data_2HAZ
# 
_entry.id   2HAZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HAZ         
RCSB  RCSB038148   
WWPDB D_1000038148 
# 
_pdbx_database_status.entry_id                        2HAZ 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-06-13 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sekulic, N.' 1 
'Lavie, A.'   2 
# 
_citation.id                        primary 
_citation.title                     
;A novel alpha-helix in the first fibronectin type III repeat of the neural cell adhesion molecule is critical for N-glycan polysialylation.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                36052 
_citation.page_last                 36059 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17003032 
_citation.pdbx_database_id_DOI      10.1074/jbc.M608073200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mendiratta, S.S.'       1 
primary 'Sekulic, N.'            2 
primary 'Hernandez-Guzman, F.G.' 3 
primary 'Close, B.E.'            4 
primary 'Lavie, A.'              5 
primary 'Colley, K.J.'           6 
# 
_cell.entry_id           2HAZ 
_cell.length_a           42.760 
_cell.length_b           53.880 
_cell.length_c           74.070 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HAZ 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Neural cell adhesion molecule 1' 11365.625 1  ? ? 'first fibronectin type III repeat domain' ? 
2 non-polymer syn 'SODIUM ION'                      22.990    1  ? ? ?                                          ? 
3 water       nat water                             18.015    97 ? ? ?                                          ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'N-CAM 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMDTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYA
VRLAALNGKGLGEISAASEFKTQPV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMDTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYA
VRLAALNGKGLGEISAASEFKTQPV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   ASP n 
1 6   THR n 
1 7   PRO n 
1 8   SER n 
1 9   SER n 
1 10  PRO n 
1 11  SER n 
1 12  ILE n 
1 13  ASP n 
1 14  GLN n 
1 15  VAL n 
1 16  GLU n 
1 17  PRO n 
1 18  TYR n 
1 19  SER n 
1 20  SER n 
1 21  THR n 
1 22  ALA n 
1 23  GLN n 
1 24  VAL n 
1 25  GLN n 
1 26  PHE n 
1 27  ASP n 
1 28  GLU n 
1 29  PRO n 
1 30  GLU n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  PRO n 
1 37  ILE n 
1 38  LEU n 
1 39  LYS n 
1 40  TYR n 
1 41  LYS n 
1 42  ALA n 
1 43  GLU n 
1 44  TRP n 
1 45  ARG n 
1 46  ALA n 
1 47  VAL n 
1 48  GLY n 
1 49  GLU n 
1 50  GLU n 
1 51  VAL n 
1 52  TRP n 
1 53  HIS n 
1 54  SER n 
1 55  LYS n 
1 56  TRP n 
1 57  TYR n 
1 58  ASP n 
1 59  ALA n 
1 60  LYS n 
1 61  GLU n 
1 62  ALA n 
1 63  SER n 
1 64  MET n 
1 65  GLU n 
1 66  GLY n 
1 67  ILE n 
1 68  VAL n 
1 69  THR n 
1 70  ILE n 
1 71  VAL n 
1 72  GLY n 
1 73  LEU n 
1 74  LYS n 
1 75  PRO n 
1 76  GLU n 
1 77  THR n 
1 78  THR n 
1 79  TYR n 
1 80  ALA n 
1 81  VAL n 
1 82  ARG n 
1 83  LEU n 
1 84  ALA n 
1 85  ALA n 
1 86  LEU n 
1 87  ASN n 
1 88  GLY n 
1 89  LYS n 
1 90  GLY n 
1 91  LEU n 
1 92  GLY n 
1 93  GLU n 
1 94  ILE n 
1 95  SER n 
1 96  ALA n 
1 97  ALA n 
1 98  SER n 
1 99  GLU n 
1 100 PHE n 
1 101 LYS n 
1 102 THR n 
1 103 GLN n 
1 104 PRO n 
1 105 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 NCAM1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Bl21-DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET14b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NCA12_HUMAN 
_struct_ref.pdbx_db_accession          P13592 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLA
ALNGKGLGEISAASEFKTQPV
;
_struct_ref.pdbx_align_begin           498 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2HAZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 105 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P13592 
_struct_ref_seq.db_align_beg                  498 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  598 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       485 
_struct_ref_seq.pdbx_auth_seq_align_end       589 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2HAZ GLY A 1 ? UNP P13592 ? ? 'CLONING ARTIFACT' 485 1 
1 2HAZ SER A 2 ? UNP P13592 ? ? 'CLONING ARTIFACT' 486 2 
1 2HAZ HIS A 3 ? UNP P13592 ? ? 'CLONING ARTIFACT' 487 3 
1 2HAZ MET A 4 ? UNP P13592 ? ? 'CLONING ARTIFACT' 488 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2HAZ 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      1.90 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   35.19 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.1 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;0.3 M Calcium chloride, 17% PEG 3350, 10% PEG 400 (the latter only in the drop), pH 5.1, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2005-04-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9766 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9766 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
# 
_reflns.entry_id                     2HAZ 
_reflns.d_resolution_high            1.69 
_reflns.number_obs                   9851 
_reflns.pdbx_Rmerge_I_obs            0.095 
_reflns.pdbx_netI_over_sigmaI        12.88 
_reflns.percent_possible_obs         99.0 
_reflns.B_iso_Wilson_estimate        25.195 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_low             30 
_reflns.number_all                   9851 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_redundancy              7.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.69 
_reflns_shell.d_res_low              1.79 
_reflns_shell.number_measured_obs    9770 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.487 
_reflns_shell.meanI_over_sigI_obs    3.1 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1500 
_reflns_shell.percent_possible_all   94.4 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2HAZ 
_refine.ls_d_res_high                            1.700 
_refine.ls_d_res_low                             20.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.690 
_refine.ls_number_reflns_obs                     9694 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_all                          0.219 
_refine.ls_R_factor_R_work                       0.212 
_refine.ls_R_factor_R_free                       0.286 
_refine.ls_percent_reflns_R_free                 9.700 
_refine.ls_number_reflns_R_free                  941 
_refine.B_iso_mean                               19.456 
_refine.aniso_B[1][1]                            0.860 
_refine.aniso_B[2][2]                            -1.890 
_refine.aniso_B[3][3]                            1.030 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.943 
_refine.correlation_coeff_Fo_to_Fc_free          0.906 
_refine.pdbx_overall_ESU_R                       0.155 
_refine.pdbx_overall_ESU_R_Free                  0.161 
_refine.overall_SU_ML                            0.121 
_refine.overall_SU_B                             3.705 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     9694 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB Entry: 1UEM' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        793 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             97 
_refine_hist.number_atoms_total               891 
_refine_hist.d_res_high                       1.700 
_refine_hist.d_res_low                        20.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             813  0.010  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1109 1.286  1.955  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       103  6.978  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33   41.430 25.455 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       128  13.360 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       2    11.776 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr               122  0.082  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         622  0.005  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined                327  0.215  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              549  0.296  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        71   0.202  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          3    0.054  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       62   0.305  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     23   0.345  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined 1    0.010  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it                  519  0.652  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 836  1.189  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it                  312  1.957  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it                 273  3.306  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.700 
_refine_ls_shell.d_res_low                        1.744 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               100.000 
_refine_ls_shell.number_reflns_R_work             640 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.298 
_refine_ls_shell.R_factor_R_free                  0.431 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             68 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                708 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2HAZ 
_struct.title                     'Crystal structure of the first fibronectin domain of human NCAM1' 
_struct.pdbx_descriptor           'Neural cell adhesion molecule 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HAZ 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            'fibronectin type III repeat, FN1, NCAM, beta sandwich, CELL ADHESION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ALA 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        59 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLY 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        66 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ALA 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         543 
_struct_conf.end_auth_comp_id        GLY 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         550 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   8 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B NA  .  NA  ? ? ? 1_555 A ASP 27 OD1 ? ? A NA  101 A ASP 511 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc2 metalc ? ? B NA  .  NA  ? ? ? 1_555 A ASP 27 OD2 ? ? A NA  101 A ASP 511 1_555 ? ? ? ? ? ? ? 2.384 ? 
metalc3 metalc ? ? B NA  .  NA  ? ? ? 1_555 A ASP 13 OD2 ? ? A NA  101 A ASP 497 1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc4 metalc ? ? B NA  .  NA  ? ? ? 1_555 A GLU 61 OE1 ? ? A NA  101 A GLU 545 8_456 ? ? ? ? ? ? ? 2.457 ? 
metalc5 metalc ? ? B NA  .  NA  ? ? ? 1_555 A GLU 61 OE2 ? ? A NA  101 A GLU 545 8_456 ? ? ? ? ? ? ? 2.399 ? 
metalc6 metalc ? ? A ASP 13 OD1 ? ? ? 1_555 B NA  .  NA  ? ? A ASP 497 A NA  101 1_555 ? ? ? ? ? ? ? 2.621 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 11 ? PRO A 17  ? SER A 495 PRO A 501 
A 2 ALA A 22 ? ASP A 27  ? ALA A 506 ASP A 511 
A 3 ILE A 67 ? ILE A 70  ? ILE A 551 ILE A 554 
B 1 HIS A 53 ? ASP A 58  ? HIS A 537 ASP A 542 
B 2 LYS A 39 ? ALA A 46  ? LYS A 523 ALA A 530 
B 3 THR A 78 ? ASN A 87  ? THR A 562 ASN A 571 
B 4 GLY A 90 ? LEU A 91  ? GLY A 574 LEU A 575 
C 1 HIS A 53 ? ASP A 58  ? HIS A 537 ASP A 542 
C 2 LYS A 39 ? ALA A 46  ? LYS A 523 ALA A 530 
C 3 THR A 78 ? ASN A 87  ? THR A 562 ASN A 571 
C 4 SER A 98 ? LYS A 101 ? SER A 582 LYS A 585 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 14 ? N GLN A 498 O GLN A 25  ? O GLN A 509 
A 2 3 N VAL A 24 ? N VAL A 508 O VAL A 68  ? O VAL A 552 
B 1 2 O HIS A 53 ? O HIS A 537 N TRP A 44  ? N TRP A 528 
B 2 3 N LYS A 41 ? N LYS A 525 O ALA A 84  ? O ALA A 568 
B 3 4 N ASN A 87 ? N ASN A 571 O GLY A 90  ? O GLY A 574 
C 1 2 O HIS A 53 ? O HIS A 537 N TRP A 44  ? N TRP A 528 
C 2 3 N LYS A 41 ? N LYS A 525 O ALA A 84  ? O ALA A 568 
C 3 4 N TYR A 79 ? N TYR A 563 O PHE A 100 ? O PHE A 584 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE NA A 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ASP A 13 ? ASP A 497 . ? 1_555 ? 
2 AC1 4 ASP A 27 ? ASP A 511 . ? 1_555 ? 
3 AC1 4 ASP A 58 ? ASP A 542 . ? 8_456 ? 
4 AC1 4 GLU A 61 ? GLU A 545 . ? 8_456 ? 
# 
_atom_sites.entry_id                    2HAZ 
