data_2HC2
# 
_entry.id   2HC2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2HC2         pdb_00002hc2 10.2210/pdb2hc2/pdb 
RCSB  RCSB038180   ?            ?                   
WWPDB D_1000038180 ?            ?                   
# 
_pdbx_database_status.entry_id                        2HC2 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-06-15 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Evdokimov, A.G.' 1 
'Pokross, M.'     2 
'Walter, R.'      3 
'Mekel, M.'       4 
# 
_citation.id                        primary 
_citation.title                     
'Engineering the catalytic domain of human protein tyrosine phosphatase beta for structure-based drug discovery.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            62 
_citation.page_first                1435 
_citation.page_last                 1445 
_citation.year                      2006 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17139078 
_citation.pdbx_database_id_DOI      10.1107/S0907444906037784 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Evdokimov, A.G.' 1  ? 
primary 'Pokross, M.'     2  ? 
primary 'Walter, R.'      3  ? 
primary 'Mekel, M.'       4  ? 
primary 'Cox, B.'         5  ? 
primary 'Li, C.'          6  ? 
primary 'Bechard, R.'     7  ? 
primary 'Genbauffe, F.'   8  ? 
primary 'Andrews, R.'     9  ? 
primary 'Diven, C.'       10 ? 
primary 'Howard, B.'      11 ? 
primary 'Rastogi, V.'     12 ? 
primary 'Gray, J.'        13 ? 
primary 'Maier, M.'       14 ? 
primary 'Peters, K.G.'    15 ? 
# 
_cell.length_a           38.314 
_cell.length_b           70.775 
_cell.length_c           49.846 
_cell.angle_alpha        90.000 
_cell.angle_beta         92.520 
_cell.angle_gamma        90.000 
_cell.entry_id           2HC2 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              2 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         2HC2 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Receptor-type tyrosine-protein phosphatase beta' 33780.340 1   3.1.3.48 yes 'catalytic domain' ? 
2 non-polymer syn 'MAGNESIUM ION'                                   24.305    1   ?        ?   ?                  ? 
3 non-polymer syn 'SODIUM ION'                                      22.990    2   ?        ?   ?                  ? 
4 water       nat water                                             18.015    303 ?        ?   ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein-tyrosine phosphatase beta, R-PTP-beta' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSGGSDYIN
ASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLP
EWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDR
ILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSGGSDYIN
ASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLP
EWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDR
ILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ARG n 
1 4   LYS n 
1 5   THR n 
1 6   SER n 
1 7   CYS n 
1 8   PRO n 
1 9   ILE n 
1 10  LYS n 
1 11  ILE n 
1 12  ASN n 
1 13  GLN n 
1 14  PHE n 
1 15  GLU n 
1 16  GLY n 
1 17  HIS n 
1 18  PHE n 
1 19  MET n 
1 20  LYS n 
1 21  LEU n 
1 22  GLN n 
1 23  ALA n 
1 24  ASP n 
1 25  SER n 
1 26  ASN n 
1 27  TYR n 
1 28  LEU n 
1 29  LEU n 
1 30  SER n 
1 31  LYS n 
1 32  GLU n 
1 33  TYR n 
1 34  GLU n 
1 35  GLU n 
1 36  LEU n 
1 37  LYS n 
1 38  ASP n 
1 39  VAL n 
1 40  GLY n 
1 41  ARG n 
1 42  ASN n 
1 43  GLN n 
1 44  SER n 
1 45  CYS n 
1 46  ASP n 
1 47  ILE n 
1 48  ALA n 
1 49  LEU n 
1 50  LEU n 
1 51  PRO n 
1 52  GLU n 
1 53  ASN n 
1 54  ARG n 
1 55  GLY n 
1 56  LYS n 
1 57  ASN n 
1 58  ARG n 
1 59  TYR n 
1 60  ASN n 
1 61  ASN n 
1 62  ILE n 
1 63  LEU n 
1 64  PRO n 
1 65  TYR n 
1 66  ASP n 
1 67  ALA n 
1 68  THR n 
1 69  ARG n 
1 70  VAL n 
1 71  LYS n 
1 72  LEU n 
1 73  SER n 
1 74  GLY n 
1 75  GLY n 
1 76  SER n 
1 77  ASP n 
1 78  TYR n 
1 79  ILE n 
1 80  ASN n 
1 81  ALA n 
1 82  SER n 
1 83  TYR n 
1 84  ILE n 
1 85  PRO n 
1 86  GLY n 
1 87  ASN n 
1 88  ASN n 
1 89  PHE n 
1 90  ARG n 
1 91  ARG n 
1 92  GLU n 
1 93  TYR n 
1 94  ILE n 
1 95  VAL n 
1 96  THR n 
1 97  GLN n 
1 98  GLY n 
1 99  PRO n 
1 100 LEU n 
1 101 PRO n 
1 102 GLY n 
1 103 THR n 
1 104 LYS n 
1 105 ASP n 
1 106 ASP n 
1 107 PHE n 
1 108 TRP n 
1 109 LYS n 
1 110 MET n 
1 111 VAL n 
1 112 TRP n 
1 113 GLU n 
1 114 GLN n 
1 115 ASN n 
1 116 VAL n 
1 117 HIS n 
1 118 ASN n 
1 119 ILE n 
1 120 VAL n 
1 121 MET n 
1 122 VAL n 
1 123 THR n 
1 124 GLN n 
1 125 CYS n 
1 126 VAL n 
1 127 GLU n 
1 128 LYS n 
1 129 GLY n 
1 130 ARG n 
1 131 VAL n 
1 132 LYS n 
1 133 CYS n 
1 134 ASP n 
1 135 HIS n 
1 136 TYR n 
1 137 TRP n 
1 138 PRO n 
1 139 ALA n 
1 140 ASP n 
1 141 GLN n 
1 142 ASP n 
1 143 SER n 
1 144 LEU n 
1 145 TYR n 
1 146 TYR n 
1 147 GLY n 
1 148 ASP n 
1 149 LEU n 
1 150 ILE n 
1 151 LEU n 
1 152 GLN n 
1 153 MET n 
1 154 LEU n 
1 155 SER n 
1 156 GLU n 
1 157 SER n 
1 158 VAL n 
1 159 LEU n 
1 160 PRO n 
1 161 GLU n 
1 162 TRP n 
1 163 THR n 
1 164 ILE n 
1 165 ARG n 
1 166 GLU n 
1 167 PHE n 
1 168 LYS n 
1 169 ILE n 
1 170 CYS n 
1 171 GLY n 
1 172 GLU n 
1 173 GLU n 
1 174 GLN n 
1 175 LEU n 
1 176 ASP n 
1 177 ALA n 
1 178 HIS n 
1 179 ARG n 
1 180 LEU n 
1 181 ILE n 
1 182 ARG n 
1 183 HIS n 
1 184 PHE n 
1 185 HIS n 
1 186 TYR n 
1 187 THR n 
1 188 VAL n 
1 189 TRP n 
1 190 PRO n 
1 191 ASP n 
1 192 HIS n 
1 193 GLY n 
1 194 VAL n 
1 195 PRO n 
1 196 GLU n 
1 197 THR n 
1 198 THR n 
1 199 GLN n 
1 200 SER n 
1 201 LEU n 
1 202 ILE n 
1 203 GLN n 
1 204 PHE n 
1 205 VAL n 
1 206 ARG n 
1 207 THR n 
1 208 VAL n 
1 209 ARG n 
1 210 ASP n 
1 211 TYR n 
1 212 ILE n 
1 213 ASN n 
1 214 ARG n 
1 215 SER n 
1 216 PRO n 
1 217 GLY n 
1 218 ALA n 
1 219 GLY n 
1 220 PRO n 
1 221 THR n 
1 222 VAL n 
1 223 VAL n 
1 224 HIS n 
1 225 CYS n 
1 226 SER n 
1 227 ALA n 
1 228 GLY n 
1 229 VAL n 
1 230 GLY n 
1 231 ARG n 
1 232 THR n 
1 233 GLY n 
1 234 THR n 
1 235 PHE n 
1 236 ILE n 
1 237 ALA n 
1 238 LEU n 
1 239 ASP n 
1 240 ARG n 
1 241 ILE n 
1 242 LEU n 
1 243 GLN n 
1 244 GLN n 
1 245 LEU n 
1 246 ASP n 
1 247 SER n 
1 248 LYS n 
1 249 ASP n 
1 250 SER n 
1 251 VAL n 
1 252 ASP n 
1 253 ILE n 
1 254 TYR n 
1 255 GLY n 
1 256 ALA n 
1 257 VAL n 
1 258 HIS n 
1 259 ASP n 
1 260 LEU n 
1 261 ARG n 
1 262 LEU n 
1 263 HIS n 
1 264 ARG n 
1 265 VAL n 
1 266 HIS n 
1 267 MET n 
1 268 VAL n 
1 269 GLN n 
1 270 THR n 
1 271 GLU n 
1 272 CYS n 
1 273 GLN n 
1 274 TYR n 
1 275 VAL n 
1 276 TYR n 
1 277 LEU n 
1 278 HIS n 
1 279 GLN n 
1 280 CYS n 
1 281 VAL n 
1 282 ARG n 
1 283 ASP n 
1 284 VAL n 
1 285 LEU n 
1 286 ARG n 
1 287 ALA n 
1 288 ARG n 
1 289 LYS n 
1 290 LEU n 
1 291 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PTPRB 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               TOP10 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pHisMBP-DEST 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PTPRB_HUMAN 
_struct_ref.pdbx_db_accession          P23467 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1676 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2HC2 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 286 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P23467 
_struct_ref_seq.db_align_beg                  1676 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1970 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1676 
_struct_ref_seq.pdbx_auth_seq_align_end       1965 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2HC2 SER A 1  ? UNP P23467 ?   ?    'cloning artifact'    1675 1 
1 2HC2 ?   A ?  ? UNP P23467 ASN 1748 deletion              ?    2 
1 2HC2 ?   A ?  ? UNP P23467 VAL 1749 deletion              ?    3 
1 2HC2 ?   A ?  ? UNP P23467 ASP 1750 deletion              ?    4 
1 2HC2 ?   A ?  ? UNP P23467 ASP 1751 deletion              ?    5 
1 2HC2 ?   A ?  ? UNP P23467 ASP 1752 deletion              ?    6 
1 2HC2 GLY A 74 ? UNP P23467 PRO 1753 'engineered mutation' 1748 7 
1 2HC2 GLY A 75 ? UNP P23467 CYS 1754 'engineered mutation' 1749 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'           24.305  
NA  non-polymer         . 'SODIUM ION'    ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2HC2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.00 
_exptl_crystal.density_percent_sol   38.44 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.85 
_exptl_crystal_grow.pdbx_details    
'21% PEG 8000, 200 mM MgCl2, 1% BME, 0.1% BOG, 1mM DTT, 80 mM Na Citrate, pH 7.85, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2006-02-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Si 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     2HC2 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             33.67 
_reflns.d_resolution_high            1.4 
_reflns.number_obs                   48397 
_reflns.number_all                   48397 
_reflns.percent_possible_obs         92.5 
_reflns.pdbx_Rmerge_I_obs            0.028 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.4 
_reflns_shell.d_res_low              1.5 
_reflns_shell.percent_possible_all   69.4 
_reflns_shell.Rmerge_I_obs           0.21 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.87 
_reflns_shell.pdbx_redundancy        1.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2HC2 
_refine.ls_number_reflns_obs                     45933 
_refine.ls_number_reflns_all                     48397 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             33.67 
_refine.ls_d_res_high                            1.40 
_refine.ls_percent_reflns_obs                    92.51 
_refine.ls_R_factor_obs                          0.14571 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.14391 
_refine.ls_R_factor_R_free                       0.17892 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2464 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.972 
_refine.correlation_coeff_Fo_to_Fc_free          0.962 
_refine.B_iso_mean                               19.055 
_refine.aniso_B[1][1]                            0.67 
_refine.aniso_B[2][2]                            -0.32 
_refine.aniso_B[3][3]                            -0.35 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.05 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      2HC1 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             anisotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.077 
_refine.pdbx_overall_ESU_R_Free                  0.065 
_refine.overall_SU_ML                            0.035 
_refine.overall_SU_B                             1.945 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2488 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             303 
_refine_hist.number_atoms_total               2794 
_refine_hist.d_res_high                       1.40 
_refine_hist.d_res_low                        33.67 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.022  ? 2576 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.206  1.947  ? 3537 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.896  5.000  ? 342  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.767 23.577 ? 137  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.775 15.000 ? 474  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.582 15.000 ? 24   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.102  0.200  ? 385  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 2014 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.260  0.200  ? 1237 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.319  0.200  ? 1757 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.206  0.200  ? 219  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.375  0.200  ? 63   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.156  0.200  ? 33   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  3.024  1.500  ? 1511 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 4.138  2.000  ? 2495 'X-RAY DIFFRACTION' ? 
r_scbond_it                  5.308  3.000  ? 1105 'X-RAY DIFFRACTION' ? 
r_scangle_it                 6.959  4.500  ? 1009 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           3.487  3.000  ? 2616 'X-RAY DIFFRACTION' ? 
r_sphericity_free            16.373 3.000  ? 306  'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          10.465 3.000  ? 2488 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.400 
_refine_ls_shell.d_res_low                        1.436 
_refine_ls_shell.number_reflns_R_work             2286 
_refine_ls_shell.R_factor_R_work                  0.155 
_refine_ls_shell.percent_reflns_obs               62.23 
_refine_ls_shell.R_factor_R_free                  0.208 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             121 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2HC2 
_struct.title                     'Engineered protein tyrosine phosphatase beta catalytic domain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HC2 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'protein tyrosine phosphatase, WPD-loop, sulfamic acid, phosphatase, inhibitor, drug design, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 13  ? GLU A 35  ? GLN A 1687 GLU A 1709 1 ? 23 
HELX_P HELX_P2 2 LEU A 50  ? ASN A 57  ? LEU A 1724 ASN A 1731 5 ? 8  
HELX_P HELX_P3 3 TYR A 65  ? ALA A 67  ? TYR A 1739 ALA A 1741 5 ? 3  
HELX_P HELX_P4 4 THR A 103 ? GLN A 114 ? THR A 1782 GLN A 1793 1 ? 12 
HELX_P HELX_P5 5 THR A 197 ? ARG A 214 ? THR A 1876 ARG A 1893 1 ? 18 
HELX_P HELX_P6 6 VAL A 229 ? LYS A 248 ? VAL A 1908 LYS A 1927 1 ? 20 
HELX_P HELX_P7 7 ASP A 252 ? LEU A 262 ? ASP A 1931 LEU A 1941 1 ? 11 
HELX_P HELX_P8 8 THR A 270 ? LEU A 290 ? THR A 1949 LEU A 1969 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? E HOH . O  ? ? ? 1_555 B MG  .   MG ? ? A HOH 1   A MG  401  1_555 ? ? ? ? ? ? ? 2.157 ? ? 
metalc2 metalc ? ? E HOH . O  ? ? ? 1_555 B MG  .   MG ? ? A HOH 2   A MG  401  1_555 ? ? ? ? ? ? ? 2.041 ? ? 
metalc3 metalc ? ? E HOH . O  ? ? ? 1_555 B MG  .   MG ? ? A HOH 3   A MG  401  1_555 ? ? ? ? ? ? ? 2.052 ? ? 
metalc4 metalc ? ? E HOH . O  ? ? ? 1_555 B MG  .   MG ? ? A HOH 4   A MG  401  1_555 ? ? ? ? ? ? ? 2.159 ? ? 
metalc5 metalc ? ? E HOH . O  ? ? ? 1_555 B MG  .   MG ? ? A HOH 5   A MG  401  1_555 ? ? ? ? ? ? ? 2.045 ? ? 
metalc6 metalc ? ? E HOH . O  ? ? ? 1_555 B MG  .   MG ? ? A HOH 6   A MG  401  1_555 ? ? ? ? ? ? ? 2.147 ? ? 
metalc7 metalc ? ? E HOH . O  ? ? ? 1_555 C NA  .   NA ? ? A HOH 366 A NA  402  1_555 ? ? ? ? ? ? ? 2.979 ? ? 
metalc8 metalc ? ? D NA  . NA ? ? ? 1_555 A TYR 145 N  ? ? A NA  403 A TYR 1824 1_555 ? ? ? ? ? ? ? 2.867 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 9 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
B 8 9 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 9   ? LYS A 10  ? ILE A 1683 LYS A 1684 
A 2 SER A 250 ? VAL A 251 ? SER A 1929 VAL A 1930 
B 1 ARG A 69  ? LYS A 71  ? ARG A 1743 LYS A 1745 
B 2 TYR A 78  ? ILE A 84  ? TYR A 1757 ILE A 1763 
B 3 TYR A 93  ? THR A 96  ? TYR A 1772 THR A 1775 
B 4 THR A 221 ? HIS A 224 ? THR A 1900 HIS A 1903 
B 5 ASN A 118 ? MET A 121 ? ASN A 1797 MET A 1800 
B 6 ARG A 179 ? TYR A 186 ? ARG A 1858 TYR A 1865 
B 7 TRP A 162 ? CYS A 170 ? TRP A 1841 CYS A 1849 
B 8 LEU A 149 ? VAL A 158 ? LEU A 1828 VAL A 1837 
B 9 LEU A 144 ? TYR A 146 ? LEU A 1823 TYR A 1825 
C 1 VAL A 126 ? GLU A 127 ? VAL A 1805 GLU A 1806 
C 2 ARG A 130 ? VAL A 131 ? ARG A 1809 VAL A 1810 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 9   ? N ILE A 1683 O VAL A 251 ? O VAL A 1930 
B 1 2 N VAL A 70  ? N VAL A 1744 O ALA A 81  ? O ALA A 1760 
B 2 3 N ILE A 84  ? N ILE A 1763 O TYR A 93  ? O TYR A 1772 
B 3 4 N ILE A 94  ? N ILE A 1773 O VAL A 223 ? O VAL A 1902 
B 4 5 O VAL A 222 ? O VAL A 1901 N VAL A 120 ? N VAL A 1799 
B 5 6 N ILE A 119 ? N ILE A 1798 O PHE A 184 ? O PHE A 1863 
B 6 7 O HIS A 185 ? O HIS A 1864 N THR A 163 ? N THR A 1842 
B 7 8 O LYS A 168 ? O LYS A 1847 N GLN A 152 ? N GLN A 1831 
B 8 9 O LEU A 151 ? O LEU A 1830 N LEU A 144 ? N LEU A 1823 
C 1 2 N GLU A 127 ? N GLU A 1806 O ARG A 130 ? O ARG A 1809 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG 401 ? 6 'BINDING SITE FOR RESIDUE MG A 401' 
AC2 Software A NA 402 ? 3 'BINDING SITE FOR RESIDUE NA A 402' 
AC3 Software A NA 403 ? 2 'BINDING SITE FOR RESIDUE NA A 403' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 HOH E .   ? HOH A 1    . ? 1_555 ? 
