.896  1.00 46.57  ? 300  VAL B O   1 
ATOM   6429 C CB  . VAL B 1 300 ? 59.187 54.538  42.185  1.00 44.67  ? 300  VAL B CB  1 
ATOM   6430 C CG1 . VAL B 1 300 ? 58.293 55.635  41.566  1.00 44.12  ? 300  VAL B CG1 1 
ATOM   6431 C CG2 . VAL B 1 300 ? 60.560 54.558  41.541  1.00 45.21  ? 300  VAL B CG2 1 
ATOM   6432 N N   . PRO B 1 301 ? 59.458 52.347  44.451  1.00 44.68  ? 301  PRO B N   1 
ATOM   6433 C CA  . PRO B 1 301 ? 60.199 51.218  44.991  1.00 44.93  ? 301  PRO B CA  1 
ATOM   6434 C C   . PRO B 1 301 ? 61.623 51.135  44.448  1.00 46.86  ? 301  PRO B C   1 
ATOM   6435 O O   . PRO B 1 301 ? 61.874 51.446  43.271  1.00 47.46  ? 301  PRO B O   1 
ATOM   6436 C CB  . PRO B 1 301 ? 59.381 50.024  44.513  1.00 43.95  ? 301  PRO B CB  1 
ATOM   6437 C CG  . PRO B 1 301 ? 57.993 50.525  44.513  1.00 42.78  ? 301  PRO B CG  1 
ATOM   6438 C CD  . PRO B 1 301 ? 58.083 51.959  44.076  1.00 43.55  ? 301  PRO B CD  1 
ATOM   6439 N N   . VAL B 1 302 ? 62.548 50.730  45.311  1.00 47.94  ? 302  VAL B N   1 
ATOM   6440 C CA  . VAL B 1 302 ? 63.961 50.656  44.978  1.00 49.30  ? 302  VAL B CA  1 
ATOM   6441 C C   . VAL B 1 302 ? 64.449 49.204  45.012  1.00 50.07  ? 302  VAL B C   1 
ATOM   6442 O O   . VAL B 1 302 ? 64.074 48.443  45.897  1.00 50.19  ? 302  VAL B O   1 
ATOM   6443 C CB  . VAL B 1 302 ? 64.790 51.508  45.970  1.00 50.46  ? 302  VAL B CB  1 
ATOM   6444 C CG1 . VAL B 1 302 ? 64.560 51.053  47.401  1.00 49.28  ? 302  VAL B CG1 1 
ATOM   6445 C CG2 . VAL B 1 302 ? 66.285 51.463  45.619  1.00 52.32  ? 302  VAL B CG2 1 
ATOM   6446 N N   . VAL B 1 303 ? 65.291 48.820  44.061  1.00 51.23  ? 303  VAL B N   1 
ATOM   6447 C CA  . VAL B 1 303 ? 65.858 47.474  44.073  1.00 52.33  ? 303  VAL B CA  1 
ATOM   6448 C C   . VAL B 1 303 ? 66.924 47.451  45.172  1.00 54.36  ? 303  VAL B C   1 
ATOM   6449 O O   . VAL B 1 303 ? 68.078 47.829  44.953  1.00 55.82  ? 303  VAL B O   1 
ATOM   6450 C CB  . VAL B 1 303 ? 66.383 47.053  42.663  1.00 52.86  ? 303  VAL B CB  1 
ATOM   6451 C CG1 . VAL B 1 303 ? 67.015 45.668  42.687  1.00 53.73  ? 303  VAL B CG1 1 
ATOM   6452 C CG2 . VAL B 1 303 ? 65.251 47.068  41.650  1.00 51.26  ? 303  VAL B CG2 1 
ATOM   6453 N N   . ASP B 1 304 ? 66.499 47.040  46.367  1.00 54.73  ? 304  ASP B N   1 
ATOM   6454 C CA  . ASP B 1 304 ? 67.303 47.147  47.593  1.00 56.71  ? 304  ASP B CA  1 
ATOM   6455 C C   . ASP B 1 304 ? 68.105 45.890  47.936  1.00 58.50  ? 304  ASP B C   1 
ATOM   6456 O O   . ASP B 1 304 ? 68.934 45.912  48.856  1.00 60.12  ? 304  ASP B O   1 
ATOM   6457 C CB  . ASP B 1 304 ? 66.404 47.517  48.781  1.00 55.67  ? 304  ASP B CB  1 
ATOM   6458 C CG  . ASP B 1 304 ? 65.217 46.565  48.944  1.00 55.93  ? 304  ASP B CG  1 
ATOM   6459 O OD1 . ASP B 1 304 ? 65.024 45.684  48.073  1.00 55.74  ? 304  ASP B OD1 1 
ATOM   6460 O OD2 . ASP B 1 304 ? 64.468 46.700  49.946  1.00 55.61  ? 304  ASP B OD2 1 
ATOM   6461 N N   . GLY B 1 305 ? 67.861 44.806  47.201  1.00 58.49  ? 305  GLY B N   1 
ATOM   6462 C CA  . GLY B 1 305 ? 68.404 43.496  47.546  1.00 60.14  ? 305  GLY B CA  1 
ATOM   6463 C C   . GLY B 1 305 ? 67.778 42.904  48.807  1.00 60.55  ? 305  GLY B C   1 
ATOM   6464 O O   . GLY B 1 305 ? 68.369 42.024  49.432  1.00 61.68  ? 305  GLY B O   1 
ATOM   6465 N N   . ASP B 1 306 ? 66.584 43.385  49.179  1.00 59.45  ? 306  ASP B N   1 
ATOM   6466 C CA  . ASP B 1 306 ? 65.885 42.935  50.400  1.00 59.83  ? 306  ASP B CA  1 
ATOM   6467 C C   . ASP B 1 306 ? 64.393 42.683  50.148  1.00 57.89  ? 306  ASP B C   1 
ATOM   6468 O O   . ASP B 1 306 ? 63.979 41.530  49.999  1.00 57.92  ? 306  ASP B O   1 
ATOM   6469 C CB  . ASP B 1 306 ? 66.099 43.927  51.559  1.00 60.67  ? 306  ASP B CB  1 
ATOM   6470 C CG  . ASP B 1 306 ? 65.394 43.497  52.854  1.00 62.52  ? 306  ASP B CG  1 
ATOM   6471 O OD1 . ASP B 1 306 ? 64.993 42.316  52.960  1.00 63.57  ? 306  ASP B OD1 1 
ATOM   6472 O OD2 . ASP B 1 306 ? 65.242 44.344  53.773  1.00 64.61  ? 306  ASP B OD2 1 
ATOM   6473 N N   . PHE B 1 307 ? 63.583 43.745  50.108  1.00 56.54  ? 307  PHE B N   1 
ATOM   6474 C CA  . PHE B 1 307 ? 62.185 43.599  49.686  1.00 54.78  ? 307  PHE B CA  1 
ATOM   6475 C C   . PHE B 1 307 ? 62.178 42.989  48.297  1.00 54.52  ? 307  PHE B C   1 
ATOM   6476 O O   . PHE B 1 307 ? 61.526 41.972  48.072  1.00 54.52  ? 307  PHE B O   1 
ATOM   6477 C CB  . PHE B 1 307 ? 61.429 44.931  49.677  1.00 53.71  ? 307  PHE B CB  1 
ATOM   6478 C CG  . PHE B 1 307 ? 59.933 44.775  49.584  1.00 52.41  ? 307  PHE B CG  1 
ATOM   6479 C CD1 . PHE B 1 307 ? 59.318 44.457  48.373  1.00 51.74  ? 307  PHE B CD1 1 
ATOM   6480 C CD2 . PHE B 1 307 ? 59.134 44.937  50.708  1.00 52.54  ? 307  PHE B CD2 1 
ATOM   6481 C CE1 . PHE B 1 307 ? 57.935 44.309  48.286  1.00 50.10  ? 307  PHE B CE1 1 
ATOM   6482 C CE2 . PHE B 1 307 ? 57.747 44.794  50.621  1.00 51.52  ? 307  PHE B CE2 1 
ATOM   6483 C CZ  . PHE B 1 307 ? 57.155 44.475  49.411  1.00 50.39  ? 307  PHE B CZ  1 
ATOM   6484 N N   . LEU B 1 308 ? 62.915 43.614  47.380  1.00 54.59  ? 308  LEU B N   1 
ATOM   6485 C CA  . LEU B 1 308 ? 63.173 43.053  46.059  1.00 54.77  ? 308  LEU B CA  1 
ATOM   6486 C C   . LEU B 1 308 ? 64.612 42.556  46.011  1.00 56.85  ? 308  LEU B C   1 
ATOM   6487 O O   . LEU B 1 308 ? 65.549 43.354  46.102  1.00 57.85  ? 308  LEU B O   1 
ATOM   6488 C CB  . LEU B 1 308 ? 62.964 44.113  44.980  1.00 53.68  ? 308  LEU B CB  1 
ATOM   6489 C CG  . LEU B 1 308 ? 61.658 44.905  44.917  1.00 52.22  ? 308  LEU B CG  1 
ATOM   6490 C CD1 . LEU B 1 308 ? 61.829 46.037  43.917  1.00 51.78  ? 308  LEU B CD1 1 
ATOM   6491 C CD2 . LEU B 1 308 ? 60.468 44.020  44.544  1.00 51.20  ? 308  LEU B CD2 1 
ATOM   6492 N N   . SER B 1 309 ? 64.798 41.248  45.861  1.00 57.90  ? 309  SER B N   1 
ATOM   6493 C CA  . SER B 1 309 ? 66.153 40.669  45.930  1.00 60.39  ? 309  SER B CA  1 
ATOM   6494 C C   . SER B 1 309 ? 66.960 40.811  44.633  1.00 61.24  ? 309  SER B C   1 
ATOM   6495 O O   . SER B 1 309 ? 68.144 40.480  44.599  1.00 63.05  ? 309  SER B O   1 
ATOM   6496 C CB  . SER B 1 309 ? 66.114 39.207  46.396  1.00 61.20  ? 309  SER B CB  1 
ATOM   6497 O OG  . SER B 1 309 ? 65.733 38.346  45.339  1.00 61.47  ? 309  SER B OG  1 
ATOM   6498 N N   . ASP B 1 310 ? 66.305 41.297  43.580  1.00 60.28  ? 310  ASP B N   1 
ATOM   6499 C CA  . ASP B 1 310 ? 66.929 41.592  42.287  1.00 61.04  ? 310  ASP B CA  1 
ATOM   6500 C C   . ASP B 1 310 ? 65.908 42.427  41.523  1.00 59.51  ? 310  ASP B C   1 
ATOM   6501 O O   . ASP B 1 310 ? 64.866 42.776  42.082  1.00 57.79  ? 310  ASP B O   1 
ATOM   6502 C CB  . ASP B 1 310 ? 67.251 40.298  41.533  1.00 62.17  ? 310  ASP B CB  1 
ATOM   6503 C CG  . ASP B 1 310 ? 68.469 40.423  40.607  1.00 64.17  ? 310  ASP B CG  1 
ATOM   6504 O OD1 . ASP B 1 310 ? 68.789 41.533  40.129  1.00 64.87  ? 310  ASP B OD1 1 
ATOM   6505 O OD2 . ASP B 1 310 ? 69.099 39.380  40.338  1.00 65.57  ? 310  ASP B OD2 1 
ATOM   6506 N N   . THR B 1 311 ? 66.192 42.766  40.266  1.00 60.01  ? 311  THR B N   1 
ATOM   6507 C CA  . THR B 1 311 ? 65.246 43.562  39.475  1.00 59.16  ? 311  THR B CA  1 
ATOM   6508 C C   . THR B 1 311 ? 63.982 42.751  39.174  1.00 58.50  ? 311  THR B C   1 
ATOM   6509 O O   . THR B 1 311 ? 64.058 41.521  39.017  1.00 59.02  ? 311  THR B O   1 
ATOM   6510 C CB  . THR B 1 311 ? 65.865 44.083  38.145  1.00 59.71  ? 311  THR B CB  1 
ATOM   6511 O OG1 . THR B 1 311 ? 65.991 43.009  37.208  1.00 60.40  ? 311  THR B OG1 1 
ATOM   6512 C CG2 . THR B 1 311 ? 67.230 44.719  38.380  1.00 61.10  ? 311  THR B CG2 1 
ATOM   6513 N N   . PRO B 1 312 ? 62.817 43.425  39.094  1.00 57.57  ? 312  PRO B N   1 
ATOM   6514 C CA  . PRO B 1 312 ? 61.583 42.721  38.723  1.00 57.31  ? 312  PRO B CA  1 
ATOM   6515 C C   . PRO B 1 312 ? 61.795 41.884  37.465  1.00 58.44  ? 312  PRO B C   1 
ATOM   6516 O O   . PRO B 1 312 ? 61.260 40.774  37.351  1.00 58.46  ? 312  PRO B O   1 
ATOM   6517 C CB  . PRO B 1 312 ? 60.596 43.859  38.442  1.00 56.05  ? 312  PRO B CB  1 
ATOM   6518 C CG  . PRO B 1 312 ? 61.062 44.974  39.291  1.00 56.01  ? 312  PRO B CG  1 
ATOM   6519 C CD  . PRO B 1 312 ? 62.576 44.858  39.337  1.00 57.20  ? 312  PRO B CD  1 
ATOM   6520 N N   . GLU B 1 313 ? 62.601 42.423  36.553  1.00 59.78  ? 313  GLU B N   1 
ATOM   6521 C CA  . GLU B 1 313 ? 62.978 41.762  35.306  1.00 61.25  ? 313  GLU B CA  1 
ATOM   6522 C C   . GLU B 1 313 ? 63.672 40.436  35.590  1.00 62.44  ? 313  GLU B C   1 
ATOM   6523 O O   . GLU B 1 313 ? 63.279 39.397  35.057  1.00 62.72  ? 313  GLU B O   1 
ATOM   6524 C CB  . GLU B 1 313 ? 63.887 42.682  34.476  1.00 62.42  ? 313  GLU B CB  1 
ATOM   6525 C CG  . GLU B 1 313 ? 63.187 43.927  33.853  1.00 63.10  ? 313  GLU B CG  1 
ATOM   6526 C CD  . GLU B 1 313 ? 62.830 45.065  34.847  1.00 64.27  ? 313  GLU B CD  1 
ATOM   6527 O OE1 . GLU B 1 313 ? 63.314 45.087  36.010  1.00 64.09  ? 313  GLU B OE1 1 
ATOM   6528 O OE2 . GLU B 1 313 ? 62.049 45.957  34.438  1.00 63.71  ? 313  GLU B OE2 1 
ATOM   6529 N N   . ALA B 1 314 ? 64.688 40.470  36.449  1.00 63.54  ? 314  ALA B N   1 
ATOM   6530 C CA  . ALA B 1 314 ? 65.399 39.255  36.834  1.00 65.25  ? 314  ALA B CA  1 
ATOM   6531 C C   . ALA B 1 314 ? 64.477 38.268  37.541  1.00 65.24  ? 314  ALA B C   1 
ATOM   6532 O O   . ALA B 1 314 ? 64.522 37.072  37.258  1.00 66.30  ? 314  ALA B O   1 
ATOM   6533 C CB  . ALA B 1 314 ? 66.602 39.577  37.710  1.00 66.25  ? 314  ALA B CB  1 
ATOM   6534 N N   . LEU B 1 315 ? 63.638 38.772  38.446  1.00 64.53  ? 315  LEU B N   1 
ATOM   6535 C CA  . LEU B 1 315 ? 62.780 37.919  39.264  1.00 64.61  ? 315  LEU B CA  1 
ATOM   6536 C C   . LEU B 1 315 ? 61.633 37.259  38.496  1.00 64.42  ? 315  LEU B C   1 
ATOM   6537 O O   . LEU B 1 315 ? 61.231 36.142  38.835  1.00 64.57  ? 315  LEU B O   1 
ATOM   6538 C CB  . LEU B 1 315 ? 62.238 38.691  40.466  1.00 63.73  ? 315  LEU B CB  1 
ATOM   6539 C CG  . LEU B 1 315 ? 63.263 39.218  41.468  1.00 64.60  ? 315  LEU B CG  1 
ATOM   6540 C CD1 . LEU B 1 315 ? 62.559 39.971  42.591  1.00 62.53  ? 315  LEU B CD1 1 
ATOM   6541 C CD2 . LEU B 1 315 ? 64.121 38.080  42.023  1.00 66.68  ? 315  LEU B CD2 1 
ATOM   6542 N N   . ILE B 1 316 ? 61.111 37.936  37.472  1.00 64.36  ? 316  ILE B N   1 
ATOM   6543 C CA  . ILE B 1 316 ? 60.043 37.341  36.655  1.00 64.93  ? 316  ILE B CA  1 
ATOM   6544 C C   . ILE B 1 316 ? 60.575 36.283  35.679  1.00 67.00  ? 316  ILE B C   1 
ATOM   6545 O O   . ILE B 1 316 ? 59.881 35.308  35.398  1.00 67.54  ? 316  ILE B O   1 
ATOM   6546 C CB  . ILE B 1 316 ? 59.113 38.383  35.935  1.00 63.56  ? 316  ILE B CB  1 
ATOM   6547 C CG1 . ILE B 1 316 ? 59.899 39.284  34.963  1.00 64.13  ? 316  ILE B CG1 1 
ATOM   6548 C CG2 . ILE B 1 316 ? 58.318 39.200  36.963  1.00 61.73  ? 316  ILE B CG2 1 
ATOM   6549 C CD1 . ILE B 1 316 ? 59.033 40.065  33.932  1.00 62.92  ? 316  ILE B CD1 1 
ATOM   6550 N N   . ASN B 1 317 ? 61.798 36.471  35.179  1.00 68.95  ? 317  ASN B N   1 
ATOM   6551 C CA  . ASN B 1 317 ? 62.427 35.484  34.288  1.00 71.33  ? 317  ASN B CA  1 
ATOM   6552 C C   . ASN B 1 317 ? 62.727 34.175  35.011  1.00 72.83  ? 317  ASN B C   1 
ATOM   6553 O O   . ASN B 1 317 ? 62.694 33.112  34.395  1.00 74.00  ? 317  ASN B O   1 
ATOM   6554 C CB  . ASN B 1 317 ? 63.733 36.013  33.658  1.00 72.74  ? 317  ASN B CB  1 
ATOM   6555 C CG  . ASN B 1 317 ? 63.506 37.130  32.624  1.00 73.22  ? 317  ASN B CG  1 
ATOM   6556 O OD1 . ASN B 1 317 ? 62.378 37.578  32.388  1.00 73.65  ? 317  ASN B OD1 1 
ATOM   6557 N ND2 . ASN B 1 317 ? 64.598 37.586  32.006  1.00 74.48  ? 317  ASN B ND2 1 
ATOM   6558 N N   . THR B 1 318 ? 63.001 34.257  36.314  1.00 73.13  ? 318  THR B N   1 
ATOM   6559 C CA  . THR B 1 318 ? 63.556 33.125  37.065  1.00 75.10  ? 318  THR B CA  1 
ATOM   6560 C C   . THR B 1 318 ? 62.644 32.506  38.128  1.00 74.87  ? 318  THR B C   1 
ATOM   6561 O O   . THR B 1 318 ? 63.008 31.497  38.731  1.00 76.54  ? 318  THR B O   1 
ATOM   6562 C CB  . THR B 1 318 ? 64.890 33.501  37.767  1.00 76.38  ? 318  THR B CB  1 
ATOM   6563 O OG1 . THR B 1 318 ? 64.656 34.556  38.711  1.00 74.94  ? 318  THR B OG1 1 
ATOM   6564 C CG2 . THR B 1 318 ? 65.954 33.932  36.747  1.00 77.54  ? 318  THR B CG2 1 
ATOM   6565 N N   . GLY B 1 319 ? 61.481 33.103  38.368  1.00 73.21  ? 319  GLY B N   1 
ATOM   6566 C CA  . GLY B 1 319 ? 60.584 32.635  39.427  1.00 73.02  ? 319  GLY B CA  1 
ATOM   6567 C C   . GLY B 1 319 ? 59.842 31.337  39.134  1.00 73.96  ? 319  GLY B C   1 
ATOM   6568 O O   . GLY B 1 319 ? 59.846 30.839  38.005  1.00 74.45  ? 319  GLY B O   1 
ATOM   6569 N N   . ASP B 1 320 ? 59.225 30.776  40.172  1.00 74.24  ? 320  ASP B N   1 
ATOM   6570 C CA  . ASP B 1 320 ? 58.315 29.640  40.032  1.00 74.67  ? 320  ASP B CA  1 
ATOM   6571 C C   . ASP B 1 320 ? 56.929 30.108  40.468  1.00 72.85  ? 320  ASP B C   1 
ATOM   6572 O O   . ASP B 1 320 ? 56.703 30.396  41.650  1.00 72.63  ? 320  ASP B O   1 
ATOM   6573 C CB  . ASP B 1 320 ? 58.775 28.461  40.894  1.00 76.95  ? 320  ASP B CB  1 
ATOM   6574 C CG  . ASP B 1 320 ? 58.103 27.139  40.509  1.00 78.90  ? 320  ASP B CG  1 
ATOM   6575 O OD1 . ASP B 1 320 ? 57.345 27.095  39.511  1.00 78.82  ? 320  ASP B OD1 1 
ATOM   6576 O OD2 . ASP B 1 320 ? 58.348 26.133  41.212  1.00 80.54  ? 320  ASP B OD2 1 
ATOM   6577 N N   . PHE B 1 321 ? 56.011 30.208  39.509  1.00 71.26  ? 321  PHE B N   1 
ATOM   6578 C CA  . PHE B 1 321 ? 54.691 30.765  39.788  1.00 69.29  ? 321  PHE B CA  1 
ATOM   6579 C C   . PHE B 1 321 ? 53.590 29.729  39.602  1.00 69.87  ? 321  PHE B C   1 
ATOM   6580 O O   . PHE B 1 321 ? 52.449 30.068  39.276  1.00 69.07  ? 321  PHE B O   1 
ATOM   6581 C CB  . PHE B 1 321 ? 54.448 32.016  38.931  1.00 67.36  ? 321  PHE B CB  1 
ATOM   6582 C CG  . PHE B 1 321 ? 55.478 33.087  39.123  1.00 65.49  ? 321  PHE B CG  1 
ATOM   6583 C CD1 . PHE B 1 321 ? 55.519 33.836  40.297  1.00 64.87  ? 321  PHE B CD1 1 
ATOM   6584 C CD2 . PHE B 1 321 ? 56.415 33.345  38.140  1.00 65.15  ? 321  PHE B CD2 1 
ATOM   6585 C CE1 . PHE B 1 321 ? 56.483 34.831  40.484  1.00 63.91  ? 321  PHE B CE1 1 
ATOM   6586 C CE2 . PHE B 1 321 ? 57.379 34.347  38.318  1.00 65.26  ? 321  PHE B CE2 1 
ATOM   6587 C CZ  . PHE B 1 321 ? 57.410 35.088  39.490  1.00 64.13  ? 321  PHE B CZ  1 
ATOM   6588 N N   . GLN B 1 322 ? 53.939 28.471  39.863  1.00 71.31  ? 322  GLN B N   1 
ATOM   6589 C CA  . GLN B 1 322 ? 53.083 27.340  39.534  1.00 72.16  ? 322  GLN B CA  1 
ATOM   6590 C C   . GLN B 1 322 ? 51.773 27.272  40.337  1.00 71.47  ? 322  GLN B C   1 
ATOM   6591 O O   . GLN B 1 322 ? 50.752 26.844  39.805  1.00 72.13  ? 322  GLN B O   1 
ATOM   6592 C CB  . GLN B 1 322 ? 53.864 26.019  39.583  1.00 74.23  ? 322  GLN B CB  1 
ATOM   6593 C CG  . GLN B 1 322 ? 53.352 24.979  38.575  1.00 76.57  ? 322  GLN B CG  1 
ATOM   6594 C CD  . GLN B 1 322 ? 54.425 23.983  38.106  1.00 79.60  ? 322  GLN B CD  1 
ATOM   6595 O OE1 . GLN B 1 322 ? 54.628 23.787  36.899  1.00 79.20  ? 322  GLN B OE1 1 
ATOM   6596 N NE2 . GLN B 1 322 ? 55.105 23.348  39.059  1.00 80.63  ? 322  GLN B NE2 1 
ATOM   6597 N N   . ASP B 1 323 ? 51.774 27.707  41.591  1.00 70.31  ? 323  ASP B N   1 
ATOM   6598 C CA  . ASP B 1 323 ? 50.512 27.725  42.342  1.00 69.71  ? 323  ASP B CA  1 
ATOM   6599 C C   . ASP B 1 323 ? 49.902 29.137  42.439  1.00 66.87  ? 323  ASP B C   1 
ATOM   6600 O O   . ASP B 1 323 ? 49.384 29.540  43.480  1.00 66.55  ? 323  ASP B O   1 
ATOM   6601 C CB  . ASP B 1 323 ? 50.653 27.026  43.715  1.00 71.51  ? 323  ASP B CB  1 
ATOM   6602 C CG  . ASP B 1 323 ? 50.678 25.475  43.604  1.00 74.91  ? 323  ASP B CG  1 
ATOM   6603 O OD1 . ASP B 1 323 ? 50.410 24.920  42.508  1.00 76.98  ? 323  ASP B OD1 1 
ATOM   6604 O OD2 . ASP B 1 323 ? 50.966 24.803  44.623  1.00 77.10  ? 323  ASP B OD2 1 
ATOM   6605 N N   . LEU B 1 324 ? 49.956 29.866  41.326  1.00 64.42  ? 324  LEU B N   1 
ATOM   6606 C CA  . LEU B 1 324 ? 49.499 31.246  41.260  1.00 61.18  ? 324  LEU B CA  1 
ATOM   6607 C C   . LEU B 1 324 ? 48.486 31.484  40.136  1.00 59.66  ? 324  LEU B C   1 
ATOM   6608 O O   . LEU B 1 324 ? 48.670 31.022  39.007  1.00 59.47  ? 324  LEU B O   1 
ATOM   6609 C CB  . LEU B 1 324 ? 50.693 32.182  41.064  1.00 60.66  ? 324  LEU B CB  1 
ATOM   6610 C CG  . LEU B 1 324 ? 50.427 33.693  41.091  1.00 58.67  ? 324  LEU B CG  1 
ATOM   6611 C CD1 . LEU B 1 324 ? 50.256 34.174  42.526  1.00 58.26  ? 324  LEU B CD1 1 
ATOM   6612 C CD2 . LEU B 1 324 ? 51.546 34.429  40.406  1.00 57.11  ? 324  LEU B CD2 1 
ATOM   6613 N N   . GLN B 1 325 ? 47.429 32.218  40.471  1.00 57.51  ? 325  GLN B N   1 
ATOM   6614 C CA  . GLN B 1 325 ? 46.454 32.685  39.505  1.00 56.05  ? 325  GLN B CA  1 
ATOM   6615 C C   . GLN B 1 325 ? 46.529 34.204  39.377  1.00 53.97  ? 325  GLN B C   1 
ATOM   6616 O O   . GLN B 1 325 ? 46.558 34.907  40.387  1.00 53.37  ? 325  GLN B O   1 
ATOM   6617 C CB  . GLN B 1 325 ? 45.042 32.280  39.922  1.00 56.79  ? 325  GLN B CB  1 
ATOM   6618 C CG  . GLN B 1 325 ? 44.736 30.799  39.773  1.00 57.81  ? 325  GLN B CG  1 
ATOM   6619 C CD  . GLN B 1 325 ? 44.797 30.059  41.088  1.00 58.29  ? 325  GLN B CD  1 
ATOM   6620 O OE1 . GLN B 1 325 ? 45.459 29.032  41.197  1.00 60.29  ? 325  GLN B OE1 1 
ATOM   6621 N NE2 . GLN B 1 325 ? 44.115 30.580  42.100  1.00 57.45  ? 325  GLN B NE2 1 
ATOM   6622 N N   . VAL B 1 326 ? 46.550 34.702  38.139  1.00 52.65  ? 326  VAL B N   1 
ATOM   6623 C CA  . VAL B 1 326 ? 46.670 36.140  37.873  1.00 50.83  ? 326  VAL B CA  1 
ATOM   6624 C C   . VAL B 1 326 ? 45.693 36.617  36.798  1.00 50.07  ? 326  VAL B C   1 
ATOM   6625 O O   . VAL B 1 326 ? 45.621 36.036  35.719  1.00 50.44  ? 326  VAL B O   1 
ATOM   6626 C CB  . VAL B 1 326 ? 48.113 36.549  37.432  1.00 50.43  ? 326  VAL B CB  1 
ATOM   6627 C CG1 . VAL B 1 326 ? 48.325 38.016  37.651  1.00 49.41  ? 326  VAL B CG1 1 
ATOM   6628 C CG2 . VAL B 1 326 ? 49.153 35.818  38.209  1.00 51.13  ? 326  VAL B CG2 1 
ATOM   6629 N N   . LEU B 1 327 ? 44.946 37.673  37.110  1.00 49.04  ? 327  LEU B N   1 
ATOM   6630 C CA  . LEU B 1 327 ? 44.125 38.397  36.138  1.00 48.68  ? 327  LEU B CA  1 
ATOM   6631 C C   . LEU B 1 327 ? 44.829 39.713  35.809  1.00 47.45  ? 327  LEU B C   1 
ATOM   6632 O O   . LEU B 1 327 ? 45.197 40.468  36.709  1.00 47.04  ? 327  LEU B O   1 
ATOM   6633 C CB  . LEU B 1 327 ? 42.714 38.661  36.687  1.00 48.94  ? 327  LEU B CB  1 
ATOM   6634 C CG  . LEU B 1 327 ? 41.774 39.577  35.876  1.00 50.14  ? 327  LEU B CG  1 
ATOM   6635 C CD1 . LEU B 1 327 ? 41.418 38.998  34.509  1.00 49.78  ? 327  LEU B CD1 1 
ATOM   6636 C CD2 . LEU B 1 327 ? 40.507 39.882  36.651  1.00 51.40  ? 327  LEU B CD2 1 
ATOM   6637 N N   . VAL B 1 328 ? 45.022 39.982  34.522  1.00 46.82  ? 328  VAL B N   1 
ATOM   6638 C CA  . VAL B 1 328 ? 45.859 41.098  34.093  1.00 45.71  ? 328  VAL B CA  1 
ATOM   6639 C C   . VAL B 1 328 ? 45.238 41.775  32.865  1.00 45.65  ? 328  VAL B C   1 
ATOM   6640 O O   . VAL B 1 328 ? 44.560 41.110  32.060  1.00 46.11  ? 328  VAL B O   1 
ATOM   6641 C CB  . VAL B 1 328 ? 47.317 40.614  33.829  1.00 45.27  ? 328  VAL B CB  1 
ATOM   6642 C CG1 . VAL B 1 328 ? 47.412 39.864  32.534  1.00 47.01  ? 328  VAL B CG1 1 
ATOM   6643 C CG2 . VAL B 1 328 ? 48.260 41.764  33.785  1.00 45.90  ? 328  VAL B CG2 1 
ATOM   6644 N N   . GLY B 1 329 ? 45.444 43.085  32.724  1.00 44.56  ? 329  GLY B N   1 
ATOM   6645 C CA  . GLY B 1 329 ? 44.907 43.795  31.575  1.00 44.58  ? 329  GLY B CA  1 
ATOM   6646 C C   . GLY B 1 329 ? 45.250 45.257  31.429  1.00 44.73  ? 329  GLY B C   1 
ATOM   6647 O O   . GLY B 1 329 ? 45.903 45.851  32.292  1.00 44.44  ? 329  GLY B O   1 
ATOM   6648 N N   . VAL B 1 330 ? 44.783 45.836  30.323  1.00 45.33  ? 330  VAL B N   1 
ATOM   6649 C CA  . VAL B 1 330 ? 45.043 47.235  29.960  1.00 45.00  ? 330  VAL B CA  1 
ATOM   6650 C C   . VAL B 1 330 ? 43.749 47.904  29.513  1.00 46.18  ? 330  VAL B C   1 
ATOM   6651 O O   . VAL B 1 330 ? 42.784 47.215  29.202  1.00 47.16  ? 330  VAL B O   1 
ATOM   6652 C CB  . VAL B 1 330 ? 46.086 47.329  28.804  1.00 45.10  ? 330  VAL B CB  1 
ATOM   6653 C CG1 . VAL B 1 330 ? 47.435 46.742  29.227  1.00 43.88  ? 330  VAL B CG1 1 
ATOM   6654 C CG2 . VAL B 1 330 ? 45.577 46.650  27.536  1.00 44.35  ? 330  VAL B CG2 1 
ATOM   6655 N N   . VAL B 1 331 ? 43.717 49.234  29.483  1.00 46.70  ? 331  VAL B N   1 
ATOM   6656 C CA  . VAL B 1 331 ? 42.612 49.959  28.845  1.00 47.91  ? 331  VAL B CA  1 
ATOM   6657 C C   . VAL B 1 331 ? 43.053 50.373  27.438  1.00 49.39  ? 331  VAL B C   1 
ATOM   6658 O O   . VAL B 1 331 ? 44.241 50.238  27.094  1.00 48.87  ? 331  VAL B O   1 
ATOM   6659 C CB  . VAL B 1 331 ? 42.141 51.191  29.666  1.00 48.25  ? 331  VAL B CB  1 
ATOM   6660 C CG1 . VAL B 1 331 ? 41.555 50.754  31.008  1.00 47.61  ? 331  VAL B CG1 1 
ATOM   6661 C CG2 . VAL B 1 331 ? 43.267 52.200  29.855  1.00 47.10  ? 331  VAL B CG2 1 
ATOM   6662 N N   . LYS B 1 332 ? 42.115 50.879  26.633  1.00 51.20  ? 332  LYS B N   1 
ATOM   6663 C CA  . LYS B 1 332 ? 42.368 51.077  25.196  1.00 52.95  ? 332  LYS B CA  1 
ATOM   6664 C C   . LYS B 1 332 ? 43.385 52.182  24.880  1.00 53.32  ? 332  LYS B C   1 
ATOM   6665 O O   . LYS B 1 332 ? 44.099 52.106  23.880  1.00 53.78  ? 332  LYS B O   1 
ATOM   6666 C CB  . LYS B 1 332 ? 41.054 51.274  24.421  1.00 54.73  ? 332  LYS B CB  1 
ATOM   6667 C CG  . LYS B 1 332 ? 41.210 51.466  22.899  1.00 57.74  ? 332  LYS B CG  1 
ATOM   6668 C CD  . LYS B 1 332 ? 39.854 51.469  22.182  1.00 63.43  ? 332  LYS B CD  1 
ATOM   6669 C CE  . LYS B 1 332 ? 39.854 52.355  20.916  1.00 67.74  ? 332  LYS B CE  1 
ATOM   6670 N NZ  . LYS B 1 332 ? 39.636 53.819  21.215  1.00 69.46  ? 332  LYS B NZ  1 
ATOM   6671 N N   . ASP B 1 333 ? 43.467 53.191  25.741  1.00 53.44  ? 333  ASP B N   1 
ATOM   6672 C CA  . ASP B 1 333 ? 44.286 54.366  25.465  1.00 54.15  ? 333  ASP B CA  1 
ATOM   6673 C C   . ASP B 1 333 ? 45.095 54.735  26.687  1.00 53.40  ? 333  ASP B C   1 
ATOM   6674 O O   . ASP B 1 333 ? 44.897 55.779  27.291  1.00 53.81  ? 333  ASP B O   1 
ATOM   6675 C CB  . ASP B 1 333 ? 43.400 55.533  25.027  1.00 55.73  ? 333  ASP B CB  1 
ATOM   6676 C CG  . ASP B 1 333 ? 42.651 55.239  23.752  1.00 56.98  ? 333  ASP B CG  1 
ATOM   6677 O OD1 . ASP B 1 333 ? 41.461 54.879  23.849  1.00 57.83  ? 333  ASP B OD1 1 
ATOM   6678 O OD2 . ASP B 1 333 ? 43.258 55.345  22.663  1.00 56.84  ? 333  ASP B OD2 1 
ATOM   6679 N N   . GLU B 1 334 ? 46.028 53.861  27.031  1.00 53.00  ? 334  GLU B N   1 
ATOM   6680 C CA  . GLU B 1 334 ? 46.804 53.979  28.252  1.00 52.17  ? 334  GLU B CA  1 
ATOM   6681 C C   . GLU B 1 334 ? 47.586 55.272  28.349  1.00 52.79  ? 334  GLU B C   1 
ATOM   6682 O O   . GLU B 1 334 ? 47.789 55.779  29.440  1.00 53.15  ? 334  GLU B O   1 
ATOM   6683 C CB  . GLU B 1 334 ? 47.744 52.776  28.394  1.00 51.41  ? 334  GLU B CB  1 
ATOM   6684 C CG  . GLU B 1 334 ? 47.052 51.475  28.816  1.00 51.55  ? 334  GLU B CG  1 
ATOM   6685 C CD  . GLU B 1 334 ? 46.651 51.464  30.299  1.00 52.72  ? 334  GLU B CD  1 
ATOM   6686 O OE1 . GLU B 1 334 ? 47.143 52.325  31.062  1.00 52.22  ? 334  GLU B OE1 1 
ATOM   6687 O OE2 . GLU B 1 334 ? 45.847 50.590  30.702  1.00 52.23  ? 334  GLU B OE2 1 
ATOM   6688 N N   . GLY B 1 335 ? 48.001 55.831  27.224  1.00 54.01  ? 335  GLY B N   1 
ATOM   6689 C CA  . GLY B 1 335 ? 48.909 56.968  27.266  1.00 55.35  ? 335  GLY B CA  1 
ATOM   6690 C C   . GLY B 1 335 ? 48.356 58.377  27.123  1.00 57.06  ? 335  GLY B C   1 
ATOM   6691 O O   . GLY B 1 335 ? 49.072 59.336  27.387  1.00 57.43  ? 335  GLY B O   1 
ATOM   6692 N N   . SER B 1 336 ? 47.099 58.509  26.702  1.00 58.15  ? 336  SER B N   1 
ATOM   6693 C CA  . SER B 1 336 ? 46.525 59.814  26.358  1.00 60.40  ? 336  SER B CA  1 
ATOM   6694 C C   . SER B 1 336 ? 46.530 60.791  27.535  1.00 61.01  ? 336  SER B C   1 
ATOM   6695 O O   . SER B 1 336 ? 46.918 61.947  27.398  1.00 62.35  ? 336  SER B O   1 
ATOM   6696 C CB  . SER B 1 336 ? 45.106 59.638  25.813  1.00 61.14  ? 336  SER B CB  1 
ATOM   6697 O OG  . SER B 1 336 ? 44.233 59.120  26.802  1.00 60.38  ? 336  SER B OG  1 
ATOM   6698 N N   . TYR B 1 337 ? 46.109 60.294  28.692  1.00 60.48  ? 337  TYR B N   1 
ATOM   6699 C CA  . TYR B 1 337 ? 46.088 61.031  29.948  1.00 60.84  ? 337  TYR B CA  1 
ATOM   6700 C C   . TYR B 1 337 ? 47.350 61.847  30.219  1.00 60.96  ? 337  TYR B C   1 
ATOM   6701 O O   . TYR B 1 337 ? 47.270 63.003  30.639  1.00 62.35  ? 337  TYR B O   1 
ATOM   6702 C CB  . TYR B 1 337 ? 45.907 60.028  31.085  1.00 60.21  ? 337  TYR B CB  1 
ATOM   6703 C CG  . TYR B 1 337 ? 45.414 60.622  32.359  1.00 61.23  ? 337  TYR B CG  1 
ATOM   6704 C CD1 . TYR B 1 337 ? 44.062 60.568  32.684  1.00 63.20  ? 337  TYR B CD1 1 
ATOM   6705 C CD2 . TYR B 1 337 ? 46.290 61.242  33.248  1.00 63.19  ? 337  TYR B CD2 1 
ATOM   6706 C CE1 . TYR B 1 337 ? 43.576 61.126  33.880  1.00 64.12  ? 337  TYR B CE1 1 
ATOM   6707 C CE2 . TYR B 1 337 ? 45.821 61.816  34.446  1.00 64.34  ? 337  TYR B CE2 1 
ATOM   6708 C CZ  . TYR B 1 337 ? 44.457 61.749  34.752  1.00 63.48  ? 337  TYR B CZ  1 
ATOM   6709 O OH  . TYR B 1 337 ? 43.975 62.295  35.921  1.00 63.18  ? 337  TYR B OH  1 
ATOM   6710 N N   . PHE B 1 338 ? 48.504 61.234  29.974  1.00 59.55  ? 338  PHE B N   1 
ATOM   6711 C CA  . PHE B 1 338 ? 49.798 61.741  30.422  1.00 59.12  ? 338  PHE B CA  1 
ATOM   6712 C C   . PHE B 1 338 ? 50.361 62.797  29.510  1.00 60.60  ? 338  PHE B C   1 
ATOM   6713 O O   . PHE B 1 338 ? 51.285 63.524  29.886  1.00 60.81  ? 338  PHE B O   1 
ATOM   6714 C CB  . PHE B 1 338 ? 50.796 60.588  30.508  1.00 57.85  ? 338  PHE B CB  1 
ATOM   6715 C CG  . PHE B 1 338 ? 50.465 59.600  31.571  1.00 56.46  ? 338  PHE B CG  1 
ATOM   6716 C CD1 . PHE B 1 338 ? 49.555 58.570  31.323  1.00 55.03  ? 338  PHE B CD1 1 
ATOM   6717 C CD2 . PHE B 1 338 ? 51.037 59.709  32.830  1.00 55.26  ? 338  PHE B CD2 1 
ATOM   6718 C CE1 . PHE B 1 338 ? 49.224 57.664  32.313  1.00 53.73  ? 338  PHE B CE1 1 
ATOM   6719 C CE2 . PHE B 1 338 ? 50.720 58.798  33.828  1.00 54.69  ? 338  PHE B CE2 1 
ATOM   6720 C CZ  . PHE B 1 338 ? 49.809 57.774  33.572  1.00 53.46  ? 338  PHE B CZ  1 
ATOM   6721 N N   . LEU B 1 339 ? 49.809 62.864  28.304  1.00 61.34  ? 339  LEU B N   1 
ATOM   6722 C CA  . LEU B 1 339 ? 50.335 63.744  27.278  1.00 63.06  ? 339  LEU B CA  1 
ATOM   6723 C C   . LEU B 1 339 ? 50.157 65.204  27.641  1.00 64.74  ? 339  LEU B C   1 
ATOM   6724 O O   . LEU B 1 339 ? 51.019 66.023  27.330  1.00 66.12  ? 339  LEU B O   1 
ATOM   6725 C CB  . LEU B 1 339 ? 49.697 63.441  25.922  1.00 63.62  ? 339  LEU B CB  1 
ATOM   6726 C CG  . LEU B 1 339 ? 50.010 62.071  25.319  1.00 61.81  ? 339  LEU B CG  1 
ATOM   6727 C CD1 . LEU B 1 339 ? 49.540 62.018  23.886  1.00 61.75  ? 339  LEU B CD1 1 
ATOM   6728 C CD2 . LEU B 1 339 ? 51.488 61.760  25.399  1.00 60.79  ? 339  LEU B CD2 1 
ATOM   6729 N N   . VAL B 1 340 ? 49.051 65.514  28.318  1.00 65.02  ? 340  VAL B N   1 
ATOM   6730 C CA  . VAL B 1 340 ? 48.699 66.904  28.667  1.00 67.01  ? 340  VAL B CA  1 
ATOM   6731 C C   . VAL B 1 340 ? 49.537 67.473  29.816  1.00 67.15  ? 340  VAL B C   1 
ATOM   6732 O O   . VAL B 1 340 ? 49.473 68.662  30.110  1.00 69.05  ? 340  VAL B O   1 
ATOM   6733 C CB  . VAL B 1 340 ? 47.178 67.063  28.981  1.00 67.24  ? 340  VAL B CB  1 
ATOM   6734 C CG1 . VAL B 1 340 ? 46.342 66.693  27.769  1.00 67.27  ? 340  VAL B CG1 1 
ATOM   6735 C CG2 . VAL B 1 340 ? 46.763 66.227  30.197  1.00 65.25  ? 340  VAL B CG2 1 
ATOM   6736 N N   . TYR B 1 341 ? 50.327 66.613  30.450  1.00 65.84  ? 341  TYR B N   1 
ATOM   6737 C CA  . TYR B 1 341 ? 51.130 66.991  31.604  1.00 65.97  ? 341  TYR B CA  1 
ATOM   6738 C C   . TYR B 1 341 ? 52.574 67.308  31.254  1.00 66.92  ? 341  TYR B C   1 
ATOM   6739 O O   . TYR B 1 341 ? 53.411 67.377  32.141  1.00 67.26  ? 341  TYR B O   1 
ATOM   6740 C CB  . TYR B 1 341 ? 51.107 65.884  32.662  1.00 63.79  ? 341  TYR B CB  1 
ATOM   6741 C CG  . TYR B 1 341 ? 49.883 65.888  33.546  1.00 63.76  ? 341  TYR B CG  1 
ATOM   6742 C CD1 . TYR B 1 341 ? 48.755 65.136  33.212  1.00 62.53  ? 341  TYR B CD1 1 
ATOM   6743 C CD2 . TYR B 1 341 ? 49.856 66.632  34.729  1.00 64.20  ? 341  TYR B CD2 1 
ATOM   6744 C CE1 . TYR B 1 341 ? 47.624 65.132  34.024  1.00 62.10  ? 341  TYR B CE1 1 
ATOM   6745 C CE2 . TYR B 1 341 ? 48.738 66.624  35.551  1.00 64.12  ? 341  TYR B CE2 1 