_atom_sites.fract_transf_matrix[1][1]   0.023386 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018560 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013501 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . SER A 1 2   ? 18.099 -12.778 26.135 1.00 34.04 ? 486 SER A N   1 
ATOM   2   C  CA  . SER A 1 2   ? 19.555 -12.751 26.480 1.00 33.73 ? 486 SER A CA  1 
ATOM   3   C  C   . SER A 1 2   ? 20.149 -11.337 26.454 1.00 33.56 ? 486 SER A C   1 
ATOM   4   O  O   . SER A 1 2   ? 21.270 -11.122 26.912 1.00 33.65 ? 486 SER A O   1 
ATOM   5   C  CB  . SER A 1 2   ? 20.337 -13.681 25.557 1.00 33.50 ? 486 SER A CB  1 
ATOM   6   N  N   . HIS A 1 3   ? 19.395 -10.370 25.940 1.00 33.24 ? 487 HIS A N   1 
ATOM   7   C  CA  . HIS A 1 3   ? 19.935 -9.030  25.771 1.00 32.68 ? 487 HIS A CA  1 
ATOM   8   C  C   . HIS A 1 3   ? 18.992 -7.910  26.206 1.00 32.08 ? 487 HIS A C   1 
ATOM   9   O  O   . HIS A 1 3   ? 17.799 -7.914  25.889 1.00 32.09 ? 487 HIS A O   1 
ATOM   10  C  CB  . HIS A 1 3   ? 20.389 -8.816  24.332 1.00 32.97 ? 487 HIS A CB  1 
ATOM   11  C  CG  . HIS A 1 3   ? 21.716 -8.137  24.219 1.00 33.45 ? 487 HIS A CG  1 
ATOM   12  N  ND1 . HIS A 1 3   ? 22.866 -8.662  24.768 1.00 34.28 ? 487 HIS A ND1 1 
ATOM   13  C  CD2 . HIS A 1 3   ? 22.080 -6.987  23.604 1.00 34.80 ? 487 HIS A CD2 1 
ATOM   14  C  CE1 . HIS A 1 3   ? 23.880 -7.856  24.508 1.00 35.36 ? 487 HIS A CE1 1 
ATOM   15  N  NE2 . HIS A 1 3   ? 23.434 -6.836  23.795 1.00 34.16 ? 487 HIS A NE2 1 
ATOM   16  N  N   . MET A 1 4   ? 19.570 -6.961  26.939 1.00 31.29 ? 488 MET A N   1 
ATOM   17  C  CA  . MET A 1 4   ? 18.894 -5.768  27.408 1.00 30.09 ? 488 MET A CA  1 
ATOM   18  C  C   . MET A 1 4   ? 18.709 -4.844  26.232 1.00 28.83 ? 488 MET A C   1 
ATOM   19  O  O   . MET A 1 4   ? 19.506 -4.858  25.294 1.00 28.45 ? 488 MET A O   1 
ATOM   20  C  CB  . MET A 1 4   ? 19.770 -5.049  28.434 1.00 30.88 ? 488 MET A CB  1 
ATOM   21  C  CG  . MET A 1 4   ? 20.589 -5.959  29.374 1.00 33.48 ? 488 MET A CG  1 
ATOM   22  S  SD  . MET A 1 4   ? 21.637 -7.254  28.626 1.00 39.59 ? 488 MET A SD  1 
ATOM   23  C  CE  . MET A 1 4   ? 22.892 -6.311  27.795 1.00 34.96 ? 488 MET A CE  1 
ATOM   24  N  N   . ASP A 1 5   ? 17.663 -4.027  26.263 1.00 27.06 ? 489 ASP A N   1 
ATOM   25  C  CA  . ASP A 1 5   ? 17.608 -2.957  25.281 1.00 25.16 ? 489 ASP A CA  1 
ATOM   26  C  C   . ASP A 1 5   ? 17.697 -1.565  25.893 1.00 23.30 ? 489 ASP A C   1 
ATOM   27  O  O   . ASP A 1 5   ? 17.872 -1.395  27.097 1.00 21.20 ? 489 ASP A O   1 
ATOM   28  C  CB  . ASP A 1 5   ? 16.428 -3.108  24.313 1.00 25.80 ? 489 ASP A CB  1 
ATOM   29  C  CG  . ASP A 1 5   ? 15.155 -3.538  24.987 1.00 26.28 ? 489 ASP A CG  1 
ATOM   30  O  OD1 . ASP A 1 5   ? 14.511 -4.491  24.484 1.00 26.94 ? 489 ASP A OD1 1 
ATOM   31  O  OD2 . ASP A 1 5   ? 14.790 -2.922  26.002 1.00 26.91 ? 489 ASP A OD2 1 
ATOM   32  N  N   . THR A 1 6   ? 17.614 -0.577  25.016 1.00 21.63 ? 490 THR A N   1 
ATOM   33  C  CA  . THR A 1 6   ? 17.582 0.821   25.393 1.00 20.24 ? 490 THR A CA  1 
ATOM   34  C  C   . THR A 1 6   ? 16.237 1.124   26.102 1.00 19.71 ? 490 THR A C   1 
ATOM   35  O  O   . THR A 1 6   ? 15.286 0.339   25.968 1.00 19.99 ? 490 THR A O   1 
ATOM   36  C  CB  . THR A 1 6   ? 17.763 1.666   24.124 1.00 19.67 ? 490 THR A CB  1 
ATOM   37  O  OG1 . THR A 1 6   ? 16.899 1.153   23.100 1.00 19.96 ? 490 THR A OG1 1 
ATOM   38  C  CG2 . THR A 1 6   ? 19.204 1.578   23.633 1.00 19.42 ? 490 THR A CG2 1 
ATOM   39  N  N   . PRO A 1 7   ? 16.159 2.232   26.881 1.00 19.21 ? 491 PRO A N   1 
ATOM   40  C  CA  . PRO A 1 7   ? 14.941 2.591   27.632 1.00 18.68 ? 491 PRO A CA  1 
ATOM   41  C  C   . PRO A 1 7   ? 13.715 2.934   26.780 1.00 18.31 ? 491 PRO A C   1 
ATOM   42  O  O   . PRO A 1 7   ? 13.839 3.319   25.604 1.00 18.44 ? 491 PRO A O   1 
ATOM   43  C  CB  . PRO A 1 7   ? 15.371 3.829   28.426 1.00 19.09 ? 491 PRO A CB  1 
ATOM   44  C  CG  . PRO A 1 7   ? 16.864 3.771   28.464 1.00 19.32 ? 491 PRO A CG  1 
ATOM   45  C  CD  . PRO A 1 7   ? 17.241 3.202   27.136 1.00 18.81 ? 491 PRO A CD  1 
ATOM   46  N  N   . SER A 1 8   ? 12.534 2.814   27.374 1.00 17.47 ? 492 SER A N   1 
ATOM   47  C  CA  . SER A 1 8   ? 11.328 3.301   26.714 1.00 18.15 ? 492 SER A CA  1 
ATOM   48  C  C   . SER A 1 8   ? 11.306 4.820   26.886 1.00 17.97 ? 492 SER A C   1 
ATOM   49  O  O   . SER A 1 8   ? 12.213 5.387   27.515 1.00 17.95 ? 492 SER A O   1 
ATOM   50  C  CB  . SER A 1 8   ? 10.059 2.665   27.299 1.00 17.95 ? 492 SER A CB  1 
ATOM   51  O  OG  . SER A 1 8   ? 9.851  3.083   28.635 1.00 18.46 ? 492 SER A OG  1 
ATOM   52  N  N   . SER A 1 9   ? 10.279 5.476   26.351 1.00 18.63 ? 493 SER A N   1 
ATOM   53  C  CA  . SER A 1 9   ? 10.302 6.943   26.282 1.00 18.90 ? 493 SER A CA  1 
ATOM   54  C  C   . SER A 1 9   ? 9.943  7.584   27.608 1.00 19.11 ? 493 SER A C   1 
ATOM   55  O  O   . SER A 1 9   ? 9.074  7.067   28.325 1.00 19.09 ? 493 SER A O   1 
ATOM   56  C  CB  . SER A 1 9   ? 9.389  7.462   25.177 1.00 19.55 ? 493 SER A CB  1 
ATOM   57  O  OG  . SER A 1 9   ? 8.059  7.051   25.388 1.00 21.60 ? 493 SER A OG  1 
ATOM   58  N  N   . PRO A 1 10  ? 10.618 8.701   27.945 1.00 18.59 ? 494 PRO A N   1 
ATOM   59  C  CA  . PRO A 1 10  ? 10.153 9.537   29.049 1.00 18.41 ? 494 PRO A CA  1 
ATOM   60  C  C   . PRO A 1 10  ? 8.842  10.198  28.630 1.00 18.24 ? 494 PRO A C   1 
ATOM   61  O  O   . PRO A 1 10  ? 8.504  10.180  27.443 1.00 17.30 ? 494 PRO A O   1 
ATOM   62  C  CB  . PRO A 1 10  ? 11.272 10.577  29.209 1.00 18.13 ? 494 PRO A CB  1 
ATOM   63  C  CG  . PRO A 1 10  ? 12.427 10.044  28.439 1.00 18.56 ? 494 PRO A CG  1 
ATOM   64  C  CD  . PRO A 1 10  ? 11.843 9.251   27.334 1.00 18.00 ? 494 PRO A CD  1 
ATOM   65  N  N   . SER A 1 11  ? 8.104  10.741  29.595 1.00 17.86 ? 495 SER A N   1 
ATOM   66  C  CA  . SER A 1 11  ? 6.888  11.507  29.304 1.00 19.35 ? 495 SER A CA  1 
ATOM   67  C  C   . SER A 1 11  ? 7.102  12.929  29.770 1.00 18.74 ? 495 SER A C   1 
ATOM   68  O  O   . SER A 1 11  ? 7.542  13.126  30.889 1.00 19.07 ? 495 SER A O   1 
ATOM   69  C  CB  . SER A 1 11  ? 5.682  10.936  30.071 1.00 19.40 ? 495 SER A CB  1 
ATOM   70  O  OG  . SER A 1 11  ? 5.132  9.813   29.424 1.00 22.57 ? 495 SER A OG  1 
ATOM   71  N  N   . ILE A 1 12  ? 6.771  13.907  28.926 1.00 18.92 ? 496 ILE A N   1 
ATOM   72  C  CA  . ILE A 1 12  ? 6.762  15.319  29.339 1.00 18.37 ? 496 ILE A CA  1 
ATOM   73  C  C   . ILE A 1 12  ? 5.379  15.705  29.889 1.00 18.87 ? 496 ILE A C   1 
ATOM   74  O  O   . ILE A 1 12  ? 4.363  15.608  29.198 1.00 19.01 ? 496 ILE A O   1 
ATOM   75  C  CB  . ILE A 1 12  ? 7.214  16.285  28.200 1.00 18.27 ? 496 ILE A CB  1 
ATOM   76  C  CG1 . ILE A 1 12  ? 8.668  16.003  27.766 1.00 18.12 ? 496 ILE A CG1 1 
ATOM   77  C  CG2 . ILE A 1 12  ? 7.076  17.745  28.641 1.00 17.26 ? 496 ILE A CG2 1 
ATOM   78  C  CD1 . ILE A 1 12  ? 9.140  16.767  26.506 1.00 17.55 ? 496 ILE A CD1 1 
ATOM   79  N  N   . ASP A 1 13  ? 5.348  16.122  31.148 1.00 19.33 ? 497 ASP A N   1 
ATOM   80  C  CA  . ASP A 1 13  ? 4.113  16.541  31.795 1.00 20.16 ? 497 ASP A CA  1 
ATOM   81  C  C   . ASP A 1 13  ? 3.726  17.967  31.398 1.00 19.98 ? 497 ASP A C   1 
ATOM   82  O  O   . ASP A 1 13  ? 2.643  18.193  30.834 1.00 19.94 ? 497 ASP A O   1 
ATOM   83  C  CB  . ASP A 1 13  ? 4.223  16.390  33.314 1.00 20.02 ? 497 ASP A CB  1 
ATOM   84  C  CG  . ASP A 1 13  ? 4.066  14.935  33.771 1.00 22.51 ? 497 ASP A CG  1 
ATOM   85  O  OD1 . ASP A 1 13  ? 4.023  14.021  32.915 1.00 23.23 ? 497 ASP A OD1 1 
ATOM   86  O  OD2 . ASP A 1 13  ? 3.971  14.695  34.993 1.00 23.10 ? 497 ASP A OD2 1 
ATOM   87  N  N   . GLN A 1 14  ? 4.617  18.913  31.683 1.00 19.76 ? 498 GLN A N   1 
ATOM   88  C  CA  . GLN A 1 14  ? 4.456  20.305  31.271 1.00 19.78 ? 498 GLN A CA  1 
ATOM   89  C  C   . GLN A 1 14  ? 5.809  20.995  31.174 1.00 19.25 ? 498 GLN A C   1 
ATOM   90  O  O   . GLN A 1 14  ? 6.816  20.489  31.683 1.00 18.29 ? 498 GLN A O   1 
ATOM   91  C  CB  . GLN A 1 14  ? 3.548  21.078  32.239 1.00 20.67 ? 498 GLN A CB  1 
ATOM   92  C  CG  . GLN A 1 14  ? 4.110  21.228  33.646 1.00 23.89 ? 498 GLN A CG  1 
ATOM   93  C  CD  . GLN A 1 14  ? 3.190  22.014  34.547 1.00 27.39 ? 498 GLN A CD  1 
ATOM   94  O  OE1 . GLN A 1 14  ? 2.082  21.571  34.853 1.00 30.54 ? 498 GLN A OE1 1 
ATOM   95  N  NE2 . GLN A 1 14  ? 3.642  23.183  34.985 1.00 29.71 ? 498 GLN A NE2 1 
ATOM   96  N  N   . VAL A 1 15  ? 5.814  22.147  30.508 1.00 17.41 ? 499 VAL A N   1 
ATOM   97  C  CA  . VAL A 1 15  ? 6.992  22.987  30.421 1.00 16.72 ? 499 VAL A CA  1 
ATOM   98  C  C   . VAL A 1 15  ? 6.658  24.372  30.977 1.00 17.33 ? 499 VAL A C   1 
ATOM   99  O  O   . VAL A 1 15  ? 5.670  24.995  30.563 1.00 17.59 ? 499 VAL A O   1 
ATOM   100 C  CB  . VAL A 1 15  ? 7.457  23.124  28.968 1.00 16.11 ? 499 VAL A CB  1 
ATOM   101 C  CG1 . VAL A 1 15  ? 8.726  23.969  28.902 1.00 15.07 ? 499 VAL A CG1 1 
ATOM   102 C  CG2 . VAL A 1 15  ? 7.643  21.735  28.326 1.00 14.24 ? 499 VAL A CG2 1 
ATOM   103 N  N   . GLU A 1 16  ? 7.443  24.834  31.938 1.00 17.82 ? 500 GLU A N   1 
ATOM   104 C  CA  . GLU A 1 16  ? 7.235  26.162  32.493 1.00 18.02 ? 500 GLU A CA  1 
ATOM   105 C  C   . GLU A 1 16  ? 8.296  27.066  31.897 1.00 17.46 ? 500 GLU A C   1 
ATOM   106 O  O   . GLU A 1 16  ? 9.463  27.012  32.295 1.00 16.86 ? 500 GLU A O   1 
ATOM   107 C  CB  . GLU A 1 16  ? 7.297  26.167  34.024 1.00 18.20 ? 500 GLU A CB  1 
ATOM   108 C  CG  . GLU A 1 16  ? 6.389  25.146  34.692 1.00 22.34 ? 500 GLU A CG  1 
ATOM   109 C  CD  . GLU A 1 16  ? 6.969  24.607  35.991 1.00 28.09 ? 500 GLU A CD  1 
ATOM   110 O  OE1 . GLU A 1 16  ? 7.538  23.489  35.961 1.00 30.56 ? 500 GLU A OE1 1 
ATOM   111 O  OE2 . GLU A 1 16  ? 6.883  25.297  37.044 1.00 30.03 ? 500 GLU A OE2 1 
ATOM   112 N  N   . PRO A 1 17  ? 7.904  27.873  30.901 1.00 16.79 ? 501 PRO A N   1 
ATOM   113 C  CA  . PRO A 1 17  ? 8.859  28.760  30.275 1.00 17.30 ? 501 PRO A CA  1 
ATOM   114 C  C   . PRO A 1 17  ? 8.994  30.118  30.951 1.00 17.55 ? 501 PRO A C   1 
ATOM   115 O  O   . PRO A 1 17  ? 8.025  30.663  31.501 1.00 17.65 ? 501 PRO A O   1 
ATOM   116 C  CB  . PRO A 1 17  ? 8.295  28.922  28.857 1.00 17.26 ? 501 PRO A CB  1 
ATOM   117 C  CG  . PRO A 1 17  ? 6.802  28.830  29.058 1.00 16.41 ? 501 PRO A CG  1 
ATOM   118 C  CD  . PRO A 1 17  ? 6.570  27.955  30.267 1.00 17.09 ? 501 PRO A CD  1 
ATOM   119 N  N   . TYR A 1 18  ? 10.207 30.641  30.895 1.00 17.61 ? 502 TYR A N   1 
ATOM   120 C  CA  . TYR A 1 18  ? 10.465 32.033  31.191 1.00 18.74 ? 502 TYR A CA  1 
ATOM   121 C  C   . TYR A 1 18  ? 10.891 32.732  29.895 1.00 18.83 ? 502 TYR A C   1 
ATOM   122 O  O   . TYR A 1 18  ? 10.336 32.436  28.821 1.00 18.96 ? 502 TYR A O   1 
ATOM   123 C  CB  . TYR A 1 18  ? 11.485 32.135  32.338 1.00 19.01 ? 502 TYR A CB  1 
ATOM   124 C  CG  . TYR A 1 18  ? 10.917 31.446  33.541 1.00 19.87 ? 502 TYR A CG  1 
ATOM   125 C  CD1 . TYR A 1 18  ? 9.968  32.087  34.343 1.00 21.74 ? 502 TYR A CD1 1 
ATOM   126 C  CD2 . TYR A 1 18  ? 11.235 30.120  33.821 1.00 22.13 ? 502 TYR A CD2 1 
ATOM   127 C  CE1 . TYR A 1 18  ? 9.387  31.442  35.421 1.00 23.14 ? 502 TYR A CE1 1 
ATOM   128 C  CE2 . TYR A 1 18  ? 10.661 29.467  34.902 1.00 21.97 ? 502 TYR A CE2 1 
ATOM   129 C  CZ  . TYR A 1 18  ? 9.741  30.140  35.689 1.00 22.47 ? 502 TYR A CZ  1 
ATOM   130 O  OH  . TYR A 1 18  ? 9.178  29.513  36.761 1.00 23.05 ? 502 TYR A OH  1 
ATOM   131 N  N   . SER A 1 19  ? 11.880 33.617  29.970 1.00 19.20 ? 503 SER A N   1 
ATOM   132 C  CA  . SER A 1 19  ? 12.265 34.417  28.811 1.00 19.42 ? 503 SER A CA  1 
ATOM   133 C  C   . SER A 1 19  ? 13.256 33.727  27.902 1.00 19.15 ? 503 SER A C   1 
ATOM   134 O  O   . SER A 1 19  ? 13.054 33.672  26.694 1.00 19.64 ? 503 SER A O   1 
ATOM   135 C  CB  . SER A 1 19  ? 12.774 35.809  29.225 1.00 19.59 ? 503 SER A CB  1 
ATOM   136 O  OG  . SER A 1 19  ? 11.676 36.595  29.641 1.00 22.00 ? 503 SER A OG  1 
ATOM   137 N  N   . SER A 1 20  ? 14.331 33.212  28.487 1.00 19.01 ? 504 SER A N   1 
ATOM   138 C  CA  . SER A 1 20  ? 15.394 32.569  27.722 1.00 18.20 ? 504 SER A CA  1 
ATOM   139 C  C   . SER A 1 20  ? 15.654 31.125  28.211 1.00 17.32 ? 504 SER A C   1 
ATOM   140 O  O   . SER A 1 20  ? 16.576 30.455  27.738 1.00 16.62 ? 504 SER A O   1 
ATOM   141 C  CB  . SER A 1 20  ? 16.663 33.413  27.809 1.00 18.55 ? 504 SER A CB  1 
ATOM   142 O  OG  . SER A 1 20  ? 17.178 33.410  29.138 1.00 18.70 ? 504 SER A OG  1 
ATOM   143 N  N   . THR A 1 21  ? 14.842 30.675  29.167 1.00 16.92 ? 505 THR A N   1 
ATOM   144 C  CA  . THR A 1 21  ? 14.971 29.339  29.770 1.00 16.86 ? 505 THR A CA  1 
ATOM   145 C  C   . THR A 1 21  ? 13.593 28.706  29.996 1.00 16.46 ? 505 THR A C   1 