2  AC1 6 HOH E .   ? HOH A 2    . ? 1_555 ? 
3  AC1 6 HOH E .   ? HOH A 3    . ? 1_555 ? 
4  AC1 6 HOH E .   ? HOH A 4    . ? 1_555 ? 
5  AC1 6 HOH E .   ? HOH A 5    . ? 1_555 ? 
6  AC1 6 HOH E .   ? HOH A 6    . ? 1_555 ? 
7  AC2 3 HOH E .   ? HOH A 366  . ? 1_555 ? 
8  AC2 3 GLY A 193 ? GLY A 1872 . ? 1_555 ? 
9  AC2 3 THR A 270 ? THR A 1949 . ? 1_555 ? 
10 AC3 2 LEU A 144 ? LEU A 1823 . ? 1_555 ? 
11 AC3 2 TYR A 145 ? TYR A 1824 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2HC2 
_atom_sites.fract_transf_matrix[1][1]   0.026100 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001149 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014129 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020081 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 2   ? 27.122  -21.453 5.100   1.00 37.65 ? 1676 ASN A N   1 
ATOM   2    C  CA  . ASN A 1 2   ? 26.203  -22.611 5.262   1.00 35.77 ? 1676 ASN A CA  1 
ATOM   3    C  C   . ASN A 1 2   ? 24.776  -22.196 4.923   1.00 31.74 ? 1676 ASN A C   1 
ATOM   4    O  O   . ASN A 1 2   ? 24.134  -22.793 4.056   1.00 32.60 ? 1676 ASN A O   1 
ATOM   5    C  CB  . ASN A 1 2   ? 26.286  -23.168 6.690   1.00 37.07 ? 1676 ASN A CB  1 
ATOM   6    C  CG  . ASN A 1 2   ? 25.672  -24.553 6.823   1.00 43.16 ? 1676 ASN A CG  1 
ATOM   7    O  OD1 . ASN A 1 2   ? 24.448  -24.706 6.855   1.00 49.40 ? 1676 ASN A OD1 1 
ATOM   8    N  ND2 . ASN A 1 2   ? 26.522  -25.571 6.915   1.00 48.18 ? 1676 ASN A ND2 1 
ATOM   9    N  N   . ARG A 1 3   ? 24.279  -21.165 5.600   1.00 27.30 ? 1677 ARG A N   1 
ATOM   10   C  CA  . ARG A 1 3   ? 22.864  -20.815 5.477   1.00 28.08 ? 1677 ARG A CA  1 
ATOM   11   C  C   . ARG A 1 3   ? 22.572  -19.834 4.341   1.00 23.26 ? 1677 ARG A C   1 
ATOM   12   O  O   . ARG A 1 3   ? 23.371  -18.956 4.025   1.00 21.91 ? 1677 ARG A O   1 
ATOM   13   C  CB  . ARG A 1 3   ? 22.323  -20.280 6.799   1.00 29.62 ? 1677 ARG A CB  1 
ATOM   14   C  CG  . ARG A 1 3   ? 22.748  -18.856 7.090   1.00 34.95 ? 1677 ARG A CG  1 
ATOM   15   C  CD  . ARG A 1 3   ? 21.851  -18.232 8.152   1.00 35.19 ? 1677 ARG A CD  1 
ATOM   16   N  NE  . ARG A 1 3   ? 22.252  -18.625 9.498   1.00 38.56 ? 1677 ARG A NE  1 
ATOM   17   C  CZ  . ARG A 1 3   ? 23.260  -18.068 10.162  1.00 27.30 ? 1677 ARG A CZ  1 
ATOM   18   N  NH1 . ARG A 1 3   ? 23.964  -17.101 9.597   1.00 39.77 ? 1677 ARG A NH1 1 
ATOM   19   N  NH2 . ARG A 1 3   ? 23.564  -18.485 11.379  1.00 38.31 ? 1677 ARG A NH2 1 
ATOM   20   N  N   . LYS A 1 4   ? 21.404  -19.997 3.731   1.00 22.36 ? 1678 LYS A N   1 
ATOM   21   C  CA  . LYS A 1 4   ? 20.902  -19.053 2.753   1.00 21.98 ? 1678 LYS A CA  1 
ATOM   22   C  C   . LYS A 1 4   ? 20.863  -17.639 3.346   1.00 18.58 ? 1678 LYS A C   1 
ATOM   23   O  O   . LYS A 1 4   ? 20.535  -17.466 4.524   1.00 20.54 ? 1678 LYS A O   1 
ATOM   24   C  CB  . LYS A 1 4   ? 19.473  -19.462 2.386   1.00 24.78 ? 1678 LYS A CB  1 
ATOM   25   C  CG  . LYS A 1 4   ? 19.169  -19.441 0.923   1.00 33.53 ? 1678 LYS A CG  1 
ATOM   26   C  CD  . LYS A 1 4   ? 17.811  -20.088 0.684   1.00 33.07 ? 1678 LYS A CD  1 
ATOM   27   C  CE  . LYS A 1 4   ? 17.907  -21.606 0.788   1.00 38.56 ? 1678 LYS A CE  1 
ATOM   28   N  NZ  . LYS A 1 4   ? 16.584  -22.263 0.587   1.00 44.03 ? 1678 LYS A NZ  1 
ATOM   29   N  N   . THR A 1 5   ? 21.172  -16.637 2.529   1.00 17.30 ? 1679 THR A N   1 
ATOM   30   C  CA  . THR A 1 5   ? 20.988  -15.230 2.933   1.00 18.88 ? 1679 THR A CA  1 
ATOM   31   C  C   . THR A 1 5   ? 19.797  -14.533 2.259   1.00 17.76 ? 1679 THR A C   1 
ATOM   32   O  O   . THR A 1 5   ? 19.440  -13.405 2.608   1.00 18.65 ? 1679 THR A O   1 
ATOM   33   C  CB  . THR A 1 5   ? 22.254  -14.412 2.625   1.00 20.93 ? 1679 THR A CB  1 
ATOM   34   O  OG1 . THR A 1 5   ? 22.476  -14.400 1.208   1.00 25.64 ? 1679 THR A OG1 1 
ATOM   35   C  CG2 . THR A 1 5   ? 23.457  -15.041 3.303   1.00 21.45 ? 1679 THR A CG2 1 
ATOM   36   N  N   . SER A 1 6   ? 19.195  -15.215 1.295   1.00 17.16 ? 1680 SER A N   1 
ATOM   37   C  CA  . SER A 1 6   ? 18.178  -14.632 0.427   1.00 19.11 ? 1680 SER A CA  1 
ATOM   38   C  C   . SER A 1 6   ? 17.284  -15.759 -0.095  1.00 18.80 ? 1680 SER A C   1 
ATOM   39   O  O   . SER A 1 6   ? 17.759  -16.862 -0.351  1.00 20.73 ? 1680 SER A O   1 
ATOM   40   C  CB  . SER A 1 6   ? 18.872  -13.911 -0.738  1.00 21.70 ? 1680 SER A CB  1 
ATOM   41   O  OG  . SER A 1 6   ? 17.952  -13.465 -1.721  1.00 27.34 ? 1680 SER A OG  1 
ATOM   42   N  N   . CYS A 1 7   ? 15.989  -15.497 -0.238  1.00 18.42 ? 1681 CYS A N   1 
ATOM   43   C  CA  A CYS A 1 7   ? 15.090  -16.440 -0.912  0.50 19.89 ? 1681 CYS A CA  1 
ATOM   44   C  CA  B CYS A 1 7   ? 15.107  -16.429 -0.935  0.50 18.60 ? 1681 CYS A CA  1 
ATOM   45   C  C   . CYS A 1 7   ? 14.117  -15.676 -1.817  1.00 18.37 ? 1681 CYS A C   1 
ATOM   46   O  O   . CYS A 1 7   ? 12.932  -15.513 -1.476  1.00 20.58 ? 1681 CYS A O   1 
ATOM   47   C  CB  A CYS A 1 7   ? 14.294  -17.262 0.114   0.50 21.73 ? 1681 CYS A CB  1 
ATOM   48   C  CB  B CYS A 1 7   ? 14.365  -17.325 0.049   0.50 18.84 ? 1681 CYS A CB  1 
ATOM   49   S  SG  A CYS A 1 7   ? 15.251  -18.447 1.118   0.50 30.75 ? 1681 CYS A SG  1 
ATOM   50   S  SG  B CYS A 1 7   ? 13.575  -18.729 -0.741  0.50 24.61 ? 1681 CYS A SG  1 
ATOM   51   N  N   . PRO A 1 8   ? 14.603  -15.183 -2.960  1.00 19.62 ? 1682 PRO A N   1 
ATOM   52   C  CA  . PRO A 1 8   ? 13.722  -14.373 -3.802  1.00 20.79 ? 1682 PRO A CA  1 
ATOM   53   C  C   . PRO A 1 8   ? 12.626  -15.215 -4.457  1.00 22.86 ? 1682 PRO A C   1 
ATOM   54   O  O   . PRO A 1 8   ? 12.862  -16.363 -4.849  1.00 23.99 ? 1682 PRO A O   1 
ATOM   55   C  CB  . PRO A 1 8   ? 14.665  -13.797 -4.863  1.00 23.68 ? 1682 PRO A CB  1 
ATOM   56   C  CG  . PRO A 1 8   ? 16.060  -14.088 -4.371  1.00 25.96 ? 1682 PRO A CG  1 
ATOM   57   C  CD  . PRO A 1 8   ? 15.954  -15.313 -3.531  1.00 23.03 ? 1682 PRO A CD  1 
ATOM   58   N  N   . ILE A 1 9   ? 11.437  -14.630 -4.559  1.00 20.52 ? 1683 ILE A N   1 
ATOM   59   C  CA  A ILE A 1 9   ? 10.264  -15.311 -5.111  0.50 21.52 ? 1683 ILE A CA  1 
ATOM   60   C  CA  B ILE A 1 9   ? 10.294  -15.320 -5.135  0.50 21.23 ? 1683 ILE A CA  1 
ATOM   61   C  C   . ILE A 1 9   ? 9.674   -14.453 -6.223  1.00 22.21 ? 1683 ILE A C   1 
ATOM   62   O  O   . ILE A 1 9   ? 9.430   -13.262 -6.024  1.00 22.78 ? 1683 ILE A O   1 
ATOM   63   C  CB  A ILE A 1 9   ? 9.167   -15.481 -4.047  0.50 22.09 ? 1683 ILE A CB  1 
ATOM   64   C  CB  B ILE A 1 9   ? 9.247   -15.658 -4.058  0.50 21.22 ? 1683 ILE A CB  1 
ATOM   65   C  CG1 A ILE A 1 9   ? 9.680   -16.247 -2.827  0.50 23.13 ? 1683 ILE A CG1 1 
ATOM   66   C  CG1 B ILE A 1 9   ? 9.876   -16.495 -2.938  0.50 20.45 ? 1683 ILE A CG1 1 
ATOM   67   C  CG2 A ILE A 1 9   ? 7.926   -16.144 -4.643  0.50 21.97 ? 1683 ILE A CG2 1 
ATOM   68   C  CG2 B ILE A 1 9   ? 8.043   -16.374 -4.672  0.50 22.73 ? 1683 ILE A CG2 1 
ATOM   69   C  CD1 A ILE A 1 9   ? 8.856   -15.981 -1.585  0.50 25.41 ? 1683 ILE A CD1 1 
ATOM   70   C  CD1 B ILE A 1 9   ? 10.105  -17.942 -3.304  0.50 18.53 ? 1683 ILE A CD1 1 
ATOM   71   N  N   . LYS A 1 10  ? 9.439   -15.055 -7.387  1.00 21.85 ? 1684 LYS A N   1 
ATOM   72   C  CA  A LYS A 1 10  ? 8.734   -14.348 -8.447  0.70 21.88 ? 1684 LYS A CA  1 
ATOM   73   C  CA  B LYS A 1 10  ? 8.728   -14.370 -8.457  0.30 21.87 ? 1684 LYS A CA  1 
ATOM   74   C  C   . LYS A 1 10  ? 7.349   -13.948 -7.974  1.00 20.31 ? 1684 LYS A C   1 
ATOM   75   O  O   . LYS A 1 10  ? 6.626   -14.746 -7.385  1.00 21.83 ? 1684 LYS A O   1 
ATOM   76   C  CB  A LYS A 1 10  ? 8.636   -15.192 -9.722  0.70 20.95 ? 1684 LYS A CB  1 
ATOM   77   C  CB  B LYS A 1 10  ? 8.599   -15.279 -9.682  0.30 21.61 ? 1684 LYS A CB  1 
ATOM   78   C  CG  A LYS A 1 10  ? 9.906   -15.157 -10.566 0.70 26.47 ? 1684 LYS A CG  1 
ATOM   79   C  CG  B LYS A 1 10  ? 9.927   -15.574 -10.365 0.30 23.26 ? 1684 LYS A CG  1 
ATOM   80   C  CD  A LYS A 1 10  ? 10.005  -16.370 -11.485 0.70 33.59 ? 1684 LYS A CD  1 
ATOM   81   C  CD  B LYS A 1 10  ? 10.580  -14.292 -10.861 0.30 26.67 ? 1684 LYS A CD  1 
ATOM   82   C  CE  A LYS A 1 10  ? 11.434  -16.565 -11.978 0.70 35.80 ? 1684 LYS A CE  1 
ATOM   83   C  CE  B LYS A 1 10  ? 11.875  -14.575 -11.601 0.30 29.59 ? 1684 LYS A CE  1 
ATOM   84   N  NZ  A LYS A 1 10  ? 12.023  -15.306 -12.530 0.70 38.16 ? 1684 LYS A NZ  1 
ATOM   85   N  NZ  B LYS A 1 10  ? 12.482  -13.324 -12.134 0.30 33.38 ? 1684 LYS A NZ  1 
ATOM   86   N  N   . ILE A 1 11  ? 6.993   -12.697 -8.222  1.00 23.39 ? 1685 ILE A N   1 
ATOM   87   C  CA  . ILE A 1 11  ? 5.743   -12.188 -7.693  1.00 26.14 ? 1685 ILE A CA  1 
ATOM   88   C  C   . ILE A 1 11  ? 4.521   -13.039 -8.108  1.00 25.83 ? 1685 ILE A C   1 
ATOM   89   O  O   . ILE A 1 11  ? 3.674   -13.341 -7.274  1.00 26.55 ? 1685 ILE A O   1 
ATOM   90   C  CB  . ILE A 1 11  ? 5.587   -10.670 -7.924  1.00 27.33 ? 1685 ILE A CB  1 
ATOM   91   C  CG1 . ILE A 1 11  ? 6.516   -9.901  -6.970  1.00 27.14 ? 1685 ILE A CG1 1 
ATOM   92   C  CG2 . ILE A 1 11  ? 4.149   -10.234 -7.686  1.00 30.13 ? 1685 ILE A CG2 1 
ATOM   93   C  CD1 . ILE A 1 11  ? 6.813   -8.480  -7.399  1.00 32.44 ? 1685 ILE A CD1 1 
ATOM   94   N  N   . ASN A 1 12  ? 4.469   -13.504 -9.354  1.00 26.96 ? 1686 ASN A N   1 
ATOM   95   C  CA  A ASN A 1 12  ? 3.352   -14.342 -9.819  0.70 28.11 ? 1686 ASN A CA  1 
ATOM   96   C  CA  B ASN A 1 12  ? 3.334   -14.326 -9.783  0.30 25.57 ? 1686 ASN A CA  1 
ATOM   97   C  C   . ASN A 1 12  ? 3.385   -15.781 -9.309  1.00 27.16 ? 1686 ASN A C   1 
ATOM   98   O  O   . ASN A 1 12  ? 2.468   -16.564 -9.571  1.00 28.14 ? 1686 ASN A O   1 
ATOM   99   C  CB  A ASN A 1 12  ? 3.264   -14.344 -11.346 0.70 31.18 ? 1686 ASN A CB  1 
ATOM   100  C  CB  B ASN A 1 12  ? 3.101   -14.234 -11.295 0.30 25.46 ? 1686 ASN A CB  1 
ATOM   101  C  CG  A ASN A 1 12  ? 3.464   -12.971 -11.941 0.70 36.21 ? 1686 ASN A CG  1 
ATOM   102  C  CG  B ASN A 1 12  ? 4.245   -14.815 -12.103 0.30 20.17 ? 1686 ASN A CG  1 
ATOM   103  O  OD1 A ASN A 1 12  ? 4.585   -12.585 -12.271 0.70 38.16 ? 1686 ASN A OD1 1 
ATOM   104  O  OD1 B ASN A 1 12  ? 5.189   -15.378 -11.552 0.30 18.49 ? 1686 ASN A OD1 1 
ATOM   105  N  ND2 A ASN A 1 12  ? 2.375   -12.222 -12.083 0.70 40.24 ? 1686 ASN A ND2 1 
ATOM   106  N  ND2 B ASN A 1 12  ? 4.163   -14.678 -13.422 0.30 17.95 ? 1686 ASN A ND2 1 
ATOM   107  N  N   . GLN A 1 13  ? 4.450   -16.138 -8.595  1.00 24.30 ? 1687 GLN A N   1 
ATOM   108  C  CA  . GLN A 1 13  ? 4.520   -17.449 -7.962  1.00 24.93 ? 1687 GLN A CA  1 
ATOM   109  C  C   . GLN A 1 13  ? 4.392   -17.386 -6.444  1.00 22.26 ? 1687 GLN A C   1 
ATOM   110  O  O   . GLN A 1 13  ? 4.437   -18.409 -5.741  1.00 24.33 ? 1687 GLN A O   1 
ATOM   111  C  CB  . GLN A 1 13  ? 5.785   -18.180 -8.407  1.00 24.23 ? 1687 GLN A CB  1 
ATOM   112  C  CG  . GLN A 1 13  ? 5.716   -18.582 -9.878  1.00 29.38 ? 1687 GLN A CG  1 
ATOM   113  C  CD  . GLN A 1 13  ? 6.898   -19.427 -10.313 1.00 37.29 ? 1687 GLN A CD  1 
ATOM   114  O  OE1 . GLN A 1 13  ? 6.798   -20.649 -10.409 1.00 40.06 ? 1687 GLN A OE1 1 
ATOM   115  N  NE2 . GLN A 1 13  ? 8.028   -18.775 -10.575 1.00 45.36 ? 1687 GLN A NE2 1 
ATOM   116  N  N   . PHE A 1 14  ? 4.167   -16.180 -5.934  1.00 23.84 ? 1688 PHE A N   1 
ATOM   117  C  CA  . PHE A 1 14  ? 4.212   -15.986 -4.506  1.00 21.64 ? 1688 PHE A CA  1 
ATOM   118  C  C   . PHE A 1 14  ? 3.060   -16.645 -3.769  1.00 20.00 ? 1688 PHE A C   1 
ATOM   119  O  O   . PHE A 1 14  ? 3.258   -17.283 -2.742  1.00 21.33 ? 1688 PHE A O   1 
ATOM   120  C  CB  . PHE A 1 14  ? 4.270   -14.508 -4.146  1.00 23.23 ? 1688 PHE A CB  1 
ATOM   121  C  CG  . PHE A 1 14  ? 4.419   -14.284 -2.685  1.00 21.06 ? 1688 PHE A CG  1 
ATOM   122  C  CD1 . PHE A 1 14  ? 5.691   -14.211 -2.114  1.00 19.77 ? 1688 PHE A CD1 1 
ATOM   123  C  CD2 . PHE A 1 14  ? 3.305   -14.195 -1.869  1.00 21.63 ? 1688 PHE A CD2 1 
ATOM   124  C  CE1 . PHE A 1 14  ? 5.843   -14.032 -0.759  1.00 18.09 ? 1688 PHE A CE1 1 
ATOM   125  C  CE2 . PHE A 1 14  ? 3.439   -14.016 -0.507  1.00 17.04 ? 1688 PHE A CE2 1 
ATOM   126  C  CZ  . PHE A 1 14  ? 4.723   -13.935 0.061   1.00 18.81 ? 1688 PHE A CZ  1 
ATOM   127  N  N   . GLU A 1 15  ? 1.840   -16.475 -4.283  1.00 22.37 ? 1689 GLU A N   1 
ATOM   128  C  CA  . GLU A 1 15  ? 0.677   -17.105 -3.666  1.00 22.05 ? 1689 GLU A CA  1 
ATOM   129  C  C   . GLU A 1 15  ? 0.920   -18.613 -3.439  1.00 17.99 ? 1689 GLU A C   1 
ATOM   130  O  O   . GLU A 1 15  ? 0.681   -19.139 -2.339  1.00 22.11 ? 1689 GLU A O   1 
ATOM   131  C  CB  . GLU A 1 15  ? -0.563  -16.863 -4.539  1.00 23.53 ? 1689 GLU A CB  1 
ATOM   132  C  CG  . GLU A 1 15  ? -1.826  -17.597 -4.104  1.00 27.08 ? 1689 GLU A CG  1 
ATOM   133  C  CD  . GLU A 1 15  ? -2.708  -16.753 -3.209  1.00 27.94 ? 1689 GLU A CD  1 
ATOM   134  O  OE1 . GLU A 1 15  ? -2.929  -15.558 -3.541  1.00 38.10 ? 1689 GLU A OE1 1 
ATOM   135  O  OE2 . GLU A 1 15  ? -3.176  -17.280 -2.174  1.00 31.68 ? 1689 GLU A OE2 1 
ATOM   136  N  N   . GLY A 1 16  ? 1.416   -19.299 -4.460  1.00 23.63 ? 1690 GLY A N   1 
ATOM   137  C  CA  . GLY A 1 16  ? 1.612   -20.751 -4.389  1.00 22.85 ? 1690 GLY A CA  1 
ATOM   138  C  C   . GLY A 1 16  ? 2.833   -21.144 -3.565  1.00 22.28 ? 1690 GLY A C   1 
ATOM   139  O  O   . GLY A 1 16  ? 2.816   -22.164 -2.863  1.00 25.30 ? 1690 GLY A O   1 
ATOM   140  N  N   . HIS A 1 17  ? 3.876   -20.310 -3.611  1.00 24.91 ? 1691 HIS A N   1 
ATOM   141  C  CA  . HIS A 1 17  ? 5.027   -20.444 -2.704  1.00 23.02 ? 1691 HIS A CA  1 
ATOM   142  C  C   . HIS A 1 17  ? 4.563   -20.410 -1.262  1.00 21.12 ? 1691 HIS A C   1 
ATOM   143  O  O   . HIS A 1 17  ? 4.904   -21.288 -0.473  1.00 22.88 ? 1691 HIS A O   1 
ATOM   144  C  CB  . HIS A 1 17  ? 6.054   -19.333 -2.948  1.00 24.25 ? 1691 HIS A CB  1 
ATOM   145  C  CG  . HIS A 1 17  ? 7.074   -19.188 -1.853  1.00 25.06 ? 1691 HIS A CG  1 
ATOM   146  N  ND1 . HIS A 1 17  ? 8.087   -20.101 -1.643  1.00 27.04 ? 1691 HIS A ND1 1 
ATOM   147  C  CD2 . HIS A 1 17  ? 7.245   -18.220 -0.919  1.00 22.15 ? 1691 HIS A CD2 1 
ATOM   148  C  CE1 . HIS A 1 17  ? 8.838   -19.701 -0.630  1.00 22.12 ? 1691 HIS A CE1 1 
ATOM   149  N  NE2 . HIS A 1 17  ? 8.353   -18.557 -0.178  1.00 25.70 ? 1691 HIS A NE2 1 
ATOM   150  N  N   . PHE A 1 18  ? 3.788   -19.382 -0.912  1.00 17.95 ? 1692 PHE A N   1 
ATOM   151  C  CA  . PHE A 1 18  ? 3.338   -19.242 0.462   1.00 20.36 ? 1692 PHE A CA  1 
ATOM   152  C  C   . PHE A 1 18  ? 2.443   -20.445 0.851   1.00 16.58 ? 1692 PHE A C   1 
ATOM   153  O  O   . PHE A 1 18  ? 2.604   -21.033 1.925   1.00 19.54 ? 1692 PHE A O   1 
ATOM   154  C  CB  . PHE A 1 18  ? 2.690   -17.853 0.661   1.00 18.09 ? 1692 PHE A CB  1 
ATOM   155  C  CG  . PHE A 1 18  ? 2.229   -17.569 2.056   1.00 19.92 ? 1692 PHE A CG  1 
ATOM   156  C  CD1 . PHE A 1 18  ? 2.944   -18.025 3.165   1.00 18.83 ? 1692 PHE A CD1 1 
ATOM   157  C  CD2 . PHE A 1 18  ? 1.085   -16.793 2.264   1.00 18.75 ? 1692 PHE A CD2 1 
ATOM   158  C  CE1 . PHE A 1 18  ? 2.499   -17.758 4.452   1.00 18.50 ? 1692 PHE A CE1 1 
ATOM   159  C  CE2 . PHE A 1 18  ? 0.644   -16.518 3.545   1.00 22.30 ? 1692 PHE A CE2 1 
ATOM   160  C  CZ  . PHE A 1 18  ? 1.345   -16.998 4.643   1.00 22.42 ? 1692 PHE A CZ  1 
ATOM   161  N  N   . MET A 1 19  ? 1.505   -20.826 -0.023  1.00 21.39 ? 1693 MET A N   1 
ATOM   162  C  CA  A MET A 1 19  ? 0.718   -22.032 0.239   0.50 19.68 ? 1693 MET A CA  1 
ATOM   163  C  CA  B MET A 1 19  ? 0.723   -22.066 0.119   0.50 22.32 ? 1693 MET A CA  1 
ATOM   164  C  C   . MET A 1 19  ? 1.577   -23.275 0.503   1.00 20.69 ? 1693 MET A C   1 
ATOM   165  O  O   . MET A 1 19  ? 1.316   -23.994 1.472   1.00 22.98 ? 1693 MET A O   1 
ATOM   166  C  CB  A MET A 1 19  ? -0.268  -22.324 -0.890  0.50 17.58 ? 1693 MET A CB  1 
ATOM   167  C  CB  B MET A 1 19  ? 0.074   -22.395 -1.228  0.50 23.39 ? 1693 MET A CB  1 
ATOM   168  C  CG  A MET A 1 19  ? -1.393  -21.322 -1.046  0.50 16.25 ? 1693 MET A CG  1 
ATOM   169  C  CG  B MET A 1 19  ? -0.773  -21.294 -1.803  0.50 23.93 ? 1693 MET A CG  1 
ATOM   170  S  SD  A MET A 1 19  ? -2.204  -21.617 -2.625  0.50 13.77 ? 1693 MET A SD  1 
ATOM   171  S  SD  B MET A 1 19  ? -2.401  -21.434 -1.086  0.50 22.03 ? 1693 MET A SD  1 
ATOM   172  C  CE  A MET A 1 19  ? -2.753  -23.303 -2.414  0.50 14.19 ? 1693 MET A CE  1 
ATOM   173  C  CE  B MET A 1 19  ? -2.949  -22.974 -1.817  0.50 15.79 ? 1693 MET A CE  1 
ATOM   174  N  N   . LYS A 1 20  ? 2.586   -23.505 -0.321  1.00 22.29 ? 1694 LYS A N   1 
ATOM   175  C  CA  A LYS A 1 20  ? 3.572   -24.553 -0.075  0.70 24.67 ? 1694 LYS A CA  1 
ATOM   176  C  CA  B LYS A 1 20  ? 3.590   -24.544 -0.081  0.30 24.08 ? 1694 LYS A CA  1 
ATOM   177  C  C   . LYS A 1 20  ? 4.255   -24.457 1.297   1.00 24.25 ? 1694 LYS A C   1 
ATOM   178  O  O   . LYS A 1 20  ? 4.448   -25.467 1.978   1.00 24.50 ? 1694 LYS A O   1 
ATOM   179  C  CB  A LYS A 1 20  ? 4.613   -24.548 -1.192  0.70 25.88 ? 1694 LYS A CB  1 
ATOM   180  C  CB  B LYS A 1 20  ? 4.662   -24.490 -1.172  0.30 24.99 ? 1694 LYS A CB  1 
ATOM   181  C  CG  A LYS A 1 20  ? 5.519   -25.775 -1.205  0.70 29.24 ? 1694 LYS A CG  1 
ATOM   182  C  CG  B LYS A 1 20  ? 4.188   -24.952 -2.539  0.30 26.80 ? 1694 LYS A CG  1 
ATOM   183  C  CD  A LYS A 1 20  ? 6.503   -25.702 -2.353  0.70 35.30 ? 1694 LYS A CD  1 