ATOM   6746 C CZ  . TYR B 1 341 ? 47.621 65.873  35.190  1.00 63.26  ? 341  TYR B CZ  1 
ATOM   6747 O OH  . TYR B 1 341 ? 46.500 65.869  35.992  1.00 63.12  ? 341  TYR B OH  1 
ATOM   6748 N N   . GLY B 1 342 ? 52.886 67.500  29.979  1.00 68.21  ? 342  GLY B N   1 
ATOM   6749 C CA  . GLY B 1 342 ? 54.266 67.831  29.618  1.00 69.08  ? 342  GLY B CA  1 
ATOM   6750 C C   . GLY B 1 342 ? 54.653 67.877  28.155  1.00 69.96  ? 342  GLY B C   1 
ATOM   6751 O O   . GLY B 1 342 ? 55.647 68.520  27.810  1.00 72.06  ? 342  GLY B O   1 
ATOM   6752 N N   . VAL B 1 343 ? 53.895 67.199  27.296  1.00 68.77  ? 343  VAL B N   1 
ATOM   6753 C CA  . VAL B 1 343 ? 54.202 67.187  25.864  1.00 69.41  ? 343  VAL B CA  1 
ATOM   6754 C C   . VAL B 1 343 ? 53.614 68.419  25.169  1.00 71.60  ? 343  VAL B C   1 
ATOM   6755 O O   . VAL B 1 343 ? 52.394 68.589  25.143  1.00 71.66  ? 343  VAL B O   1 
ATOM   6756 C CB  . VAL B 1 343 ? 53.696 65.900  25.160  1.00 68.03  ? 343  VAL B CB  1 
ATOM   6757 C CG1 . VAL B 1 343 ? 54.147 65.882  23.697  1.00 68.16  ? 343  VAL B CG1 1 
ATOM   6758 C CG2 . VAL B 1 343 ? 54.173 64.645  25.899  1.00 65.46  ? 343  VAL B CG2 1 
ATOM   6759 N N   . PRO B 1 344 ? 54.477 69.282  24.604  1.00 73.48  ? 344  PRO B N   1 
ATOM   6760 C CA  . PRO B 1 344 ? 53.967 70.479  23.925  1.00 75.93  ? 344  PRO B CA  1 
ATOM   6761 C C   . PRO B 1 344 ? 53.010 70.123  22.784  1.00 75.97  ? 344  PRO B C   1 
ATOM   6762 O O   . PRO B 1 344 ? 53.264 69.171  22.031  1.00 74.91  ? 344  PRO B O   1 
ATOM   6763 C CB  . PRO B 1 344 ? 55.236 71.159  23.380  1.00 77.89  ? 344  PRO B CB  1 
ATOM   6764 C CG  . PRO B 1 344 ? 56.349 70.632  24.222  1.00 77.07  ? 344  PRO B CG  1 
ATOM   6765 C CD  . PRO B 1 344 ? 55.948 69.209  24.563  1.00 74.15  ? 344  PRO B CD  1 
ATOM   6766 N N   . GLY B 1 345 ? 51.915 70.881  22.688  1.00 77.01  ? 345  GLY B N   1 
ATOM   6767 C CA  . GLY B 1 345 ? 50.884 70.673  21.675  1.00 77.09  ? 345  GLY B CA  1 
ATOM   6768 C C   . GLY B 1 345 ? 49.617 70.003  22.180  1.00 75.44  ? 345  GLY B C   1 
ATOM   6769 O O   . GLY B 1 345 ? 48.618 69.965  21.467  1.00 76.18  ? 345  GLY B O   1 
ATOM   6770 N N   . PHE B 1 346 ? 49.651 69.482  23.409  1.00 73.50  ? 346  PHE B N   1 
ATOM   6771 C CA  . PHE B 1 346 ? 48.549 68.666  23.948  1.00 71.81  ? 346  PHE B CA  1 
ATOM   6772 C C   . PHE B 1 346 ? 47.810 69.366  25.075  1.00 72.55  ? 346  PHE B C   1 
ATOM   6773 O O   . PHE B 1 346 ? 48.433 69.937  25.976  1.00 73.04  ? 346  PHE B O   1 
ATOM   6774 C CB  . PHE B 1 346 ? 49.054 67.296  24.431  1.00 68.89  ? 346  PHE B CB  1 
ATOM   6775 C CG  . PHE B 1 346 ? 49.408 66.343  23.316  1.00 67.72  ? 346  PHE B CG  1 
ATOM   6776 C CD1 . PHE B 1 346 ? 50.680 66.344  22.754  1.00 67.54  ? 346  PHE B CD1 1 
ATOM   6777 C CD2 . PHE B 1 346 ? 48.465 65.441  22.827  1.00 66.44  ? 346  PHE B CD2 1 
ATOM   6778 C CE1 . PHE B 1 346 ? 51.006 65.459  21.717  1.00 67.44  ? 346  PHE B CE1 1 
ATOM   6779 C CE2 . PHE B 1 346 ? 48.781 64.563  21.790  1.00 64.96  ? 346  PHE B CE2 1 
ATOM   6780 C CZ  . PHE B 1 346 ? 50.054 64.567  21.239  1.00 66.02  ? 346  PHE B CZ  1 
ATOM   6781 N N   . SER B 1 347 ? 46.479 69.311  25.014  1.00 73.11  ? 347  SER B N   1 
ATOM   6782 C CA  . SER B 1 347 ? 45.584 69.965  25.981  1.00 73.51  ? 347  SER B CA  1 
ATOM   6783 C C   . SER B 1 347 ? 44.242 69.242  25.969  1.00 72.69  ? 347  SER B C   1 
ATOM   6784 O O   . SER B 1 347 ? 43.894 68.596  24.979  1.00 72.94  ? 347  SER B O   1 
ATOM   6785 C CB  . SER B 1 347 ? 45.397 71.446  25.615  1.00 76.67  ? 347  SER B CB  1 
ATOM   6786 O OG  . SER B 1 347 ? 44.331 72.059  26.338  1.00 78.16  ? 347  SER B OG  1 
ATOM   6787 N N   . LYS B 1 348 ? 43.493 69.339  27.063  1.00 72.16  ? 348  LYS B N   1 
ATOM   6788 C CA  . LYS B 1 348 ? 42.140 68.785  27.116  1.00 71.83  ? 348  LYS B CA  1 
ATOM   6789 C C   . LYS B 1 348 ? 41.121 69.727  26.454  1.00 74.72  ? 348  LYS B C   1 
ATOM   6790 O O   . LYS B 1 348 ? 40.038 69.294  26.048  1.00 75.10  ? 348  LYS B O   1 
ATOM   6791 C CB  . LYS B 1 348 ? 41.723 68.497  28.563  1.00 70.43  ? 348  LYS B CB  1 
ATOM   6792 C CG  . LYS B 1 348 ? 41.297 69.729  29.371  1.00 71.74  ? 348  LYS B CG  1 
ATOM   6793 C CD  . LYS B 1 348 ? 40.306 69.361  30.470  1.00 70.50  ? 348  LYS B CD  1 
ATOM   6794 C CE  . LYS B 1 348 ? 39.906 70.573  31.316  1.00 72.13  ? 348  LYS B CE  1 
ATOM   6795 N NZ  . LYS B 1 348 ? 38.837 71.430  30.703  1.00 73.37  ? 348  LYS B NZ  1 
ATOM   6796 N N   . ASP B 1 349 ? 41.475 71.008  26.353  1.00 76.62  ? 349  ASP B N   1 
ATOM   6797 C CA  . ASP B 1 349 ? 40.549 72.038  25.876  1.00 79.70  ? 349  ASP B CA  1 
ATOM   6798 C C   . ASP B 1 349 ? 40.490 72.176  24.339  1.00 81.29  ? 349  ASP B C   1 
ATOM   6799 O O   . ASP B 1 349 ? 39.778 73.038  23.822  1.00 83.77  ? 349  ASP B O   1 
ATOM   6800 C CB  . ASP B 1 349 ? 40.851 73.386  26.555  1.00 81.39  ? 349  ASP B CB  1 
ATOM   6801 C CG  . ASP B 1 349 ? 40.713 73.322  28.079  1.00 80.60  ? 349  ASP B CG  1 
ATOM   6802 O OD1 . ASP B 1 349 ? 39.790 72.627  28.561  1.00 80.25  ? 349  ASP B OD1 1 
ATOM   6803 O OD2 . ASP B 1 349 ? 41.520 73.965  28.796  1.00 79.71  ? 349  ASP B OD2 1 
ATOM   6804 N N   . ASN B 1 350 ? 41.235 71.327  23.625  1.00 79.72  ? 350  ASN B N   1 
ATOM   6805 C CA  . ASN B 1 350 ? 41.166 71.255  22.159  1.00 80.74  ? 350  ASN B CA  1 
ATOM   6806 C C   . ASN B 1 350 ? 41.499 69.863  21.593  1.00 78.53  ? 350  ASN B C   1 
ATOM   6807 O O   . ASN B 1 350 ? 41.824 68.930  22.335  1.00 76.13  ? 350  ASN B O   1 
ATOM   6808 C CB  . ASN B 1 350 ? 42.013 72.359  21.488  1.00 82.77  ? 350  ASN B CB  1 
ATOM   6809 C CG  . ASN B 1 350 ? 43.520 72.144  21.642  1.00 81.61  ? 350  ASN B CG  1 
ATOM   6810 O OD1 . ASN B 1 350 ? 44.034 71.027  21.498  1.00 79.93  ? 350  ASN B OD1 1 
ATOM   6811 N ND2 . ASN B 1 350 ? 44.238 73.226  21.915  1.00 82.01  ? 350  ASN B ND2 1 
ATOM   6812 N N   . GLU B 1 351 ? 41.429 69.755  20.269  1.00 79.48  ? 351  GLU B N   1 
ATOM   6813 C CA  . GLU B 1 351 ? 41.591 68.503  19.539  1.00 77.75  ? 351  GLU B CA  1 
ATOM   6814 C C   . GLU B 1 351 ? 43.008 67.918  19.578  1.00 75.13  ? 351  GLU B C   1 
ATOM   6815 O O   . GLU B 1 351 ? 43.205 66.753  19.231  1.00 73.59  ? 351  GLU B O   1 
ATOM   6816 C CB  . GLU B 1 351 ? 41.173 68.719  18.085  1.00 80.64  ? 351  GLU B CB  1 
ATOM   6817 C CG  . GLU B 1 351 ? 39.692 69.047  17.877  1.00 85.09  ? 351  GLU B CG  1 
ATOM   6818 C CD  . GLU B 1 351 ? 38.831 67.797  17.725  1.00 87.09  ? 351  GLU B CD  1 
ATOM   6819 O OE1 . GLU B 1 351 ? 38.206 67.644  16.643  1.00 88.95  ? 351  GLU B OE1 1 
ATOM   6820 O OE2 . GLU B 1 351 ? 38.795 66.972  18.679  1.00 85.00  ? 351  GLU B OE2 1 
ATOM   6821 N N   . SER B 1 352 ? 43.981 68.731  19.989  1.00 74.73  ? 352  SER B N   1 
ATOM   6822 C CA  . SER B 1 352 ? 45.393 68.338  20.076  1.00 72.85  ? 352  SER B CA  1 
ATOM   6823 C C   . SER B 1 352 ? 45.950 67.693  18.804  1.00 72.47  ? 352  SER B C   1 
ATOM   6824 O O   . SER B 1 352 ? 46.540 66.608  18.843  1.00 70.60  ? 352  SER B O   1 
ATOM   6825 C CB  . SER B 1 352 ? 45.639 67.443  21.299  1.00 70.24  ? 352  SER B CB  1 
ATOM   6826 O OG  . SER B 1 352 ? 45.715 68.220  22.483  1.00 71.25  ? 352  SER B OG  1 
ATOM   6827 N N   . LEU B 1 353 ? 45.760 68.367  17.678  1.00 74.12  ? 353  LEU B N   1 
ATOM   6828 C CA  . LEU B 1 353 ? 46.314 67.910  16.417  1.00 74.26  ? 353  LEU B CA  1 
ATOM   6829 C C   . LEU B 1 353 ? 47.707 68.504  16.281  1.00 74.74  ? 353  LEU B C   1 
ATOM   6830 O O   . LEU B 1 353 ? 47.864 69.714  16.169  1.00 77.02  ? 353  LEU B O   1 
ATOM   6831 C CB  . LEU B 1 353 ? 45.412 68.310  15.242  1.00 76.63  ? 353  LEU B CB  1 
ATOM   6832 C CG  . LEU B 1 353 ? 43.939 67.859  15.250  1.00 76.83  ? 353  LEU B CG  1 
ATOM   6833 C CD1 . LEU B 1 353 ? 43.134 68.575  14.160  1.00 79.37  ? 353  LEU B CD1 1 
ATOM   6834 C CD2 . LEU B 1 353 ? 43.773 66.333  15.131  1.00 74.92  ? 353  LEU B CD2 1 
ATOM   6835 N N   . ILE B 1 354 ? 48.719 67.643  16.303  1.00 72.85  ? 354  ILE B N   1 
ATOM   6836 C CA  . ILE B 1 354 ? 50.115 68.078  16.341  1.00 72.96  ? 354  ILE B CA  1 
ATOM   6837 C C   . ILE B 1 354 ? 50.834 67.949  14.999  1.00 74.32  ? 354  ILE B C   1 
ATOM   6838 O O   . ILE B 1 354 ? 50.313 67.348  14.057  1.00 74.49  ? 354  ILE B O   1 
ATOM   6839 C CB  . ILE B 1 354 ? 50.907 67.317  17.426  1.00 70.51  ? 354  ILE B CB  1 
ATOM   6840 C CG1 . ILE B 1 354 ? 50.799 65.799  17.213  1.00 68.24  ? 354  ILE B CG1 1 
ATOM   6841 C CG2 . ILE B 1 354 ? 50.408 67.716  18.817  1.00 69.57  ? 354  ILE B CG2 1 
ATOM   6842 C CD1 . ILE B 1 354 ? 51.798 64.983  18.007  1.00 66.00  ? 354  ILE B CD1 1 
ATOM   6843 N N   . SER B 1 355 ? 52.034 68.525  14.930  1.00 75.46  ? 355  SER B N   1 
ATOM   6844 C CA  . SER B 1 355 ? 52.904 68.438  13.751  1.00 76.84  ? 355  SER B CA  1 
ATOM   6845 C C   . SER B 1 355 ? 53.883 67.266  13.884  1.00 74.91  ? 355  SER B C   1 
ATOM   6846 O O   . SER B 1 355 ? 53.954 66.630  14.949  1.00 72.56  ? 355  SER B O   1 
ATOM   6847 C CB  . SER B 1 355 ? 53.712 69.720  13.633  1.00 79.30  ? 355  SER B CB  1 
ATOM   6848 O OG  . SER B 1 355 ? 54.683 69.755  14.670  1.00 78.68  ? 355  SER B OG  1 
ATOM   6849 N N   . ARG B 1 356 ? 54.644 66.991  12.819  1.00 75.88  ? 356  ARG B N   1 
ATOM   6850 C CA  . ARG B 1 356 ? 55.734 66.012  12.910  1.00 74.75  ? 356  ARG B CA  1 
ATOM   6851 C C   . ARG B 1 356 ? 56.817 66.467  13.885  1.00 74.38  ? 356  ARG B C   1 
ATOM   6852 O O   . ARG B 1 356 ? 57.264 65.689  14.740  1.00 72.16  ? 356  ARG B O   1 
ATOM   6853 C CB  . ARG B 1 356 ? 56.337 65.683  11.549  1.00 76.32  ? 356  ARG B CB  1 
ATOM   6854 C CG  . ARG B 1 356 ? 56.043 64.261  11.123  1.00 76.26  ? 356  ARG B CG  1 
ATOM   6855 C CD  . ARG B 1 356 ? 56.810 63.844  9.870   1.00 80.63  ? 356  ARG B CD  1 
ATOM   6856 N NE  . ARG B 1 356 ? 58.038 63.098  10.155  1.00 81.84  ? 356  ARG B NE  1 
ATOM   6857 C CZ  . ARG B 1 356 ? 58.085 61.841  10.604  1.00 80.80  ? 356  ARG B CZ  1 
ATOM   6858 N NH1 . ARG B 1 356 ? 56.966 61.160  10.859  1.00 78.65  ? 356  ARG B NH1 1 
ATOM   6859 N NH2 . ARG B 1 356 ? 59.265 61.265  10.811  1.00 80.84  ? 356  ARG B NH2 1 
ATOM   6860 N N   . ALA B 1 357 ? 57.211 67.733  13.762  1.00 76.41  ? 357  ALA B N   1 
ATOM   6861 C CA  . ALA B 1 357 ? 58.175 68.337  14.673  1.00 76.39  ? 357  ALA B CA  1 
ATOM   6862 C C   . ALA B 1 357 ? 57.760 68.037  16.108  1.00 73.72  ? 357  ALA B C   1 
ATOM   6863 O O   . ALA B 1 357 ? 58.553 67.521  16.897  1.00 72.30  ? 357  ALA B O   1 
ATOM   6864 C CB  . ALA B 1 357 ? 58.264 69.838  14.430  1.00 79.21  ? 357  ALA B CB  1 
ATOM   6865 N N   . GLN B 1 358 ? 56.496 68.323  16.415  1.00 73.13  ? 358  GLN B N   1 
ATOM   6866 C CA  . GLN B 1 358 ? 55.941 68.117  17.750  1.00 71.06  ? 358  GLN B CA  1 
ATOM   6867 C C   . GLN B 1 358 ? 55.914 66.651  18.153  1.00 68.02  ? 358  GLN B C   1 
ATOM   6868 O O   . GLN B 1 358 ? 56.060 66.324  19.333  1.00 66.33  ? 358  GLN B O   1 
ATOM   6869 C CB  . GLN B 1 358 ? 54.542 68.729  17.854  1.00 71.49  ? 358  GLN B CB  1 
ATOM   6870 C CG  . GLN B 1 358 ? 54.553 70.223  18.133  1.00 74.33  ? 358  GLN B CG  1 
ATOM   6871 C CD  . GLN B 1 358 ? 53.199 70.884  17.905  1.00 76.54  ? 358  GLN B CD  1 
ATOM   6872 O OE1 . GLN B 1 358 ? 52.448 70.492  17.006  1.00 77.57  ? 358  GLN B OE1 1 
ATOM   6873 N NE2 . GLN B 1 358 ? 52.890 71.904  18.708  1.00 76.26  ? 358  GLN B NE2 1 
ATOM   6874 N N   . PHE B 1 359 ? 55.728 65.771  17.173  1.00 67.56  ? 359  PHE B N   1 
ATOM   6875 C CA  . PHE B 1 359 ? 55.739 64.330  17.434  1.00 65.00  ? 359  PHE B CA  1 
ATOM   6876 C C   . PHE B 1 359 ? 57.143 63.830  17.787  1.00 64.64  ? 359  PHE B C   1 
ATOM   6877 O O   . PHE B 1 359 ? 57.298 63.086  18.751  1.00 62.68  ? 359  PHE B O   1 
ATOM   6878 C CB  . PHE B 1 359 ? 55.120 63.546  16.270  1.00 64.68  ? 359  PHE B CB  1 
ATOM   6879 C CG  . PHE B 1 359 ? 55.326 62.056  16.354  1.00 62.41  ? 359  PHE B CG  1 
ATOM   6880 C CD1 . PHE B 1 359 ? 56.099 61.396  15.409  1.00 62.24  ? 359  PHE B CD1 1 
ATOM   6881 C CD2 . PHE B 1 359 ? 54.756 61.313  17.379  1.00 59.97  ? 359  PHE B CD2 1 
ATOM   6882 C CE1 . PHE B 1 359 ? 56.291 60.031  15.487  1.00 60.06  ? 359  PHE B CE1 1 
ATOM   6883 C CE2 . PHE B 1 359 ? 54.954 59.942  17.463  1.00 56.99  ? 359  PHE B CE2 1 
ATOM   6884 C CZ  . PHE B 1 359 ? 55.716 59.306  16.518  1.00 58.05  ? 359  PHE B CZ  1 
ATOM   6885 N N   . LEU B 1 360 ? 58.160 64.259  17.035  1.00 66.86  ? 360  LEU B N   1 
ATOM   6886 C CA  . LEU B 1 360 ? 59.545 63.861  17.326  1.00 67.18  ? 360  LEU B CA  1 
ATOM   6887 C C   . LEU B 1 360 ? 59.964 64.319  18.727  1.00 66.73  ? 360  LEU B C   1 
ATOM   6888 O O   . LEU B 1 360 ? 60.582 63.561  19.476  1.00 65.35  ? 360  LEU B O   1 
ATOM   6889 C CB  . LEU B 1 360 ? 60.540 64.383  16.272  1.00 69.56  ? 360  LEU B CB  1 
ATOM   6890 C CG  . LEU B 1 360 ? 60.247 64.411  14.757  1.00 72.04  ? 360  LEU B CG  1 
ATOM   6891 C CD1 . LEU B 1 360 ? 61.467 64.917  13.977  1.00 75.93  ? 360  LEU B CD1 1 
ATOM   6892 C CD2 . LEU B 1 360 ? 59.761 63.094  14.151  1.00 70.41  ? 360  LEU B CD2 1 
ATOM   6893 N N   . ALA B 1 361 ? 59.600 65.554  19.071  1.00 68.04  ? 361  ALA B N   1 
ATOM   6894 C CA  . ALA B 1 361 ? 59.972 66.167  20.349  1.00 68.22  ? 361  ALA B CA  1 
ATOM   6895 C C   . ALA B 1 361 ? 59.237 65.554  21.534  1.00 65.88  ? 361  ALA B C   1 
ATOM   6896 O O   . ALA B 1 361 ? 59.786 65.476  22.635  1.00 65.40  ? 361  ALA B O   1 
ATOM   6897 C CB  . ALA B 1 361 ? 59.747 67.688  20.304  1.00 70.16  ? 361  ALA B CB  1 
ATOM   6898 N N   . GLY B 1 362 ? 57.993 65.136  21.304  1.00 65.00  ? 362  GLY B N   1 
ATOM   6899 C CA  . GLY B 1 362 ? 57.207 64.393  22.300  1.00 62.96  ? 362  GLY B CA  1 
ATOM   6900 C C   . GLY B 1 362 ? 57.735 62.992  22.582  1.00 61.42  ? 362  GLY B C   1 
ATOM   6901 O O   . GLY B 1 362 ? 57.620 62.498  23.706  1.00 59.74  ? 362  GLY B O   1 
ATOM   6902 N N   . VAL B 1 363 ? 58.313 62.353  21.561  1.00 62.14  ? 363  VAL B N   1 
ATOM   6903 C CA  . VAL B 1 363 ? 58.973 61.051  21.727  1.00 61.37  ? 363  VAL B CA  1 
ATOM   6904 C C   . VAL B 1 363 ? 60.171 61.117  22.692  1.00 61.90  ? 363  VAL B C   1 
ATOM   6905 O O   . VAL B 1 363 ? 60.340 60.214  23.510  1.00 60.36  ? 363  VAL B O   1 
ATOM   6906 C CB  . VAL B 1 363 ? 59.387 60.413  20.367  1.00 62.04  ? 363  VAL B CB  1 
ATOM   6907 C CG1 . VAL B 1 363 ? 60.346 59.243  20.571  1.00 61.34  ? 363  VAL B CG1 1 
ATOM   6908 C CG2 . VAL B 1 363 ? 58.169 59.960  19.587  1.00 61.18  ? 363  VAL B CG2 1 
ATOM   6909 N N   . ARG B 1 364 ? 60.979 62.181  22.607  1.00 64.31  ? 364  ARG B N   1 
ATOM   6910 C CA  . ARG B 1 364 ? 62.146 62.344  23.495  1.00 65.55  ? 364  ARG B CA  1 
ATOM   6911 C C   . ARG B 1 364 ? 61.733 62.506  24.952  1.00 64.78  ? 364  ARG B C   1 
ATOM   6912 O O   . ARG B 1 364 ? 62.471 62.120  25.857  1.00 64.64  ? 364  ARG B O   1 
ATOM   6913 C CB  . ARG B 1 364 ? 63.011 63.540  23.094  1.00 67.87  ? 364  ARG B CB  1 
ATOM   6914 C CG  . ARG B 1 364 ? 63.519 63.523  21.663  1.00 70.83  ? 364  ARG B CG  1 
ATOM   6915 C CD  . ARG B 1 364 ? 64.135 62.188  21.250  1.00 71.56  ? 364  ARG B CD  1 
ATOM   6916 N NE  . ARG B 1 364 ? 65.341 61.829  22.006  1.00 72.55  ? 364  ARG B NE  1 
ATOM   6917 C CZ  . ARG B 1 364 ? 66.590 62.100  21.618  1.00 74.87  ? 364  ARG B CZ  1 
ATOM   6918 N NH1 . ARG B 1 364 ? 66.835 62.748  20.480  1.00 75.11  ? 364  ARG B NH1 1 
ATOM   6919 N NH2 . ARG B 1 364 ? 67.606 61.719  22.380  1.00 75.75  ? 364  ARG B NH2 1 
ATOM   6920 N N   . ILE B 1 365 ? 60.558 63.091  25.166  1.00 64.93  ? 365  ILE B N   1 
ATOM   6921 C CA  . ILE B 1 365 ? 60.017 63.303  26.502  1.00 64.11  ? 365  ILE B CA  1 
ATOM   6922 C C   . ILE B 1 365 ? 59.324 62.025  26.973  1.00 62.36  ? 365  ILE B C   1 
ATOM   6923 O O   . ILE B 1 365 ? 59.425 61.652  28.153  1.00 61.50  ? 365  ILE B O   1 
ATOM   6924 C CB  . ILE B 1 365 ? 59.050 64.525  26.525  1.00 64.97  ? 365  ILE B CB  1 
ATOM   6925 C CG1 . ILE B 1 365 ? 59.823 65.819  26.231  1.00 66.83  ? 365  ILE B CG1 1 
ATOM   6926 C CG2 . ILE B 1 365 ? 58.295 64.621  27.858  1.00 63.91  ? 365  ILE B CG2 1 
ATOM   6927 C CD1 . ILE B 1 365 ? 58.956 67.014  25.947  1.00 67.85  ? 365  ILE B CD1 1 
ATOM   6928 N N   . GLY B 1 366 ? 58.637 61.353  26.046  1.00 62.02  ? 366  GLY B N   1 
ATOM   6929 C CA  . GLY B 1 366 ? 57.923 60.102  26.354  1.00 60.46  ? 366  GLY B CA  1 
ATOM   6930 C C   . GLY B 1 366 ? 58.832 58.899  26.567  1.00 59.73  ? 366  GLY B C   1 
ATOM   6931 O O   . GLY B 1 366 ? 58.484 57.969  27.286  1.00 58.56  ? 366  GLY B O   1 
ATOM   6932 N N   . VAL B 1 367 ? 59.993 58.913  25.920  1.00 60.94  ? 367  VAL B N   1 
ATOM   6933 C CA  . VAL B 1 367 ? 61.001 57.876  26.086  1.00 60.69  ? 367  VAL B CA  1 
ATOM   6934 C C   . VAL B 1 367 ? 62.288 58.589  26.501  1.00 62.89  ? 367  VAL B C   1 
ATOM   6935 O O   . VAL B 1 367 ? 63.218 58.732  25.703  1.00 64.37  ? 367  VAL B O   1 
ATOM   6936 C CB  . VAL B 1 367 ? 61.179 57.029  24.790  1.00 60.76  ? 367  VAL B CB  1 
ATOM   6937 C CG1 . VAL B 1 367 ? 62.070 55.820  25.043  1.00 59.53  ? 367  VAL B CG1 1 
ATOM   6938 C CG2 . VAL B 1 367 ? 59.827 56.567  24.265  1.00 58.94  ? 367  VAL B CG2 1 
ATOM   6939 N N   . PRO B 1 368 ? 62.331 59.068  27.761  1.00 63.36  ? 368  PRO B N   1 
ATOM   6940 C CA  . PRO B 1 368 ? 63.406 59.950  28.228  1.00 65.19  ? 368  PRO B CA  1 
ATOM   6941 C C   . PRO B 1 368 ? 64.772 59.289  28.217  1.00 66.65  ? 368  PRO B C   1 
ATOM   6942 O O   . PRO B 1 368 ? 65.802 59.976  28.144  1.00 68.53  ? 368  PRO B O   1 
ATOM   6943 C CB  . PRO B 1 368 ? 62.993 60.289  29.665  1.00 64.32  ? 368  PRO B CB  1 
ATOM   6944 C CG  . PRO B 1 368 ? 62.052 59.198  30.075  1.00 62.48  ? 368  PRO B CG  1 
ATOM   6945 C CD  . PRO B 1 368 ? 61.334 58.800  28.821  1.00 61.76  ? 368  PRO B CD  1 
ATOM   6946 N N   . GLN B 1 369 ? 64.779 57.964  28.279  1.00 66.27  ? 369  GLN B N   1 
ATOM   6947 C CA  . GLN B 1 369 ? 66.027 57.212  28.323  1.00 68.00  ? 369  GLN B CA  1 
ATOM   6948 C C   . GLN B 1 369 ? 66.567 56.908  26.932  1.00 69.14  ? 369  GLN B C   1 
ATOM   6949 O O   . GLN B 1 369 ? 67.663 56.374  26.813  1.00 70.68  ? 369  GLN B O   1 
ATOM   6950 C CB  . GLN B 1 369 ? 65.858 55.919  29.134  1.00 66.70  ? 369  GLN B CB  1 
ATOM   6951 C CG  . GLN B 1 369 ? 65.108 54.783  28.413  1.00 67.89  ? 369  GLN B CG  1 
ATOM   6952 C CD  . GLN B 1 369 ? 63.575 54.907  28.444  1.00 68.85  ? 369  GLN B CD  1 
ATOM   6953 O OE1 . GLN B 1 369 ? 62.874 54.053  27.902  1.00 70.38  ? 369  GLN B OE1 1 
ATOM   6954 N NE2 . GLN B 1 369 ? 63.058 55.956  29.073  1.00 67.97  ? 369  GLN B NE2 1 
ATOM   6955 N N   . ALA B 1 370 ? 65.807 57.256  25.891  1.00 69.00  ? 370  ALA B N   1 
ATOM   6956 C CA  . ALA B 1 370 ? 66.186 56.944  24.503  1.00 70.09  ? 370  ALA B CA  1 
ATOM   6957 C C   . ALA B 1 370 ? 67.362 57.756  23.964  1.00 72.47  ? 370  ALA B C   1 
ATOM   6958 O O   . ALA B 1 370 ? 67.408 58.980  24.114  1.00 73.65  ? 370  ALA B O   1 
ATOM   6959 C CB  . ALA B 1 370 ? 64.988 57.096  23.574  1.00 69.39  ? 370  ALA B CB  1 
ATOM   6960 N N   . SER B 1 371 ? 68.301 57.071  23.321  1.00 73.50  ? 371  SER B N   1 
ATOM   6961 C CA  . SER B 1 371 ? 69.361 57.753  22.585  1.00 76.21  ? 371  SER B CA  1 
ATOM   6962 C C   . SER B 1 371 ? 68.796 58.277  21.263  1.00 76.97  ? 371  SER B C   1 
ATOM   6963 O O   . SER B 1 371 ? 67.671 57.938  20.892  1.00 75.83  ? 371  SER B O   1 
ATOM   6964 C CB  . SER B 1 371 ? 70.544 56.814  22.339  1.00 77.25  ? 371  SER B CB  1 
ATOM   6965 O OG  . SER B 1 371 ? 70.269 55.888  21.306  1.00 77.21  ? 371  SER B OG  1 
ATOM   6966 N N   . ASP B 1 372 ? 69.566 59.103  20.558  1.00 79.19  ? 372  ASP B N   1 
ATOM   6967 C CA  . ASP B 1 372 ? 69.134 59.628  19.264  1.00 80.14  ? 372  ASP B CA  1 
ATOM   6968 C C   . ASP B 1 372 ? 68.612 58.514  18.352  1.00 78.96  ? 372  ASP B C   1 
ATOM   6969 O O   . ASP B 1 372 ? 67.494 58.599  17.844  1.00 78.30  ? 372  ASP B O   1 
ATOM   6970 C CB  . ASP B 1 372 ? 70.268 60.399  18.579  1.00 83.13  ? 372  ASP B CB  1 
ATOM   6971 C CG  . ASP B 1 372 ? 70.669 61.662  19.339  1.00 84.98  ? 372  ASP B CG  1 
ATOM   6972 O OD1 . ASP B 1 372 ? 70.205 61.860  20.491  1.00 83.76  ? 372  ASP B OD1 1 
ATOM   6973 O OD2 . ASP B 1 372 ? 71.454 62.460  18.776  1.00 87.12  ? 372  ASP B OD2 1 
ATOM   6974 N N   . LEU B 1 373 ? 69.412 57.463  18.179  1.00 78.73  ? 373  LEU B N   1 
ATOM   6975 C CA  . LEU B 1 373 ? 69.067 56.353  17.293  1.00 77.66  ? 373  LEU B CA  1 
ATOM   6976 C C   . LEU B 1 373 ? 67.769 55.651  17.688  1.00 74.84  ? 373  LEU B C   1 
ATOM   6977 O O   . LEU B 1 373 ? 66.912 55.399  16.839  1.00 74.33  ? 373  LEU B O   1 
ATOM   6978 C CB  . LEU B 1 373 ? 70.219 55.349  17.244  1.00 78.60  ? 373  LEU B CB  1 
ATOM   6979 C CG  . LEU B 1 373 ? 70.143 54.143  16.304  1.00 78.40  ? 373  LEU B CG  1 
ATOM   6980 C CD1 . LEU B 1 373 ? 70.143 54.560  14.832  1.00 79.89  ? 373  LEU B CD1 1 
ATOM   6981 C CD2 . LEU B 1 373 ? 71.315 53.242  16.599  1.00 79.08  ? 373  LEU B CD2 1 
ATOM   6982 N N   . ALA B 1 374 ? 67.635 55.347  18.978  1.00 72.88  ? 374  ALA B N   1 
ATOM   6983 C CA  . ALA B 1 374 ? 66.473 54.643  19.512  1.00 70.06  ? 374  ALA B CA  1 
ATOM   6984 C C   . ALA B 1 374 ? 65.177 55.436  19.350  1.00 68.87  ? 374  ALA B C   1 
ATOM   6985 O O   . ALA B 1 374 ? 64.116 54.861  19.112  1.00 67.52  ? 374  ALA B O   1 
ATOM   6986 C CB  . ALA B 1 374 ? 66.705 54.288  20.980  1.00 69.05  ? 374  ALA B CB  1 
ATOM   6987 N N   . ALA B 1 375 ? 65.281 56.753  19.492  1.00 69.38  ? 375  ALA B N   1 
ATOM   6988 C CA  . ALA B 1 375 ? 64.153 57.664  19.342  1.00 68.48  ? 375  ALA B CA  1 
ATOM   6989 C C   . ALA B 1 375 ? 63.674 57.691  17.899  1.00 68.93  ? 375  ALA B C   1 
ATOM   6990 O O   . ALA B 1 375 ? 62.475 57.664  17.634  1.00 67.93  ? 375  ALA B O   1 
ATOM   6991 C CB  . ALA B 1 375 ? 64.551 59.062  19.788  1.00 69.78  ? 375  ALA B CB  1 
ATOM   6992 N N   . GLU B 1 376 ? 64.610 57.741  16.963  1.00 70.36  ? 376  GLU B N   1 
ATOM   6993 C CA  . GLU B 1 376 ? 64.231 57.718  15.560  1.00 71.33  ? 376  GLU B CA  1 
ATOM   6994 C C   . GLU B 1 376 ? 63.676 56.345  15.168  1.00 69.38  ? 376  GLU B C   1 
ATOM   6995 O O   . GLU B 1 376 ? 62.768 56.266  14.346  1.00 69.62  ? 376  GLU B O   1 
ATOM   6996 C CB  . GLU B 1 376 ? 65.378 58.179  14.650  1.00 74.04  ? 376  GLU B CB  1 
ATOM   6997 C CG  . GLU B 1 376 ? 64.918 58.675  13.257  1.00 78.04  ? 376  GLU B CG  1 
ATOM   6998 C CD  . GLU B 1 376 ? 64.124 60.007  13.253  1.00 80.91  ? 376  GLU B CD  1 
ATOM   6999 O OE1 . GLU B 1 376 ? 63.962 60.656  14.318  1.00 81.28  ? 376  GLU B OE1 1 
ATOM   7000 O OE2 . GLU B 1 376 ? 63.650 60.403  12.161  1.00 82.08  ? 376  GLU B OE2 1 
ATOM   7001 N N   . ALA B 1 377 ? 64.190 55.278  15.781  1.00 67.37  ? 377  ALA B N   1 
ATOM   7002 C CA  . ALA B 1 377 ? 63.599 53.951  15.625  1.00 65.25  ? 377  ALA B CA  1 
ATOM   7003 C C   . ALA B 1 377 ? 62.145 53.941  16.081  1.00 63.21  ? 377  ALA B C   1 
ATOM   7004 O O   . ALA B 1 377 ? 61.295 53.363  15.410  1.00 62.65  ? 377  ALA B O   1 
ATOM   7005 C CB  . ALA B 1 377 ? 64.395 52.901  16.380  1.00 64.61  ? 377  ALA B CB  1 
ATOM   7006 N N   . VAL B 1 378 ? 61.870 54.579  17.221  1.00 61.91  ? 378  VAL B N   1 
ATOM   7007 C CA  . VAL B 1 378 ? 60.506 54.748  17.721  1.00 60.10  ? 378  VAL B CA  1 
ATOM   7008 C C   . VAL B 1 378 ? 59.646 55.526  16.729  1.00 60.98  ? 378  VAL B C   1 
ATOM   7009 O O   . VAL B 1 378 ? 58.553 55.079  16.377  1.00 60.14  ? 378  VAL B O   1 
ATOM   7010 C CB  . VAL B 1 378 ? 60.481 55.417  19.113  1.00 59.32  ? 378  VAL B CB  1 
ATOM   7011 C CG1 . VAL B 1 378 ? 59.068 55.842  19.505  1.00 57.95  ? 378  VAL B CG1 1 
ATOM   7012 C CG2 . VAL B 1 378 ? 61.055 54.466  20.161  1.00 58.92  ? 378  VAL B CG2 1 
ATOM   7013 N N   . VAL B 1 379 ? 60.150 56.671  16.266  1.00 62.71  ? 379  VAL B N   1 
ATOM   7014 C CA  . VAL B 1 379 ? 59.416 57.525  15.331  1.00 63.84  ? 379  VAL B CA  1 
ATOM   7015 C C   . VAL B 1 379 ? 59.113 56.775  14.035  1.00 64.75  ? 379  VAL B C   1 
ATOM   7016 O O   . VAL B 1 379 ? 57.965 56.739  13.573  1.00 64.45  ? 379  VAL B O   1 
ATOM   7017 C CB  . VAL B 1 379 ? 60.180 58.843  15.026  1.00 65.87  ? 379  VAL B CB  1 
ATOM   7018 C CG1 . VAL B 1 379 ? 59.605 59.540  13.800  1.00 66.57  ? 379  VAL B CG1 1 
ATOM   7019 C CG2 . VAL B 1 379 ? 60.150 59.774  16.238  1.00 65.19  ? 379  VAL B CG2 1 
ATOM   7020 N N   . LEU B 1 380 ? 60.142 56.161  13.464  1.00 65.72  ? 380  LEU B N   1 
ATOM   7021 C CA  . LEU B 1 380 ? 59.981 55.451  12.212  1.00 66.86  ? 380  LEU B CA  1 
ATOM   7022 C C   . LEU B 1 380 ? 58.975 54.310  12.361  1.00 65.25  ? 380  LEU B C   1 
ATOM   7023 O O   . LEU B 1 380 ? 58.187 54.041  11.450  1.00 66.13  ? 380  LEU B O   1 
ATOM   7024 C CB  . LEU B 1 380 ? 61.343 55.004  11.633  1.00 68.34  ? 380  LEU B CB  1 
ATOM   7025 C CG  . LEU B 1 380 ? 62.338 56.122  11.190  1.00 71.36  ? 380  LEU B CG  1 
ATOM   7026 C CD1 . LEU B 1 380 ? 63.495 55.609  10.342  1.00 73.09  ? 380  LEU B CD1 1 
ATOM   7027 C CD2 . LEU B 1 380 ? 61.693 57.303  10.455  1.00 72.93  ? 380  LEU B CD2 1 
ATOM   7028 N N   . HIS B 1 381 ? 58.964 53.681  13.529  1.00 63.29  ? 381  HIS B N   1 
ATOM   7029 C CA  . HIS B 1 381 ? 58.055 52.569  13.801  1.00 61.72  ? 381  HIS B CA  1 
ATOM   7030 C C   . HIS B 1 381 ? 56.582 52.980  13.998  1.00 60.30  ? 381  HIS B C   1 
ATOM   7031 O O   . HIS B 1 381 ? 55.675 52.226  13.663  1.00 59.54  ? 381  HIS B O   1 
ATOM   7032 C CB  . HIS B 1 381 ? 58.544 51.776  15.018  1.00 60.81  ? 381  HIS B CB  1 
ATOM   7033 C CG  . HIS B 1 381 ? 57.752 50.538  15.278  1.00 61.49  ? 381  HIS B CG  1 
ATOM   7034 N ND1 . HIS B 1 381 ? 58.109 49.308  14.765  1.00 63.59  ? 381  HIS B ND1 1 
ATOM   7035 C CD2 . HIS B 1 381 ? 56.600 50.346  15.967  1.00 61.60  ? 381  HIS B CD2 1 
ATOM   7036 C CE1 . HIS B 1 381 ? 57.210 48.411  15.132  1.00 64.25  ? 381  HIS B CE1 1 
ATOM   7037 N NE2 . HIS B 1 381 ? 56.286 49.014  15.865  1.00 62.91  ? 381  HIS B NE2 1 
ATOM   7038 N N   . TYR B 1 382 ? 56.344 54.163  14.551  1.00 59.88  ? 382  TYR B N   1 
ATOM   7039 C CA  . TYR B 1 382 ? 54.975 54.609  14.805  1.00 58.80  ? 382  TYR B CA  1 
ATOM   7040 C C   . TYR B 1 382 ? 54.420 55.562  13.746  1.00 60.60  ? 382  TYR B C   1 
ATOM   7041 O O   . TYR B 1 382 ? 53.253 55.956  13.810  1.00 61.02  ? 382  TYR B O   1 
ATOM   7042 C CB  . TYR B 1 382 ? 54.856 55.228  16.200  1.00 57.47  ? 382  TYR B CB  1 
ATOM   7043 C CG  . TYR B 1 382 ? 54.735 54.221  17.328  1.00 54.55  ? 382  TYR B CG  1 
ATOM   7044 C CD1 . TYR B 1 382 ? 55.864 53.629  17.886  1.00 53.93  ? 382  TYR B CD1 1 
ATOM   7045 C CD2 . TYR B 1 382 ? 53.494 53.871  17.837  1.00 52.61  ? 382  TYR B CD2 1 
ATOM   7046 C CE1 . TYR B 1 382 ? 55.758 52.704  18.926  1.00 52.98  ? 382  TYR B CE1 1 
ATOM   7047 C CE2 . TYR B 1 382 ? 53.371 52.961  18.882  1.00 52.30  ? 382  TYR B CE2 1 
ATOM   7048 C CZ  . TYR B 1 382 ? 54.509 52.378  19.426  1.00 52.22  ? 382  TYR B CZ  1 
ATOM   7049 O OH  . TYR B 1 382 ? 54.393 51.471  20.462  1.00 50.43  ? 382  TYR B OH  1 
ATOM   7050 N N   . THR B 1 383 ? 55.242 55.940  12.775  1.00 62.01  ? 383  THR B N   1 
ATOM   7051 C CA  . THR B 1 383 ? 54.759 56.767  11.685  1.00 63.84  ? 383  THR B CA  1 
ATOM   7052 C C   . THR B 1 383 ? 53.884 55.920  10.765  1.00 64.52  ? 383  THR B C   1 
ATOM   7053 O O   . THR B 1 383 ? 54.160 54.739  10.557  1.00 63.92  ? 383  THR B O   1 
ATOM   7054 C CB  . THR B 1 383 ? 55.929 57.397  10.907  1.00 65.53  ? 383  THR B CB  1 
ATOM   7055 O OG1 . THR B 1 383 ? 56.659 58.262  11.782  1.00 65.05  ? 383  THR B OG1 1 
ATOM   7056 C CG2 . THR B 1 383 ? 55.441 58.202  9.718   1.00 67.07  ? 383  THR B CG2 1 
ATOM   7057 N N   . ASP B 1 384 ? 52.809 56.520  10.257  1.00 66.08  ? 384  ASP B N   1 
ATOM   7058 C CA  . ASP B 1 384 ? 52.036 55.946  9.157   1.00 67.48  ? 384  ASP B CA  1 
ATOM   7059 C C   . ASP B 1 384 ? 52.615 56.479  7.843   1.00 69.62  ? 384  ASP B C   1 
ATOM   7060 O O   . ASP B 1 384 ? 52.376 57.626  7.473   1.00 71.17  ? 384  ASP B O   1 
ATOM   7061 C CB  . ASP B 1 384 ? 50.553 56.324  9.272   1.00 67.95  ? 384  ASP B CB  1 
ATOM   7062 C CG  . ASP B 1 384 ? 49.634 55.364  8.510   1.00 69.43  ? 384  ASP B CG  1 
ATOM   7063 O OD1 . ASP B 1 384 ? 49.638 55.368  7.255   1.00 70.56  ? 384  ASP B OD1 1 