ATOM   146 O  O   . THR A 1 21  ? 12.564 29.386  29.938 1.00 16.08 ? 505 THR A O   1 
ATOM   147 C  CB  . THR A 1 21  ? 15.731 29.362  31.133 1.00 16.99 ? 505 THR A CB  1 
ATOM   148 O  OG1 . THR A 1 21  ? 14.941 30.022  32.130 1.00 16.51 ? 505 THR A OG1 1 
ATOM   149 C  CG2 . THR A 1 21  ? 17.114 30.034  31.029 1.00 18.61 ? 505 THR A CG2 1 
ATOM   150 N  N   . ALA A 1 22  ? 13.577 27.401  30.263 1.00 16.05 ? 506 ALA A N   1 
ATOM   151 C  CA  . ALA A 1 22  ? 12.335 26.681  30.522 1.00 15.71 ? 506 ALA A CA  1 
ATOM   152 C  C   . ALA A 1 22  ? 12.607 25.444  31.368 1.00 15.85 ? 506 ALA A C   1 
ATOM   153 O  O   . ALA A 1 22  ? 13.652 24.778  31.202 1.00 15.36 ? 506 ALA A O   1 
ATOM   154 C  CB  . ALA A 1 22  ? 11.651 26.289  29.225 1.00 14.84 ? 506 ALA A CB  1 
ATOM   155 N  N   . GLN A 1 23  ? 11.682 25.163  32.281 1.00 16.36 ? 507 GLN A N   1 
ATOM   156 C  CA  . GLN A 1 23  ? 11.733 23.955  33.108 1.00 15.99 ? 507 GLN A CA  1 
ATOM   157 C  C   . GLN A 1 23  ? 10.842 22.864  32.511 1.00 15.75 ? 507 GLN A C   1 
ATOM   158 O  O   . GLN A 1 23  ? 9.617  23.024  32.405 1.00 14.95 ? 507 GLN A O   1 
ATOM   159 C  CB  . GLN A 1 23  ? 11.324 24.253  34.560 1.00 16.81 ? 507 GLN A CB  1 
ATOM   160 C  CG  . GLN A 1 23  ? 11.835 25.580  35.144 1.00 18.42 ? 507 GLN A CG  1 
ATOM   161 C  CD  . GLN A 1 23  ? 13.285 25.529  35.518 1.00 23.05 ? 507 GLN A CD  1 
ATOM   162 O  OE1 . GLN A 1 23  ? 13.650 25.026  36.586 1.00 26.74 ? 507 GLN A OE1 1 
ATOM   163 N  NE2 . GLN A 1 23  ? 14.133 26.067  34.656 1.00 24.07 ? 507 GLN A NE2 1 
ATOM   164 N  N   . VAL A 1 24  ? 11.456 21.752  32.117 1.00 15.47 ? 508 VAL A N   1 
ATOM   165 C  CA  . VAL A 1 24  ? 10.722 20.675  31.457 1.00 15.66 ? 508 VAL A CA  1 
ATOM   166 C  C   . VAL A 1 24  ? 10.389 19.638  32.529 1.00 15.85 ? 508 VAL A C   1 
ATOM   167 O  O   . VAL A 1 24  ? 11.284 18.987  33.069 1.00 15.22 ? 508 VAL A O   1 
ATOM   168 C  CB  . VAL A 1 24  ? 11.519 20.061  30.254 1.00 15.20 ? 508 VAL A CB  1 
ATOM   169 C  CG1 . VAL A 1 24  ? 10.749 18.929  29.597 1.00 14.74 ? 508 VAL A CG1 1 
ATOM   170 C  CG2 . VAL A 1 24  ? 11.874 21.137  29.191 1.00 15.56 ? 508 VAL A CG2 1 
ATOM   171 N  N   . GLN A 1 25  ? 9.103  19.510  32.859 1.00 16.38 ? 509 GLN A N   1 
ATOM   172 C  CA  . GLN A 1 25  ? 8.662  18.493  33.813 1.00 17.41 ? 509 GLN A CA  1 
ATOM   173 C  C   . GLN A 1 25  ? 8.385  17.191  33.110 1.00 17.00 ? 509 GLN A C   1 
ATOM   174 O  O   . GLN A 1 25  ? 7.586  17.148  32.165 1.00 17.47 ? 509 GLN A O   1 
ATOM   175 C  CB  . GLN A 1 25  ? 7.372  18.914  34.496 1.00 17.66 ? 509 GLN A CB  1 
ATOM   176 C  CG  . GLN A 1 25  ? 7.544  19.905  35.597 1.00 21.39 ? 509 GLN A CG  1 
ATOM   177 C  CD  . GLN A 1 25  ? 6.268  20.053  36.385 1.00 26.83 ? 509 GLN A CD  1 
ATOM   178 O  OE1 . GLN A 1 25  ? 5.546  19.066  36.633 1.00 29.13 ? 509 GLN A OE1 1 
ATOM   179 N  NE2 . GLN A 1 25  ? 5.974  21.285  36.797 1.00 28.70 ? 509 GLN A NE2 1 
ATOM   180 N  N   . PHE A 1 26  ? 8.983  16.115  33.612 1.00 17.56 ? 510 PHE A N   1 
ATOM   181 C  CA  . PHE A 1 26  ? 8.929  14.832  32.922 1.00 18.07 ? 510 PHE A CA  1 
ATOM   182 C  C   . PHE A 1 26  ? 8.814  13.635  33.880 1.00 18.46 ? 510 PHE A C   1 
ATOM   183 O  O   . PHE A 1 26  ? 9.172  13.741  35.064 1.00 17.57 ? 510 PHE A O   1 
ATOM   184 C  CB  . PHE A 1 26  ? 10.167 14.663  32.026 1.00 18.11 ? 510 PHE A CB  1 
ATOM   185 C  CG  . PHE A 1 26  ? 11.415 14.249  32.777 1.00 17.99 ? 510 PHE A CG  1 
ATOM   186 C  CD1 . PHE A 1 26  ? 11.812 12.906  32.828 1.00 18.89 ? 510 PHE A CD1 1 
ATOM   187 C  CD2 . PHE A 1 26  ? 12.183 15.188  33.439 1.00 17.17 ? 510 PHE A CD2 1 
ATOM   188 C  CE1 . PHE A 1 26  ? 12.957 12.533  33.525 1.00 19.54 ? 510 PHE A CE1 1 
ATOM   189 C  CE2 . PHE A 1 26  ? 13.328 14.817  34.121 1.00 18.51 ? 510 PHE A CE2 1 
ATOM   190 C  CZ  . PHE A 1 26  ? 13.707 13.488  34.174 1.00 19.00 ? 510 PHE A CZ  1 
ATOM   191 N  N   . ASP A 1 27  ? 8.335  12.513  33.328 1.00 19.45 ? 511 ASP A N   1 
ATOM   192 C  CA  . ASP A 1 27  ? 8.304  11.202  34.004 1.00 20.80 ? 511 ASP A CA  1 
ATOM   193 C  C   . ASP A 1 27  ? 9.411  10.326  33.473 1.00 21.33 ? 511 ASP A C   1 
ATOM   194 O  O   . ASP A 1 27  ? 9.647  10.297  32.266 1.00 21.38 ? 511 ASP A O   1 
ATOM   195 C  CB  . ASP A 1 27  ? 7.032  10.431  33.665 1.00 21.08 ? 511 ASP A CB  1 
ATOM   196 C  CG  . ASP A 1 27  ? 5.803  11.139  34.062 1.00 22.74 ? 511 ASP A CG  1 
ATOM   197 O  OD1 . ASP A 1 27  ? 5.812  11.792  35.128 1.00 24.65 ? 511 ASP A OD1 1 
ATOM   198 O  OD2 . ASP A 1 27  ? 4.808  11.040  33.304 1.00 25.61 ? 511 ASP A OD2 1 
ATOM   199 N  N   . GLU A 1 28  ? 10.051 9.583   34.369 1.00 22.02 ? 512 GLU A N   1 
ATOM   200 C  CA  . GLU A 1 28  ? 10.991 8.528   33.983 1.00 23.17 ? 512 GLU A CA  1 
ATOM   201 C  C   . GLU A 1 28  ? 10.337 7.510   33.038 1.00 23.13 ? 512 GLU A C   1 
ATOM   202 O  O   . GLU A 1 28  ? 9.115  7.324   33.085 1.00 22.42 ? 512 GLU A O   1 
ATOM   203 C  CB  . GLU A 1 28  ? 11.508 7.806   35.228 1.00 23.82 ? 512 GLU A CB  1 
ATOM   204 C  CG  . GLU A 1 28  ? 12.355 8.659   36.154 1.00 26.27 ? 512 GLU A CG  1 
ATOM   205 C  CD  . GLU A 1 28  ? 11.521 9.476   37.144 1.00 30.33 ? 512 GLU A CD  1 
ATOM   206 O  OE1 . GLU A 1 28  ? 10.272 9.462   37.056 1.00 30.93 ? 512 GLU A OE1 1 
ATOM   207 O  OE2 . GLU A 1 28  ? 12.117 10.131  38.026 1.00 33.38 ? 512 GLU A OE2 1 
ATOM   208 N  N   . PRO A 1 29  ? 11.148 6.855   32.174 1.00 23.38 ? 513 PRO A N   1 
ATOM   209 C  CA  . PRO A 1 29  ? 10.674 5.745   31.338 1.00 23.99 ? 513 PRO A CA  1 
ATOM   210 C  C   . PRO A 1 29  ? 9.965  4.653   32.159 1.00 24.23 ? 513 PRO A C   1 
ATOM   211 O  O   . PRO A 1 29  ? 10.347 4.407   33.302 1.00 23.92 ? 513 PRO A O   1 
ATOM   212 C  CB  . PRO A 1 29  ? 11.981 5.181   30.750 1.00 23.85 ? 513 PRO A CB  1 
ATOM   213 C  CG  . PRO A 1 29  ? 12.886 6.360   30.667 1.00 23.74 ? 513 PRO A CG  1 
ATOM   214 C  CD  . PRO A 1 29  ? 12.575 7.158   31.916 1.00 23.53 ? 513 PRO A CD  1 
ATOM   215 N  N   . GLU A 1 30  ? 8.931  4.028   31.598 1.00 25.11 ? 514 GLU A N   1 
ATOM   216 C  CA  . GLU A 1 30  ? 8.285  2.896   32.273 1.00 25.77 ? 514 GLU A CA  1 
ATOM   217 C  C   . GLU A 1 30  ? 9.286  1.748   32.391 1.00 25.71 ? 514 GLU A C   1 
ATOM   218 O  O   . GLU A 1 30  ? 9.390  1.089   33.432 1.00 25.14 ? 514 GLU A O   1 
ATOM   219 C  CB  . GLU A 1 30  ? 7.037  2.435   31.518 1.00 26.18 ? 514 GLU A CB  1 
ATOM   220 C  CG  . GLU A 1 30  ? 5.885  3.423   31.546 1.00 29.14 ? 514 GLU A CG  1 
ATOM   221 C  CD  . GLU A 1 30  ? 5.086  3.379   32.841 1.00 32.10 ? 514 GLU A CD  1 
ATOM   222 O  OE1 . GLU A 1 30  ? 5.027  4.423   33.528 1.00 34.03 ? 514 GLU A OE1 1 
ATOM   223 O  OE2 . GLU A 1 30  ? 4.507  2.310   33.164 1.00 34.18 ? 514 GLU A OE2 1 
ATOM   224 N  N   . ALA A 1 31  ? 10.038 1.532   31.315 1.00 25.86 ? 515 ALA A N   1 
ATOM   225 C  CA  . ALA A 1 31  ? 11.065 0.503   31.286 1.00 25.74 ? 515 ALA A CA  1 
ATOM   226 C  C   . ALA A 1 31  ? 12.444 1.111   31.077 1.00 26.03 ? 515 ALA A C   1 
ATOM   227 O  O   . ALA A 1 31  ? 12.657 1.911   30.164 1.00 26.33 ? 515 ALA A O   1 
ATOM   228 C  CB  . ALA A 1 31  ? 10.766 -0.516  30.201 1.00 26.19 ? 515 ALA A CB  1 
ATOM   229 N  N   . THR A 1 32  ? 13.371 0.715   31.936 1.00 25.76 ? 516 THR A N   1 
ATOM   230 C  CA  . THR A 1 32  ? 14.781 1.041   31.781 1.00 26.26 ? 516 THR A CA  1 
ATOM   231 C  C   . THR A 1 32  ? 15.367 0.310   30.570 1.00 26.14 ? 516 THR A C   1 
ATOM   232 O  O   . THR A 1 32  ? 16.442 0.661   30.087 1.00 26.00 ? 516 THR A O   1 
ATOM   233 C  CB  . THR A 1 32  ? 15.573 0.664   33.046 1.00 26.67 ? 516 THR A CB  1 
ATOM   234 O  OG1 . THR A 1 32  ? 15.367 -0.726  33.355 1.00 27.66 ? 516 THR A OG1 1 
ATOM   235 C  CG2 . THR A 1 32  ? 15.135 1.516   34.233 1.00 26.63 ? 516 THR A CG2 1 
ATOM   236 N  N   . GLY A 1 33  ? 14.639 -0.692  30.077 1.00 25.88 ? 517 GLY A N   1 
ATOM   237 C  CA  . GLY A 1 33  ? 15.139 -1.580  29.023 1.00 26.05 ? 517 GLY A CA  1 
ATOM   238 C  C   . GLY A 1 33  ? 15.828 -2.817  29.580 1.00 26.11 ? 517 GLY A C   1 
ATOM   239 O  O   . GLY A 1 33  ? 15.991 -3.832  28.877 1.00 25.69 ? 517 GLY A O   1 
ATOM   240 N  N   . GLY A 1 34  ? 16.244 -2.735  30.842 1.00 25.96 ? 518 GLY A N   1 
ATOM   241 C  CA  . GLY A 1 34  ? 16.869 -3.877  31.509 1.00 25.91 ? 518 GLY A CA  1 
ATOM   242 C  C   . GLY A 1 34  ? 18.109 -3.483  32.282 1.00 25.72 ? 518 GLY A C   1 
ATOM   243 O  O   . GLY A 1 34  ? 18.508 -4.181  33.225 1.00 25.98 ? 518 GLY A O   1 
ATOM   244 N  N   . VAL A 1 35  ? 18.709 -2.361  31.880 1.00 24.87 ? 519 VAL A N   1 
ATOM   245 C  CA  . VAL A 1 35  ? 19.839 -1.736  32.585 1.00 24.02 ? 519 VAL A CA  1 
ATOM   246 C  C   . VAL A 1 35  ? 19.513 -0.259  32.868 1.00 23.83 ? 519 VAL A C   1 
ATOM   247 O  O   . VAL A 1 35  ? 18.746 0.344   32.113 1.00 23.48 ? 519 VAL A O   1 
ATOM   248 C  CB  . VAL A 1 35  ? 21.185 -1.859  31.796 1.00 24.08 ? 519 VAL A CB  1 
ATOM   249 C  CG1 . VAL A 1 35  ? 21.676 -3.310  31.769 1.00 23.00 ? 519 VAL A CG1 1 
ATOM   250 C  CG2 . VAL A 1 35  ? 21.062 -1.294  30.387 1.00 23.39 ? 519 VAL A CG2 1 
ATOM   251 N  N   . PRO A 1 36  ? 20.089 0.314   33.954 1.00 23.35 ? 520 PRO A N   1 
ATOM   252 C  CA  . PRO A 1 36  ? 19.768 1.635   34.539 1.00 23.20 ? 520 PRO A CA  1 
ATOM   253 C  C   . PRO A 1 36  ? 19.960 2.875   33.651 1.00 22.11 ? 520 PRO A C   1 
ATOM   254 O  O   . PRO A 1 36  ? 20.938 2.973   32.920 1.00 22.78 ? 520 PRO A O   1 
ATOM   255 C  CB  . PRO A 1 36  ? 20.747 1.736   35.725 1.00 23.34 ? 520 PRO A CB  1 
ATOM   256 C  CG  . PRO A 1 36  ? 21.865 0.788   35.367 1.00 23.84 ? 520 PRO A CG  1 
ATOM   257 C  CD  . PRO A 1 36  ? 21.153 -0.358  34.723 1.00 23.39 ? 520 PRO A CD  1 
ATOM   258 N  N   . ILE A 1 37  ? 19.056 3.842   33.783 1.00 21.47 ? 521 ILE A N   1 
ATOM   259 C  CA  . ILE A 1 37  ? 19.212 5.148   33.116 1.00 20.61 ? 521 ILE A CA  1 
ATOM   260 C  C   . ILE A 1 37  ? 20.436 5.915   33.615 1.00 19.49 ? 521 ILE A C   1 
ATOM   261 O  O   . ILE A 1 37  ? 20.627 6.090   34.824 1.00 20.68 ? 521 ILE A O   1 
ATOM   262 C  CB  . ILE A 1 37  ? 17.951 6.039   33.276 1.00 20.50 ? 521 ILE A CB  1 
ATOM   263 C  CG1 . ILE A 1 37  ? 16.672 5.248   32.979 1.00 21.43 ? 521 ILE A CG1 1 
ATOM   264 C  CG2 . ILE A 1 37  ? 18.080 7.311   32.433 1.00 19.55 ? 521 ILE A CG2 1 
ATOM   265 C  CD1 . ILE A 1 37  ? 16.656 4.512   31.674 1.00 20.57 ? 521 ILE A CD1 1 
ATOM   266 N  N   . LEU A 1 38  ? 21.245 6.395   32.679 1.00 18.46 ? 522 LEU A N   1 
ATOM   267 C  CA  . LEU A 1 38  ? 22.511 7.063   32.983 1.00 17.19 ? 522 LEU A CA  1 
ATOM   268 C  C   . LEU A 1 38  ? 22.458 8.585   32.819 1.00 17.00 ? 522 LEU A C   1 
ATOM   269 O  O   . LEU A 1 38  ? 23.046 9.334   33.600 1.00 15.41 ? 522 LEU A O   1 
ATOM   270 C  CB  . LEU A 1 38  ? 23.617 6.523   32.081 1.00 17.73 ? 522 LEU A CB  1 
ATOM   271 C  CG  . LEU A 1 38  ? 23.978 5.037   32.010 1.00 18.16 ? 522 LEU A CG  1 
ATOM   272 C  CD1 . LEU A 1 38  ? 25.105 4.845   31.011 1.00 19.76 ? 522 LEU A CD1 1 
ATOM   273 C  CD2 . LEU A 1 38  ? 24.379 4.547   33.373 1.00 20.75 ? 522 LEU A CD2 1 
ATOM   274 N  N   . LYS A 1 39  ? 21.789 9.023   31.757 1.00 15.87 ? 523 LYS A N   1 
ATOM   275 C  CA  . LYS A 1 39  ? 21.661 10.438  31.426 1.00 15.06 ? 523 LYS A CA  1 
ATOM   276 C  C   . LYS A 1 39  ? 20.342 10.640  30.721 1.00 14.01 ? 523 LYS A C   1 
ATOM   277 O  O   . LYS A 1 39  ? 19.740 9.682   30.223 1.00 13.36 ? 523 LYS A O   1 
ATOM   278 C  CB  . LYS A 1 39  ? 22.777 10.882  30.469 1.00 15.10 ? 523 LYS A CB  1 
ATOM   279 C  CG  . LYS A 1 39  ? 24.165 10.964  31.065 1.00 16.64 ? 523 LYS A CG  1 
ATOM   280 C  CD  . LYS A 1 39  ? 25.108 11.665  30.097 1.00 19.67 ? 523 LYS A CD  1 
ATOM   281 C  CE  . LYS A 1 39  ? 26.564 11.672  30.582 1.00 21.77 ? 523 LYS A CE  1 
ATOM   282 N  NZ  . LYS A 1 39  ? 26.725 12.098  32.003 1.00 21.85 ? 523 LYS A NZ  1 
ATOM   283 N  N   . TYR A 1 40  ? 19.907 11.897  30.671 1.00 13.34 ? 524 TYR A N   1 
ATOM   284 C  CA  . TYR A 1 40  ? 18.845 12.307  29.759 1.00 13.52 ? 524 TYR A CA  1 
ATOM   285 C  C   . TYR A 1 40  ? 19.363 13.237  28.681 1.00 12.85 ? 524 TYR A C   1 
ATOM   286 O  O   . TYR A 1 40  ? 20.288 14.025  28.899 1.00 12.76 ? 524 TYR A O   1 
ATOM   287 C  CB  . TYR A 1 40  ? 17.673 12.952  30.505 1.00 14.15 ? 524 TYR A CB  1 
ATOM   288 C  CG  . TYR A 1 40  ? 16.880 11.960  31.328 1.00 14.69 ? 524 TYR A CG  1 
ATOM   289 C  CD1 . TYR A 1 40  ? 15.809 11.260  30.780 1.00 15.59 ? 524 TYR A CD1 1 
ATOM   290 C  CD2 . TYR A 1 40  ? 17.211 11.728  32.658 1.00 15.38 ? 524 TYR A CD2 1 
ATOM   291 C  CE1 . TYR A 1 40  ? 15.086 10.331  31.548 1.00 15.89 ? 524 TYR A CE1 1 