ATOM   184  C  CD  B LYS A 1 20  ? 5.289   -24.832 -3.577  0.30 27.85 ? 1694 LYS A CD  1 
ATOM   185  C  CE  A LYS A 1 20  ? 7.716   -24.865 -1.976  0.70 35.61 ? 1694 LYS A CE  1 
ATOM   186  C  CE  B LYS A 1 20  ? 5.242   -23.485 -4.284  0.30 25.80 ? 1694 LYS A CE  1 
ATOM   187  N  NZ  A LYS A 1 20  ? 8.324   -24.197 -3.160  0.70 40.55 ? 1694 LYS A NZ  1 
ATOM   188  N  NZ  B LYS A 1 20  ? 6.273   -23.375 -5.357  0.30 28.00 ? 1694 LYS A NZ  1 
ATOM   189  N  N   . LEU A 1 21  ? 4.627   -23.249 1.709   1.00 22.45 ? 1695 LEU A N   1 
ATOM   190  C  CA  . LEU A 1 21  ? 5.215   -23.078 3.025   1.00 21.99 ? 1695 LEU A CA  1 
ATOM   191  C  C   . LEU A 1 21  ? 4.239   -23.422 4.143   1.00 21.65 ? 1695 LEU A C   1 
ATOM   192  O  O   . LEU A 1 21  ? 4.645   -23.987 5.161   1.00 24.27 ? 1695 LEU A O   1 
ATOM   193  C  CB  . LEU A 1 21  ? 5.732   -21.645 3.199   1.00 21.86 ? 1695 LEU A CB  1 
ATOM   194  C  CG  . LEU A 1 21  ? 6.919   -21.172 2.353   1.00 22.19 ? 1695 LEU A CG  1 
ATOM   195  C  CD1 . LEU A 1 21  ? 7.311   -19.744 2.745   1.00 22.86 ? 1695 LEU A CD1 1 
ATOM   196  C  CD2 . LEU A 1 21  ? 8.118   -22.112 2.558   1.00 24.42 ? 1695 LEU A CD2 1 
ATOM   197  N  N   . GLN A 1 22  ? 2.956   -23.072 3.964   1.00 21.19 ? 1696 GLN A N   1 
ATOM   198  C  CA  . GLN A 1 22  ? 1.944   -23.284 5.015   1.00 21.21 ? 1696 GLN A CA  1 
ATOM   199  C  C   . GLN A 1 22  ? 1.428   -24.722 5.081   1.00 21.79 ? 1696 GLN A C   1 
ATOM   200  O  O   . GLN A 1 22  ? 0.856   -25.146 6.087   1.00 23.09 ? 1696 GLN A O   1 
ATOM   201  C  CB  . GLN A 1 22  ? 0.735   -22.400 4.770   1.00 21.63 ? 1696 GLN A CB  1 
ATOM   202  C  CG  . GLN A 1 22  ? 1.021   -20.940 4.916   1.00 20.78 ? 1696 GLN A CG  1 
ATOM   203  C  CD  . GLN A 1 22  ? -0.224  -20.133 4.672   1.00 22.86 ? 1696 GLN A CD  1 
ATOM   204  O  OE1 . GLN A 1 22  ? -0.711  -20.055 3.543   1.00 25.29 ? 1696 GLN A OE1 1 
ATOM   205  N  NE2 . GLN A 1 22  ? -0.767  -19.553 5.733   1.00 27.03 ? 1696 GLN A NE2 1 
ATOM   206  N  N   . ALA A 1 23  ? 1.618   -25.456 4.003   1.00 21.80 ? 1697 ALA A N   1 
ATOM   207  C  CA  . ALA A 1 23  ? 1.105   -26.828 3.926   1.00 24.52 ? 1697 ALA A CA  1 
ATOM   208  C  C   . ALA A 1 23  ? 1.625   -27.668 5.094   1.00 28.66 ? 1697 ALA A C   1 
ATOM   209  O  O   . ALA A 1 23  ? 2.749   -27.460 5.561   1.00 26.57 ? 1697 ALA A O   1 
ATOM   210  C  CB  . ALA A 1 23  ? 1.509   -27.457 2.602   1.00 25.20 ? 1697 ALA A CB  1 
ATOM   211  N  N   . ASP A 1 24  ? 0.814   -28.614 5.565   1.00 30.63 ? 1698 ASP A N   1 
ATOM   212  C  CA  A ASP A 1 24  ? 1.260   -29.564 6.574   0.50 32.50 ? 1698 ASP A CA  1 
ATOM   213  C  CA  B ASP A 1 24  ? 1.249   -29.561 6.584   0.50 32.01 ? 1698 ASP A CA  1 
ATOM   214  C  C   . ASP A 1 24  ? 1.633   -28.853 7.879   1.00 32.48 ? 1698 ASP A C   1 
ATOM   215  O  O   . ASP A 1 24  ? 2.708   -29.084 8.430   1.00 32.61 ? 1698 ASP A O   1 
ATOM   216  C  CB  A ASP A 1 24  ? 2.463   -30.352 6.045   0.50 34.62 ? 1698 ASP A CB  1 
ATOM   217  C  CB  B ASP A 1 24  ? 2.427   -30.391 6.073   0.50 33.61 ? 1698 ASP A CB  1 
ATOM   218  C  CG  A ASP A 1 24  ? 2.571   -31.737 6.650   0.50 38.31 ? 1698 ASP A CG  1 
ATOM   219  C  CG  B ASP A 1 24  ? 2.063   -31.229 4.871   0.50 35.65 ? 1698 ASP A CG  1 
ATOM   220  O  OD1 A ASP A 1 24  ? 1.726   -32.092 7.502   0.50 41.67 ? 1698 ASP A OD1 1 
ATOM   221  O  OD1 B ASP A 1 24  ? 0.996   -31.878 4.911   0.50 37.37 ? 1698 ASP A OD1 1 
ATOM   222  O  OD2 A ASP A 1 24  ? 3.507   -32.470 6.271   0.50 41.76 ? 1698 ASP A OD2 1 
ATOM   223  O  OD2 B ASP A 1 24  ? 2.838   -31.237 3.891   0.50 37.88 ? 1698 ASP A OD2 1 
ATOM   224  N  N   . SER A 1 25  ? 0.741   -27.991 8.360   1.00 30.01 ? 1699 SER A N   1 
ATOM   225  C  CA  . SER A 1 25  ? 0.928   -27.301 9.630   1.00 30.24 ? 1699 SER A CA  1 
ATOM   226  C  C   . SER A 1 25  ? 2.228   -26.494 9.623   1.00 29.23 ? 1699 SER A C   1 
ATOM   227  O  O   . SER A 1 25  ? 2.995   -26.517 10.591  1.00 30.76 ? 1699 SER A O   1 
ATOM   228  C  CB  . SER A 1 25  ? 0.918   -28.296 10.792  1.00 32.31 ? 1699 SER A CB  1 
ATOM   229  O  OG  . SER A 1 25  ? -0.342  -28.941 10.885  1.00 36.93 ? 1699 SER A OG  1 
ATOM   230  N  N   . ASN A 1 26  ? 2.461   -25.785 8.522   1.00 26.12 ? 1700 ASN A N   1 
ATOM   231  C  CA  . ASN A 1 26  ? 3.596   -24.860 8.410   1.00 25.37 ? 1700 ASN A CA  1 
ATOM   232  C  C   . ASN A 1 26  ? 4.934   -25.596 8.324   1.00 25.38 ? 1700 ASN A C   1 
ATOM   233  O  O   . ASN A 1 26  ? 5.962   -25.069 8.730   1.00 24.22 ? 1700 ASN A O   1 
ATOM   234  C  CB  . ASN A 1 26  ? 3.609   -23.858 9.572   1.00 26.34 ? 1700 ASN A CB  1 
ATOM   235  C  CG  . ASN A 1 26  ? 2.854   -22.580 9.247   1.00 28.83 ? 1700 ASN A CG  1 
ATOM   236  O  OD1 . ASN A 1 26  ? 2.206   -22.480 8.205   1.00 31.26 ? 1700 ASN A OD1 1 
ATOM   237  N  ND2 . ASN A 1 26  ? 2.947   -21.589 10.130  1.00 29.73 ? 1700 ASN A ND2 1 
ATOM   238  N  N   . TYR A 1 27  ? 4.929   -26.809 7.786   1.00 24.41 ? 1701 TYR A N   1 
ATOM   239  C  CA  . TYR A 1 27  ? 6.149   -27.618 7.782   1.00 27.05 ? 1701 TYR A CA  1 
ATOM   240  C  C   . TYR A 1 27  ? 7.361   -26.883 7.199   1.00 27.32 ? 1701 TYR A C   1 
ATOM   241  O  O   . TYR A 1 27  ? 8.393   -26.744 7.858   1.00 27.77 ? 1701 TYR A O   1 
ATOM   242  C  CB  . TYR A 1 27  ? 5.933   -28.945 7.053   1.00 28.36 ? 1701 TYR A CB  1 
ATOM   243  C  CG  . TYR A 1 27  ? 7.142   -29.853 7.143   1.00 27.13 ? 1701 TYR A CG  1 
ATOM   244  C  CD1 . TYR A 1 27  ? 7.482   -30.471 8.343   1.00 35.27 ? 1701 TYR A CD1 1 
ATOM   245  C  CD2 . TYR A 1 27  ? 7.939   -30.082 6.033   1.00 30.00 ? 1701 TYR A CD2 1 
ATOM   246  C  CE1 . TYR A 1 27  ? 8.589   -31.306 8.432   1.00 36.67 ? 1701 TYR A CE1 1 
ATOM   247  C  CE2 . TYR A 1 27  ? 9.049   -30.922 6.106   1.00 33.29 ? 1701 TYR A CE2 1 
ATOM   248  C  CZ  . TYR A 1 27  ? 9.368   -31.523 7.308   1.00 36.01 ? 1701 TYR A CZ  1 
ATOM   249  O  OH  . TYR A 1 27  ? 10.469  -32.347 7.384   1.00 40.46 ? 1701 TYR A OH  1 
ATOM   250  N  N   . LEU A 1 28  ? 7.249   -26.428 5.957   1.00 22.32 ? 1702 LEU A N   1 
ATOM   251  C  CA  . LEU A 1 28  ? 8.378   -25.792 5.292   1.00 23.73 ? 1702 LEU A CA  1 
ATOM   252  C  C   . LEU A 1 28  ? 8.558   -24.351 5.746   1.00 20.86 ? 1702 LEU A C   1 
ATOM   253  O  O   . LEU A 1 28  ? 9.676   -23.832 5.785   1.00 21.32 ? 1702 LEU A O   1 
ATOM   254  C  CB  . LEU A 1 28  ? 8.229   -25.832 3.779   1.00 22.29 ? 1702 LEU A CB  1 
ATOM   255  C  CG  . LEU A 1 28  ? 8.203   -27.224 3.129   1.00 23.67 ? 1702 LEU A CG  1 
ATOM   256  C  CD1 . LEU A 1 28  ? 8.058   -27.095 1.624   1.00 25.75 ? 1702 LEU A CD1 1 
ATOM   257  C  CD2 . LEU A 1 28  ? 9.471   -27.971 3.475   1.00 27.17 ? 1702 LEU A CD2 1 
ATOM   258  N  N   . LEU A 1 29  ? 7.459   -23.694 6.092   1.00 21.00 ? 1703 LEU A N   1 
ATOM   259  C  CA  . LEU A 1 29  ? 7.565   -22.320 6.581   1.00 21.63 ? 1703 LEU A CA  1 
ATOM   260  C  C   . LEU A 1 29  ? 8.452   -22.288 7.815   1.00 21.12 ? 1703 LEU A C   1 
ATOM   261  O  O   . LEU A 1 29  ? 9.380   -21.471 7.907   1.00 21.18 ? 1703 LEU A O   1 
ATOM   262  C  CB  . LEU A 1 29  ? 6.183   -21.728 6.881   1.00 20.66 ? 1703 LEU A CB  1 
ATOM   263  C  CG  . LEU A 1 29  ? 6.281   -20.237 7.215   1.00 22.84 ? 1703 LEU A CG  1 
ATOM   264  C  CD1 . LEU A 1 29  ? 5.080   -19.461 6.677   1.00 31.74 ? 1703 LEU A CD1 1 
ATOM   265  C  CD2 . LEU A 1 29  ? 6.445   -20.050 8.717   1.00 25.53 ? 1703 LEU A CD2 1 
ATOM   266  N  N   . SER A 1 30  ? 8.188   -23.207 8.746   1.00 22.07 ? 1704 SER A N   1 
ATOM   267  C  CA  . SER A 1 30  ? 8.959   -23.296 9.988   1.00 20.72 ? 1704 SER A CA  1 
ATOM   268  C  C   . SER A 1 30  ? 10.419  -23.629 9.711   1.00 21.45 ? 1704 SER A C   1 
ATOM   269  O  O   . SER A 1 30  ? 11.308  -23.084 10.363  1.00 22.78 ? 1704 SER A O   1 
ATOM   270  C  CB  . SER A 1 30  ? 8.337   -24.320 10.946  1.00 22.68 ? 1704 SER A CB  1 
ATOM   271  O  OG  . SER A 1 30  ? 7.030   -23.916 11.321  1.00 26.17 ? 1704 SER A OG  1 
ATOM   272  N  N   . LYS A 1 31  ? 10.672  -24.492 8.725   1.00 20.97 ? 1705 LYS A N   1 
ATOM   273  C  CA  . LYS A 1 31  ? 12.057  -24.827 8.365   1.00 21.95 ? 1705 LYS A CA  1 
ATOM   274  C  C   . LYS A 1 31  ? 12.781  -23.593 7.830   1.00 21.86 ? 1705 LYS A C   1 
ATOM   275  O  O   . LYS A 1 31  ? 13.935  -23.327 8.179   1.00 20.96 ? 1705 LYS A O   1 
ATOM   276  C  CB  . LYS A 1 31  ? 12.119  -25.969 7.339   1.00 24.41 ? 1705 LYS A CB  1 
ATOM   277  C  CG  . LYS A 1 31  ? 11.877  -27.351 7.929   1.00 30.00 ? 1705 LYS A CG  1 
ATOM   278  C  CD  . LYS A 1 31  ? 11.782  -28.426 6.843   1.00 37.43 ? 1705 LYS A CD  1 
ATOM   279  C  CE  . LYS A 1 31  ? 13.066  -28.521 6.020   1.00 41.69 ? 1705 LYS A CE  1 
ATOM   280  N  NZ  . LYS A 1 31  ? 12.975  -29.537 4.916   1.00 42.08 ? 1705 LYS A NZ  1 
ATOM   281  N  N   . GLU A 1 32  ? 12.098  -22.814 6.995   1.00 20.55 ? 1706 GLU A N   1 
ATOM   282  C  CA  . GLU A 1 32  ? 12.734  -21.628 6.434   1.00 19.21 ? 1706 GLU A CA  1 
ATOM   283  C  C   . GLU A 1 32  ? 12.988  -20.614 7.540   1.00 18.88 ? 1706 GLU A C   1 
ATOM   284  O  O   . GLU A 1 32  ? 14.076  -20.036 7.640   1.00 18.37 ? 1706 GLU A O   1 
ATOM   285  C  CB  . GLU A 1 32  ? 11.870  -21.004 5.336   1.00 19.55 ? 1706 GLU A CB  1 
ATOM   286  C  CG  . GLU A 1 32  ? 12.465  -19.718 4.783   1.00 19.59 ? 1706 GLU A CG  1 
ATOM   287  C  CD  . GLU A 1 32  ? 11.722  -19.231 3.556   1.00 22.70 ? 1706 GLU A CD  1 
ATOM   288  O  OE1 . GLU A 1 32  ? 11.860  -19.855 2.485   1.00 28.65 ? 1706 GLU A OE1 1 
ATOM   289  O  OE2 . GLU A 1 32  ? 10.993  -18.220 3.662   1.00 21.98 ? 1706 GLU A OE2 1 
ATOM   290  N  N   . TYR A 1 33  ? 11.972  -20.387 8.370   1.00 19.24 ? 1707 TYR A N   1 
ATOM   291  C  CA  . TYR A 1 33  ? 12.101  -19.440 9.469   1.00 19.26 ? 1707 TYR A CA  1 
ATOM   292  C  C   . TYR A 1 33  ? 13.239  -19.840 10.420  1.00 18.74 ? 1707 TYR A C   1 
ATOM   293  O  O   . TYR A 1 33  ? 14.000  -18.971 10.866  1.00 17.36 ? 1707 TYR A O   1 
ATOM   294  C  CB  . TYR A 1 33  ? 10.776  -19.282 10.216  1.00 19.64 ? 1707 TYR A CB  1 
ATOM   295  C  CG  . TYR A 1 33  ? 10.846  -18.325 11.383  1.00 18.51 ? 1707 TYR A CG  1 
ATOM   296  C  CD1 . TYR A 1 33  ? 10.930  -16.953 11.180  1.00 18.95 ? 1707 TYR A CD1 1 
ATOM   297  C  CD2 . TYR A 1 33  ? 10.862  -18.795 12.688  1.00 20.28 ? 1707 TYR A CD2 1 
ATOM   298  C  CE1 . TYR A 1 33  ? 11.014  -16.077 12.250  1.00 17.35 ? 1707 TYR A CE1 1 
ATOM   299  C  CE2 . TYR A 1 33  ? 10.938  -17.944 13.756  1.00 22.17 ? 1707 TYR A CE2 1 
ATOM   300  C  CZ  . TYR A 1 33  ? 11.024  -16.587 13.540  1.00 20.55 ? 1707 TYR A CZ  1 
ATOM   301  O  OH  . TYR A 1 33  ? 11.109  -15.759 14.631  1.00 23.39 ? 1707 TYR A OH  1 
ATOM   302  N  N   . GLU A 1 34  ? 13.379  -21.143 10.695  1.00 17.82 ? 1708 GLU A N   1 
ATOM   303  C  CA  A GLU A 1 34  ? 14.408  -21.602 11.615  0.70 18.88 ? 1708 GLU A CA  1 
ATOM   304  C  CA  B GLU A 1 34  ? 14.409  -21.649 11.602  0.30 18.52 ? 1708 GLU A CA  1 
ATOM   305  C  C   . GLU A 1 34  ? 15.810  -21.362 11.064  1.00 18.39 ? 1708 GLU A C   1 
ATOM   306  O  O   . GLU A 1 34  ? 16.769  -21.215 11.829  1.00 19.69 ? 1708 GLU A O   1 
ATOM   307  C  CB  A GLU A 1 34  ? 14.206  -23.072 11.974  0.70 20.59 ? 1708 GLU A CB  1 
ATOM   308  C  CB  B GLU A 1 34  ? 14.228  -23.157 11.828  0.30 19.67 ? 1708 GLU A CB  1 
ATOM   309  C  CG  A GLU A 1 34  ? 13.128  -23.296 13.014  0.70 28.19 ? 1708 GLU A CG  1 
ATOM   310  C  CG  B GLU A 1 34  ? 15.131  -23.763 12.903  0.30 21.37 ? 1708 GLU A CG  1 
ATOM   311  C  CD  A GLU A 1 34  ? 13.072  -24.738 13.496  0.70 40.13 ? 1708 GLU A CD  1 
ATOM   312  C  CD  B GLU A 1 34  ? 15.097  -25.286 12.912  0.30 27.24 ? 1708 GLU A CD  1 
ATOM   313  O  OE1 A GLU A 1 34  ? 14.135  -25.294 13.848  0.70 46.31 ? 1708 GLU A OE1 1 
ATOM   314  O  OE1 B GLU A 1 34  ? 15.561  -25.901 11.928  0.30 28.33 ? 1708 GLU A OE1 1 
ATOM   315  O  OE2 A GLU A 1 34  ? 11.963  -25.316 13.526  0.70 44.39 ? 1708 GLU A OE2 1 
ATOM   316  O  OE2 B GLU A 1 34  ? 14.610  -25.871 13.905  0.30 29.84 ? 1708 GLU A OE2 1 
ATOM   317  N  N   . GLU A 1 35  ? 15.938  -21.304 9.745   1.00 16.89 ? 1709 GLU A N   1 
ATOM   318  C  CA  . GLU A 1 35  ? 17.244  -21.020 9.142   1.00 18.38 ? 1709 GLU A CA  1 
ATOM   319  C  C   . GLU A 1 35  ? 17.754  -19.623 9.477   1.00 16.10 ? 1709 GLU A C   1 
ATOM   320  O  O   . GLU A 1 35  ? 18.955  -19.336 9.363   1.00 18.51 ? 1709 GLU A O   1 
ATOM   321  C  CB  . GLU A 1 35  ? 17.202  -21.196 7.633   1.00 20.31 ? 1709 GLU A CB  1 
ATOM   322  C  CG  . GLU A 1 35  ? 16.926  -22.618 7.186   1.00 25.34 ? 1709 GLU A CG  1 
ATOM   323  C  CD  . GLU A 1 35  ? 16.916  -22.750 5.682   1.00 39.10 ? 1709 GLU A CD  1 
ATOM   324  O  OE1 . GLU A 1 35  ? 17.520  -21.891 5.005   1.00 45.53 ? 1709 GLU A OE1 1 
ATOM   325  O  OE2 . GLU A 1 35  ? 16.300  -23.713 5.175   1.00 44.62 ? 1709 GLU A OE2 1 
ATOM   326  N  N   . LEU A 1 36  ? 16.841  -18.744 9.872   1.00 13.88 ? 1710 LEU A N   1 
ATOM   327  C  CA  . LEU A 1 36  ? 17.219  -17.377 10.245  1.00 13.30 ? 1710 LEU A CA  1 
ATOM   328  C  C   . LEU A 1 36  ? 17.683  -17.254 11.711  1.00 14.25 ? 1710 LEU A C   1 
ATOM   329  O  O   . LEU A 1 36  ? 18.154  -16.200 12.137  1.00 14.18 ? 1710 LEU A O   1 
ATOM   330  C  CB  . LEU A 1 36  ? 16.049  -16.425 9.975   1.00 13.42 ? 1710 LEU A CB  1 
ATOM   331  C  CG  . LEU A 1 36  ? 15.685  -16.240 8.505   1.00 13.65 ? 1710 LEU A CG  1 
ATOM   332  C  CD1 . LEU A 1 36  ? 14.244  -15.692 8.351   1.00 16.46 ? 1710 LEU A CD1 1 
ATOM   333  C  CD2 . LEU A 1 36  ? 16.665  -15.278 7.851   1.00 17.44 ? 1710 LEU A CD2 1 
ATOM   334  N  N   . LYS A 1 37  ? 17.545  -18.338 12.476  1.00 15.22 ? 1711 LYS A N   1 
ATOM   335  C  CA  . LYS A 1 37  ? 17.604  -18.283 13.931  1.00 15.59 ? 1711 LYS A CA  1 
ATOM   336  C  C   . LYS A 1 37  ? 18.887  -17.611 14.436  1.00 14.57 ? 1711 LYS A C   1 
ATOM   337  O  O   . LYS A 1 37  ? 18.847  -16.762 15.325  1.00 17.35 ? 1711 LYS A O   1 
ATOM   338  C  CB  . LYS A 1 37  ? 17.501  -19.706 14.501  1.00 18.71 ? 1711 LYS A CB  1 
ATOM   339  C  CG  . LYS A 1 37  ? 17.418  -19.786 16.014  1.00 25.22 ? 1711 LYS A CG  1 
ATOM   340  C  CD  . LYS A 1 37  ? 17.429  -21.248 16.467  1.00 32.44 ? 1711 LYS A CD  1 
ATOM   341  C  CE  . LYS A 1 37  ? 18.415  -21.492 17.594  1.00 32.75 ? 1711 LYS A CE  1 
ATOM   342  N  NZ  . LYS A 1 37  ? 18.489  -22.948 17.899  1.00 38.90 ? 1711 LYS A NZ  1 
ATOM   343  N  N   . ASP A 1 38  ? 20.026  -18.009 13.882  1.00 14.21 ? 1712 ASP A N   1 
ATOM   344  C  CA  . ASP A 1 38  ? 21.317  -17.609 14.439  1.00 15.05 ? 1712 ASP A CA  1 
ATOM   345  C  C   . ASP A 1 38  ? 21.917  -16.381 13.741  1.00 14.93 ? 1712 ASP A C   1 
ATOM   346  O  O   . ASP A 1 38  ? 23.011  -15.947 14.077  1.00 15.76 ? 1712 ASP A O   1 
ATOM   347  C  CB  . ASP A 1 38  ? 22.291  -18.793 14.410  1.00 17.11 ? 1712 ASP A CB  1 
ATOM   348  C  CG  . ASP A 1 38  ? 21.865  -19.916 15.332  1.00 20.59 ? 1712 ASP A CG  1 
ATOM   349  O  OD1 . ASP A 1 38  ? 21.381  -19.620 16.445  1.00 27.69 ? 1712 ASP A OD1 1 
ATOM   350  O  OD2 . ASP A 1 38  ? 21.996  -21.094 14.934  1.00 33.06 ? 1712 ASP A OD2 1 
ATOM   351  N  N   . VAL A 1 39  ? 21.201  -15.804 12.781  1.00 13.75 ? 1713 VAL A N   1 
ATOM   352  C  CA  . VAL A 1 39  ? 21.750  -14.671 12.031  1.00 11.61 ? 1713 VAL A CA  1 
ATOM   353  C  C   . VAL A 1 39  ? 22.086  -13.516 12.991  1.00 13.50 ? 1713 VAL A C   1 
ATOM   354  O  O   . VAL A 1 39  ? 21.255  -13.107 13.825  1.00 14.28 ? 1713 VAL A O   1 
ATOM   355  C  CB  . VAL A 1 39  ? 20.788  -14.185 10.927  1.00 12.60 ? 1713 VAL A CB  1 
ATOM   356  C  CG1 . VAL A 1 39  ? 21.326  -12.946 10.234  1.00 12.86 ? 1713 VAL A CG1 1 
ATOM   357  C  CG2 . VAL A 1 39  ? 20.552  -15.319 9.908   1.00 13.78 ? 1713 VAL A CG2 1 
ATOM   358  N  N   . GLY A 1 40  ? 23.301  -12.996 12.865  1.00 13.39 ? 1714 GLY A N   1 
ATOM   359  C  CA  . GLY A 1 40  ? 23.724  -11.828 13.647  1.00 14.76 ? 1714 GLY A CA  1 
ATOM   360  C  C   . GLY A 1 40  ? 24.235  -12.168 15.042  1.00 15.33 ? 1714 GLY A C   1 
ATOM   361  O  O   . GLY A 1 40  ? 24.814  -11.307 15.715  1.00 15.62 ? 1714 GLY A O   1 
ATOM   362  N  N   . ARG A 1 41  ? 24.043  -13.421 15.479  1.00 16.24 ? 1715 ARG A N   1 
ATOM   363  C  CA  . ARG A 1 41  ? 24.208  -13.786 16.897  1.00 18.54 ? 1715 ARG A CA  1 
ATOM   364  C  C   . ARG A 1 41  ? 25.678  -14.042 17.304  1.00 18.71 ? 1715 ARG A C   1 
ATOM   365  O  O   . ARG A 1 41  ? 25.947  -14.422 18.439  1.00 20.38 ? 1715 ARG A O   1 
ATOM   366  C  CB  . ARG A 1 41  ? 23.312  -14.989 17.287  1.00 17.77 ? 1715 ARG A CB  1 
ATOM   367  C  CG  . ARG A 1 41  ? 21.782  -14.773 17.097  1.00 21.14 ? 1715 ARG A CG  1 
ATOM   368  C  CD  . ARG A 1 41  ? 21.197  -13.833 18.155  1.00 17.57 ? 1715 ARG A CD  1 
ATOM   369  N  NE  . ARG A 1 41  ? 19.748  -13.668 18.056  1.00 20.18 ? 1715 ARG A NE  1 
ATOM   370  C  CZ  . ARG A 1 41  ? 18.896  -13.987 19.028  1.00 19.80 ? 1715 ARG A CZ  1 
ATOM   371  N  NH1 . ARG A 1 41  ? 19.348  -14.507 20.160  1.00 19.53 ? 1715 ARG A NH1 1 
ATOM   372  N  NH2 . ARG A 1 41  ? 17.594  -13.768 18.876  1.00 21.11 ? 1715 ARG A NH2 1 
ATOM   373  N  N   . ASN A 1 42  ? 26.611  -13.798 16.395  1.00 17.94 ? 1716 ASN A N   1 
ATOM   374  C  CA  A ASN A 1 42  ? 28.026  -13.866 16.753  0.50 19.01 ? 1716 ASN A CA  1 
ATOM   375  C  CA  B ASN A 1 42  ? 28.044  -13.841 16.678  0.50 20.08 ? 1716 ASN A CA  1 