ATOM   7064 O OD2 . ASP B 1 384 ? 48.900 54.605  9.186   1.00 70.32  ? 384  ASP B OD2 1 
ATOM   7065 N N   . TRP B 1 385 ? 53.367 55.644  7.136   1.00 69.84  ? 385  TRP B N   1 
ATOM   7066 C CA  . TRP B 1 385 ? 54.093 56.111  5.951   1.00 72.03  ? 385  TRP B CA  1 
ATOM   7067 C C   . TRP B 1 385 ? 53.212 56.441  4.744   1.00 74.43  ? 385  TRP B C   1 
ATOM   7068 O O   . TRP B 1 385 ? 53.683 57.010  3.752   1.00 76.64  ? 385  TRP B O   1 
ATOM   7069 C CB  . TRP B 1 385 ? 55.274 55.188  5.631   1.00 71.49  ? 385  TRP B CB  1 
ATOM   7070 C CG  . TRP B 1 385 ? 56.255 55.264  6.740   1.00 69.43  ? 385  TRP B CG  1 
ATOM   7071 C CD1 . TRP B 1 385 ? 56.387 54.393  7.780   1.00 67.39  ? 385  TRP B CD1 1 
ATOM   7072 C CD2 . TRP B 1 385 ? 57.178 56.325  6.985   1.00 69.72  ? 385  TRP B CD2 1 
ATOM   7073 N NE1 . TRP B 1 385 ? 57.365 54.830  8.645   1.00 67.03  ? 385  TRP B NE1 1 
ATOM   7074 C CE2 . TRP B 1 385 ? 57.866 56.014  8.176   1.00 68.62  ? 385  TRP B CE2 1 
ATOM   7075 C CE3 . TRP B 1 385 ? 57.505 57.502  6.302   1.00 72.12  ? 385  TRP B CE3 1 
ATOM   7076 C CZ2 . TRP B 1 385 ? 58.865 56.831  8.694   1.00 69.41  ? 385  TRP B CZ2 1 
ATOM   7077 C CZ3 . TRP B 1 385 ? 58.495 58.316  6.820   1.00 73.16  ? 385  TRP B CZ3 1 
ATOM   7078 C CH2 . TRP B 1 385 ? 59.163 57.977  8.006   1.00 71.68  ? 385  TRP B CH2 1 
ATOM   7079 N N   . LEU B 1 386 ? 51.929 56.102  4.856   1.00 74.34  ? 386  LEU B N   1 
ATOM   7080 C CA  . LEU B 1 386 ? 50.921 56.517  3.887   1.00 76.79  ? 386  LEU B CA  1 
ATOM   7081 C C   . LEU B 1 386 ? 50.428 57.936  4.164   1.00 77.91  ? 386  LEU B C   1 
ATOM   7082 O O   . LEU B 1 386 ? 50.029 58.657  3.249   1.00 79.83  ? 386  LEU B O   1 
ATOM   7083 C CB  . LEU B 1 386 ? 49.744 55.544  3.907   1.00 76.10  ? 386  LEU B CB  1 
ATOM   7084 C CG  . LEU B 1 386 ? 49.714 54.486  2.806   1.00 77.61  ? 386  LEU B CG  1 
ATOM   7085 C CD1 . LEU B 1 386 ? 48.729 53.376  3.176   1.00 77.52  ? 386  LEU B CD1 1 
ATOM   7086 C CD2 . LEU B 1 386 ? 49.356 55.125  1.468   1.00 79.75  ? 386  LEU B CD2 1 
ATOM   7087 N N   . HIS B 1 387 ? 50.455 58.308  5.444   1.00 76.83  ? 387  HIS B N   1 
ATOM   7088 C CA  . HIS B 1 387 ? 50.023 59.623  5.923   1.00 77.98  ? 387  HIS B CA  1 
ATOM   7089 C C   . HIS B 1 387 ? 51.037 60.141  6.952   1.00 76.70  ? 387  HIS B C   1 
ATOM   7090 O O   . HIS B 1 387 ? 50.696 60.337  8.125   1.00 75.25  ? 387  HIS B O   1 
ATOM   7091 C CB  . HIS B 1 387 ? 48.624 59.534  6.557   1.00 77.47  ? 387  HIS B CB  1 
ATOM   7092 C CG  . HIS B 1 387 ? 47.588 58.918  5.666   1.00 79.83  ? 387  HIS B CG  1 
ATOM   7093 N ND1 . HIS B 1 387 ? 47.129 57.627  5.840   1.00 78.83  ? 387  HIS B ND1 1 
ATOM   7094 C CD2 . HIS B 1 387 ? 46.932 59.411  4.586   1.00 83.42  ? 387  HIS B CD2 1 
ATOM   7095 C CE1 . HIS B 1 387 ? 46.233 57.353  4.908   1.00 81.12  ? 387  HIS B CE1 1 
ATOM   7096 N NE2 . HIS B 1 387 ? 46.095 58.418  4.133   1.00 84.06  ? 387  HIS B NE2 1 
ATOM   7097 N N   . PRO B 1 388 ? 52.293 60.364  6.518   1.00 77.44  ? 388  PRO B N   1 
ATOM   7098 C CA  . PRO B 1 388 ? 53.368 60.685  7.465   1.00 76.51  ? 388  PRO B CA  1 
ATOM   7099 C C   . PRO B 1 388 ? 53.187 61.993  8.239   1.00 76.91  ? 388  PRO B C   1 
ATOM   7100 O O   . PRO B 1 388 ? 53.783 62.148  9.310   1.00 75.54  ? 388  PRO B O   1 
ATOM   7101 C CB  . PRO B 1 388 ? 54.616 60.762  6.573   1.00 78.37  ? 388  PRO B CB  1 
ATOM   7102 C CG  . PRO B 1 388 ? 54.105 61.010  5.201   1.00 80.21  ? 388  PRO B CG  1 
ATOM   7103 C CD  . PRO B 1 388 ? 52.782 60.323  5.126   1.00 79.42  ? 388  PRO B CD  1 
ATOM   7104 N N   . GLU B 1 389 ? 52.377 62.912  7.707   1.00 78.69  ? 389  GLU B N   1 
ATOM   7105 C CA  . GLU B 1 389 ? 52.219 64.250  8.301   1.00 79.70  ? 389  GLU B CA  1 
ATOM   7106 C C   . GLU B 1 389 ? 50.783 64.598  8.703   1.00 79.31  ? 389  GLU B C   1 
ATOM   7107 O O   . GLU B 1 389 ? 50.486 65.758  9.025   1.00 80.69  ? 389  GLU B O   1 
ATOM   7108 C CB  . GLU B 1 389 ? 52.782 65.328  7.369   1.00 82.69  ? 389  GLU B CB  1 
ATOM   7109 C CG  . GLU B 1 389 ? 54.007 64.862  6.594   1.00 84.77  ? 389  GLU B CG  1 
ATOM   7110 C CD  . GLU B 1 389 ? 54.983 65.971  6.286   1.00 87.64  ? 389  GLU B CD  1 
ATOM   7111 O OE1 . GLU B 1 389 ? 55.381 66.698  7.228   1.00 87.40  ? 389  GLU B OE1 1 
ATOM   7112 O OE2 . GLU B 1 389 ? 55.366 66.090  5.102   1.00 89.45  ? 389  GLU B OE2 1 
ATOM   7113 N N   . ASP B 1 390 ? 49.900 63.600  8.690   1.00 77.49  ? 390  ASP B N   1 
ATOM   7114 C CA  . ASP B 1 390 ? 48.515 63.791  9.108   1.00 77.05  ? 390  ASP B CA  1 
ATOM   7115 C C   . ASP B 1 390 ? 48.445 63.977  10.622  1.00 74.94  ? 390  ASP B C   1 
ATOM   7116 O O   . ASP B 1 390 ? 48.865 63.093  11.364  1.00 72.70  ? 390  ASP B O   1 
ATOM   7117 C CB  . ASP B 1 390 ? 47.656 62.605  8.677   1.00 76.39  ? 390  ASP B CB  1 
ATOM   7118 C CG  . ASP B 1 390 ? 46.252 62.677  9.230   1.00 76.60  ? 390  ASP B CG  1 
ATOM   7119 O OD1 . ASP B 1 390 ? 45.496 63.592  8.837   1.00 78.54  ? 390  ASP B OD1 1 
ATOM   7120 O OD2 . ASP B 1 390 ? 45.906 61.818  10.066  1.00 75.37  ? 390  ASP B OD2 1 
ATOM   7121 N N   . PRO B 1 391 ? 47.908 65.127  11.082  1.00 76.00  ? 391  PRO B N   1 
ATOM   7122 C CA  . PRO B 1 391 ? 47.924 65.500  12.502  1.00 74.68  ? 391  PRO B CA  1 
ATOM   7123 C C   . PRO B 1 391 ? 47.116 64.595  13.437  1.00 72.64  ? 391  PRO B C   1 
ATOM   7124 O O   . PRO B 1 391 ? 47.457 64.496  14.617  1.00 71.00  ? 391  PRO B O   1 
ATOM   7125 C CB  . PRO B 1 391 ? 47.343 66.919  12.497  1.00 77.03  ? 391  PRO B CB  1 
ATOM   7126 C CG  . PRO B 1 391 ? 47.479 67.394  11.082  1.00 79.38  ? 391  PRO B CG  1 
ATOM   7127 C CD  . PRO B 1 391 ? 47.259 66.168  10.268  1.00 78.76  ? 391  PRO B CD  1 
ATOM   7128 N N   . THR B 1 392 ? 46.071 63.940  12.923  1.00 73.06  ? 392  THR B N   1 
ATOM   7129 C CA  . THR B 1 392 ? 45.264 62.993  13.719  1.00 71.25  ? 392  THR B CA  1 
ATOM   7130 C C   . THR B 1 392 ? 46.035 61.704  14.034  1.00 69.10  ? 392  THR B C   1 
ATOM   7131 O O   . THR B 1 392 ? 45.997 61.229  15.176  1.00 67.12  ? 392  THR B O   1 
ATOM   7132 C CB  . THR B 1 392 ? 43.898 62.649  13.040  1.00 72.48  ? 392  THR B CB  1 
ATOM   7133 O OG1 . THR B 1 392 ? 43.232 63.859  12.653  1.00 76.27  ? 392  THR B OG1 1 
ATOM   7134 C CG2 . THR B 1 392 ? 42.982 61.854  13.982  1.00 69.85  ? 392  THR B CG2 1 
ATOM   7135 N N   . HIS B 1 393 ? 46.717 61.134  13.034  1.00 69.55  ? 393  HIS B N   1 
ATOM   7136 C CA  . HIS B 1 393 ? 47.557 59.942  13.268  1.00 67.99  ? 393  HIS B CA  1 
ATOM   7137 C C   . HIS B 1 393 ? 48.705 60.279  14.217  1.00 66.37  ? 393  HIS B C   1 
ATOM   7138 O O   . HIS B 1 393 ? 48.979 59.516  15.141  1.00 64.28  ? 393  HIS B O   1 
ATOM   7139 C CB  . HIS B 1 393 ? 48.148 59.365  11.976  1.00 69.20  ? 393  HIS B CB  1 
ATOM   7140 C CG  . HIS B 1 393 ? 47.145 58.736  11.058  1.00 72.53  ? 393  HIS B CG  1 
ATOM   7141 N ND1 . HIS B 1 393 ? 46.101 59.440  10.492  1.00 76.74  ? 393  HIS B ND1 1 
ATOM   7142 C CD2 . HIS B 1 393 ? 47.067 57.481  10.554  1.00 74.22  ? 393  HIS B CD2 1 
ATOM   7143 C CE1 . HIS B 1 393 ? 45.407 58.640  9.702   1.00 77.63  ? 393  HIS B CE1 1 
ATOM   7144 N NE2 . HIS B 1 393 ? 45.975 57.445  9.718   1.00 76.71  ? 393  HIS B NE2 1 
ATOM   7145 N N   . LEU B 1 394 ? 49.360 61.420  13.980  1.00 67.37  ? 394  LEU B N   1 
ATOM   7146 C CA  . LEU B 1 394 ? 50.491 61.871  14.802  1.00 66.62  ? 394  LEU B CA  1 
ATOM   7147 C C   . LEU B 1 394 ? 50.127 62.013  16.277  1.00 64.94  ? 394  LEU B C   1 
ATOM   7148 O O   . LEU B 1 394 ? 50.902 61.631  17.154  1.00 63.50  ? 394  LEU B O   1 
ATOM   7149 C CB  . LEU B 1 394 ? 51.091 63.173  14.258  1.00 68.85  ? 394  LEU B CB  1 
ATOM   7150 C CG  . LEU B 1 394 ? 51.879 63.023  12.945  1.00 70.28  ? 394  LEU B CG  1 
ATOM   7151 C CD1 . LEU B 1 394 ? 52.254 64.372  12.364  1.00 72.79  ? 394  LEU B CD1 1 
ATOM   7152 C CD2 . LEU B 1 394 ? 53.122 62.146  13.107  1.00 68.49  ? 394  LEU B CD2 1 
ATOM   7153 N N   . ARG B 1 395 ? 48.934 62.527  16.541  1.00 65.30  ? 395  ARG B N   1 
ATOM   7154 C CA  . ARG B 1 395 ? 48.433 62.632  17.901  1.00 64.08  ? 395  ARG B CA  1 
ATOM   7155 C C   . ARG B 1 395 ? 48.150 61.257  18.506  1.00 61.75  ? 395  ARG B C   1 
ATOM   7156 O O   . ARG B 1 395 ? 48.651 60.953  19.587  1.00 60.49  ? 395  ARG B O   1 
ATOM   7157 C CB  . ARG B 1 395 ? 47.205 63.552  17.948  1.00 65.81  ? 395  ARG B CB  1 
ATOM   7158 C CG  . ARG B 1 395 ? 46.514 63.648  19.305  1.00 64.89  ? 395  ARG B CG  1 
ATOM   7159 C CD  . ARG B 1 395 ? 45.181 62.953  19.273  1.00 64.52  ? 395  ARG B CD  1 
ATOM   7160 N NE  . ARG B 1 395 ? 44.151 63.816  18.715  1.00 67.13  ? 395  ARG B NE  1 
ATOM   7161 C CZ  . ARG B 1 395 ? 43.105 63.379  18.020  1.00 68.58  ? 395  ARG B CZ  1 
ATOM   7162 N NH1 . ARG B 1 395 ? 42.946 62.082  17.778  1.00 66.80  ? 395  ARG B NH1 1 
ATOM   7163 N NH2 . ARG B 1 395 ? 42.217 64.248  17.558  1.00 71.31  ? 395  ARG B NH2 1 
ATOM   7164 N N   . ASP B 1 396 ? 47.365 60.430  17.813  1.00 61.60  ? 396  ASP B N   1 
ATOM   7165 C CA  . ASP B 1 396 ? 47.053 59.072  18.285  1.00 59.79  ? 396  ASP B CA  1 
ATOM   7166 C C   . ASP B 1 396 ? 48.305 58.213  18.500  1.00 58.32  ? 396  ASP B C   1 
ATOM   7167 O O   . ASP B 1 396 ? 48.329 57.369  19.407  1.00 56.80  ? 396  ASP B O   1 
ATOM   7168 C CB  . ASP B 1 396 ? 46.088 58.347  17.331  1.00 60.62  ? 396  ASP B CB  1 
ATOM   7169 C CG  . ASP B 1 396 ? 44.700 58.991  17.276  1.00 63.41  ? 396  ASP B CG  1 
ATOM   7170 O OD1 . ASP B 1 396 ? 44.256 59.562  18.292  1.00 64.71  ? 396  ASP B OD1 1 
ATOM   7171 O OD2 . ASP B 1 396 ? 44.045 58.925  16.209  1.00 65.98  ? 396  ASP B OD2 1 
ATOM   7172 N N   . ALA B 1 397 ? 49.327 58.430  17.668  1.00 58.87  ? 397  ALA B N   1 
ATOM   7173 C CA  . ALA B 1 397 ? 50.582 57.673  17.737  1.00 58.00  ? 397  ALA B CA  1 
ATOM   7174 C C   . ALA B 1 397 ? 51.434 58.061  18.946  1.00 57.13  ? 397  ALA B C   1 
ATOM   7175 O O   . ALA B 1 397 ? 52.067 57.198  19.569  1.00 55.97  ? 397  ALA B O   1 
ATOM   7176 C CB  . ALA B 1 397 ? 51.381 57.834  16.455  1.00 59.47  ? 397  ALA B CB  1 
ATOM   7177 N N   . MET B 1 398 ? 51.455 59.357  19.255  1.00 57.62  ? 398  MET B N   1 
ATOM   7178 C CA  . MET B 1 398 ? 52.105 59.880  20.456  1.00 56.86  ? 398  MET B CA  1 
ATOM   7179 C C   . MET B 1 398 ? 51.487 59.269  21.711  1.00 54.77  ? 398  MET B C   1 
ATOM   7180 O O   . MET B 1 398 ? 52.196 58.867  22.629  1.00 53.42  ? 398  MET B O   1 
ATOM   7181 C CB  . MET B 1 398 ? 51.974 61.404  20.493  1.00 58.75  ? 398  MET B CB  1 
ATOM   7182 C CG  . MET B 1 398 ? 52.740 62.094  21.605  1.00 59.53  ? 398  MET B CG  1 
ATOM   7183 S SD  . MET B 1 398 ? 54.519 61.940  21.394  1.00 63.57  ? 398  MET B SD  1 
ATOM   7184 C CE  . MET B 1 398 ? 54.918 60.752  22.688  1.00 59.76  ? 398  MET B CE  1 
ATOM   7185 N N   . SER B 1 399 ? 50.156 59.216  21.737  1.00 54.61  ? 399  SER B N   1 
ATOM   7186 C CA  . SER B 1 399 ? 49.405 58.523  22.777  1.00 52.90  ? 399  SER B CA  1 
ATOM   7187 C C   . SER B 1 399 ? 49.768 57.036  22.847  1.00 51.49  ? 399  SER B C   1 
ATOM   7188 O O   . SER B 1 399 ? 49.968 56.497  23.935  1.00 50.52  ? 399  SER B O   1 
ATOM   7189 C CB  . SER B 1 399 ? 47.915 58.685  22.513  1.00 53.52  ? 399  SER B CB  1 
ATOM   7190 O OG  . SER B 1 399 ? 47.149 57.852  23.356  1.00 52.45  ? 399  SER B OG  1 
ATOM   7191 N N   . ALA B 1 400 ? 49.852 56.386  21.687  1.00 51.65  ? 400  ALA B N   1 
ATOM   7192 C CA  . ALA B 1 400 ? 50.247 54.978  21.589  1.00 50.72  ? 400  ALA B CA  1 
ATOM   7193 C C   . ALA B 1 400 ? 51.676 54.722  22.075  1.00 50.27  ? 400  ALA B C   1 
ATOM   7194 O O   . ALA B 1 400 ? 51.906 53.751  22.787  1.00 49.15  ? 400  ALA B O   1 
ATOM   7195 C CB  . ALA B 1 400 ? 50.064 54.457  20.165  1.00 51.44  ? 400  ALA B CB  1 
ATOM   7196 N N   . VAL B 1 401 ? 52.622 55.589  21.708  1.00 51.30  ? 401  VAL B N   1 
ATOM   7197 C CA  . VAL B 1 401 ? 54.016 55.465  22.180  1.00 51.35  ? 401  VAL B CA  1 
ATOM   7198 C C   . VAL B 1 401 ? 54.106 55.371  23.706  1.00 50.41  ? 401  VAL B C   1 
ATOM   7199 O O   . VAL B 1 401 ? 54.765 54.474  24.246  1.00 49.49  ? 401  VAL B O   1 
ATOM   7200 C CB  . VAL B 1 401 ? 54.942 56.616  21.663  1.00 52.71  ? 401  VAL B CB  1 
ATOM   7201 C CG1 . VAL B 1 401 ? 56.218 56.698  22.489  1.00 51.47  ? 401  VAL B CG1 1 
ATOM   7202 C CG2 . VAL B 1 401 ? 55.287 56.412  20.185  1.00 53.76  ? 401  VAL B CG2 1 
ATOM   7203 N N   . VAL B 1 402 ? 53.425 56.290  24.386  1.00 50.79  ? 402  VAL B N   1 
ATOM   7204 C CA  . VAL B 1 402 ? 53.481 56.375  25.842  1.00 50.33  ? 402  VAL B CA  1 
ATOM   7205 C C   . VAL B 1 402 ? 52.790 55.174  26.499  1.00 49.23  ? 402  VAL B C   1 
ATOM   7206 O O   . VAL B 1 402 ? 53.363 54.547  27.392  1.00 48.56  ? 402  VAL B O   1 
ATOM   7207 C CB  . VAL B 1 402 ? 52.899 57.724  26.362  1.00 50.98  ? 402  VAL B CB  1 
ATOM   7208 C CG1 . VAL B 1 402 ? 52.742 57.701  27.866  1.00 49.69  ? 402  VAL B CG1 1 
ATOM   7209 C CG2 . VAL B 1 402 ? 53.789 58.887  25.942  1.00 52.15  ? 402  VAL B CG2 1 
ATOM   7210 N N   . GLY B 1 403 ? 51.577 54.849  26.048  1.00 49.21  ? 403  GLY B N   1 
ATOM   7211 C CA  . GLY B 1 403 ? 50.844 53.703  26.584  1.00 48.26  ? 403  GLY B CA  1 
ATOM   7212 C C   . GLY B 1 403 ? 51.560 52.365  26.417  1.00 48.39  ? 403  GLY B C   1 
ATOM   7213 O O   . GLY B 1 403 ? 51.571 51.540  27.342  1.00 47.99  ? 403  GLY B O   1 
ATOM   7214 N N   . ASP B 1 404 ? 52.163 52.151  25.243  1.00 48.83  ? 404  ASP B N   1 
ATOM   7215 C CA  . ASP B 1 404 ? 52.802 50.892  24.912  1.00 48.16  ? 404  ASP B CA  1 
ATOM   7216 C C   . ASP B 1 404 ? 54.078 50.706  25.713  1.00 48.05  ? 404  ASP B C   1 
ATOM   7217 O O   . ASP B 1 404 ? 54.318 49.639  26.286  1.00 47.43  ? 404  ASP B O   1 
ATOM   7218 C CB  . ASP B 1 404 ? 53.113 50.824  23.411  1.00 49.31  ? 404  ASP B CB  1 
ATOM   7219 C CG  . ASP B 1 404 ? 51.866 50.707  22.555  1.00 49.66  ? 404  ASP B CG  1 
ATOM   7220 O OD1 . ASP B 1 404 ? 50.771 50.473  23.109  1.00 50.28  ? 404  ASP B OD1 1 
ATOM   7221 O OD2 . ASP B 1 404 ? 51.975 50.853  21.319  1.00 50.24  ? 404  ASP B OD2 1 
ATOM   7222 N N   . HIS B 1 405 ? 54.895 51.752  25.748  1.00 48.62  ? 405  HIS B N   1 
ATOM   7223 C CA  . HIS B 1 405 ? 56.187 51.715  26.424  1.00 48.55  ? 405  HIS B CA  1 
ATOM   7224 C C   . HIS B 1 405 ? 56.013 51.537  27.938  1.00 47.47  ? 405  HIS B C   1 
ATOM   7225 O O   . HIS B 1 405 ? 56.797 50.841  28.584  1.00 47.35  ? 405  HIS B O   1 
ATOM   7226 C CB  . HIS B 1 405 ? 56.966 52.997  26.083  1.00 49.63  ? 405  HIS B CB  1 
ATOM   7227 C CG  . HIS B 1 405 ? 58.224 53.193  26.874  1.00 49.85  ? 405  HIS B CG  1 
ATOM   7228 N ND1 . HIS B 1 405 ? 59.214 52.239  26.953  1.00 48.76  ? 405  HIS B ND1 1 
ATOM   7229 C CD2 . HIS B 1 405 ? 58.667 54.255  27.592  1.00 50.63  ? 405  HIS B CD2 1 
ATOM   7230 C CE1 . HIS B 1 405 ? 60.205 52.695  27.699  1.00 49.52  ? 405  HIS B CE1 1 
ATOM   7231 N NE2 . HIS B 1 405 ? 59.897 53.914  28.102  1.00 50.73  ? 405  HIS B NE2 1 
ATOM   7232 N N   . ASN B 1 406 ? 54.961 52.134  28.482  1.00 47.02  ? 406  ASN B N   1 
ATOM   7233 C CA  . ASN B 1 406 ? 54.775 52.203  29.934  1.00 46.71  ? 406  ASN B CA  1 
ATOM   7234 C C   . ASN B 1 406 ? 53.837 51.172  30.558  1.00 45.74  ? 406  ASN B C   1 
ATOM   7235 O O   . ASN B 1 406 ? 54.001 50.835  31.739  1.00 45.47  ? 406  ASN B O   1 
ATOM   7236 C CB  . ASN B 1 406 ? 54.339 53.620  30.357  1.00 46.85  ? 406  ASN B CB  1 
ATOM   7237 C CG  . ASN B 1 406 ? 55.471 54.630  30.267  1.00 47.66  ? 406  ASN B CG  1 
ATOM   7238 O OD1 . ASN B 1 406 ? 56.535 54.455  30.865  1.00 48.13  ? 406  ASN B OD1 1 
ATOM   7239 N ND2 . ASN B 1 406 ? 55.246 55.692  29.514  1.00 49.08  ? 406  ASN B ND2 1 
ATOM   7240 N N   . VAL B 1 407 ? 52.861 50.687  29.788  1.00 45.14  ? 407  VAL B N   1 
ATOM   7241 C CA  . VAL B 1 407 ? 51.864 49.758  30.312  1.00 44.27  ? 407  VAL B CA  1 
ATOM   7242 C C   . VAL B 1 407 ? 51.667 48.496  29.449  1.00 44.42  ? 407  VAL B C   1 
ATOM   7243 O O   . VAL B 1 407 ? 51.959 47.386  29.896  1.00 43.92  ? 407  VAL B O   1 
ATOM   7244 C CB  . VAL B 1 407 ? 50.503 50.461  30.542  1.00 44.30  ? 407  VAL B CB  1 
ATOM   7245 C CG1 . VAL B 1 407 ? 49.498 49.492  31.113  1.00 44.13  ? 407  VAL B CG1 1 
ATOM   7246 C CG2 . VAL B 1 407 ? 50.654 51.639  31.473  1.00 44.17  ? 407  VAL B CG2 1 
ATOM   7247 N N   . VAL B 1 408 ? 51.191 48.667  28.215  1.00 44.86  ? 408  VAL B N   1 
ATOM   7248 C CA  . VAL B 1 408 ? 50.772 47.529  27.389  1.00 44.76  ? 408  VAL B CA  1 
ATOM   7249 C C   . VAL B 1 408 ? 51.895 46.506  27.181  1.00 45.51  ? 408  VAL B C   1 
ATOM   7250 O O   . VAL B 1 408 ? 51.693 45.304  27.372  1.00 45.85  ? 408  VAL B O   1 
ATOM   7251 C CB  . VAL B 1 408 ? 50.156 47.978  26.027  1.00 45.33  ? 408  VAL B CB  1 
ATOM   7252 C CG1 . VAL B 1 408 ? 49.694 46.783  25.228  1.00 44.74  ? 408  VAL B CG1 1 
ATOM   7253 C CG2 . VAL B 1 408 ? 48.996 48.948  26.238  1.00 43.88  ? 408  VAL B CG2 1 
ATOM   7254 N N   . CYS B 1 409 ? 53.081 46.970  26.810  1.00 46.23  ? 409  CYS B N   1 
ATOM   7255 C CA  . CYS B 1 409 ? 54.167 46.039  26.542  1.00 46.74  ? 409  CYS B CA  1 
ATOM   7256 C C   . CYS B 1 409 ? 54.805 45.474  27.817  1.00 46.71  ? 409  CYS B C   1 
ATOM   7257 O O   . CYS B 1 409 ? 55.143 44.285  27.850  1.00 47.21  ? 409  CYS B O   1 
ATOM   7258 C CB  . CYS B 1 409 ? 55.202 46.634  25.595  1.00 47.43  ? 409  CYS B CB  1 
ATOM   7259 S SG  . CYS B 1 409 ? 54.533 47.000  23.979  1.00 48.27  ? 409  CYS B SG  1 
ATOM   7260 N N   . PRO B 1 410 ? 55.009 46.315  28.858  1.00 46.21  ? 410  PRO B N   1 
ATOM   7261 C CA  . PRO B 1 410 ? 55.297 45.716  30.165  1.00 45.94  ? 410  PRO B CA  1 
ATOM   7262 C C   . PRO B 1 410 ? 54.275 44.657  30.621  1.00 45.41  ? 410  PRO B C   1 
ATOM   7263 O O   . PRO B 1 410 ? 54.679 43.617  31.151  1.00 46.01  ? 410  PRO B O   1 
ATOM   7264 C CB  . PRO B 1 410 ? 55.315 46.924  31.098  1.00 45.48  ? 410  PRO B CB  1 
ATOM   7265 C CG  . PRO B 1 410 ? 55.780 48.023  30.235  1.00 45.49  ? 410  PRO B CG  1 
ATOM   7266 C CD  . PRO B 1 410 ? 55.115 47.782  28.912  1.00 45.97  ? 410  PRO B CD  1 
ATOM   7267 N N   . VAL B 1 411 ? 52.986 44.891  30.387  1.00 44.79  ? 411  VAL B N   1 
ATOM   7268 C CA  . VAL B 1 411 ? 51.943 43.900  30.722  1.00 44.19  ? 411  VAL B CA  1 
ATOM   7269 C C   . VAL B 1 411 ? 52.074 42.611  29.892  1.00 45.44  ? 411  VAL B C   1 
ATOM   7270 O O   . VAL B 1 411 ? 51.963 41.504  30.443  1.00 46.05  ? 411  VAL B O   1 
ATOM   7271 C CB  . VAL B 1 411 ? 50.492 44.491  30.619  1.00 43.73  ? 411  VAL B CB  1 
ATOM   7272 C CG1 . VAL B 1 411 ? 49.439 43.396  30.594  1.00 42.61  ? 411  VAL B CG1 1 
ATOM   7273 C CG2 . VAL B 1 411 ? 50.213 45.466  31.763  1.00 41.39  ? 411  VAL B CG2 1 
ATOM   7274 N N   . ALA B 1 412 ? 52.314 42.747  28.585  1.00 46.07  ? 412  ALA B N   1 
ATOM   7275 C CA  . ALA B 1 412 ? 52.479 41.579  27.699  1.00 46.93  ? 412  ALA B CA  1 
ATOM   7276 C C   . ALA B 1 412 ? 53.675 40.727  28.104  1.00 47.29  ? 412  ALA B C   1 
ATOM   7277 O O   . ALA B 1 412 ? 53.595 39.505  28.117  1.00 48.03  ? 412  ALA B O   1 
ATOM   7278 C CB  . ALA B 1 412 ? 52.611 42.011  26.239  1.00 47.57  ? 412  ALA B CB  1 
ATOM   7279 N N   . GLN B 1 413 ? 54.779 41.392  28.417  1.00 47.38  ? 413  GLN B N   1 
ATOM   7280 C CA  . GLN B 1 413 ? 55.973 40.766  28.968  1.00 48.36  ? 413  GLN B CA  1 
ATOM   7281 C C   . GLN B 1 413 ? 55.698 39.980  30.274  1.00 47.77  ? 413  GLN B C   1 
ATOM   7282 O O   . GLN B 1 413 ? 56.127 38.830  30.424  1.00 48.13  ? 413  GLN B O   1 
ATOM   7283 C CB  . GLN B 1 413 ? 57.032 41.849  29.182  1.00 48.81  ? 413  GLN B CB  1 
ATOM   7284 C CG  . GLN B 1 413 ? 58.155 41.513  30.135  1.00 51.90  ? 413  GLN B CG  1 
ATOM   7285 C CD  . GLN B 1 413 ? 59.316 40.859  29.446  1.00 58.00  ? 413  GLN B CD  1 
ATOM   7286 O OE1 . GLN B 1 413 ? 59.214 40.454  28.282  1.00 61.24  ? 413  GLN B OE1 1 
ATOM   7287 N NE2 . GLN B 1 413 ? 60.443 40.737  30.161  1.00 60.32  ? 413  GLN B NE2 1 
ATOM   7288 N N   . LEU B 1 414 ? 54.990 40.608  31.210  1.00 46.53  ? 414  LEU B N   1 
ATOM   7289 C CA  . LEU B 1 414 ? 54.661 39.959  32.462  1.00 46.13  ? 414  LEU B CA  1 
ATOM   7290 C C   . LEU B 1 414 ? 53.757 38.736  32.237  1.00 46.76  ? 414  LEU B C   1 
ATOM   7291 O O   . LEU B 1 414 ? 54.008 37.664  32.803  1.00 47.41  ? 414  LEU B O   1 
ATOM   7292 C CB  . LEU B 1 414 ? 54.003 40.951  33.412  1.00 45.18  ? 414  LEU B CB  1 
ATOM   7293 C CG  . LEU B 1 414 ? 53.614 40.398  34.786  1.00 44.74  ? 414  LEU B CG  1 
ATOM   7294 C CD1 . LEU B 1 414 ? 54.860 40.122  35.628  1.00 44.76  ? 414  LEU B CD1 1 
ATOM   7295 C CD2 . LEU B 1 414 ? 52.642 41.304  35.513  1.00 41.31  ? 414  LEU B CD2 1 
ATOM   7296 N N   . ALA B 1 415 ? 52.722 38.896  31.408  1.00 46.40  ? 415  ALA B N   1 
ATOM   7297 C CA  . ALA B 1 415 ? 51.762 37.827  31.147  1.00 46.76  ? 415  ALA B CA  1 
ATOM   7298 C C   . ALA B 1 415 ? 52.463 36.602  30.579  1.00 48.04  ? 415  ALA B C   1 
ATOM   7299 O O   . ALA B 1 415 ? 52.193 35.464  30.990  1.00 48.39  ? 415  ALA B O   1 
ATOM   7300 C CB  . ALA B 1 415 ? 50.682 38.305  30.191  1.00 46.70  ? 415  ALA B CB  1 
ATOM   7301 N N   . GLY B 1 416 ? 53.375 36.849  29.642  1.00 48.46  ? 416  GLY B N   1 
ATOM   7302 C CA  . GLY B 1 416 ? 54.121 35.793  28.994  1.00 49.85  ? 416  GLY B CA  1 
ATOM   7303 C C   . GLY B 1 416 ? 55.037 35.075  29.957  1.00 50.71  ? 416  GLY B C   1 
ATOM   7304 O O   . GLY B 1 416 ? 55.105 33.851  29.946  1.00 51.64  ? 416  GLY B O   1 
ATOM   7305 N N   . ARG B 1 417 ? 55.740 35.828  30.800  1.00 50.65  ? 417  ARG B N   1 
ATOM   7306 C CA  . ARG B 1 417 ? 56.706 35.215  31.708  1.00 51.93  ? 417  ARG B CA  1 
ATOM   7307 C C   . ARG B 1 417 ? 56.027 34.349  32.771  1.00 51.59  ? 417  ARG B C   1 
ATOM   7308 O O   . ARG B 1 417 ? 56.460 33.222  33.015  1.00 52.27  ? 417  ARG B O   1 
ATOM   7309 C CB  . ARG B 1 417 ? 57.637 36.252  32.347  1.00 52.27  ? 417  ARG B CB  1 
ATOM   7310 C CG  . ARG B 1 417 ? 58.551 37.016  31.387  1.00 55.22  ? 417  ARG B CG  1 
ATOM   7311 C CD  . ARG B 1 417 ? 59.440 36.129  30.520  1.00 62.60  ? 417  ARG B CD  1 
ATOM   7312 N NE  . ARG B 1 417 ? 60.055 35.033  31.271  1.00 69.77  ? 417  ARG B NE  1 
ATOM   7313 C CZ  . ARG B 1 417 ? 61.123 34.334  30.867  1.00 73.77  ? 417  ARG B CZ  1 
ATOM   7314 N NH1 . ARG B 1 417 ? 61.734 34.624  29.718  1.00 74.97  ? 417  ARG B NH1 1 
ATOM   7315 N NH2 . ARG B 1 417 ? 61.599 33.352  31.628  1.00 74.47  ? 417  ARG B NH2 1 
ATOM   7316 N N   . LEU B 1 418 ? 54.964 34.877  33.382  1.00 50.43  ? 418  LEU B N   1 
ATOM   7317 C CA  . LEU B 1 418 ? 54.155 34.133  34.356  1.00 50.31  ? 418  LEU B CA  1 
ATOM   7318 C C   . LEU B 1 418 ? 53.520 32.880  33.748  1.00 51.30  ? 418  LEU B C   1 
ATOM   7319 O O   . LEU B 1 418 ? 53.525 31.828  34.375  1.00 52.75  ? 418  LEU B O   1 
ATOM   7320 C CB  . LEU B 1 418 ? 53.071 35.020  34.985  1.00 49.19  ? 418  LEU B CB  1 
ATOM   7321 C CG  . LEU B 1 418 ? 53.429 36.347  35.678  1.00 48.81  ? 418  LEU B CG  1 
ATOM   7322 C CD1 . LEU B 1 418 ? 52.184 37.145  36.043  1.00 46.91  ? 418  LEU B CD1 1 
ATOM   7323 C CD2 . LEU B 1 418 ? 54.310 36.153  36.910  1.00 49.92  ? 418  LEU B CD2 1 
ATOM   7324 N N   . ALA B 1 419 ? 52.991 32.968  32.530  1.00 51.17  ? 419  ALA B N   1 
ATOM   7325 C CA  . ALA B 1 419 ? 52.386 31.787  31.905  1.00 52.38  ? 419  ALA B CA  1 
ATOM   7326 C C   . ALA B 1 419 ? 53.427 30.698  31.648  1.00 54.15  ? 419  ALA B C   1 
ATOM   7327 O O   . ALA B 1 419 ? 53.183 29.522  31.924  1.00 55.29  ? 419  ALA B O   1 
ATOM   7328 C CB  . ALA B 1 419 ? 51.653 32.149  30.624  1.00 51.93  ? 419  ALA B CB  1 
ATOM   7329 N N   . ALA B 1 420 ? 54.583 31.117  31.134  1.00 54.81  ? 420  ALA B N   1 
ATOM   7330 C CA  . ALA B 1 420 ? 55.730 30.251  30.867  1.00 56.64  ? 420  ALA B CA  1 
ATOM   7331 C C   . ALA B 1 420 ? 56.254 29.592  32.142  1.00 57.80  ? 420  ALA B C   1 
ATOM   7332 O O   . ALA B 1 420 ? 56.672 28.429  32.128  1.00 59.36  ? 420  ALA B O   1 
ATOM   7333 C CB  . ALA B 1 420 ? 56.838 31.058  30.201  1.00 56.24  ? 420  ALA B CB  1 
ATOM   7334 N N   . GLN B 1 421 ? 56.222 30.354  33.233  1.00 57.27  ? 421  GLN B N   1 
ATOM   7335 C CA  . GLN B 1 421 ? 56.711 29.926  34.539  1.00 58.50  ? 421  GLN B CA  1 
ATOM   7336 C C   . GLN B 1 421 ? 55.675 29.139  35.355  1.00 58.81  ? 421  GLN B C   1 
ATOM   7337 O O   . GLN B 1 421 ? 55.841 28.966  36.564  1.00 59.36  ? 421  GLN B O   1 
ATOM   7338 C CB  . GLN B 1 421 ? 57.179 31.153  35.333  1.00 57.62  ? 421  GLN B CB  1 
ATOM   7339 C CG  . GLN B 1 421 ? 58.693 31.251  35.541  1.00 60.23  ? 421  GLN B CG  1 
ATOM   7340 C CD  . GLN B 1 421 ? 59.493 31.323  34.254  1.00 62.06  ? 421  GLN B CD  1 
ATOM   7341 O OE1 . GLN B 1 421 ? 60.059 30.324  33.808  1.00 63.40  ? 421  GLN B OE1 1 
ATOM   7342 N NE2 . GLN B 1 421 ? 59.551 32.510  33.653  1.00 61.96  ? 421  GLN B NE2 1 
ATOM   7343 N N   . GLY B 1 422 ? 54.606 28.682  34.702  1.00 58.77  ? 422  GLY B N   1 
ATOM   7344 C CA  . GLY B 1 422 ? 53.625 27.790  35.331  1.00 59.11  ? 422  GLY B CA  1 
ATOM   7345 C C   . GLY B 1 422 ? 52.393 28.428  35.962  1.00 57.65  ? 422  GLY B C   1 
ATOM   7346 O O   . GLY B 1 422 ? 51.554 27.719  36.518  1.00 58.34  ? 422  GLY B O   1 
ATOM   7347 N N   . ALA B 1 423 ? 52.279 29.754  35.887  1.00 55.58  ? 423  ALA B N   1 
ATOM   7348 C CA  . ALA B 1 423 ? 51.120 30.466  36.440  1.00 53.97  ? 423  ALA B CA  1 
ATOM   7349 C C   . ALA B 1 423 ? 49.886 30.346  35.558  1.00 53.71  ? 423  ALA B C   1 
ATOM   7350 O O   . ALA B 1 423 ? 49.982 30.053  34.363  1.00 54.26  ? 423  ALA B O   1 
ATOM   7351 C CB  . ALA B 1 423 ? 51.444 31.916  36.661  1.00 52.38  ? 423  ALA B CB  1 
ATOM   7352 N N   . ARG B 1 424 ? 48.728 30.569  36.166  1.00 52.80  ? 424  ARG B N   1 
ATOM   7353 C CA  . ARG B 1 424 ? 47.463 30.623  35.452  1.00 52.40  ? 424  ARG B CA  1 
ATOM   7354 C C   . ARG B 1 424 ? 47.139 32.102  35.209  1.00 49.91  ? 424  ARG B C   1 
ATOM   7355 O O   . ARG B 1 424 ? 46.915 32.866  36.158  1.00 48.72  ? 424  ARG B O   1 
ATOM   7356 C CB  . ARG B 1 424 ? 46.391 29.956  36.302  1.00 53.59  ? 424  ARG B CB  1 
ATOM   7357 C CG  . ARG B 1 424 ? 45.116 29.567  35.585  1.00 57.18  ? 424  ARG B CG  1 
ATOM   7358 C CD  . ARG B 1 424 ? 44.151 28.918  36.609  1.00 63.30  ? 424  ARG B CD  1 
ATOM   7359 N NE  . ARG B 1 424 ? 43.097 28.085  36.034  1.00 66.65  ? 424  ARG B NE  1 
ATOM   7360 C CZ  . ARG B 1 424 ? 43.205 27.369  34.914  1.00 69.62  ? 424  ARG B CZ  1 
ATOM   7361 N NH1 . ARG B 1 424 ? 44.342 27.348  34.219  1.00 69.35  ? 424  ARG B NH1 1 
ATOM   7362 N NH2 . ARG B 1 424 ? 42.168 26.654  34.494  1.00 71.43  ? 424  ARG B NH2 1 
ATOM   7363 N N   . VAL B 1 425 ? 47.141 32.504  33.939  1.00 48.38  ? 425  VAL B N   1 
ATOM   7364 C CA  . VAL B 1 425 ? 46.989 33.910  33.562  1.00 45.83  ? 425  VAL B CA  1 
ATOM   7365 C C   . VAL B 1 425 ? 45.729 34.132  32.741  1.00 45.54  ? 425  VAL B C   1 
ATOM   7366 O O   . VAL B 1 425 ? 45.431 33.351  31.851  1.00 46.54  ? 425  VAL B O   1 
ATOM   7367 C CB  . VAL B 1 425 ? 48.223 34.424  32.743  1.00 45.34  ? 425  VAL B CB  1 
ATOM   7368 C CG1 . VAL B 1 425 ? 48.199 35.965  32.590  1.00 43.81  ? 425  VAL B CG1 1 
ATOM   7369 C CG2 . VAL B 1 425 ? 49.519 33.970  33.376  1.00 43.94  ? 425  VAL B CG2 1 
ATOM   7370 N N   . TYR B 1 426 ? 45.006 35.206  33.051  1.00 44.46  ? 426  TYR B N   1 
ATOM   7371 C CA  . TYR B 1 426 ? 43.861 35.688  32.263  1.00 44.11  ? 426  TYR B CA  1 
ATOM   7372 C C   . TYR B 1 426 ? 44.107 37.150  31.895  1.00 44.02  ? 426  TYR B C   1 
ATOM   7373 O O   . TYR B 1 426 ? 44.468 37.969  32.765  1.00 43.61  ? 426  TYR B O   1 
ATOM   7374 C CB  . TYR B 1 426 ? 42.571 35.579  33.077  1.00 43.47  ? 426  TYR B CB  1 
ATOM   7375 C CG  . TYR B 1 426 ? 42.128 34.159  33.335  1.00 43.89  ? 426  TYR B CG  1 
ATOM   7376 C CD1 . TYR B 1 426 ? 42.521 33.478  34.494  1.00 42.25  ? 426  TYR B CD1 1 
ATOM   7377 C CD2 . TYR B 1 426 ? 41.318 33.488  32.416  1.00 43.66  ? 426  TYR B CD2 1 
ATOM   7378 C CE1 . TYR B 1 426 ? 42.123 32.170  34.724  1.00 42.42  ? 426  TYR B CE1 1 
ATOM   7379 C CE2 . TYR B 1 426 ? 40.925 32.191  32.635  1.00 45.91  ? 426  TYR B CE2 1 
ATOM   7380 C CZ  . TYR B 1 426 ? 41.327 31.534  33.796  1.00 45.45  ? 426  TYR B CZ  1 