ATOM   292 C  CE2 . TYR A 1 40  ? 16.495 10.807  33.435 1.00 16.81 ? 524 TYR A CE2 1 
ATOM   293 C  CZ  . TYR A 1 40  ? 15.438 10.124  32.872 1.00 16.19 ? 524 TYR A CZ  1 
ATOM   294 O  OH  . TYR A 1 40  ? 14.744 9.228   33.640 1.00 18.58 ? 524 TYR A OH  1 
ATOM   295 N  N   . LYS A 1 41  ? 18.755 13.155  27.510 1.00 13.22 ? 525 LYS A N   1 
ATOM   296 C  CA  . LYS A 1 41  ? 19.043 14.114  26.454 1.00 12.94 ? 525 LYS A CA  1 
ATOM   297 C  C   . LYS A 1 41  ? 17.776 14.905  26.153 1.00 12.97 ? 525 LYS A C   1 
ATOM   298 O  O   . LYS A 1 41  ? 16.733 14.329  25.845 1.00 13.50 ? 525 LYS A O   1 
ATOM   299 C  CB  . LYS A 1 41  ? 19.546 13.395  25.201 1.00 12.49 ? 525 LYS A CB  1 
ATOM   300 C  CG  . LYS A 1 41  ? 20.056 14.324  24.098 1.00 14.03 ? 525 LYS A CG  1 
ATOM   301 C  CD  . LYS A 1 41  ? 20.349 13.491  22.859 1.00 17.42 ? 525 LYS A CD  1 
ATOM   302 C  CE  . LYS A 1 41  ? 21.080 14.244  21.798 1.00 21.06 ? 525 LYS A CE  1 
ATOM   303 N  NZ  . LYS A 1 41  ? 21.260 13.330  20.612 1.00 20.89 ? 525 LYS A NZ  1 
ATOM   304 N  N   . ALA A 1 42  ? 17.871 16.225  26.270 1.00 12.75 ? 526 ALA A N   1 
ATOM   305 C  CA  . ALA A 1 42  ? 16.826 17.106  25.764 1.00 11.99 ? 526 ALA A CA  1 
ATOM   306 C  C   . ALA A 1 42  ? 17.225 17.646  24.405 1.00 12.30 ? 526 ALA A C   1 
ATOM   307 O  O   . ALA A 1 42  ? 18.351 18.096  24.225 1.00 11.77 ? 526 ALA A O   1 
ATOM   308 C  CB  . ALA A 1 42  ? 16.578 18.272  26.718 1.00 11.84 ? 526 ALA A CB  1 
ATOM   309 N  N   . GLU A 1 43  ? 16.293 17.583  23.464 1.00 11.95 ? 527 GLU A N   1 
ATOM   310 C  CA  . GLU A 1 43  ? 16.409 18.224  22.159 1.00 11.91 ? 527 GLU A CA  1 
ATOM   311 C  C   . GLU A 1 43  ? 15.277 19.239  21.994 1.00 11.53 ? 527 GLU A C   1 
ATOM   312 O  O   . GLU A 1 43  ? 14.106 18.928  22.285 1.00 11.28 ? 527 GLU A O   1 
ATOM   313 C  CB  . GLU A 1 43  ? 16.333 17.174  21.049 1.00 12.00 ? 527 GLU A CB  1 
ATOM   314 C  CG  . GLU A 1 43  ? 17.340 16.042  21.202 1.00 15.86 ? 527 GLU A CG  1 
ATOM   315 C  CD  . GLU A 1 43  ? 17.225 15.020  20.096 1.00 21.11 ? 527 GLU A CD  1 
ATOM   316 O  OE1 . GLU A 1 43  ? 16.434 14.057  20.249 1.00 23.82 ? 527 GLU A OE1 1 
ATOM   317 O  OE2 . GLU A 1 43  ? 17.925 15.189  19.066 1.00 26.63 ? 527 GLU A OE2 1 
ATOM   318 N  N   . TRP A 1 44  ? 15.607 20.444  21.526 1.00 10.15 ? 528 TRP A N   1 
ATOM   319 C  CA  . TRP A 1 44  ? 14.566 21.466  21.299 1.00 10.94 ? 528 TRP A CA  1 
ATOM   320 C  C   . TRP A 1 44  ? 14.815 22.203  19.998 1.00 11.40 ? 528 TRP A C   1 
ATOM   321 O  O   . TRP A 1 44  ? 15.956 22.284  19.530 1.00 10.49 ? 528 TRP A O   1 
ATOM   322 C  CB  . TRP A 1 44  ? 14.447 22.451  22.479 1.00 11.26 ? 528 TRP A CB  1 
ATOM   323 C  CG  . TRP A 1 44  ? 15.691 23.262  22.760 1.00 11.73 ? 528 TRP A CG  1 
ATOM   324 C  CD1 . TRP A 1 44  ? 15.996 24.507  22.278 1.00 9.99  ? 528 TRP A CD1 1 
ATOM   325 C  CD2 . TRP A 1 44  ? 16.808 22.859  23.562 1.00 12.17 ? 528 TRP A CD2 1 
ATOM   326 N  NE1 . TRP A 1 44  ? 17.217 24.919  22.773 1.00 13.54 ? 528 TRP A NE1 1 
ATOM   327 C  CE2 . TRP A 1 44  ? 17.730 23.929  23.570 1.00 11.81 ? 528 TRP A CE2 1 
ATOM   328 C  CE3 . TRP A 1 44  ? 17.091 21.718  24.327 1.00 14.35 ? 528 TRP A CE3 1 
ATOM   329 C  CZ2 . TRP A 1 44  ? 18.953 23.866  24.264 1.00 12.19 ? 528 TRP A CZ2 1 
ATOM   330 C  CZ3 . TRP A 1 44  ? 18.302 21.661  25.033 1.00 12.24 ? 528 TRP A CZ3 1 
ATOM   331 C  CH2 . TRP A 1 44  ? 19.208 22.735  25.001 1.00 10.29 ? 528 TRP A CH2 1 
ATOM   332 N  N   . ARG A 1 45  ? 13.746 22.735  19.418 1.00 11.36 ? 529 ARG A N   1 
ATOM   333 C  CA  . ARG A 1 45  ? 13.885 23.601  18.249 1.00 12.73 ? 529 ARG A CA  1 
ATOM   334 C  C   . ARG A 1 45  ? 12.718 24.575  18.145 1.00 12.84 ? 529 ARG A C   1 
ATOM   335 O  O   . ARG A 1 45  ? 11.577 24.244  18.516 1.00 13.50 ? 529 ARG A O   1 
ATOM   336 C  CB  . ARG A 1 45  ? 14.010 22.779  16.968 1.00 13.75 ? 529 ARG A CB  1 
ATOM   337 C  CG  . ARG A 1 45  ? 12.876 21.855  16.701 1.00 15.45 ? 529 ARG A CG  1 
ATOM   338 C  CD  . ARG A 1 45  ? 12.707 21.489  15.218 1.00 18.97 ? 529 ARG A CD  1 
ATOM   339 N  NE  . ARG A 1 45  ? 11.412 20.818  15.095 1.00 23.57 ? 529 ARG A NE  1 
ATOM   340 C  CZ  . ARG A 1 45  ? 10.312 21.356  14.564 1.00 25.35 ? 529 ARG A CZ  1 
ATOM   341 N  NH1 . ARG A 1 45  ? 10.334 22.577  14.027 1.00 24.32 ? 529 ARG A NH1 1 
ATOM   342 N  NH2 . ARG A 1 45  ? 9.182  20.650  14.549 1.00 27.19 ? 529 ARG A NH2 1 
ATOM   343 N  N   . ALA A 1 46  ? 13.015 25.780  17.660 1.00 13.65 ? 530 ALA A N   1 
ATOM   344 C  CA  . ALA A 1 46  ? 11.988 26.771  17.401 1.00 13.59 ? 530 ALA A CA  1 
ATOM   345 C  C   . ALA A 1 46  ? 11.101 26.241  16.269 1.00 13.94 ? 530 ALA A C   1 
ATOM   346 O  O   . ALA A 1 46  ? 11.595 25.834  15.215 1.00 13.79 ? 530 ALA A O   1 
ATOM   347 C  CB  . ALA A 1 46  ? 12.616 28.101  17.031 1.00 13.11 ? 530 ALA A CB  1 
ATOM   348 N  N   . VAL A 1 47  ? 9.788  26.217  16.507 1.00 14.33 ? 531 VAL A N   1 
ATOM   349 C  CA  . VAL A 1 47  ? 8.831  25.740  15.505 1.00 15.01 ? 531 VAL A CA  1 
ATOM   350 C  C   . VAL A 1 47  ? 9.018  26.542  14.194 1.00 15.92 ? 531 VAL A C   1 
ATOM   351 O  O   . VAL A 1 47  ? 9.132  27.770  14.220 1.00 15.48 ? 531 VAL A O   1 
ATOM   352 C  CB  . VAL A 1 47  ? 7.387  25.854  16.057 1.00 15.07 ? 531 VAL A CB  1 
ATOM   353 C  CG1 . VAL A 1 47  ? 6.359  25.568  14.983 1.00 13.60 ? 531 VAL A CG1 1 
ATOM   354 C  CG2 . VAL A 1 47  ? 7.185  24.916  17.271 1.00 15.28 ? 531 VAL A CG2 1 
ATOM   355 N  N   . GLY A 1 48  ? 9.067  25.821  13.075 1.00 16.76 ? 532 GLY A N   1 
ATOM   356 C  CA  . GLY A 1 48  ? 9.395  26.378  11.767 1.00 17.73 ? 532 GLY A CA  1 
ATOM   357 C  C   . GLY A 1 48  ? 10.840 26.190  11.329 1.00 18.51 ? 532 GLY A C   1 
ATOM   358 O  O   . GLY A 1 48  ? 11.130 26.247  10.130 1.00 19.07 ? 532 GLY A O   1 
ATOM   359 N  N   . GLU A 1 49  ? 11.746 25.969  12.292 1.00 18.83 ? 533 GLU A N   1 
ATOM   360 C  CA  . GLU A 1 49  ? 13.172 25.780  12.002 1.00 19.07 ? 533 GLU A CA  1 
ATOM   361 C  C   . GLU A 1 49  ? 13.525 24.297  11.898 1.00 19.31 ? 533 GLU A C   1 
ATOM   362 O  O   . GLU A 1 49  ? 12.833 23.463  12.476 1.00 19.50 ? 533 GLU A O   1 
ATOM   363 C  CB  . GLU A 1 49  ? 14.028 26.439  13.070 1.00 19.60 ? 533 GLU A CB  1 
ATOM   364 C  CG  . GLU A 1 49  ? 13.862 27.951  13.125 1.00 21.05 ? 533 GLU A CG  1 
ATOM   365 C  CD  . GLU A 1 49  ? 14.811 28.609  14.098 1.00 24.16 ? 533 GLU A CD  1 
ATOM   366 O  OE1 . GLU A 1 49  ? 15.826 27.988  14.497 1.00 25.34 ? 533 GLU A OE1 1 
ATOM   367 O  OE2 . GLU A 1 49  ? 14.539 29.763  14.467 1.00 24.97 ? 533 GLU A OE2 1 
ATOM   368 N  N   . GLU A 1 50  ? 14.594 23.983  11.166 1.00 19.32 ? 534 GLU A N   1 
ATOM   369 C  CA  . GLU A 1 50  ? 15.050 22.581  10.991 1.00 19.87 ? 534 GLU A CA  1 
ATOM   370 C  C   . GLU A 1 50  ? 16.071 22.128  12.045 1.00 18.72 ? 534 GLU A C   1 
ATOM   371 O  O   . GLU A 1 50  ? 16.104 20.958  12.407 1.00 19.06 ? 534 GLU A O   1 
ATOM   372 C  CB  . GLU A 1 50  ? 15.661 22.356  9.597  1.00 20.05 ? 534 GLU A CB  1 
ATOM   373 C  CG  . GLU A 1 50  ? 14.797 22.777  8.431  1.00 24.14 ? 534 GLU A CG  1 
ATOM   374 C  CD  . GLU A 1 50  ? 15.546 22.720  7.107  1.00 28.39 ? 534 GLU A CD  1 
ATOM   375 O  OE1 . GLU A 1 50  ? 15.798 23.797  6.523  1.00 30.62 ? 534 GLU A OE1 1 
ATOM   376 O  OE2 . GLU A 1 50  ? 15.887 21.604  6.659  1.00 30.07 ? 534 GLU A OE2 1 
ATOM   377 N  N   . VAL A 1 51  ? 16.905 23.045  12.526 1.00 17.11 ? 535 VAL A N   1 
ATOM   378 C  CA  . VAL A 1 51  ? 18.021 22.685  13.413 1.00 16.03 ? 535 VAL A CA  1 
ATOM   379 C  C   . VAL A 1 51  ? 17.601 22.373  14.866 1.00 15.51 ? 535 VAL A C   1 
ATOM   380 O  O   . VAL A 1 51  ? 16.925 23.174  15.508 1.00 15.42 ? 535 VAL A O   1 
ATOM   381 C  CB  . VAL A 1 51  ? 19.093 23.785  13.410 1.00 15.72 ? 535 VAL A CB  1 
ATOM   382 C  CG1 . VAL A 1 51  ? 20.209 23.459  14.369 1.00 14.06 ? 535 VAL A CG1 1 
ATOM   383 C  CG2 . VAL A 1 51  ? 19.603 24.028  11.976 1.00 16.01 ? 535 VAL A CG2 1 
ATOM   384 N  N   . TRP A 1 52  ? 18.003 21.208  15.368 1.00 14.75 ? 536 TRP A N   1 
ATOM   385 C  CA  . TRP A 1 52  ? 17.713 20.817  16.753 1.00 14.26 ? 536 TRP A CA  1 
ATOM   386 C  C   . TRP A 1 52  ? 18.864 21.224  17.677 1.00 13.48 ? 536 TRP A C   1 
ATOM   387 O  O   . TRP A 1 52  ? 20.042 21.098  17.310 1.00 14.44 ? 536 TRP A O   1 
ATOM   388 C  CB  . TRP A 1 52  ? 17.504 19.294  16.875 1.00 14.49 ? 536 TRP A CB  1 
ATOM   389 C  CG  . TRP A 1 52  ? 16.154 18.766  16.429 1.00 15.79 ? 536 TRP A CG  1 
ATOM   390 C  CD1 . TRP A 1 52  ? 15.840 18.235  15.200 1.00 15.22 ? 536 TRP A CD1 1 
ATOM   391 C  CD2 . TRP A 1 52  ? 14.966 18.693  17.212 1.00 15.01 ? 536 TRP A CD2 1 
ATOM   392 N  NE1 . TRP A 1 52  ? 14.520 17.850  15.175 1.00 17.07 ? 536 TRP A NE1 1 
ATOM   393 C  CE2 . TRP A 1 52  ? 13.959 18.114  16.399 1.00 16.41 ? 536 TRP A CE2 1 
ATOM   394 C  CE3 . TRP A 1 52  ? 14.644 19.068  18.525 1.00 14.58 ? 536 TRP A CE3 1 
ATOM   395 C  CZ2 . TRP A 1 52  ? 12.655 17.910  16.853 1.00 16.58 ? 536 TRP A CZ2 1 
ATOM   396 C  CZ3 . TRP A 1 52  ? 13.342 18.849  18.989 1.00 15.34 ? 536 TRP A CZ3 1 
ATOM   397 C  CH2 . TRP A 1 52  ? 12.363 18.275  18.150 1.00 15.88 ? 536 TRP A CH2 1 
ATOM   398 N  N   . HIS A 1 53  ? 18.529 21.680  18.884 1.00 11.91 ? 537 HIS A N   1 
ATOM   399 C  CA  . HIS A 1 53  ? 19.543 21.965  19.877 1.00 10.39 ? 537 HIS A CA  1 
ATOM   400 C  C   . HIS A 1 53  ? 19.437 20.890  20.934 1.00 10.12 ? 537 HIS A C   1 
ATOM   401 O  O   . HIS A 1 53  ? 18.316 20.469  21.307 1.00 10.01 ? 537 HIS A O   1 
ATOM   402 C  CB  . HIS A 1 53  ? 19.264 23.323  20.512 1.00 10.21 ? 537 HIS A CB  1 
ATOM   403 C  CG  . HIS A 1 53  ? 18.988 24.392  19.510 1.00 11.80 ? 537 HIS A CG  1 
ATOM   404 N  ND1 . HIS A 1 53  ? 19.988 25.005  18.791 1.00 13.22 ? 537 HIS A ND1 1 
ATOM   405 C  CD2 . HIS A 1 53  ? 17.826 24.915  19.057 1.00 15.03 ? 537 HIS A CD2 1 
ATOM   406 C  CE1 . HIS A 1 53  ? 19.459 25.882  17.957 1.00 15.00 ? 537 HIS A CE1 1 
ATOM   407 N  NE2 . HIS A 1 53  ? 18.147 25.857  18.111 1.00 14.19 ? 537 HIS A NE2 1 
ATOM   408 N  N   . SER A 1 54  ? 20.569 20.506  21.495 1.00 9.63  ? 538 SER A N   1 
ATOM   409 C  CA  . SER A 1 54  ? 20.544 19.401  22.435 1.00 10.69 ? 538 SER A CA  1 
ATOM   410 C  C   . SER A 1 54  ? 21.550 19.562  23.553 1.00 10.73 ? 538 SER A C   1 
ATOM   411 O  O   . SER A 1 54  ? 22.594 20.221  23.393 1.00 11.01 ? 538 SER A O   1 
ATOM   412 C  CB  . SER A 1 54  ? 20.699 18.050  21.710 1.00 10.78 ? 538 SER A CB  1 
ATOM   413 O  OG  . SER A 1 54  ? 22.043 17.781  21.324 1.00 12.22 ? 538 SER A OG  1 
ATOM   414 N  N   . LYS A 1 55  ? 21.199 18.967  24.683 1.00 10.82 ? 539 LYS A N   1 
ATOM   415 C  CA  . LYS A 1 55  ? 22.012 18.988  25.889 1.00 10.87 ? 539 LYS A CA  1 
ATOM   416 C  C   . LYS A 1 55  ? 21.798 17.723  26.741 1.00 10.69 ? 539 LYS A C   1 
ATOM   417 O  O   . LYS A 1 55  ? 20.694 17.211  26.843 1.00 9.86  ? 539 LYS A O   1 
ATOM   418 C  CB  . LYS A 1 55  ? 21.697 20.224  26.733 1.00 10.58 ? 539 LYS A CB  1 
ATOM   419 C  CG  . LYS A 1 55  ? 22.625 20.386  27.913 1.00 12.74 ? 539 LYS A CG  1 
ATOM   420 C  CD  . LYS A 1 55  ? 22.399 21.663  28.707 1.00 12.67 ? 539 LYS A CD  1 
ATOM   421 C  CE  . LYS A 1 55  ? 23.636 21.936  29.567 1.00 10.89 ? 539 LYS A CE  1 
ATOM   422 N  NZ  . LYS A 1 55  ? 23.241 22.866  30.695 1.00 13.74 ? 539 LYS A NZ  1 
ATOM   423 N  N   . TRP A 1 56  ? 22.882 17.253  27.353 1.00 11.97 ? 540 TRP A N   1 
ATOM   424 C  CA  . TRP A 1 56  ? 22.851 16.114  28.276 1.00 12.66 ? 540 TRP A CA  1 
ATOM   425 C  C   . TRP A 1 56  ? 22.606 16.549  29.715 1.00 13.54 ? 540 TRP A C   1 
ATOM   426 O  O   . TRP A 1 56  ? 23.044 17.626  30.134 1.00 13.86 ? 540 TRP A O   1 
ATOM   427 C  CB  . TRP A 1 56  ? 24.190 15.349  28.204 1.00 13.10 ? 540 TRP A CB  1 
ATOM   428 C  CG  . TRP A 1 56  ? 24.447 14.698  26.876 1.00 13.09 ? 540 TRP A CG  1 
ATOM   429 C  CD1 . TRP A 1 56  ? 25.299 15.130  25.914 1.00 14.52 ? 540 TRP A CD1 1 
ATOM   430 C  CD2 . TRP A 1 56  ? 23.846 13.501  26.382 1.00 13.27 ? 540 TRP A CD2 1 
ATOM   431 N  NE1 . TRP A 1 56  ? 25.280 14.269  24.831 1.00 12.97 ? 540 TRP A NE1 1 
ATOM   432 C  CE2 . TRP A 1 56  ? 24.389 13.263  25.090 1.00 14.51 ? 540 TRP A CE2 1 
ATOM   433 C  CE3 . TRP A 1 56  ? 22.897 12.601  26.899 1.00 14.00 ? 540 TRP A CE3 1 
ATOM   434 C  CZ2 . TRP A 1 56  ? 24.025 12.151  24.313 1.00 14.01 ? 540 TRP A CZ2 1 
ATOM   435 C  CZ3 . TRP A 1 56  ? 22.536 11.479  26.118 1.00 15.65 ? 540 TRP A CZ3 1 
ATOM   436 C  CH2 . TRP A 1 56  ? 23.098 11.280  24.840 1.00 14.19 ? 540 TRP A CH2 1 
ATOM   437 N  N   . TYR A 1 57  ? 21.906 15.690  30.462 1.00 13.74 ? 541 TYR A N   1 