ATOM   376  C  C   . ASN A 1 42  ? 28.546  -12.538 17.314  1.00 20.49 ? 1716 ASN A C   1 
ATOM   377  O  O   . ASN A 1 42  ? 29.707  -12.427 17.707  1.00 20.56 ? 1716 ASN A O   1 
ATOM   378  C  CB  A ASN A 1 42  ? 28.875  -14.324 15.562  0.50 21.00 ? 1716 ASN A CB  1 
ATOM   379  C  CB  B ASN A 1 42  ? 28.796  -14.078 15.365  0.50 23.47 ? 1716 ASN A CB  1 
ATOM   380  C  CG  A ASN A 1 42  ? 28.482  -15.696 15.056  0.50 22.99 ? 1716 ASN A CG  1 
ATOM   381  C  CG  B ASN A 1 42  ? 28.587  -12.947 14.365  0.50 27.18 ? 1716 ASN A CG  1 
ATOM   382  O  OD1 A ASN A 1 42  ? 28.230  -16.610 15.841  0.50 25.98 ? 1716 ASN A OD1 1 
ATOM   383  O  OD1 B ASN A 1 42  ? 27.462  -12.669 13.946  0.50 27.55 ? 1716 ASN A OD1 1 
ATOM   384  N  ND2 A ASN A 1 42  ? 28.437  -15.850 13.737  0.50 27.28 ? 1716 ASN A ND2 1 
ATOM   385  N  ND2 B ASN A 1 42  ? 29.675  -12.275 13.995  0.50 31.16 ? 1716 ASN A ND2 1 
ATOM   386  N  N   . GLN A 1 43  ? 27.674  -11.536 17.377  1.00 15.41 ? 1717 GLN A N   1 
ATOM   387  C  CA  . GLN A 1 43  ? 28.049  -10.166 17.763  1.00 13.69 ? 1717 GLN A CA  1 
ATOM   388  C  C   . GLN A 1 43  ? 27.819  -9.888  19.250  1.00 12.79 ? 1717 GLN A C   1 
ATOM   389  O  O   . GLN A 1 43  ? 26.830  -10.324 19.834  1.00 14.17 ? 1717 GLN A O   1 
ATOM   390  C  CB  . GLN A 1 43  ? 27.274  -9.148  16.919  1.00 12.51 ? 1717 GLN A CB  1 
ATOM   391  C  CG  . GLN A 1 43  ? 27.658  -9.167  15.448  1.00 17.23 ? 1717 GLN A CG  1 
ATOM   392  C  CD  . GLN A 1 43  ? 26.763  -8.277  14.615  1.00 18.16 ? 1717 GLN A CD  1 
ATOM   393  O  OE1 . GLN A 1 43  ? 27.162  -7.213  14.165  1.00 22.64 ? 1717 GLN A OE1 1 
ATOM   394  N  NE2 . GLN A 1 43  ? 25.543  -8.726  14.391  1.00 14.63 ? 1717 GLN A NE2 1 
ATOM   395  N  N   . SER A 1 44  ? 28.725  -9.127  19.863  1.00 10.34 ? 1718 SER A N   1 
ATOM   396  C  CA  . SER A 1 44  ? 28.614  -8.796  21.282  1.00 9.42  ? 1718 SER A CA  1 
ATOM   397  C  C   . SER A 1 44  ? 27.897  -7.470  21.525  1.00 9.53  ? 1718 SER A C   1 
ATOM   398  O  O   . SER A 1 44  ? 27.786  -6.620  20.617  1.00 11.02 ? 1718 SER A O   1 
ATOM   399  C  CB  . SER A 1 44  ? 30.005  -8.736  21.928  1.00 10.73 ? 1718 SER A CB  1 
ATOM   400  O  OG  . SER A 1 44  ? 30.663  -9.985  21.771  1.00 11.63 ? 1718 SER A OG  1 
ATOM   401  N  N   . CYS A 1 45  ? 27.444  -7.307  22.765  1.00 10.26 ? 1719 CYS A N   1 
ATOM   402  C  CA  A CYS A 1 45  ? 26.815  -6.070  23.224  0.70 10.19 ? 1719 CYS A CA  1 
ATOM   403  C  CA  B CYS A 1 45  ? 26.832  -6.060  23.217  0.30 11.89 ? 1719 CYS A CA  1 
ATOM   404  C  C   . CYS A 1 45  ? 27.537  -5.551  24.476  1.00 11.95 ? 1719 CYS A C   1 
ATOM   405  O  O   . CYS A 1 45  ? 26.901  -5.185  25.478  1.00 11.33 ? 1719 CYS A O   1 
ATOM   406  C  CB  A CYS A 1 45  ? 25.342  -6.318  23.567  0.70 11.36 ? 1719 CYS A CB  1 
ATOM   407  C  CB  B CYS A 1 45  ? 25.337  -6.261  23.483  0.30 13.31 ? 1719 CYS A CB  1 
ATOM   408  S  SG  A CYS A 1 45  ? 24.347  -7.032  22.245  0.70 9.58  ? 1719 CYS A SG  1 
ATOM   409  S  SG  B CYS A 1 45  ? 24.922  -7.783  24.371  0.30 18.85 ? 1719 CYS A SG  1 
ATOM   410  N  N   . ASP A 1 46  ? 28.867  -5.528  24.436  1.00 11.07 ? 1720 ASP A N   1 
ATOM   411  C  CA  . ASP A 1 46  ? 29.634  -5.242  25.641  1.00 11.43 ? 1720 ASP A CA  1 
ATOM   412  C  C   . ASP A 1 46  ? 29.464  -3.799  26.145  1.00 10.99 ? 1720 ASP A C   1 
ATOM   413  O  O   . ASP A 1 46  ? 29.471  -3.556  27.354  1.00 13.06 ? 1720 ASP A O   1 
ATOM   414  C  CB  . ASP A 1 46  ? 31.109  -5.595  25.423  1.00 13.02 ? 1720 ASP A CB  1 
ATOM   415  C  CG  . ASP A 1 46  ? 31.348  -7.105  25.335  1.00 12.65 ? 1720 ASP A CG  1 
ATOM   416  O  OD1 . ASP A 1 46  ? 30.569  -7.883  25.934  1.00 12.53 ? 1720 ASP A OD1 1 
ATOM   417  O  OD2 . ASP A 1 46  ? 32.327  -7.520  24.669  1.00 15.04 ? 1720 ASP A OD2 1 
ATOM   418  N  N   . ILE A 1 47  ? 29.301  -2.834  25.238  1.00 11.76 ? 1721 ILE A N   1 
ATOM   419  C  CA  . ILE A 1 47  ? 29.154  -1.441  25.681  1.00 11.42 ? 1721 ILE A CA  1 
ATOM   420  C  C   . ILE A 1 47  ? 27.814  -1.298  26.410  1.00 10.25 ? 1721 ILE A C   1 
ATOM   421  O  O   . ILE A 1 47  ? 27.720  -0.648  27.447  1.00 11.68 ? 1721 ILE A O   1 
ATOM   422  C  CB  . ILE A 1 47  ? 29.238  -0.453  24.481  1.00 11.51 ? 1721 ILE A CB  1 
ATOM   423  C  CG1 . ILE A 1 47  ? 30.611  -0.539  23.795  1.00 13.81 ? 1721 ILE A CG1 1 
ATOM   424  C  CG2 . ILE A 1 47  ? 28.948  0.977   24.931  1.00 13.52 ? 1721 ILE A CG2 1 
ATOM   425  C  CD1 . ILE A 1 47  ? 31.784  -0.282  24.748  1.00 16.65 ? 1721 ILE A CD1 1 
ATOM   426  N  N   . ALA A 1 48  ? 26.757  -1.891  25.846  1.00 10.86 ? 1722 ALA A N   1 
ATOM   427  C  CA  . ALA A 1 48  ? 25.433  -1.782  26.457  1.00 10.33 ? 1722 ALA A CA  1 
ATOM   428  C  C   . ALA A 1 48  ? 25.395  -2.387  27.860  1.00 10.09 ? 1722 ALA A C   1 
ATOM   429  O  O   . ALA A 1 48  ? 24.544  -2.033  28.672  1.00 11.25 ? 1722 ALA A O   1 
ATOM   430  C  CB  . ALA A 1 48  ? 24.405  -2.479  25.572  1.00 11.03 ? 1722 ALA A CB  1 
ATOM   431  N  N   . LEU A 1 49  ? 26.292  -3.341  28.113  1.00 10.98 ? 1723 LEU A N   1 
ATOM   432  C  CA  . LEU A 1 49  ? 26.369  -4.049  29.399  1.00 11.64 ? 1723 LEU A CA  1 
ATOM   433  C  C   . LEU A 1 49  ? 27.228  -3.328  30.463  1.00 13.65 ? 1723 LEU A C   1 
ATOM   434  O  O   . LEU A 1 49  ? 27.306  -3.777  31.620  1.00 14.52 ? 1723 LEU A O   1 
ATOM   435  C  CB  . LEU A 1 49  ? 26.938  -5.461  29.194  1.00 12.00 ? 1723 LEU A CB  1 
ATOM   436  C  CG  . LEU A 1 49  ? 25.992  -6.454  28.529  1.00 12.60 ? 1723 LEU A CG  1 
ATOM   437  C  CD1 . LEU A 1 49  ? 26.775  -7.689  28.060  1.00 15.20 ? 1723 LEU A CD1 1 
ATOM   438  C  CD2 . LEU A 1 49  ? 24.888  -6.849  29.506  1.00 13.35 ? 1723 LEU A CD2 1 
ATOM   439  N  N   . LEU A 1 50  ? 27.894  -2.239  30.088  1.00 11.93 ? 1724 LEU A N   1 
ATOM   440  C  CA  . LEU A 1 50  ? 28.719  -1.524  31.074  1.00 13.29 ? 1724 LEU A CA  1 
ATOM   441  C  C   . LEU A 1 50  ? 27.857  -1.000  32.215  1.00 14.18 ? 1724 LEU A C   1 
ATOM   442  O  O   . LEU A 1 50  ? 26.715  -0.575  32.000  1.00 14.66 ? 1724 LEU A O   1 
ATOM   443  C  CB  . LEU A 1 50  ? 29.434  -0.362  30.416  1.00 14.13 ? 1724 LEU A CB  1 
ATOM   444  C  CG  . LEU A 1 50  ? 30.511  -0.711  29.395  1.00 14.74 ? 1724 LEU A CG  1 
ATOM   445  C  CD1 . LEU A 1 50  ? 31.010  0.557   28.691  1.00 18.82 ? 1724 LEU A CD1 1 
ATOM   446  C  CD2 . LEU A 1 50  ? 31.675  -1.493  30.021  1.00 18.91 ? 1724 LEU A CD2 1 
ATOM   447  N  N   . PRO A 1 51  ? 28.389  -1.039  33.446  1.00 17.07 ? 1725 PRO A N   1 
ATOM   448  C  CA  . PRO A 1 51  ? 27.587  -0.583  34.588  1.00 19.49 ? 1725 PRO A CA  1 
ATOM   449  C  C   . PRO A 1 51  ? 27.020  0.833   34.401  1.00 20.74 ? 1725 PRO A C   1 
ATOM   450  O  O   . PRO A 1 51  ? 25.878  1.095   34.795  1.00 23.06 ? 1725 PRO A O   1 
ATOM   451  C  CB  . PRO A 1 51  ? 28.574  -0.613  35.757  1.00 21.32 ? 1725 PRO A CB  1 
ATOM   452  C  CG  . PRO A 1 51  ? 29.695  -1.505  35.319  1.00 23.11 ? 1725 PRO A CG  1 
ATOM   453  C  CD  . PRO A 1 51  ? 29.719  -1.545  33.827  1.00 17.44 ? 1725 PRO A CD  1 
ATOM   454  N  N   . GLU A 1 52  ? 27.805  1.719   33.788  1.00 19.24 ? 1726 GLU A N   1 
ATOM   455  C  CA  A GLU A 1 52  ? 27.390  3.104   33.572  0.70 20.44 ? 1726 GLU A CA  1 
ATOM   456  C  CA  B GLU A 1 52  ? 27.389  3.103   33.566  0.30 19.17 ? 1726 GLU A CA  1 
ATOM   457  C  C   . GLU A 1 52  ? 26.117  3.196   32.721  1.00 18.26 ? 1726 GLU A C   1 
ATOM   458  O  O   . GLU A 1 52  ? 25.419  4.219   32.738  1.00 20.63 ? 1726 GLU A O   1 
ATOM   459  C  CB  A GLU A 1 52  ? 28.518  3.880   32.886  0.70 20.91 ? 1726 GLU A CB  1 
ATOM   460  C  CB  B GLU A 1 52  ? 28.519  3.904   32.905  0.30 19.52 ? 1726 GLU A CB  1 
ATOM   461  C  CG  A GLU A 1 52  ? 29.274  3.063   31.843  0.70 28.46 ? 1726 GLU A CG  1 
ATOM   462  C  CG  B GLU A 1 52  ? 28.807  3.513   31.457  0.30 19.20 ? 1726 GLU A CG  1 
ATOM   463  C  CD  A GLU A 1 52  ? 30.648  2.615   32.323  0.70 26.93 ? 1726 GLU A CD  1 
ATOM   464  C  CD  B GLU A 1 52  ? 30.163  3.993   30.975  0.30 22.58 ? 1726 GLU A CD  1 
ATOM   465  O  OE1 A GLU A 1 52  ? 31.644  3.157   31.802  0.70 35.35 ? 1726 GLU A OE1 1 
ATOM   466  O  OE1 B GLU A 1 52  ? 31.186  3.421   31.401  0.30 24.27 ? 1726 GLU A OE1 1 
ATOM   467  O  OE2 A GLU A 1 52  ? 30.738  1.730   33.212  0.70 24.25 ? 1726 GLU A OE2 1 
ATOM   468  O  OE2 B GLU A 1 52  ? 30.210  4.939   30.165  0.30 22.61 ? 1726 GLU A OE2 1 
ATOM   469  N  N   . ASN A 1 53  ? 25.817  2.139   31.972  1.00 15.62 ? 1727 ASN A N   1 
ATOM   470  C  CA  . ASN A 1 53  ? 24.693  2.175   31.023  1.00 15.49 ? 1727 ASN A CA  1 
ATOM   471  C  C   . ASN A 1 53  ? 23.434  1.438   31.457  1.00 17.23 ? 1727 ASN A C   1 
ATOM   472  O  O   . ASN A 1 53  ? 22.464  1.440   30.735  1.00 15.44 ? 1727 ASN A O   1 
ATOM   473  C  CB  . ASN A 1 53  ? 25.152  1.691   29.647  1.00 14.39 ? 1727 ASN A CB  1 
ATOM   474  C  CG  . ASN A 1 53  ? 26.146  2.633   29.030  1.00 13.75 ? 1727 ASN A CG  1 
ATOM   475  O  OD1 . ASN A 1 53  ? 26.057  3.832   29.261  1.00 15.10 ? 1727 ASN A OD1 1 
ATOM   476  N  ND2 . ASN A 1 53  ? 27.113  2.105   28.263  1.00 13.95 ? 1727 ASN A ND2 1 
ATOM   477  N  N   . ARG A 1 54  ? 23.453  0.785   32.619  1.00 18.94 ? 1728 ARG A N   1 
ATOM   478  C  CA  A ARG A 1 54  ? 22.385  -0.151  33.002  0.70 20.23 ? 1728 ARG A CA  1 
ATOM   479  C  CA  B ARG A 1 54  ? 22.383  -0.152  32.968  0.30 18.54 ? 1728 ARG A CA  1 
ATOM   480  C  C   . ARG A 1 54  ? 21.017  0.534   32.996  1.00 18.79 ? 1728 ARG A C   1 
ATOM   481  O  O   . ARG A 1 54  ? 20.016  -0.004  32.468  1.00 19.02 ? 1728 ARG A O   1 
ATOM   482  C  CB  A ARG A 1 54  ? 22.667  -0.720  34.397  0.70 23.60 ? 1728 ARG A CB  1 
ATOM   483  C  CB  B ARG A 1 54  ? 22.668  -0.827  34.310  0.30 19.55 ? 1728 ARG A CB  1 
ATOM   484  C  CG  A ARG A 1 54  ? 23.248  0.302   35.373  0.70 29.14 ? 1728 ARG A CG  1 
ATOM   485  C  CG  B ARG A 1 54  ? 21.699  -1.945  34.659  0.30 18.39 ? 1728 ARG A CG  1 
ATOM   486  C  CD  A ARG A 1 54  ? 23.520  -0.296  36.749  0.70 39.03 ? 1728 ARG A CD  1 
ATOM   487  C  CD  B ARG A 1 54  ? 22.372  -3.007  35.513  0.30 24.16 ? 1728 ARG A CD  1 
ATOM   488  N  NE  A ARG A 1 54  ? 23.082  0.598   37.818  0.70 42.58 ? 1728 ARG A NE  1 
ATOM   489  N  NE  B ARG A 1 54  ? 21.408  -3.755  36.316  0.30 30.82 ? 1728 ARG A NE  1 
ATOM   490  C  CZ  A ARG A 1 54  ? 23.242  0.355   39.116  0.70 44.10 ? 1728 ARG A CZ  1 
ATOM   491  C  CZ  B ARG A 1 54  ? 20.951  -3.358  37.500  0.30 34.29 ? 1728 ARG A CZ  1 
ATOM   492  N  NH1 A ARG A 1 54  ? 22.809  1.232   40.015  0.70 42.43 ? 1728 ARG A NH1 1 
ATOM   493  N  NH1 B ARG A 1 54  ? 20.075  -4.106  38.157  0.30 35.16 ? 1728 ARG A NH1 1 
ATOM   494  N  NH2 A ARG A 1 54  ? 23.837  -0.763  39.516  0.70 46.03 ? 1728 ARG A NH2 1 
ATOM   495  N  NH2 B ARG A 1 54  ? 21.368  -2.215  38.030  0.30 37.07 ? 1728 ARG A NH2 1 
ATOM   496  N  N   . GLY A 1 55  ? 20.969  1.723   33.582  1.00 15.88 ? 1729 GLY A N   1 
ATOM   497  C  CA  . GLY A 1 55  ? 19.709  2.449   33.723  1.00 15.50 ? 1729 GLY A CA  1 
ATOM   498  C  C   . GLY A 1 55  ? 19.173  2.997   32.406  1.00 13.88 ? 1729 GLY A C   1 
ATOM   499  O  O   . GLY A 1 55  ? 18.055  3.510   32.352  1.00 18.22 ? 1729 GLY A O   1 
ATOM   500  N  N   . LYS A 1 56  ? 19.977  2.898   31.350  1.00 11.91 ? 1730 LYS A N   1 
ATOM   501  C  CA  . LYS A 1 56  ? 19.607  3.418   30.039  1.00 12.27 ? 1730 LYS A CA  1 
ATOM   502  C  C   . LYS A 1 56  ? 18.948  2.356   29.157  1.00 10.85 ? 1730 LYS A C   1 
ATOM   503  O  O   . LYS A 1 56  ? 18.515  2.643   28.039  1.00 11.38 ? 1730 LYS A O   1 
ATOM   504  C  CB  . LYS A 1 56  ? 20.843  3.980   29.332  1.00 12.56 ? 1730 LYS A CB  1 
ATOM   505  C  CG  . LYS A 1 56  ? 21.500  5.116   30.102  1.00 16.62 ? 1730 LYS A CG  1 
ATOM   506  C  CD  . LYS A 1 56  ? 22.774  5.583   29.422  1.00 17.45 ? 1730 LYS A CD  1 
ATOM   507  C  CE  . LYS A 1 56  ? 23.603  6.478   30.329  1.00 27.01 ? 1730 LYS A CE  1 
ATOM   508  N  NZ  . LYS A 1 56  ? 25.002  6.570   29.812  1.00 27.75 ? 1730 LYS A NZ  1 
ATOM   509  N  N   . ASN A 1 57  ? 18.871  1.127   29.658  1.00 10.86 ? 1731 ASN A N   1 
ATOM   510  C  CA  . ASN A 1 57  ? 18.211  0.035   28.926  1.00 10.44 ? 1731 ASN A CA  1 
ATOM   511  C  C   . ASN A 1 57  ? 16.885  -0.268  29.577  1.00 11.39 ? 1731 ASN A C   1 
ATOM   512  O  O   . ASN A 1 57  ? 16.823  -0.500  30.791  1.00 12.03 ? 1731 ASN A O   1 
ATOM   513  C  CB  . ASN A 1 57  ? 19.094  -1.205  28.961  1.00 10.19 ? 1731 ASN A CB  1 
ATOM   514  C  CG  . ASN A 1 57  ? 20.381  -0.981  28.221  1.00 9.85  ? 1731 ASN A CG  1 
ATOM   515  O  OD1 . ASN A 1 57  ? 20.363  -0.460  27.105  1.00 11.24 ? 1731 ASN A OD1 1 
ATOM   516  N  ND2 . ASN A 1 57  ? 21.521  -1.334  28.851  1.00 11.30 ? 1731 ASN A ND2 1 
ATOM   517  N  N   . ARG A 1 58  ? 15.816  -0.243  28.778  1.00 10.56 ? 1732 ARG A N   1 
ATOM   518  C  CA  . ARG A 1 58  ? 14.504  -0.588  29.329  1.00 10.97 ? 1732 ARG A CA  1 
ATOM   519  C  C   . ARG A 1 58  ? 14.470  -2.059  29.780  1.00 11.72 ? 1732 ARG A C   1 
ATOM   520  O  O   . ARG A 1 58  ? 13.915  -2.404  30.834  1.00 13.55 ? 1732 ARG A O   1 
ATOM   521  C  CB  . ARG A 1 58  ? 13.422  -0.336  28.272  1.00 11.39 ? 1732 ARG A CB  1 
ATOM   522  C  CG  . ARG A 1 58  ? 12.037  -0.692  28.747  1.00 12.27 ? 1732 ARG A CG  1 
ATOM   523  C  CD  . ARG A 1 58  ? 10.966  -0.283  27.714  1.00 13.22 ? 1732 ARG A CD  1 
ATOM   524  N  NE  . ARG A 1 58  ? 10.798  1.164   27.667  1.00 13.08 ? 1732 ARG A NE  1 
ATOM   525  C  CZ  . ARG A 1 58  ? 10.055  1.860   28.521  1.00 13.73 ? 1732 ARG A CZ  1 
ATOM   526  N  NH1 . ARG A 1 58  ? 9.406   1.241   29.515  1.00 13.75 ? 1732 ARG A NH1 1 
ATOM   527  N  NH2 . ARG A 1 58  ? 9.966   3.183   28.383  1.00 15.17 ? 1732 ARG A NH2 1 
ATOM   528  N  N   . TYR A 1 59  ? 15.046  -2.920  28.954  1.00 11.98 ? 1733 TYR A N   1 
ATOM   529  C  CA  . TYR A 1 59  ? 15.114  -4.351  29.265  1.00 13.30 ? 1733 TYR A CA  1 
ATOM   530  C  C   . TYR A 1 59  ? 16.566  -4.775  29.241  1.00 12.98 ? 1733 TYR A C   1 
ATOM   531  O  O   . TYR A 1 59  ? 17.242  -4.582  28.235  1.00 12.78 ? 1733 TYR A O   1 
ATOM   532  C  CB  . TYR A 1 59  ? 14.327  -5.179  28.249  1.00 13.37 ? 1733 TYR A CB  1 
ATOM   533  C  CG  . TYR A 1 59  ? 12.878  -4.744  28.111  1.00 13.88 ? 1733 TYR A CG  1 
ATOM   534  C  CD1 . TYR A 1 59  ? 11.927  -5.126  29.048  1.00 16.50 ? 1733 TYR A CD1 1 
ATOM   535  C  CD2 . TYR A 1 59  ? 12.473  -3.939  27.062  1.00 13.93 ? 1733 TYR A CD2 1 
ATOM   536  C  CE1 . TYR A 1 59  ? 10.597  -4.730  28.926  1.00 17.43 ? 1733 TYR A CE1 1 
ATOM   537  C  CE2 . TYR A 1 59  ? 11.153  -3.542  26.941  1.00 14.09 ? 1733 TYR A CE2 1 
ATOM   538  C  CZ  . TYR A 1 59  ? 10.225  -3.951  27.869  1.00 14.22 ? 1733 TYR A CZ  1 
ATOM   539  O  OH  . TYR A 1 59  ? 8.903   -3.560  27.765  1.00 19.80 ? 1733 TYR A OH  1 
ATOM   540  N  N   . ASN A 1 60  ? 17.064  -5.329  30.350  1.00 13.91 ? 1734 ASN A N   1 
ATOM   541  C  CA  . ASN A 1 60  ? 18.516  -5.518  30.474  1.00 14.47 ? 1734 ASN A CA  1 
ATOM   542  C  C   . ASN A 1 60  ? 19.035  -6.643  29.558  1.00 13.93 ? 1734 ASN A C   1 
ATOM   543  O  O   . ASN A 1 60  ? 20.252  -6.801  29.364  1.00 15.65 ? 1734 ASN A O   1 
ATOM   544  C  CB  . ASN A 1 60  ? 18.909  -5.757  31.940  1.00 17.92 ? 1734 ASN A CB  1 
ATOM   545  C  CG  . ASN A 1 60  ? 18.665  -4.523  32.843  1.00 21.24 ? 1734 ASN A CG  1 
ATOM   546  O  OD1 . ASN A 1 60  ? 18.342  -4.676  34.027  1.00 32.32 ? 1734 ASN A OD1 1 
ATOM   547  N  ND2 . ASN A 1 60  ? 18.830  -3.310  32.292  1.00 21.19 ? 1734 ASN A ND2 1 
ATOM   548  N  N   . ASN A 1 61  ? 18.114  -7.414  28.983  1.00 12.79 ? 1735 ASN A N   1 
ATOM   549  C  CA  . ASN A 1 61  ? 18.474  -8.477  28.024  1.00 12.07 ? 1735 ASN A CA  1 
ATOM   550  C  C   . ASN A 1 61  ? 18.144  -8.138  26.555  1.00 11.22 ? 1735 ASN A C   1 
ATOM   551  O  O   . ASN A 1 61  ? 18.208  -9.018  25.686  1.00 12.91 ? 1735 ASN A O   1 
ATOM   552  C  CB  . ASN A 1 61  ? 17.792  -9.801  28.397  1.00 12.81 ? 1735 ASN A CB  1 
ATOM   553  C  CG  . ASN A 1 61  ? 16.278  -9.716  28.270  1.00 15.98 ? 1735 ASN A CG  1 
ATOM   554  O  OD1 . ASN A 1 61  ? 15.698  -8.651  28.502  1.00 15.97 ? 1735 ASN A OD1 1 
ATOM   555  N  ND2 . ASN A 1 61  ? 15.635  -10.820 27.885  1.00 15.43 ? 1735 ASN A ND2 1 
ATOM   556  N  N   . ILE A 1 62  ? 17.812  -6.876  26.263  1.00 9.88  ? 1736 ILE A N   1 
ATOM   557  C  CA  A ILE A 1 62  ? 17.543  -6.462  24.890  0.20 9.76  ? 1736 ILE A CA  1 
ATOM   558  C  CA  B ILE A 1 62  ? 17.573  -6.499  24.870  0.80 8.83  ? 1736 ILE A CA  1 
ATOM   559  C  C   . ILE A 1 62  ? 18.423  -5.264  24.558  1.00 9.03  ? 1736 ILE A C   1 
ATOM   560  O  O   . ILE A 1 62  ? 18.074  -4.131  24.883  1.00 9.77  ? 1736 ILE A O   1 
ATOM   561  C  CB  A ILE A 1 62  ? 16.065  -6.072  24.710  0.20 10.38 ? 1736 ILE A CB  1 
ATOM   562  C  CB  B ILE A 1 62  ? 16.089  -6.252  24.570  0.80 9.65  ? 1736 ILE A CB  1 
ATOM   563  C  CG1 A ILE A 1 62  ? 15.161  -7.266  25.027  0.20 10.55 ? 1736 ILE A CG1 1 
ATOM   564  C  CG1 B ILE A 1 62  ? 15.251  -7.501  24.914  0.80 10.59 ? 1736 ILE A CG1 1 
ATOM   565  C  CG2 A ILE A 1 62  ? 15.817  -5.556  23.297  0.20 11.23 ? 1736 ILE A CG2 1 
ATOM   566  C  CG2 B ILE A 1 62  ? 15.933  -5.831  23.118  0.80 11.84 ? 1736 ILE A CG2 1 