ATOM   7381 O OH  . TYR B 1 426 ? 40.914 30.239  34.001  1.00 47.59  ? 426  TYR B OH  1 
ATOM   7382 N N   . ALA B 1 427 ? 43.923 37.484  30.620  1.00 44.38  ? 427  ALA B N   1 
ATOM   7383 C CA  . ALA B 1 427 ? 44.251 38.816  30.136  1.00 43.99  ? 427  ALA B CA  1 
ATOM   7384 C C   . ALA B 1 427 ? 43.069 39.509  29.480  1.00 44.94  ? 427  ALA B C   1 
ATOM   7385 O O   . ALA B 1 427 ? 42.195 38.851  28.909  1.00 45.98  ? 427  ALA B O   1 
ATOM   7386 C CB  . ALA B 1 427 ? 45.418 38.750  29.174  1.00 44.19  ? 427  ALA B CB  1 
ATOM   7387 N N   . TYR B 1 428 ? 43.050 40.843  29.551  1.00 44.51  ? 428  TYR B N   1 
ATOM   7388 C CA  . TYR B 1 428 ? 41.966 41.620  28.963  1.00 45.18  ? 428  TYR B CA  1 
ATOM   7389 C C   . TYR B 1 428 ? 42.430 42.954  28.398  1.00 45.71  ? 428  TYR B C   1 
ATOM   7390 O O   . TYR B 1 428 ? 43.493 43.465  28.755  1.00 44.85  ? 428  TYR B O   1 
ATOM   7391 C CB  . TYR B 1 428 ? 40.849 41.867  29.993  1.00 45.01  ? 428  TYR B CB  1 
ATOM   7392 C CG  . TYR B 1 428 ? 41.229 42.824  31.104  1.00 43.45  ? 428  TYR B CG  1 
ATOM   7393 C CD1 . TYR B 1 428 ? 41.130 44.207  30.932  1.00 42.22  ? 428  TYR B CD1 1 
ATOM   7394 C CD2 . TYR B 1 428 ? 41.687 42.344  32.330  1.00 41.91  ? 428  TYR B CD2 1 
ATOM   7395 C CE1 . TYR B 1 428 ? 41.491 45.084  31.948  1.00 41.34  ? 428  TYR B CE1 1 
ATOM   7396 C CE2 . TYR B 1 428 ? 42.045 43.203  33.348  1.00 40.13  ? 428  TYR B CE2 1 
ATOM   7397 C CZ  . TYR B 1 428 ? 41.946 44.568  33.154  1.00 41.62  ? 428  TYR B CZ  1 
ATOM   7398 O OH  . TYR B 1 428 ? 42.314 45.418  34.170  1.00 41.88  ? 428  TYR B OH  1 
ATOM   7399 N N   . ILE B 1 429 ? 41.611 43.511  27.510  1.00 47.31  ? 429  ILE B N   1 
ATOM   7400 C CA  . ILE B 1 429 ? 41.703 44.911  27.135  1.00 47.85  ? 429  ILE B CA  1 
ATOM   7401 C C   . ILE B 1 429 ? 40.336 45.543  27.371  1.00 49.02  ? 429  ILE B C   1 
ATOM   7402 O O   . ILE B 1 429 ? 39.308 44.981  26.986  1.00 50.45  ? 429  ILE B O   1 
ATOM   7403 C CB  . ILE B 1 429 ? 42.156 45.096  25.681  1.00 48.66  ? 429  ILE B CB  1 
ATOM   7404 C CG1 . ILE B 1 429 ? 42.238 46.593  25.338  1.00 48.97  ? 429  ILE B CG1 1 
ATOM   7405 C CG2 . ILE B 1 429 ? 41.224 44.348  24.719  1.00 49.69  ? 429  ILE B CG2 1 
ATOM   7406 C CD1 . ILE B 1 429 ? 42.993 46.885  24.035  1.00 51.03  ? 429  ILE B CD1 1 
ATOM   7407 N N   . PHE B 1 430 ? 40.330 46.700  28.020  1.00 49.01  ? 430  PHE B N   1 
ATOM   7408 C CA  . PHE B 1 430 ? 39.097 47.369  28.409  1.00 50.13  ? 430  PHE B CA  1 
ATOM   7409 C C   . PHE B 1 430 ? 38.792 48.513  27.430  1.00 51.54  ? 430  PHE B C   1 
ATOM   7410 O O   . PHE B 1 430 ? 39.577 49.466  27.320  1.00 51.29  ? 430  PHE B O   1 
ATOM   7411 C CB  . PHE B 1 430 ? 39.235 47.890  29.843  1.00 49.28  ? 430  PHE B CB  1 
ATOM   7412 C CG  . PHE B 1 430 ? 37.978 48.470  30.395  1.00 50.17  ? 430  PHE B CG  1 
ATOM   7413 C CD1 . PHE B 1 430 ? 37.653 49.797  30.165  1.00 50.71  ? 430  PHE B CD1 1 
ATOM   7414 C CD2 . PHE B 1 430 ? 37.109 47.683  31.142  1.00 51.25  ? 430  PHE B CD2 1 
ATOM   7415 C CE1 . PHE B 1 430 ? 36.476 50.340  30.671  1.00 52.24  ? 430  PHE B CE1 1 
ATOM   7416 C CE2 . PHE B 1 430 ? 35.934 48.212  31.651  1.00 52.58  ? 430  PHE B CE2 1 
ATOM   7417 C CZ  . PHE B 1 430 ? 35.616 49.550  31.416  1.00 52.96  ? 430  PHE B CZ  1 
ATOM   7418 N N   . GLU B 1 431 ? 37.648 48.430  26.746  1.00 53.00  ? 431  GLU B N   1 
ATOM   7419 C CA  . GLU B 1 431 ? 37.391 49.270  25.570  1.00 54.72  ? 431  GLU B CA  1 
ATOM   7420 C C   . GLU B 1 431 ? 36.175 50.196  25.663  1.00 56.25  ? 431  GLU B C   1 
ATOM   7421 O O   . GLU B 1 431 ? 35.883 50.950  24.724  1.00 57.39  ? 431  GLU B O   1 
ATOM   7422 C CB  . GLU B 1 431 ? 37.261 48.402  24.316  1.00 55.53  ? 431  GLU B CB  1 
ATOM   7423 C CG  . GLU B 1 431 ? 38.558 47.774  23.860  1.00 55.74  ? 431  GLU B CG  1 
ATOM   7424 C CD  . GLU B 1 431 ? 38.422 46.987  22.567  1.00 58.85  ? 431  GLU B CD  1 
ATOM   7425 O OE1 . GLU B 1 431 ? 37.325 46.441  22.281  1.00 59.94  ? 431  GLU B OE1 1 
ATOM   7426 O OE2 . GLU B 1 431 ? 39.433 46.916  21.831  1.00 60.24  ? 431  GLU B OE2 1 
ATOM   7427 N N   . HIS B 1 432 ? 35.453 50.132  26.774  1.00 56.31  ? 432  HIS B N   1 
ATOM   7428 C CA  . HIS B 1 432 ? 34.272 50.969  26.923  1.00 57.72  ? 432  HIS B CA  1 
ATOM   7429 C C   . HIS B 1 432 ? 34.605 52.310  27.579  1.00 57.63  ? 432  HIS B C   1 
ATOM   7430 O O   . HIS B 1 432 ? 35.140 52.350  28.688  1.00 56.41  ? 432  HIS B O   1 
ATOM   7431 C CB  . HIS B 1 432 ? 33.174 50.246  27.702  1.00 57.96  ? 432  HIS B CB  1 
ATOM   7432 C CG  . HIS B 1 432 ? 32.028 51.134  28.055  1.00 59.64  ? 432  HIS B CG  1 
ATOM   7433 N ND1 . HIS B 1 432 ? 31.105 51.555  27.124  1.00 61.59  ? 432  HIS B ND1 1 
ATOM   7434 C CD2 . HIS B 1 432 ? 31.687 51.729  29.223  1.00 60.05  ? 432  HIS B CD2 1 
ATOM   7435 C CE1 . HIS B 1 432 ? 30.227 52.352  27.708  1.00 62.86  ? 432  HIS B CE1 1 
ATOM   7436 N NE2 . HIS B 1 432 ? 30.560 52.476  28.981  1.00 62.60  ? 432  HIS B NE2 1 
ATOM   7437 N N   . ARG B 1 433 ? 34.285 53.397  26.881  1.00 59.09  ? 433  ARG B N   1 
ATOM   7438 C CA  . ARG B 1 433 ? 34.455 54.743  27.407  1.00 59.61  ? 433  ARG B CA  1 
ATOM   7439 C C   . ARG B 1 433 ? 33.155 55.190  28.092  1.00 61.35  ? 433  ARG B C   1 
ATOM   7440 O O   . ARG B 1 433 ? 32.082 55.180  27.477  1.00 63.13  ? 433  ARG B O   1 
ATOM   7441 C CB  . ARG B 1 433 ? 34.837 55.696  26.274  1.00 60.69  ? 433  ARG B CB  1 
ATOM   7442 C CG  . ARG B 1 433 ? 34.876 57.177  26.643  1.00 61.65  ? 433  ARG B CG  1 
ATOM   7443 C CD  . ARG B 1 433 ? 35.028 58.037  25.393  1.00 62.53  ? 433  ARG B CD  1 
ATOM   7444 N NE  . ARG B 1 433 ? 34.741 59.454  25.628  1.00 63.78  ? 433  ARG B NE  1 
ATOM   7445 C CZ  . ARG B 1 433 ? 35.661 60.379  25.906  1.00 63.20  ? 433  ARG B CZ  1 
ATOM   7446 N NH1 . ARG B 1 433 ? 36.952 60.051  25.992  1.00 60.56  ? 433  ARG B NH1 1 
ATOM   7447 N NH2 . ARG B 1 433 ? 35.288 61.640  26.094  1.00 63.04  ? 433  ARG B NH2 1 
ATOM   7448 N N   . ALA B 1 434 ? 33.262 55.572  29.366  1.00 60.94  ? 434  ALA B N   1 
ATOM   7449 C CA  . ALA B 1 434 ? 32.107 55.974  30.173  1.00 62.13  ? 434  ALA B CA  1 
ATOM   7450 C C   . ALA B 1 434 ? 31.386 57.151  29.537  1.00 64.86  ? 434  ALA B C   1 
ATOM   7451 O O   . ALA B 1 434 ? 32.022 58.120  29.116  1.00 65.39  ? 434  ALA B O   1 
ATOM   7452 C CB  . ALA B 1 434 ? 32.538 56.326  31.572  1.00 60.43  ? 434  ALA B CB  1 
ATOM   7453 N N   . SER B 1 435 ? 30.059 57.048  29.458  1.00 66.87  ? 435  SER B N   1 
ATOM   7454 C CA  . SER B 1 435 ? 29.209 58.122  28.962  1.00 69.60  ? 435  SER B CA  1 
ATOM   7455 C C   . SER B 1 435 ? 29.407 59.447  29.715  1.00 70.19  ? 435  SER B C   1 
ATOM   7456 O O   . SER B 1 435 ? 29.278 60.520  29.130  1.00 71.61  ? 435  SER B O   1 
ATOM   7457 C CB  . SER B 1 435 ? 27.740 57.696  29.039  1.00 71.55  ? 435  SER B CB  1 
ATOM   7458 O OG  . SER B 1 435 ? 27.389 57.307  30.355  1.00 71.07  ? 435  SER B OG  1 
ATOM   7459 N N   . THR B 1 436 ? 29.734 59.347  31.004  1.00 69.03  ? 436  THR B N   1 
ATOM   7460 C CA  . THR B 1 436 ? 29.853 60.494  31.912  1.00 69.70  ? 436  THR B CA  1 
ATOM   7461 C C   . THR B 1 436 ? 31.247 61.142  31.968  1.00 68.34  ? 436  THR B C   1 
ATOM   7462 O O   . THR B 1 436 ? 31.455 62.091  32.731  1.00 68.55  ? 436  THR B O   1 
ATOM   7463 C CB  . THR B 1 436 ? 29.480 60.079  33.345  1.00 69.11  ? 436  THR B CB  1 
ATOM   7464 O OG1 . THR B 1 436 ? 30.399 59.075  33.800  1.00 67.55  ? 436  THR B OG1 1 
ATOM   7465 C CG2 . THR B 1 436 ? 28.046 59.535  33.396  1.00 70.97  ? 436  THR B CG2 1 
ATOM   7466 N N   . LEU B 1 437 ? 32.182 60.629  31.161  1.00 66.91  ? 437  LEU B N   1 
ATOM   7467 C CA  . LEU B 1 437 ? 33.579 61.088  31.132  1.00 65.42  ? 437  LEU B CA  1 
ATOM   7468 C C   . LEU B 1 437 ? 33.744 62.561  30.726  1.00 66.99  ? 437  LEU B C   1 
ATOM   7469 O O   . LEU B 1 437 ? 33.129 63.022  29.762  1.00 68.58  ? 437  LEU B O   1 
ATOM   7470 C CB  . LEU B 1 437 ? 34.400 60.177  30.208  1.00 64.22  ? 437  LEU B CB  1 
ATOM   7471 C CG  . LEU B 1 437 ? 35.932 60.108  30.317  1.00 62.61  ? 437  LEU B CG  1 
ATOM   7472 C CD1 . LEU B 1 437 ? 36.408 60.211  31.746  1.00 61.93  ? 437  LEU B CD1 1 
ATOM   7473 C CD2 . LEU B 1 437 ? 36.445 58.832  29.708  1.00 60.48  ? 437  LEU B CD2 1 
ATOM   7474 N N   . THR B 1 438 ? 34.578 63.288  31.471  1.00 66.31  ? 438  THR B N   1 
ATOM   7475 C CA  . THR B 1 438 ? 34.752 64.737  31.271  1.00 67.88  ? 438  THR B CA  1 
ATOM   7476 C C   . THR B 1 438 ? 35.946 65.107  30.390  1.00 67.46  ? 438  THR B C   1 
ATOM   7477 O O   . THR B 1 438 ? 36.042 66.238  29.908  1.00 69.42  ? 438  THR B O   1 
ATOM   7478 C CB  . THR B 1 438 ? 34.870 65.498  32.617  1.00 68.10  ? 438  THR B CB  1 
ATOM   7479 O OG1 . THR B 1 438 ? 35.787 64.815  33.481  1.00 65.56  ? 438  THR B OG1 1 
ATOM   7480 C CG2 . THR B 1 438 ? 33.514 65.611  33.294  1.00 69.15  ? 438  THR B CG2 1 
ATOM   7481 N N   . TRP B 1 439 ? 36.857 64.156  30.199  1.00 65.09  ? 439  TRP B N   1 
ATOM   7482 C CA  . TRP B 1 439 ? 37.977 64.315  29.272  1.00 64.39  ? 439  TRP B CA  1 
ATOM   7483 C C   . TRP B 1 439 ? 37.469 64.327  27.826  1.00 65.87  ? 439  TRP B C   1 
ATOM   7484 O O   . TRP B 1 439 ? 36.460 63.690  27.533  1.00 66.13  ? 439  TRP B O   1 
ATOM   7485 C CB  . TRP B 1 439 ? 38.973 63.170  29.459  1.00 61.60  ? 439  TRP B CB  1 
ATOM   7486 C CG  . TRP B 1 439 ? 39.648 63.155  30.790  1.00 59.72  ? 439  TRP B CG  1 
ATOM   7487 C CD1 . TRP B 1 439 ? 39.372 62.327  31.838  1.00 58.05  ? 439  TRP B CD1 1 
ATOM   7488 C CD2 . TRP B 1 439 ? 40.725 64.002  31.218  1.00 59.60  ? 439  TRP B CD2 1 
ATOM   7489 N NE1 . TRP B 1 439 ? 40.206 62.604  32.893  1.00 57.28  ? 439  TRP B NE1 1 
ATOM   7490 C CE2 . TRP B 1 439 ? 41.045 63.630  32.541  1.00 58.65  ? 439  TRP B CE2 1 
ATOM   7491 C CE3 . TRP B 1 439 ? 41.445 65.045  30.614  1.00 60.34  ? 439  TRP B CE3 1 
ATOM   7492 C CZ2 . TRP B 1 439 ? 42.059 64.263  33.272  1.00 58.49  ? 439  TRP B CZ2 1 
ATOM   7493 C CZ3 . TRP B 1 439 ? 42.447 65.668  31.329  1.00 60.12  ? 439  TRP B CZ3 1 
ATOM   7494 C CH2 . TRP B 1 439 ? 42.746 65.278  32.649  1.00 59.54  ? 439  TRP B CH2 1 
ATOM   7495 N N   . PRO B 1 440 ? 38.168 65.042  26.915  1.00 66.96  ? 440  PRO B N   1 
ATOM   7496 C CA  . PRO B 1 440 ? 37.722 65.109  25.518  1.00 68.67  ? 440  PRO B CA  1 
ATOM   7497 C C   . PRO B 1 440 ? 37.724 63.749  24.817  1.00 67.73  ? 440  PRO B C   1 
ATOM   7498 O O   . PRO B 1 440 ? 38.346 62.799  25.307  1.00 65.80  ? 440  PRO B O   1 
ATOM   7499 C CB  . PRO B 1 440 ? 38.739 66.051  24.864  1.00 69.40  ? 440  PRO B CB  1 
ATOM   7500 C CG  . PRO B 1 440 ? 39.909 66.023  25.728  1.00 67.53  ? 440  PRO B CG  1 
ATOM   7501 C CD  . PRO B 1 440 ? 39.400 65.824  27.122  1.00 66.91  ? 440  PRO B CD  1 
ATOM   7502 N N   . LEU B 1 441 ? 37.036 63.664  23.681  1.00 69.38  ? 441  LEU B N   1 
ATOM   7503 C CA  . LEU B 1 441 ? 36.894 62.404  22.960  1.00 69.02  ? 441  LEU B CA  1 
ATOM   7504 C C   . LEU B 1 441 ? 38.220 61.800  22.495  1.00 67.25  ? 441  LEU B C   1 
ATOM   7505 O O   . LEU B 1 441 ? 38.404 60.582  22.554  1.00 65.81  ? 441  LEU B O   1 
ATOM   7506 C CB  . LEU B 1 441 ? 35.936 62.558  21.779  1.00 71.62  ? 441  LEU B CB  1 
ATOM   7507 C CG  . LEU B 1 441 ? 34.443 62.529  22.124  1.00 74.36  ? 441  LEU B CG  1 
ATOM   7508 C CD1 . LEU B 1 441 ? 33.621 63.213  21.034  1.00 78.26  ? 441  LEU B CD1 1 
ATOM   7509 C CD2 . LEU B 1 441 ? 33.953 61.092  22.356  1.00 74.70  ? 441  LEU B CD2 1 
ATOM   7510 N N   . TRP B 1 442 ? 39.147 62.648  22.058  1.00 67.53  ? 442  TRP B N   1 
ATOM   7511 C CA  . TRP B 1 442 ? 40.412 62.163  21.498  1.00 66.09  ? 442  TRP B CA  1 
ATOM   7512 C C   . TRP B 1 442 ? 41.206 61.288  22.468  1.00 63.27  ? 442  TRP B C   1 
ATOM   7513 O O   . TRP B 1 442 ? 42.059 60.512  22.052  1.00 62.15  ? 442  TRP B O   1 
ATOM   7514 C CB  . TRP B 1 442 ? 41.269 63.318  20.946  1.00 67.48  ? 442  TRP B CB  1 
ATOM   7515 C CG  . TRP B 1 442 ? 41.950 64.194  21.965  1.00 66.92  ? 442  TRP B CG  1 
ATOM   7516 C CD1 . TRP B 1 442 ? 41.538 65.422  22.391  1.00 68.87  ? 442  TRP B CD1 1 
ATOM   7517 C CD2 . TRP B 1 442 ? 43.184 63.925  22.652  1.00 65.34  ? 442  TRP B CD2 1 
ATOM   7518 N NE1 . TRP B 1 442 ? 42.428 65.928  23.313  1.00 68.41  ? 442  TRP B NE1 1 
ATOM   7519 C CE2 . TRP B 1 442 ? 43.442 65.028  23.494  1.00 65.86  ? 442  TRP B CE2 1 
ATOM   7520 C CE3 . TRP B 1 442 ? 44.089 62.850  22.647  1.00 63.47  ? 442  TRP B CE3 1 
ATOM   7521 C CZ2 . TRP B 1 442 ? 44.570 65.094  24.314  1.00 65.30  ? 442  TRP B CZ2 1 
ATOM   7522 C CZ3 . TRP B 1 442 ? 45.205 62.910  23.468  1.00 62.37  ? 442  TRP B CZ3 1 
ATOM   7523 C CH2 . TRP B 1 442 ? 45.438 64.025  24.292  1.00 63.15  ? 442  TRP B CH2 1 
ATOM   7524 N N   . MET B 1 443 ? 40.914 61.413  23.758  1.00 62.12  ? 443  MET B N   1 
ATOM   7525 C CA  . MET B 1 443 ? 41.616 60.639  24.770  1.00 59.96  ? 443  MET B CA  1 
ATOM   7526 C C   . MET B 1 443 ? 41.088 59.208  24.863  1.00 58.23  ? 443  MET B C   1 
ATOM   7527 O O   . MET B 1 443 ? 41.721 58.356  25.481  1.00 56.79  ? 443  MET B O   1 
ATOM   7528 C CB  . MET B 1 443 ? 41.551 61.330  26.140  1.00 59.40  ? 443  MET B CB  1 
ATOM   7529 C CG  . MET B 1 443 ? 42.268 62.665  26.196  1.00 60.71  ? 443  MET B CG  1 
ATOM   7530 S SD  . MET B 1 443 ? 42.767 63.133  27.875  1.00 60.86  ? 443  MET B SD  1 
ATOM   7531 C CE  . MET B 1 443 ? 43.376 64.782  27.569  1.00 61.02  ? 443  MET B CE  1 
ATOM   7532 N N   . GLY B 1 444 ? 39.932 58.957  24.251  1.00 58.88  ? 444  GLY B N   1 
ATOM   7533 C CA  . GLY B 1 444 ? 39.315 57.633  24.239  1.00 57.44  ? 444  GLY B CA  1 
ATOM   7534 C C   . GLY B 1 444 ? 38.993 57.099  25.621  1.00 55.94  ? 444  GLY B C   1 
ATOM   7535 O O   . GLY B 1 444 ? 38.242 57.716  26.374  1.00 56.80  ? 444  GLY B O   1 
ATOM   7536 N N   . VAL B 1 445 ? 39.557 55.937  25.940  1.00 54.04  ? 445  VAL B N   1 
ATOM   7537 C CA  . VAL B 1 445 ? 39.414 55.310  27.247  1.00 52.22  ? 445  VAL B CA  1 
ATOM   7538 C C   . VAL B 1 445 ? 40.750 55.500  27.963  1.00 51.13  ? 445  VAL B C   1 
ATOM   7539 O O   . VAL B 1 445 ? 41.684 54.740  27.742  1.00 50.18  ? 445  VAL B O   1 
ATOM   7540 C CB  . VAL B 1 445 ? 39.095 53.804  27.126  1.00 51.51  ? 445  VAL B CB  1 
ATOM   7541 C CG1 . VAL B 1 445 ? 38.622 53.248  28.471  1.00 50.03  ? 445  VAL B CG1 1 
ATOM   7542 C CG2 . VAL B 1 445 ? 38.063 53.544  26.020  1.00 51.97  ? 445  VAL B CG2 1 
ATOM   7543 N N   . PRO B 1 446 ? 40.856 56.541  28.797  1.00 51.39  ? 446  PRO B N   1 
ATOM   7544 C CA  . PRO B 1 446 ? 42.134 56.879  29.409  1.00 50.60  ? 446  PRO B CA  1 
ATOM   7545 C C   . PRO B 1 446 ? 42.493 55.970  30.567  1.00 49.37  ? 446  PRO B C   1 
ATOM   7546 O O   . PRO B 1 446 ? 41.617 55.350  31.165  1.00 49.43  ? 446  PRO B O   1 
ATOM   7547 C CB  . PRO B 1 446 ? 41.914 58.312  29.929  1.00 51.45  ? 446  PRO B CB  1 
ATOM   7548 C CG  . PRO B 1 446 ? 40.562 58.738  29.414  1.00 52.83  ? 446  PRO B CG  1 
ATOM   7549 C CD  . PRO B 1 446 ? 39.800 57.482  29.197  1.00 52.54  ? 446  PRO B CD  1 
ATOM   7550 N N   . HIS B 1 447 ? 43.787 55.907  30.858  1.00 48.84  ? 447  HIS B N   1 
ATOM   7551 C CA  . HIS B 1 447 ? 44.340 55.290  32.052  1.00 48.10  ? 447  HIS B CA  1 
ATOM   7552 C C   . HIS B 1 447 ? 43.483 55.655  33.267  1.00 48.26  ? 447  HIS B C   1 
ATOM   7553 O O   . HIS B 1 447 ? 43.321 56.831  33.591  1.00 49.20  ? 447  HIS B O   1 
ATOM   7554 C CB  . HIS B 1 447 ? 45.768 55.827  32.199  1.00 48.28  ? 447  HIS B CB  1 
ATOM   7555 C CG  . HIS B 1 447 ? 46.575 55.181  33.280  1.00 49.10  ? 447  HIS B CG  1 
ATOM   7556 N ND1 . HIS B 1 447 ? 47.005 53.873  33.212  1.00 50.17  ? 447  HIS B ND1 1 
ATOM   7557 C CD2 . HIS B 1 447 ? 47.078 55.682  34.434  1.00 49.62  ? 447  HIS B CD2 1 
ATOM   7558 C CE1 . HIS B 1 447 ? 47.725 53.590  34.283  1.00 49.06  ? 447  HIS B CE1 1 
ATOM   7559 N NE2 . HIS B 1 447 ? 47.784 54.669  35.042  1.00 49.15  ? 447  HIS B NE2 1 
ATOM   7560 N N   . GLY B 1 448 ? 42.896 54.644  33.902  1.00 48.03  ? 448  GLY B N   1 
ATOM   7561 C CA  . GLY B 1 448 ? 42.141 54.818  35.141  1.00 47.91  ? 448  GLY B CA  1 
ATOM   7562 C C   . GLY B 1 448 ? 40.634 54.634  35.056  1.00 49.38  ? 448  GLY B C   1 
ATOM   7563 O O   . GLY B 1 448 ? 39.972 54.457  36.086  1.00 49.96  ? 448  GLY B O   1 
ATOM   7564 N N   . TYR B 1 449 ? 40.068 54.666  33.849  1.00 50.11  ? 449  TYR B N   1 
ATOM   7565 C CA  . TYR B 1 449 ? 38.600 54.756  33.722  1.00 50.88  ? 449  TYR B CA  1 
ATOM   7566 C C   . TYR B 1 449 ? 37.812 53.431  33.581  1.00 50.69  ? 449  TYR B C   1 
ATOM   7567 O O   . TYR B 1 449 ? 36.636 53.421  33.209  1.00 51.85  ? 449  TYR B O   1 
ATOM   7568 C CB  . TYR B 1 449 ? 38.215 55.835  32.701  1.00 52.12  ? 449  TYR B CB  1 
ATOM   7569 C CG  . TYR B 1 449 ? 38.517 57.194  33.276  1.00 52.43  ? 449  TYR B CG  1 
ATOM   7570 C CD1 . TYR B 1 449 ? 39.779 57.763  33.140  1.00 51.71  ? 449  TYR B CD1 1 
ATOM   7571 C CD2 . TYR B 1 449 ? 37.561 57.879  34.027  1.00 53.08  ? 449  TYR B CD2 1 
ATOM   7572 C CE1 . TYR B 1 449 ? 40.073 59.003  33.712  1.00 53.09  ? 449  TYR B CE1 1 
ATOM   7573 C CE2 . TYR B 1 449 ? 37.839 59.118  34.597  1.00 53.42  ? 449  TYR B CE2 1 
ATOM   7574 C CZ  . TYR B 1 449 ? 39.096 59.678  34.436  1.00 53.75  ? 449  TYR B CZ  1 
ATOM   7575 O OH  . TYR B 1 449 ? 39.384 60.903  35.009  1.00 53.82  ? 449  TYR B OH  1 
ATOM   7576 N N   . GLU B 1 450 ? 38.466 52.329  33.927  1.00 49.04  ? 450  GLU B N   1 
ATOM   7577 C CA  . GLU B 1 450 ? 37.782 51.062  34.130  1.00 48.80  ? 450  GLU B CA  1 
ATOM   7578 C C   . GLU B 1 450 ? 37.433 50.879  35.612  1.00 48.60  ? 450  GLU B C   1 
ATOM   7579 O O   . GLU B 1 450 ? 36.520 50.118  35.949  1.00 49.18  ? 450  GLU B O   1 
ATOM   7580 C CB  . GLU B 1 450 ? 38.646 49.898  33.635  1.00 47.76  ? 450  GLU B CB  1 
ATOM   7581 C CG  . GLU B 1 450 ? 39.698 49.390  34.616  1.00 46.31  ? 450  GLU B CG  1 
ATOM   7582 C CD  . GLU B 1 450 ? 40.907 50.311  34.790  1.00 47.23  ? 450  GLU B CD  1 
ATOM   7583 O OE1 . GLU B 1 450 ? 40.861 51.506  34.396  1.00 48.79  ? 450  GLU B OE1 1 
ATOM   7584 O OE2 . GLU B 1 450 ? 41.924 49.826  35.335  1.00 46.49  ? 450  GLU B OE2 1 
ATOM   7585 N N   . ILE B 1 451 ? 38.148 51.573  36.499  1.00 47.82  ? 451  ILE B N   1 
ATOM   7586 C CA  . ILE B 1 451 ? 37.960 51.347  37.927  1.00 47.54  ? 451  ILE B CA  1 
ATOM   7587 C C   . ILE B 1 451 ? 36.505 51.538  38.349  1.00 49.23  ? 451  ILE B C   1 
ATOM   7588 O O   . ILE B 1 451 ? 35.935 50.656  38.985  1.00 50.11  ? 451  ILE B O   1 
ATOM   7589 C CB  . ILE B 1 451 ? 38.893 52.189  38.811  1.00 47.00  ? 451  ILE B CB  1 
ATOM   7590 C CG1 . ILE B 1 451 ? 40.369 51.849  38.526  1.00 46.15  ? 451  ILE B CG1 1 
ATOM   7591 C CG2 . ILE B 1 451 ? 38.596 51.903  40.282  1.00 46.49  ? 451  ILE B CG2 1 
ATOM   7592 C CD1 . ILE B 1 451 ? 41.339 52.924  38.998  1.00 44.44  ? 451  ILE B CD1 1 
ATOM   7593 N N   . GLU B 1 452 ? 35.893 52.662  37.976  1.00 50.03  ? 452  GLU B N   1 
ATOM   7594 C CA  . GLU B 1 452 ? 34.523 52.924  38.376  1.00 51.61  ? 452  GLU B CA  1 
ATOM   7595 C C   . GLU B 1 452 ? 33.538 51.794  38.004  1.00 52.16  ? 452  GLU B C   1 
ATOM   7596 O O   . GLU B 1 452 ? 32.518 51.629  38.675  1.00 53.29  ? 452  GLU B O   1 
ATOM   7597 C CB  . GLU B 1 452 ? 34.044 54.299  37.873  1.00 53.25  ? 452  GLU B CB  1 
ATOM   7598 C CG  . GLU B 1 452 ? 33.995 54.475  36.347  1.00 55.69  ? 452  GLU B CG  1 
ATOM   7599 C CD  . GLU B 1 452 ? 34.023 55.943  35.922  1.00 57.97  ? 452  GLU B CD  1 
ATOM   7600 O OE1 . GLU B 1 452 ? 32.964 56.471  35.539  1.00 61.55  ? 452  GLU B OE1 1 
ATOM   7601 O OE2 . GLU B 1 452 ? 35.097 56.578  35.981  1.00 58.14  ? 452  GLU B OE2 1 
ATOM   7602 N N   . PHE B 1 453 ? 33.855 51.021  36.959  1.00 51.14  ? 453  PHE B N   1 
ATOM   7603 C CA  . PHE B 1 453 ? 33.002 49.923  36.503  1.00 51.44  ? 453  PHE B CA  1 
ATOM   7604 C C   . PHE B 1 453 ? 33.221 48.645  37.294  1.00 50.99  ? 453  PHE B C   1 
ATOM   7605 O O   . PHE B 1 453 ? 32.265 47.941  37.606  1.00 52.15  ? 453  PHE B O   1 
ATOM   7606 C CB  . PHE B 1 453 ? 33.198 49.650  35.002  1.00 51.30  ? 453  PHE B CB  1 
ATOM   7607 C CG  . PHE B 1 453 ? 32.666 50.733  34.132  1.00 51.68  ? 453  PHE B CG  1 
ATOM   7608 C CD1 . PHE B 1 453 ? 31.300 50.805  33.845  1.00 52.82  ? 453  PHE B CD1 1 
ATOM   7609 C CD2 . PHE B 1 453 ? 33.511 51.710  33.629  1.00 50.32  ? 453  PHE B CD2 1 
ATOM   7610 C CE1 . PHE B 1 453 ? 30.786 51.823  33.049  1.00 53.59  ? 453  PHE B CE1 1 
ATOM   7611 C CE2 . PHE B 1 453 ? 33.009 52.743  32.841  1.00 52.06  ? 453  PHE B CE2 1 
ATOM   7612 C CZ  . PHE B 1 453 ? 31.640 52.797  32.548  1.00 54.11  ? 453  PHE B CZ  1 
ATOM   7613 N N   . ILE B 1 454 ? 34.484 48.339  37.590  1.00 49.54  ? 454  ILE B N   1 
ATOM   7614 C CA  . ILE B 1 454 ? 34.844 47.173  38.376  1.00 48.67  ? 454  ILE B CA  1 
ATOM   7615 C C   . ILE B 1 454 ? 34.246 47.305  39.765  1.00 49.20  ? 454  ILE B C   1 
ATOM   7616 O O   . ILE B 1 454 ? 33.706 46.337  40.285  1.00 49.93  ? 454  ILE B O   1 
ATOM   7617 C CB  . ILE B 1 454 ? 36.383 47.011  38.488  1.00 47.73  ? 454  ILE B CB  1 
ATOM   7618 C CG1 . ILE B 1 454 ? 37.048 46.984  37.100  1.00 46.91  ? 454  ILE B CG1 1 
ATOM   7619 C CG2 . ILE B 1 454 ? 36.767 45.793  39.368  1.00 46.39  ? 454  ILE B CG2 1 
ATOM   7620 C CD1 . ILE B 1 454 ? 36.593 45.854  36.219  1.00 48.81  ? 454  ILE B CD1 1 
ATOM   7621 N N   . PHE B 1 455 ? 34.336 48.497  40.360  1.00 49.31  ? 455  PHE B N   1 
ATOM   7622 C CA  . PHE B 1 455 ? 33.745 48.761  41.690  1.00 50.13  ? 455  PHE B CA  1 
ATOM   7623 C C   . PHE B 1 455 ? 32.213 48.871  41.690  1.00 52.18  ? 455  PHE B C   1 
ATOM   7624 O O   . PHE B 1 455 ? 31.595 48.856  42.750  1.00 53.09  ? 455  PHE B O   1 
ATOM   7625 C CB  . PHE B 1 455 ? 34.372 49.993  42.356  1.00 49.45  ? 455  PHE B CB  1 
ATOM   7626 C CG  . PHE B 1 455 ? 35.640 49.688  43.109  1.00 48.23  ? 455  PHE B CG  1 
ATOM   7627 C CD1 . PHE B 1 455 ? 36.867 49.640  42.448  1.00 46.67  ? 455  PHE B CD1 1 
ATOM   7628 C CD2 . PHE B 1 455 ? 35.610 49.440  44.474  1.00 47.73  ? 455  PHE B CD2 1 
ATOM   7629 C CE1 . PHE B 1 455 ? 38.048 49.352  43.140  1.00 46.13  ? 455  PHE B CE1 1 
ATOM   7630 C CE2 . PHE B 1 455 ? 36.796 49.141  45.174  1.00 47.81  ? 455  PHE B CE2 1 
ATOM   7631 C CZ  . PHE B 1 455 ? 38.013 49.098  44.503  1.00 45.73  ? 455  PHE B CZ  1 
ATOM   7632 N N   . GLY B 1 456 ? 31.618 48.982  40.504  1.00 53.21  ? 456  GLY B N   1 
ATOM   7633 C CA  . GLY B 1 456 ? 30.177 48.898  40.343  1.00 55.60  ? 456  GLY B CA  1 
ATOM   7634 C C   . GLY B 1 456 ? 29.388 50.178  40.514  1.00 57.49  ? 456  GLY B C   1 
ATOM   7635 O O   . GLY B 1 456 ? 28.168 50.136  40.720  1.00 58.81  ? 456  GLY B O   1 
ATOM   7636 N N   . LEU B 1 457 ? 30.076 51.312  40.399  1.00 57.46  ? 457  LEU B N   1 
ATOM   7637 C CA  . LEU B 1 457 ? 29.452 52.624  40.599  1.00 59.66  ? 457  LEU B CA  1 
ATOM   7638 C C   . LEU B 1 457 ? 28.206 52.897  39.745  1.00 62.24  ? 457  LEU B C   1 
ATOM   7639 O O   . LEU B 1 457 ? 27.255 53.487  40.250  1.00 64.05  ? 457  LEU B O   1 
ATOM   7640 C CB  . LEU B 1 457 ? 30.473 53.756  40.446  1.00 58.71  ? 457  LEU B CB  1 
ATOM   7641 C CG  . LEU B 1 457 ? 31.133 54.264  41.728  1.00 57.59  ? 457  LEU B CG  1 
ATOM   7642 C CD1 . LEU B 1 457 ? 32.129 53.258  42.282  1.00 54.11  ? 457  LEU B CD1 1 
ATOM   7643 C CD2 . LEU B 1 457 ? 31.812 55.605  41.455  1.00 58.07  ? 457  LEU B CD2 1 
ATOM   7644 N N   . PRO B 1 458 ? 28.197 52.474  38.461  1.00 62.75  ? 458  PRO B N   1 
ATOM   7645 C CA  . PRO B 1 458 ? 27.003 52.699  37.644  1.00 65.52  ? 458  PRO B CA  1 
ATOM   7646 C C   . PRO B 1 458 ? 25.689 52.155  38.207  1.00 68.14  ? 458  PRO B C   1 
ATOM   7647 O O   . PRO B 1 458 ? 24.623 52.473  37.672  1.00 70.88  ? 458  PRO B O   1 
ATOM   7648 C CB  . PRO B 1 458 ? 27.351 52.003  36.333  1.00 64.97  ? 458  PRO B CB  1 
ATOM   7649 C CG  . PRO B 1 458 ? 28.828 52.074  36.275  1.00 62.02  ? 458  PRO B CG  1 
ATOM   7650 C CD  . PRO B 1 458 ? 29.258 51.830  37.670  1.00 60.89  ? 458  PRO B CD  1 
ATOM   7651 N N   . LEU B 1 459 ? 25.754 51.363  39.273  1.00 68.25  ? 459  LEU B N   1 
ATOM   7652 C CA  . LEU B 1 459 ? 24.545 50.833  39.921  1.00 70.77  ? 459  LEU B CA  1 
ATOM   7653 C C   . LEU B 1 459 ? 23.829 51.861  40.804  1.00 72.71  ? 459  LEU B C   1 
ATOM   7654 O O   . LEU B 1 459 ? 22.662 51.675  41.172  1.00 74.74  ? 459  LEU B O   1 
ATOM   7655 C CB  . LEU B 1 459 ? 24.874 49.571  40.725  1.00 69.84  ? 459  LEU B CB  1 
ATOM   7656 C CG  . LEU B 1 459 ? 24.871 48.209  40.024  1.00 70.09  ? 459  LEU B CG  1 
ATOM   7657 C CD1 . LEU B 1 459 ? 25.832 48.137  38.825  1.00 69.72  ? 459  LEU B CD1 1 
ATOM   7658 C CD2 . LEU B 1 459 ? 25.230 47.156  41.043  1.00 69.80  ? 459  LEU B CD2 1 
ATOM   7659 N N   . ASP B 1 460 ? 24.546 52.930  41.152  1.00 72.53  ? 460  ASP B N   1 
ATOM   7660 C CA  . ASP B 1 460 ? 23.966 54.103  41.806  1.00 74.61  ? 460  ASP B CA  1 
ATOM   7661 C C   . ASP B 1 460 ? 23.211 54.886  40.735  1.00 77.05  ? 460  ASP B C   1 
ATOM   7662 O O   . ASP B 1 460 ? 23.827 55.437  39.818  1.00 76.42  ? 460  ASP B O   1 
ATOM   7663 C CB  . ASP B 1 460 ? 25.074 54.966  42.429  1.00 72.86  ? 460  ASP B CB  1 
ATOM   7664 C CG  . ASP B 1 460 ? 24.535 56.062  43.364  1.00 75.14  ? 460  ASP B CG  1 
ATOM   7665 O OD1 . ASP B 1 460 ? 23.325 56.397  43.320  1.00 76.82  ? 460  ASP B OD1 1 
ATOM   7666 O OD2 . ASP B 1 460 ? 25.348 56.603  44.148  1.00 74.21  ? 460  ASP B OD2 1 
ATOM   7667 N N   . PRO B 1 461 ? 21.870 54.939  40.838  1.00 80.25  ? 461  PRO B N   1 
ATOM   7668 C CA  . PRO B 1 461 ? 21.097 55.567  39.757  1.00 82.65  ? 461  PRO B CA  1 
ATOM   7669 C C   . PRO B 1 461 ? 21.348 57.076  39.700  1.00 83.16  ? 461  PRO B C   1 
ATOM   7670 O O   . PRO B 1 461 ? 21.300 57.671  38.619  1.00 84.08  ? 461  PRO B O   1 
ATOM   7671 C CB  . PRO B 1 461 ? 19.633 55.272  40.135  1.00 85.55  ? 461  PRO B CB  1 
ATOM   7672 C CG  . PRO B 1 461 ? 19.686 54.260  41.252  1.00 84.74  ? 461  PRO B CG  1 
ATOM   7673 C CD  . PRO B 1 461 ? 21.003 54.477  41.939  1.00 81.78  ? 461  PRO B CD  1 
ATOM   7674 N N   . SER B 1 462 ? 21.638 57.668  40.859  1.00 82.61  ? 462  SER B N   1 
ATOM   7675 C CA  . SER B 1 462 ? 21.919 59.098  40.978  1.00 83.09  ? 462  SER B CA  1 
ATOM   7676 C C   . SER B 1 462 ? 23.213 59.543  40.272  1.00 81.31  ? 462  SER B C   1 
ATOM   7677 O O   . SER B 1 462 ? 23.468 60.744  40.151  1.00 82.26  ? 462  SER B O   1 
ATOM   7678 C CB  . SER B 1 462 ? 21.965 59.501  42.455  1.00 82.98  ? 462  SER B CB  1 
ATOM   7679 O OG  . SER B 1 462 ? 23.220 59.199  43.040  1.00 79.30  ? 462  SER B OG  1 
ATOM   7680 N N   . LEU B 1 463 ? 24.024 58.589  39.813  1.00 78.75  ? 463  LEU B N   1 
ATOM   7681 C CA  . LEU B 1 463 ? 25.269 58.918  39.122  1.00 76.76  ? 463  LEU B CA  1 
ATOM   7682 C C   . LEU B 1 463 ? 25.110 59.141  37.609  1.00 77.52  ? 463  LEU B C   1 
ATOM   7683 O O   . LEU B 1 463 ? 26.060 59.548  36.935  1.00 76.54  ? 463  LEU B O   1 
ATOM   7684 C CB  . LEU B 1 463 ? 26.360 57.883  39.423  1.00 74.08  ? 463  LEU B CB  1 
ATOM   7685 C CG  . LEU B 1 463 ? 26.977 57.903  40.829  1.00 73.23  ? 463  LEU B CG  1 
ATOM   7686 C CD1 . LEU B 1 463 ? 28.004 56.797  40.960  1.00 69.84  ? 463  LEU B CD1 1 
ATOM   7687 C CD2 . LEU B 1 463 ? 27.604 59.272  41.177  1.00 73.01  ? 463  LEU B CD2 1 
ATOM   7688 N N   . ASN B 1 464 ? 23.911 58.878  37.092  1.00 79.19  ? 464  ASN B N   1 
ATOM   7689 C CA  . ASN B 1 464 ? 23.550 59.186  35.696  1.00 80.41  ? 464  ASN B CA  1 
ATOM   7690 C C   . ASN B 1 464 ? 24.260 58.347  34.592  1.00 78.05  ? 464  ASN B C   1 
ATOM   7691 O O   . ASN B 1 464 ? 24.362 58.788  33.438  1.00 78.96  ? 464  ASN B O   1 
ATOM   7692 C CB  . ASN B 1 464 ? 23.637 60.710  35.421  1.00 82.06  ? 464  ASN B CB  1 
ATOM   7693 C CG  . ASN B 1 464 ? 22.597 61.526  36.216  1.00 86.31  ? 464  ASN B CG  1 
ATOM   7694 O OD1 . ASN B 1 464 ? 21.383 61.316  36.089  1.00 89.67  ? 464  ASN B OD1 1 
ATOM   7695 N ND2 . ASN B 1 464 ? 23.077 62.476  37.026  1.00 87.24  ? 464  ASN B ND2 1 
ATOM   7696 N N   . TYR B 1 465 ? 24.733 57.145  34.937  1.00 74.80  ? 465  TYR B N   1 
ATOM   7697 C CA  . TYR B 1 465 ? 25.175 56.171  33.921  1.00 72.46  ? 465  TYR B CA  1 
ATOM   7698 C C   . TYR B 1 465 ? 23.975 55.573  33.183  1.00 74.30  ? 465  TYR B C   1 