ATOM   438 C  CA  . TYR A 1 57  ? 21.584 15.905  31.882 1.00 14.62 ? 541 TYR A CA  1 
ATOM   439 C  C   . TYR A 1 57  ? 21.792 14.620  32.658 1.00 15.54 ? 541 TYR A C   1 
ATOM   440 O  O   . TYR A 1 57  ? 21.414 13.538  32.206 1.00 15.50 ? 541 TYR A O   1 
ATOM   441 C  CB  . TYR A 1 57  ? 20.130 16.356  32.053 1.00 14.77 ? 541 TYR A CB  1 
ATOM   442 C  CG  . TYR A 1 57  ? 19.804 17.608  31.299 1.00 12.75 ? 541 TYR A CG  1 
ATOM   443 C  CD1 . TYR A 1 57  ? 19.896 18.856  31.915 1.00 14.71 ? 541 TYR A CD1 1 
ATOM   444 C  CD2 . TYR A 1 57  ? 19.403 17.549  29.954 1.00 14.35 ? 541 TYR A CD2 1 
ATOM   445 C  CE1 . TYR A 1 57  ? 19.600 20.020  31.213 1.00 13.97 ? 541 TYR A CE1 1 
ATOM   446 C  CE2 . TYR A 1 57  ? 19.119 18.705  29.244 1.00 13.13 ? 541 TYR A CE2 1 
ATOM   447 C  CZ  . TYR A 1 57  ? 19.220 19.935  29.876 1.00 12.18 ? 541 TYR A CZ  1 
ATOM   448 O  OH  . TYR A 1 57  ? 18.940 21.094  29.196 1.00 14.41 ? 541 TYR A OH  1 
ATOM   449 N  N   . ASP A 1 58  ? 22.390 14.754  33.838 1.00 16.48 ? 542 ASP A N   1 
ATOM   450 C  CA  . ASP A 1 58  ? 22.556 13.624  34.764 1.00 18.19 ? 542 ASP A CA  1 
ATOM   451 C  C   . ASP A 1 58  ? 21.211 13.054  35.180 1.00 17.98 ? 542 ASP A C   1 
ATOM   452 O  O   . ASP A 1 58  ? 20.294 13.808  35.521 1.00 17.48 ? 542 ASP A O   1 
ATOM   453 C  CB  . ASP A 1 58  ? 23.282 14.067  36.021 1.00 19.16 ? 542 ASP A CB  1 
ATOM   454 C  CG  . ASP A 1 58  ? 24.602 14.717  35.735 1.00 23.21 ? 542 ASP A CG  1 
ATOM   455 O  OD1 . ASP A 1 58  ? 25.380 14.202  34.889 1.00 27.14 ? 542 ASP A OD1 1 
ATOM   456 O  OD2 . ASP A 1 58  ? 24.873 15.756  36.386 1.00 27.93 ? 542 ASP A OD2 1 
ATOM   457 N  N   . ALA A 1 59  ? 21.114 11.727  35.182 1.00 18.10 ? 543 ALA A N   1 
ATOM   458 C  CA  . ALA A 1 59  ? 19.871 11.044  35.508 1.00 18.30 ? 543 ALA A CA  1 
ATOM   459 C  C   . ALA A 1 59  ? 19.445 11.270  36.962 1.00 18.95 ? 543 ALA A C   1 
ATOM   460 O  O   . ALA A 1 59  ? 18.254 11.432  37.248 1.00 18.04 ? 543 ALA A O   1 
ATOM   461 C  CB  . ALA A 1 59  ? 19.978 9.551   35.196 1.00 18.75 ? 543 ALA A CB  1 
ATOM   462 N  N   . LYS A 1 60  ? 20.416 11.290  37.872 1.00 19.67 ? 544 LYS A N   1 
ATOM   463 C  CA  . LYS A 1 60  ? 20.085 11.382  39.292 1.00 21.04 ? 544 LYS A CA  1 
ATOM   464 C  C   . LYS A 1 60  ? 19.366 12.679  39.660 1.00 21.46 ? 544 LYS A C   1 
ATOM   465 O  O   . LYS A 1 60  ? 18.292 12.636  40.236 1.00 22.46 ? 544 LYS A O   1 
ATOM   466 C  CB  . LYS A 1 60  ? 21.300 11.184  40.182 1.00 21.02 ? 544 LYS A CB  1 
ATOM   467 C  CG  . LYS A 1 60  ? 20.878 10.895  41.614 1.00 22.88 ? 544 LYS A CG  1 
ATOM   468 C  CD  . LYS A 1 60  ? 22.016 11.121  42.554 1.00 24.10 ? 544 LYS A CD  1 
ATOM   469 C  CE  . LYS A 1 60  ? 21.636 10.755  43.967 1.00 25.79 ? 544 LYS A CE  1 
ATOM   470 N  NZ  . LYS A 1 60  ? 22.841 10.802  44.821 1.00 24.89 ? 544 LYS A NZ  1 
ATOM   471 N  N   . GLU A 1 61  ? 19.941 13.821  39.303 1.00 22.81 ? 545 GLU A N   1 
ATOM   472 C  CA  . GLU A 1 61  ? 19.324 15.105  39.646 1.00 24.12 ? 545 GLU A CA  1 
ATOM   473 C  C   . GLU A 1 61  ? 18.018 15.340  38.898 1.00 24.19 ? 545 GLU A C   1 
ATOM   474 O  O   . GLU A 1 61  ? 17.088 15.942  39.438 1.00 24.58 ? 545 GLU A O   1 
ATOM   475 C  CB  . GLU A 1 61  ? 20.285 16.269  39.409 1.00 24.73 ? 545 GLU A CB  1 
ATOM   476 C  CG  . GLU A 1 61  ? 21.362 16.376  40.456 1.00 27.30 ? 545 GLU A CG  1 
ATOM   477 C  CD  . GLU A 1 61  ? 22.544 15.495  40.150 1.00 30.28 ? 545 GLU A CD  1 
ATOM   478 O  OE1 . GLU A 1 61  ? 22.497 14.734  39.153 1.00 31.18 ? 545 GLU A OE1 1 
ATOM   479 O  OE2 . GLU A 1 61  ? 23.546 15.556  40.890 1.00 31.25 ? 545 GLU A OE2 1 
ATOM   480 N  N   . ALA A 1 62  ? 17.946 14.867  37.655 1.00 23.37 ? 546 ALA A N   1 
ATOM   481 C  CA  . ALA A 1 62  ? 16.757 15.088  36.848 1.00 23.38 ? 546 ALA A CA  1 
ATOM   482 C  C   . ALA A 1 62  ? 15.577 14.321  37.439 1.00 23.95 ? 546 ALA A C   1 
ATOM   483 O  O   . ALA A 1 62  ? 14.471 14.857  37.579 1.00 24.11 ? 546 ALA A O   1 
ATOM   484 C  CB  . ALA A 1 62  ? 17.008 14.678  35.395 1.00 23.22 ? 546 ALA A CB  1 
ATOM   485 N  N   . SER A 1 63  ? 15.812 13.066  37.813 1.00 23.78 ? 547 SER A N   1 
ATOM   486 C  CA  . SER A 1 63  ? 14.721 12.236  38.284 1.00 24.62 ? 547 SER A CA  1 
ATOM   487 C  C   . SER A 1 63  ? 14.297 12.650  39.700 1.00 24.74 ? 547 SER A C   1 
ATOM   488 O  O   . SER A 1 63  ? 13.134 12.505  40.059 1.00 25.61 ? 547 SER A O   1 
ATOM   489 C  CB  . SER A 1 63  ? 15.082 10.754  38.202 1.00 24.73 ? 547 SER A CB  1 
ATOM   490 O  OG  . SER A 1 63  ? 16.022 10.424  39.201 1.00 24.72 ? 547 SER A OG  1 
ATOM   491 N  N   . MET A 1 64  ? 15.229 13.204  40.466 1.00 24.66 ? 548 MET A N   1 
ATOM   492 C  CA  . MET A 1 64  ? 14.951 13.686  41.826 1.00 25.49 ? 548 MET A CA  1 
ATOM   493 C  C   . MET A 1 64  ? 14.191 15.023  41.834 1.00 25.31 ? 548 MET A C   1 
ATOM   494 O  O   . MET A 1 64  ? 13.224 15.190  42.588 1.00 25.39 ? 548 MET A O   1 
ATOM   495 C  CB  . MET A 1 64  ? 16.240 13.804  42.626 1.00 25.26 ? 548 MET A CB  1 
ATOM   496 N  N   . GLU A 1 65  ? 14.628 15.960  40.988 1.00 25.18 ? 549 GLU A N   1 
ATOM   497 C  CA  . GLU A 1 65  ? 13.954 17.256  40.833 1.00 25.00 ? 549 GLU A CA  1 
ATOM   498 C  C   . GLU A 1 65  ? 12.667 17.114  40.011 1.00 24.43 ? 549 GLU A C   1 
ATOM   499 O  O   . GLU A 1 65  ? 11.700 17.862  40.208 1.00 25.14 ? 549 GLU A O   1 
ATOM   500 C  CB  . GLU A 1 65  ? 14.906 18.283  40.198 1.00 25.27 ? 549 GLU A CB  1 
ATOM   501 C  CG  . GLU A 1 65  ? 14.721 19.739  40.662 1.00 27.19 ? 549 GLU A CG  1 
ATOM   502 C  CD  . GLU A 1 65  ? 15.187 20.028  42.102 1.00 28.13 ? 549 GLU A CD  1 
ATOM   503 O  OE1 . GLU A 1 65  ? 16.231 19.502  42.564 1.00 30.51 ? 549 GLU A OE1 1 
ATOM   504 O  OE2 . GLU A 1 65  ? 14.501 20.817  42.776 1.00 28.86 ? 549 GLU A OE2 1 
ATOM   505 N  N   . GLY A 1 66  ? 12.647 16.141  39.107 1.00 23.03 ? 550 GLY A N   1 
ATOM   506 C  CA  . GLY A 1 66  ? 11.522 15.958  38.191 1.00 21.77 ? 550 GLY A CA  1 
ATOM   507 C  C   . GLY A 1 66  ? 11.600 16.845  36.952 1.00 20.06 ? 550 GLY A C   1 
ATOM   508 O  O   . GLY A 1 66  ? 10.694 16.828  36.120 1.00 20.08 ? 550 GLY A O   1 
ATOM   509 N  N   . ILE A 1 67  ? 12.698 17.593  36.822 1.00 19.22 ? 551 ILE A N   1 
ATOM   510 C  CA  . ILE A 1 67  ? 12.905 18.550  35.715 1.00 17.49 ? 551 ILE A CA  1 
ATOM   511 C  C   . ILE A 1 67  ? 14.280 18.476  35.043 1.00 17.23 ? 551 ILE A C   1 
ATOM   512 O  O   . ILE A 1 67  ? 15.268 17.996  35.621 1.00 16.57 ? 551 ILE A O   1 
ATOM   513 C  CB  . ILE A 1 67  ? 12.715 20.043  36.168 1.00 18.02 ? 551 ILE A CB  1 
ATOM   514 C  CG1 . ILE A 1 67  ? 13.773 20.435  37.205 1.00 17.17 ? 551 ILE A CG1 1 
ATOM   515 C  CG2 . ILE A 1 67  ? 11.251 20.309  36.611 1.00 17.84 ? 551 ILE A CG2 1 
ATOM   516 C  CD1 . ILE A 1 67  ? 13.712 21.877  37.703 1.00 18.68 ? 551 ILE A CD1 1 
ATOM   517 N  N   . VAL A 1 68  ? 14.318 18.972  33.811 1.00 15.57 ? 552 VAL A N   1 
ATOM   518 C  CA  . VAL A 1 68  ? 15.541 19.456  33.203 1.00 14.64 ? 552 VAL A CA  1 
ATOM   519 C  C   . VAL A 1 68  ? 15.304 20.896  32.712 1.00 14.54 ? 552 VAL A C   1 
ATOM   520 O  O   . VAL A 1 68  ? 14.183 21.255  32.289 1.00 13.79 ? 552 VAL A O   1 
ATOM   521 C  CB  . VAL A 1 68  ? 16.066 18.524  32.071 1.00 14.45 ? 552 VAL A CB  1 
ATOM   522 C  CG1 . VAL A 1 68  ? 16.437 17.158  32.632 1.00 14.41 ? 552 VAL A CG1 1 
ATOM   523 C  CG2 . VAL A 1 68  ? 15.059 18.398  30.919 1.00 13.86 ? 552 VAL A CG2 1 
ATOM   524 N  N   . THR A 1 69  ? 16.351 21.711  32.785 1.00 14.32 ? 553 THR A N   1 
ATOM   525 C  CA  . THR A 1 69  ? 16.271 23.115  32.405 1.00 15.57 ? 553 THR A CA  1 
ATOM   526 C  C   . THR A 1 69  ? 16.958 23.343  31.088 1.00 16.11 ? 553 THR A C   1 
ATOM   527 O  O   . THR A 1 69  ? 18.166 23.131  30.959 1.00 16.27 ? 553 THR A O   1 
ATOM   528 C  CB  . THR A 1 69  ? 16.940 24.060  33.429 1.00 16.04 ? 553 THR A CB  1 
ATOM   529 O  OG1 . THR A 1 69  ? 16.408 23.826  34.732 1.00 16.10 ? 553 THR A OG1 1 
ATOM   530 C  CG2 . THR A 1 69  ? 16.686 25.522  33.036 1.00 15.41 ? 553 THR A CG2 1 
ATOM   531 N  N   . ILE A 1 70  ? 16.189 23.814  30.121 1.00 16.43 ? 554 ILE A N   1 
ATOM   532 C  CA  . ILE A 1 70  ? 16.754 24.176  28.844 1.00 17.25 ? 554 ILE A CA  1 
ATOM   533 C  C   . ILE A 1 70  ? 17.065 25.671  28.844 1.00 17.39 ? 554 ILE A C   1 
ATOM   534 O  O   . ILE A 1 70  ? 16.379 26.488  29.503 1.00 16.53 ? 554 ILE A O   1 
ATOM   535 C  CB  . ILE A 1 70  ? 15.871 23.709  27.647 1.00 17.65 ? 554 ILE A CB  1 
ATOM   536 C  CG1 . ILE A 1 70  ? 14.478 24.336  27.696 1.00 18.59 ? 554 ILE A CG1 1 
ATOM   537 C  CG2 . ILE A 1 70  ? 15.768 22.156  27.610 1.00 18.98 ? 554 ILE A CG2 1 
ATOM   538 C  CD1 . ILE A 1 70  ? 13.495 23.776  26.650 1.00 17.16 ? 554 ILE A CD1 1 
ATOM   539 N  N   . VAL A 1 71  ? 18.124 26.016  28.124 1.00 17.90 ? 555 VAL A N   1 
ATOM   540 C  CA  . VAL A 1 71  ? 18.721 27.355  28.157 1.00 19.12 ? 555 VAL A CA  1 
ATOM   541 C  C   . VAL A 1 71  ? 18.938 27.924  26.758 1.00 18.85 ? 555 VAL A C   1 
ATOM   542 O  O   . VAL A 1 71  ? 18.705 27.251  25.751 1.00 19.75 ? 555 VAL A O   1 
ATOM   543 C  CB  . VAL A 1 71  ? 20.112 27.345  28.877 1.00 19.50 ? 555 VAL A CB  1 
ATOM   544 C  CG1 . VAL A 1 71  ? 19.982 26.970  30.344 1.00 21.00 ? 555 VAL A CG1 1 
ATOM   545 C  CG2 . VAL A 1 71  ? 21.078 26.409  28.155 1.00 19.86 ? 555 VAL A CG2 1 
ATOM   546 N  N   . GLY A 1 72  ? 19.383 29.175  26.709 1.00 19.37 ? 556 GLY A N   1 
ATOM   547 C  CA  . GLY A 1 72  ? 19.757 29.819  25.456 1.00 19.16 ? 556 GLY A CA  1 
ATOM   548 C  C   . GLY A 1 72  ? 18.622 30.009  24.473 1.00 18.43 ? 556 GLY A C   1 
ATOM   549 O  O   . GLY A 1 72  ? 18.850 30.048  23.251 1.00 18.80 ? 556 GLY A O   1 
ATOM   550 N  N   . LEU A 1 73  ? 17.410 30.150  25.005 1.00 17.97 ? 557 LEU A N   1 
ATOM   551 C  CA  . LEU A 1 73  ? 16.222 30.352  24.200 1.00 17.43 ? 557 LEU A CA  1 
ATOM   552 C  C   . LEU A 1 73  ? 16.043 31.840  23.914 1.00 18.05 ? 557 LEU A C   1 
ATOM   553 O  O   . LEU A 1 73  ? 16.593 32.701  24.617 1.00 17.96 ? 557 LEU A O   1 
ATOM   554 C  CB  . LEU A 1 73  ? 14.977 29.803  24.899 1.00 16.99 ? 557 LEU A CB  1 
ATOM   555 C  CG  . LEU A 1 73  ? 15.017 28.352  25.409 1.00 15.32 ? 557 LEU A CG  1 
ATOM   556 C  CD1 . LEU A 1 73  ? 13.798 28.080  26.266 1.00 15.36 ? 557 LEU A CD1 1 
ATOM   557 C  CD2 . LEU A 1 73  ? 15.101 27.377  24.228 1.00 11.86 ? 557 LEU A CD2 1 
ATOM   558 N  N   . LYS A 1 74  ? 15.286 32.118  22.870 1.00 18.40 ? 558 LYS A N   1 
ATOM   559 C  CA  . LYS A 1 74  ? 14.929 33.481  22.496 1.00 19.09 ? 558 LYS A CA  1 
ATOM   560 C  C   . LYS A 1 74  ? 13.559 33.800  23.059 1.00 18.84 ? 558 LYS A C   1 
ATOM   561 O  O   . LYS A 1 74  ? 12.681 32.934  23.053 1.00 19.88 ? 558 LYS A O   1 
ATOM   562 C  CB  . LYS A 1 74  ? 14.900 33.612  20.974 1.00 19.07 ? 558 LYS A CB  1 
ATOM   563 C  CG  . LYS A 1 74  ? 16.156 33.105  20.306 1.00 20.40 ? 558 LYS A CG  1 
ATOM   564 C  CD  . LYS A 1 74  ? 16.421 33.777  18.963 1.00 21.80 ? 558 LYS A CD  1 
ATOM   565 C  CE  . LYS A 1 74  ? 15.372 33.412  17.937 1.00 24.45 ? 558 LYS A CE  1 
ATOM   566 N  NZ  . LYS A 1 74  ? 15.199 31.937  17.792 1.00 24.59 ? 558 LYS A NZ  1 
ATOM   567 N  N   . PRO A 1 75  ? 13.366 35.035  23.557 1.00 18.86 ? 559 PRO A N   1 
ATOM   568 C  CA  . PRO A 1 75  ? 12.069 35.435  24.091 1.00 18.35 ? 559 PRO A CA  1 
ATOM   569 C  C   . PRO A 1 75  ? 10.972 35.386  23.030 1.00 17.57 ? 559 PRO A C   1 
ATOM   570 O  O   . PRO A 1 75  ? 11.262 35.387  21.832 1.00 17.44 ? 559 PRO A O   1 
ATOM   571 C  CB  . PRO A 1 75  ? 12.308 36.870  24.574 1.00 18.66 ? 559 PRO A CB  1 
ATOM   572 C  CG  . PRO A 1 75  ? 13.767 36.971  24.746 1.00 19.33 ? 559 PRO A CG  1 
ATOM   573 C  CD  . PRO A 1 75  ? 14.365 36.109  23.691 1.00 18.72 ? 559 PRO A CD  1 
ATOM   574 N  N   . GLU A 1 76  ? 9.728  35.275  23.492 1.00 17.42 ? 560 GLU A N   1 
ATOM   575 C  CA  . GLU A 1 76  ? 8.531  35.320  22.645 1.00 17.10 ? 560 GLU A CA  1 
ATOM   576 C  C   . GLU A 1 76  ? 8.542  34.351  21.462 1.00 16.48 ? 560 GLU A C   1 
ATOM   577 O  O   . GLU A 1 76  ? 8.019  34.673  20.400 1.00 16.66 ? 560 GLU A O   1 
ATOM   578 C  CB  . GLU A 1 76  ? 8.302  36.746  22.113 1.00 17.83 ? 560 GLU A CB  1 
ATOM   579 C  CG  . GLU A 1 76  ? 7.668  37.677  23.091 1.00 20.95 ? 560 GLU A CG  1 
ATOM   580 C  CD  . GLU A 1 76  ? 7.548  39.089  22.551 1.00 22.28 ? 560 GLU A CD  1 
ATOM   581 O  OE1 . GLU A 1 76  ? 6.424  39.489  22.205 1.00 26.11 ? 560 GLU A OE1 1 
ATOM   582 O  OE2 . GLU A 1 76  ? 8.574  39.795  22.462 1.00 25.14 ? 560 GLU A OE2 1 
ATOM   583 N  N   . THR A 1 77  ? 9.122  33.170  21.646 1.00 15.25 ? 561 THR A N   1 