ATOM   567  C  CD1 A ILE A 1 62  ? 15.189  -8.338  23.968  0.20 9.33  ? 1736 ILE A CD1 1 
ATOM   568  C  CD1 B ILE A 1 62  ? 13.731  -7.239  24.949  0.80 10.98 ? 1736 ILE A CD1 1 
ATOM   569  N  N   . LEU A 1 63  ? 19.570  -5.528  23.947  1.00 9.01  ? 1737 LEU A N   1 
ATOM   570  C  CA  . LEU A 1 63  ? 20.656  -4.565  23.851  1.00 8.01  ? 1737 LEU A CA  1 
ATOM   571  C  C   . LEU A 1 63  ? 21.158  -4.462  22.420  1.00 9.50  ? 1737 LEU A C   1 
ATOM   572  O  O   . LEU A 1 63  ? 21.124  -5.437  21.674  1.00 9.44  ? 1737 LEU A O   1 
ATOM   573  C  CB  . LEU A 1 63  ? 21.829  -5.006  24.738  1.00 10.22 ? 1737 LEU A CB  1 
ATOM   574  C  CG  . LEU A 1 63  ? 21.479  -5.297  26.194  1.00 9.80  ? 1737 LEU A CG  1 
ATOM   575  C  CD1 . LEU A 1 63  ? 22.710  -5.769  26.965  1.00 13.05 ? 1737 LEU A CD1 1 
ATOM   576  C  CD2 . LEU A 1 63  ? 20.855  -4.064  26.823  1.00 11.02 ? 1737 LEU A CD2 1 
ATOM   577  N  N   . PRO A 1 64  ? 21.678  -3.284  22.040  1.00 8.10  ? 1738 PRO A N   1 
ATOM   578  C  CA  . PRO A 1 64  ? 22.253  -3.143  20.720  1.00 7.29  ? 1738 PRO A CA  1 
ATOM   579  C  C   . PRO A 1 64  ? 23.607  -3.839  20.603  1.00 8.77  ? 1738 PRO A C   1 
ATOM   580  O  O   . PRO A 1 64  ? 24.378  -3.867  21.580  1.00 9.48  ? 1738 PRO A O   1 
ATOM   581  C  CB  . PRO A 1 64  ? 22.419  -1.620  20.575  1.00 9.91  ? 1738 PRO A CB  1 
ATOM   582  C  CG  . PRO A 1 64  ? 22.684  -1.166  21.988  1.00 9.40  ? 1738 PRO A CG  1 
ATOM   583  C  CD  . PRO A 1 64  ? 21.777  -2.045  22.830  1.00 9.15  ? 1738 PRO A CD  1 
ATOM   584  N  N   . TYR A 1 65  ? 23.883  -4.401  19.435  1.00 8.78  ? 1739 TYR A N   1 
ATOM   585  C  CA  . TYR A 1 65  ? 25.241  -4.879  19.125  1.00 8.46  ? 1739 TYR A CA  1 
ATOM   586  C  C   . TYR A 1 65  ? 26.217  -3.709  19.091  1.00 9.81  ? 1739 TYR A C   1 
ATOM   587  O  O   . TYR A 1 65  ? 25.894  -2.631  18.597  1.00 10.00 ? 1739 TYR A O   1 
ATOM   588  C  CB  . TYR A 1 65  ? 25.266  -5.563  17.767  1.00 9.49  ? 1739 TYR A CB  1 
ATOM   589  C  CG  . TYR A 1 65  ? 24.420  -6.826  17.683  1.00 10.29 ? 1739 TYR A CG  1 
ATOM   590  C  CD1 . TYR A 1 65  ? 24.510  -7.816  18.651  1.00 10.03 ? 1739 TYR A CD1 1 
ATOM   591  C  CD2 . TYR A 1 65  ? 23.556  -7.022  16.618  1.00 10.36 ? 1739 TYR A CD2 1 
ATOM   592  C  CE1 . TYR A 1 65  ? 23.739  -8.987  18.568  1.00 9.08  ? 1739 TYR A CE1 1 
ATOM   593  C  CE2 . TYR A 1 65  ? 22.778  -8.192  16.517  1.00 10.71 ? 1739 TYR A CE2 1 
ATOM   594  C  CZ  . TYR A 1 65  ? 22.893  -9.163  17.494  1.00 10.43 ? 1739 TYR A CZ  1 
ATOM   595  O  OH  . TYR A 1 65  ? 22.164  -10.312 17.438  1.00 12.01 ? 1739 TYR A OH  1 
ATOM   596  N  N   . ASP A 1 66  ? 27.433  -3.946  19.586  1.00 9.22  ? 1740 ASP A N   1 
ATOM   597  C  CA  . ASP A 1 66  ? 28.468  -2.909  19.573  1.00 10.82 ? 1740 ASP A CA  1 
ATOM   598  C  C   . ASP A 1 66  ? 28.734  -2.408  18.157  1.00 10.61 ? 1740 ASP A C   1 
ATOM   599  O  O   . ASP A 1 66  ? 28.993  -1.208  17.945  1.00 13.19 ? 1740 ASP A O   1 
ATOM   600  C  CB  . ASP A 1 66  ? 29.770  -3.471  20.164  1.00 11.20 ? 1740 ASP A CB  1 
ATOM   601  C  CG  . ASP A 1 66  ? 29.631  -3.882  21.610  1.00 12.98 ? 1740 ASP A CG  1 
ATOM   602  O  OD1 . ASP A 1 66  ? 28.901  -3.195  22.368  1.00 12.80 ? 1740 ASP A OD1 1 
ATOM   603  O  OD2 . ASP A 1 66  ? 30.263  -4.897  22.013  1.00 15.68 ? 1740 ASP A OD2 1 
ATOM   604  N  N   . ALA A 1 67  ? 28.703  -3.325  17.198  1.00 11.45 ? 1741 ALA A N   1 
ATOM   605  C  CA  . ALA A 1 67  ? 29.141  -3.010  15.836  1.00 12.99 ? 1741 ALA A CA  1 
ATOM   606  C  C   . ALA A 1 67  ? 28.216  -2.002  15.124  1.00 11.24 ? 1741 ALA A C   1 
ATOM   607  O  O   . ALA A 1 67  ? 28.644  -1.313  14.200  1.00 14.54 ? 1741 ALA A O   1 
ATOM   608  C  CB  . ALA A 1 67  ? 29.261  -4.289  15.018  1.00 14.76 ? 1741 ALA A CB  1 
ATOM   609  N  N   . THR A 1 68  ? 26.947  -1.964  15.526  1.00 10.82 ? 1742 THR A N   1 
ATOM   610  C  CA  . THR A 1 68  ? 25.927  -1.224  14.778  1.00 9.81  ? 1742 THR A CA  1 
ATOM   611  C  C   . THR A 1 68  ? 25.182  -0.212  15.646  1.00 9.76  ? 1742 THR A C   1 
ATOM   612  O  O   . THR A 1 68  ? 24.210  0.387   15.202  1.00 11.93 ? 1742 THR A O   1 
ATOM   613  C  CB  . THR A 1 68  ? 24.913  -2.197  14.153  1.00 10.97 ? 1742 THR A CB  1 
ATOM   614  O  OG1 . THR A 1 68  ? 24.280  -2.961  15.181  1.00 13.23 ? 1742 THR A OG1 1 
ATOM   615  C  CG2 . THR A 1 68  ? 25.585  -3.121  13.151  1.00 14.21 ? 1742 THR A CG2 1 
ATOM   616  N  N   . ARG A 1 69  ? 25.638  0.001   16.880  1.00 10.05 ? 1743 ARG A N   1 
ATOM   617  C  CA  . ARG A 1 69  ? 24.939  0.921   17.761  1.00 10.43 ? 1743 ARG A CA  1 
ATOM   618  C  C   . ARG A 1 69  ? 25.095  2.370   17.299  1.00 9.91  ? 1743 ARG A C   1 
ATOM   619  O  O   . ARG A 1 69  ? 26.110  2.741   16.697  1.00 13.14 ? 1743 ARG A O   1 
ATOM   620  C  CB  . ARG A 1 69  ? 25.397  0.772   19.212  1.00 12.01 ? 1743 ARG A CB  1 
ATOM   621  C  CG  . ARG A 1 69  ? 26.758  1.393   19.506  1.00 12.86 ? 1743 ARG A CG  1 
ATOM   622  C  CD  . ARG A 1 69  ? 27.220  1.065   20.933  1.00 13.65 ? 1743 ARG A CD  1 
ATOM   623  N  NE  . ARG A 1 69  ? 28.547  1.645   21.200  1.00 13.88 ? 1743 ARG A NE  1 
ATOM   624  C  CZ  . ARG A 1 69  ? 28.752  2.794   21.844  1.00 15.27 ? 1743 ARG A CZ  1 
ATOM   625  N  NH1 . ARG A 1 69  ? 27.719  3.517   22.287  1.00 13.45 ? 1743 ARG A NH1 1 
ATOM   626  N  NH2 . ARG A 1 69  ? 29.993  3.232   22.044  1.00 16.45 ? 1743 ARG A NH2 1 
ATOM   627  N  N   . VAL A 1 70  ? 24.104  3.199   17.627  1.00 10.56 ? 1744 VAL A N   1 
ATOM   628  C  CA  . VAL A 1 70  ? 24.190  4.635   17.364  1.00 11.03 ? 1744 VAL A CA  1 
ATOM   629  C  C   . VAL A 1 70  ? 24.834  5.334   18.540  1.00 12.81 ? 1744 VAL A C   1 
ATOM   630  O  O   . VAL A 1 70  ? 24.525  5.039   19.681  1.00 15.21 ? 1744 VAL A O   1 
ATOM   631  C  CB  . VAL A 1 70  ? 22.766  5.218   17.192  1.00 9.81  ? 1744 VAL A CB  1 
ATOM   632  C  CG1 . VAL A 1 70  ? 22.812  6.711   16.860  1.00 11.87 ? 1744 VAL A CG1 1 
ATOM   633  C  CG2 . VAL A 1 70  ? 21.991  4.452   16.127  1.00 9.83  ? 1744 VAL A CG2 1 
ATOM   634  N  N   . LYS A 1 71  ? 25.724  6.279   18.248  1.00 15.41 ? 1745 LYS A N   1 
ATOM   635  C  CA  A LYS A 1 71  ? 26.482  6.941   19.293  0.50 18.08 ? 1745 LYS A CA  1 
ATOM   636  C  CA  B LYS A 1 71  ? 26.489  6.966   19.288  0.50 18.51 ? 1745 LYS A CA  1 
ATOM   637  C  C   . LYS A 1 71  ? 26.025  8.403   19.431  1.00 18.53 ? 1745 LYS A C   1 
ATOM   638  O  O   . LYS A 1 71  ? 25.854  9.104   18.427  1.00 21.98 ? 1745 LYS A O   1 
ATOM   639  C  CB  A LYS A 1 71  ? 27.997  6.796   19.023  0.50 20.05 ? 1745 LYS A CB  1 
ATOM   640  C  CB  B LYS A 1 71  ? 27.983  6.965   18.956  0.50 19.51 ? 1745 LYS A CB  1 
ATOM   641  C  CG  A LYS A 1 71  ? 28.467  5.305   19.030  0.50 16.92 ? 1745 LYS A CG  1 
ATOM   642  C  CG  B LYS A 1 71  ? 28.798  6.016   19.812  0.50 22.23 ? 1745 LYS A CG  1 
ATOM   643  C  CD  A LYS A 1 71  ? 29.808  5.012   18.316  0.50 22.52 ? 1745 LYS A CD  1 
ATOM   644  C  CD  B LYS A 1 71  ? 30.226  5.913   19.316  0.50 25.27 ? 1745 LYS A CD  1 
ATOM   645  C  CE  A LYS A 1 71  ? 30.103  3.489   18.309  0.50 20.80 ? 1745 LYS A CE  1 
ATOM   646  C  CE  B LYS A 1 71  ? 30.328  5.021   18.088  0.50 27.63 ? 1745 LYS A CE  1 
ATOM   647  N  NZ  A LYS A 1 71  ? 31.416  3.039   17.715  0.50 18.87 ? 1745 LYS A NZ  1 
ATOM   648  N  NZ  B LYS A 1 71  ? 30.446  5.827   16.847  0.50 31.63 ? 1745 LYS A NZ  1 
ATOM   649  N  N   . LEU A 1 72  ? 25.806  8.836   20.671  1.00 17.90 ? 1746 LEU A N   1 
ATOM   650  C  CA  . LEU A 1 72  ? 25.511  10.239  20.967  1.00 16.61 ? 1746 LEU A CA  1 
ATOM   651  C  C   . LEU A 1 72  ? 26.859  10.964  21.079  1.00 19.11 ? 1746 LEU A C   1 
ATOM   652  O  O   . LEU A 1 72  ? 27.830  10.372  21.532  1.00 21.45 ? 1746 LEU A O   1 
ATOM   653  C  CB  . LEU A 1 72  ? 24.774  10.364  22.309  1.00 19.43 ? 1746 LEU A CB  1 
ATOM   654  C  CG  . LEU A 1 72  ? 23.442  9.613   22.495  1.00 17.57 ? 1746 LEU A CG  1 
ATOM   655  C  CD1 . LEU A 1 72  ? 22.959  9.715   23.952  1.00 19.72 ? 1746 LEU A CD1 1 
ATOM   656  C  CD2 . LEU A 1 72  ? 22.380  10.122  21.540  1.00 20.89 ? 1746 LEU A CD2 1 
ATOM   657  N  N   . SER A 1 73  ? 26.920  12.232  20.676  1.00 22.36 ? 1747 SER A N   1 
ATOM   658  C  CA  . SER A 1 73  ? 28.152  13.012  20.794  1.00 23.67 ? 1747 SER A CA  1 
ATOM   659  C  C   . SER A 1 73  ? 28.432  13.252  22.260  1.00 24.73 ? 1747 SER A C   1 
ATOM   660  O  O   . SER A 1 73  ? 27.528  13.199  23.086  1.00 27.16 ? 1747 SER A O   1 
ATOM   661  C  CB  . SER A 1 73  ? 27.998  14.376  20.116  1.00 27.01 ? 1747 SER A CB  1 
ATOM   662  O  OG  . SER A 1 73  ? 27.105  15.178  20.863  1.00 26.97 ? 1747 SER A OG  1 
ATOM   663  N  N   . GLY A 1 74  ? 29.673  13.552  22.609  1.00 24.76 ? 1748 GLY A N   1 
ATOM   664  C  CA  . GLY A 1 74  ? 29.966  13.908  23.980  1.00 24.30 ? 1748 GLY A CA  1 
ATOM   665  C  C   . GLY A 1 74  ? 30.534  12.757  24.774  1.00 25.98 ? 1748 GLY A C   1 
ATOM   666  O  O   . GLY A 1 74  ? 30.958  11.767  24.204  1.00 29.79 ? 1748 GLY A O   1 
ATOM   667  N  N   . GLY A 1 75  ? 30.547  12.883  26.089  1.00 27.70 ? 1749 GLY A N   1 
ATOM   668  C  CA  . GLY A 1 75  ? 31.262  11.933  26.918  1.00 28.68 ? 1749 GLY A CA  1 
ATOM   669  C  C   . GLY A 1 75  ? 30.405  10.844  27.543  1.00 28.73 ? 1749 GLY A C   1 
ATOM   670  O  O   . GLY A 1 75  ? 30.919  10.000  28.254  1.00 31.48 ? 1749 GLY A O   1 
ATOM   671  N  N   . SER A 1 76  ? 29.095  10.888  27.301  1.00 26.93 ? 1755 SER A N   1 
ATOM   672  C  CA  . SER A 1 76  ? 28.257  9.704   27.497  1.00 25.61 ? 1755 SER A CA  1 
ATOM   673  C  C   . SER A 1 76  ? 27.552  9.313   26.202  1.00 22.10 ? 1755 SER A C   1 
ATOM   674  O  O   . SER A 1 76  ? 26.493  9.819   25.899  1.00 24.45 ? 1755 SER A O   1 
ATOM   675  C  CB  . SER A 1 76  ? 27.226  9.912   28.609  1.00 28.61 ? 1755 SER A CB  1 
ATOM   676  O  OG  . SER A 1 76  ? 27.851  10.108  29.861  1.00 36.50 ? 1755 SER A OG  1 
ATOM   677  N  N   . ASP A 1 77  ? 28.178  8.447   25.432  1.00 18.66 ? 1756 ASP A N   1 
ATOM   678  C  CA  . ASP A 1 77  ? 27.733  8.203   24.049  1.00 18.45 ? 1756 ASP A CA  1 
ATOM   679  C  C   . ASP A 1 77  ? 26.601  7.203   23.856  1.00 16.56 ? 1756 ASP A C   1 
ATOM   680  O  O   . ASP A 1 77  ? 26.140  7.014   22.715  1.00 16.71 ? 1756 ASP A O   1 
ATOM   681  C  CB  . ASP A 1 77  ? 28.897  7.856   23.122  1.00 19.36 ? 1756 ASP A CB  1 
ATOM   682  C  CG  . ASP A 1 77  ? 29.387  6.430   23.301  1.00 20.81 ? 1756 ASP A CG  1 
ATOM   683  O  OD1 . ASP A 1 77  ? 28.730  5.626   24.022  1.00 20.49 ? 1756 ASP A OD1 1 
ATOM   684  O  OD2 . ASP A 1 77  ? 30.430  6.113   22.696  1.00 23.62 ? 1756 ASP A OD2 1 
ATOM   685  N  N   . TYR A 1 78  ? 26.133  6.614   24.952  1.00 15.22 ? 1757 TYR A N   1 
ATOM   686  C  CA  . TYR A 1 78  ? 25.321  5.403   24.855  1.00 13.73 ? 1757 TYR A CA  1 
ATOM   687  C  C   . TYR A 1 78  ? 23.832  5.699   24.716  1.00 13.21 ? 1757 TYR A C   1 
ATOM   688  O  O   . TYR A 1 78  ? 23.246  6.411   25.547  1.00 13.76 ? 1757 TYR A O   1 
ATOM   689  C  CB  . TYR A 1 78  ? 25.541  4.443   26.032  1.00 13.53 ? 1757 TYR A CB  1 
ATOM   690  C  CG  . TYR A 1 78  ? 24.672  3.214   25.854  1.00 11.42 ? 1757 TYR A CG  1 
ATOM   691  C  CD1 . TYR A 1 78  ? 25.028  2.227   24.938  1.00 12.66 ? 1757 TYR A CD1 1 
ATOM   692  C  CD2 . TYR A 1 78  ? 23.470  3.071   26.548  1.00 12.05 ? 1757 TYR A CD2 1 
ATOM   693  C  CE1 . TYR A 1 78  ? 24.221  1.103   24.733  1.00 10.12 ? 1757 TYR A CE1 1 
ATOM   694  C  CE2 . TYR A 1 78  ? 22.639  1.959   26.341  1.00 11.60 ? 1757 TYR A CE2 1 
ATOM   695  C  CZ  . TYR A 1 78  ? 23.031  0.990   25.429  1.00 10.73 ? 1757 TYR A CZ  1 
ATOM   696  O  OH  . TYR A 1 78  ? 22.232  -0.102  25.202  1.00 10.06 ? 1757 TYR A OH  1 
ATOM   697  N  N   . ILE A 1 79  ? 23.221  5.073   23.711  1.00 11.63 ? 1758 ILE A N   1 
ATOM   698  C  CA  . ILE A 1 79  ? 21.758  4.952   23.653  1.00 10.95 ? 1758 ILE A CA  1 
ATOM   699  C  C   . ILE A 1 79  ? 21.419  3.562   23.129  1.00 9.04  ? 1758 ILE A C   1 
ATOM   700  O  O   . ILE A 1 79  ? 22.166  2.986   22.330  1.00 9.50  ? 1758 ILE A O   1 
ATOM   701  C  CB  . ILE A 1 79  ? 21.112  6.053   22.765  1.00 11.85 ? 1758 ILE A CB  1 
ATOM   702  C  CG1 . ILE A 1 79  ? 19.587  5.954   22.766  1.00 12.03 ? 1758 ILE A CG1 1 
ATOM   703  C  CG2 . ILE A 1 79  ? 21.716  6.067   21.358  1.00 11.78 ? 1758 ILE A CG2 1 
ATOM   704  C  CD1 . ILE A 1 79  ? 18.925  7.203   22.259  1.00 13.99 ? 1758 ILE A CD1 1 
ATOM   705  N  N   . ASN A 1 80  ? 20.318  3.001   23.611  1.00 8.73  ? 1759 ASN A N   1 
ATOM   706  C  CA  . ASN A 1 80  ? 19.899  1.685   23.117  1.00 8.30  ? 1759 ASN A CA  1 
ATOM   707  C  C   . ASN A 1 80  ? 19.230  1.879   21.762  1.00 7.93  ? 1759 ASN A C   1 
ATOM   708  O  O   . ASN A 1 80  ? 18.003  2.110   21.688  1.00 9.37  ? 1759 ASN A O   1 
ATOM   709  C  CB  . ASN A 1 80  ? 18.954  1.023   24.110  1.00 9.13  ? 1759 ASN A CB  1 
ATOM   710  C  CG  . ASN A 1 80  ? 18.695  -0.421  23.769  1.00 9.07  ? 1759 ASN A CG  1 
ATOM   711  O  OD1 . ASN A 1 80  ? 18.528  -0.753  22.607  1.00 9.09  ? 1759 ASN A OD1 1 
ATOM   712  N  ND2 . ASN A 1 80  ? 18.689  -1.286  24.773  1.00 9.08  ? 1759 ASN A ND2 1 
ATOM   713  N  N   . ALA A 1 81  ? 20.047  1.860   20.707  1.00 7.74  ? 1760 ALA A N   1 
ATOM   714  C  CA  . ALA A 1 81  ? 19.620  2.133   19.336  1.00 8.23  ? 1760 ALA A CA  1 
ATOM   715  C  C   . ALA A 1 81  ? 20.648  1.545   18.367  1.00 8.13  ? 1760 ALA A C   1 
ATOM   716  O  O   . ALA A 1 81  ? 21.857  1.527   18.645  1.00 8.94  ? 1760 ALA A O   1 
ATOM   717  C  CB  . ALA A 1 81  ? 19.505  3.646   19.113  1.00 8.18  ? 1760 ALA A CB  1 
ATOM   718  N  N   . SER A 1 82  ? 20.155  1.106   17.220  1.00 8.57  ? 1761 SER A N   1 
ATOM   719  C  CA  . SER A 1 82  ? 20.924  0.411   16.215  1.00 7.66  ? 1761 SER A CA  1 
ATOM   720  C  C   . SER A 1 82  ? 20.639  0.952   14.811  1.00 7.76  ? 1761 SER A C   1 
ATOM   721  O  O   . SER A 1 82  ? 19.495  1.229   14.481  1.00 8.97  ? 1761 SER A O   1 
ATOM   722  C  CB  . SER A 1 82  ? 20.573  -1.075  16.231  1.00 9.07  ? 1761 SER A CB  1 
ATOM   723  O  OG  . SER A 1 82  ? 20.717  -1.634  17.512  1.00 9.08  ? 1761 SER A OG  1 
ATOM   724  N  N   . TYR A 1 83  ? 21.672  1.065   13.977  1.00 8.26  ? 1762 TYR A N   1 
ATOM   725  C  CA  . TYR A 1 83  ? 21.475  1.354   12.561  1.00 9.82  ? 1762 TYR A CA  1 
ATOM   726  C  C   . TYR A 1 83  ? 21.029  0.109   11.815  1.00 9.47  ? 1762 TYR A C   1 
ATOM   727  O  O   . TYR A 1 83  ? 21.609  -0.958  12.007  1.00 12.03 ? 1762 TYR A O   1 
ATOM   728  C  CB  . TYR A 1 83  ? 22.763  1.834   11.920  1.00 10.59 ? 1762 TYR A CB  1 
ATOM   729  C  CG  . TYR A 1 83  ? 23.264  3.185   12.375  1.00 11.65 ? 1762 TYR A CG  1 
ATOM   730  C  CD1 . TYR A 1 83  ? 22.592  4.352   12.017  1.00 12.88 ? 1762 TYR A CD1 1 
ATOM   731  C  CD2 . TYR A 1 83  ? 24.434  3.301   13.132  1.00 10.77 ? 1762 TYR A CD2 1 
ATOM   732  C  CE1 . TYR A 1 83  ? 23.056  5.599   12.393  1.00 13.66 ? 1762 TYR A CE1 1 
ATOM   733  C  CE2 . TYR A 1 83  ? 24.911  4.560   13.519  1.00 11.99 ? 1762 TYR A CE2 1 
ATOM   734  C  CZ  . TYR A 1 83  ? 24.224  5.701   13.139  1.00 11.18 ? 1762 TYR A CZ  1 
ATOM   735  O  OH  . TYR A 1 83  ? 24.685  6.931   13.524  1.00 13.96 ? 1762 TYR A OH  1 
ATOM   736  N  N   . ILE A 1 84  ? 20.060  0.267   10.908  1.00 10.20 ? 1763 ILE A N   1 
ATOM   737  C  CA  . ILE A 1 84  ? 19.507  -0.865  10.146  1.00 10.48 ? 1763 ILE A CA  1 
ATOM   738  C  C   . ILE A 1 84  ? 19.471  -0.491  8.655   1.00 9.86  ? 1763 ILE A C   1 
ATOM   739  O  O   . ILE A 1 84  ? 19.030  0.605   8.291   1.00 10.75 ? 1763 ILE A O   1 
ATOM   740  C  CB  . ILE A 1 84  ? 18.047  -1.180  10.584  1.00 12.30 ? 1763 ILE A CB  1 
ATOM   741  C  CG1 . ILE A 1 84  ? 17.934  -1.379  12.101  1.00 14.88 ? 1763 ILE A CG1 1 
ATOM   742  C  CG2 . ILE A 1 84  ? 17.463  -2.338  9.798   1.00 13.88 ? 1763 ILE A CG2 1 
ATOM   743  C  CD1 . ILE A 1 84  ? 18.664  -2.588  12.676  1.00 15.19 ? 1763 ILE A CD1 1 
ATOM   744  N  N   . PRO A 1 85  ? 19.902  -1.402  7.775   1.00 11.63 ? 1764 PRO A N   1 
ATOM   745  C  CA  . PRO A 1 85  ? 19.834  -1.151  6.319   1.00 12.72 ? 1764 PRO A CA  1 
ATOM   746  C  C   . PRO A 1 85  ? 18.420  -1.210  5.776   1.00 12.32 ? 1764 PRO A C   1 
ATOM   747  O  O   . PRO A 1 85  ? 17.563  -1.925  6.343   1.00 12.93 ? 1764 PRO A O   1 
ATOM   748  C  CB  . PRO A 1 85  ? 20.627  -2.313  5.722   1.00 14.45 ? 1764 PRO A CB  1 
ATOM   749  C  CG  . PRO A 1 85  ? 20.456  -3.433  6.757   1.00 16.60 ? 1764 PRO A CG  1 
ATOM   750  C  CD  . PRO A 1 85  ? 20.479  -2.721  8.099   1.00 12.48 ? 1764 PRO A CD  1 
ATOM   751  N  N   . GLY A 1 86  ? 18.194  -0.484  4.677   1.00 12.60 ? 1765 GLY A N   1 
ATOM   752  C  CA  . GLY A 1 86  ? 16.976  -0.648  3.881   1.00 13.56 ? 1765 GLY A CA  1 
ATOM   753  C  C   . GLY A 1 86  ? 17.256  -1.143  2.469   1.00 16.40 ? 1765 GLY A C   1 
ATOM   754  O  O   . GLY A 1 86  ? 18.335  -1.672  2.190   1.00 19.34 ? 1765 GLY A O   1 
ATOM   755  N  N   . ASN A 1 87  ? 16.289  -0.963  1.573   1.00 16.64 ? 1766 ASN A N   1 
ATOM   756  C  CA  . ASN A 1 87  ? 16.484  -1.295  0.157   1.00 20.43 ? 1766 ASN A CA  1 
ATOM   757  C  C   . ASN A 1 87  ? 17.533  -0.403  -0.483  1.00 24.28 ? 1766 ASN A C   1 
ATOM   758  O  O   . ASN A 1 87  ? 18.191  -0.787  -1.455  1.00 29.45 ? 1766 ASN A O   1 