ATOM   7699 O O   . TYR B 1 465 ? 22.869 55.527  33.721  1.00 75.85  ? 465  TYR B O   1 
ATOM   7700 C CB  . TYR B 1 465 ? 25.974 55.022  34.549  1.00 69.60  ? 465  TYR B CB  1 
ATOM   7701 C CG  . TYR B 1 465 ? 27.321 55.389  35.138  1.00 65.98  ? 465  TYR B CG  1 
ATOM   7702 C CD1 . TYR B 1 465 ? 28.479 55.391  34.356  1.00 64.21  ? 465  TYR B CD1 1 
ATOM   7703 C CD2 . TYR B 1 465 ? 27.435 55.710  36.481  1.00 64.37  ? 465  TYR B CD2 1 
ATOM   7704 C CE1 . TYR B 1 465 ? 29.722 55.721  34.908  1.00 62.35  ? 465  TYR B CE1 1 
ATOM   7705 C CE2 . TYR B 1 465 ? 28.646 56.034  37.044  1.00 63.51  ? 465  TYR B CE2 1 
ATOM   7706 C CZ  . TYR B 1 465 ? 29.792 56.039  36.263  1.00 62.81  ? 465  TYR B CZ  1 
ATOM   7707 O OH  . TYR B 1 465 ? 30.984 56.367  36.861  1.00 60.01  ? 465  TYR B OH  1 
ATOM   7708 N N   . THR B 1 466 ? 24.200 55.100  31.959  1.00 74.06  ? 466  THR B N   1 
ATOM   7709 C CA  . THR B 1 466 ? 23.141 54.485  31.158  1.00 75.95  ? 466  THR B CA  1 
ATOM   7710 C C   . THR B 1 466 ? 22.752 53.113  31.707  1.00 75.68  ? 466  THR B C   1 
ATOM   7711 O O   . THR B 1 466 ? 23.423 52.577  32.584  1.00 73.81  ? 466  THR B O   1 
ATOM   7712 C CB  . THR B 1 466 ? 23.536 54.334  29.667  1.00 75.89  ? 466  THR B CB  1 
ATOM   7713 O OG1 . THR B 1 466 ? 24.496 53.284  29.526  1.00 73.80  ? 466  THR B OG1 1 
ATOM   7714 C CG2 . THR B 1 466 ? 24.106 55.622  29.103  1.00 75.98  ? 466  THR B CG2 1 
ATOM   7715 N N   . THR B 1 467 ? 21.662 52.560  31.183  1.00 78.08  ? 467  THR B N   1 
ATOM   7716 C CA  . THR B 1 467 ? 21.169 51.235  31.559  1.00 78.48  ? 467  THR B CA  1 
ATOM   7717 C C   . THR B 1 467 ? 22.134 50.133  31.111  1.00 76.56  ? 467  THR B C   1 
ATOM   7718 O O   . THR B 1 467 ? 22.368 49.166  31.846  1.00 75.43  ? 467  THR B O   1 
ATOM   7719 C CB  . THR B 1 467 ? 19.750 51.003  30.974  1.00 81.71  ? 467  THR B CB  1 
ATOM   7720 O OG1 . THR B 1 467 ? 18.854 51.972  31.532  1.00 83.92  ? 467  THR B OG1 1 
ATOM   7721 C CG2 . THR B 1 467 ? 19.223 49.601  31.284  1.00 82.05  ? 467  THR B CG2 1 
ATOM   7722 N N   . GLU B 1 468 ? 22.689 50.292  29.908  1.00 76.38  ? 468  GLU B N   1 
ATOM   7723 C CA  . GLU B 1 468 ? 23.671 49.360  29.357  1.00 74.91  ? 468  GLU B CA  1 
ATOM   7724 C C   . GLU B 1 468 ? 24.938 49.278  30.234  1.00 71.85  ? 468  GLU B C   1 
ATOM   7725 O O   . GLU B 1 468 ? 25.522 48.200  30.415  1.00 70.32  ? 468  GLU B O   1 
ATOM   7726 C CB  . GLU B 1 468 ? 24.039 49.764  27.921  1.00 75.52  ? 468  GLU B CB  1 
ATOM   7727 C CG  . GLU B 1 468 ? 22.964 49.479  26.868  1.00 80.20  ? 468  GLU B CG  1 
ATOM   7728 C CD  . GLU B 1 468 ? 21.987 50.651  26.634  1.00 85.86  ? 468  GLU B CD  1 
ATOM   7729 O OE1 . GLU B 1 468 ? 21.800 51.506  27.537  1.00 86.85  ? 468  GLU B OE1 1 
ATOM   7730 O OE2 . GLU B 1 468 ? 21.391 50.711  25.529  1.00 88.79  ? 468  GLU B OE2 1 
ATOM   7731 N N   . GLU B 1 469 ? 25.343 50.423  30.782  1.00 70.84  ? 469  GLU B N   1 
ATOM   7732 C CA  . GLU B 1 469 ? 26.529 50.510  31.617  1.00 68.11  ? 469  GLU B CA  1 
ATOM   7733 C C   . GLU B 1 469 ? 26.336 49.887  32.998  1.00 67.43  ? 469  GLU B C   1 
ATOM   7734 O O   . GLU B 1 469 ? 27.317 49.492  33.633  1.00 65.63  ? 469  GLU B O   1 
ATOM   7735 C CB  . GLU B 1 469 ? 26.980 51.961  31.756  1.00 67.94  ? 469  GLU B CB  1 
ATOM   7736 C CG  . GLU B 1 469 ? 27.573 52.563  30.486  1.00 68.03  ? 469  GLU B CG  1 
ATOM   7737 C CD  . GLU B 1 469 ? 27.907 54.045  30.642  1.00 68.48  ? 469  GLU B CD  1 
ATOM   7738 O OE1 . GLU B 1 469 ? 27.088 54.787  31.241  1.00 69.49  ? 469  GLU B OE1 1 
ATOM   7739 O OE2 . GLU B 1 469 ? 28.987 54.467  30.161  1.00 66.48  ? 469  GLU B OE2 1 
ATOM   7740 N N   . ARG B 1 470 ? 25.091 49.799  33.465  1.00 68.98  ? 470  ARG B N   1 
ATOM   7741 C CA  . ARG B 1 470 ? 24.806 49.106  34.720  1.00 68.77  ? 470  ARG B CA  1 
ATOM   7742 C C   . ARG B 1 470 ? 24.949 47.593  34.538  1.00 67.83  ? 470  ARG B C   1 
ATOM   7743 O O   . ARG B 1 470 ? 25.592 46.921  35.351  1.00 66.44  ? 470  ARG B O   1 
ATOM   7744 C CB  . ARG B 1 470 ? 23.423 49.460  35.264  1.00 71.36  ? 470  ARG B CB  1 
ATOM   7745 C CG  . ARG B 1 470 ? 22.962 48.518  36.374  1.00 73.90  ? 470  ARG B CG  1 
ATOM   7746 C CD  . ARG B 1 470 ? 21.459 48.531  36.577  1.00 81.57  ? 470  ARG B CD  1 
ATOM   7747 N NE  . ARG B 1 470 ? 21.059 49.743  37.286  1.00 86.28  ? 470  ARG B NE  1 
ATOM   7748 C CZ  . ARG B 1 470 ? 20.338 50.730  36.759  1.00 89.46  ? 470  ARG B CZ  1 
ATOM   7749 N NH1 . ARG B 1 470 ? 19.894 50.656  35.503  1.00 90.49  ? 470  ARG B NH1 1 
ATOM   7750 N NH2 . ARG B 1 470 ? 20.051 51.790  37.507  1.00 91.36  ? 470  ARG B NH2 1 
ATOM   7751 N N   . ILE B 1 471 ? 24.353 47.070  33.467  1.00 68.70  ? 471  ILE B N   1 
ATOM   7752 C CA  . ILE B 1 471 ? 24.483 45.657  33.095  1.00 67.87  ? 471  ILE B CA  1 
ATOM   7753 C C   . ILE B 1 471 ? 25.954 45.255  32.883  1.00 64.95  ? 471  ILE B C   1 
ATOM   7754 O O   . ILE B 1 471 ? 26.377 44.185  33.326  1.00 64.11  ? 471  ILE B O   1 
ATOM   7755 C CB  . ILE B 1 471 ? 23.613 45.329  31.852  1.00 70.02  ? 471  ILE B CB  1 
ATOM   7756 C CG1 . ILE B 1 471 ? 22.128 45.320  32.240  1.00 72.91  ? 471  ILE B CG1 1 
ATOM   7757 C CG2 . ILE B 1 471 ? 24.004 43.988  31.237  1.00 69.28  ? 471  ILE B CG2 1 
ATOM   7758 C CD1 . ILE B 1 471 ? 21.168 45.642  31.089  1.00 75.27  ? 471  ILE B CD1 1 
ATOM   7759 N N   . PHE B 1 472 ? 26.718 46.125  32.222  1.00 63.39  ? 472  PHE B N   1 
ATOM   7760 C CA  . PHE B 1 472 ? 28.163 45.948  32.020  1.00 60.64  ? 472  PHE B CA  1 
ATOM   7761 C C   . PHE B 1 472 ? 28.920 45.896  33.358  1.00 58.68  ? 472  PHE B C   1 
ATOM   7762 O O   . PHE B 1 472 ? 29.672 44.957  33.609  1.00 57.08  ? 472  PHE B O   1 
ATOM   7763 C CB  . PHE B 1 472 ? 28.692 47.077  31.117  1.00 60.43  ? 472  PHE B CB  1 
ATOM   7764 C CG  . PHE B 1 472 ? 30.157 46.983  30.775  1.00 57.59  ? 472  PHE B CG  1 
ATOM   7765 C CD1 . PHE B 1 472 ? 30.713 45.799  30.294  1.00 57.12  ? 472  PHE B CD1 1 
ATOM   7766 C CD2 . PHE B 1 472 ? 30.970 48.109  30.884  1.00 56.72  ? 472  PHE B CD2 1 
ATOM   7767 C CE1 . PHE B 1 472 ? 32.080 45.722  29.963  1.00 56.40  ? 472  PHE B CE1 1 
ATOM   7768 C CE2 . PHE B 1 472 ? 32.338 48.057  30.552  1.00 55.86  ? 472  PHE B CE2 1 
ATOM   7769 C CZ  . PHE B 1 472 ? 32.894 46.857  30.089  1.00 55.48  ? 472  PHE B CZ  1 
ATOM   7770 N N   . ALA B 1 473 ? 28.705 46.896  34.216  1.00 58.38  ? 473  ALA B N   1 
ATOM   7771 C CA  . ALA B 1 473 ? 29.317 46.912  35.544  1.00 56.91  ? 473  ALA B CA  1 
ATOM   7772 C C   . ALA B 1 473 ? 29.022 45.624  36.308  1.00 57.23  ? 473  ALA B C   1 
ATOM   7773 O O   . ALA B 1 473 ? 29.887 45.109  37.013  1.00 56.27  ? 473  ALA B O   1 
ATOM   7774 C CB  . ALA B 1 473 ? 28.867 48.130  36.343  1.00 57.18  ? 473  ALA B CB  1 
ATOM   7775 N N   . GLN B 1 474 ? 27.808 45.104  36.157  1.00 59.11  ? 474  GLN B N   1 
ATOM   7776 C CA  . GLN B 1 474 ? 27.421 43.850  36.791  1.00 60.00  ? 474  GLN B CA  1 
ATOM   7777 C C   . GLN B 1 474 ? 28.199 42.644  36.225  1.00 59.26  ? 474  GLN B C   1 
ATOM   7778 O O   . GLN B 1 474 ? 28.565 41.730  36.976  1.00 58.77  ? 474  GLN B O   1 
ATOM   7779 C CB  . GLN B 1 474 ? 25.901 43.639  36.694  1.00 62.41  ? 474  GLN B CB  1 
ATOM   7780 C CG  . GLN B 1 474 ? 25.115 44.417  37.741  1.00 64.46  ? 474  GLN B CG  1 
ATOM   7781 C CD  . GLN B 1 474 ? 23.595 44.338  37.569  1.00 68.59  ? 474  GLN B CD  1 
ATOM   7782 O OE1 . GLN B 1 474 ? 23.058 44.616  36.498  1.00 70.82  ? 474  GLN B OE1 1 
ATOM   7783 N NE2 . GLN B 1 474 ? 22.899 43.981  38.641  1.00 69.63  ? 474  GLN B NE2 1 
ATOM   7784 N N   . ARG B 1 475 ? 28.447 42.648  34.912  1.00 59.17  ? 475  ARG B N   1 
ATOM   7785 C CA  . ARG B 1 475 ? 29.271 41.621  34.278  1.00 58.49  ? 475  ARG B CA  1 
ATOM   7786 C C   . ARG B 1 475 ? 30.679 41.648  34.865  1.00 56.22  ? 475  ARG B C   1 
ATOM   7787 O O   . ARG B 1 475 ? 31.215 40.604  35.241  1.00 55.67  ? 475  ARG B O   1 
ATOM   7788 C CB  . ARG B 1 475 ? 29.343 41.804  32.759  1.00 58.53  ? 475  ARG B CB  1 
ATOM   7789 C CG  . ARG B 1 475 ? 28.206 41.166  31.949  1.00 62.20  ? 475  ARG B CG  1 
ATOM   7790 C CD  . ARG B 1 475 ? 28.357 41.429  30.419  1.00 61.92  ? 475  ARG B CD  1 
ATOM   7791 N NE  . ARG B 1 475 ? 29.672 40.984  29.947  1.00 60.50  ? 475  ARG B NE  1 
ATOM   7792 C CZ  . ARG B 1 475 ? 30.391 41.579  29.000  1.00 58.12  ? 475  ARG B CZ  1 
ATOM   7793 N NH1 . ARG B 1 475 ? 29.938 42.668  28.386  1.00 58.03  ? 475  ARG B NH1 1 
ATOM   7794 N NH2 . ARG B 1 475 ? 31.576 41.078  28.677  1.00 54.89  ? 475  ARG B NH2 1 
ATOM   7795 N N   . LEU B 1 476 ? 31.269 42.837  34.955  1.00 55.02  ? 476  LEU B N   1 
ATOM   7796 C CA  . LEU B 1 476 ? 32.652 42.952  35.401  1.00 53.42  ? 476  LEU B CA  1 
ATOM   7797 C C   . LEU B 1 476 ? 32.806 42.594  36.871  1.00 53.15  ? 476  LEU B C   1 
ATOM   7798 O O   . LEU B 1 476 ? 33.740 41.883  37.241  1.00 52.25  ? 476  LEU B O   1 
ATOM   7799 C CB  . LEU B 1 476 ? 33.219 44.341  35.116  1.00 52.52  ? 476  LEU B CB  1 
ATOM   7800 C CG  . LEU B 1 476 ? 33.285 44.759  33.647  1.00 53.20  ? 476  LEU B CG  1 
ATOM   7801 C CD1 . LEU B 1 476 ? 33.822 46.164  33.549  1.00 53.31  ? 476  LEU B CD1 1 
ATOM   7802 C CD2 . LEU B 1 476 ? 34.141 43.806  32.827  1.00 52.49  ? 476  LEU B CD2 1 
ATOM   7803 N N   . MET B 1 477 ? 31.880 43.064  37.701  1.00 54.06  ? 477  MET B N   1 
ATOM   7804 C CA  . MET B 1 477 ? 31.879 42.703  39.113  1.00 54.40  ? 477  MET B CA  1 
ATOM   7805 C C   . MET B 1 477 ? 31.861 41.191  39.292  1.00 54.52  ? 477  MET B C   1 
ATOM   7806 O O   . MET B 1 477 ? 32.434 40.660  40.246  1.00 53.69  ? 477  MET B O   1 
ATOM   7807 C CB  . MET B 1 477 ? 30.697 43.344  39.839  1.00 55.66  ? 477  MET B CB  1 
ATOM   7808 C CG  . MET B 1 477 ? 30.911 44.811  40.212  1.00 55.43  ? 477  MET B CG  1 
ATOM   7809 S SD  . MET B 1 477 ? 29.382 45.630  40.716  1.00 58.86  ? 477  MET B SD  1 
ATOM   7810 C CE  . MET B 1 477 ? 29.051 44.891  42.308  1.00 60.06  ? 477  MET B CE  1 
ATOM   7811 N N   . LYS B 1 478 ? 31.212 40.502  38.356  1.00 55.86  ? 478  LYS B N   1 
ATOM   7812 C CA  . LYS B 1 478 ? 31.166 39.044  38.372  1.00 56.62  ? 478  LYS B CA  1 
ATOM   7813 C C   . LYS B 1 478 ? 32.480 38.381  37.964  1.00 54.67  ? 478  LYS B C   1 
ATOM   7814 O O   . LYS B 1 478 ? 32.908 37.423  38.604  1.00 54.47  ? 478  LYS B O   1 
ATOM   7815 C CB  . LYS B 1 478 ? 30.012 38.503  37.532  1.00 58.62  ? 478  LYS B CB  1 
ATOM   7816 C CG  . LYS B 1 478 ? 28.924 37.968  38.393  1.00 62.68  ? 478  LYS B CG  1 
ATOM   7817 C CD  . LYS B 1 478 ? 28.236 36.753  37.797  1.00 67.82  ? 478  LYS B CD  1 
ATOM   7818 C CE  . LYS B 1 478 ? 27.753 35.814  38.918  1.00 71.69  ? 478  LYS B CE  1 
ATOM   7819 N NZ  . LYS B 1 478 ? 27.288 36.543  40.164  1.00 72.30  ? 478  LYS B NZ  1 
ATOM   7820 N N   . TYR B 1 479 ? 33.110 38.877  36.906  1.00 53.08  ? 479  TYR B N   1 
ATOM   7821 C CA  . TYR B 1 479 ? 34.377 38.314  36.485  1.00 51.72  ? 479  TYR B CA  1 
ATOM   7822 C C   . TYR B 1 479 ? 35.386 38.441  37.634  1.00 50.28  ? 479  TYR B C   1 
ATOM   7823 O O   . TYR B 1 479 ? 36.024 37.463  38.019  1.00 50.19  ? 479  TYR B O   1 
ATOM   7824 C CB  . TYR B 1 479 ? 34.918 39.030  35.254  1.00 51.00  ? 479  TYR B CB  1 
ATOM   7825 C CG  . TYR B 1 479 ? 34.143 38.864  33.966  1.00 51.95  ? 479  TYR B CG  1 
ATOM   7826 C CD1 . TYR B 1 479 ? 33.736 37.605  33.511  1.00 53.16  ? 479  TYR B CD1 1 
ATOM   7827 C CD2 . TYR B 1 479 ? 33.868 39.974  33.162  1.00 51.74  ? 479  TYR B CD2 1 
ATOM   7828 C CE1 . TYR B 1 479 ? 33.038 37.469  32.298  1.00 53.98  ? 479  TYR B CE1 1 
ATOM   7829 C CE2 . TYR B 1 479 ? 33.173 39.847  31.955  1.00 52.58  ? 479  TYR B CE2 1 
ATOM   7830 C CZ  . TYR B 1 479 ? 32.768 38.602  31.533  1.00 54.09  ? 479  TYR B CZ  1 
ATOM   7831 O OH  . TYR B 1 479 ? 32.094 38.502  30.342  1.00 56.49  ? 479  TYR B OH  1 
ATOM   7832 N N   . TRP B 1 480 ? 35.492 39.645  38.189  1.00 49.31  ? 480  TRP B N   1 
ATOM   7833 C CA  . TRP B 1 480 ? 36.414 39.941  39.293  1.00 48.14  ? 480  TRP B CA  1 
ATOM   7834 C C   . TRP B 1 480 ? 36.204 39.111  40.567  1.00 48.77  ? 480  TRP B C   1 
ATOM   7835 O O   . TRP B 1 480 ? 37.173 38.565  41.107  1.00 48.60  ? 480  TRP B O   1 
ATOM   7836 C CB  . TRP B 1 480 ? 36.435 41.449  39.604  1.00 46.73  ? 480  TRP B CB  1 
ATOM   7837 C CG  . TRP B 1 480 ? 37.573 42.199  38.958  1.00 45.01  ? 480  TRP B CG  1 
ATOM   7838 C CD1 . TRP B 1 480 ? 38.609 42.816  39.597  1.00 43.97  ? 480  TRP B CD1 1 
ATOM   7839 C CD2 . TRP B 1 480 ? 37.792 42.410  37.549  1.00 45.06  ? 480  TRP B CD2 1 
ATOM   7840 N NE1 . TRP B 1 480 ? 39.457 43.407  38.682  1.00 42.80  ? 480  TRP B NE1 1 
ATOM   7841 C CE2 . TRP B 1 480 ? 38.980 43.172  37.419  1.00 43.53  ? 480  TRP B CE2 1 
ATOM   7842 C CE3 . TRP B 1 480 ? 37.100 42.030  36.387  1.00 45.83  ? 480  TRP B CE3 1 
ATOM   7843 C CZ2 . TRP B 1 480 ? 39.488 43.563  36.179  1.00 42.90  ? 480  TRP B CZ2 1 
ATOM   7844 C CZ3 . TRP B 1 480 ? 37.607 42.425  35.147  1.00 45.42  ? 480  TRP B CZ3 1 
ATOM   7845 C CH2 . TRP B 1 480 ? 38.791 43.182  35.057  1.00 44.34  ? 480  TRP B CH2 1 
ATOM   7846 N N   . THR B 1 481 ? 34.967 38.994  41.041  1.00 50.03  ? 481  THR B N   1 
ATOM   7847 C CA  . THR B 1 481 ? 34.717 38.201  42.250  1.00 51.12  ? 481  THR B CA  1 
ATOM   7848 C C   . THR B 1 481 ? 34.687 36.705  41.968  1.00 52.45  ? 481  THR B C   1 
ATOM   7849 O O   . THR B 1 481 ? 34.956 35.896  42.862  1.00 53.49  ? 481  THR B O   1 
ATOM   7850 C CB  . THR B 1 481 ? 33.430 38.626  43.018  1.00 52.37  ? 481  THR B CB  1 
ATOM   7851 O OG1 . THR B 1 481 ? 32.258 38.341  42.235  1.00 54.72  ? 481  THR B OG1 1 
ATOM   7852 C CG2 . THR B 1 481 ? 33.472 40.106  43.373  1.00 50.70  ? 481  THR B CG2 1 
ATOM   7853 N N   . ASN B 1 482 ? 34.352 36.323  40.739  1.00 53.08  ? 482  ASN B N   1 
ATOM   7854 C CA  . ASN B 1 482 ? 34.464 34.912  40.355  1.00 53.94  ? 482  ASN B CA  1 
ATOM   7855 C C   . ASN B 1 482 ? 35.900 34.492  40.377  1.00 52.62  ? 482  ASN B C   1 
ATOM   7856 O O   . ASN B 1 482 ? 36.220 33.387  40.806  1.00 53.54  ? 482  ASN B O   1 
ATOM   7857 C CB  . ASN B 1 482 ? 33.878 34.625  38.974  1.00 54.92  ? 482  ASN B CB  1 
ATOM   7858 C CG  . ASN B 1 482 ? 32.412 34.275  39.027  1.00 56.70  ? 482  ASN B CG  1 
ATOM   7859 O OD1 . ASN B 1 482 ? 31.871 33.901  40.077  1.00 57.56  ? 482  ASN B OD1 1 
ATOM   7860 N ND2 . ASN B 1 482 ? 31.756 34.392  37.889  1.00 58.68  ? 482  ASN B ND2 1 
ATOM   7861 N N   . PHE B 1 483 ? 36.759 35.391  39.913  1.00 51.01  ? 483  PHE B N   1 
ATOM   7862 C CA  . PHE B 1 483 ? 38.189 35.177  39.957  1.00 49.95  ? 483  PHE B CA  1 
ATOM   7863 C C   . PHE B 1 483 ? 38.690 35.066  41.411  1.00 50.33  ? 483  PHE B C   1 
ATOM   7864 O O   . PHE B 1 483 ? 39.513 34.199  41.718  1.00 50.13  ? 483  PHE B O   1 
ATOM   7865 C CB  . PHE B 1 483 ? 38.931 36.286  39.199  1.00 48.02  ? 483  PHE B CB  1 
ATOM   7866 C CG  . PHE B 1 483 ? 40.421 36.171  39.292  1.00 46.14  ? 483  PHE B CG  1 
ATOM   7867 C CD1 . PHE B 1 483 ? 41.101 35.208  38.554  1.00 44.87  ? 483  PHE B CD1 1 
ATOM   7868 C CD2 . PHE B 1 483 ? 41.141 36.999  40.144  1.00 44.17  ? 483  PHE B CD2 1 
ATOM   7869 C CE1 . PHE B 1 483 ? 42.469 35.080  38.655  1.00 44.67  ? 483  PHE B CE1 1 
ATOM   7870 C CE2 . PHE B 1 483 ? 42.517 36.875  40.254  1.00 43.40  ? 483  PHE B CE2 1 
ATOM   7871 C CZ  . PHE B 1 483 ? 43.184 35.922  39.510  1.00 44.14  ? 483  PHE B CZ  1 
ATOM   7872 N N   . ALA B 1 484 ? 38.192 35.939  42.294  1.00 50.57  ? 484  ALA B N   1 
ATOM   7873 C CA  . ALA B 1 484 ? 38.594 35.923  43.703  1.00 51.04  ? 484  ALA B CA  1 
ATOM   7874 C C   . ALA B 1 484 ? 38.176 34.631  44.404  1.00 53.21  ? 484  ALA B C   1 
ATOM   7875 O O   . ALA B 1 484 ? 38.926 34.094  45.230  1.00 53.01  ? 484  ALA B O   1 
ATOM   7876 C CB  . ALA B 1 484 ? 38.040 37.141  44.442  1.00 50.55  ? 484  ALA B CB  1 
ATOM   7877 N N   . ARG B 1 485 ? 36.985 34.138  44.054  1.00 55.42  ? 485  ARG B N   1 
ATOM   7878 C CA  . ARG B 1 485 ? 36.422 32.911  44.633  1.00 58.32  ? 485  ARG B CA  1 
ATOM   7879 C C   . ARG B 1 485 ? 37.172 31.658  44.218  1.00 58.69  ? 485  ARG B C   1 
ATOM   7880 O O   . ARG B 1 485 ? 37.293 30.733  45.020  1.00 59.95  ? 485  ARG B O   1 
ATOM   7881 C CB  . ARG B 1 485 ? 34.944 32.727  44.238  1.00 59.61  ? 485  ARG B CB  1 
ATOM   7882 C CG  . ARG B 1 485 ? 33.910 33.447  45.108  1.00 61.68  ? 485  ARG B CG  1 
ATOM   7883 C CD  . ARG B 1 485 ? 32.451 33.135  44.660  1.00 63.96  ? 485  ARG B CD  1 
ATOM   7884 N NE  . ARG B 1 485 ? 32.029 33.941  43.507  1.00 67.24  ? 485  ARG B NE  1 
ATOM   7885 C CZ  . ARG B 1 485 ? 31.485 35.163  43.577  1.00 68.27  ? 485  ARG B CZ  1 
ATOM   7886 N NH1 . ARG B 1 485 ? 31.263 35.749  44.757  1.00 67.67  ? 485  ARG B NH1 1 
ATOM   7887 N NH2 . ARG B 1 485 ? 31.152 35.804  42.454  1.00 68.06  ? 485  ARG B NH2 1 
ATOM   7888 N N   . THR B 1 486 ? 37.647 31.615  42.967  1.00 58.20  ? 486  THR B N   1 
ATOM   7889 C CA  . THR B 1 486 ? 38.090 30.344  42.352  1.00 59.23  ? 486  THR B CA  1 
ATOM   7890 C C   . THR B 1 486 ? 39.401 30.377  41.562  1.00 58.35  ? 486  THR B C   1 
ATOM   7891 O O   . THR B 1 486 ? 39.977 29.326  41.286  1.00 59.16  ? 486  THR B O   1 
ATOM   7892 C CB  . THR B 1 486 ? 37.032 29.779  41.381  1.00 60.47  ? 486  THR B CB  1 
ATOM   7893 O OG1 . THR B 1 486 ? 36.871 30.683  40.280  1.00 59.46  ? 486  THR B OG1 1 
ATOM   7894 C CG2 . THR B 1 486 ? 35.700 29.563  42.069  1.00 61.20  ? 486  THR B CG2 1 
ATOM   7895 N N   . GLY B 1 487 ? 39.852 31.569  41.178  1.00 56.97  ? 487  GLY B N   1 
ATOM   7896 C CA  . GLY B 1 487 ? 41.026 31.716  40.321  1.00 56.06  ? 487  GLY B CA  1 
ATOM   7897 C C   . GLY B 1 487 ? 40.664 31.660  38.851  1.00 56.69  ? 487  GLY B C   1 
ATOM   7898 O O   . GLY B 1 487 ? 41.546 31.552  38.000  1.00 56.30  ? 487  GLY B O   1 
ATOM   7899 N N   . ASP B 1 488 ? 39.362 31.736  38.563  1.00 57.88  ? 488  ASP B N   1 
ATOM   7900 C CA  . ASP B 1 488 ? 38.819 31.603  37.214  1.00 59.03  ? 488  ASP B CA  1 
ATOM   7901 C C   . ASP B 1 488 ? 37.645 32.576  37.086  1.00 59.70  ? 488  ASP B C   1 
ATOM   7902 O O   . ASP B 1 488 ? 36.656 32.441  37.803  1.00 60.78  ? 488  ASP B O   1 
ATOM   7903 C CB  . ASP B 1 488 ? 38.368 30.148  36.981  1.00 60.69  ? 488  ASP B CB  1 
ATOM   7904 C CG  . ASP B 1 488 ? 37.994 29.849  35.529  1.00 61.24  ? 488  ASP B CG  1 
ATOM   7905 O OD1 . ASP B 1 488 ? 37.622 30.772  34.785  1.00 61.42  ? 488  ASP B OD1 1 
ATOM   7906 O OD2 . ASP B 1 488 ? 38.060 28.670  35.124  1.00 62.00  ? 488  ASP B OD2 1 
ATOM   7907 N N   . PRO B 1 489 ? 37.741 33.558  36.169  1.00 59.62  ? 489  PRO B N   1 
ATOM   7908 C CA  . PRO B 1 489 ? 36.698 34.593  36.082  1.00 60.39  ? 489  PRO B CA  1 
ATOM   7909 C C   . PRO B 1 489 ? 35.417 34.114  35.396  1.00 62.85  ? 489  PRO B C   1 
ATOM   7910 O O   . PRO B 1 489 ? 34.455 34.869  35.293  1.00 63.35  ? 489  PRO B O   1 
ATOM   7911 C CB  . PRO B 1 489 ? 37.366 35.694  35.251  1.00 58.86  ? 489  PRO B CB  1 
ATOM   7912 C CG  . PRO B 1 489 ? 38.333 34.957  34.378  1.00 58.78  ? 489  PRO B CG  1 
ATOM   7913 C CD  . PRO B 1 489 ? 38.801 33.755  35.161  1.00 58.74  ? 489  PRO B CD  1 
ATOM   7914 N N   . ASN B 1 490 ? 35.411 32.871  34.938  1.00 65.16  ? 490  ASN B N   1 
ATOM   7915 C CA  . ASN B 1 490 ? 34.253 32.315  34.256  1.00 68.27  ? 490  ASN B CA  1 
ATOM   7916 C C   . ASN B 1 490 ? 33.173 31.884  35.236  1.00 71.06  ? 490  ASN B C   1 
ATOM   7917 O O   . ASN B 1 490 ? 33.475 31.349  36.306  1.00 71.17  ? 490  ASN B O   1 
ATOM   7918 C CB  . ASN B 1 490 ? 34.667 31.153  33.358  1.00 68.51  ? 490  ASN B CB  1 
ATOM   7919 C CG  . ASN B 1 490 ? 35.472 31.607  32.160  1.00 66.72  ? 490  ASN B CG  1 
ATOM   7920 O OD1 . ASN B 1 490 ? 34.932 32.176  31.213  1.00 66.60  ? 490  ASN B OD1 1 
ATOM   7921 N ND2 . ASN B 1 490 ? 36.769 31.347  32.191  1.00 64.29  ? 490  ASN B ND2 1 
ATOM   7922 N N   . ASP B 1 491 ? 31.922 32.136  34.853  1.00 74.12  ? 491  ASP B N   1 
ATOM   7923 C CA  . ASP B 1 491 ? 30.747 31.827  35.663  1.00 77.64  ? 491  ASP B CA  1 
ATOM   7924 C C   . ASP B 1 491 ? 30.537 30.304  35.701  1.00 80.37  ? 491  ASP B C   1 
ATOM   7925 O O   . ASP B 1 491 ? 30.074 29.733  34.713  1.00 81.85  ? 491  ASP B O   1 
ATOM   7926 C CB  . ASP B 1 491 ? 29.519 32.513  35.046  1.00 79.13  ? 491  ASP B CB  1 
ATOM   7927 C CG  . ASP B 1 491 ? 28.589 33.134  36.087  1.00 80.90  ? 491  ASP B CG  1 
ATOM   7928 O OD1 . ASP B 1 491 ? 28.239 32.473  37.099  1.00 82.25  ? 491  ASP B OD1 1 
ATOM   7929 O OD2 . ASP B 1 491 ? 28.189 34.299  35.867  1.00 81.73  ? 491  ASP B OD2 1 
ATOM   7930 N N   . PRO B 1 492 ? 30.838 29.653  36.853  1.00 81.53  ? 492  PRO B N   1 
ATOM   7931 C CA  . PRO B 1 492 ? 31.001 28.185  36.944  1.00 83.61  ? 492  PRO B CA  1 
ATOM   7932 C C   . PRO B 1 492 ? 29.731 27.341  36.782  1.00 86.94  ? 492  PRO B C   1 
ATOM   7933 O O   . PRO B 1 492 ? 29.838 26.121  36.647  1.00 88.54  ? 492  PRO B O   1 
ATOM   7934 C CB  . PRO B 1 492 ? 31.581 27.979  38.350  1.00 83.14  ? 492  PRO B CB  1 
ATOM   7935 C CG  . PRO B 1 492 ? 31.056 29.143  39.144  1.00 82.27  ? 492  PRO B CG  1 
ATOM   7936 C CD  . PRO B 1 492 ? 30.996 30.303  38.174  1.00 80.68  ? 492  PRO B CD  1 
ATOM   7937 N N   . ARG B 1 493 ? 28.554 27.970  36.800  1.00 88.56  ? 493  ARG B N   1 
ATOM   7938 C CA  . ARG B 1 493 ? 27.280 27.252  36.620  1.00 92.03  ? 493  ARG B CA  1 
ATOM   7939 C C   . ARG B 1 493 ? 26.534 27.721  35.366  1.00 93.32  ? 493  ARG B C   1 
ATOM   7940 O O   . ARG B 1 493 ? 25.729 26.976  34.784  1.00 95.56  ? 493  ARG B O   1 
ATOM   7941 C CB  . ARG B 1 493 ? 26.396 27.377  37.867  1.00 93.12  ? 493  ARG B CB  1 
ATOM   7942 N N   . ASP B 1 494 ? 26.806 28.961  34.961  1.00 92.05  ? 494  ASP B N   1 
ATOM   7943 C CA  . ASP B 1 494 ? 26.322 29.488  33.685  1.00 92.94  ? 494  ASP B CA  1 
ATOM   7944 C C   . ASP B 1 494 ? 27.093 28.838  32.533  1.00 92.39  ? 494  ASP B C   1 
ATOM   7945 O O   . ASP B 1 494 ? 28.322 28.729  32.569  1.00 90.60  ? 494  ASP B O   1 
ATOM   7946 C CB  . ASP B 1 494 ? 26.469 31.020  33.645  1.00 91.59  ? 494  ASP B CB  1 
ATOM   7947 C CG  . ASP B 1 494 ? 26.238 31.603  32.252  1.00 92.93  ? 494  ASP B CG  1 
ATOM   7948 O OD1 . ASP B 1 494 ? 25.070 31.658  31.804  1.00 96.21  ? 494  ASP B OD1 1 
ATOM   7949 O OD2 . ASP B 1 494 ? 27.232 32.014  31.610  1.00 92.91  ? 494  ASP B OD2 1 
ATOM   7950 N N   . SER B 1 495 ? 26.365 28.388  31.519  1.00 94.08  ? 495  SER B N   1 
ATOM   7951 C CA  . SER B 1 495 ? 26.997 27.818  30.333  1.00 93.69  ? 495  SER B CA  1 
ATOM   7952 C C   . SER B 1 495 ? 27.541 28.931  29.422  1.00 91.55  ? 495  SER B C   1 
ATOM   7953 O O   . SER B 1 495 ? 28.499 29.630  29.784  1.00 89.19  ? 495  SER B O   1 
ATOM   7954 C CB  . SER B 1 495 ? 26.020 26.895  29.587  1.00 96.63  ? 495  SER B CB  1 
ATOM   7955 O OG  . SER B 1 495 ? 26.462 26.627  28.264  1.00 96.51  ? 495  SER B OG  1 
ATOM   7956 N N   . LYS B 1 496 ? 26.892 29.088  28.264  1.00 92.27  ? 496  LYS B N   1 
ATOM   7957 C CA  . LYS B 1 496 ? 27.298 29.996  27.174  1.00 90.36  ? 496  LYS B CA  1 
ATOM   7958 C C   . LYS B 1 496 ? 28.798 30.133  26.835  1.00 86.88  ? 496  LYS B C   1 
ATOM   7959 O O   . LYS B 1 496 ? 29.604 30.666  27.620  1.00 84.24  ? 496  LYS B O   1 
ATOM   7960 C CB  . LYS B 1 496 ? 26.595 31.369  27.260  1.00 90.47  ? 496  LYS B CB  1 
ATOM   7961 C CG  . LYS B 1 496 ? 25.508 31.542  26.163  1.00 93.87  ? 496  LYS B CG  1 
ATOM   7962 C CD  . LYS B 1 496 ? 24.055 31.724  26.675  1.00 97.69  ? 496  LYS B CD  1 
ATOM   7963 C CE  . LYS B 1 496 ? 23.682 30.854  27.890  1.00 99.30  ? 496  LYS B CE  1 
ATOM   7964 N NZ  . LYS B 1 496 ? 24.066 31.512  29.195  1.00 97.40  ? 496  LYS B NZ  1 
ATOM   7965 N N   . SER B 1 497 ? 29.139 29.647  25.639  1.00 85.99  ? 497  SER B N   1 
ATOM   7966 C CA  . SER B 1 497 ? 30.319 30.119  24.919  1.00 82.76  ? 497  SER B CA  1 
ATOM   7967 C C   . SER B 1 497 ? 30.006 31.543  24.423  1.00 80.88  ? 497  SER B C   1 
ATOM   7968 O O   . SER B 1 497 ? 28.871 31.804  23.981  1.00 82.90  ? 497  SER B O   1 
ATOM   7969 C CB  . SER B 1 497 ? 30.636 29.200  23.740  1.00 83.95  ? 497  SER B CB  1 
ATOM   7970 O OG  . SER B 1 497 ? 29.634 29.276  22.748  1.00 86.14  ? 497  SER B OG  1 
ATOM   7971 N N   . PRO B 1 498 ? 31.006 32.454  24.445  1.00 76.89  ? 498  PRO B N   1 
ATOM   7972 C CA  . PRO B 1 498 ? 32.421 32.158  24.632  1.00 73.53  ? 498  PRO B CA  1 
ATOM   7973 C C   . PRO B 1 498 ? 32.915 32.253  26.080  1.00 69.92  ? 498  PRO B C   1 
ATOM   7974 O O   . PRO B 1 498 ? 32.494 33.126  26.849  1.00 68.87  ? 498  PRO B O   1 
ATOM   7975 C CB  . PRO B 1 498 ? 33.113 33.211  23.743  1.00 72.61  ? 498  PRO B CB  1 
ATOM   7976 C CG  . PRO B 1 498 ? 32.039 34.307  23.503  1.00 74.29  ? 498  PRO B CG  1 
ATOM   7977 C CD  . PRO B 1 498 ? 30.801 33.901  24.271  1.00 76.17  ? 498  PRO B CD  1 
ATOM   7978 N N   . GLN B 1 499 ? 33.802 31.324  26.419  1.00 67.08  ? 499  GLN B N   1 
ATOM   7979 C CA  . GLN B 1 499 ? 34.496 31.311  27.691  1.00 62.90  ? 499  GLN B CA  1 
ATOM   7980 C C   . GLN B 1 499 ? 35.731 32.196  27.565  1.00 58.83  ? 499  GLN B C   1 
ATOM   7981 O O   . GLN B 1 499 ? 36.298 32.327  26.484  1.00 57.93  ? 499  GLN B O   1 
ATOM   7982 C CB  . GLN B 1 499 ? 34.898 29.869  28.054  1.00 63.92  ? 499  GLN B CB  1 
ATOM   7983 C CG  . GLN B 1 499 ? 33.745 28.920  28.361  1.00 65.77  ? 499  GLN B CG  1 
ATOM   7984 C CD  . GLN B 1 499 ? 33.191 29.081  29.781  1.00 67.29  ? 499  GLN B CD  1 
ATOM   7985 O OE1 . GLN B 1 499 ? 32.063 29.546  29.973  1.00 68.00  ? 499  GLN B OE1 1 
ATOM   7986 N NE2 . GLN B 1 499 ? 33.984 28.687  30.780  1.00 66.35  ? 499  GLN B NE2 1 
ATOM   7987 N N   . TRP B 1 500 ? 36.130 32.800  28.678  1.00 55.29  ? 500  TRP B N   1 
ATOM   7988 C CA  . TRP B 1 500 ? 37.393 33.528  28.787  1.00 51.89  ? 500  TRP B CA  1 
ATOM   7989 C C   . TRP B 1 500 ? 38.560 32.528  28.917  1.00 50.79  ? 500  TRP B C   1 
ATOM   7990 O O   . TRP B 1 500 ? 38.722 31.903  29.968  1.00 50.72  ? 500  TRP B O   1 
ATOM   7991 C CB  . TRP B 1 500 ? 37.346 34.426  30.029  1.00 50.26  ? 500  TRP B CB  1 
ATOM   7992 C CG  . TRP B 1 500 ? 38.452 35.421  30.153  1.00 47.91  ? 500  TRP B CG  1 
ATOM   7993 C CD1 . TRP B 1 500 ? 39.705 35.343  29.605  1.00 46.74  ? 500  TRP B CD1 1 
ATOM   7994 C CD2 . TRP B 1 500 ? 38.425 36.632  30.917  1.00 46.89  ? 500  TRP B CD2 1 
ATOM   7995 N NE1 . TRP B 1 500 ? 40.448 36.442  29.961  1.00 44.89  ? 500  TRP B NE1 1 
ATOM   7996 C CE2 . TRP B 1 500 ? 39.692 37.245  30.774  1.00 45.47  ? 500  TRP B CE2 1 
ATOM   7997 C CE3 . TRP B 1 500 ? 37.450 37.267  31.703  1.00 47.67  ? 500  TRP B CE3 1 
ATOM   7998 C CZ2 . TRP B 1 500 ? 40.007 38.467  31.382  1.00 45.42  ? 500  TRP B CZ2 1 
ATOM   7999 C CZ3 . TRP B 1 500 ? 37.764 38.486  32.311  1.00 45.71  ? 500  TRP B CZ3 1 
ATOM   8000 C CH2 . TRP B 1 500 ? 39.030 39.071  32.142  1.00 44.98  ? 500  TRP B CH2 1 
ATOM   8001 N N   . PRO B 1 501 ? 39.384 32.382  27.863  1.00 49.62  ? 501  PRO B N   1 
ATOM   8002 C CA  . PRO B 1 501 ? 40.437 31.384  27.947  1.00 49.35  ? 501  PRO B CA  1 
ATOM   8003 C C   . PRO B 1 501 ? 41.667 31.911  28.670  1.00 47.90  ? 501  PRO B C   1 
ATOM   8004 O O   . PRO B 1 501 ? 41.911 33.122  28.659  1.00 46.34  ? 501  PRO B O   1 
ATOM   8005 C CB  . PRO B 1 501 ? 40.769 31.088  26.477  1.00 49.68  ? 501  PRO B CB  1 
ATOM   8006 C CG  . PRO B 1 501 ? 40.097 32.139  25.672  1.00 49.45  ? 501  PRO B CG  1 
ATOM   8007 C CD  . PRO B 1 501 ? 39.419 33.104  26.584  1.00 49.41  ? 501  PRO B CD  1 
ATOM   8008 N N   . PRO B 1 502 ? 42.444 31.014  29.309  1.00 48.37  ? 502  PRO B N   1 
ATOM   8009 C CA  . PRO B 1 502 ? 43.718 31.463  29.899  1.00 47.33  ? 502  PRO B CA  1 
ATOM   8010 C C   . PRO B 1 502 ? 44.711 31.982  28.846  1.00 47.38  ? 502  PRO B C   1 
ATOM   8011 O O   . PRO B 1 502 ? 44.743 31.483  27.702  1.00 47.97  ? 502  PRO B O   1 
ATOM   8012 C CB  . PRO B 1 502 ? 44.274 30.203  30.573  1.00 47.75  ? 502  PRO B CB  1 
ATOM   8013 C CG  . PRO B 1 502 ? 43.141 29.250  30.660  1.00 49.62  ? 502  PRO B CG  1 
ATOM   8014 C CD  . PRO B 1 502 ? 42.195 29.581  29.542  1.00 49.64  ? 502  PRO B CD  1 
ATOM   8015 N N   . TYR B 1 503 ? 45.500 32.982  29.240  1.00 46.76  ? 503  TYR B N   1 
ATOM   8016 C CA  . TYR B 1 503 ? 46.599 33.486  28.426  1.00 47.39  ? 503  TYR B CA  1 