ATOM   584 C  CA  . THR A 1 77  ? 9.283  32.224  20.550 1.00 14.98 ? 561 THR A CA  1 
ATOM   585 C  C   . THR A 1 77  ? 8.710  30.850  20.922 1.00 14.43 ? 561 THR A C   1 
ATOM   586 O  O   . THR A 1 77  ? 8.947  30.366  22.025 1.00 14.37 ? 561 THR A O   1 
ATOM   587 C  CB  . THR A 1 77  ? 10.787 32.115  20.142 1.00 15.19 ? 561 THR A CB  1 
ATOM   588 O  OG1 . THR A 1 77  ? 11.262 33.394  19.686 1.00 16.08 ? 561 THR A OG1 1 
ATOM   589 C  CG2 . THR A 1 77  ? 10.984 31.124  19.014 1.00 15.03 ? 561 THR A CG2 1 
ATOM   590 N  N   . THR A 1 78  ? 7.969  30.227  20.000 1.00 14.11 ? 562 THR A N   1 
ATOM   591 C  CA  . THR A 1 78  ? 7.401  28.889  20.229 1.00 13.54 ? 562 THR A CA  1 
ATOM   592 C  C   . THR A 1 78  ? 8.421  27.800  19.881 1.00 12.63 ? 562 THR A C   1 
ATOM   593 O  O   . THR A 1 78  ? 8.991  27.811  18.777 1.00 12.72 ? 562 THR A O   1 
ATOM   594 C  CB  . THR A 1 78  ? 6.117  28.685  19.409 1.00 13.82 ? 562 THR A CB  1 
ATOM   595 O  OG1 . THR A 1 78  ? 5.266  29.833  19.581 1.00 14.20 ? 562 THR A OG1 1 
ATOM   596 C  CG2 . THR A 1 78  ? 5.370  27.398  19.836 1.00 13.37 ? 562 THR A CG2 1 
ATOM   597 N  N   . TYR A 1 79  ? 8.625  26.865  20.818 1.00 11.85 ? 563 TYR A N   1 
ATOM   598 C  CA  . TYR A 1 79  ? 9.575  25.745  20.650 1.00 11.46 ? 563 TYR A CA  1 
ATOM   599 C  C   . TYR A 1 79  ? 8.872  24.385  20.774 1.00 11.06 ? 563 TYR A C   1 
ATOM   600 O  O   . TYR A 1 79  ? 7.849  24.269  21.450 1.00 11.35 ? 563 TYR A O   1 
ATOM   601 C  CB  . TYR A 1 79  ? 10.709 25.781  21.703 1.00 11.72 ? 563 TYR A CB  1 
ATOM   602 C  CG  . TYR A 1 79  ? 11.691 26.913  21.549 1.00 12.69 ? 563 TYR A CG  1 
ATOM   603 C  CD1 . TYR A 1 79  ? 12.909 26.717  20.901 1.00 15.12 ? 563 TYR A CD1 1 
ATOM   604 C  CD2 . TYR A 1 79  ? 11.392 28.191  22.041 1.00 13.05 ? 563 TYR A CD2 1 
ATOM   605 C  CE1 . TYR A 1 79  ? 13.801 27.759  20.731 1.00 15.11 ? 563 TYR A CE1 1 
ATOM   606 C  CE2 . TYR A 1 79  ? 12.279 29.232  21.887 1.00 14.69 ? 563 TYR A CE2 1 
ATOM   607 C  CZ  . TYR A 1 79  ? 13.482 29.011  21.230 1.00 15.42 ? 563 TYR A CZ  1 
ATOM   608 O  OH  . TYR A 1 79  ? 14.373 30.036  21.085 1.00 15.99 ? 563 TYR A OH  1 
ATOM   609 N  N   . ALA A 1 80  ? 9.454  23.367  20.145 1.00 10.42 ? 564 ALA A N   1 
ATOM   610 C  CA  . ALA A 1 80  ? 9.163  21.946  20.436 1.00 10.01 ? 564 ALA A CA  1 
ATOM   611 C  C   . ALA A 1 80  ? 10.326 21.390  21.228 1.00 10.47 ? 564 ALA A C   1 
ATOM   612 O  O   . ALA A 1 80  ? 11.480 21.681  20.891 1.00 8.82  ? 564 ALA A O   1 
ATOM   613 C  CB  . ALA A 1 80  ? 8.991  21.139  19.126 1.00 11.19 ? 564 ALA A CB  1 
ATOM   614 N  N   . VAL A 1 81  ? 10.012 20.604  22.266 1.00 10.25 ? 565 VAL A N   1 
ATOM   615 C  CA  . VAL A 1 81  ? 11.017 19.873  23.050 1.00 10.44 ? 565 VAL A CA  1 
ATOM   616 C  C   . VAL A 1 81  ? 10.621 18.395  23.187 1.00 11.17 ? 565 VAL A C   1 
ATOM   617 O  O   . VAL A 1 81  ? 9.440  18.046  23.224 1.00 11.23 ? 565 VAL A O   1 
ATOM   618 C  CB  . VAL A 1 81  ? 11.273 20.536  24.430 1.00 10.82 ? 565 VAL A CB  1 
ATOM   619 C  CG1 . VAL A 1 81  ? 10.052 20.509  25.325 1.00 10.53 ? 565 VAL A CG1 1 
ATOM   620 C  CG2 . VAL A 1 81  ? 12.482 19.921  25.142 1.00 9.82  ? 565 VAL A CG2 1 
ATOM   621 N  N   . ARG A 1 82  ? 11.637 17.543  23.192 1.00 11.15 ? 566 ARG A N   1 
ATOM   622 C  CA  . ARG A 1 82  ? 11.479 16.114  23.451 1.00 12.03 ? 566 ARG A CA  1 
ATOM   623 C  C   . ARG A 1 82  ? 12.669 15.630  24.294 1.00 12.11 ? 566 ARG A C   1 
ATOM   624 O  O   . ARG A 1 82  ? 13.711 16.305  24.355 1.00 10.70 ? 566 ARG A O   1 
ATOM   625 C  CB  . ARG A 1 82  ? 11.371 15.364  22.117 1.00 12.19 ? 566 ARG A CB  1 
ATOM   626 C  CG  . ARG A 1 82  ? 12.616 15.446  21.242 1.00 13.45 ? 566 ARG A CG  1 
ATOM   627 C  CD  . ARG A 1 82  ? 12.290 15.197  19.766 1.00 19.47 ? 566 ARG A CD  1 
ATOM   628 N  NE  . ARG A 1 82  ? 13.494 14.746  19.077 1.00 23.30 ? 566 ARG A NE  1 
ATOM   629 C  CZ  . ARG A 1 82  ? 13.563 14.337  17.811 1.00 22.90 ? 566 ARG A CZ  1 
ATOM   630 N  NH1 . ARG A 1 82  ? 12.486 14.289  17.038 1.00 22.68 ? 566 ARG A NH1 1 
ATOM   631 N  NH2 . ARG A 1 82  ? 14.736 13.966  17.323 1.00 21.55 ? 566 ARG A NH2 1 
ATOM   632 N  N   . LEU A 1 83  ? 12.481 14.485  24.950 1.00 12.88 ? 567 LEU A N   1 
ATOM   633 C  CA  . LEU A 1 83  ? 13.440 13.885  25.870 1.00 13.69 ? 567 LEU A CA  1 
ATOM   634 C  C   . LEU A 1 83  ? 13.649 12.427  25.540 1.00 13.10 ? 567 LEU A C   1 
ATOM   635 O  O   . LEU A 1 83  ? 12.701 11.725  25.202 1.00 12.94 ? 567 LEU A O   1 
ATOM   636 C  CB  . LEU A 1 83  ? 12.911 13.909  27.297 1.00 13.99 ? 567 LEU A CB  1 
ATOM   637 C  CG  . LEU A 1 83  ? 12.931 15.158  28.164 1.00 16.54 ? 567 LEU A CG  1 
ATOM   638 C  CD1 . LEU A 1 83  ? 12.443 14.713  29.527 1.00 17.47 ? 567 LEU A CD1 1 
ATOM   639 C  CD2 . LEU A 1 83  ? 14.335 15.746  28.278 1.00 17.95 ? 567 LEU A CD2 1 
ATOM   640 N  N   . ALA A 1 84  ? 14.887 11.985  25.713 1.00 13.29 ? 568 ALA A N   1 
ATOM   641 C  CA  . ALA A 1 84  ? 15.268 10.572  25.622 1.00 13.99 ? 568 ALA A CA  1 
ATOM   642 C  C   . ALA A 1 84  ? 16.174 10.230  26.798 1.00 13.59 ? 568 ALA A C   1 
ATOM   643 O  O   . ALA A 1 84  ? 16.937 11.080  27.268 1.00 14.69 ? 568 ALA A O   1 
ATOM   644 C  CB  . ALA A 1 84  ? 15.979 10.302  24.318 1.00 13.39 ? 568 ALA A CB  1 
ATOM   645 N  N   . ALA A 1 85  ? 16.046 8.992   27.283 1.00 13.98 ? 569 ALA A N   1 
ATOM   646 C  CA  . ALA A 1 85  ? 16.910 8.420   28.305 1.00 13.28 ? 569 ALA A CA  1 
ATOM   647 C  C   . ALA A 1 85  ? 18.035 7.644   27.652 1.00 13.19 ? 569 ALA A C   1 
ATOM   648 O  O   . ALA A 1 85  ? 17.834 6.944   26.641 1.00 13.36 ? 569 ALA A O   1 
ATOM   649 C  CB  . ALA A 1 85  ? 16.130 7.485   29.223 1.00 12.68 ? 569 ALA A CB  1 
ATOM   650 N  N   . LEU A 1 86  ? 19.212 7.780   28.237 1.00 12.65 ? 570 LEU A N   1 
ATOM   651 C  CA  . LEU A 1 86  ? 20.378 7.010   27.837 1.00 12.75 ? 570 LEU A CA  1 
ATOM   652 C  C   . LEU A 1 86  ? 20.650 5.932   28.880 1.00 13.11 ? 570 LEU A C   1 
ATOM   653 O  O   . LEU A 1 86  ? 20.745 6.248   30.077 1.00 13.59 ? 570 LEU A O   1 
ATOM   654 C  CB  . LEU A 1 86  ? 21.607 7.920   27.745 1.00 13.04 ? 570 LEU A CB  1 
ATOM   655 C  CG  . LEU A 1 86  ? 22.927 7.314   27.262 1.00 11.52 ? 570 LEU A CG  1 
ATOM   656 C  CD1 . LEU A 1 86  ? 22.947 7.140   25.741 1.00 12.92 ? 570 LEU A CD1 1 
ATOM   657 C  CD2 . LEU A 1 86  ? 24.053 8.206   27.687 1.00 11.73 ? 570 LEU A CD2 1 
ATOM   658 N  N   . ASN A 1 87  ? 20.761 4.673   28.442 1.00 12.98 ? 571 ASN A N   1 
ATOM   659 C  CA  . ASN A 1 87  ? 21.391 3.651   29.302 1.00 13.09 ? 571 ASN A CA  1 
ATOM   660 C  C   . ASN A 1 87  ? 22.674 3.082   28.685 1.00 13.67 ? 571 ASN A C   1 
ATOM   661 O  O   . ASN A 1 87  ? 23.165 3.603   27.675 1.00 12.68 ? 571 ASN A O   1 
ATOM   662 C  CB  . ASN A 1 87  ? 20.410 2.542   29.766 1.00 12.78 ? 571 ASN A CB  1 
ATOM   663 C  CG  . ASN A 1 87  ? 19.956 1.609   28.653 1.00 12.82 ? 571 ASN A CG  1 
ATOM   664 O  OD1 . ASN A 1 87  ? 20.420 1.661   27.495 1.00 12.14 ? 571 ASN A OD1 1 
ATOM   665 N  ND2 . ASN A 1 87  ? 19.001 0.747   29.000 1.00 12.12 ? 571 ASN A ND2 1 
ATOM   666 N  N   . GLY A 1 88  ? 23.203 2.020   29.297 1.00 13.47 ? 572 GLY A N   1 
ATOM   667 C  CA  . GLY A 1 88  ? 24.417 1.352   28.838 1.00 14.28 ? 572 GLY A CA  1 
ATOM   668 C  C   . GLY A 1 88  ? 24.378 0.853   27.399 1.00 14.76 ? 572 GLY A C   1 
ATOM   669 O  O   . GLY A 1 88  ? 25.435 0.702   26.782 1.00 15.47 ? 572 GLY A O   1 
ATOM   670 N  N   . LYS A 1 89  ? 23.174 0.616   26.873 1.00 14.85 ? 573 LYS A N   1 
ATOM   671 C  CA  . LYS A 1 89  ? 22.966 0.128   25.505 1.00 15.64 ? 573 LYS A CA  1 
ATOM   672 C  C   . LYS A 1 89  ? 22.945 1.268   24.490 1.00 15.48 ? 573 LYS A C   1 
ATOM   673 O  O   . LYS A 1 89  ? 23.200 1.059   23.314 1.00 16.08 ? 573 LYS A O   1 
ATOM   674 C  CB  . LYS A 1 89  ? 21.659 -0.688  25.391 1.00 15.51 ? 573 LYS A CB  1 
ATOM   675 C  CG  . LYS A 1 89  ? 21.466 -1.826  26.431 1.00 18.50 ? 573 LYS A CG  1 
ATOM   676 C  CD  . LYS A 1 89  ? 22.646 -2.773  26.493 1.00 20.46 ? 573 LYS A CD  1 
ATOM   677 C  CE  . LYS A 1 89  ? 22.616 -3.740  25.325 1.00 20.92 ? 573 LYS A CE  1 
ATOM   678 N  NZ  . LYS A 1 89  ? 23.750 -4.724  25.400 1.00 20.95 ? 573 LYS A NZ  1 
ATOM   679 N  N   . GLY A 1 90  ? 22.637 2.477   24.955 1.00 15.16 ? 574 GLY A N   1 
ATOM   680 C  CA  . GLY A 1 90  ? 22.567 3.665   24.084 1.00 14.53 ? 574 GLY A CA  1 
ATOM   681 C  C   . GLY A 1 90  ? 21.317 4.475   24.377 1.00 14.92 ? 574 GLY A C   1 
ATOM   682 O  O   . GLY A 1 90  ? 20.722 4.335   25.458 1.00 15.21 ? 574 GLY A O   1 
ATOM   683 N  N   . LEU A 1 91  ? 20.920 5.315   23.420 1.00 14.75 ? 575 LEU A N   1 
ATOM   684 C  CA  . LEU A 1 91  ? 19.738 6.167   23.557 1.00 14.73 ? 575 LEU A CA  1 
ATOM   685 C  C   . LEU A 1 91  ? 18.403 5.455   23.289 1.00 14.64 ? 575 LEU A C   1 
ATOM   686 O  O   . LEU A 1 91  ? 18.218 4.788   22.257 1.00 15.25 ? 575 LEU A O   1 
ATOM   687 C  CB  . LEU A 1 91  ? 19.881 7.403   22.655 1.00 14.83 ? 575 LEU A CB  1 
ATOM   688 C  CG  . LEU A 1 91  ? 19.252 8.704   23.159 1.00 15.48 ? 575 LEU A CG  1 
ATOM   689 C  CD1 . LEU A 1 91  ? 19.888 9.178   24.460 1.00 15.43 ? 575 LEU A CD1 1 
ATOM   690 C  CD2 . LEU A 1 91  ? 19.388 9.773   22.076 1.00 15.93 ? 575 LEU A CD2 1 
ATOM   691 N  N   . GLY A 1 92  ? 17.472 5.614   24.224 1.00 14.48 ? 576 GLY A N   1 
ATOM   692 C  CA  . GLY A 1 92  ? 16.129 5.052   24.095 1.00 14.12 ? 576 GLY A CA  1 
ATOM   693 C  C   . GLY A 1 92  ? 15.141 5.871   23.271 1.00 14.50 ? 576 GLY A C   1 
ATOM   694 O  O   . GLY A 1 92  ? 15.499 6.872   22.634 1.00 14.06 ? 576 GLY A O   1 
ATOM   695 N  N   . GLU A 1 93  ? 13.883 5.431   23.289 1.00 14.38 ? 577 GLU A N   1 
ATOM   696 C  CA  . GLU A 1 93  ? 12.821 6.065   22.527 1.00 14.02 ? 577 GLU A CA  1 
ATOM   697 C  C   . GLU A 1 93  ? 12.650 7.525   22.952 1.00 13.98 ? 577 GLU A C   1 
ATOM   698 O  O   . GLU A 1 93  ? 12.631 7.820   24.140 1.00 13.32 ? 577 GLU A O   1 
ATOM   699 C  CB  . GLU A 1 93  ? 11.497 5.331   22.781 1.00 14.15 ? 577 GLU A CB  1 
ATOM   700 C  CG  . GLU A 1 93  ? 10.546 5.445   21.621 1.00 16.35 ? 577 GLU A CG  1 
ATOM   701 C  CD  . GLU A 1 93  ? 9.175  4.882   21.924 1.00 18.49 ? 577 GLU A CD  1 
ATOM   702 O  OE1 . GLU A 1 93  ? 9.036  4.135   22.911 1.00 19.96 ? 577 GLU A OE1 1 
ATOM   703 O  OE2 . GLU A 1 93  ? 8.230  5.195   21.170 1.00 22.31 ? 577 GLU A OE2 1 
ATOM   704 N  N   . ILE A 1 94  ? 12.532 8.423   21.974 1.00 13.86 ? 578 ILE A N   1 
ATOM   705 C  CA  . ILE A 1 94  ? 12.258 9.829   22.244 1.00 14.49 ? 578 ILE A CA  1 
ATOM   706 C  C   . ILE A 1 94  ? 10.803 9.989   22.665 1.00 14.37 ? 578 ILE A C   1 
ATOM   707 O  O   . ILE A 1 94  ? 9.902  9.311   22.132 1.00 14.90 ? 578 ILE A O   1 
ATOM   708 C  CB  . ILE A 1 94  ? 12.540 10.733  21.019 1.00 14.93 ? 578 ILE A CB  1 
ATOM   709 C  CG1 . ILE A 1 94  ? 11.568 10.427  19.867 1.00 15.03 ? 578 ILE A CG1 1 
ATOM   710 C  CG2 . ILE A 1 94  ? 13.983 10.561  20.555 1.00 14.48 ? 578 ILE A CG2 1 
ATOM   711 C  CD1 . ILE A 1 94  ? 11.881 11.146  18.545 1.00 15.98 ? 578 ILE A CD1 1 
ATOM   712 N  N   . SER A 1 95  ? 10.584 10.884  23.618 1.00 14.49 ? 579 SER A N   1 
ATOM   713 C  CA  . SER A 1 95  ? 9.235  11.247  24.056 1.00 15.04 ? 579 SER A CA  1 
ATOM   714 C  C   . SER A 1 95  ? 8.439  11.875  22.903 1.00 15.51 ? 579 SER A C   1 
ATOM   715 O  O   . SER A 1 95  ? 9.023  12.296  21.903 1.00 15.70 ? 579 SER A O   1 
ATOM   716 C  CB  . SER A 1 95  ? 9.289  12.187  25.266 1.00 14.28 ? 579 SER A CB  1 
ATOM   717 O  OG  . SER A 1 95  ? 9.740  13.497  24.923 1.00 15.16 ? 579 SER A OG  1 
ATOM   718 N  N   . ALA A 1 96  ? 7.111  11.916  23.025 1.00 16.04 ? 580 ALA A N   1 
ATOM   719 C  CA  . ALA A 1 96  ? 6.318  12.768  22.137 1.00 16.09 ? 580 ALA A CA  1 
ATOM   720 C  C   . ALA A 1 96  ? 6.753  14.217  22.359 1.00 15.84 ? 580 ALA A C   1 
ATOM   721 O  O   . ALA A 1 96  ? 7.078  14.600  23.485 1.00 15.60 ? 580 ALA A O   1 
ATOM   722 C  CB  . ALA A 1 96  ? 4.819  12.613  22.405 1.00 16.18 ? 580 ALA A CB  1 
ATOM   723 N  N   . ALA A 1 97  ? 6.802  15.009  21.290 1.00 15.59 ? 581 ALA A N   1 
ATOM   724 C  CA  . ALA A 1 97  ? 7.204  16.417  21.443 1.00 15.35 ? 581 ALA A CA  1 
ATOM   725 C  C   . ALA A 1 97  ? 6.165  17.249  22.206 1.00 15.65 ? 581 ALA A C   1 
ATOM   726 O  O   . ALA A 1 97  ? 4.956  17.036  22.058 1.00 15.89 ? 581 ALA A O   1 
ATOM   727 C  CB  . ALA A 1 97  ? 7.511  17.036  20.104 1.00 15.39 ? 581 ALA A CB  1 
ATOM   728 N  N   . SER A 1 98  ? 6.642  18.173  23.036 1.00 15.69 ? 582 SER A N   1 
ATOM   729 C  CA  . SER A 1 98  ? 5.772  19.119  23.735 1.00 16.44 ? 582 SER A CA  1 