ATOM   759  C  CB  . ASN A 1 87  ? 15.169  -1.148  -0.605  1.00 20.41 ? 1766 ASN A CB  1 
ATOM   760  C  CG  . ASN A 1 87  ? 14.152  -2.193  -0.216  1.00 20.50 ? 1766 ASN A CG  1 
ATOM   761  O  OD1 . ASN A 1 87  ? 14.441  -3.094  0.560   1.00 23.86 ? 1766 ASN A OD1 1 
ATOM   762  N  ND2 . ASN A 1 87  ? 12.946  -2.072  -0.751  1.00 22.86 ? 1766 ASN A ND2 1 
ATOM   763  N  N   . ASN A 1 88  ? 17.680  0.784   0.086   1.00 24.73 ? 1767 ASN A N   1 
ATOM   764  C  CA  . ASN A 1 88  ? 18.169  1.951   -0.617  1.00 29.04 ? 1767 ASN A CA  1 
ATOM   765  C  C   . ASN A 1 88  ? 19.567  2.326   -0.066  1.00 28.51 ? 1767 ASN A C   1 
ATOM   766  O  O   . ASN A 1 88  ? 20.458  2.718   -0.824  1.00 33.49 ? 1767 ASN A O   1 
ATOM   767  C  CB  . ASN A 1 88  ? 17.145  3.104   -0.455  1.00 31.80 ? 1767 ASN A CB  1 
ATOM   768  C  CG  . ASN A 1 88  ? 15.720  2.723   -0.946  1.00 29.21 ? 1767 ASN A CG  1 
ATOM   769  O  OD1 . ASN A 1 88  ? 15.542  2.349   -2.119  1.00 32.96 ? 1767 ASN A OD1 1 
ATOM   770  N  ND2 . ASN A 1 88  ? 14.702  2.832   -0.053  1.00 19.34 ? 1767 ASN A ND2 1 
ATOM   771  N  N   . PHE A 1 89  ? 19.760  2.177   1.245   1.00 25.91 ? 1768 PHE A N   1 
ATOM   772  C  CA  . PHE A 1 89  ? 20.933  2.736   1.946   1.00 24.82 ? 1768 PHE A CA  1 
ATOM   773  C  C   . PHE A 1 89  ? 21.312  1.852   3.144   1.00 21.18 ? 1768 PHE A C   1 
ATOM   774  O  O   . PHE A 1 89  ? 20.459  1.211   3.740   1.00 18.00 ? 1768 PHE A O   1 
ATOM   775  C  CB  . PHE A 1 89  ? 20.610  4.141   2.476   1.00 26.49 ? 1768 PHE A CB  1 
ATOM   776  C  CG  . PHE A 1 89  ? 20.126  5.094   1.422   1.00 30.66 ? 1768 PHE A CG  1 
ATOM   777  C  CD1 . PHE A 1 89  ? 21.027  5.745   0.592   1.00 36.90 ? 1768 PHE A CD1 1 
ATOM   778  C  CD2 . PHE A 1 89  ? 18.772  5.343   1.262   1.00 31.22 ? 1768 PHE A CD2 1 
ATOM   779  C  CE1 . PHE A 1 89  ? 20.589  6.626   -0.383  1.00 40.48 ? 1768 PHE A CE1 1 
ATOM   780  C  CE2 . PHE A 1 89  ? 18.324  6.226   0.290   1.00 38.69 ? 1768 PHE A CE2 1 
ATOM   781  C  CZ  . PHE A 1 89  ? 19.235  6.866   -0.535  1.00 39.77 ? 1768 PHE A CZ  1 
ATOM   782  N  N   . ARG A 1 90  ? 22.584  1.849   3.530   1.00 20.86 ? 1769 ARG A N   1 
ATOM   783  C  CA  . ARG A 1 90  ? 23.018  1.007   4.649   1.00 18.83 ? 1769 ARG A CA  1 
ATOM   784  C  C   . ARG A 1 90  ? 22.527  1.443   6.041   1.00 19.82 ? 1769 ARG A C   1 
ATOM   785  O  O   . ARG A 1 90  ? 22.380  0.617   6.950   1.00 21.50 ? 1769 ARG A O   1 
ATOM   786  C  CB  . ARG A 1 90  ? 24.533  0.811   4.628   1.00 22.98 ? 1769 ARG A CB  1 
ATOM   787  C  CG  . ARG A 1 90  ? 25.325  2.037   4.931   1.00 28.23 ? 1769 ARG A CG  1 
ATOM   788  C  CD  . ARG A 1 90  ? 26.790  1.648   5.074   1.00 30.08 ? 1769 ARG A CD  1 
ATOM   789  N  NE  . ARG A 1 90  ? 27.048  0.877   6.291   1.00 29.70 ? 1769 ARG A NE  1 
ATOM   790  C  CZ  . ARG A 1 90  ? 28.262  0.712   6.808   1.00 33.61 ? 1769 ARG A CZ  1 
ATOM   791  N  NH1 . ARG A 1 90  ? 28.435  0.013   7.923   1.00 31.12 ? 1769 ARG A NH1 1 
ATOM   792  N  NH2 . ARG A 1 90  ? 29.302  1.265   6.209   1.00 33.85 ? 1769 ARG A NH2 1 
ATOM   793  N  N   . ARG A 1 91  ? 22.238  2.727   6.208   1.00 17.85 ? 1770 ARG A N   1 
ATOM   794  C  CA  . ARG A 1 91  ? 21.724  3.215   7.491   1.00 14.19 ? 1770 ARG A CA  1 
ATOM   795  C  C   . ARG A 1 91  ? 20.395  3.929   7.264   1.00 13.46 ? 1770 ARG A C   1 
ATOM   796  O  O   . ARG A 1 91  ? 20.210  5.093   7.608   1.00 16.88 ? 1770 ARG A O   1 
ATOM   797  C  CB  . ARG A 1 91  ? 22.752  4.142   8.167   1.00 14.87 ? 1770 ARG A CB  1 
ATOM   798  C  CG  . ARG A 1 91  ? 24.018  3.400   8.563   1.00 14.62 ? 1770 ARG A CG  1 
ATOM   799  C  CD  . ARG A 1 91  ? 24.979  4.295   9.307   1.00 20.71 ? 1770 ARG A CD  1 
ATOM   800  N  NE  . ARG A 1 91  ? 26.214  3.596   9.619   1.00 20.70 ? 1770 ARG A NE  1 
ATOM   801  C  CZ  . ARG A 1 91  ? 27.320  3.691   8.892   1.00 23.98 ? 1770 ARG A CZ  1 
ATOM   802  N  NH1 . ARG A 1 91  ? 27.341  4.465   7.815   1.00 29.09 ? 1770 ARG A NH1 1 
ATOM   803  N  NH2 . ARG A 1 91  ? 28.399  3.020   9.249   1.00 25.79 ? 1770 ARG A NH2 1 
ATOM   804  N  N   . GLU A 1 92  ? 19.465  3.203   6.676   1.00 11.71 ? 1771 GLU A N   1 
ATOM   805  C  CA  . GLU A 1 92  ? 18.190  3.785   6.297   1.00 11.87 ? 1771 GLU A CA  1 
ATOM   806  C  C   . GLU A 1 92  ? 17.279  3.982   7.507   1.00 9.64  ? 1771 GLU A C   1 
ATOM   807  O  O   . GLU A 1 92  ? 16.438  4.884   7.499   1.00 10.66 ? 1771 GLU A O   1 
ATOM   808  C  CB  . GLU A 1 92  ? 17.516  2.856   5.304   1.00 13.93 ? 1771 GLU A CB  1 
ATOM   809  C  CG  . GLU A 1 92  ? 16.462  3.515   4.474   1.00 19.70 ? 1771 GLU A CG  1 
ATOM   810  C  CD  . GLU A 1 92  ? 16.252  2.863   3.108   1.00 18.32 ? 1771 GLU A CD  1 
ATOM   811  O  OE1 . GLU A 1 92  ? 15.150  3.052   2.632   1.00 23.12 ? 1771 GLU A OE1 1 
ATOM   812  O  OE2 . GLU A 1 92  ? 17.157  2.203   2.509   1.00 21.23 ? 1771 GLU A OE2 1 
ATOM   813  N  N   . TYR A 1 93  ? 17.457  3.148   8.533   1.00 9.02  ? 1772 TYR A N   1 
ATOM   814  C  CA  . TYR A 1 93  ? 16.676  3.272   9.758   1.00 9.16  ? 1772 TYR A CA  1 
ATOM   815  C  C   . TYR A 1 93  ? 17.545  3.284   10.995  1.00 9.14  ? 1772 TYR A C   1 
ATOM   816  O  O   . TYR A 1 93  ? 18.666  2.770   10.991  1.00 9.74  ? 1772 TYR A O   1 
ATOM   817  C  CB  . TYR A 1 93  ? 15.646  2.138   9.910   1.00 10.77 ? 1772 TYR A CB  1 
ATOM   818  C  CG  . TYR A 1 93  ? 14.895  1.770   8.662   1.00 9.99  ? 1772 TYR A CG  1 
ATOM   819  C  CD1 . TYR A 1 93  ? 15.414  0.855   7.756   1.00 9.43  ? 1772 TYR A CD1 1 
ATOM   820  C  CD2 . TYR A 1 93  ? 13.629  2.305   8.404   1.00 11.17 ? 1772 TYR A CD2 1 
ATOM   821  C  CE1 . TYR A 1 93  ? 14.715  0.495   6.612   1.00 10.83 ? 1772 TYR A CE1 1 
ATOM   822  C  CE2 . TYR A 1 93  ? 12.919  1.944   7.257   1.00 10.17 ? 1772 TYR A CE2 1 
ATOM   823  C  CZ  . TYR A 1 93  ? 13.468  1.031   6.374   1.00 11.01 ? 1772 TYR A CZ  1 
ATOM   824  O  OH  . TYR A 1 93  ? 12.788  0.632   5.246   1.00 12.46 ? 1772 TYR A OH  1 
ATOM   825  N  N   . ILE A 1 94  ? 16.999  3.845   12.056  1.00 8.68  ? 1773 ILE A N   1 
ATOM   826  C  CA  . ILE A 1 94  ? 17.496  3.595   13.394  1.00 8.71  ? 1773 ILE A CA  1 
ATOM   827  C  C   . ILE A 1 94  ? 16.369  2.934   14.159  1.00 9.19  ? 1773 ILE A C   1 
ATOM   828  O  O   . ILE A 1 94  ? 15.258  3.483   14.219  1.00 9.84  ? 1773 ILE A O   1 
ATOM   829  C  CB  . ILE A 1 94  ? 17.897  4.913   14.088  1.00 9.80  ? 1773 ILE A CB  1 
ATOM   830  C  CG1 . ILE A 1 94  ? 19.163  5.472   13.435  1.00 9.98  ? 1773 ILE A CG1 1 
ATOM   831  C  CG2 . ILE A 1 94  ? 18.036  4.724   15.608  1.00 10.54 ? 1773 ILE A CG2 1 
ATOM   832  C  CD1 . ILE A 1 94  ? 19.479  6.890   13.873  1.00 11.26 ? 1773 ILE A CD1 1 
ATOM   833  N  N   . VAL A 1 95  ? 16.654  1.758   14.718  1.00 8.96  ? 1774 VAL A N   1 
ATOM   834  C  CA  . VAL A 1 95  ? 15.736  1.089   15.612  1.00 8.21  ? 1774 VAL A CA  1 
ATOM   835  C  C   . VAL A 1 95  ? 16.168  1.331   17.040  1.00 8.38  ? 1774 VAL A C   1 
ATOM   836  O  O   . VAL A 1 95  ? 17.352  1.203   17.379  1.00 9.88  ? 1774 VAL A O   1 
ATOM   837  C  CB  . VAL A 1 95  ? 15.670  -0.421  15.328  1.00 9.64  ? 1774 VAL A CB  1 
ATOM   838  C  CG1 . VAL A 1 95  ? 14.990  -1.153  16.475  1.00 11.85 ? 1774 VAL A CG1 1 
ATOM   839  C  CG2 . VAL A 1 95  ? 14.958  -0.654  14.004  1.00 13.09 ? 1774 VAL A CG2 1 
ATOM   840  N  N   . THR A 1 96  ? 15.218  1.707   17.875  1.00 8.42  ? 1775 THR A N   1 
ATOM   841  C  CA  . THR A 1 96  ? 15.518  2.003   19.257  1.00 8.78  ? 1775 THR A CA  1 
ATOM   842  C  C   . THR A 1 96  ? 14.409  1.472   20.167  1.00 7.68  ? 1775 THR A C   1 
ATOM   843  O  O   . THR A 1 96  ? 13.345  1.054   19.696  1.00 9.03  ? 1775 THR A O   1 
ATOM   844  C  CB  . THR A 1 96  ? 15.773  3.537   19.427  1.00 10.57 ? 1775 THR A CB  1 
ATOM   845  O  OG1 . THR A 1 96  ? 16.291  3.832   20.725  1.00 10.99 ? 1775 THR A OG1 1 
ATOM   846  C  CG2 . THR A 1 96  ? 14.509  4.330   19.211  1.00 10.05 ? 1775 THR A CG2 1 
ATOM   847  N  N   . GLN A 1 97  ? 14.684  1.410   21.458  1.00 8.87  ? 1776 GLN A N   1 
ATOM   848  C  CA  . GLN A 1 97  ? 13.671  1.053   22.441  1.00 7.93  ? 1776 GLN A CA  1 
ATOM   849  C  C   . GLN A 1 97  ? 12.708  2.239   22.654  1.00 8.72  ? 1776 GLN A C   1 
ATOM   850  O  O   . GLN A 1 97  ? 12.996  3.384   22.300  1.00 9.94  ? 1776 GLN A O   1 
ATOM   851  C  CB  . GLN A 1 97  ? 14.346  0.680   23.765  1.00 9.65  ? 1776 GLN A CB  1 
ATOM   852  C  CG  . GLN A 1 97  ? 14.982  1.876   24.456  1.00 9.14  ? 1776 GLN A CG  1 
ATOM   853  C  CD  . GLN A 1 97  ? 15.740  1.522   25.729  1.00 9.77  ? 1776 GLN A CD  1 
ATOM   854  O  OE1 . GLN A 1 97  ? 16.021  0.348   26.020  1.00 10.55 ? 1776 GLN A OE1 1 
ATOM   855  N  NE2 . GLN A 1 97  ? 16.066  2.544   26.501  1.00 11.55 ? 1776 GLN A NE2 1 
ATOM   856  N  N   . GLY A 1 98  ? 11.590  1.957   23.302  1.00 10.04 ? 1777 GLY A N   1 
ATOM   857  C  CA  . GLY A 1 98  ? 10.701  3.022   23.765  1.00 9.55  ? 1777 GLY A CA  1 
ATOM   858  C  C   . GLY A 1 98  ? 11.433  3.809   24.847  1.00 8.72  ? 1777 GLY A C   1 
ATOM   859  O  O   . GLY A 1 98  ? 11.855  3.235   25.852  1.00 11.52 ? 1777 GLY A O   1 
ATOM   860  N  N   . PRO A 1 99  ? 11.606  5.136   24.649  1.00 10.05 ? 1778 PRO A N   1 
ATOM   861  C  CA  . PRO A 1 99  ? 12.327  5.933   25.642  1.00 10.99 ? 1778 PRO A CA  1 
ATOM   862  C  C   . PRO A 1 99  ? 11.795  5.782   27.058  1.00 11.54 ? 1778 PRO A C   1 
ATOM   863  O  O   . PRO A 1 99  ? 10.587  5.638   27.280  1.00 12.11 ? 1778 PRO A O   1 
ATOM   864  C  CB  . PRO A 1 99  ? 12.141  7.376   25.142  1.00 13.11 ? 1778 PRO A CB  1 
ATOM   865  C  CG  . PRO A 1 99  ? 12.034  7.220   23.665  1.00 12.04 ? 1778 PRO A CG  1 
ATOM   866  C  CD  . PRO A 1 99  ? 11.239  5.942   23.472  1.00 10.33 ? 1778 PRO A CD  1 
ATOM   867  N  N   . LEU A 1 100 ? 12.729  5.804   28.002  1.00 12.10 ? 1779 LEU A N   1 
ATOM   868  C  CA  . LEU A 1 100 ? 12.431  5.826   29.424  1.00 12.84 ? 1779 LEU A CA  1 
ATOM   869  C  C   . LEU A 1 100 ? 12.324  7.289   29.855  1.00 12.73 ? 1779 LEU A C   1 
ATOM   870  O  O   . LEU A 1 100 ? 12.847  8.168   29.179  1.00 14.04 ? 1779 LEU A O   1 
ATOM   871  C  CB  . LEU A 1 100 ? 13.583  5.167   30.190  1.00 11.97 ? 1779 LEU A CB  1 
ATOM   872  C  CG  . LEU A 1 100 ? 13.746  3.651   29.971  1.00 11.81 ? 1779 LEU A CG  1 
ATOM   873  C  CD1 . LEU A 1 100 ? 15.152  3.210   30.364  1.00 14.78 ? 1779 LEU A CD1 1 
ATOM   874  C  CD2 . LEU A 1 100 ? 12.694  2.877   30.758  1.00 15.75 ? 1779 LEU A CD2 1 
ATOM   875  N  N   . PRO A 1 101 ? 11.709  7.549   31.013  1.00 14.87 ? 1780 PRO A N   1 
ATOM   876  C  CA  . PRO A 1 101 ? 11.725  8.930   31.526  1.00 16.32 ? 1780 PRO A CA  1 
ATOM   877  C  C   . PRO A 1 101 ? 13.142  9.484   31.556  1.00 15.71 ? 1780 PRO A C   1 
ATOM   878  O  O   . PRO A 1 101 ? 13.368  10.652  31.212  1.00 18.24 ? 1780 PRO A O   1 
ATOM   879  C  CB  . PRO A 1 101 ? 11.170  8.781   32.941  1.00 19.68 ? 1780 PRO A CB  1 
ATOM   880  C  CG  . PRO A 1 101 ? 10.313  7.549   32.883  1.00 20.09 ? 1780 PRO A CG  1 
ATOM   881  C  CD  . PRO A 1 101 ? 11.008  6.619   31.916  1.00 17.09 ? 1780 PRO A CD  1 
ATOM   882  N  N   . GLY A 1 102 ? 14.095  8.645   31.947  1.00 14.22 ? 1781 GLY A N   1 
ATOM   883  C  CA  . GLY A 1 102 ? 15.477  9.076   32.068  1.00 14.64 ? 1781 GLY A CA  1 
ATOM   884  C  C   . GLY A 1 102 ? 16.280  9.097   30.778  1.00 16.68 ? 1781 GLY A C   1 
ATOM   885  O  O   . GLY A 1 102 ? 17.418  9.582   30.775  1.00 18.02 ? 1781 GLY A O   1 
ATOM   886  N  N   . THR A 1 103 ? 15.708  8.582   29.681  1.00 13.48 ? 1782 THR A N   1 
ATOM   887  C  CA  . THR A 1 103 ? 16.413  8.576   28.406  1.00 12.47 ? 1782 THR A CA  1 
ATOM   888  C  C   . THR A 1 103 ? 15.713  9.370   27.308  1.00 11.64 ? 1782 THR A C   1 
ATOM   889  O  O   . THR A 1 103 ? 16.202  9.404   26.198  1.00 12.22 ? 1782 THR A O   1 
ATOM   890  C  CB  . THR A 1 103 ? 16.705  7.150   27.856  1.00 11.18 ? 1782 THR A CB  1 
ATOM   891  O  OG1 . THR A 1 103 ? 15.478  6.541   27.425  1.00 12.10 ? 1782 THR A OG1 1 
ATOM   892  C  CG2 . THR A 1 103 ? 17.401  6.281   28.904  1.00 12.57 ? 1782 THR A CG2 1 
ATOM   893  N  N   . LYS A 1 104 ? 14.599  10.036  27.606  1.00 13.02 ? 1783 LYS A N   1 
ATOM   894  C  CA  A LYS A 1 104 ? 13.958  10.790  26.540  0.70 13.03 ? 1783 LYS A CA  1 
ATOM   895  C  CA  B LYS A 1 104 ? 13.913  10.844  26.595  0.30 13.20 ? 1783 LYS A CA  1 
ATOM   896  C  C   . LYS A 1 104 ? 14.807  11.935  26.012  1.00 12.22 ? 1783 LYS A C   1 
ATOM   897  O  O   . LYS A 1 104 ? 14.768  12.219  24.826  1.00 12.75 ? 1783 LYS A O   1 
ATOM   898  C  CB  A LYS A 1 104 ? 12.536  11.233  26.880  0.70 15.38 ? 1783 LYS A CB  1 
ATOM   899  C  CB  B LYS A 1 104 ? 12.623  11.459  27.152  0.30 14.65 ? 1783 LYS A CB  1 
ATOM   900  C  CG  A LYS A 1 104 ? 12.430  12.178  28.041  0.70 14.46 ? 1783 LYS A CG  1 
ATOM   901  C  CG  B LYS A 1 104 ? 12.779  12.146  28.498  0.30 16.13 ? 1783 LYS A CG  1 
ATOM   902  C  CD  A LYS A 1 104 ? 10.964  12.390  28.421  0.70 17.41 ? 1783 LYS A CD  1 
ATOM   903  C  CD  B LYS A 1 104 ? 11.546  12.979  28.850  0.30 18.15 ? 1783 LYS A CD  1 
ATOM   904  C  CE  A LYS A 1 104 ? 10.820  13.484  29.454  0.70 21.61 ? 1783 LYS A CE  1 
ATOM   905  C  CE  B LYS A 1 104 ? 10.361  12.095  29.198  0.30 17.83 ? 1783 LYS A CE  1 
ATOM   906  N  NZ  A LYS A 1 104 ? 11.192  13.005  30.811  0.70 22.49 ? 1783 LYS A NZ  1 
ATOM   907  N  NZ  B LYS A 1 104 ? 9.147   12.888  29.545  0.30 19.38 ? 1783 LYS A NZ  1 
ATOM   908  N  N   . ASP A 1 105 ? 15.611  12.576  26.863  1.00 12.53 ? 1784 ASP A N   1 
ATOM   909  C  CA  . ASP A 1 105 ? 16.476  13.639  26.331  1.00 13.23 ? 1784 ASP A CA  1 
ATOM   910  C  C   . ASP A 1 105 ? 17.514  13.037  25.373  1.00 12.64 ? 1784 ASP A C   1 
ATOM   911  O  O   . ASP A 1 105 ? 17.851  13.621  24.340  1.00 14.45 ? 1784 ASP A O   1 
ATOM   912  C  CB  . ASP A 1 105 ? 17.191  14.377  27.459  1.00 14.72 ? 1784 ASP A CB  1 
ATOM   913  C  CG  . ASP A 1 105 ? 16.244  15.127  28.361  1.00 17.98 ? 1784 ASP A CG  1 
ATOM   914  O  OD1 . ASP A 1 105 ? 15.054  15.306  28.000  1.00 19.66 ? 1784 ASP A OD1 1 
ATOM   915  O  OD2 . ASP A 1 105 ? 16.711  15.557  29.435  1.00 23.97 ? 1784 ASP A OD2 1 
ATOM   916  N  N   . ASP A 1 106 ? 18.025  11.859  25.728  1.00 13.49 ? 1785 ASP A N   1 
ATOM   917  C  CA  . ASP A 1 106 ? 18.951  11.125  24.868  1.00 14.44 ? 1785 ASP A CA  1 
ATOM   918  C  C   . ASP A 1 106 ? 18.315  10.798  23.517  1.00 11.87 ? 1785 ASP A C   1 
ATOM   919  O  O   . ASP A 1 106 ? 18.948  10.929  22.462  1.00 11.85 ? 1785 ASP A O   1 
ATOM   920  C  CB  . ASP A 1 106 ? 19.368  9.791   25.528  1.00 16.60 ? 1785 ASP A CB  1 
ATOM   921  C  CG  . ASP A 1 106 ? 20.082  9.966   26.846  1.00 22.17 ? 1785 ASP A CG  1 
ATOM   922  O  OD1 . ASP A 1 106 ? 20.618  11.075  27.089  1.00 25.34 ? 1785 ASP A OD1 1 
ATOM   923  O  OD2 . ASP A 1 106 ? 20.149  8.963   27.622  1.00 23.26 ? 1785 ASP A OD2 1 
ATOM   924  N  N   . PHE A 1 107 ? 17.065  10.338  23.549  1.00 11.83 ? 1786 PHE A N   1 
ATOM   925  C  CA  . PHE A 1 107 ? 16.319  10.045  22.332  1.00 11.37 ? 1786 PHE A CA  1 
ATOM   926  C  C   . PHE A 1 107 ? 16.239  11.284  21.442  1.00 10.37 ? 1786 PHE A C   1 
ATOM   927  O  O   . PHE A 1 107 ? 16.556  11.226  20.260  1.00 10.90 ? 1786 PHE A O   1 
ATOM   928  C  CB  . PHE A 1 107 ? 14.915  9.576   22.695  1.00 12.41 ? 1786 PHE A CB  1 
ATOM   929  C  CG  . PHE A 1 107 ? 14.020  9.391   21.499  1.00 11.23 ? 1786 PHE A CG  1 
ATOM   930  C  CD1 . PHE A 1 107 ? 13.971  8.181   20.813  1.00 12.20 ? 1786 PHE A CD1 1 
ATOM   931  C  CD2 . PHE A 1 107 ? 13.222  10.447  21.050  1.00 10.30 ? 1786 PHE A CD2 1 
ATOM   932  C  CE1 . PHE A 1 107 ? 13.135  8.026   19.711  1.00 13.12 ? 1786 PHE A CE1 1 
ATOM   933  C  CE2 . PHE A 1 107 ? 12.404  10.294  19.940  1.00 11.84 ? 1786 PHE A CE2 1 
ATOM   934  C  CZ  . PHE A 1 107 ? 12.348  9.097   19.282  1.00 11.72 ? 1786 PHE A CZ  1 
ATOM   935  N  N   . TRP A 1 108 ? 15.838  12.412  22.022  1.00 11.30 ? 1787 TRP A N   1 
ATOM   936  C  CA  . TRP A 1 108 ? 15.722  13.622  21.221  1.00 11.30 ? 1787 TRP A CA  1 
ATOM   937  C  C   . TRP A 1 108 ? 17.074  14.118  20.717  1.00 11.68 ? 1787 TRP A C   1 
ATOM   938  O  O   . TRP A 1 108 ? 17.184  14.613  19.591  1.00 12.77 ? 1787 TRP A O   1 
ATOM   939  C  CB  . TRP A 1 108 ? 14.949  14.705  21.959  1.00 13.75 ? 1787 TRP A CB  1 
ATOM   940  C  CG  . TRP A 1 108 ? 13.500  14.371  22.041  1.00 12.59 ? 1787 TRP A CG  1 
ATOM   941  C  CD1 . TRP A 1 108 ? 12.790  14.091  23.165  1.00 12.97 ? 1787 TRP A CD1 1 
ATOM   942  C  CD2 . TRP A 1 108 ? 12.577  14.266  20.942  1.00 12.99 ? 1787 TRP A CD2 1 
ATOM   943  N  NE1 . TRP A 1 108 ? 11.468  13.833  22.840  1.00 12.20 ? 1787 TRP A NE1 1 
ATOM   944  C  CE2 . TRP A 1 108 ? 11.317  13.928  21.483  1.00 12.48 ? 1787 TRP A CE2 1 
ATOM   945  C  CE3 . TRP A 1 108 ? 12.691  14.440  19.560  1.00 13.30 ? 1787 TRP A CE3 1 
ATOM   946  C  CZ2 . TRP A 1 108 ? 10.168  13.766  20.682  1.00 13.06 ? 1787 TRP A CZ2 1 
ATOM   947  C  CZ3 . TRP A 1 108 ? 11.549  14.277  18.764  1.00 13.31 ? 1787 TRP A CZ3 1 
ATOM   948  C  CH2 . TRP A 1 108 ? 10.319  13.922  19.333  1.00 14.34 ? 1787 TRP A CH2 1 
ATOM   949  N  N   . LYS A 1 109 ? 18.108  13.952  21.537  1.00 12.22 ? 1788 LYS A N   1 
ATOM   950  C  CA  . LYS A 1 109 ? 19.452  14.283  21.103  1.00 12.81 ? 1788 LYS A CA  1 