ATOM   8017 C C   . TYR B 1 503 ? 47.764 32.496  28.488  1.00 48.50  ? 503  TYR B C   1 
ATOM   8018 O O   . TYR B 1 503 ? 48.158 32.062  29.573  1.00 48.70  ? 503  TYR B O   1 
ATOM   8019 C CB  . TYR B 1 503 ? 47.032 34.888  28.896  1.00 46.38  ? 503  TYR B CB  1 
ATOM   8020 C CG  . TYR B 1 503 ? 48.098 35.529  28.026  1.00 46.85  ? 503  TYR B CG  1 
ATOM   8021 C CD1 . TYR B 1 503 ? 49.454 35.237  28.222  1.00 46.57  ? 503  TYR B CD1 1 
ATOM   8022 C CD2 . TYR B 1 503 ? 47.752 36.422  27.001  1.00 46.34  ? 503  TYR B CD2 1 
ATOM   8023 C CE1 . TYR B 1 503 ? 50.432 35.800  27.427  1.00 46.67  ? 503  TYR B CE1 1 
ATOM   8024 C CE2 . TYR B 1 503 ? 48.728 36.997  26.195  1.00 46.75  ? 503  TYR B CE2 1 
ATOM   8025 C CZ  . TYR B 1 503 ? 50.069 36.681  26.415  1.00 47.57  ? 503  TYR B CZ  1 
ATOM   8026 O OH  . TYR B 1 503 ? 51.055 37.243  25.632  1.00 48.09  ? 503  TYR B OH  1 
ATOM   8027 N N   . THR B 1 504 ? 48.277 32.118  27.319  1.00 49.82  ? 504  THR B N   1 
ATOM   8028 C CA  . THR B 1 504 ? 49.424 31.215  27.190  1.00 51.45  ? 504  THR B CA  1 
ATOM   8029 C C   . THR B 1 504 ? 50.434 31.870  26.259  1.00 52.27  ? 504  THR B C   1 
ATOM   8030 O O   . THR B 1 504 ? 50.053 32.678  25.412  1.00 52.50  ? 504  THR B O   1 
ATOM   8031 C CB  . THR B 1 504 ? 49.035 29.880  26.524  1.00 53.10  ? 504  THR B CB  1 
ATOM   8032 O OG1 . THR B 1 504 ? 48.567 30.133  25.189  1.00 52.58  ? 504  THR B OG1 1 
ATOM   8033 C CG2 . THR B 1 504 ? 47.973 29.133  27.330  1.00 52.87  ? 504  THR B CG2 1 
ATOM   8034 N N   . THR B 1 505 ? 51.711 31.522  26.378  1.00 53.50  ? 505  THR B N   1 
ATOM   8035 C CA  . THR B 1 505 ? 52.719 32.101  25.472  1.00 54.30  ? 505  THR B CA  1 
ATOM   8036 C C   . THR B 1 505 ? 52.508 31.695  24.001  1.00 55.45  ? 505  THR B C   1 
ATOM   8037 O O   . THR B 1 505 ? 52.753 32.498  23.105  1.00 55.68  ? 505  THR B O   1 
ATOM   8038 C CB  . THR B 1 505 ? 54.181 31.799  25.914  1.00 54.89  ? 505  THR B CB  1 
ATOM   8039 O OG1 . THR B 1 505 ? 54.356 30.395  26.082  1.00 57.44  ? 505  THR B OG1 1 
ATOM   8040 C CG2 . THR B 1 505 ? 54.511 32.486  27.223  1.00 53.60  ? 505  THR B CG2 1 
ATOM   8041 N N   . ALA B 1 506 ? 52.038 30.468  23.763  1.00 56.67  ? 506  ALA B N   1 
ATOM   8042 C CA  . ALA B 1 506 ? 51.748 29.984  22.401  1.00 57.97  ? 506  ALA B CA  1 
ATOM   8043 C C   . ALA B 1 506 ? 50.579 30.710  21.719  1.00 57.69  ? 506  ALA B C   1 
ATOM   8044 O O   . ALA B 1 506 ? 50.783 31.431  20.738  1.00 57.91  ? 506  ALA B O   1 
ATOM   8045 C CB  . ALA B 1 506 ? 51.502 28.472  22.404  1.00 59.34  ? 506  ALA B CB  1 
ATOM   8046 N N   . ALA B 1 507 ? 49.364 30.508  22.237  1.00 57.36  ? 507  ALA B N   1 
ATOM   8047 C CA  . ALA B 1 507 ? 48.148 31.090  21.655  1.00 56.94  ? 507  ALA B CA  1 
ATOM   8048 C C   . ALA B 1 507 ? 47.920 32.571  21.983  1.00 55.22  ? 507  ALA B C   1 
ATOM   8049 O O   . ALA B 1 507 ? 47.250 33.273  21.231  1.00 55.88  ? 507  ALA B O   1 
ATOM   8050 C CB  . ALA B 1 507 ? 46.932 30.265  22.053  1.00 57.58  ? 507  ALA B CB  1 
ATOM   8051 N N   . GLN B 1 508 ? 48.460 33.041  23.101  1.00 53.59  ? 508  GLN B N   1 
ATOM   8052 C CA  . GLN B 1 508 ? 48.326 34.452  23.523  1.00 52.14  ? 508  GLN B CA  1 
ATOM   8053 C C   . GLN B 1 508 ? 46.890 35.006  23.503  1.00 51.20  ? 508  GLN B C   1 
ATOM   8054 O O   . GLN B 1 508 ? 46.660 36.137  23.074  1.00 51.09  ? 508  GLN B O   1 
ATOM   8055 C CB  . GLN B 1 508 ? 49.261 35.368  22.708  1.00 52.08  ? 508  GLN B CB  1 
ATOM   8056 C CG  . GLN B 1 508 ? 50.709 34.904  22.655  1.00 53.32  ? 508  GLN B CG  1 
ATOM   8057 C CD  . GLN B 1 508 ? 51.524 35.603  21.579  1.00 54.14  ? 508  GLN B CD  1 
ATOM   8058 O OE1 . GLN B 1 508 ? 51.759 36.807  21.639  1.00 54.16  ? 508  GLN B OE1 1 
ATOM   8059 N NE2 . GLN B 1 508 ? 51.964 34.843  20.595  1.00 56.13  ? 508  GLN B NE2 1 
ATOM   8060 N N   . GLN B 1 509 ? 45.934 34.225  23.989  1.00 50.70  ? 509  GLN B N   1 
ATOM   8061 C CA  . GLN B 1 509 ? 44.537 34.653  23.976  1.00 50.09  ? 509  GLN B CA  1 
ATOM   8062 C C   . GLN B 1 509 ? 44.184 35.611  25.109  1.00 48.78  ? 509  GLN B C   1 
ATOM   8063 O O   . GLN B 1 509 ? 44.587 35.421  26.261  1.00 47.78  ? 509  GLN B O   1 
ATOM   8064 C CB  . GLN B 1 509 ? 43.595 33.452  23.991  1.00 50.98  ? 509  GLN B CB  1 
ATOM   8065 C CG  . GLN B 1 509 ? 43.728 32.588  22.770  1.00 51.89  ? 509  GLN B CG  1 
ATOM   8066 C CD  . GLN B 1 509 ? 42.946 31.312  22.865  1.00 52.28  ? 509  GLN B CD  1 
ATOM   8067 O OE1 . GLN B 1 509 ? 43.205 30.467  23.718  1.00 51.52  ? 509  GLN B OE1 1 
ATOM   8068 N NE2 . GLN B 1 509 ? 41.988 31.151  21.971  1.00 54.45  ? 509  GLN B NE2 1 
ATOM   8069 N N   . TYR B 1 510 ? 43.428 36.643  24.754  1.00 48.29  ? 510  TYR B N   1 
ATOM   8070 C CA  . TYR B 1 510 ? 42.884 37.595  25.712  1.00 47.61  ? 510  TYR B CA  1 
ATOM   8071 C C   . TYR B 1 510 ? 41.460 37.986  25.283  1.00 48.41  ? 510  TYR B C   1 
ATOM   8072 O O   . TYR B 1 510 ? 41.051 37.703  24.153  1.00 50.07  ? 510  TYR B O   1 
ATOM   8073 C CB  . TYR B 1 510 ? 43.804 38.822  25.843  1.00 46.35  ? 510  TYR B CB  1 
ATOM   8074 C CG  . TYR B 1 510 ? 43.900 39.689  24.600  1.00 46.53  ? 510  TYR B CG  1 
ATOM   8075 C CD1 . TYR B 1 510 ? 44.735 39.335  23.537  1.00 46.81  ? 510  TYR B CD1 1 
ATOM   8076 C CD2 . TYR B 1 510 ? 43.173 40.873  24.498  1.00 46.53  ? 510  TYR B CD2 1 
ATOM   8077 C CE1 . TYR B 1 510 ? 44.824 40.127  22.400  1.00 47.10  ? 510  TYR B CE1 1 
ATOM   8078 C CE2 . TYR B 1 510 ? 43.258 41.676  23.363  1.00 47.16  ? 510  TYR B CE2 1 
ATOM   8079 C CZ  . TYR B 1 510 ? 44.088 41.292  22.320  1.00 47.66  ? 510  TYR B CZ  1 
ATOM   8080 O OH  . TYR B 1 510 ? 44.175 42.075  21.197  1.00 48.31  ? 510  TYR B OH  1 
ATOM   8081 N N   . VAL B 1 511 ? 40.700 38.618  26.172  1.00 47.67  ? 511  VAL B N   1 
ATOM   8082 C CA  . VAL B 1 511 ? 39.344 39.038  25.824  1.00 48.52  ? 511  VAL B CA  1 
ATOM   8083 C C   . VAL B 1 511 ? 39.181 40.550  25.838  1.00 48.10  ? 511  VAL B C   1 
ATOM   8084 O O   . VAL B 1 511 ? 39.886 41.252  26.560  1.00 47.31  ? 511  VAL B O   1 
ATOM   8085 C CB  . VAL B 1 511 ? 38.266 38.401  26.744  1.00 49.23  ? 511  VAL B CB  1 
ATOM   8086 C CG1 . VAL B 1 511 ? 38.263 36.874  26.615  1.00 49.74  ? 511  VAL B CG1 1 
ATOM   8087 C CG2 . VAL B 1 511 ? 38.441 38.847  28.201  1.00 47.46  ? 511  VAL B CG2 1 
ATOM   8088 N N   . SER B 1 512 ? 38.251 41.053  25.041  1.00 49.17  ? 512  SER B N   1 
ATOM   8089 C CA  . SER B 1 512 ? 37.919 42.466  25.099  1.00 49.40  ? 512  SER B CA  1 
ATOM   8090 C C   . SER B 1 512 ? 36.718 42.694  26.022  1.00 50.12  ? 512  SER B C   1 
ATOM   8091 O O   . SER B 1 512 ? 35.707 41.996  25.936  1.00 50.86  ? 512  SER B O   1 
ATOM   8092 C CB  . SER B 1 512 ? 37.650 43.017  23.705  1.00 50.17  ? 512  SER B CB  1 
ATOM   8093 O OG  . SER B 1 512 ? 36.449 42.495  23.204  1.00 52.10  ? 512  SER B OG  1 
ATOM   8094 N N   . LEU B 1 513 ? 36.851 43.653  26.929  1.00 49.79  ? 513  LEU B N   1 
ATOM   8095 C CA  . LEU B 1 513 ? 35.758 43.991  27.828  1.00 50.85  ? 513  LEU B CA  1 
ATOM   8096 C C   . LEU B 1 513 ? 35.088 45.265  27.324  1.00 52.31  ? 513  LEU B C   1 
ATOM   8097 O O   . LEU B 1 513 ? 35.684 46.338  27.358  1.00 52.03  ? 513  LEU B O   1 
ATOM   8098 C CB  . LEU B 1 513 ? 36.266 44.149  29.271  1.00 49.31  ? 513  LEU B CB  1 
ATOM   8099 C CG  . LEU B 1 513 ? 36.908 42.926  29.944  1.00 47.42  ? 513  LEU B CG  1 
ATOM   8100 C CD1 . LEU B 1 513 ? 37.548 43.270  31.278  1.00 43.87  ? 513  LEU B CD1 1 
ATOM   8101 C CD2 . LEU B 1 513 ? 35.895 41.806  30.112  1.00 47.39  ? 513  LEU B CD2 1 
ATOM   8102 N N   . ASN B 1 514 ? 33.874 45.122  26.805  1.00 54.56  ? 514  ASN B N   1 
ATOM   8103 C CA  . ASN B 1 514 ? 33.058 46.256  26.374  1.00 56.71  ? 514  ASN B CA  1 
ATOM   8104 C C   . ASN B 1 514 ? 31.584 45.887  26.467  1.00 59.00  ? 514  ASN B C   1 
ATOM   8105 O O   . ASN B 1 514 ? 31.243 44.859  27.058  1.00 59.34  ? 514  ASN B O   1 
ATOM   8106 C CB  . ASN B 1 514 ? 33.426 46.717  24.958  1.00 57.21  ? 514  ASN B CB  1 
ATOM   8107 C CG  . ASN B 1 514 ? 33.507 45.566  23.964  1.00 58.55  ? 514  ASN B CG  1 
ATOM   8108 O OD1 . ASN B 1 514 ? 34.533 45.368  23.312  1.00 58.67  ? 514  ASN B OD1 1 
ATOM   8109 N ND2 . ASN B 1 514 ? 32.432 44.798  23.852  1.00 60.50  ? 514  ASN B ND2 1 
ATOM   8110 N N   . LEU B 1 515 ? 30.715 46.710  25.881  1.00 61.19  ? 515  LEU B N   1 
ATOM   8111 C CA  . LEU B 1 515 ? 29.272 46.485  25.971  1.00 63.79  ? 515  LEU B CA  1 
ATOM   8112 C C   . LEU B 1 515 ? 28.811 45.226  25.239  1.00 65.35  ? 515  LEU B C   1 
ATOM   8113 O O   . LEU B 1 515 ? 27.829 44.607  25.640  1.00 66.86  ? 515  LEU B O   1 
ATOM   8114 C CB  . LEU B 1 515 ? 28.492 47.704  25.473  1.00 65.47  ? 515  LEU B CB  1 
ATOM   8115 C CG  . LEU B 1 515 ? 28.709 49.039  26.190  1.00 64.84  ? 515  LEU B CG  1 
ATOM   8116 C CD1 . LEU B 1 515 ? 27.851 50.110  25.537  1.00 66.04  ? 515  LEU B CD1 1 
ATOM   8117 C CD2 . LEU B 1 515 ? 28.436 48.955  27.702  1.00 63.02  ? 515  LEU B CD2 1 
ATOM   8118 N N   . LYS B 1 516 ? 29.523 44.862  24.172  1.00 65.52  ? 516  LYS B N   1 
ATOM   8119 C CA  . LYS B 1 516 ? 29.273 43.632  23.415  1.00 67.14  ? 516  LYS B CA  1 
ATOM   8120 C C   . LYS B 1 516 ? 29.742 42.410  24.223  1.00 65.85  ? 516  LYS B C   1 
ATOM   8121 O O   . LYS B 1 516 ? 30.605 42.553  25.091  1.00 64.14  ? 516  LYS B O   1 
ATOM   8122 C CB  . LYS B 1 516 ? 29.979 43.698  22.047  1.00 67.30  ? 516  LYS B CB  1 
ATOM   8123 C CG  . LYS B 1 516 ? 29.521 44.874  21.166  1.00 70.87  ? 516  LYS B CG  1 
ATOM   8124 C CD  . LYS B 1 516 ? 30.118 44.842  19.748  1.00 75.49  ? 516  LYS B CD  1 
ATOM   8125 C CE  . LYS B 1 516 ? 31.477 45.574  19.660  1.00 75.89  ? 516  LYS B CE  1 
ATOM   8126 N NZ  . LYS B 1 516 ? 32.238 45.261  18.399  1.00 76.35  ? 516  LYS B NZ  1 
ATOM   8127 N N   . PRO B 1 517 ? 29.162 41.214  23.962  1.00 66.99  ? 517  PRO B N   1 
ATOM   8128 C CA  . PRO B 1 517 ? 29.622 39.969  24.613  1.00 66.12  ? 517  PRO B CA  1 
ATOM   8129 C C   . PRO B 1 517 ? 31.115 39.704  24.382  1.00 64.01  ? 517  PRO B C   1 
ATOM   8130 O O   . PRO B 1 517 ? 31.675 40.189  23.399  1.00 63.92  ? 517  PRO B O   1 
ATOM   8131 C CB  . PRO B 1 517 ? 28.786 38.873  23.919  1.00 68.29  ? 517  PRO B CB  1 
ATOM   8132 C CG  . PRO B 1 517 ? 27.579 39.563  23.421  1.00 69.95  ? 517  PRO B CG  1 
ATOM   8133 C CD  . PRO B 1 517 ? 28.032 40.961  23.047  1.00 69.47  ? 517  PRO B CD  1 
ATOM   8134 N N   . LEU B 1 518 ? 31.749 38.942  25.273  1.00 62.63  ? 518  LEU B N   1 
ATOM   8135 C CA  . LEU B 1 518 ? 33.192 38.671  25.175  1.00 60.75  ? 518  LEU B CA  1 
ATOM   8136 C C   . LEU B 1 518 ? 33.647 38.231  23.784  1.00 61.22  ? 518  LEU B C   1 
ATOM   8137 O O   . LEU B 1 518 ? 33.024 37.390  23.143  1.00 62.68  ? 518  LEU B O   1 
ATOM   8138 C CB  . LEU B 1 518 ? 33.632 37.610  26.180  1.00 59.91  ? 518  LEU B CB  1 
ATOM   8139 C CG  . LEU B 1 518 ? 33.888 37.958  27.638  1.00 58.69  ? 518  LEU B CG  1 
ATOM   8140 C CD1 . LEU B 1 518 ? 34.708 36.856  28.257  1.00 58.02  ? 518  LEU B CD1 1 
ATOM   8141 C CD2 . LEU B 1 518 ? 34.613 39.276  27.790  1.00 58.23  ? 518  LEU B CD2 1 
ATOM   8142 N N   . GLU B 1 519 ? 34.743 38.819  23.330  1.00 60.08  ? 519  GLU B N   1 
ATOM   8143 C CA  . GLU B 1 519 ? 35.405 38.384  22.110  1.00 60.61  ? 519  GLU B CA  1 
ATOM   8144 C C   . GLU B 1 519 ? 36.844 37.936  22.445  1.00 58.58  ? 519  GLU B C   1 
ATOM   8145 O O   . GLU B 1 519 ? 37.580 38.642  23.132  1.00 56.80  ? 519  GLU B O   1 
ATOM   8146 C CB  . GLU B 1 519 ? 35.365 39.507  21.062  1.00 61.08  ? 519  GLU B CB  1 
ATOM   8147 C CG  . GLU B 1 519 ? 36.424 39.423  19.981  1.00 62.67  ? 519  GLU B CG  1 
ATOM   8148 C CD  . GLU B 1 519 ? 36.233 40.465  18.892  1.00 66.35  ? 519  GLU B CD  1 
ATOM   8149 O OE1 . GLU B 1 519 ? 35.294 40.287  18.074  1.00 69.51  ? 519  GLU B OE1 1 
ATOM   8150 O OE2 . GLU B 1 519 ? 37.019 41.448  18.851  1.00 64.49  ? 519  GLU B OE2 1 
ATOM   8151 N N   . VAL B 1 520 ? 37.216 36.745  21.983  1.00 58.70  ? 520  VAL B N   1 
ATOM   8152 C CA  . VAL B 1 520 ? 38.576 36.233  22.162  1.00 57.41  ? 520  VAL B CA  1 
ATOM   8153 C C   . VAL B 1 520 ? 39.483 36.723  21.029  1.00 57.19  ? 520  VAL B C   1 
ATOM   8154 O O   . VAL B 1 520 ? 39.197 36.502  19.857  1.00 58.49  ? 520  VAL B O   1 
ATOM   8155 C CB  . VAL B 1 520 ? 38.597 34.679  22.239  1.00 58.10  ? 520  VAL B CB  1 
ATOM   8156 C CG1 . VAL B 1 520 ? 40.015 34.167  22.419  1.00 56.63  ? 520  VAL B CG1 1 
ATOM   8157 C CG2 . VAL B 1 520 ? 37.694 34.177  23.367  1.00 57.59  ? 520  VAL B CG2 1 
ATOM   8158 N N   . ARG B 1 521 ? 40.569 37.395  21.388  1.00 55.93  ? 521  ARG B N   1 
ATOM   8159 C CA  . ARG B 1 521 ? 41.558 37.863  20.415  1.00 55.80  ? 521  ARG B CA  1 
ATOM   8160 C C   . ARG B 1 521 ? 42.901 37.204  20.700  1.00 55.20  ? 521  ARG B C   1 
ATOM   8161 O O   . ARG B 1 521 ? 43.114 36.662  21.782  1.00 54.50  ? 521  ARG B O   1 
ATOM   8162 C CB  . ARG B 1 521 ? 41.695 39.389  20.475  1.00 55.18  ? 521  ARG B CB  1 
ATOM   8163 C CG  . ARG B 1 521 ? 40.500 40.139  19.922  1.00 55.89  ? 521  ARG B CG  1 
ATOM   8164 C CD  . ARG B 1 521 ? 40.603 41.626  20.170  1.00 55.43  ? 521  ARG B CD  1 
ATOM   8165 N NE  . ARG B 1 521 ? 39.302 42.284  20.025  1.00 56.25  ? 521  ARG B NE  1 
ATOM   8166 C CZ  . ARG B 1 521 ? 39.020 43.522  20.435  1.00 55.68  ? 521  ARG B CZ  1 
ATOM   8167 N NH1 . ARG B 1 521 ? 39.941 44.277  21.021  1.00 52.38  ? 521  ARG B NH1 1 
ATOM   8168 N NH2 . ARG B 1 521 ? 37.799 44.006  20.262  1.00 57.95  ? 521  ARG B NH2 1 
ATOM   8169 N N   . ARG B 1 522 ? 43.805 37.243  19.731  1.00 55.85  ? 522  ARG B N   1 
ATOM   8170 C CA  . ARG B 1 522 ? 45.111 36.627  19.908  1.00 55.90  ? 522  ARG B CA  1 
ATOM   8171 C C   . ARG B 1 522 ? 46.229 37.637  19.698  1.00 55.66  ? 522  ARG B C   1 
ATOM   8172 O O   . ARG B 1 522 ? 46.291 38.286  18.659  1.00 56.38  ? 522  ARG B O   1 
ATOM   8173 C CB  . ARG B 1 522 ? 45.277 35.410  18.984  1.00 56.83  ? 522  ARG B CB  1 
ATOM   8174 C CG  . ARG B 1 522 ? 44.454 34.184  19.399  1.00 57.60  ? 522  ARG B CG  1 
ATOM   8175 C CD  . ARG B 1 522 ? 44.526 33.023  18.383  1.00 58.84  ? 522  ARG B CD  1 
ATOM   8176 N NE  . ARG B 1 522 ? 45.847 32.389  18.350  1.00 60.36  ? 522  ARG B NE  1 
ATOM   8177 C CZ  . ARG B 1 522 ? 46.122 31.199  17.811  1.00 62.26  ? 522  ARG B CZ  1 
ATOM   8178 N NH1 . ARG B 1 522 ? 45.162 30.464  17.259  1.00 63.74  ? 522  ARG B NH1 1 
ATOM   8179 N NH2 . ARG B 1 522 ? 47.368 30.735  17.830  1.00 61.09  ? 522  ARG B NH2 1 
ATOM   8180 N N   . GLY B 1 523 ? 47.098 37.766  20.698  1.00 55.17  ? 523  GLY B N   1 
ATOM   8181 C CA  . GLY B 1 523 ? 48.328 38.536  20.577  1.00 55.48  ? 523  GLY B CA  1 
ATOM   8182 C C   . GLY B 1 523 ? 48.149 39.987  20.960  1.00 55.43  ? 523  GLY B C   1 
ATOM   8183 O O   . GLY B 1 523 ? 47.559 40.749  20.217  1.00 55.70  ? 523  GLY B O   1 
ATOM   8184 N N   . LEU B 1 524 ? 48.683 40.354  22.123  1.00 55.41  ? 524  LEU B N   1 
ATOM   8185 C CA  . LEU B 1 524 ? 48.493 41.665  22.720  1.00 55.72  ? 524  LEU B CA  1 
ATOM   8186 C C   . LEU B 1 524 ? 49.535 42.655  22.211  1.00 56.23  ? 524  LEU B C   1 
ATOM   8187 O O   . LEU B 1 524 ? 50.617 42.785  22.798  1.00 56.10  ? 524  LEU B O   1 
ATOM   8188 C CB  . LEU B 1 524 ? 48.575 41.533  24.243  1.00 55.15  ? 524  LEU B CB  1 
ATOM   8189 C CG  . LEU B 1 524 ? 47.956 42.624  25.129  1.00 56.39  ? 524  LEU B CG  1 
ATOM   8190 C CD1 . LEU B 1 524 ? 46.493 42.930  24.759  1.00 57.70  ? 524  LEU B CD1 1 
ATOM   8191 C CD2 . LEU B 1 524 ? 48.060 42.212  26.589  1.00 56.75  ? 524  LEU B CD2 1 
ATOM   8192 N N   . ARG B 1 525 ? 49.206 43.347  21.116  1.00 57.17  ? 525  ARG B N   1 
ATOM   8193 C CA  . ARG B 1 525 ? 50.157 44.190  20.395  1.00 57.86  ? 525  ARG B CA  1 
ATOM   8194 C C   . ARG B 1 525 ? 51.485 43.446  20.139  1.00 57.85  ? 525  ARG B C   1 
ATOM   8195 O O   . ARG B 1 525 ? 52.569 43.962  20.403  1.00 57.74  ? 525  ARG B O   1 
ATOM   8196 C CB  . ARG B 1 525 ? 50.391 45.508  21.149  1.00 57.87  ? 525  ARG B CB  1 
ATOM   8197 C CG  . ARG B 1 525 ? 49.301 46.553  20.966  1.00 60.05  ? 525  ARG B CG  1 
ATOM   8198 C CD  . ARG B 1 525 ? 49.920 47.944  20.987  1.00 65.07  ? 525  ARG B CD  1 
ATOM   8199 N NE  . ARG B 1 525 ? 48.991 49.082  21.128  1.00 69.78  ? 525  ARG B NE  1 
ATOM   8200 C CZ  . ARG B 1 525 ? 47.777 49.059  21.689  1.00 71.33  ? 525  ARG B CZ  1 
ATOM   8201 N NH1 . ARG B 1 525 ? 47.260 47.939  22.195  1.00 72.42  ? 525  ARG B NH1 1 
ATOM   8202 N NH2 . ARG B 1 525 ? 47.068 50.180  21.743  1.00 71.93  ? 525  ARG B NH2 1 
ATOM   8203 N N   . ALA B 1 526 ? 51.376 42.232  19.610  1.00 58.02  ? 526  ALA B N   1 
ATOM   8204 C CA  . ALA B 1 526 ? 52.509 41.319  19.444  1.00 57.86  ? 526  ALA B CA  1 
ATOM   8205 C C   . ALA B 1 526 ? 53.692 41.850  18.624  1.00 58.27  ? 526  ALA B C   1 
ATOM   8206 O O   . ALA B 1 526 ? 54.839 41.729  19.071  1.00 58.38  ? 526  ALA B O   1 
ATOM   8207 C CB  . ALA B 1 526 ? 52.029 39.963  18.902  1.00 58.49  ? 526  ALA B CB  1 
ATOM   8208 N N   . GLN B 1 527 ? 53.437 42.414  17.439  1.00 58.68  ? 527  GLN B N   1 
ATOM   8209 C CA  . GLN B 1 527 ? 54.534 42.993  16.630  1.00 59.32  ? 527  GLN B CA  1 
ATOM   8210 C C   . GLN B 1 527 ? 55.122 44.195  17.365  1.00 58.28  ? 527  GLN B C   1 
ATOM   8211 O O   . GLN B 1 527 ? 56.331 44.272  17.570  1.00 58.71  ? 527  GLN B O   1 
ATOM   8212 C CB  . GLN B 1 527 ? 54.105 43.411  15.205  1.00 60.50  ? 527  GLN B CB  1 
ATOM   8213 C CG  . GLN B 1 527 ? 53.589 42.314  14.288  1.00 62.78  ? 527  GLN B CG  1 
ATOM   8214 C CD  . GLN B 1 527 ? 54.521 41.102  14.208  1.00 67.18  ? 527  GLN B CD  1 
ATOM   8215 O OE1 . GLN B 1 527 ? 54.229 40.038  14.786  1.00 67.15  ? 527  GLN B OE1 1 
ATOM   8216 N NE2 . GLN B 1 527 ? 55.650 41.257  13.498  1.00 67.52  ? 527  GLN B NE2 1 
ATOM   8217 N N   . THR B 1 528 ? 54.259 45.121  17.775  1.00 56.96  ? 528  THR B N   1 
ATOM   8218 C CA  . THR B 1 528 ? 54.703 46.344  18.435  1.00 56.01  ? 528  THR B CA  1 
ATOM   8219 C C   . THR B 1 528 ? 55.506 46.065  19.713  1.00 54.99  ? 528  THR B C   1 
ATOM   8220 O O   . THR B 1 528 ? 56.531 46.702  19.945  1.00 55.33  ? 528  THR B O   1 
ATOM   8221 C CB  . THR B 1 528 ? 53.515 47.284  18.739  1.00 55.64  ? 528  THR B CB  1 
ATOM   8222 O OG1 . THR B 1 528 ? 52.871 47.658  17.512  1.00 56.07  ? 528  THR B OG1 1 
ATOM   8223 C CG2 . THR B 1 528 ? 53.987 48.535  19.465  1.00 55.03  ? 528  THR B CG2 1 
ATOM   8224 N N   . CYS B 1 529 ? 55.052 45.115  20.530  1.00 53.81  ? 529  CYS B N   1 
ATOM   8225 C CA  . CYS B 1 529 ? 55.753 44.798  21.786  1.00 52.89  ? 529  CYS B CA  1 
ATOM   8226 C C   . CYS B 1 529 ? 57.078 44.060  21.582  1.00 52.98  ? 529  CYS B C   1 
ATOM   8227 O O   . CYS B 1 529 ? 57.998 44.223  22.380  1.00 52.74  ? 529  CYS B O   1 
ATOM   8228 C CB  . CYS B 1 529 ? 54.833 44.128  22.816  1.00 51.42  ? 529  CYS B CB  1 
ATOM   8229 S SG  . CYS B 1 529 ? 53.508 45.292  23.406  1.00 53.25  ? 529  CYS B SG  1 
ATOM   8230 N N   . ALA B 1 530 ? 57.194 43.300  20.497  1.00 53.28  ? 530  ALA B N   1 
ATOM   8231 C CA  . ALA B 1 530 ? 58.499 42.759  20.100  1.00 54.50  ? 530  ALA B CA  1 
ATOM   8232 C C   . ALA B 1 530 ? 59.529 43.880  19.884  1.00 55.05  ? 530  ALA B C   1 
ATOM   8233 O O   . ALA B 1 530 ? 60.705 43.727  20.219  1.00 55.65  ? 530  ALA B O   1 
ATOM   8234 C CB  . ALA B 1 530 ? 58.385 41.879  18.838  1.00 55.34  ? 530  ALA B CB  1 
ATOM   8235 N N   . PHE B 1 531 ? 59.086 45.001  19.322  1.00 54.89  ? 531  PHE B N   1 
ATOM   8236 C CA  . PHE B 1 531 ? 59.953 46.157  19.191  1.00 55.78  ? 531  PHE B CA  1 
ATOM   8237 C C   . PHE B 1 531 ? 60.412 46.694  20.569  1.00 55.38  ? 531  PHE B C   1 
ATOM   8238 O O   . PHE B 1 531 ? 61.603 46.940  20.768  1.00 56.10  ? 531  PHE B O   1 
ATOM   8239 C CB  . PHE B 1 531 ? 59.283 47.259  18.355  1.00 55.87  ? 531  PHE B CB  1 
ATOM   8240 C CG  . PHE B 1 531 ? 59.986 48.586  18.432  1.00 56.00  ? 531  PHE B CG  1 
ATOM   8241 C CD1 . PHE B 1 531 ? 61.119 48.834  17.676  1.00 57.92  ? 531  PHE B CD1 1 
ATOM   8242 C CD2 . PHE B 1 531 ? 59.525 49.580  19.275  1.00 55.89  ? 531  PHE B CD2 1 
ATOM   8243 C CE1 . PHE B 1 531 ? 61.769 50.057  17.745  1.00 58.69  ? 531  PHE B CE1 1 
ATOM   8244 C CE2 . PHE B 1 531 ? 60.174 50.809  19.356  1.00 56.64  ? 531  PHE B CE2 1 
ATOM   8245 C CZ  . PHE B 1 531 ? 61.290 51.045  18.584  1.00 58.47  ? 531  PHE B CZ  1 
ATOM   8246 N N   . TRP B 1 532 ? 59.476 46.873  21.503  1.00 54.01  ? 532  TRP B N   1 
ATOM   8247 C CA  . TRP B 1 532 ? 59.810 47.430  22.817  1.00 54.11  ? 532  TRP B CA  1 
ATOM   8248 C C   . TRP B 1 532 ? 60.491 46.450  23.774  1.00 54.81  ? 532  TRP B C   1 
ATOM   8249 O O   . TRP B 1 532 ? 61.273 46.879  24.624  1.00 55.49  ? 532  TRP B O   1 
ATOM   8250 C CB  . TRP B 1 532 ? 58.583 48.003  23.529  1.00 52.01  ? 532  TRP B CB  1 
ATOM   8251 C CG  . TRP B 1 532 ? 58.001 49.238  22.945  1.00 51.68  ? 532  TRP B CG  1 
ATOM   8252 C CD1 . TRP B 1 532 ? 56.875 49.324  22.187  1.00 50.79  ? 532  TRP B CD1 1 
ATOM   8253 C CD2 . TRP B 1 532 ? 58.482 50.577  23.101  1.00 51.81  ? 532  TRP B CD2 1 
ATOM   8254 N NE1 . TRP B 1 532 ? 56.626 50.628  21.853  1.00 51.06  ? 532  TRP B NE1 1 
ATOM   8255 C CE2 . TRP B 1 532 ? 57.598 51.421  22.397  1.00 51.23  ? 532  TRP B CE2 1 
ATOM   8256 C CE3 . TRP B 1 532 ? 59.578 51.146  23.760  1.00 52.19  ? 532  TRP B CE3 1 
ATOM   8257 C CZ2 . TRP B 1 532 ? 57.771 52.805  22.331  1.00 52.35  ? 532  TRP B CZ2 1 
ATOM   8258 C CZ3 . TRP B 1 532 ? 59.746 52.532  23.699  1.00 52.93  ? 532  TRP B CZ3 1 
ATOM   8259 C CH2 . TRP B 1 532 ? 58.843 53.342  22.988  1.00 52.92  ? 532  TRP B CH2 1 
ATOM   8260 N N   . ASN B 1 533 ? 60.174 45.160  23.663  1.00 55.44  ? 533  ASN B N   1 
ATOM   8261 C CA  . ASN B 1 533 ? 60.680 44.156  24.606  1.00 56.33  ? 533  ASN B CA  1 
ATOM   8262 C C   . ASN B 1 533 ? 61.900 43.376  24.119  1.00 58.71  ? 533  ASN B C   1 
ATOM   8263 O O   . ASN B 1 533 ? 62.730 42.947  24.933  1.00 59.05  ? 533  ASN B O   1 
ATOM   8264 C CB  . ASN B 1 533 ? 59.574 43.186  25.021  1.00 55.50  ? 533  ASN B CB  1 
ATOM   8265 C CG  . ASN B 1 533 ? 58.423 43.882  25.730  1.00 54.82  ? 533  ASN B CG  1 
ATOM   8266 O OD1 . ASN B 1 533 ? 58.603 44.949  26.313  1.00 55.37  ? 533  ASN B OD1 1 
ATOM   8267 N ND2 . ASN B 1 533 ? 57.231 43.279  25.681  1.00 53.72  ? 533  ASN B ND2 1 
ATOM   8268 N N   . ARG B 1 534 ? 62.014 43.196  22.802  1.00 60.52  ? 534  ARG B N   1 
ATOM   8269 C CA  . ARG B 1 534 ? 63.142 42.465  22.234  1.00 62.98  ? 534  ARG B CA  1 
ATOM   8270 C C   . ARG B 1 534 ? 64.186 43.355  21.565  1.00 64.90  ? 534  ARG B C   1 
ATOM   8271 O O   . ARG B 1 534 ? 65.378 43.174  21.792  1.00 66.63  ? 534  ARG B O   1 
ATOM   8272 C CB  . ARG B 1 534 ? 62.667 41.395  21.247  1.00 63.60  ? 534  ARG B CB  1 
ATOM   8273 C CG  . ARG B 1 534 ? 61.867 40.277  21.877  1.00 63.32  ? 534  ARG B CG  1 
ATOM   8274 C CD  . ARG B 1 534 ? 61.099 39.505  20.826  1.00 63.80  ? 534  ARG B CD  1 
ATOM   8275 N NE  . ARG B 1 534 ? 60.065 38.651  21.418  1.00 64.07  ? 534  ARG B NE  1 
ATOM   8276 C CZ  . ARG B 1 534 ? 60.256 37.397  21.831  1.00 63.99  ? 534  ARG B CZ  1 
ATOM   8277 N NH1 . ARG B 1 534 ? 61.453 36.819  21.729  1.00 63.61  ? 534  ARG B NH1 1 
ATOM   8278 N NH2 . ARG B 1 534 ? 59.238 36.719  22.348  1.00 62.78  ? 534  ARG B NH2 1 
ATOM   8279 N N   . PHE B 1 535 ? 63.759 44.303  20.738  1.00 65.56  ? 535  PHE B N   1 
ATOM   8280 C CA  . PHE B 1 535 ? 64.729 45.058  19.945  1.00 67.65  ? 535  PHE B CA  1 
ATOM   8281 C C   . PHE B 1 535 ? 65.325 46.272  20.645  1.00 68.93  ? 535  PHE B C   1 
ATOM   8282 O O   . PHE B 1 535 ? 66.541 46.477  20.619  1.00 70.63  ? 535  PHE B O   1 
ATOM   8283 C CB  . PHE B 1 535 ? 64.186 45.454  18.566  1.00 67.16  ? 535  PHE B CB  1 
ATOM   8284 C CG  . PHE B 1 535 ? 65.192 46.177  17.720  1.00 67.32  ? 535  PHE B CG  1 
ATOM   8285 C CD1 . PHE B 1 535 ? 66.271 45.492  17.166  1.00 67.24  ? 535  PHE B CD1 1 
ATOM   8286 C CD2 . PHE B 1 535 ? 65.089 47.545  17.512  1.00 65.31  ? 535  PHE B CD2 1 
ATOM   8287 C CE1 . PHE B 1 535 ? 67.213 46.153  16.403  1.00 67.59  ? 535  PHE B CE1 1 
ATOM   8288 C CE2 . PHE B 1 535 ? 66.033 48.209  16.751  1.00 66.73  ? 535  PHE B CE2 1 
ATOM   8289 C CZ  . PHE B 1 535 ? 67.091 47.508  16.189  1.00 68.90  ? 535  PHE B CZ  1 
ATOM   8290 N N   . LEU B 1 536 ? 64.475 47.088  21.244  1.00 69.06  ? 536  LEU B N   1 
ATOM   8291 C CA  . LEU B 1 536 ? 64.937 48.333  21.835  1.00 71.07  ? 536  LEU B CA  1 
ATOM   8292 C C   . LEU B 1 536 ? 66.043 48.156  22.894  1.00 72.84  ? 536  LEU B C   1 
ATOM   8293 O O   . LEU B 1 536 ? 67.019 48.892  22.860  1.00 74.22  ? 536  LEU B O   1 
ATOM   8294 C CB  . LEU B 1 536 ? 63.765 49.170  22.369  1.00 69.51  ? 536  LEU B CB  1 
ATOM   8295 C CG  . LEU B 1 536 ? 64.042 50.673  22.305  1.00 70.80  ? 536  LEU B CG  1 
ATOM   8296 C CD1 . LEU B 1 536 ? 63.801 51.205  20.899  1.00 71.74  ? 536  LEU B CD1 1 
ATOM   8297 C CD2 . LEU B 1 536 ? 63.218 51.432  23.324  1.00 70.15  ? 536  LEU B CD2 1 
ATOM   8298 N N   . PRO B 1 537 ? 65.890 47.195  23.836  1.00 73.51  ? 537  PRO B N   1 
ATOM   8299 C CA  . PRO B 1 537 ? 66.979 46.884  24.768  1.00 75.44  ? 537  PRO B CA  1 
ATOM   8300 C C   . PRO B 1 537 ? 68.333 46.591  24.111  1.00 78.84  ? 537  PRO B C   1 
ATOM   8301 O O   . PRO B 1 537 ? 69.366 47.027  24.632  1.00 80.30  ? 537  PRO B O   1 
ATOM   8302 C CB  . PRO B 1 537 ? 66.464 45.638  25.499  1.00 74.37  ? 537  PRO B CB  1 
ATOM   8303 C CG  . PRO B 1 537 ? 64.990 45.820  25.513  1.00 72.08  ? 537  PRO B CG  1 
ATOM   8304 C CD  . PRO B 1 537 ? 64.688 46.387  24.145  1.00 72.33  ? 537  PRO B CD  1 
ATOM   8305 N N   . LYS B 1 538 ? 68.331 45.873  22.988  1.00 80.86  ? 538  LYS B N   1 
ATOM   8306 C CA  . LYS B 1 538 ? 69.562 45.584  22.246  1.00 84.29  ? 538  LYS B CA  1 
ATOM   8307 C C   . LYS B 1 538 ? 70.196 46.853  21.688  1.00 86.45  ? 538  LYS B C   1 
ATOM   8308 O O   . LYS B 1 538 ? 71.418 46.948  21.572  1.00 88.68  ? 538  LYS B O   1 
ATOM   8309 C CB  . LYS B 1 538 ? 69.300 44.600  21.103  1.00 84.69  ? 538  LYS B CB  1 
ATOM   8310 C CG  . LYS B 1 538 ? 69.019 43.173  21.544  1.00 85.29  ? 538  LYS B CG  1 
ATOM   8311 C CD  . LYS B 1 538 ? 69.006 42.226  20.346  1.00 88.04  ? 538  LYS B CD  1 
ATOM   8312 C CE  . LYS B 1 538 ? 68.573 40.818  20.746  1.00 88.58  ? 538  LYS B CE  1 
ATOM   8313 N NZ  . LYS B 1 538 ? 68.438 39.919  19.556  1.00 90.08  ? 538  LYS B NZ  1 
ATOM   8314 N N   . LEU B 1 539 ? 69.355 47.823  21.352  1.00 86.72  ? 539  LEU B N   1 
ATOM   8315 C CA  . LEU B 1 539 ? 69.790 49.068  20.726  1.00 89.24  ? 539  LEU B CA  1 
ATOM   8316 C C   . LEU B 1 539 ? 70.374 50.032  21.747  1.00 90.69  ? 539  LEU B C   1 
ATOM   8317 O O   . LEU B 1 539 ? 71.246 50.844  21.426  1.00 92.64  ? 539  LEU B O   1 
ATOM   8318 C CB  . LEU B 1 539 ? 68.607 49.722  20.017  1.00 88.16  ? 539  LEU B CB  1 
ATOM   8319 C CG  . LEU B 1 539 ? 68.831 50.848  19.021  1.00 89.25  ? 539  LEU B CG  1 
ATOM   8320 C CD1 . LEU B 1 539 ? 69.616 50.345  17.834  1.00 91.11  ? 539  LEU B CD1 1 
ATOM   8321 C CD2 . LEU B 1 539 ? 67.480 51.364  18.581  1.00 88.34  ? 539  LEU B CD2 1 
ATOM   8322 N N   . LEU B 1 540 ? 69.871 49.948  22.975  1.00 90.45  ? 540  LEU B N   1 
ATOM   8323 C CA  . LEU B 1 540 ? 70.391 50.749  24.077  1.00 92.03  ? 540  LEU B CA  1 
ATOM   8324 C C   . LEU B 1 540 ? 71.642 50.097  24.684  1.00 94.24  ? 540  LEU B C   1 
ATOM   8325 O O   . LEU B 1 540 ? 72.618 50.791  24.981  1.00 95.97  ? 540  LEU B O   1 
ATOM   8326 C CB  . LEU B 1 540 ? 69.299 51.014  25.125  1.00 89.75  ? 540  LEU B CB  1 
ATOM   8327 C CG  . LEU B 1 540 ? 68.093 51.826  24.613  1.00 89.04  ? 540  LEU B CG  1 
ATOM   8328 C CD1 . LEU B 1 540 ? 66.897 51.803  25.584  1.00 86.58  ? 540  LEU B CD1 1 
ATOM   8329 C CD2 . LEU B 1 540 ? 68.480 53.267  24.251  1.00 90.34  ? 540  LEU B CD2 1 
ATOM   8330 N N   . SER B 1 541 ? 71.622 48.769  24.836  1.00 94.78  ? 541  SER B N   1 
ATOM   8331 C CA  . SER B 1 541 ? 72.802 48.024  25.295  1.00 97.23  ? 541  SER B CA  1 
ATOM   8332 C C   . SER B 1 541 ? 73.836 47.898  24.168  1.00 100.28 ? 541  SER B C   1 
ATOM   8333 O O   . SER B 1 541 ? 74.428 46.833  23.941  1.00 101.40 ? 541  SER B O   1 