ATOM   730 C  C   . SER A 1 98  ? 6.104  20.524  23.270 1.00 16.69 ? 582 SER A C   1 
ATOM   731 O  O   . SER A 1 98  ? 7.274  20.894  23.197 1.00 16.34 ? 582 SER A O   1 
ATOM   732 C  CB  . SER A 1 98  ? 5.982  19.032  25.243 1.00 16.30 ? 582 SER A CB  1 
ATOM   733 O  OG  . SER A 1 98  ? 5.134  19.952  25.931 1.00 18.58 ? 582 SER A OG  1 
ATOM   734 N  N   . GLU A 1 99  ? 5.078  21.309  22.963 1.00 16.97 ? 583 GLU A N   1 
ATOM   735 C  CA  . GLU A 1 99  ? 5.300  22.630  22.415 1.00 17.33 ? 583 GLU A CA  1 
ATOM   736 C  C   . GLU A 1 99  ? 5.037  23.675  23.509 1.00 17.10 ? 583 GLU A C   1 
ATOM   737 O  O   . GLU A 1 99  ? 4.062  23.563  24.258 1.00 17.97 ? 583 GLU A O   1 
ATOM   738 C  CB  . GLU A 1 99  ? 4.413  22.841  21.177 1.00 17.63 ? 583 GLU A CB  1 
ATOM   739 C  CG  . GLU A 1 99  ? 4.897  22.151  19.865 1.00 21.23 ? 583 GLU A CG  1 
ATOM   740 C  CD  . GLU A 1 99  ? 4.482  20.657  19.700 1.00 25.59 ? 583 GLU A CD  1 
ATOM   741 O  OE1 . GLU A 1 99  ? 3.266  20.348  19.573 1.00 25.52 ? 583 GLU A OE1 1 
ATOM   742 O  OE2 . GLU A 1 99  ? 5.381  19.781  19.651 1.00 25.55 ? 583 GLU A OE2 1 
ATOM   743 N  N   . PHE A 1 100 ? 5.923  24.662  23.624 1.00 15.17 ? 584 PHE A N   1 
ATOM   744 C  CA  . PHE A 1 100 ? 5.731  25.779  24.548 1.00 13.94 ? 584 PHE A CA  1 
ATOM   745 C  C   . PHE A 1 100 ? 6.181  27.098  23.896 1.00 13.79 ? 584 PHE A C   1 
ATOM   746 O  O   . PHE A 1 100 ? 6.781  27.090  22.810 1.00 12.81 ? 584 PHE A O   1 
ATOM   747 C  CB  . PHE A 1 100 ? 6.505  25.549  25.851 1.00 13.37 ? 584 PHE A CB  1 
ATOM   748 C  CG  . PHE A 1 100 ? 8.001  25.505  25.662 1.00 13.03 ? 584 PHE A CG  1 
ATOM   749 C  CD1 . PHE A 1 100 ? 8.779  26.659  25.813 1.00 11.52 ? 584 PHE A CD1 1 
ATOM   750 C  CD2 . PHE A 1 100 ? 8.637  24.308  25.319 1.00 10.51 ? 584 PHE A CD2 1 
ATOM   751 C  CE1 . PHE A 1 100 ? 10.174 26.610  25.615 1.00 12.49 ? 584 PHE A CE1 1 
ATOM   752 C  CE2 . PHE A 1 100 ? 10.009 24.251  25.128 1.00 10.30 ? 584 PHE A CE2 1 
ATOM   753 C  CZ  . PHE A 1 100 ? 10.779 25.401  25.263 1.00 9.24  ? 584 PHE A CZ  1 
ATOM   754 N  N   . LYS A 1 101 ? 5.905  28.215  24.573 1.00 13.70 ? 585 LYS A N   1 
ATOM   755 C  CA  . LYS A 1 101 ? 6.331  29.545  24.106 1.00 13.62 ? 585 LYS A CA  1 
ATOM   756 C  C   . LYS A 1 101 ? 7.038  30.314  25.222 1.00 13.86 ? 585 LYS A C   1 
ATOM   757 O  O   . LYS A 1 101 ? 6.541  30.401  26.352 1.00 13.66 ? 585 LYS A O   1 
ATOM   758 C  CB  . LYS A 1 101 ? 5.127  30.349  23.582 1.00 14.31 ? 585 LYS A CB  1 
ATOM   759 C  CG  . LYS A 1 101 ? 5.527  31.537  22.693 1.00 12.69 ? 585 LYS A CG  1 
ATOM   760 C  CD  . LYS A 1 101 ? 4.276  32.255  22.159 1.00 14.15 ? 585 LYS A CD  1 
ATOM   761 C  CE  . LYS A 1 101 ? 4.667  33.198  21.036 1.00 15.37 ? 585 LYS A CE  1 
ATOM   762 N  NZ  . LYS A 1 101 ? 3.618  34.208  20.724 1.00 19.04 ? 585 LYS A NZ  1 
ATOM   763 N  N   . THR A 1 102 ? 8.205  30.869  24.905 1.00 13.46 ? 586 THR A N   1 
ATOM   764 C  CA  . THR A 1 102 ? 8.925  31.679  25.876 1.00 14.17 ? 586 THR A CA  1 
ATOM   765 C  C   . THR A 1 102 ? 8.169  32.992  26.047 1.00 14.76 ? 586 THR A C   1 
ATOM   766 O  O   . THR A 1 102 ? 7.588  33.513  25.092 1.00 15.24 ? 586 THR A O   1 
ATOM   767 C  CB  . THR A 1 102 ? 10.407 31.936  25.453 1.00 12.79 ? 586 THR A CB  1 
ATOM   768 O  OG1 . THR A 1 102 ? 10.468 32.314  24.070 1.00 13.37 ? 586 THR A OG1 1 
ATOM   769 C  CG2 . THR A 1 102 ? 11.271 30.680  25.658 1.00 13.66 ? 586 THR A CG2 1 
ATOM   770 N  N   . GLN A 1 103 ? 8.156  33.497  27.274 1.00 16.28 ? 587 GLN A N   1 
ATOM   771 C  CA  . GLN A 1 103 ? 7.536  34.773  27.598 1.00 17.09 ? 587 GLN A CA  1 
ATOM   772 C  C   . GLN A 1 103 ? 8.259  35.961  26.963 1.00 18.02 ? 587 GLN A C   1 
ATOM   773 O  O   . GLN A 1 103 ? 9.452  35.876  26.665 1.00 17.79 ? 587 GLN A O   1 
ATOM   774 C  CB  . GLN A 1 103 ? 7.495  34.960  29.117 1.00 17.08 ? 587 GLN A CB  1 
ATOM   775 C  CG  . GLN A 1 103 ? 6.719  33.864  29.827 1.00 17.25 ? 587 GLN A CG  1 
ATOM   776 C  CD  . GLN A 1 103 ? 6.477  34.205  31.282 1.00 19.25 ? 587 GLN A CD  1 
ATOM   777 O  OE1 . GLN A 1 103 ? 5.908  35.258  31.594 1.00 19.77 ? 587 GLN A OE1 1 
ATOM   778 N  NE2 . GLN A 1 103 ? 6.906  33.325  32.182 1.00 19.28 ? 587 GLN A NE2 1 
ATOM   779 N  N   . PRO A 1 104 ? 7.525  37.073  26.750 1.00 19.15 ? 588 PRO A N   1 
ATOM   780 C  CA  . PRO A 1 104 ? 8.116  38.346  26.366 1.00 20.37 ? 588 PRO A CA  1 
ATOM   781 C  C   . PRO A 1 104 ? 9.017  38.878  27.471 1.00 21.79 ? 588 PRO A C   1 
ATOM   782 O  O   . PRO A 1 104 ? 8.723  38.685  28.660 1.00 21.48 ? 588 PRO A O   1 
ATOM   783 C  CB  . PRO A 1 104 ? 6.895  39.272  26.186 1.00 20.11 ? 588 PRO A CB  1 
ATOM   784 C  CG  . PRO A 1 104 ? 5.793  38.633  26.878 1.00 20.15 ? 588 PRO A CG  1 
ATOM   785 C  CD  . PRO A 1 104 ? 6.055  37.149  26.835 1.00 19.22 ? 588 PRO A CD  1 
ATOM   786 N  N   . VAL A 1 105 ? 10.120 39.519  27.084 1.00 23.49 ? 589 VAL A N   1 
ATOM   787 C  CA  . VAL A 1 105 ? 10.914 40.283  28.043 1.00 25.15 ? 589 VAL A CA  1 
ATOM   788 C  C   . VAL A 1 105 ? 10.045 41.418  28.600 1.00 26.12 ? 589 VAL A C   1 
ATOM   789 O  O   . VAL A 1 105 ? 9.672  41.416  29.783 1.00 26.71 ? 589 VAL A O   1 
ATOM   790 C  CB  . VAL A 1 105 ? 12.194 40.873  27.419 1.00 25.22 ? 589 VAL A CB  1 
ATOM   791 C  CG1 . VAL A 1 105 ? 13.060 41.527  28.504 1.00 25.83 ? 589 VAL A CG1 1 
ATOM   792 C  CG2 . VAL A 1 105 ? 12.983 39.800  26.676 1.00 25.67 ? 589 VAL A CG2 1 
ATOM   793 O  OXT . VAL A 1 105 ? 9.677  42.354  27.866 1.00 27.45 ? 589 VAL A OXT 1 
HETATM 794 NA NA  . NA  B 2 .   ? 3.570  12.339  34.874 1.00 20.09 ? 101 NA  A NA  1 
HETATM 795 O  O   . HOH C 3 .   ? 8.023  34.076  17.706 1.00 13.61 ? 1   HOH A O   1 
HETATM 796 O  O   . HOH C 3 .   ? 14.211 7.024   26.278 1.00 8.27  ? 2   HOH A O   1 
HETATM 797 O  O   . HOH C 3 .   ? 18.811 20.771  34.612 1.00 13.34 ? 3   HOH A O   1 
HETATM 798 O  O   . HOH C 3 .   ? 5.960  10.499  25.433 1.00 20.40 ? 4   HOH A O   1 
HETATM 799 O  O   . HOH C 3 .   ? 23.171 19.421  32.419 1.00 21.77 ? 5   HOH A O   1 
HETATM 800 O  O   . HOH C 3 .   ? 22.846 1.214   31.948 1.00 22.93 ? 6   HOH A O   1 
HETATM 801 O  O   . HOH C 3 .   ? 16.618 28.980  19.264 1.00 20.04 ? 7   HOH A O   1 
HETATM 802 O  O   . HOH C 3 .   ? 9.148  29.635  16.384 1.00 20.67 ? 8   HOH A O   1 
HETATM 803 O  O   . HOH C 3 .   ? 20.185 16.664  35.663 1.00 20.69 ? 9   HOH A O   1 
HETATM 804 O  O   . HOH C 3 .   ? 4.189  36.159  23.538 1.00 22.91 ? 10  HOH A O   1 
HETATM 805 O  O   . HOH C 3 .   ? 17.791 18.253  35.658 1.00 17.67 ? 11  HOH A O   1 
HETATM 806 O  O   . HOH C 3 .   ? 17.473 -1.652  35.448 1.00 29.16 ? 12  HOH A O   1 
HETATM 807 O  O   . HOH C 3 .   ? 12.649 -3.599  30.681 1.00 27.39 ? 13  HOH A O   1 
HETATM 808 O  O   . HOH C 3 .   ? 16.966 25.976  10.705 1.00 19.99 ? 14  HOH A O   1 
HETATM 809 O  O   . HOH C 3 .   ? 6.959  29.238  13.866 1.00 17.25 ? 15  HOH A O   1 
HETATM 810 O  O   . HOH C 3 .   ? 5.912  13.447  26.353 1.00 26.46 ? 16  HOH A O   1 
HETATM 811 O  O   . HOH C 3 .   ? 25.403 5.057   26.849 1.00 11.91 ? 17  HOH A O   1 
HETATM 812 O  O   . HOH C 3 .   ? 21.991 4.040   20.400 1.00 25.52 ? 18  HOH A O   1 
HETATM 813 O  O   . HOH C 3 .   ? 7.306  31.476  17.387 1.00 14.01 ? 19  HOH A O   1 
HETATM 814 O  O   . HOH C 3 .   ? 7.478  4.168   25.723 1.00 26.69 ? 20  HOH A O   1 
HETATM 815 O  O   . HOH C 3 .   ? 10.403 18.473  42.237 1.00 20.39 ? 21  HOH A O   1 
HETATM 816 O  O   . HOH C 3 .   ? -0.874 22.657  35.165 1.00 33.20 ? 22  HOH A O   1 
HETATM 817 O  O   . HOH C 3 .   ? 24.413 16.936  42.495 1.00 24.78 ? 23  HOH A O   1 
HETATM 818 O  O   . HOH C 3 .   ? 8.640  12.905  19.258 1.00 22.78 ? 24  HOH A O   1 
HETATM 819 O  O   . HOH C 3 .   ? 20.672 23.638  31.865 1.00 28.90 ? 25  HOH A O   1 
HETATM 820 O  O   . HOH C 3 .   ? 19.559 3.550   20.182 1.00 24.82 ? 26  HOH A O   1 
HETATM 821 O  O   . HOH C 3 .   ? 5.226  35.803  33.741 1.00 25.61 ? 27  HOH A O   1 
HETATM 822 O  O   . HOH C 3 .   ? 17.497 18.581  11.019 1.00 26.88 ? 28  HOH A O   1 
HETATM 823 O  O   . HOH C 3 .   ? 5.645  35.805  19.528 1.00 28.31 ? 29  HOH A O   1 
HETATM 824 O  O   . HOH C 3 .   ? 17.873 0.830   20.460 1.00 25.77 ? 30  HOH A O   1 
HETATM 825 O  O   . HOH C 3 .   ? 4.026  27.838  33.244 1.00 24.00 ? 31  HOH A O   1 
HETATM 826 O  O   . HOH C 3 .   ? 10.212 40.015  24.284 1.00 23.82 ? 32  HOH A O   1 
HETATM 827 O  O   . HOH C 3 .   ? 25.290 15.217  31.754 1.00 22.99 ? 33  HOH A O   1 
HETATM 828 O  O   . HOH C 3 .   ? 24.458 25.316  28.904 1.00 22.49 ? 34  HOH A O   1 
HETATM 829 O  O   . HOH C 3 .   ? 16.230 8.387   35.848 1.00 28.39 ? 35  HOH A O   1 
HETATM 830 O  O   . HOH C 3 .   ? 21.274 21.421  33.700 1.00 24.02 ? 36  HOH A O   1 
HETATM 831 O  O   . HOH C 3 .   ? 5.770  41.739  22.769 1.00 25.51 ? 37  HOH A O   1 
HETATM 832 O  O   . HOH C 3 .   ? 6.005  29.176  33.252 1.00 24.93 ? 38  HOH A O   1 
HETATM 833 O  O   . HOH C 3 .   ? 22.845 6.666   36.364 1.00 30.93 ? 39  HOH A O   1 
HETATM 834 O  O   . HOH C 3 .   ? 9.827  14.342  17.351 1.00 24.26 ? 40  HOH A O   1 
HETATM 835 O  O   . HOH C 3 .   ? 8.398  13.090  37.440 1.00 24.33 ? 41  HOH A O   1 
HETATM 836 O  O   . HOH C 3 .   ? 15.612 25.507  16.010 1.00 20.87 ? 42  HOH A O   1 
HETATM 837 O  O   . HOH C 3 .   ? 23.375 17.529  34.746 1.00 31.24 ? 43  HOH A O   1 
HETATM 838 O  O   . HOH C 3 .   ? 4.633  22.434  26.855 1.00 29.03 ? 44  HOH A O   1 
HETATM 839 O  O   . HOH C 3 .   ? 27.450 15.092  36.660 1.00 19.29 ? 45  HOH A O   1 
HETATM 840 O  O   . HOH C 3 .   ? 9.507  26.940  37.035 0.50 24.20 ? 46  HOH A O   1 
HETATM 841 O  O   . HOH C 3 .   ? 8.872  14.129  39.720 1.00 48.92 ? 47  HOH A O   1 
HETATM 842 O  O   . HOH C 3 .   ? 7.888  4.810   29.267 1.00 30.01 ? 48  HOH A O   1 
HETATM 843 O  O   . HOH C 3 .   ? 8.269  3.844   35.704 1.00 36.87 ? 49  HOH A O   1 
HETATM 844 O  O   . HOH C 3 .   ? 7.000  6.332   34.702 1.00 28.44 ? 50  HOH A O   1 
HETATM 845 O  O   . HOH C 3 .   ? 20.819 18.615  18.600 0.50 10.43 ? 51  HOH A O   1 
HETATM 846 O  O   . HOH C 3 .   ? 17.801 22.785  36.662 1.00 23.36 ? 52  HOH A O   1 
HETATM 847 O  O   . HOH C 3 .   ? 20.751 25.740  34.206 1.00 36.36 ? 53  HOH A O   1 
HETATM 848 O  O   . HOH C 3 .   ? 12.312 39.944  21.876 1.00 25.67 ? 54  HOH A O   1 
HETATM 849 O  O   . HOH C 3 .   ? 12.942 37.239  20.606 1.00 21.13 ? 55  HOH A O   1 
HETATM 850 O  O   . HOH C 3 .   ? 4.773  38.203  21.392 1.00 29.32 ? 56  HOH A O   1 
HETATM 851 O  O   . HOH C 3 .   ? 4.879  34.096  25.140 1.00 15.84 ? 57  HOH A O   1 
HETATM 852 O  O   . HOH C 3 .   ? 16.624 8.465   20.461 1.00 20.03 ? 58  HOH A O   1 
HETATM 853 O  O   . HOH C 3 .   ? 2.547  33.867  18.057 1.00 33.14 ? 59  HOH A O   1 
HETATM 854 O  O   . HOH C 3 .   ? 11.371 23.582  8.794  1.00 29.36 ? 60  HOH A O   1 
HETATM 855 O  O   . HOH C 3 .   ? 13.624 25.997  8.319  1.00 41.75 ? 61  HOH A O   1 
HETATM 856 O  O   . HOH C 3 .   ? 2.401  20.121  21.671 1.00 30.63 ? 62  HOH A O   1 
HETATM 857 O  O   . HOH C 3 .   ? 6.700  7.597   30.575 1.00 28.32 ? 63  HOH A O   1 
HETATM 858 O  O   . HOH C 3 .   ? 3.778  26.075  37.921 1.00 40.11 ? 64  HOH A O   1 
HETATM 859 O  O   . HOH C 3 .   ? 23.748 16.749  23.381 1.00 26.18 ? 65  HOH A O   1 
HETATM 860 O  O   . HOH C 3 .   ? 23.698 2.089   20.899 1.00 35.00 ? 66  HOH A O   1 
HETATM 861 O  O   . HOH C 3 .   ? 18.282 27.459  21.895 1.00 31.62 ? 67  HOH A O   1 
HETATM 862 O  O   . HOH C 3 .   ? 7.318  8.725   21.211 1.00 34.28 ? 68  HOH A O   1 
HETATM 863 O  O   . HOH C 3 .   ? 24.730 -8.930  27.198 1.00 34.45 ? 69  HOH A O   1 
HETATM 864 O  O   . HOH C 3 .   ? 23.903 -1.212  22.156 1.00 31.09 ? 70  HOH A O   1 
HETATM 865 O  O   . HOH C 3 .   ? 23.330 10.558  37.374 1.00 22.63 ? 71  HOH A O   1 
HETATM 866 O  O   . HOH C 3 .   ? 2.751  35.145  22.940 1.00 25.09 ? 72  HOH A O   1 
HETATM 867 O  O   . HOH C 3 .   ? 6.650  1.104   35.008 1.00 33.63 ? 73  HOH A O   1 
HETATM 868 O  O   . HOH C 3 .   ? 1.146  32.407  20.829 1.00 15.19 ? 74  HOH A O   1 
HETATM 869 O  O   . HOH C 3 .   ? 16.724 4.091   19.977 1.00 30.45 ? 75  HOH A O   1 
HETATM 870 O  O   . HOH C 3 .   ? 17.216 3.692   35.904 1.00 25.51 ? 76  HOH A O   1 
HETATM 871 O  O   . HOH C 3 .   ? 21.279 15.133  18.513 0.50 24.33 ? 77  HOH A O   1 
HETATM 872 O  O   . HOH C 3 .   ? 18.732 -2.021  22.288 1.00 37.60 ? 78  HOH A O   1 
HETATM 873 O  O   . HOH C 3 .   ? 17.949 27.655  12.548 1.00 35.87 ? 79  HOH A O   1 
HETATM 874 O  O   . HOH C 3 .   ? 6.393  14.090  18.662 1.00 25.81 ? 80  HOH A O   1 
HETATM 875 O  O   . HOH C 3 .   ? 5.877  8.039   27.132 1.00 29.06 ? 81  HOH A O   1 