ATOM   951  C  C   . LYS A 1 109 ? 19.875  13.477  19.870  1.00 11.76 ? 1788 LYS A C   1 
ATOM   952  O  O   . LYS A 1 109 ? 20.420  14.018  18.911  1.00 13.57 ? 1788 LYS A O   1 
ATOM   953  C  CB  . LYS A 1 109 ? 20.431  14.081  22.258  1.00 13.64 ? 1788 LYS A CB  1 
ATOM   954  C  CG  . LYS A 1 109 ? 21.894  14.378  21.903  1.00 14.60 ? 1788 LYS A CG  1 
ATOM   955  C  CD  . LYS A 1 109 ? 22.831  14.292  23.134  1.00 18.81 ? 1788 LYS A CD  1 
ATOM   956  C  CE  . LYS A 1 109 ? 24.298  14.467  22.747  1.00 22.25 ? 1788 LYS A CE  1 
ATOM   957  N  NZ  . LYS A 1 109 ? 25.184  14.308  23.930  1.00 29.13 ? 1788 LYS A NZ  1 
ATOM   958  N  N   . MET A 1 110 ? 19.607  12.174  19.886  1.00 11.37 ? 1789 MET A N   1 
ATOM   959  C  CA  . MET A 1 110 ? 19.836  11.337  18.705  1.00 11.45 ? 1789 MET A CA  1 
ATOM   960  C  C   . MET A 1 110 ? 19.051  11.811  17.488  1.00 11.94 ? 1789 MET A C   1 
ATOM   961  O  O   . MET A 1 110 ? 19.588  11.881  16.385  1.00 11.90 ? 1789 MET A O   1 
ATOM   962  C  CB  . MET A 1 110 ? 19.445  9.886   19.008  1.00 12.10 ? 1789 MET A CB  1 
ATOM   963  C  CG  . MET A 1 110 ? 19.699  8.935   17.860  1.00 12.18 ? 1789 MET A CG  1 
ATOM   964  S  SD  . MET A 1 110 ? 19.251  7.237   18.252  1.00 12.69 ? 1789 MET A SD  1 
ATOM   965  C  CE  . MET A 1 110 ? 17.453  7.338   18.341  1.00 14.29 ? 1789 MET A CE  1 
ATOM   966  N  N   . VAL A 1 111 ? 17.770  12.120  17.697  1.00 11.68 ? 1790 VAL A N   1 
ATOM   967  C  CA  . VAL A 1 111 ? 16.927  12.610  16.615  1.00 11.61 ? 1790 VAL A CA  1 
ATOM   968  C  C   . VAL A 1 111 ? 17.579  13.869  15.985  1.00 11.03 ? 1790 VAL A C   1 
ATOM   969  O  O   . VAL A 1 111 ? 17.685  13.982  14.763  1.00 12.72 ? 1790 VAL A O   1 
ATOM   970  C  CB  . VAL A 1 111 ? 15.493  12.899  17.120  1.00 12.01 ? 1790 VAL A CB  1 
ATOM   971  C  CG1 . VAL A 1 111 ? 14.716  13.767  16.104  1.00 12.12 ? 1790 VAL A CG1 1 
ATOM   972  C  CG2 . VAL A 1 111 ? 14.759  11.568  17.405  1.00 10.99 ? 1790 VAL A CG2 1 
ATOM   973  N  N   . TRP A 1 112 ? 18.025  14.801  16.819  1.00 12.13 ? 1791 TRP A N   1 
ATOM   974  C  CA  . TRP A 1 112 ? 18.667  16.015  16.331  1.00 12.33 ? 1791 TRP A CA  1 
ATOM   975  C  C   . TRP A 1 112 ? 19.982  15.694  15.595  1.00 12.72 ? 1791 TRP A C   1 
ATOM   976  O  O   . TRP A 1 112 ? 20.204  16.122  14.456  1.00 14.95 ? 1791 TRP A O   1 
ATOM   977  C  CB  . TRP A 1 112 ? 18.932  16.973  17.501  1.00 13.96 ? 1791 TRP A CB  1 
ATOM   978  C  CG  . TRP A 1 112 ? 19.519  18.256  17.047  1.00 14.74 ? 1791 TRP A CG  1 
ATOM   979  C  CD1 . TRP A 1 112 ? 20.806  18.677  17.231  1.00 17.94 ? 1791 TRP A CD1 1 
ATOM   980  C  CD2 . TRP A 1 112 ? 18.849  19.306  16.325  1.00 13.49 ? 1791 TRP A CD2 1 
ATOM   981  N  NE1 . TRP A 1 112 ? 20.980  19.925  16.661  1.00 18.12 ? 1791 TRP A NE1 1 
ATOM   982  C  CE2 . TRP A 1 112 ? 19.799  20.323  16.087  1.00 16.36 ? 1791 TRP A CE2 1 
ATOM   983  C  CE3 . TRP A 1 112 ? 17.548  19.470  15.829  1.00 15.26 ? 1791 TRP A CE3 1 
ATOM   984  C  CZ2 . TRP A 1 112 ? 19.483  21.498  15.402  1.00 16.30 ? 1791 TRP A CZ2 1 
ATOM   985  C  CZ3 . TRP A 1 112 ? 17.230  20.653  15.163  1.00 17.38 ? 1791 TRP A CZ3 1 
ATOM   986  C  CH2 . TRP A 1 112 ? 18.200  21.640  14.939  1.00 17.39 ? 1791 TRP A CH2 1 
ATOM   987  N  N   . GLU A 1 113 ? 20.864  14.956  16.265  1.00 14.32 ? 1792 GLU A N   1 
ATOM   988  C  CA  . GLU A 1 113 ? 22.215  14.751  15.739  1.00 14.50 ? 1792 GLU A CA  1 
ATOM   989  C  C   . GLU A 1 113 ? 22.215  13.923  14.452  1.00 13.74 ? 1792 GLU A C   1 
ATOM   990  O  O   . GLU A 1 113 ? 23.079  14.097  13.598  1.00 16.07 ? 1792 GLU A O   1 
ATOM   991  C  CB  . GLU A 1 113 ? 23.118  14.105  16.800  1.00 15.02 ? 1792 GLU A CB  1 
ATOM   992  C  CG  . GLU A 1 113 ? 23.370  15.018  18.004  1.00 17.52 ? 1792 GLU A CG  1 
ATOM   993  C  CD  . GLU A 1 113 ? 24.410  14.486  18.980  1.00 20.87 ? 1792 GLU A CD  1 
ATOM   994  O  OE1 . GLU A 1 113 ? 24.752  13.278  18.924  1.00 21.66 ? 1792 GLU A OE1 1 
ATOM   995  O  OE2 . GLU A 1 113 ? 24.886  15.291  19.815  1.00 25.03 ? 1792 GLU A OE2 1 
ATOM   996  N  N   . GLN A 1 114 ? 21.252  13.004  14.327  1.00 12.80 ? 1793 GLN A N   1 
ATOM   997  C  CA  . GLN A 1 114 ? 21.210  12.119  13.186  1.00 12.98 ? 1793 GLN A CA  1 
ATOM   998  C  C   . GLN A 1 114 ? 20.340  12.660  12.032  1.00 13.14 ? 1793 GLN A C   1 
ATOM   999  O  O   . GLN A 1 114 ? 20.138  11.978  11.036  1.00 14.57 ? 1793 GLN A O   1 
ATOM   1000 C  CB  . GLN A 1 114 ? 20.716  10.723  13.625  1.00 13.66 ? 1793 GLN A CB  1 
ATOM   1001 C  CG  . GLN A 1 114 ? 21.631  10.066  14.656  1.00 14.40 ? 1793 GLN A CG  1 
ATOM   1002 C  CD  . GLN A 1 114 ? 22.957  9.671   14.055  1.00 19.60 ? 1793 GLN A CD  1 
ATOM   1003 O  OE1 . GLN A 1 114 ? 22.997  8.960   13.048  1.00 20.92 ? 1793 GLN A OE1 1 
ATOM   1004 N  NE2 . GLN A 1 114 ? 24.059  10.142  14.658  1.00 22.56 ? 1793 GLN A NE2 1 
ATOM   1005 N  N   . ASN A 1 115 ? 19.854  13.892  12.177  1.00 13.53 ? 1794 ASN A N   1 
ATOM   1006 C  CA  . ASN A 1 115 ? 19.046  14.533  11.143  1.00 13.11 ? 1794 ASN A CA  1 
ATOM   1007 C  C   . ASN A 1 115 ? 17.776  13.759  10.813  1.00 13.29 ? 1794 ASN A C   1 
ATOM   1008 O  O   . ASN A 1 115 ? 17.374  13.658  9.648   1.00 14.85 ? 1794 ASN A O   1 
ATOM   1009 C  CB  . ASN A 1 115 ? 19.841  14.780  9.861   1.00 16.11 ? 1794 ASN A CB  1 
ATOM   1010 C  CG  . ASN A 1 115 ? 19.116  15.741  8.923   1.00 16.44 ? 1794 ASN A CG  1 
ATOM   1011 O  OD1 . ASN A 1 115 ? 18.443  16.681  9.380   1.00 21.34 ? 1794 ASN A OD1 1 
ATOM   1012 N  ND2 . ASN A 1 115 ? 19.228  15.503  7.616   1.00 21.73 ? 1794 ASN A ND2 1 
ATOM   1013 N  N   . VAL A 1 116 ? 17.148  13.238  11.852  1.00 12.51 ? 1795 VAL A N   1 
ATOM   1014 C  CA  . VAL A 1 116 ? 15.923  12.487  11.704  1.00 12.18 ? 1795 VAL A CA  1 
ATOM   1015 C  C   . VAL A 1 116 ? 14.769  13.458  11.446  1.00 12.76 ? 1795 VAL A C   1 
ATOM   1016 O  O   . VAL A 1 116 ? 14.628  14.466  12.141  1.00 14.19 ? 1795 VAL A O   1 
ATOM   1017 C  CB  . VAL A 1 116 ? 15.661  11.669  12.976  1.00 10.55 ? 1795 VAL A CB  1 
ATOM   1018 C  CG1 . VAL A 1 116 ? 14.293  11.000  12.924  1.00 13.18 ? 1795 VAL A CG1 1 
ATOM   1019 C  CG2 . VAL A 1 116 ? 16.760  10.629  13.164  1.00 11.61 ? 1795 VAL A CG2 1 
ATOM   1020 N  N   . HIS A 1 117 ? 13.943  13.124  10.462  1.00 11.55 ? 1796 HIS A N   1 
ATOM   1021 C  CA  . HIS A 1 117 ? 12.723  13.878  10.161  1.00 11.31 ? 1796 HIS A CA  1 
ATOM   1022 C  C   . HIS A 1 117 ? 11.443  13.075  10.350  1.00 11.84 ? 1796 HIS A C   1 
ATOM   1023 O  O   . HIS A 1 117 ? 10.347  13.657  10.351  1.00 13.46 ? 1796 HIS A O   1 
ATOM   1024 C  CB  . HIS A 1 117 ? 12.764  14.389  8.719   1.00 14.07 ? 1796 HIS A CB  1 
ATOM   1025 C  CG  . HIS A 1 117 ? 13.694  15.548  8.514   1.00 16.78 ? 1796 HIS A CG  1 
ATOM   1026 N  ND1 . HIS A 1 117 ? 15.064  15.446  8.641   1.00 20.61 ? 1796 HIS A ND1 1 
ATOM   1027 C  CD2 . HIS A 1 117 ? 13.441  16.842  8.198   1.00 22.66 ? 1796 HIS A CD2 1 
ATOM   1028 C  CE1 . HIS A 1 117 ? 15.618  16.626  8.408   1.00 18.78 ? 1796 HIS A CE1 1 
ATOM   1029 N  NE2 . HIS A 1 117 ? 14.654  17.491  8.142   1.00 24.99 ? 1796 HIS A NE2 1 
ATOM   1030 N  N   . ASN A 1 118 ? 11.558  11.752  10.455  1.00 10.60 ? 1797 ASN A N   1 
ATOM   1031 C  CA  . ASN A 1 118 ? 10.381  10.892  10.588  1.00 10.70 ? 1797 ASN A CA  1 
ATOM   1032 C  C   . ASN A 1 118 ? 10.628  9.863   11.674  1.00 9.86  ? 1797 ASN A C   1 
ATOM   1033 O  O   . ASN A 1 118 ? 11.668  9.195   11.689  1.00 10.64 ? 1797 ASN A O   1 
ATOM   1034 C  CB  . ASN A 1 118 ? 10.106  10.182  9.258   1.00 11.47 ? 1797 ASN A CB  1 
ATOM   1035 C  CG  . ASN A 1 118 ? 9.759   11.147  8.153   1.00 12.82 ? 1797 ASN A CG  1 
ATOM   1036 O  OD1 . ASN A 1 118 ? 10.536  11.360  7.211   1.00 16.20 ? 1797 ASN A OD1 1 
ATOM   1037 N  ND2 . ASN A 1 118 ? 8.610   11.763  8.283   1.00 11.96 ? 1797 ASN A ND2 1 
ATOM   1038 N  N   . ILE A 1 119 ? 9.660   9.748   12.575  1.00 10.34 ? 1798 ILE A N   1 
ATOM   1039 C  CA  . ILE A 1 119 ? 9.694   8.776   13.676  1.00 9.99  ? 1798 ILE A CA  1 
ATOM   1040 C  C   . ILE A 1 119 ? 8.448   7.903   13.604  1.00 9.60  ? 1798 ILE A C   1 
ATOM   1041 O  O   . ILE A 1 119 ? 7.336   8.430   13.463  1.00 10.15 ? 1798 ILE A O   1 
ATOM   1042 C  CB  . ILE A 1 119 ? 9.708   9.478   15.058  1.00 10.59 ? 1798 ILE A CB  1 
ATOM   1043 C  CG1 . ILE A 1 119 ? 10.930  10.402  15.177  1.00 11.26 ? 1798 ILE A CG1 1 
ATOM   1044 C  CG2 . ILE A 1 119 ? 9.640   8.460   16.193  1.00 10.83 ? 1798 ILE A CG2 1 
ATOM   1045 C  CD1 . ILE A 1 119 ? 10.835  11.403  16.306  1.00 13.00 ? 1798 ILE A CD1 1 
ATOM   1046 N  N   . VAL A 1 120 ? 8.634   6.587   13.709  1.00 8.56  ? 1799 VAL A N   1 
ATOM   1047 C  CA  . VAL A 1 120 ? 7.536   5.615   13.697  1.00 7.90  ? 1799 VAL A CA  1 
ATOM   1048 C  C   . VAL A 1 120 ? 7.478   4.902   15.042  1.00 7.88  ? 1799 VAL A C   1 
ATOM   1049 O  O   . VAL A 1 120 ? 8.492   4.374   15.520  1.00 8.95  ? 1799 VAL A O   1 
ATOM   1050 C  CB  . VAL A 1 120 ? 7.777   4.568   12.594  1.00 8.68  ? 1799 VAL A CB  1 
ATOM   1051 C  CG1 . VAL A 1 120 ? 6.742   3.479   12.634  1.00 10.60 ? 1799 VAL A CG1 1 
ATOM   1052 C  CG2 . VAL A 1 120 ? 7.871   5.254   11.228  1.00 10.89 ? 1799 VAL A CG2 1 
ATOM   1053 N  N   . MET A 1 121 ? 6.285   4.874   15.641  1.00 8.36  ? 1800 MET A N   1 
ATOM   1054 C  CA  . MET A 1 121 ? 6.056   4.266   16.954  1.00 8.38  ? 1800 MET A CA  1 
ATOM   1055 C  C   . MET A 1 121 ? 4.983   3.195   16.826  1.00 8.83  ? 1800 MET A C   1 
ATOM   1056 O  O   . MET A 1 121 ? 3.873   3.502   16.384  1.00 10.06 ? 1800 MET A O   1 
ATOM   1057 C  CB  . MET A 1 121 ? 5.625   5.330   17.973  1.00 9.91  ? 1800 MET A CB  1 
ATOM   1058 C  CG  . MET A 1 121 ? 5.304   4.804   19.341  1.00 11.10 ? 1800 MET A CG  1 
ATOM   1059 S  SD  . MET A 1 121 ? 5.103   6.220   20.465  1.00 11.77 ? 1800 MET A SD  1 
ATOM   1060 C  CE  . MET A 1 121 ? 4.586   5.452   21.990  1.00 15.04 ? 1800 MET A CE  1 
ATOM   1061 N  N   . VAL A 1 122 ? 5.338   1.949   17.164  1.00 8.22  ? 1801 VAL A N   1 
ATOM   1062 C  CA  . VAL A 1 122 ? 4.430   0.817   17.020  1.00 8.87  ? 1801 VAL A CA  1 
ATOM   1063 C  C   . VAL A 1 122 ? 4.209   0.121   18.375  1.00 9.80  ? 1801 VAL A C   1 
ATOM   1064 O  O   . VAL A 1 122 ? 4.082   -1.098  18.470  1.00 14.86 ? 1801 VAL A O   1 
ATOM   1065 C  CB  . VAL A 1 122 ? 4.892   -0.159  15.917  1.00 10.37 ? 1801 VAL A CB  1 
ATOM   1066 C  CG1 . VAL A 1 122 ? 4.797   0.508   14.545  1.00 14.27 ? 1801 VAL A CG1 1 
ATOM   1067 C  CG2 . VAL A 1 122 ? 6.321   -0.679  16.165  1.00 14.30 ? 1801 VAL A CG2 1 
ATOM   1068 N  N   . THR A 1 123 ? 4.089   0.934   19.415  1.00 13.47 ? 1802 THR A N   1 
ATOM   1069 C  CA  . THR A 1 123 ? 3.628   0.493   20.736  1.00 12.05 ? 1802 THR A CA  1 
ATOM   1070 C  C   . THR A 1 123 ? 2.699   1.558   21.321  1.00 12.47 ? 1802 THR A C   1 
ATOM   1071 O  O   . THR A 1 123 ? 2.794   2.726   20.962  1.00 12.77 ? 1802 THR A O   1 
ATOM   1072 C  CB  . THR A 1 123 ? 4.827   0.257   21.710  1.00 14.30 ? 1802 THR A CB  1 
ATOM   1073 O  OG1 . THR A 1 123 ? 4.350   -0.264  22.958  1.00 15.43 ? 1802 THR A OG1 1 
ATOM   1074 C  CG2 . THR A 1 123 ? 5.589   1.533   21.940  1.00 14.68 ? 1802 THR A CG2 1 
ATOM   1075 N  N   . GLN A 1 124 ? 1.830   1.154   22.244  1.00 13.77 ? 1803 GLN A N   1 
ATOM   1076 C  CA  . GLN A 1 124 ? 1.203   2.123   23.144  1.00 15.17 ? 1803 GLN A CA  1 
ATOM   1077 C  C   . GLN A 1 124 ? 2.133   2.404   24.320  1.00 13.83 ? 1803 GLN A C   1 
ATOM   1078 O  O   . GLN A 1 124 ? 3.032   1.604   24.615  1.00 14.30 ? 1803 GLN A O   1 
ATOM   1079 C  CB  . GLN A 1 124 ? -0.109  1.569   23.700  1.00 16.86 ? 1803 GLN A CB  1 
ATOM   1080 C  CG  . GLN A 1 124 ? -1.099  1.128   22.648  1.00 22.73 ? 1803 GLN A CG  1 
ATOM   1081 C  CD  . GLN A 1 124 ? -1.731  2.291   21.922  1.00 30.30 ? 1803 GLN A CD  1 
ATOM   1082 O  OE1 . GLN A 1 124 ? -1.699  3.427   22.391  1.00 38.12 ? 1803 GLN A OE1 1 
ATOM   1083 N  NE2 . GLN A 1 124 ? -2.317  2.011   20.768  1.00 37.51 ? 1803 GLN A NE2 1 
ATOM   1084 N  N   . CYS A 1 125 ? 1.904   3.513   25.016  1.00 13.36 ? 1804 CYS A N   1 
ATOM   1085 C  CA  . CYS A 1 125 ? 2.676   3.799   26.219  1.00 14.29 ? 1804 CYS A CA  1 
ATOM   1086 C  C   . CYS A 1 125 ? 2.426   2.818   27.352  1.00 13.38 ? 1804 CYS A C   1 
ATOM   1087 O  O   . CYS A 1 125 ? 3.355   2.468   28.095  1.00 13.57 ? 1804 CYS A O   1 
ATOM   1088 C  CB  . CYS A 1 125 ? 2.434   5.229   26.699  1.00 15.12 ? 1804 CYS A CB  1 
ATOM   1089 S  SG  . CYS A 1 125 ? 3.100   6.462   25.556  1.00 17.84 ? 1804 CYS A SG  1 
ATOM   1090 N  N   . VAL A 1 126 ? 1.180   2.375   27.476  1.00 14.01 ? 1805 VAL A N   1 
ATOM   1091 C  CA  . VAL A 1 126 ? 0.789   1.459   28.550  1.00 14.12 ? 1805 VAL A CA  1 
ATOM   1092 C  C   . VAL A 1 126 ? -0.049  0.356   27.920  1.00 14.82 ? 1805 VAL A C   1 
ATOM   1093 O  O   . VAL A 1 126 ? -0.880  0.658   27.065  1.00 18.84 ? 1805 VAL A O   1 
ATOM   1094 C  CB  . VAL A 1 126 ? -0.040  2.168   29.654  1.00 15.52 ? 1805 VAL A CB  1 
ATOM   1095 C  CG1 . VAL A 1 126 ? -0.339  1.198   30.763  1.00 19.80 ? 1805 VAL A CG1 1 
ATOM   1096 C  CG2 . VAL A 1 126 ? 0.730   3.359   30.212  1.00 17.61 ? 1805 VAL A CG2 1 
ATOM   1097 N  N   . GLU A 1 127 ? 0.195   -0.899  28.309  1.00 15.07 ? 1806 GLU A N   1 
ATOM   1098 C  CA  A GLU A 1 127 ? -0.605  -1.987  27.787  0.50 16.88 ? 1806 GLU A CA  1 
ATOM   1099 C  CA  B GLU A 1 127 ? -0.524  -2.100  27.805  0.50 17.17 ? 1806 GLU A CA  1 
ATOM   1100 C  C   . GLU A 1 127 ? -1.073  -2.855  28.998  1.00 20.07 ? 1806 GLU A C   1 
ATOM   1101 O  O   . GLU A 1 127 ? -0.280  -3.366  29.807  1.00 20.11 ? 1806 GLU A O   1 
ATOM   1102 C  CB  A GLU A 1 127 ? 0.120   -2.684  26.573  0.50 16.73 ? 1806 GLU A CB  1 
ATOM   1103 C  CB  B GLU A 1 127 ? 0.483   -3.070  27.172  0.50 18.36 ? 1806 GLU A CB  1 
ATOM   1104 C  CG  A GLU A 1 127 ? 0.402   -1.701  25.305  0.50 17.37 ? 1806 GLU A CG  1 
ATOM   1105 C  CG  B GLU A 1 127 ? 0.701   -2.921  25.698  0.50 13.82 ? 1806 GLU A CG  1 
ATOM   1106 C  CD  A GLU A 1 127 ? 1.279   -2.291  24.135  0.50 17.83 ? 1806 GLU A CD  1 
ATOM   1107 C  CD  B GLU A 1 127 ? 1.603   -4.009  25.115  0.50 13.84 ? 1806 GLU A CD  1 
ATOM   1108 O  OE1 A GLU A 1 127 ? 1.871   -3.362  24.350  0.50 13.28 ? 1806 GLU A OE1 1 
ATOM   1109 O  OE1 B GLU A 1 127 ? 2.078   -3.809  23.974  0.50 20.87 ? 1806 GLU A OE1 1 
ATOM   1110 O  OE2 A GLU A 1 127 ? 1.401   -1.683  23.002  0.50 13.13 ? 1806 GLU A OE2 1 
ATOM   1111 O  OE2 B GLU A 1 127 ? 1.854   -5.057  25.781  0.50 15.51 ? 1806 GLU A OE2 1 
ATOM   1112 N  N   . LYS A 1 128 ? -2.397  -2.946  29.155  1.00 18.86 ? 1807 LYS A N   1 
ATOM   1113 C  CA  . LYS A 1 128 ? -3.010  -3.512  30.373  1.00 23.32 ? 1807 LYS A CA  1 
ATOM   1114 C  C   . LYS A 1 128 ? -2.336  -3.080  31.670  1.00 22.08 ? 1807 LYS A C   1 
ATOM   1115 O  O   . LYS A 1 128 ? -2.058  -3.907  32.544  1.00 24.77 ? 1807 LYS A O   1 
ATOM   1116 C  CB  . LYS A 1 128 ? -3.060  -5.046  30.323  1.00 25.13 ? 1807 LYS A CB  1 
ATOM   1117 C  CG  . LYS A 1 128 ? -3.957  -5.608  29.242  1.00 23.81 ? 1807 LYS A CG  1 
ATOM   1118 C  CD  . LYS A 1 128 ? -4.000  -7.117  29.297  1.00 23.09 ? 1807 LYS A CD  1 
ATOM   1119 C  CE  . LYS A 1 128 ? -4.706  -7.661  28.075  1.00 25.04 ? 1807 LYS A CE  1 
ATOM   1120 N  NZ  . LYS A 1 128 ? -3.749  -7.723  26.962  1.00 19.93 ? 1807 LYS A NZ  1 
ATOM   1121 N  N   . GLY A 1 129 ? -2.082  -1.782  31.795  1.00 22.05 ? 1808 GLY A N   1 
ATOM   1122 C  CA  . GLY A 1 129 ? -1.601  -1.214  33.045  1.00 21.95 ? 1808 GLY A CA  1 
ATOM   1123 C  C   . GLY A 1 129 ? -0.099  -1.327  33.230  1.00 20.26 ? 1808 GLY A C   1 
ATOM   1124 O  O   . GLY A 1 129 ? 0.443   -0.810  34.210  1.00 24.11 ? 1808 GLY A O   1 
ATOM   1125 N  N   . ARG A 1 130 ? 0.583   -2.002  32.302  1.00 19.00 ? 1809 ARG A N   1 
ATOM   1126 C  CA  A ARG A 1 130 ? 2.046   -2.131  32.365  0.70 17.38 ? 1809 ARG A CA  1 
ATOM   1127 C  CA  B ARG A 1 130 ? 2.041   -2.125  32.365  0.30 18.15 ? 1809 ARG A CA  1 
ATOM   1128 C  C   . ARG A 1 130 ? 2.700   -1.103  31.447  1.00 17.43 ? 1809 ARG A C   1 
ATOM   1129 O  O   . ARG A 1 130 ? 2.364   -1.002  30.280  1.00 15.52 ? 1809 ARG A O   1 
ATOM   1130 C  CB  A ARG A 1 130 ? 2.461   -3.535  31.924  0.70 19.81 ? 1809 ARG A CB  1 
ATOM   1131 C  CB  B ARG A 1 130 ? 2.486   -3.534  31.964  0.30 19.29 ? 1809 ARG A CB  1 
ATOM   1132 C  CG  A ARG A 1 130 ? 3.914   -3.875  32.146  0.70 23.45 ? 1809 ARG A CG  1 
ATOM   1133 C  CG  B ARG A 1 130 ? 2.635   -4.501  33.129  0.30 22.39 ? 1809 ARG A CG  1 
ATOM   1134 C  CD  A ARG A 1 130 ? 4.148   -5.358  31.901  0.70 30.41 ? 1809 ARG A CD  1 
ATOM   1135 C  CD  B ARG A 1 130 ? 2.064   -5.864  32.791  0.30 23.53 ? 1809 ARG A CD  1 
ATOM   1136 N  NE  A ARG A 1 130 ? 3.804   -6.144  33.078  0.70 34.39 ? 1809 ARG A NE  1 
ATOM   1137 N  NE  B ARG A 1 130 ? 0.669   -5.970  33.210  0.30 28.26 ? 1809 ARG A NE  1 
ATOM   1138 C  CZ  A ARG A 1 130 ? 4.688   -6.557  33.979  0.70 33.29 ? 1809 ARG A CZ  1 
ATOM   1139 C  CZ  B ARG A 1 130 ? -0.214  -6.809  32.682  0.30 29.71 ? 1809 ARG A CZ  1 
ATOM   1140 N  NH1 A ARG A 1 130 ? 5.972   -6.270  33.825  0.70 31.79 ? 1809 ARG A NH1 1 
ATOM   1141 N  NH1 B ARG A 1 130 ? 0.145   -7.636  31.709  0.30 28.63 ? 1809 ARG A NH1 1 