ATOM   8334 C CB  . SER B 1 541 ? 72.415 46.655  25.873  1.00 96.28  ? 541  SER B CB  1 
ATOM   8335 O OG  . SER B 1 541 ? 72.135 45.716  24.850  1.00 96.46  ? 541  SER B OG  1 
ATOM   8336 N N   . ALA B 1 542 ? 74.010 49.017  23.464  1.00 101.99 ? 542  ALA B N   1 
ATOM   8337 C CA  . ALA B 1 542 ? 75.035 49.250  22.439  1.00 105.14 ? 542  ALA B CA  1 
ATOM   8338 C C   . ALA B 1 542 ? 74.960 50.739  22.074  1.00 106.13 ? 542  ALA B C   1 
ATOM   8339 O O   . ALA B 1 542 ? 75.710 51.220  21.221  1.00 108.29 ? 542  ALA B O   1 
ATOM   8340 C CB  . ALA B 1 542 ? 74.814 48.360  21.202  1.00 105.18 ? 542  ALA B CB  1 
ATOM   8341 N N   . THR B 1 543 ? 74.044 51.444  22.755  1.00 104.94 ? 543  THR B N   1 
ATOM   8342 C CA  . THR B 1 543 ? 73.759 52.892  22.593  1.00 105.69 ? 543  THR B CA  1 
ATOM   8343 C C   . THR B 1 543 ? 73.427 53.323  21.144  1.00 106.54 ? 543  THR B C   1 
ATOM   8344 O O   . THR B 1 543 ? 72.263 53.583  20.817  1.00 105.03 ? 543  THR B O   1 
ATOM   8345 C CB  . THR B 1 543 ? 74.858 53.802  23.261  1.00 107.76 ? 543  THR B CB  1 
ATOM   8346 O OG1 . THR B 1 543 ? 74.926 53.526  24.667  1.00 106.49 ? 543  THR B OG1 1 
ATOM   8347 C CG2 . THR B 1 543 ? 74.554 55.292  23.064  1.00 108.41 ? 543  THR B CG2 1 
ATOM   8348 O OXT . THR B 1 543 ? 74.289 53.427  20.265  1.00 108.80 ? 543  THR B OXT 1 
HETATM 8349 I I   . IOD C 2 .   ? 32.571 21.015  6.749   0.50 70.72  ? 900  IOD A I   1 
HETATM 8350 I I   . IOD D 2 .   ? 50.669 2.672   7.023   0.50 57.47  ? 902  IOD A I   1 
HETATM 8351 I I   . IOD E 2 .   ? 38.980 15.709  1.024   0.50 71.89  ? 903  IOD A I   1 
HETATM 8352 I I   . IOD F 2 .   ? 53.826 25.781  14.212  0.30 66.07  ? 907  IOD A I   1 
HETATM 8353 S SD  . ETM G 3 .   ? 28.520 22.125  13.936  0.50 63.52  ? 908  ETM A SD  1 
HETATM 8354 C C1  . ETM G 3 .   ? 28.169 20.839  15.155  0.50 62.29  ? 908  ETM A C1  1 
HETATM 8355 C C2  . ETM G 3 .   ? 26.779 20.273  14.889  1.00 61.55  ? 908  ETM A C2  1 
HETATM 8356 N N1  . ETM G 3 .   ? 26.721 18.807  15.038  1.00 61.21  ? 908  ETM A N1  1 
HETATM 8357 C C3  . ETM G 3 .   ? 27.503 18.303  16.175  1.00 60.77  ? 908  ETM A C3  1 
HETATM 8358 C C4  . ETM G 3 .   ? 27.179 18.163  13.812  1.00 60.12  ? 908  ETM A C4  1 
HETATM 8359 C C5  . ETM G 3 .   ? 25.325 18.425  15.260  1.00 61.68  ? 908  ETM A C5  1 
HETATM 8360 C C1  . BUA H 4 .   ? 30.483 19.475  12.789  0.50 59.70  ? 909  BUA A C1  1 
HETATM 8361 C C2  . BUA H 4 .   ? 30.481 18.226  11.930  0.50 60.23  ? 909  BUA A C2  1 
HETATM 8362 C C3  . BUA H 4 .   ? 29.179 17.453  12.123  1.00 60.47  ? 909  BUA A C3  1 
HETATM 8363 C C4  . BUA H 4 .   ? 29.368 15.951  12.134  1.00 59.48  ? 909  BUA A C4  1 
HETATM 8364 O O1  . BUA H 4 .   ? 29.022 15.315  11.120  1.00 60.36  ? 909  BUA A O1  1 
HETATM 8365 O O2  . BUA H 4 .   ? 29.831 15.389  13.149  1.00 58.15  ? 909  BUA A O2  1 
HETATM 8366 C C21 . BCH I 5 .   ? 30.248 22.177  10.184  1.00 91.42  ? 910  BCH A C21 1 
HETATM 8367 C C20 . BCH I 5 .   ? 31.685 22.045  9.734   1.00 91.56  ? 910  BCH A C20 1 
HETATM 8368 C C19 . BCH I 5 .   ? 32.464 23.331  9.989   1.00 92.07  ? 910  BCH A C19 1 
HETATM 8369 C C18 . BCH I 5 .   ? 33.842 23.326  9.358   1.00 92.41  ? 910  BCH A C18 1 
HETATM 8370 O O12 . BCH I 5 .   ? 34.092 22.629  8.386   1.00 92.09  ? 910  BCH A O12 1 
HETATM 8371 S S17 . BCH I 5 .   ? 35.034 24.300  10.000  1.00 92.85  ? 910  BCH A S17 1 
HETATM 8372 C C16 . BCH I 5 .   ? 36.266 24.511  8.749   1.00 94.01  ? 910  BCH A C16 1 
HETATM 8373 C C15 . BCH I 5 .   ? 36.553 26.003  8.543   1.00 95.32  ? 910  BCH A C15 1 
HETATM 8374 N N14 . BCH I 5 .   ? 37.929 26.316  8.086   1.00 96.24  ? 910  BCH A N14 1 
HETATM 8375 C C13 . BCH I 5 .   ? 38.922 26.053  9.142   1.00 95.80  ? 910  BCH A C13 1 
HETATM 8376 C C22 . BCH I 5 .   ? 38.005 27.753  7.760   1.00 95.90  ? 910  BCH A C22 1 
HETATM 8377 C C11 . BCH I 5 .   ? 38.270 25.534  6.880   1.00 95.95  ? 910  BCH A C11 1 
HETATM 8378 C C21 . BCH J 5 .   ? 12.256 28.737  1.712   1.00 116.69 ? 601  BCH A C21 1 
HETATM 8379 C C20 . BCH J 5 .   ? 11.068 27.351  1.812   1.00 117.27 ? 601  BCH A C20 1 
HETATM 8380 C C19 . BCH J 5 .   ? 11.756 26.229  1.000   1.00 118.08 ? 601  BCH A C19 1 
HETATM 8381 C C18 . BCH J 5 .   ? 11.777 24.910  1.759   1.00 118.69 ? 601  BCH A C18 1 
HETATM 8382 O O12 . BCH J 5 .   ? 10.726 24.353  2.041   1.00 118.82 ? 601  BCH A O12 1 
HETATM 8383 S S17 . BCH J 5 .   ? 13.229 24.206  2.209   1.00 118.91 ? 601  BCH A S17 1 
HETATM 8384 C C16 . BCH J 5 .   ? 13.207 22.494  1.773   1.00 119.86 ? 601  BCH A C16 1 
HETATM 8385 C C15 . BCH J 5 .   ? 13.487 22.278  0.279   1.00 120.53 ? 601  BCH A C15 1 
HETATM 8386 N N14 . BCH J 5 .   ? 12.910 21.029  -0.282  1.00 121.17 ? 601  BCH A N14 1 
HETATM 8387 C C13 . BCH J 5 .   ? 13.529 19.836  0.328   1.00 121.17 ? 601  BCH A C13 1 
HETATM 8388 C C22 . BCH J 5 .   ? 13.157 20.980  -1.731  1.00 121.13 ? 601  BCH A C22 1 
HETATM 8389 C C11 . BCH J 5 .   ? 11.448 20.988  -0.094  1.00 121.53 ? 601  BCH A C11 1 
HETATM 8390 O O1  . P6G K 6 .   ? 15.989 5.504   -11.721 1.00 63.28  ? 901  P6G A O1  1 
HETATM 8391 C C2  . P6G K 6 .   ? 17.311 6.038   -11.669 1.00 63.87  ? 901  P6G A C2  1 
HETATM 8392 C C3  . P6G K 6 .   ? 17.942 5.752   -10.301 1.00 63.03  ? 901  P6G A C3  1 
HETATM 8393 O O4  . P6G K 6 .   ? 19.354 5.554   -10.401 1.00 61.49  ? 901  P6G A O4  1 
HETATM 8394 C C5  . P6G K 6 .   ? 19.752 4.230   -9.993  1.00 57.72  ? 901  P6G A C5  1 
HETATM 8395 C C6  . P6G K 6 .   ? 21.041 3.723   -10.672 1.00 51.46  ? 901  P6G A C6  1 
HETATM 8396 O O7  . P6G K 6 .   ? 21.803 4.800   -11.205 1.00 45.28  ? 901  P6G A O7  1 
HETATM 8397 C C8  . P6G K 6 .   ? 22.777 4.304   -12.095 1.00 44.41  ? 901  P6G A C8  1 
HETATM 8398 C C9  . P6G K 6 .   ? 22.727 5.038   -13.434 1.00 41.20  ? 901  P6G A C9  1 
HETATM 8399 O O10 . P6G K 6 .   ? 23.363 6.300   -13.327 1.00 33.46  ? 901  P6G A O10 1 
HETATM 8400 C C11 . P6G K 6 .   ? 24.182 6.507   -14.422 1.00 32.26  ? 901  P6G A C11 1 
HETATM 8401 C C12 . P6G K 6 .   ? 24.109 7.992   -14.482 1.00 39.06  ? 901  P6G A C12 1 
HETATM 8402 O O13 . P6G K 6 .   ? 22.834 8.329   -13.952 1.00 46.15  ? 901  P6G A O13 1 
HETATM 8403 C C14 . P6G K 6 .   ? 21.970 8.892   -14.947 1.00 49.28  ? 901  P6G A C14 1 
HETATM 8404 C C15 . P6G K 6 .   ? 22.246 10.365  -15.207 1.00 50.91  ? 901  P6G A C15 1 
HETATM 8405 O O16 . P6G K 6 .   ? 21.167 10.849  -15.988 1.00 53.65  ? 901  P6G A O16 1 
HETATM 8406 C C17 . P6G K 6 .   ? 20.085 11.436  -15.251 1.00 58.10  ? 901  P6G A C17 1 
HETATM 8407 C C18 . P6G K 6 .   ? 19.026 10.418  -14.798 1.00 61.69  ? 901  P6G A C18 1 
HETATM 8408 O O19 . P6G K 6 .   ? 18.295 10.878  -13.649 1.00 63.95  ? 901  P6G A O19 1 
HETATM 8409 I I   . IOD L 2 .   ? 73.618 52.933  47.090  0.50 65.60  ? 904  IOD B I   1 
HETATM 8410 I I   . IOD M 2 .   ? 63.174 60.898  33.851  0.50 75.45  ? 905  IOD B I   1 
HETATM 8411 I I   . IOD N 2 .   ? 36.722 55.477  22.487  0.30 61.98  ? 906  IOD B I   1 
HETATM 8412 I I   . IOD O 2 .   ? 43.764 54.861  69.200  0.50 43.68  ? 908  IOD B I   1 
HETATM 8413 I I   . IOD P 2 .   ? 53.395 62.368  34.285  0.30 65.54  ? 909  IOD B I   1 
HETATM 8414 S SD  . ETM Q 3 .   ? 46.004 60.873  37.755  1.00 101.95 ? 602  ETM B SD  1 
HETATM 8415 C C1  . ETM Q 3 .   ? 46.064 59.351  38.724  1.00 99.43  ? 602  ETM B C1  1 
HETATM 8416 C C2  . ETM Q 3 .   ? 44.959 58.423  38.235  1.00 97.64  ? 602  ETM B C2  1 
HETATM 8417 N N1  . ETM Q 3 .   ? 45.319 57.007  38.393  1.00 96.21  ? 602  ETM B N1  1 
HETATM 8418 C C3  . ETM Q 3 .   ? 44.184 56.176  37.997  1.00 96.64  ? 602  ETM B C3  1 
HETATM 8419 C C4  . ETM Q 3 .   ? 45.684 56.688  39.780  1.00 95.66  ? 602  ETM B C4  1 
HETATM 8420 C C5  . ETM Q 3 .   ? 46.425 56.686  37.494  1.00 96.51  ? 602  ETM B C5  1 
HETATM 8421 C C1  . BUA R 4 .   ? 49.355 59.602  38.233  1.00 80.89  ? 603  BUA B C1  1 
HETATM 8422 C C2  . BUA R 4 .   ? 49.814 58.340  37.534  1.00 80.28  ? 603  BUA B C2  1 
HETATM 8423 C C3  . BUA R 4 .   ? 49.136 57.113  38.132  1.00 78.45  ? 603  BUA B C3  1 
HETATM 8424 C C4  . BUA R 4 .   ? 49.948 55.871  37.874  1.00 77.63  ? 603  BUA B C4  1 
HETATM 8425 O O1  . BUA R 4 .   ? 50.125 55.507  36.692  1.00 77.03  ? 603  BUA B O1  1 
HETATM 8426 O O2  . BUA R 4 .   ? 50.404 55.247  38.858  1.00 77.30  ? 603  BUA B O2  1 
HETATM 8427 O O   . HOH S 7 .   ? 28.306 3.498   2.337   1.00 28.29  ? 911  HOH A O   1 
HETATM 8428 O O   . HOH S 7 .   ? 14.309 8.378   -4.385  1.00 32.23  ? 912  HOH A O   1 
HETATM 8429 O O   . HOH S 7 .   ? 20.853 6.851   -12.620 1.00 64.93  ? 913  HOH A O   1 
HETATM 8430 O O   . HOH S 7 .   ? 12.743 23.918  35.428  1.00 38.24  ? 914  HOH A O   1 
HETATM 8431 O O   . HOH S 7 .   ? 22.128 20.288  7.315   1.00 49.03  ? 915  HOH A O   1 
HETATM 8432 O O   . HOH S 7 .   ? 31.121 8.129   6.704   1.00 46.09  ? 916  HOH A O   1 
HETATM 8433 O O   . HOH S 7 .   ? 39.744 20.125  16.537  1.00 42.79  ? 917  HOH A O   1 
HETATM 8434 O O   . HOH S 7 .   ? 19.150 27.676  16.821  1.00 40.63  ? 918  HOH A O   1 
HETATM 8435 O O   . HOH S 7 .   ? 18.719 11.806  13.431  1.00 36.17  ? 919  HOH A O   1 
HETATM 8436 O O   . HOH S 7 .   ? 20.919 15.355  13.121  1.00 40.13  ? 920  HOH A O   1 
HETATM 8437 O O   . HOH S 7 .   ? 11.124 23.013  6.851   1.00 34.10  ? 921  HOH A O   1 
HETATM 8438 O O   . HOH S 7 .   ? 52.414 16.394  24.601  1.00 38.54  ? 922  HOH A O   1 
HETATM 8439 O O   . HOH S 7 .   ? 41.589 13.908  32.000  1.00 40.81  ? 923  HOH A O   1 
HETATM 8440 O O   . HOH S 7 .   ? 29.277 12.109  24.863  1.00 40.88  ? 924  HOH A O   1 
HETATM 8441 O O   . HOH S 7 .   ? 32.909 19.169  29.388  1.00 39.42  ? 925  HOH A O   1 
HETATM 8442 O O   . HOH S 7 .   ? 18.338 14.870  4.476   1.00 42.23  ? 926  HOH A O   1 
HETATM 8443 O O   . HOH S 7 .   ? 46.746 10.404  11.201  1.00 42.88  ? 927  HOH A O   1 
HETATM 8444 O O   . HOH S 7 .   ? 43.609 15.724  25.128  1.00 51.68  ? 928  HOH A O   1 
HETATM 8445 O O   . HOH S 7 .   ? 36.803 2.106   37.059  1.00 35.64  ? 929  HOH A O   1 
HETATM 8446 O O   . HOH S 7 .   ? 26.036 15.595  18.624  1.00 39.35  ? 930  HOH A O   1 
HETATM 8447 O O   . HOH S 7 .   ? 52.842 9.481   22.414  1.00 50.31  ? 931  HOH A O   1 
HETATM 8448 O O   . HOH S 7 .   ? 44.077 11.270  9.492   1.00 45.03  ? 932  HOH A O   1 
HETATM 8449 O O   . HOH S 7 .   ? 37.924 12.179  -1.092  1.00 48.78  ? 933  HOH A O   1 
HETATM 8450 O O   . HOH S 7 .   ? 27.584 -1.253  37.759  1.00 37.40  ? 934  HOH A O   1 
HETATM 8451 O O   . HOH S 7 .   ? 46.062 12.644  22.963  1.00 44.72  ? 935  HOH A O   1 
HETATM 8452 O O   . HOH S 7 .   ? 24.387 -4.190  -7.446  1.00 46.03  ? 936  HOH A O   1 
HETATM 8453 O O   . HOH S 7 .   ? 28.865 18.110  20.148  1.00 42.18  ? 937  HOH A O   1 
HETATM 8454 O O   . HOH S 7 .   ? 33.009 14.542  17.269  1.00 39.06  ? 938  HOH A O   1 
HETATM 8455 O O   . HOH S 7 .   ? 40.998 16.675  21.782  1.00 42.98  ? 939  HOH A O   1 
HETATM 8456 O O   . HOH S 7 .   ? 10.761 17.886  34.122  1.00 66.63  ? 940  HOH A O   1 
HETATM 8457 O O   . HOH S 7 .   ? 43.655 18.683  16.384  1.00 39.85  ? 941  HOH A O   1 
HETATM 8458 O O   . HOH S 7 .   ? 15.487 26.181  -16.398 1.00 49.68  ? 942  HOH A O   1 
HETATM 8459 O O   . HOH S 7 .   ? 39.706 25.389  35.186  1.00 51.01  ? 943  HOH A O   1 
HETATM 8460 O O   . HOH S 7 .   ? 3.413  0.031   5.002   1.00 50.15  ? 944  HOH A O   1 
HETATM 8461 O O   . HOH S 7 .   ? 36.715 -5.040  14.375  1.00 43.81  ? 945  HOH A O   1 
HETATM 8462 O O   . HOH S 7 .   ? 53.385 25.674  8.340   1.00 58.41  ? 946  HOH A O   1 
HETATM 8463 O O   . HOH S 7 .   ? 47.449 7.674   18.313  1.00 39.21  ? 947  HOH A O   1 
HETATM 8464 O O   . HOH S 7 .   ? 25.611 15.294  28.080  1.00 40.56  ? 948  HOH A O   1 
HETATM 8465 O O   . HOH S 7 .   ? 41.284 6.763   2.963   1.00 36.48  ? 949  HOH A O   1 
HETATM 8466 O O   . HOH S 7 .   ? 13.348 3.621   33.040  1.00 52.14  ? 950  HOH A O   1 
HETATM 8467 O O   . HOH S 7 .   ? 36.782 6.411   38.571  1.00 57.53  ? 951  HOH A O   1 
HETATM 8468 O O   . HOH S 7 .   ? 17.031 22.849  32.670  1.00 57.45  ? 952  HOH A O   1 
HETATM 8469 O O   . HOH S 7 .   ? 38.103 4.056   38.328  1.00 45.01  ? 953  HOH A O   1 
HETATM 8470 O O   . HOH S 7 .   ? 7.843  17.785  32.977  1.00 43.43  ? 954  HOH A O   1 
HETATM 8471 O O   . HOH S 7 .   ? 42.358 1.054   45.108  1.00 35.59  ? 955  HOH A O   1 
HETATM 8472 O O   . HOH S 7 .   ? 14.182 21.006  14.312  1.00 35.58  ? 956  HOH A O   1 
HETATM 8473 O O   . HOH S 7 .   ? 42.703 7.476   14.462  1.00 39.00  ? 957  HOH A O   1 
HETATM 8474 O O   . HOH S 7 .   ? 38.395 15.277  12.729  1.00 46.99  ? 958  HOH A O   1 
HETATM 8475 O O   . HOH S 7 .   ? 34.841 28.524  6.621   1.00 51.74  ? 959  HOH A O   1 
HETATM 8476 O O   . HOH S 7 .   ? 19.014 23.920  38.993  1.00 49.87  ? 960  HOH A O   1 
HETATM 8477 O O   . HOH S 7 .   ? 5.984  6.068   0.778   1.00 48.90  ? 961  HOH A O   1 
HETATM 8478 O O   . HOH S 7 .   ? 37.081 1.470   34.467  1.00 41.87  ? 962  HOH A O   1 
HETATM 8479 O O   . HOH S 7 .   ? 20.014 17.751  2.591   1.00 42.35  ? 963  HOH A O   1 
HETATM 8480 O O   . HOH S 7 .   ? 40.532 16.728  12.458  1.00 40.94  ? 964  HOH A O   1 
HETATM 8481 O O   . HOH S 7 .   ? 35.110 17.467  24.786  1.00 33.92  ? 965  HOH A O   1 
HETATM 8482 O O   . HOH S 7 .   ? 49.435 5.586   41.896  1.00 60.74  ? 966  HOH A O   1 
HETATM 8483 O O   . HOH S 7 .   ? 19.108 20.114  18.731  1.00 44.71  ? 967  HOH A O   1 
HETATM 8484 O O   . HOH S 7 .   ? 11.324 1.132   10.712  1.00 44.88  ? 968  HOH A O   1 
HETATM 8485 O O   . HOH S 7 .   ? 29.509 20.609  19.093  1.00 38.91  ? 969  HOH A O   1 
HETATM 8486 O O   . HOH S 7 .   ? 21.244 28.648  22.180  1.00 53.83  ? 970  HOH A O   1 
HETATM 8487 O O   . HOH S 7 .   ? 45.330 8.048   30.070  1.00 42.30  ? 971  HOH A O   1 
HETATM 8488 O O   . HOH S 7 .   ? 5.427  19.205  11.650  1.00 60.23  ? 972  HOH A O   1 
HETATM 8489 O O   . HOH S 7 .   ? 33.149 23.530  13.512  1.00 38.52  ? 973  HOH A O   1 
HETATM 8490 O O   . HOH S 7 .   ? 42.456 21.840  1.277   1.00 57.49  ? 974  HOH A O   1 
HETATM 8491 O O   . HOH S 7 .   ? 37.490 9.524   4.557   1.00 42.87  ? 975  HOH A O   1 
HETATM 8492 O O   . HOH S 7 .   ? 26.839 5.617   0.799   1.00 52.54  ? 976  HOH A O   1 
HETATM 8493 O O   . HOH S 7 .   ? 40.288 27.353  17.286  1.00 55.48  ? 977  HOH A O   1 
HETATM 8494 O O   . HOH S 7 .   ? 21.371 34.520  17.339  1.00 46.85  ? 978  HOH A O   1 
HETATM 8495 O O   . HOH S 7 .   ? 17.379 25.192  22.121  1.00 58.88  ? 979  HOH A O   1 
HETATM 8496 O O   . HOH S 7 .   ? 56.464 15.125  26.326  1.00 43.72  ? 980  HOH A O   1 
HETATM 8497 O O   . HOH S 7 .   ? 53.718 20.785  25.509  1.00 48.57  ? 981  HOH A O   1 
HETATM 8498 O O   . HOH S 7 .   ? 53.135 23.957  25.661  1.00 51.80  ? 982  HOH A O   1 
HETATM 8499 O O   . HOH S 7 .   ? 40.438 12.407  33.817  1.00 40.80  ? 983  HOH A O   1 
HETATM 8500 O O   . HOH S 7 .   ? 46.132 15.118  24.844  1.00 45.49  ? 984  HOH A O   1 
HETATM 8501 O O   . HOH S 7 .   ? 41.127 26.682  19.843  1.00 54.28  ? 985  HOH A O   1 
HETATM 8502 O O   . HOH S 7 .   ? 43.241 9.572   11.467  1.00 49.06  ? 986  HOH A O   1 
HETATM 8503 O O   . HOH S 7 .   ? 25.025 18.550  28.867  1.00 37.18  ? 987  HOH A O   1 
HETATM 8504 O O   . HOH S 7 .   ? 39.700 1.416   26.577  1.00 46.02  ? 988  HOH A O   1 
HETATM 8505 O O   . HOH S 7 .   ? 34.456 27.634  11.276  1.00 60.55  ? 989  HOH A O   1 
HETATM 8506 O O   . HOH S 7 .   ? 25.737 19.674  46.540  1.00 43.56  ? 990  HOH A O   1 
HETATM 8507 O O   . HOH S 7 .   ? 44.779 2.391   44.307  1.00 53.72  ? 991  HOH A O   1 
HETATM 8508 O O   . HOH S 7 .   ? 37.996 9.189   47.892  1.00 46.86  ? 992  HOH A O   1 
HETATM 8509 O O   . HOH S 7 .   ? 47.015 8.598   27.521  1.00 60.96  ? 993  HOH A O   1 
HETATM 8510 O O   . HOH S 7 .   ? 49.448 5.519   28.235  1.00 67.02  ? 994  HOH A O   1 
HETATM 8511 O O   . HOH S 7 .   ? 37.293 15.078  51.350  1.00 55.54  ? 995  HOH A O   1 
HETATM 8512 O O   . HOH S 7 .   ? 41.015 19.749  35.280  1.00 50.03  ? 996  HOH A O   1 
HETATM 8513 O O   . HOH S 7 .   ? 23.728 23.652  23.210  1.00 52.82  ? 997  HOH A O   1 
HETATM 8514 O O   . HOH S 7 .   ? 39.436 27.918  26.847  1.00 44.96  ? 998  HOH A O   1 
HETATM 8515 O O   . HOH S 7 .   ? 31.887 16.909  29.920  1.00 32.64  ? 999  HOH A O   1 
HETATM 8516 O O   . HOH S 7 .   ? 16.596 -2.627  34.429  1.00 51.14  ? 1000 HOH A O   1 
HETATM 8517 O O   . HOH S 7 .   ? 30.853 20.810  16.700  1.00 49.55  ? 1001 HOH A O   1 
HETATM 8518 O O   . HOH S 7 .   ? 25.118 22.702  30.165  1.00 47.40  ? 1002 HOH A O   1 
HETATM 8519 O O   . HOH S 7 .   ? 8.263  11.366  27.858  1.00 47.06  ? 1003 HOH A O   1 
HETATM 8520 O O   . HOH S 7 .   ? 40.334 -1.874  24.117  1.00 56.17  ? 1004 HOH A O   1 
HETATM 8521 O O   . HOH S 7 .   ? 28.540 -0.164  29.667  1.00 46.49  ? 1005 HOH A O   1 
HETATM 8522 O O   . HOH S 7 .   ? 34.163 -5.428  37.692  1.00 61.08  ? 1006 HOH A O   1 
HETATM 8523 O O   . HOH S 7 .   ? 32.551 -5.521  35.541  1.00 49.12  ? 1007 HOH A O   1 
HETATM 8524 O O   . HOH S 7 .   ? 33.683 5.036   6.605   1.00 43.59  ? 1008 HOH A O   1 
HETATM 8525 O O   . HOH S 7 .   ? 46.513 1.641   3.533   1.00 51.80  ? 1009 HOH A O   1 
HETATM 8526 O O   . HOH S 7 .   ? 40.797 26.111  -2.315  1.00 63.12  ? 1010 HOH A O   1 
HETATM 8527 O O   . HOH S 7 .   ? 23.012 -14.460 10.273  1.00 60.06  ? 1011 HOH A O   1 
HETATM 8528 O O   . HOH S 7 .   ? 19.245 -13.948 9.698   1.00 60.10  ? 1012 HOH A O   1 
HETATM 8529 O O   . HOH S 7 .   ? 30.349 32.389  -1.526  1.00 54.37  ? 1013 HOH A O   1 
HETATM 8530 O O   . HOH S 7 .   ? 24.983 20.396  -17.329 1.00 58.87  ? 1014 HOH A O   1 
HETATM 8531 O O   . HOH S 7 .   ? 31.462 25.508  -12.665 1.00 41.35  ? 1015 HOH A O   1 
HETATM 8532 O O   . HOH S 7 .   ? 38.946 13.378  -13.597 1.00 65.34  ? 1016 HOH A O   1 
HETATM 8533 O O   . HOH S 7 .   ? 16.913 -8.982  10.257  1.00 51.60  ? 1017 HOH A O   1 
HETATM 8534 O O   . HOH S 7 .   ? 11.279 27.692  12.352  1.00 61.24  ? 1018 HOH A O   1 
HETATM 8535 O O   . HOH S 7 .   ? 5.174  24.172  16.608  1.00 45.90  ? 1019 HOH A O   1 
HETATM 8536 O O   . HOH S 7 .   ? 16.065 25.583  17.880  1.00 51.76  ? 1020 HOH A O   1 
HETATM 8537 O O   . HOH S 7 .   ? 14.557 32.760  6.511   1.00 60.61  ? 1021 HOH A O   1 
HETATM 8538 O O   . HOH S 7 .   ? 1.757  8.532   16.729  1.00 53.80  ? 1022 HOH A O   1 
HETATM 8539 O O   . HOH S 7 .   ? 12.109 8.899   0.215   1.00 53.24  ? 1023 HOH A O   1 
HETATM 8540 O O   . HOH S 7 .   ? 37.022 5.499   2.994   1.00 51.32  ? 1024 HOH A O   1 
HETATM 8541 O O   . HOH S 7 .   ? 39.183 18.544  10.536  1.00 59.71  ? 1025 HOH A O   1 
HETATM 8542 O O   . HOH S 7 .   ? 32.383 17.064  32.644  1.00 31.24  ? 1026 HOH A O   1 
HETATM 8543 O O   . HOH S 7 .   ? 35.183 15.897  -7.708  1.00 53.29  ? 1027 HOH A O   1 
HETATM 8544 O O   . HOH S 7 .   ? 17.990 21.438  -11.827 1.00 63.50  ? 1028 HOH A O   1 
HETATM 8545 O O   . HOH S 7 .   ? 37.045 -6.235  16.511  1.00 44.21  ? 1029 HOH A O   1 
HETATM 8546 O O   . HOH S 7 .   ? 21.454 24.608  31.917  1.00 55.23  ? 1030 HOH A O   1 
HETATM 8547 O O   . HOH S 7 .   ? 16.977 19.562  -0.785  1.00 45.32  ? 1031 HOH A O   1 
HETATM 8548 O O   . HOH S 7 .   ? 27.613 26.225  23.753  1.00 55.69  ? 1032 HOH A O   1 
HETATM 8549 O O   . HOH S 7 .   ? 42.325 26.225  6.689   1.00 66.76  ? 1033 HOH A O   1 
HETATM 8550 O O   . HOH S 7 .   ? 23.877 8.909   48.506  1.00 45.48  ? 1034 HOH A O   1 
HETATM 8551 O O   . HOH S 7 .   ? 25.286 18.193  49.381  1.00 59.74  ? 1035 HOH A O   1 
HETATM 8552 O O   . HOH S 7 .   ? 28.407 21.397  46.393  1.00 64.20  ? 1036 HOH A O   1 
HETATM 8553 O O   . HOH S 7 .   ? 43.429 0.473   6.140   1.00 47.18  ? 1037 HOH A O   1 
HETATM 8554 O O   . HOH T 7 .   ? 50.352 63.159  5.206   1.00 45.51  ? 910  HOH B O   1 
HETATM 8555 O O   . HOH T 7 .   ? 59.509 45.206  30.716  1.00 31.47  ? 911  HOH B O   1 
HETATM 8556 O O   . HOH T 7 .   ? 50.537 55.568  44.246  1.00 39.21  ? 912  HOH B O   1 
HETATM 8557 O O   . HOH T 7 .   ? 35.453 62.285  34.480  1.00 45.31  ? 913  HOH B O   1 
HETATM 8558 O O   . HOH T 7 .   ? 59.692 39.358  26.122  1.00 38.06  ? 914  HOH B O   1 
HETATM 8559 O O   . HOH T 7 .   ? 57.802 58.207  56.045  1.00 49.55  ? 915  HOH B O   1 
HETATM 8560 O O   . HOH T 7 .   ? 64.180 37.519  20.842  1.00 50.35  ? 916  HOH B O   1 
HETATM 8561 O O   . HOH T 7 .   ? 51.044 45.149  16.676  1.00 41.49  ? 917  HOH B O   1 
HETATM 8562 O O   . HOH T 7 .   ? 43.703 51.797  34.021  1.00 40.68  ? 918  HOH B O   1 
HETATM 8563 O O   . HOH T 7 .   ? 44.747 69.532  53.800  1.00 35.59  ? 919  HOH B O   1 
HETATM 8564 O O   . HOH T 7 .   ? 53.076 59.881  55.901  1.00 48.93  ? 920  HOH B O   1 
HETATM 8565 O O   . HOH T 7 .   ? 52.261 29.050  28.561  1.00 33.98  ? 921  HOH B O   1 
HETATM 8566 O O   . HOH T 7 .   ? 53.613 63.512  46.573  1.00 42.60  ? 922  HOH B O   1 
HETATM 8567 O O   . HOH T 7 .   ? 57.468 50.191  35.103  1.00 46.47  ? 923  HOH B O   1 
HETATM 8568 O O   . HOH T 7 .   ? 31.151 49.013  23.366  1.00 53.87  ? 924  HOH B O   1 
HETATM 8569 O O   . HOH T 7 .   ? 39.318 28.558  32.251  1.00 42.33  ? 925  HOH B O   1 
HETATM 8570 O O   . HOH T 7 .   ? 38.452 66.079  21.183  1.00 52.45  ? 926  HOH B O   1 
HETATM 8571 O O   . HOH T 7 .   ? 39.610 35.901  47.448  1.00 44.32  ? 927  HOH B O   1 
HETATM 8572 O O   . HOH T 7 .   ? 57.275 39.948  25.401  1.00 41.09  ? 928  HOH B O   1 
HETATM 8573 O O   . HOH T 7 .   ? 37.158 55.060  36.939  1.00 47.17  ? 929  HOH B O   1 
HETATM 8574 O O   . HOH T 7 .   ? 48.851 54.349  69.006  1.00 38.34  ? 930  HOH B O   1 
HETATM 8575 O O   . HOH T 7 .   ? 26.978 57.599  52.473  1.00 47.16  ? 931  HOH B O   1 
HETATM 8576 O O   . HOH T 7 .   ? 46.019 31.594  25.190  1.00 28.97  ? 932  HOH B O   1 
HETATM 8577 O O   . HOH T 7 .   ? 65.532 57.875  47.309  1.00 50.90  ? 933  HOH B O   1 
HETATM 8578 O O   . HOH T 7 .   ? 46.521 51.335  25.278  1.00 39.51  ? 934  HOH B O   1 
HETATM 8579 O O   . HOH T 7 .   ? 56.345 58.729  43.175  1.00 52.26  ? 935  HOH B O   1 
HETATM 8580 O O   . HOH T 7 .   ? 44.238 51.014  48.724  1.00 44.34  ? 936  HOH B O   1 
HETATM 8581 O O   . HOH T 7 .   ? 64.401 57.418  31.743  1.00 51.62  ? 937  HOH B O   1 
HETATM 8582 O O   . HOH T 7 .   ? 46.396 55.620  65.011  1.00 48.88  ? 938  HOH B O   1 
HETATM 8583 O O   . HOH T 7 .   ? 52.086 51.723  74.999  1.00 45.12  ? 939  HOH B O   1 
HETATM 8584 O O   . HOH T 7 .   ? 38.655 48.912  77.403  1.00 45.41  ? 940  HOH B O   1 
HETATM 8585 O O   . HOH T 7 .   ? 52.680 60.128  52.101  1.00 65.53  ? 941  HOH B O   1 
HETATM 8586 O O   . HOH T 7 .   ? 51.131 52.554  11.289  1.00 52.49  ? 942  HOH B O   1 
HETATM 8587 O O   . HOH T 7 .   ? 39.070 65.848  56.396  1.00 45.85  ? 943  HOH B O   1 
HETATM 8588 O O   . HOH T 7 .   ? 36.975 56.298  61.787  1.00 55.40  ? 944  HOH B O   1 
HETATM 8589 O O   . HOH T 7 .   ? 39.081 48.554  73.158  1.00 47.41  ? 945  HOH B O   1 
HETATM 8590 O O   . HOH T 7 .   ? 40.281 55.704  56.317  1.00 41.74  ? 946  HOH B O   1 
HETATM 8591 O O   . HOH T 7 .   ? 67.535 53.505  37.899  1.00 49.20  ? 947  HOH B O   1 
HETATM 8592 O O   . HOH T 7 .   ? 40.734 57.859  19.774  1.00 43.04  ? 948  HOH B O   1 
HETATM 8593 O O   . HOH T 7 .   ? 21.726 54.145  47.234  1.00 67.63  ? 949  HOH B O   1 
HETATM 8594 O O   . HOH T 7 .   ? 44.644 59.595  42.855  1.00 52.18  ? 950  HOH B O   1 
HETATM 8595 O O   . HOH T 7 .   ? 48.957 56.572  61.009  1.00 42.55  ? 951  HOH B O   1 
HETATM 8596 O O   . HOH T 7 .   ? 61.557 43.018  31.703  1.00 71.53  ? 952  HOH B O   1 
HETATM 8597 O O   . HOH T 7 .   ? 50.987 38.779  23.226  1.00 44.26  ? 953  HOH B O   1 
HETATM 8598 O O   . HOH T 7 .   ? 38.576 58.827  61.412  1.00 57.73  ? 954  HOH B O   1 
HETATM 8599 O O   . HOH T 7 .   ? 43.084 48.098  33.434  1.00 46.97  ? 955  HOH B O   1 
HETATM 8600 O O   . HOH T 7 .   ? 33.692 60.163  56.330  1.00 43.48  ? 956  HOH B O   1 
HETATM 8601 O O   . HOH T 7 .   ? 52.439 40.798  23.016  1.00 42.43  ? 957  HOH B O   1 
HETATM 8602 O O   . HOH T 7 .   ? 52.303 65.756  38.028  1.00 56.94  ? 958  HOH B O   1 
HETATM 8603 O O   . HOH T 7 .   ? 61.517 49.296  30.370  1.00 48.31  ? 959  HOH B O   1 
HETATM 8604 O O   . HOH T 7 .   ? 46.692 73.922  22.031  1.00 66.13  ? 960  HOH B O   1 
HETATM 8605 O O   . HOH T 7 .   ? 44.392 56.585  43.806  1.00 51.81  ? 961  HOH B O   1 
HETATM 8606 O O   . HOH T 7 .   ? 62.539 54.092  36.707  1.00 40.95  ? 962  HOH B O   1 
HETATM 8607 O O   . HOH T 7 .   ? 52.007 39.263  14.136  1.00 40.54  ? 963  HOH B O   1 
HETATM 8608 O O   . HOH T 7 .   ? 57.086 63.909  48.890  1.00 51.60  ? 964  HOH B O   1 
HETATM 8609 O O   . HOH T 7 .   ? 35.763 66.037  22.953  1.00 61.83  ? 965  HOH B O   1 
HETATM 8610 O O   . HOH T 7 .   ? 43.405 55.603  66.343  1.00 42.26  ? 966  HOH B O   1 
HETATM 8611 O O   . HOH T 7 .   ? 45.047 47.106  20.722  1.00 54.95  ? 967  HOH B O   1 
HETATM 8612 O O   . HOH T 7 .   ? 36.461 54.887  48.901  1.00 51.47  ? 968  HOH B O   1 
HETATM 8613 O O   . HOH T 7 .   ? 47.455 54.645  62.489  1.00 49.42  ? 969  HOH B O   1 
HETATM 8614 O O   . HOH T 7 .   ? 41.473 55.884  53.640  1.00 48.02  ? 970  HOH B O   1 
HETATM 8615 O O   . HOH T 7 .   ? 50.223 61.691  64.686  1.00 51.38  ? 971  HOH B O   1 
HETATM 8616 O O   . HOH T 7 .   ? 51.348 59.976  66.985  1.00 45.26  ? 972  HOH B O   1 
HETATM 8617 O O   . HOH T 7 .   ? 46.593 43.368  64.771  1.00 54.21  ? 973  HOH B O   1 
HETATM 8618 O O   . HOH T 7 .   ? 44.948 47.102  64.525  1.00 39.10  ? 974  HOH B O   1 
HETATM 8619 O O   . HOH T 7 .   ? 49.520 43.268  62.140  1.00 67.69  ? 975  HOH B O   1 
HETATM 8620 O O   . HOH T 7 .   ? 54.997 53.073  62.478  1.00 51.19  ? 976  HOH B O   1 
HETATM 8621 O O   . HOH T 7 .   ? 36.112 61.165  57.239  1.00 55.31  ? 977  HOH B O   1 
HETATM 8622 O O   . HOH T 7 .   ? 44.183 69.542  38.166  1.00 55.70  ? 978  HOH B O   1 
HETATM 8623 O O   . HOH T 7 .   ? 49.549 69.212  38.813  1.00 58.19  ? 979  HOH B O   1 
HETATM 8624 O O   . HOH T 7 .   ? 31.150 35.945  47.933  1.00 62.67  ? 980  HOH B O   1 
HETATM 8625 O O   . HOH T 7 .   ? 32.155 31.789  48.205  1.00 54.44  ? 981  HOH B O   1 
HETATM 8626 O O   . HOH T 7 .   ? 29.786 34.192  52.286  1.00 56.54  ? 982  HOH B O   1 
HETATM 8627 O O   . HOH T 7 .   ? 34.329 58.265  49.291  1.00 47.18  ? 983  HOH B O   1 
HETATM 8628 O O   . HOH T 7 .   ? 36.211 60.992  45.682  1.00 56.46  ? 984  HOH B O   1 
HETATM 8629 O O   . HOH T 7 .   ? 34.747 62.512  47.591  1.00 60.65  ? 985  HOH B O   1 
HETATM 8630 O O   . HOH T 7 .   ? 31.311 56.442  45.767  1.00 62.59  ? 986  HOH B O   1 
HETATM 8631 O O   . HOH T 7 .   ? 25.552 37.590  47.377  1.00 53.84  ? 987  HOH B O   1 
HETATM 8632 O O   . HOH T 7 .   ? 55.864 45.480  57.051  1.00 44.72  ? 988  HOH B O   1 
HETATM 8633 O O   . HOH T 7 .   ? 45.824 38.805  53.758  1.00 55.26  ? 989  HOH B O   1 
HETATM 8634 O O   . HOH T 7 .   ? 41.601 36.255  60.415  1.00 56.69  ? 990  HOH B O   1 
HETATM 8635 O O   . HOH T 7 .   ? 62.412 39.753  46.254  1.00 50.44  ? 991  HOH B O   1 
HETATM 8636 O O   . HOH T 7 .   ? 61.893 38.005  48.165  1.00 38.73  ? 992  HOH B O   1 
HETATM 8637 O O   . HOH T 7 .   ? 57.353 26.047  37.047  1.00 78.19  ? 993  HOH B O   1 
HETATM 8638 O O   . HOH T 7 .   ? 58.268 70.653  18.220  1.00 63.25  ? 994  HOH B O   1 
HETATM 8639 O O   . HOH T 7 .   ? 65.513 64.510  18.892  1.00 56.32  ? 995  HOH B O   1 
HETATM 8640 O O   . HOH T 7 .   ? 70.149 59.436  27.822  1.00 67.93  ? 996  HOH B O   1 
HETATM 8641 O O   . HOH T 7 .   ? 72.059 59.835  22.013  1.00 82.06  ? 997  HOH B O   1 
HETATM 8642 O O   . HOH T 7 .   ? 54.224 26.125  31.672  1.00 48.43  ? 998  HOH B O   1 
HETATM 8643 O O   . HOH T 7 .   ? 48.032 30.732  31.851  1.00 46.43  ? 999  HOH B O   1 
HETATM 8644 O O   . HOH T 7 .   ? 41.121 32.206  19.743  1.00 52.64  ? 1000 HOH B O   1 
HETATM 8645 O O   . HOH T 7 .   ? 32.928 42.279  26.669  1.00 49.04  ? 1001 HOH B O   1 
HETATM 8646 O O   . HOH T 7 .   ? 33.400 41.848  19.256  1.00 61.94  ? 1002 HOH B O   1 
HETATM 8647 O O   . HOH T 7 .   ? 35.483 34.575  20.534  1.00 47.79  ? 1003 HOH B O   1 
HETATM 8648 O O   . HOH T 7 .   ? 45.114 41.052  19.136  1.00 42.31  ? 1004 HOH B O   1 
HETATM 8649 O O   . HOH T 7 .   ? 63.441 54.207  33.101  1.00 51.40  ? 1005 HOH B O   1 
HETATM 8650 O O   . HOH T 7 .   ? 47.241 63.970  44.825  1.00 51.72  ? 1006 HOH B O   1 
HETATM 8651 O O   . HOH T 7 .   ? 33.604 68.960  35.295  1.00 55.12  ? 1007 HOH B O   1 