HETATM 876 O  O   . HOH C 3 .   ? 21.000 31.483  21.619 1.00 27.54 ? 82  HOH A O   1 
HETATM 877 O  O   . HOH C 3 .   ? 3.039  16.177  20.420 1.00 33.90 ? 83  HOH A O   1 
HETATM 878 O  O   . HOH C 3 .   ? 2.724  13.790  27.977 1.00 36.78 ? 84  HOH A O   1 
HETATM 879 O  O   . HOH C 3 .   ? 8.936  18.024  16.751 1.00 24.93 ? 85  HOH A O   1 
HETATM 880 O  O   . HOH C 3 .   ? 15.410 24.796  39.196 1.00 41.38 ? 86  HOH A O   1 
HETATM 881 O  O   . HOH C 3 .   ? 0.939  19.673  17.591 1.00 34.75 ? 87  HOH A O   1 
HETATM 882 O  O   . HOH C 3 .   ? 23.890 12.298  20.525 1.00 31.39 ? 88  HOH A O   1 
HETATM 883 O  O   . HOH C 3 .   ? 12.964 -1.125  34.214 1.00 28.47 ? 89  HOH A O   1 
HETATM 884 O  O   . HOH C 3 .   ? 3.021  22.583  29.400 1.00 20.14 ? 90  HOH A O   1 
HETATM 885 O  O   . HOH C 3 .   ? 2.332  24.000  37.254 1.00 53.52 ? 91  HOH A O   1 
HETATM 886 O  O   . HOH C 3 .   ? 11.266 12.817  37.083 1.00 50.01 ? 92  HOH A O   1 
HETATM 887 O  O   . HOH C 3 .   ? 10.465 11.577  39.223 1.00 33.32 ? 93  HOH A O   1 
HETATM 888 O  O   . HOH C 3 .   ? 7.447  10.521  19.219 1.00 33.78 ? 94  HOH A O   1 
HETATM 889 O  O   . HOH C 3 .   ? 0.194  20.083  32.359 1.00 48.40 ? 95  HOH A O   1 
HETATM 890 O  O   . HOH C 3 .   ? 6.761  19.939  39.071 1.00 28.21 ? 96  HOH A O   1 
HETATM 891 O  O   . HOH C 3 .   ? 12.661 4.063   33.997 1.00 33.03 ? 97  HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   485 ?   ?   ?   A . n 
A 1 2   SER 2   486 486 SER SER A . n 
A 1 3   HIS 3   487 487 HIS HIS A . n 
A 1 4   MET 4   488 488 MET MET A . n 
A 1 5   ASP 5   489 489 ASP ASP A . n 
A 1 6   THR 6   490 490 THR THR A . n 
A 1 7   PRO 7   491 491 PRO PRO A . n 
A 1 8   SER 8   492 492 SER SER A . n 
A 1 9   SER 9   493 493 SER SER A . n 
A 1 10  PRO 10  494 494 PRO PRO A . n 
A 1 11  SER 11  495 495 SER SER A . n 
A 1 12  ILE 12  496 496 ILE ILE A . n 
A 1 13  ASP 13  497 497 ASP ASP A . n 
A 1 14  GLN 14  498 498 GLN GLN A . n 
A 1 15  VAL 15  499 499 VAL VAL A . n 
A 1 16  GLU 16  500 500 GLU GLU A . n 
A 1 17  PRO 17  501 501 PRO PRO A . n 
A 1 18  TYR 18  502 502 TYR TYR A . n 
A 1 19  SER 19  503 503 SER SER A . n 
A 1 20  SER 20  504 504 SER SER A . n 
A 1 21  THR 21  505 505 THR THR A . n 
A 1 22  ALA 22  506 506 ALA ALA A . n 
A 1 23  GLN 23  507 507 GLN GLN A . n 
A 1 24  VAL 24  508 508 VAL VAL A . n 
A 1 25  GLN 25  509 509 GLN GLN A . n 
A 1 26  PHE 26  510 510 PHE PHE A . n 
A 1 27  ASP 27  511 511 ASP ASP A . n 
A 1 28  GLU 28  512 512 GLU GLU A . n 
A 1 29  PRO 29  513 513 PRO PRO A . n 
A 1 30  GLU 30  514 514 GLU GLU A . n 
A 1 31  ALA 31  515 515 ALA ALA A . n 
A 1 32  THR 32  516 516 THR THR A . n 
A 1 33  GLY 33  517 517 GLY GLY A . n 
A 1 34  GLY 34  518 518 GLY GLY A . n 
A 1 35  VAL 35  519 519 VAL VAL A . n 
A 1 36  PRO 36  520 520 PRO PRO A . n 
A 1 37  ILE 37  521 521 ILE ILE A . n 
A 1 38  LEU 38  522 522 LEU LEU A . n 
A 1 39  LYS 39  523 523 LYS LYS A . n 
A 1 40  TYR 40  524 524 TYR TYR A . n 
A 1 41  LYS 41  525 525 LYS LYS A . n 
A 1 42  ALA 42  526 526 ALA ALA A . n 
A 1 43  GLU 43  527 527 GLU GLU A . n 
A 1 44  TRP 44  528 528 TRP TRP A . n 
A 1 45  ARG 45  529 529 ARG ARG A . n 
A 1 46  ALA 46  530 530 ALA ALA A . n 
A 1 47  VAL 47  531 531 VAL VAL A . n 
A 1 48  GLY 48  532 532 GLY GLY A . n 
A 1 49  GLU 49  533 533 GLU GLU A . n 
A 1 50  GLU 50  534 534 GLU GLU A . n 
A 1 51  VAL 51  535 535 VAL VAL A . n 
A 1 52  TRP 52  536 536 TRP TRP A . n 
A 1 53  HIS 53  537 537 HIS HIS A . n 
A 1 54  SER 54  538 538 SER SER A . n 
A 1 55  LYS 55  539 539 LYS LYS A . n 
A 1 56  TRP 56  540 540 TRP TRP A . n 
A 1 57  TYR 57  541 541 TYR TYR A . n 
A 1 58  ASP 58  542 542 ASP ASP A . n 
A 1 59  ALA 59  543 543 ALA ALA A . n 
A 1 60  LYS 60  544 544 LYS LYS A . n 
A 1 61  GLU 61  545 545 GLU GLU A . n 
A 1 62  ALA 62  546 546 ALA ALA A . n 
A 1 63  SER 63  547 547 SER SER A . n 
A 1 64  MET 64  548 548 MET MET A . n 
A 1 65  GLU 65  549 549 GLU GLU A . n 
A 1 66  GLY 66  550 550 GLY GLY A . n 
A 1 67  ILE 67  551 551 ILE ILE A . n 
A 1 68  VAL 68  552 552 VAL VAL A . n 
A 1 69  THR 69  553 553 THR THR A . n 
A 1 70  ILE 70  554 554 ILE ILE A . n 
A 1 71  VAL 71  555 555 VAL VAL A . n 
A 1 72  GLY 72  556 556 GLY GLY A . n 
A 1 73  LEU 73  557 557 LEU LEU A . n 
A 1 74  LYS 74  558 558 LYS LYS A . n 
A 1 75  PRO 75  559 559 PRO PRO A . n 
A 1 76  GLU 76  560 560 GLU GLU A . n 
A 1 77  THR 77  561 561 THR THR A . n 
A 1 78  THR 78  562 562 THR THR A . n 
A 1 79  TYR 79  563 563 TYR TYR A . n 
A 1 80  ALA 80  564 564 ALA ALA A . n 
A 1 81  VAL 81  565 565 VAL VAL A . n 
A 1 82  ARG 82  566 566 ARG ARG A . n 
A 1 83  LEU 83  567 567 LEU LEU A . n 
A 1 84  ALA 84  568 568 ALA ALA A . n 
A 1 85  ALA 85  569 569 ALA ALA A . n 
A 1 86  LEU 86  570 570 LEU LEU A . n 
A 1 87  ASN 87  571 571 ASN ASN A . n 
A 1 88  GLY 88  572 572 GLY GLY A . n 
A 1 89  LYS 89  573 573 LYS LYS A . n 
A 1 90  GLY 90  574 574 GLY GLY A . n 
A 1 91  LEU 91  575 575 LEU LEU A . n 
A 1 92  GLY 92  576 576 GLY GLY A . n 
A 1 93  GLU 93  577 577 GLU GLU A . n 
A 1 94  ILE 94  578 578 ILE ILE A . n 
A 1 95  SER 95  579 579 SER SER A . n 
A 1 96  ALA 96  580 580 ALA ALA A . n 
A 1 97  ALA 97  581 581 ALA ALA A . n 
A 1 98  SER 98  582 582 SER SER A . n 
A 1 99  GLU 99  583 583 GLU GLU A . n 
A 1 100 PHE 100 584 584 PHE PHE A . n 
A 1 101 LYS 101 585 585 LYS LYS A . n 
A 1 102 THR 102 586 586 THR THR A . n 
A 1 103 GLN 103 587 587 GLN GLN A . n 
A 1 104 PRO 104 588 588 PRO PRO A . n 
A 1 105 VAL 105 589 589 VAL VAL A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 46 ? C HOH . 
2 1 A HOH 77 ? C HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 27 ? A ASP 511 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 OD2 ? A ASP 27 ? A ASP 511 ? 1_555 56.1  ? 
2  OD1 ? A ASP 27 ? A ASP 511 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 OD2 ? A ASP 13 ? A ASP 497 ? 1_555 93.7  ? 
3  OD2 ? A ASP 27 ? A ASP 511 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 OD2 ? A ASP 13 ? A ASP 497 ? 1_555 118.8 ? 
4  OD1 ? A ASP 27 ? A ASP 511 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 OE1 ? A GLU 61 ? A GLU 545 ? 8_456 161.7 ? 
5  OD2 ? A ASP 27 ? A ASP 511 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 OE1 ? A GLU 61 ? A GLU 545 ? 8_456 120.0 ? 
6  OD2 ? A ASP 13 ? A ASP 497 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 OE1 ? A GLU 61 ? A GLU 545 ? 8_456 102.7 ? 
7  OD1 ? A ASP 27 ? A ASP 511 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 OE2 ? A GLU 61 ? A GLU 545 ? 8_456 123.3 ? 
8  OD2 ? A ASP 27 ? A ASP 511 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 OE2 ? A GLU 61 ? A GLU 545 ? 8_456 67.8  ? 
9  OD2 ? A ASP 13 ? A ASP 497 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 OE2 ? A GLU 61 ? A GLU 545 ? 8_456 121.7 ? 
10 OE1 ? A GLU 61 ? A GLU 545 ? 8_456 NA ? B NA . ? A NA 101 ? 1_555 OE2 ? A GLU 61 ? A GLU 545 ? 8_456 53.6  ? 
11 OD1 ? A ASP 27 ? A ASP 511 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 OD1 ? A ASP 13 ? A ASP 497 ? 1_555 93.8  ? 
12 OD2 ? A ASP 27 ? A ASP 511 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 OD1 ? A ASP 13 ? A ASP 497 ? 1_555 76.6  ? 
13 OD2 ? A ASP 13 ? A ASP 497 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 OD1 ? A ASP 13 ? A ASP 497 ? 1_555 51.4  ? 
14 OE1 ? A GLU 61 ? A GLU 545 ? 8_456 NA ? B NA . ? A NA 101 ? 1_555 OD1 ? A ASP 13 ? A ASP 497 ? 1_555 102.7 ? 
15 OE2 ? A GLU 61 ? A GLU 545 ? 8_456 NA ? B NA . ? A NA 101 ? 1_555 OD1 ? A ASP 13 ? A ASP 497 ? 1_555 80.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-10-03 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
XSCALE      .     ?                package 'Wolfgang Kabsch' ?                        'data scaling'    
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/xscale_program.html ?          ? 1 
AMoRE       .     ?                program 'Jorge Navaza'    ccp4@dl.ac.uk            phasing           
http://www.ccp4.ac.uk/main.html                                    Fortran_77 ? 2 
REFMAC      .     ?                program 'Murshudov, G.N.' ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html                                    Fortran_77 ? 3 
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                                   C++        ? 4 
XDS         .     ?                ?       ?                 ?                        'data scaling'    ? ?          ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    10 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    72 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.86 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O   A HOH 18  ? ? 1_555 O A HOH 74 ? ? 5_545 1.58 
2 1 NE2 A HIS 487 ? ? 1_555 O A HOH 62 ? ? 5_545 2.15 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    TYR 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     502 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -112.16 
_pdbx_validate_torsion.psi             -139.44 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A SER 486 ? OG ? A SER 2  OG 
2 1 Y 1 A MET 548 ? CG ? A MET 64 CG 
3 1 Y 1 A MET 548 ? SD ? A MET 64 SD 
4 1 Y 1 A MET 548 ? CE ? A MET 64 CE 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     GLY 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      485 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    GLY 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SODIUM ION' NA  
3 water        HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NA  1  101 101 NA  NA  A . 
C 3 HOH 1  1   1   HOH HOH A . 
C 3 HOH 2  2   2   HOH HOH A . 
C 3 HOH 3  3   3   HOH HOH A . 
C 3 HOH 4  4   4   HOH HOH A . 
C 3 HOH 5  5   5   HOH HOH A . 
C 3 HOH 6  6   6   HOH HOH A . 
C 3 HOH 7  7   7   HOH HOH A . 
C 3 HOH 8  8   8   HOH HOH A . 
C 3 HOH 9  9   9   HOH HOH A . 
C 3 HOH 10 10  10  HOH HOH A . 
C 3 HOH 11 11  11  HOH HOH A . 
C 3 HOH 12 12  12  HOH HOH A . 
C 3 HOH 13 13  13  HOH HOH A . 
C 3 HOH 14 14  14  HOH HOH A . 
C 3 HOH 15 15  15  HOH HOH A . 
C 3 HOH 16 16  16  HOH HOH A . 
C 3 HOH 17 17  17  HOH HOH A . 
C 3 HOH 18 18  18  HOH HOH A . 
C 3 HOH 19 19  19  HOH HOH A . 
C 3 HOH 20 20  20  HOH HOH A . 
C 3 HOH 21 21  21  HOH HOH A . 
C 3 HOH 22 22  22  HOH HOH A . 
C 3 HOH 23 23  23  HOH HOH A . 
C 3 HOH 24 24  24  HOH HOH A . 
C 3 HOH 25 25  25  HOH HOH A . 
C 3 HOH 26 26  26  HOH HOH A . 
C 3 HOH 27 27  27  HOH HOH A . 
C 3 HOH 28 28  28  HOH HOH A . 
C 3 HOH 29 29  29  HOH HOH A . 
C 3 HOH 30 30  30  HOH HOH A . 
C 3 HOH 31 31  31  HOH HOH A . 
C 3 HOH 32 32  32  HOH HOH A . 
C 3 HOH 33 33  33  HOH HOH A . 
C 3 HOH 34 34  34  HOH HOH A . 
C 3 HOH 35 35  35  HOH HOH A . 
C 3 HOH 36 36  36  HOH HOH A . 
C 3 HOH 37 37  37  HOH HOH A . 
C 3 HOH 38 38  38  HOH HOH A . 
C 3 HOH 39 39  39  HOH HOH A . 
C 3 HOH 40 40  40  HOH HOH A . 
C 3 HOH 41 41  41  HOH HOH A . 
C 3 HOH 42 42  42  HOH HOH A . 
C 3 HOH 43 43  43  HOH HOH A . 
C 3 HOH 44 44  44  HOH HOH A . 
C 3 HOH 45 45  45  HOH HOH A . 
C 3 HOH 46 46  46  HOH HOH A . 
C 3 HOH 47 47  47  HOH HOH A . 
C 3 HOH 48 48  48  HOH HOH A . 
C 3 HOH 49 49  49  HOH HOH A . 
C 3 HOH 50 50  50  HOH HOH A . 
C 3 HOH 51 51  51  HOH HOH A . 
C 3 HOH 52 52  52  HOH HOH A . 
C 3 HOH 53 53  53  HOH HOH A . 
C 3 HOH 54 54  54  HOH HOH A . 
C 3 HOH 55 55  55  HOH HOH A . 
C 3 HOH 56 56  56  HOH HOH A . 
C 3 HOH 57 57  57  HOH HOH A . 
C 3 HOH 58 58  58  HOH HOH A . 
C 3 HOH 59 59  59  HOH HOH A . 
C 3 HOH 60 60  60  HOH HOH A . 
C 3 HOH 61 61  61  HOH HOH A . 
C 3 HOH 62 62  62  HOH HOH A . 
C 3 HOH 63 63  63  HOH HOH A . 
C 3 HOH 64 64  64  HOH HOH A . 
C 3 HOH 65 65  65  HOH HOH A . 
C 3 HOH 66 66  66  HOH HOH A . 
C 3 HOH 67 67  67  HOH HOH A . 
C 3 HOH 68 68  68  HOH HOH A . 
C 3 HOH 69 69  69  HOH HOH A . 
C 3 HOH 70 70  70  HOH HOH A . 
C 3 HOH 71 71  71  HOH HOH A . 
C 3 HOH 72 72  72  HOH HOH A . 
C 3 HOH 73 73  73  HOH HOH A . 
C 3 HOH 74 74  74  HOH HOH A . 
C 3 HOH 75 75  75  HOH HOH A . 
C 3 HOH 76 76  76  HOH HOH A . 
C 3 HOH 77 77  77  HOH HOH A . 
C 3 HOH 78 78  78  HOH HOH A . 
C 3 HOH 79 79  79  HOH HOH A . 
C 3 HOH 80 80  80  HOH HOH A . 
C 3 HOH 81 81  81  HOH HOH A . 
C 3 HOH 82 82  82  HOH HOH A . 
C 3 HOH 83 83  83  HOH HOH A . 
C 3 HOH 84 84  84  HOH HOH A . 
C 3 HOH 85 85  85  HOH HOH A . 
C 3 HOH 86 86  86  HOH HOH A . 
C 3 HOH 87 87  87  HOH HOH A . 
C 3 HOH 88 88  88  HOH HOH A . 
C 3 HOH 89 89  89  HOH HOH A . 
C 3 HOH 90 90  90  HOH HOH A . 
C 3 HOH 91 91  91  HOH HOH A . 
C 3 HOH 92 92  92  HOH HOH A . 
C 3 HOH 93 93  93  HOH HOH A . 
C 3 HOH 94 94  94  HOH HOH A . 
C 3 HOH 95 95  95  HOH HOH A . 
C 3 HOH 96 96  96  HOH HOH A . 
C 3 HOH 97 97  97  HOH HOH A . 
#