HETATM 8652 O O   . HOH T 7 .   ? 58.257 46.486  28.309  1.00 52.72  ? 1008 HOH B O   1 
HETATM 8653 O O   . HOH T 7 .   ? 51.144 65.955  58.997  1.00 48.86  ? 1009 HOH B O   1 
HETATM 8654 O O   . HOH T 7 .   ? 53.335 48.865  33.766  1.00 56.70  ? 1010 HOH B O   1 
HETATM 8655 O O   . HOH T 7 .   ? 36.690 30.881  24.080  1.00 46.05  ? 1011 HOH B O   1 
HETATM 8656 O O   . HOH T 7 .   ? 38.020 62.043  18.388  1.00 48.99  ? 1012 HOH B O   1 
HETATM 8657 O O   . HOH T 7 .   ? 48.945 41.228  18.036  1.00 58.54  ? 1013 HOH B O   1 
HETATM 8658 O O   . HOH T 7 .   ? 43.146 35.505  28.504  1.00 43.84  ? 1014 HOH B O   1 
HETATM 8659 O O   . HOH T 7 .   ? 43.859 44.847  65.726  1.00 54.67  ? 1015 HOH B O   1 
HETATM 8660 O O   . HOH T 7 .   ? 25.737 34.914  49.037  1.00 54.95  ? 1016 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 PRO 259 259 ?   ?   ?   A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 GLY 261 261 ?   ?   ?   A . n 
A 1 262 ALA 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 HIS 284 284 284 HIS HIS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 GLN 325 325 325 GLN GLN A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 GLN 358 358 358 GLN GLN A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ASP 372 372 372 ASP ASP A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 TYR 382 382 382 TYR TYR A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 TRP 385 385 385 TRP TRP A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 HIS 393 393 393 HIS HIS A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 MET 398 398 398 MET MET A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 VAL 402 402 402 VAL VAL A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 CYS 409 409 409 CYS CYS A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 TYR 428 428 428 TYR TYR A . n 
A 1 429 ILE 429 429 429 ILE ILE A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 HIS 432 432 432 HIS HIS A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 SER 435 435 435 SER SER A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 TRP 439 439 439 TRP TRP A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 TRP 442 442 442 TRP TRP A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 HIS 447 447 447 HIS HIS A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 TYR 449 449 449 TYR TYR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ILE 451 451 451 ILE ILE A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 THR 466 466 466 THR THR A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 LEU 476 476 476 LEU LEU A . n 
A 1 477 MET 477 477 477 MET MET A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 TRP 480 480 480 TRP TRP A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASN 482 482 482 ASN ASN A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 ARG 485 485 485 ARG ARG A . n 
A 1 486 THR 486 486 486 THR THR A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 PRO 489 489 489 PRO PRO A . n 
A 1 490 ASN 490 490 490 ASN ASN A . n 
A 1 491 ASP 491 491 491 ASP ASP A . n 
A 1 492 PRO 492 492 492 PRO PRO A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 ASP 494 494 494 ASP ASP A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LYS 496 496 496 LYS ALA A . n 
A 1 497 SER 497 497 497 SER SER A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 GLN 499 499 499 GLN GLN A . n 
A 1 500 TRP 500 500 500 TRP TRP A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 THR 504 504 504 THR THR A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ALA 506 506 506 ALA ALA A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 ASN 514 514 514 ASN ASN A . n 
A 1 515 LEU 515 515 515 LEU LEU A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 PRO 517 517 517 PRO PRO A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ARG 521 521 521 ARG ARG A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ARG 525 525 525 ARG ARG A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 THR 528 528 528 THR THR A . n 
A 1 529 CYS 529 529 529 CYS CYS A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 PHE 531 531 531 PHE PHE A . n 
A 1 532 TRP 532 532 532 TRP TRP A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 SER 541 541 541 SER SER A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 THR 543 543 ?   ?   ?   A . n 
B 1 1   GLU 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  PRO 25  25  25  PRO PRO B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  MET 48  48  48  MET MET B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  TRP 56  56  56  TRP TRP B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  CYS 69  69  69  CYS CYS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  TRP 86  86  86  TRP TRP B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  CYS 96  96  96  CYS CYS B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  TYR 98  98  98  TYR TYR B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 PRO 111 111 111 PRO PRO B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 PHE 158 158 158 PHE PHE B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 GLN 184 184 184 GLN GLN B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 ILE 187 187 187 ILE ILE B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 MET 195 195 195 MET MET B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 PHE 200 200 200 PHE PHE B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 ALA 203 203 203 ALA ALA B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 SER 208 208 208 SER SER B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 MET 211 211 211 MET MET B . n 
B 1 212 HIS 212 212 212 HIS HIS B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 LEU 221 221 221 LEU LEU B . n 
B 1 222 PHE 222 222 222 PHE PHE B . n 
B 1 223 HIS 223 223 223 HIS HIS B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ARG 245 245 245 ARG ARG B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ARG 247 247 247 ARG ARG B . n 
B 1 248 ALA 248 248 248 ALA ALA B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ARG 253 253 253 ARG ARG B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 CYS 257 257 257 CYS CYS B . n 
B 1 258 PRO 258 258 258 PRO PRO B . n 
B 1 259 PRO 259 259 ?   ?   ?   B . n 
B 1 260 GLY 260 260 ?   ?   ?   B . n 
B 1 261 GLY 261 261 ?   ?   ?   B . n 
B 1 262 ALA 262 262 ?   ?   ?   B . n 
B 1 263 GLY 263 263 ?   ?   ?   B . n 
B 1 264 GLY 264 264 ?   ?   ?   B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 ASP 266 266 266 ASP ASP B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ARG 274 274 274 ARG ARG B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 ASP 283 283 283 ASP ASP B . n 
B 1 284 HIS 284 284 284 HIS HIS B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 TRP 286 286 286 TRP TRP B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 PHE 295 295 295 PHE PHE B . n 
B 1 296 ARG 296 296 296 ARG ARG B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 VAL 300 300 300 VAL VAL B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 ASP 304 304 304 ASP ASP B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 PHE 307 307 307 PHE PHE B . n 
B 1 308 LEU 308 308 308 LEU LEU B . n 
B 1 309 SER 309 309 309 SER SER B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 PRO 312 312 312 PRO PRO B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 ILE 316 316 316 ILE ILE B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 GLN 322 322 322 GLN GLN B . n 
B 1 323 ASP 323 323 323 ASP ASP B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 GLN 325 325 325 GLN GLN B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 VAL 331 331 331 VAL VAL B . n 
B 1 332 LYS 332 332 332 LYS LYS B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 TYR 337 337 337 TYR TYR B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 TYR 341 341 341 TYR TYR B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 PRO 344 344 344 PRO PRO B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 PHE 346 346 346 PHE PHE B . n 
B 1 347 SER 347 347 347 SER SER B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 ASN 350 350 350 ASN ASN B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 ILE 354 354 354 ILE ILE B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 ARG 356 356 356 ARG ARG B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 GLN 358 358 358 GLN GLN B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 VAL 363 363 363 VAL VAL B . n 
B 1 364 ARG 364 364 364 ARG ARG B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 GLY 366 366 366 GLY GLY B . n 
B 1 367 VAL 367 367 367 VAL VAL B . n 
B 1 368 PRO 368 368 368 PRO PRO B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 SER 371 371 371 SER SER B . n 
B 1 372 ASP 372 372 372 ASP ASP B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 ALA 375 375 375 ALA ALA B . n 
B 1 376 GLU 376 376 376 GLU GLU B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 VAL 379 379 379 VAL VAL B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 HIS 381 381 381 HIS HIS B . n 
B 1 382 TYR 382 382 382 TYR TYR B . n 
B 1 383 THR 383 383 383 THR THR B . n 
B 1 384 ASP 384 384 384 ASP ASP B . n 
B 1 385 TRP 385 385 385 TRP TRP B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 HIS 387 387 387 HIS HIS B . n 
B 1 388 PRO 388 388 388 PRO PRO B . n 
B 1 389 GLU 389 389 389 GLU GLU B . n 
B 1 390 ASP 390 390 390 ASP ASP B . n 
B 1 391 PRO 391 391 391 PRO PRO B . n 
B 1 392 THR 392 392 392 THR THR B . n 
B 1 393 HIS 393 393 393 HIS HIS B . n 
B 1 394 LEU 394 394 394 LEU LEU B . n 
B 1 395 ARG 395 395 395 ARG ARG B . n 
B 1 396 ASP 396 396 396 ASP ASP B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 MET 398 398 398 MET MET B . n 
B 1 399 SER 399 399 399 SER SER B . n 
B 1 400 ALA 400 400 400 ALA ALA B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 VAL 402 402 402 VAL VAL B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 ASP 404 404 404 ASP ASP B . n 
B 1 405 HIS 405 405 405 HIS HIS B . n 
B 1 406 ASN 406 406 406 ASN ASN B . n 
B 1 407 VAL 407 407 407 VAL VAL B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 CYS 409 409 409 CYS CYS B . n 
B 1 410 PRO 410 410 410 PRO PRO B . n 
B 1 411 VAL 411 411 411 VAL VAL B . n 
B 1 412 ALA 412 412 412 ALA ALA B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 ALA 415 415 415 ALA ALA B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 ARG 417 417 417 ARG ARG B . n 
B 1 418 LEU 418 418 418 LEU LEU B . n 
B 1 419 ALA 419 419 419 ALA ALA B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 GLN 421 421 421 GLN GLN B . n 
B 1 422 GLY 422 422 422 GLY GLY B . n 
B 1 423 ALA 423 423 423 ALA ALA B . n 
B 1 424 ARG 424 424 424 ARG ARG B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 TYR 426 426 426 TYR TYR B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 TYR 428 428 428 TYR TYR B . n 
B 1 429 ILE 429 429 429 ILE ILE B . n 
B 1 430 PHE 430 430 430 PHE PHE B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 HIS 432 432 432 HIS HIS B . n 
B 1 433 ARG 433 433 433 ARG ARG B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 SER 435 435 435 SER SER B . n 
B 1 436 THR 436 436 436 THR THR B . n 
B 1 437 LEU 437 437 437 LEU LEU B . n 
B 1 438 THR 438 438 438 THR THR B . n 
B 1 439 TRP 439 439 439 TRP TRP B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 LEU 441 441 441 LEU LEU B . n 
B 1 442 TRP 442 442 442 TRP TRP B . n 
B 1 443 MET 443 443 443 MET MET B . n 
B 1 444 GLY 444 444 444 GLY GLY B . n 
B 1 445 VAL 445 445 445 VAL VAL B . n 
B 1 446 PRO 446 446 446 PRO PRO B . n 
B 1 447 HIS 447 447 447 HIS HIS B . n 
B 1 448 GLY 448 448 448 GLY GLY B . n 
B 1 449 TYR 449 449 449 TYR TYR B . n 
B 1 450 GLU 450 450 450 GLU GLU B . n 
B 1 451 ILE 451 451 451 ILE ILE B . n 
B 1 452 GLU 452 452 452 GLU GLU B . n 
B 1 453 PHE 453 453 453 PHE PHE B . n 
B 1 454 ILE 454 454 454 ILE ILE B . n 
B 1 455 PHE 455 455 455 PHE PHE B . n 
B 1 456 GLY 456 456 456 GLY GLY B . n 
B 1 457 LEU 457 457 457 LEU LEU B . n 
B 1 458 PRO 458 458 458 PRO PRO B . n 
B 1 459 LEU 459 459 459 LEU LEU B . n 
B 1 460 ASP 460 460 460 ASP ASP B . n 
B 1 461 PRO 461 461 461 PRO PRO B . n 
B 1 462 SER 462 462 462 SER SER B . n 
B 1 463 LEU 463 463 463 LEU LEU B . n 
B 1 464 ASN 464 464 464 ASN ASN B . n 
B 1 465 TYR 465 465 465 TYR TYR B . n 
B 1 466 THR 466 466 466 THR THR B . n 
B 1 467 THR 467 467 467 THR THR B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 GLU 469 469 469 GLU GLU B . n 
B 1 470 ARG 470 470 470 ARG ARG B . n 
B 1 471 ILE 471 471 471 ILE ILE B . n 
B 1 472 PHE 472 472 472 PHE PHE B . n 
B 1 473 ALA 473 473 473 ALA ALA B . n 
B 1 474 GLN 474 474 474 GLN GLN B . n 
B 1 475 ARG 475 475 475 ARG ARG B . n 
B 1 476 LEU 476 476 476 LEU LEU B . n 
B 1 477 MET 477 477 477 MET MET B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 TYR 479 479 479 TYR TYR B . n 
B 1 480 TRP 480 480 480 TRP TRP B . n 
B 1 481 THR 481 481 481 THR THR B . n 
B 1 482 ASN 482 482 482 ASN ASN B . n 
B 1 483 PHE 483 483 483 PHE PHE B . n 
B 1 484 ALA 484 484 484 ALA ALA B . n 
B 1 485 ARG 485 485 485 ARG ARG B . n 
B 1 486 THR 486 486 486 THR THR B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 ASP 488 488 488 ASP ASP B . n 
B 1 489 PRO 489 489 489 PRO PRO B . n 
B 1 490 ASN 490 490 490 ASN ASN B . n 
B 1 491 ASP 491 491 491 ASP ASP B . n 
B 1 492 PRO 492 492 492 PRO PRO B . n 
B 1 493 ARG 493 493 493 ARG ALA B . n 
B 1 494 ASP 494 494 494 ASP ASP B . n 
B 1 495 SER 495 495 495 SER SER B . n 
B 1 496 LYS 496 496 496 LYS LYS B . n 
B 1 497 SER 497 497 497 SER SER B . n 
B 1 498 PRO 498 498 498 PRO PRO B . n 
B 1 499 GLN 499 499 499 GLN GLN B . n 
B 1 500 TRP 500 500 500 TRP TRP B . n 
B 1 501 PRO 501 501 501 PRO PRO B . n 
B 1 502 PRO 502 502 502 PRO PRO B . n 
B 1 503 TYR 503 503 503 TYR TYR B . n 
B 1 504 THR 504 504 504 THR THR B . n 
B 1 505 THR 505 505 505 THR THR B . n 
B 1 506 ALA 506 506 506 ALA ALA B . n 
B 1 507 ALA 507 507 507 ALA ALA B . n 
B 1 508 GLN 508 508 508 GLN GLN B . n 
B 1 509 GLN 509 509 509 GLN GLN B . n 
B 1 510 TYR 510 510 510 TYR TYR B . n 
B 1 511 VAL 511 511 511 VAL VAL B . n 
B 1 512 SER 512 512 512 SER SER B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 ASN 514 514 514 ASN ASN B . n 
B 1 515 LEU 515 515 515 LEU LEU B . n 
B 1 516 LYS 516 516 516 LYS LYS B . n 
B 1 517 PRO 517 517 517 PRO PRO B . n 
B 1 518 LEU 518 518 518 LEU LEU B . n 
B 1 519 GLU 519 519 519 GLU GLU B . n 
B 1 520 VAL 520 520 520 VAL VAL B . n 
B 1 521 ARG 521 521 521 ARG ARG B . n 
B 1 522 ARG 522 522 522 ARG ARG B . n 
B 1 523 GLY 523 523 523 GLY GLY B . n 
B 1 524 LEU 524 524 524 LEU LEU B . n 
B 1 525 ARG 525 525 525 ARG ARG B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 GLN 527 527 527 GLN GLN B . n 
B 1 528 THR 528 528 528 THR THR B . n 
B 1 529 CYS 529 529 529 CYS CYS B . n 
B 1 530 ALA 530 530 530 ALA ALA B . n 
B 1 531 PHE 531 531 531 PHE PHE B . n 
B 1 532 TRP 532 532 532 TRP TRP B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ARG 534 534 534 ARG ARG B . n 
B 1 535 PHE 535 535 535 PHE PHE B . n 
B 1 536 LEU 536 536 536 LEU LEU B . n 
B 1 537 PRO 537 537 537 PRO PRO B . n 
B 1 538 LYS 538 538 538 LYS LYS B . n 
B 1 539 LEU 539 539 539 LEU LEU B . n 
B 1 540 LEU 540 540 540 LEU LEU B . n 
B 1 541 SER 541 541 541 SER SER B . n 
B 1 542 ALA 542 542 542 ALA ALA B . n 
B 1 543 THR 543 543 543 THR THR B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 IOD 1   900  900 IOD IDO A . 
D 2 IOD 1   902  902 IOD IDO A . 
E 2 IOD 1   903  903 IOD IDO A . 
F 2 IOD 1   907  907 IOD IDO A . 
G 3 ETM 1   908  501 ETM XCH A . 
H 4 BUA 1   909  503 BUA BTY A . 
I 5 BCH 1   910  502 BCH BCH A . 
J 5 BCH 1   601  503 BCH BCH A . 
K 6 P6G 1   901  901 P6G PEG A . 
L 2 IOD 1   904  904 IOD IDO B . 
M 2 IOD 1   905  905 IOD IDO B . 
N 2 IOD 1   906  906 IOD IDO B . 
O 2 IOD 1   908  908 IOD IDO B . 
P 2 IOD 1   909  909 IOD IDO B . 
Q 3 ETM 1   602  602 ETM XCH B . 
R 4 BUA 1   603  603 BUA BTY B . 
S 7 HOH 1   911  1   HOH HOH A . 
S 7 HOH 2   912  2   HOH HOH A . 
S 7 HOH 3   913  6   HOH HOH A . 
S 7 HOH 4   914  7   HOH HOH A . 
S 7 HOH 5   915  8   HOH HOH A . 
S 7 HOH 6   916  9   HOH HOH A . 
S 7 HOH 7   917  10  HOH HOH A . 
S 7 HOH 8   918  13  HOH HOH A . 
S 7 HOH 9   919  15  HOH HOH A . 
S 7 HOH 10  920  18  HOH HOH A . 
S 7 HOH 11  921  19  HOH HOH A . 
S 7 HOH 12  922  24  HOH HOH A . 
S 7 HOH 13  923  25  HOH HOH A . 
S 7 HOH 14  924  33  HOH HOH A . 
S 7 HOH 15  925  34  HOH HOH A . 
S 7 HOH 16  926  35  HOH HOH A . 
S 7 HOH 17  927  36  HOH HOH A . 
S 7 HOH 18  928  37  HOH HOH A . 
S 7 HOH 19  929  40  HOH HOH A . 
S 7 HOH 20  930  43  HOH HOH A . 
S 7 HOH 21  931  44  HOH HOH A . 
S 7 HOH 22  932  47  HOH HOH A . 
S 7 HOH 23  933  48  HOH HOH A . 
S 7 HOH 24  934  49  HOH HOH A . 
S 7 HOH 25  935  50  HOH HOH A . 
S 7 HOH 26  936  53  HOH HOH A . 
S 7 HOH 27  937  54  HOH HOH A . 
S 7 HOH 28  938  55  HOH HOH A . 
S 7 HOH 29  939  57  HOH HOH A . 
S 7 HOH 30  940  58  HOH HOH A . 
S 7 HOH 31  941  59  HOH HOH A . 
S 7 HOH 32  942  60  HOH HOH A . 
S 7 HOH 33  943  62  HOH HOH A . 
S 7 HOH 34  944  63  HOH HOH A . 
S 7 HOH 35  945  65  HOH HOH A . 
S 7 HOH 36  946  66  HOH HOH A . 
S 7 HOH 37  947  67  HOH HOH A . 
S 7 HOH 38  948  72  HOH HOH A . 
S 7 HOH 39  949  73  HOH HOH A . 
S 7 HOH 40  950  74  HOH HOH A . 
S 7 HOH 41  951  75  HOH HOH A . 
S 7 HOH 42  952  76  HOH HOH A . 
S 7 HOH 43  953  79  HOH HOH A . 
S 7 HOH 44  954  81  HOH HOH A . 
S 7 HOH 45  955  82  HOH HOH A . 
S 7 HOH 46  956  84  HOH HOH A . 
S 7 HOH 47  957  86  HOH HOH A . 
S 7 HOH 48  958  88  HOH HOH A . 
S 7 HOH 49  959  90  HOH HOH A . 
S 7 HOH 50  960  91  HOH HOH A . 
S 7 HOH 51  961  92  HOH HOH A . 
S 7 HOH 52  962  94  HOH HOH A . 
S 7 HOH 53  963  99  HOH HOH A . 
S 7 HOH 54  964  103 HOH HOH A . 
S 7 HOH 55  965  104 HOH HOH A . 
S 7 HOH 56  966  105 HOH HOH A . 
S 7 HOH 57  967  106 HOH HOH A . 
S 7 HOH 58  968  107 HOH HOH A . 
S 7 HOH 59  969  109 HOH HOH A . 
S 7 HOH 60  970  112 HOH HOH A . 
S 7 HOH 61  971  114 HOH HOH A . 
S 7 HOH 62  972  117 HOH HOH A . 
S 7 HOH 63  973  118 HOH HOH A . 
S 7 HOH 64  974  119 HOH HOH A . 
S 7 HOH 65  975  120 HOH HOH A . 
S 7 HOH 66  976  122 HOH HOH A . 
S 7 HOH 67  977  125 HOH HOH A . 
S 7 HOH 68  978  127 HOH HOH A . 
S 7 HOH 69  979  130 HOH HOH A . 
S 7 HOH 70  980  132 HOH HOH A . 
S 7 HOH 71  981  133 HOH HOH A . 
S 7 HOH 72  982  134 HOH HOH A . 
S 7 HOH 73  983  135 HOH HOH A . 
S 7 HOH 74  984  138 HOH HOH A . 
S 7 HOH 75  985  140 HOH HOH A . 
S 7 HOH 76  986  141 HOH HOH A . 
S 7 HOH 77  987  143 HOH HOH A . 
S 7 HOH 78  988  146 HOH HOH A . 
S 7 HOH 79  989  149 HOH HOH A . 
S 7 HOH 80  990  151 HOH HOH A . 
S 7 HOH 81  991  152 HOH HOH A . 
S 7 HOH 82  992  153 HOH HOH A . 
S 7 HOH 83  993  154 HOH HOH A . 
S 7 HOH 84  994  155 HOH HOH A . 
S 7 HOH 85  995  156 HOH HOH A . 
S 7 HOH 86  996  157 HOH HOH A . 
S 7 HOH 87  997  158 HOH HOH A . 
S 7 HOH 88  998  159 HOH HOH A . 
S 7 HOH 89  999  160 HOH HOH A . 
S 7 HOH 90  1000 161 HOH HOH A . 
S 7 HOH 91  1001 162 HOH HOH A . 
S 7 HOH 92  1002 163 HOH HOH A . 
S 7 HOH 93  1003 164 HOH HOH A . 
S 7 HOH 94  1004 165 HOH HOH A . 
S 7 HOH 95  1005 166 HOH HOH A . 
S 7 HOH 96  1006 167 HOH HOH A . 
S 7 HOH 97  1007 168 HOH HOH A . 
S 7 HOH 98  1008 169 HOH HOH A . 
S 7 HOH 99  1009 170 HOH HOH A . 
S 7 HOH 100 1010 171 HOH HOH A . 
S 7 HOH 101 1011 172 HOH HOH A . 
S 7 HOH 102 1012 173 HOH HOH A . 
S 7 HOH 103 1013 174 HOH HOH A . 
S 7 HOH 104 1014 175 HOH HOH A . 
S 7 HOH 105 1015 176 HOH HOH A . 
S 7 HOH 106 1016 177 HOH HOH A . 
S 7 HOH 107 1017 178 HOH HOH A . 
S 7 HOH 108 1018 179 HOH HOH A . 
S 7 HOH 109 1019 180 HOH HOH A . 
S 7 HOH 110 1020 181 HOH HOH A . 
S 7 HOH 111 1021 182 HOH HOH A . 
S 7 HOH 112 1022 183 HOH HOH A . 
S 7 HOH 113 1023 217 HOH HOH A . 
S 7 HOH 114 1024 218 HOH HOH A . 
S 7 HOH 115 1025 219 HOH HOH A . 
S 7 HOH 116 1026 224 HOH HOH A . 
S 7 HOH 117 1027 228 HOH HOH A . 
S 7 HOH 118 1028 229 HOH HOH A . 
S 7 HOH 119 1029 230 HOH HOH A . 
S 7 HOH 120 1030 231 HOH HOH A . 
S 7 HOH 121 1031 232 HOH HOH A . 
S 7 HOH 122 1032 233 HOH HOH A . 
S 7 HOH 123 1033 234 HOH HOH A . 
S 7 HOH 124 1034 236 HOH HOH A . 
S 7 HOH 125 1035 237 HOH HOH A . 
S 7 HOH 126 1036 238 HOH HOH A . 
S 7 HOH 127 1037 240 HOH HOH A . 
T 7 HOH 1   910  3   HOH HOH B . 
T 7 HOH 2   911  4   HOH HOH B . 
T 7 HOH 3   912  11  HOH HOH B . 
T 7 HOH 4   913  12  HOH HOH B . 
T 7 HOH 5   914  14  HOH HOH B . 
T 7 HOH 6   915  16  HOH HOH B . 
T 7 HOH 7   916  17  HOH HOH B . 
T 7 HOH 8   917  20  HOH HOH B . 
T 7 HOH 9   918  21  HOH HOH B . 
T 7 HOH 10  919  22  HOH HOH B . 
T 7 HOH 11  920  23  HOH HOH B . 
T 7 HOH 12  921  27  HOH HOH B . 
T 7 HOH 13  922  28  HOH HOH B . 
T 7 HOH 14  923  29  HOH HOH B . 
T 7 HOH 15  924  30  HOH HOH B . 
T 7 HOH 16  925  31  HOH HOH B . 
T 7 HOH 17  926  32  HOH HOH B . 
T 7 HOH 18  927  38  HOH HOH B . 
T 7 HOH 19  928  39  HOH HOH B . 
T 7 HOH 20  929  41  HOH HOH B . 
T 7 HOH 21  930  42  HOH HOH B . 
T 7 HOH 22  931  45  HOH HOH B . 
T 7 HOH 23  932  46  HOH HOH B . 
T 7 HOH 24  933  51  HOH HOH B . 
T 7 HOH 25  934  52  HOH HOH B . 
T 7 HOH 26  935  56  HOH HOH B . 
T 7 HOH 27  936  61  HOH HOH B . 
T 7 HOH 28  937  64  HOH HOH B . 
T 7 HOH 29  938  68  HOH HOH B . 
T 7 HOH 30  939  69  HOH HOH B . 
T 7 HOH 31  940  70  HOH HOH B . 
T 7 HOH 32  941  71  HOH HOH B . 
T 7 HOH 33  942  87  HOH HOH B . 
T 7 HOH 34  943  89  HOH HOH B . 
T 7 HOH 35  944  93  HOH HOH B . 
T 7 HOH 36  945  95  HOH HOH B . 
T 7 HOH 37  946  96  HOH HOH B . 
T 7 HOH 38  947  97  HOH HOH B . 
T 7 HOH 39  948  98  HOH HOH B . 
T 7 HOH 40  949  100 HOH HOH B . 
T 7 HOH 41  950  101 HOH HOH B . 
T 7 HOH 42  951  102 HOH HOH B . 
T 7 HOH 43  952  108 HOH HOH B . 
T 7 HOH 44  953  110 HOH HOH B . 
T 7 HOH 45  954  111 HOH HOH B . 
T 7 HOH 46  955  113 HOH HOH B . 
T 7 HOH 47  956  115 HOH HOH B . 
T 7 HOH 48  957  116 HOH HOH B . 
T 7 HOH 49  958  121 HOH HOH B . 
T 7 HOH 50  959  123 HOH HOH B . 
T 7 HOH 51  960  124 HOH HOH B . 
T 7 HOH 52  961  126 HOH HOH B . 
T 7 HOH 53  962  128 HOH HOH B . 
T 7 HOH 54  963  131 HOH HOH B . 
T 7 HOH 55  964  136 HOH HOH B . 
T 7 HOH 56  965  137 HOH HOH B . 
T 7 HOH 57  966  139 HOH HOH B . 
T 7 HOH 58  967  142 HOH HOH B . 
T 7 HOH 59  968  144 HOH HOH B . 
T 7 HOH 60  969  145 HOH HOH B . 
T 7 HOH 61  970  147 HOH HOH B . 
T 7 HOH 62  971  148 HOH HOH B . 
T 7 HOH 63  972  150 HOH HOH B . 
T 7 HOH 64  973  184 HOH HOH B . 
T 7 HOH 65  974  185 HOH HOH B . 
T 7 HOH 66  975  186 HOH HOH B . 
T 7 HOH 67  976  187 HOH HOH B . 
T 7 HOH 68  977  188 HOH HOH B . 
T 7 HOH 69  978  189 HOH HOH B . 
T 7 HOH 70  979  190 HOH HOH B . 
T 7 HOH 71  980  191 HOH HOH B . 
T 7 HOH 72  981  192 HOH HOH B . 
T 7 HOH 73  982  193 HOH HOH B . 
T 7 HOH 74  983  194 HOH HOH B . 
T 7 HOH 75  984  195 HOH HOH B . 
T 7 HOH 76  985  196 HOH HOH B . 
T 7 HOH 77  986  197 HOH HOH B . 
T 7 HOH 78  987  198 HOH HOH B . 
T 7 HOH 79  988  199 HOH HOH B . 
T 7 HOH 80  989  200 HOH HOH B . 
T 7 HOH 81  990  201 HOH HOH B . 
T 7 HOH 82  991  202 HOH HOH B . 
T 7 HOH 83  992  203 HOH HOH B . 
T 7 HOH 84  993  204 HOH HOH B . 
T 7 HOH 85  994  205 HOH HOH B . 
T 7 HOH 86  995  206 HOH HOH B . 
T 7 HOH 87  996  207 HOH HOH B . 
T 7 HOH 88  997  208 HOH HOH B . 
T 7 HOH 89  998  209 HOH HOH B . 
T 7 HOH 90  999  210 HOH HOH B . 
T 7 HOH 91  1000 211 HOH HOH B . 
T 7 HOH 92  1001 212 HOH HOH B . 
T 7 HOH 93  1002 213 HOH HOH B . 
T 7 HOH 94  1003 214 HOH HOH B . 
T 7 HOH 95  1004 215 HOH HOH B . 
T 7 HOH 96  1005 216 HOH HOH B . 
T 7 HOH 97  1006 220 HOH HOH B . 
T 7 HOH 98  1007 221 HOH HOH B . 
T 7 HOH 99  1008 222 HOH HOH B . 
T 7 HOH 100 1009 223 HOH HOH B . 
T 7 HOH 101 1010 225 HOH HOH B . 
T 7 HOH 102 1011 226 HOH HOH B . 
T 7 HOH 103 1012 227 HOH HOH B . 
T 7 HOH 104 1013 235 HOH HOH B . 
T 7 HOH 105 1014 239 HOH HOH B . 
T 7 HOH 106 1015 241 HOH HOH B . 
T 7 HOH 107 1016 242 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 B,L,M,N,O,P,Q,R,T     
1 2 A,C,D,E,F,G,H,I,J,K,S 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z           1.0000000000 0.0000000000 0.0000000000 0.0000000000  0.0000000000 
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 x+1/2,-y+1/2,-z 1.0000000000 0.0000000000 0.0000000000 39.6625000000 0.0000000000 
-1.0000000000 0.0000000000 55.5575000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-07-18 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-06-02 
5 'Structure model' 1 4 2021-11-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Derived calculations'      
5 5 'Structure model' 'Database references'       
6 5 'Structure model' 'Derived calculations'      
7 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_struct_assembly_gen 
2 4 'Structure model' pdbx_struct_oper_list    
3 4 'Structure model' struct_site              
4 5 'Structure model' chem_comp                
5 5 'Structure model' database_2               
6 5 'Structure model' entity                   
7 5 'Structure model' pdbx_entity_nonpoly      
8 5 'Structure model' struct_ref_seq_dif       
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
2 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
3 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
4 5 'Structure model' '_chem_comp.name'                     
5 5 'Structure model' '_database_2.pdbx_DOI'                
6 5 'Structure model' '_database_2.pdbx_database_accession' 
7 5 'Structure model' '_entity.pdbx_description'            
8 5 'Structure model' '_pdbx_entity_nonpoly.name'           
9 5 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 27.3324 11.9992 16.7786 -.1950 -.2579 -.0861 .0039 -.0006 .0175  1.1757 .9733  2.6937 -.0020 -.0015 -.4087 -.0297 
.0045  -.0525 -.0502 .0144  .0593 .1944  -.1367 .0154  'X-RAY DIFFRACTION' 
2 ? refined 47.6170 51.0107 40.7428 -.1611 -.1549 -.0728 .0378 .0335  -.0675 1.0065 1.3587 3.1793 .1303  -.2451 .5671  .1189  
-.0607 .0628  -.1553 -.1108 .0385 -.2121 -.0828 -.0081 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 1 A 1 A 542 A 542 ? 'X-RAY DIFFRACTION' ? 
2 2 B 4 B 4 B 543 B 543 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0019 ? 1 
ADSC      'data collection' .        ? 2 
DENZO     'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 71.57   -13.62  
2  1 PRO A 104 ? ? -49.61  155.11  
3  1 PHE A 158 ? ? -140.59 -3.62   
4  1 ALA A 167 ? ? -153.80 72.89   
5  1 ALA A 203 ? ? 56.87   -124.43 
6  1 ASP A 306 ? ? -121.18 -78.96  
7  1 VAL A 407 ? ? -122.31 -62.14  
8  1 SER A 541 ? ? -69.12  8.75    
9  1 PHE B 47  ? ? 73.19   -1.00   
10 1 ALA B 167 ? ? -158.25 72.14   
11 1 ALA B 203 ? ? 62.00   -127.94 
12 1 ASP B 306 ? ? -135.85 -79.21  
13 1 ASP B 323 ? ? -102.37 41.70   
14 1 VAL B 407 ? ? -130.06 -63.92  
15 1 PRO B 458 ? ? -55.21  -9.63   
16 1 SER B 495 ? ? -77.89  -110.59 
17 1 LYS B 496 ? ? 39.44   112.75  
18 1 SER B 541 ? ? -75.55  42.56   
19 1 ALA B 542 ? ? -171.79 1.07    
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 496 ? CG  ? A LYS 496 CG  
2  1 Y 1 A LYS 496 ? CD  ? A LYS 496 CD  
3  1 Y 1 A LYS 496 ? CE  ? A LYS 496 CE  
4  1 Y 1 A LYS 496 ? NZ  ? A LYS 496 NZ  
5  1 Y 1 B ARG 493 ? CG  ? B ARG 493 CG  
6  1 Y 1 B ARG 493 ? CD  ? B ARG 493 CD  
7  1 Y 1 B ARG 493 ? NE  ? B ARG 493 NE  
8  1 Y 1 B ARG 493 ? CZ  ? B ARG 493 CZ  
9  1 Y 1 B ARG 493 ? NH1 ? B ARG 493 NH1 
10 1 Y 1 B ARG 493 ? NH2 ? B ARG 493 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 259 ? A PRO 259 
2  1 Y 1 A GLY 260 ? A GLY 260 
3  1 Y 1 A GLY 261 ? A GLY 261 
4  1 Y 1 A ALA 262 ? A ALA 262 
5  1 Y 1 A GLY 263 ? A GLY 263 
6  1 Y 1 A GLY 264 ? A GLY 264 
7  1 Y 1 A THR 543 ? A THR 543 
8  1 Y 1 B GLU 1   ? B GLU 1   
9  1 Y 1 B GLY 2   ? B GLY 2   
10 1 Y 1 B ARG 3   ? B ARG 3   
11 1 Y 1 B PRO 259 ? B PRO 259 
12 1 Y 1 B GLY 260 ? B GLY 260 
13 1 Y 1 B GLY 261 ? B GLY 261 
14 1 Y 1 B ALA 262 ? B ALA 262 
15 1 Y 1 B GLY 263 ? B GLY 263 
16 1 Y 1 B GLY 264 ? B GLY 264 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'IODIDE ION'                                      IOD 
3 '2-(TRIMETHYLAMMONIUM)ETHYL THIOL'                ETM 
4 'butanoic acid'                                   BUA 
5 '2-(BUTYRYLSULFANYL)-N,N,N-TRIMETHYLETHANAMINIUM' BCH 
6 'HEXAETHYLENE GLYCOL'                             P6G 
7 water                                             HOH 
#