ATOM   1142 N  NH2 A ARG A 1 130 ? 4.290   -7.267  35.025  0.70 38.73 ? 1809 ARG A NH2 1 
ATOM   1143 N  NH2 B ARG A 1 130 ? -1.460  -6.822  33.134  0.30 25.34 ? 1809 ARG A NH2 1 
ATOM   1144 N  N   . VAL A 1 131 ? 3.639   -0.337  31.982  1.00 16.19 ? 1810 VAL A N   1 
ATOM   1145 C  CA  . VAL A 1 131 ? 4.311   0.672   31.175  1.00 14.94 ? 1810 VAL A CA  1 
ATOM   1146 C  C   . VAL A 1 131 ? 5.220   0.022   30.123  1.00 12.40 ? 1810 VAL A C   1 
ATOM   1147 O  O   . VAL A 1 131 ? 6.009   -0.868  30.437  1.00 16.95 ? 1810 VAL A O   1 
ATOM   1148 C  CB  . VAL A 1 131 ? 5.123   1.620   32.058  1.00 17.11 ? 1810 VAL A CB  1 
ATOM   1149 C  CG1 . VAL A 1 131 ? 5.767   2.707   31.221  1.00 20.79 ? 1810 VAL A CG1 1 
ATOM   1150 C  CG2 . VAL A 1 131 ? 4.230   2.217   33.115  1.00 20.29 ? 1810 VAL A CG2 1 
ATOM   1151 N  N   . LYS A 1 132 ? 5.083   0.474   28.883  1.00 12.78 ? 1811 LYS A N   1 
ATOM   1152 C  CA  . LYS A 1 132 ? 5.855   -0.022  27.751  1.00 11.45 ? 1811 LYS A CA  1 
ATOM   1153 C  C   . LYS A 1 132 ? 6.695   1.084   27.089  1.00 11.14 ? 1811 LYS A C   1 
ATOM   1154 O  O   . LYS A 1 132 ? 7.693   0.810   26.405  1.00 11.85 ? 1811 LYS A O   1 
ATOM   1155 C  CB  . LYS A 1 132 ? 4.904   -0.638  26.713  1.00 12.96 ? 1811 LYS A CB  1 
ATOM   1156 C  CG  . LYS A 1 132 ? 4.148   -1.871  27.222  1.00 15.68 ? 1811 LYS A CG  1 
ATOM   1157 C  CD  . LYS A 1 132 ? 5.145   -2.981  27.558  1.00 18.12 ? 1811 LYS A CD  1 
ATOM   1158 C  CE  . LYS A 1 132 ? 4.512   -4.319  27.823  1.00 26.61 ? 1811 LYS A CE  1 
ATOM   1159 N  NZ  . LYS A 1 132 ? 5.639   -5.303  27.996  1.00 28.55 ? 1811 LYS A NZ  1 
ATOM   1160 N  N   . CYS A 1 133 ? 6.279   2.331   27.265  1.00 12.44 ? 1812 CYS A N   1 
ATOM   1161 C  CA  . CYS A 1 133 ? 7.001   3.444   26.644  1.00 11.51 ? 1812 CYS A CA  1 
ATOM   1162 C  C   . CYS A 1 133 ? 6.629   4.709   27.357  1.00 12.70 ? 1812 CYS A C   1 
ATOM   1163 O  O   . CYS A 1 133 ? 5.471   4.886   27.708  1.00 15.26 ? 1812 CYS A O   1 
ATOM   1164 C  CB  . CYS A 1 133 ? 6.665   3.553   25.146  1.00 11.90 ? 1812 CYS A CB  1 
ATOM   1165 S  SG  . CYS A 1 133 ? 7.661   4.765   24.260  1.00 12.42 ? 1812 CYS A SG  1 
ATOM   1166 N  N   . ASP A 1 134 ? 7.591   5.602   27.568  1.00 12.17 ? 1813 ASP A N   1 
ATOM   1167 C  CA  . ASP A 1 134 ? 7.269   6.898   28.152  1.00 13.30 ? 1813 ASP A CA  1 
ATOM   1168 C  C   . ASP A 1 134 ? 6.527   7.745   27.126  1.00 13.12 ? 1813 ASP A C   1 
ATOM   1169 O  O   . ASP A 1 134 ? 6.743   7.608   25.923  1.00 13.21 ? 1813 ASP A O   1 
ATOM   1170 C  CB  . ASP A 1 134 ? 8.550   7.620   28.546  1.00 14.27 ? 1813 ASP A CB  1 
ATOM   1171 C  CG  . ASP A 1 134 ? 8.292   8.813   29.427  1.00 17.98 ? 1813 ASP A CG  1 
ATOM   1172 O  OD1 . ASP A 1 134 ? 8.698   9.923   29.038  1.00 20.07 ? 1813 ASP A OD1 1 
ATOM   1173 O  OD2 . ASP A 1 134 ? 7.666   8.643   30.496  1.00 24.27 ? 1813 ASP A OD2 1 
ATOM   1174 N  N   . HIS A 1 135 ? 5.669   8.642   27.601  1.00 14.03 ? 1814 HIS A N   1 
ATOM   1175 C  CA  . HIS A 1 135 ? 5.047   9.616   26.711  1.00 13.36 ? 1814 HIS A CA  1 
ATOM   1176 C  C   . HIS A 1 135 ? 6.064   10.752  26.506  1.00 12.87 ? 1814 HIS A C   1 
ATOM   1177 O  O   . HIS A 1 135 ? 6.006   11.779  27.182  1.00 16.72 ? 1814 HIS A O   1 
ATOM   1178 C  CB  . HIS A 1 135 ? 3.763   10.140  27.357  1.00 15.04 ? 1814 HIS A CB  1 
ATOM   1179 C  CG  . HIS A 1 135 ? 2.921   10.972  26.445  1.00 15.72 ? 1814 HIS A CG  1 
ATOM   1180 N  ND1 . HIS A 1 135 ? 3.305   12.223  26.014  1.00 17.51 ? 1814 HIS A ND1 1 
ATOM   1181 C  CD2 . HIS A 1 135 ? 1.710   10.734  25.889  1.00 19.20 ? 1814 HIS A CD2 1 
ATOM   1182 C  CE1 . HIS A 1 135 ? 2.364   12.724  25.236  1.00 17.08 ? 1814 HIS A CE1 1 
ATOM   1183 N  NE2 . HIS A 1 135 ? 1.391   11.837  25.136  1.00 18.22 ? 1814 HIS A NE2 1 
ATOM   1184 N  N   . TYR A 1 136 ? 7.012   10.536  25.596  1.00 11.67 ? 1815 TYR A N   1 
ATOM   1185 C  CA  . TYR A 1 136 ? 8.263   11.309  25.561  1.00 11.34 ? 1815 TYR A CA  1 
ATOM   1186 C  C   . TYR A 1 136 ? 8.153   12.592  24.722  1.00 12.54 ? 1815 TYR A C   1 
ATOM   1187 O  O   . TYR A 1 136 ? 9.166   13.245  24.429  1.00 12.76 ? 1815 TYR A O   1 
ATOM   1188 C  CB  . TYR A 1 136 ? 9.409   10.425  25.029  1.00 10.98 ? 1815 TYR A CB  1 
ATOM   1189 C  CG  . TYR A 1 136 ? 9.146   9.850   23.646  1.00 10.61 ? 1815 TYR A CG  1 
ATOM   1190 C  CD1 . TYR A 1 136 ? 9.447   10.570  22.502  1.00 11.25 ? 1815 TYR A CD1 1 
ATOM   1191 C  CD2 . TYR A 1 136 ? 8.603   8.574   23.492  1.00 10.26 ? 1815 TYR A CD2 1 
ATOM   1192 C  CE1 . TYR A 1 136 ? 9.177   10.075  21.238  1.00 10.96 ? 1815 TYR A CE1 1 
ATOM   1193 C  CE2 . TYR A 1 136 ? 8.347   8.048   22.218  1.00 9.76  ? 1815 TYR A CE2 1 
ATOM   1194 C  CZ  . TYR A 1 136 ? 8.643   8.799   21.091  1.00 10.60 ? 1815 TYR A CZ  1 
ATOM   1195 O  OH  . TYR A 1 136 ? 8.403   8.292   19.827  1.00 10.89 ? 1815 TYR A OH  1 
ATOM   1196 N  N   . TRP A 1 137 ? 6.930   12.942  24.324  1.00 13.08 ? 1816 TRP A N   1 
ATOM   1197 C  CA  . TRP A 1 137 ? 6.689   14.178  23.592  1.00 13.65 ? 1816 TRP A CA  1 
ATOM   1198 C  C   . TRP A 1 137 ? 5.634   14.993  24.379  1.00 13.74 ? 1816 TRP A C   1 
ATOM   1199 O  O   . TRP A 1 137 ? 5.016   14.478  25.321  1.00 14.97 ? 1816 TRP A O   1 
ATOM   1200 C  CB  . TRP A 1 137 ? 6.211   13.830  22.169  1.00 14.66 ? 1816 TRP A CB  1 
ATOM   1201 C  CG  . TRP A 1 137 ? 4.887   13.111  22.145  1.00 16.21 ? 1816 TRP A CG  1 
ATOM   1202 C  CD1 . TRP A 1 137 ? 3.654   13.687  22.052  1.00 14.38 ? 1816 TRP A CD1 1 
ATOM   1203 C  CD2 . TRP A 1 137 ? 4.664   11.697  22.257  1.00 14.45 ? 1816 TRP A CD2 1 
ATOM   1204 N  NE1 . TRP A 1 137 ? 2.675   12.721  22.086  1.00 16.37 ? 1816 TRP A NE1 1 
ATOM   1205 C  CE2 . TRP A 1 137 ? 3.268   11.490  22.209  1.00 14.42 ? 1816 TRP A CE2 1 
ATOM   1206 C  CE3 . TRP A 1 137 ? 5.507   10.586  22.401  1.00 14.08 ? 1816 TRP A CE3 1 
ATOM   1207 C  CZ2 . TRP A 1 137 ? 2.691   10.222  22.302  1.00 13.24 ? 1816 TRP A CZ2 1 
ATOM   1208 C  CZ3 . TRP A 1 137 ? 4.944   9.332   22.495  1.00 13.97 ? 1816 TRP A CZ3 1 
ATOM   1209 C  CH2 . TRP A 1 137 ? 3.536   9.155   22.433  1.00 15.81 ? 1816 TRP A CH2 1 
ATOM   1210 N  N   . PRO A 1 138 ? 5.470   16.290  24.049  1.00 15.26 ? 1817 PRO A N   1 
ATOM   1211 C  CA  . PRO A 1 138 ? 4.543   17.105  24.847  1.00 16.90 ? 1817 PRO A CA  1 
ATOM   1212 C  C   . PRO A 1 138 ? 3.080   16.678  24.773  1.00 16.28 ? 1817 PRO A C   1 
ATOM   1213 O  O   . PRO A 1 138 ? 2.652   16.120  23.765  1.00 17.89 ? 1817 PRO A O   1 
ATOM   1214 C  CB  . PRO A 1 138 ? 4.712   18.518  24.257  1.00 18.50 ? 1817 PRO A CB  1 
ATOM   1215 C  CG  . PRO A 1 138 ? 6.086   18.482  23.592  1.00 17.61 ? 1817 PRO A CG  1 
ATOM   1216 C  CD  . PRO A 1 138 ? 6.181   17.079  23.031  1.00 16.76 ? 1817 PRO A CD  1 
ATOM   1217 N  N   . ALA A 1 139 ? 2.325   16.980  25.830  1.00 16.91 ? 1818 ALA A N   1 
ATOM   1218 C  CA  . ALA A 1 139 ? 0.883   16.679  25.905  1.00 18.34 ? 1818 ALA A CA  1 
ATOM   1219 C  C   . ALA A 1 139 ? -0.004  17.708  25.193  1.00 18.52 ? 1818 ALA A C   1 
ATOM   1220 O  O   . ALA A 1 139 ? -1.191  17.469  24.943  1.00 22.45 ? 1818 ALA A O   1 
ATOM   1221 C  CB  . ALA A 1 139 ? 0.462   16.548  27.367  1.00 23.40 ? 1818 ALA A CB  1 
ATOM   1222 N  N   . ASP A 1 140 ? 0.564   18.860  24.883  1.00 15.45 ? 1819 ASP A N   1 
ATOM   1223 C  CA  . ASP A 1 140 ? -0.181  19.949  24.247  1.00 15.86 ? 1819 ASP A CA  1 
ATOM   1224 C  C   . ASP A 1 140 ? 0.789   20.773  23.377  1.00 13.50 ? 1819 ASP A C   1 
ATOM   1225 O  O   . ASP A 1 140 ? 1.925   20.341  23.126  1.00 14.15 ? 1819 ASP A O   1 
ATOM   1226 C  CB  . ASP A 1 140 ? -0.848  20.820  25.328  1.00 15.70 ? 1819 ASP A CB  1 
ATOM   1227 C  CG  . ASP A 1 140 ? 0.169   21.373  26.334  1.00 16.31 ? 1819 ASP A CG  1 
ATOM   1228 O  OD1 . ASP A 1 140 ? 1.297   21.715  25.888  1.00 14.99 ? 1819 ASP A OD1 1 
ATOM   1229 O  OD2 . ASP A 1 140 ? -0.155  21.464  27.552  1.00 18.96 ? 1819 ASP A OD2 1 
ATOM   1230 N  N   . GLN A 1 141 ? 0.352   21.935  22.905  1.00 13.87 ? 1820 GLN A N   1 
ATOM   1231 C  CA  . GLN A 1 141 ? 1.131   22.699  21.934  1.00 13.66 ? 1820 GLN A CA  1 
ATOM   1232 C  C   . GLN A 1 141 ? 2.165   23.650  22.572  1.00 13.23 ? 1820 GLN A C   1 
ATOM   1233 O  O   . GLN A 1 141 ? 2.774   24.464  21.868  1.00 15.84 ? 1820 GLN A O   1 
ATOM   1234 C  CB  . GLN A 1 141 ? 0.208   23.486  21.008  1.00 16.90 ? 1820 GLN A CB  1 
ATOM   1235 C  CG  . GLN A 1 141 ? -0.475  22.578  19.977  1.00 20.53 ? 1820 GLN A CG  1 
ATOM   1236 C  CD  . GLN A 1 141 ? -1.758  23.142  19.398  1.00 29.94 ? 1820 GLN A CD  1 
ATOM   1237 O  OE1 . GLN A 1 141 ? -2.641  23.604  20.122  1.00 33.52 ? 1820 GLN A OE1 1 
ATOM   1238 N  NE2 . GLN A 1 141 ? -1.874  23.079  18.084  1.00 31.03 ? 1820 GLN A NE2 1 
ATOM   1239 N  N   . ASP A 1 142 ? 2.360   23.554  23.885  1.00 10.85 ? 1821 ASP A N   1 
ATOM   1240 C  CA  . ASP A 1 142 ? 3.301   24.467  24.558  1.00 11.71 ? 1821 ASP A CA  1 
ATOM   1241 C  C   . ASP A 1 142 ? 4.722   23.866  24.560  1.00 10.34 ? 1821 ASP A C   1 
ATOM   1242 O  O   . ASP A 1 142 ? 4.907   22.655  24.758  1.00 11.21 ? 1821 ASP A O   1 
ATOM   1243 C  CB  . ASP A 1 142 ? 2.856   24.730  25.984  1.00 12.02 ? 1821 ASP A CB  1 
ATOM   1244 C  CG  . ASP A 1 142 ? 1.540   25.522  26.066  1.00 12.00 ? 1821 ASP A CG  1 
ATOM   1245 O  OD1 . ASP A 1 142 ? 1.001   25.939  25.015  1.00 15.21 ? 1821 ASP A OD1 1 
ATOM   1246 O  OD2 . ASP A 1 142 ? 1.071   25.734  27.195  1.00 15.32 ? 1821 ASP A OD2 1 
ATOM   1247 N  N   . SER A 1 143 ? 5.717   24.716  24.338  1.00 10.32 ? 1822 SER A N   1 
ATOM   1248 C  CA  . SER A 1 143 ? 7.099   24.243  24.206  1.00 11.14 ? 1822 SER A CA  1 
ATOM   1249 C  C   . SER A 1 143 ? 7.656   23.609  25.469  1.00 10.82 ? 1822 SER A C   1 
ATOM   1250 O  O   . SER A 1 143 ? 7.261   23.965  26.580  1.00 11.30 ? 1822 SER A O   1 
ATOM   1251 C  CB  . SER A 1 143 ? 7.998   25.407  23.793  1.00 10.86 ? 1822 SER A CB  1 
ATOM   1252 O  OG  . SER A 1 143 ? 7.954   26.475  24.722  1.00 11.68 ? 1822 SER A OG  1 
ATOM   1253 N  N   . LEU A 1 144 ? 8.609   22.691  25.302  1.00 10.44 ? 1823 LEU A N   1 
ATOM   1254 C  CA  . LEU A 1 144 ? 9.334   22.139  26.440  1.00 11.31 ? 1823 LEU A CA  1 
ATOM   1255 C  C   . LEU A 1 144 ? 10.762  21.872  26.002  1.00 10.12 ? 1823 LEU A C   1 
ATOM   1256 O  O   . LEU A 1 144 ? 10.991  21.542  24.842  1.00 11.58 ? 1823 LEU A O   1 
ATOM   1257 C  CB  . LEU A 1 144 ? 8.725   20.800  26.855  1.00 12.67 ? 1823 LEU A CB  1 
ATOM   1258 C  CG  . LEU A 1 144 ? 7.369   20.855  27.560  1.00 16.03 ? 1823 LEU A CG  1 
ATOM   1259 C  CD1 . LEU A 1 144 ? 6.908   19.437  27.793  1.00 18.95 ? 1823 LEU A CD1 1 
ATOM   1260 C  CD2 . LEU A 1 144 ? 7.461   21.648  28.880  1.00 16.45 ? 1823 LEU A CD2 1 
ATOM   1261 N  N   . TYR A 1 145 ? 11.704  21.998  26.950  1.00 10.11 ? 1824 TYR A N   1 
ATOM   1262 C  CA  . TYR A 1 145 ? 13.066  21.518  26.721  1.00 10.75 ? 1824 TYR A CA  1 
ATOM   1263 C  C   . TYR A 1 145 ? 13.152  20.003  26.865  1.00 11.82 ? 1824 TYR A C   1 
ATOM   1264 O  O   . TYR A 1 145 ? 12.534  19.424  27.760  1.00 13.09 ? 1824 TYR A O   1 
ATOM   1265 C  CB  . TYR A 1 145 ? 14.038  22.116  27.744  1.00 11.02 ? 1824 TYR A CB  1 
ATOM   1266 C  CG  . TYR A 1 145 ? 14.394  23.558  27.499  1.00 10.14 ? 1824 TYR A CG  1 
ATOM   1267 C  CD1 . TYR A 1 145 ? 15.285  23.916  26.496  1.00 12.10 ? 1824 TYR A CD1 1 
ATOM   1268 C  CD2 . TYR A 1 145 ? 13.829  24.558  28.265  1.00 11.90 ? 1824 TYR A CD2 1 
ATOM   1269 C  CE1 . TYR A 1 145 ? 15.624  25.267  26.272  1.00 11.58 ? 1824 TYR A CE1 1 
ATOM   1270 C  CE2 . TYR A 1 145 ? 14.173  25.896  28.071  1.00 12.42 ? 1824 TYR A CE2 1 
ATOM   1271 C  CZ  . TYR A 1 145 ? 15.053  26.234  27.069  1.00 11.10 ? 1824 TYR A CZ  1 
ATOM   1272 O  OH  . TYR A 1 145 ? 15.357  27.554  26.863  1.00 13.15 ? 1824 TYR A OH  1 
ATOM   1273 N  N   . TYR A 1 146 ? 13.980  19.389  26.029  1.00 12.21 ? 1825 TYR A N   1 
ATOM   1274 C  CA  . TYR A 1 146 ? 14.466  18.030  26.255  1.00 12.67 ? 1825 TYR A CA  1 
ATOM   1275 C  C   . TYR A 1 146 ? 15.975  18.109  26.102  1.00 12.55 ? 1825 TYR A C   1 
ATOM   1276 O  O   . TYR A 1 146 ? 16.495  18.181  24.981  1.00 14.40 ? 1825 TYR A O   1 
ATOM   1277 C  CB  . TYR A 1 146 ? 13.892  17.081  25.192  1.00 13.48 ? 1825 TYR A CB  1 
ATOM   1278 C  CG  . TYR A 1 146 ? 12.397  16.903  25.329  1.00 12.70 ? 1825 TYR A CG  1 
ATOM   1279 C  CD1 . TYR A 1 146 ? 11.867  15.868  26.095  1.00 14.10 ? 1825 TYR A CD1 1 
ATOM   1280 C  CD2 . TYR A 1 146 ? 11.515  17.782  24.706  1.00 14.58 ? 1825 TYR A CD2 1 
ATOM   1281 C  CE1 . TYR A 1 146 ? 10.498  15.700  26.229  1.00 16.68 ? 1825 TYR A CE1 1 
ATOM   1282 C  CE2 . TYR A 1 146 ? 10.141  17.627  24.824  1.00 15.79 ? 1825 TYR A CE2 1 
ATOM   1283 C  CZ  . TYR A 1 146 ? 9.641   16.596  25.595  1.00 12.32 ? 1825 TYR A CZ  1 
ATOM   1284 O  OH  . TYR A 1 146 ? 8.279   16.451  25.690  1.00 17.11 ? 1825 TYR A OH  1 
ATOM   1285 N  N   . GLY A 1 147 ? 16.675  18.171  27.229  1.00 14.28 ? 1826 GLY A N   1 
ATOM   1286 C  CA  . GLY A 1 147 ? 18.132  18.399  27.206  1.00 14.44 ? 1826 GLY A CA  1 
ATOM   1287 C  C   . GLY A 1 147 ? 18.461  19.765  26.613  1.00 12.71 ? 1826 GLY A C   1 
ATOM   1288 O  O   . GLY A 1 147 ? 17.976  20.786  27.095  1.00 17.09 ? 1826 GLY A O   1 
ATOM   1289 N  N   . ASP A 1 148 ? 19.295  19.781  25.579  1.00 14.65 ? 1827 ASP A N   1 
ATOM   1290 C  CA  . ASP A 1 148 ? 19.702  21.032  24.938  1.00 15.26 ? 1827 ASP A CA  1 
ATOM   1291 C  C   . ASP A 1 148 ? 18.841  21.377  23.723  1.00 17.10 ? 1827 ASP A C   1 
ATOM   1292 O  O   . ASP A 1 148 ? 19.235  22.175  22.873  1.00 21.73 ? 1827 ASP A O   1 
ATOM   1293 C  CB  . ASP A 1 148 ? 21.167  20.927  24.495  1.00 16.88 ? 1827 ASP A CB  1 
ATOM   1294 C  CG  . ASP A 1 148 ? 22.126  20.796  25.659  1.00 21.99 ? 1827 ASP A CG  1 
ATOM   1295 O  OD1 . ASP A 1 148 ? 21.921  21.434  26.698  1.00 26.50 ? 1827 ASP A OD1 1 
ATOM   1296 O  OD2 . ASP A 1 148 ? 23.100  20.032  25.534  1.00 30.82 ? 1827 ASP A OD2 1 
ATOM   1297 N  N   . LEU A 1 149 ? 17.663  20.787  23.631  1.00 13.29 ? 1828 LEU A N   1 
ATOM   1298 C  CA  . LEU A 1 149 ? 16.808  21.043  22.482  1.00 14.36 ? 1828 LEU A CA  1 
ATOM   1299 C  C   . LEU A 1 149 ? 15.502  21.612  23.001  1.00 12.16 ? 1828 LEU A C   1 
ATOM   1300 O  O   . LEU A 1 149 ? 15.068  21.257  24.089  1.00 12.60 ? 1828 LEU A O   1 
ATOM   1301 C  CB  . LEU A 1 149 ? 16.534  19.716  21.759  1.00 17.10 ? 1828 LEU A CB  1 
ATOM   1302 C  CG  . LEU A 1 149 ? 17.751  19.052  21.120  1.00 20.66 ? 1828 LEU A CG  1 
ATOM   1303 C  CD1 . LEU A 1 149 ? 17.433  17.593  20.791  1.00 25.30 ? 1828 LEU A CD1 1 
ATOM   1304 C  CD2 . LEU A 1 149 ? 18.137  19.808  19.855  1.00 25.81 ? 1828 LEU A CD2 1 
ATOM   1305 N  N   . ILE A 1 150 ? 14.855  22.474  22.220  1.00 11.84 ? 1829 ILE A N   1 
ATOM   1306 C  CA  A ILE A 1 150 ? 13.475  22.837  22.547  0.50 12.71 ? 1829 ILE A CA  1 
ATOM   1307 C  CA  B ILE A 1 150 ? 13.494  22.909  22.532  0.50 11.67 ? 1829 ILE A CA  1 
ATOM   1308 C  C   . ILE A 1 150 ? 12.543  22.305  21.499  1.00 13.83 ? 1829 ILE A C   1 
ATOM   1309 O  O   . ILE A 1 150 ? 12.870  22.288  20.311  1.00 15.28 ? 1829 ILE A O   1 
ATOM   1310 C  CB  A ILE A 1 150 ? 13.231  24.350  22.703  0.50 16.92 ? 1829 ILE A CB  1 
ATOM   1311 C  CB  B ILE A 1 150 ? 13.406  24.473  22.595  0.50 14.33 ? 1829 ILE A CB  1 
ATOM   1312 C  CG1 A ILE A 1 150 ? 14.463  25.054  23.245  0.50 14.74 ? 1829 ILE A CG1 1 
ATOM   1313 C  CG1 B ILE A 1 150 ? 11.994  24.943  22.952  0.50 12.48 ? 1829 ILE A CG1 1 
ATOM   1314 C  CG2 A ILE A 1 150 ? 12.029  24.590  23.621  0.50 17.33 ? 1829 ILE A CG2 1 
ATOM   1315 C  CG2 B ILE A 1 150 ? 13.869  25.117  21.306  0.50 14.63 ? 1829 ILE A CG2 1 
ATOM   1316 C  CD1 A ILE A 1 150 ? 14.338  26.559  23.272  0.50 16.49 ? 1829 ILE A CD1 1 
ATOM   1317 C  CD1 B ILE A 1 150 ? 11.942  25.657  24.321  0.50 12.95 ? 1829 ILE A CD1 1 
ATOM   1318 N  N   . LEU A 1 151 ? 11.391  21.824  21.967  1.00 12.85 ? 1830 LEU A N   1 
ATOM   1319 C  CA  A LEU A 1 151 ? 10.465  21.130  21.093  0.50 14.00 ? 1830 LEU A CA  1 
ATOM   1320 C  CA  B LEU A 1 151 ? 10.448  21.067  21.135  0.50 14.00 ? 1830 LEU A CA  1 
ATOM   1321 C  C   . LEU A 1 151 ? 9.062   21.694  21.260  1.00 14.16 ? 1830 LEU A C   1 
ATOM   1322 O  O   . LEU A 1 151 ? 8.656   22.032  22.358  1.00 13.11 ? 1830 LEU A O   1 
ATOM   1323 C  CB  A LEU A 1 151 ? 10.485  19.637  21.412  0.50 15.09 ? 1830 LEU A CB  1 
ATOM   1324 C  CB  B LEU A 1 151 ? 10.381  19.614  21.637  0.50 14.05 ? 1830 LEU A CB  1 
ATOM   1325 C  CG  A LEU A 1 151 ? 9.571   18.736  20.594  0.50 18.20 ? 1830 LEU A CG  1 
ATOM   1326 C  CG  B LEU A 1 151 ? 9.666   18.544  20.805  0.50 18.30 ? 1830 LEU A CG  1 
ATOM   1327 C  CD1 A LEU A 1 151 ? 10.162  17.335  20.554  0.50 13.81 ? 1830 LEU A CD1 1 
ATOM   1328 C  CD1 B LEU A 1 151 ? 10.405  18.289  19.492  0.50 18.64 ? 1830 LEU A CD1 1 
ATOM   1329 C  CD2 A LEU A 1 151 ? 8.208   18.729  21.226  0.50 16.36 ? 1830 LEU A CD2 1 
ATOM   1330 C  CD2 B LEU A 1 151 ? 9.542   17.249  21.604  0.50 16.14 ? 1830 LEU A CD2 1 
ATOM   1331 N  N   . GLN A 1 152 ? 8.337   21.808  20.145  1.00 14.17 ? 1831 GLN A N   1 
ATOM   1332 C  CA  . GLN A 1 152 ? 6.944   22.290  20.148  1.00 15.45 ? 1831 GLN A CA  1 
ATOM   1333 C  C   . GLN A 1 152 ? 6.129   21.332  19.299  1.00 13.73 ? 1831 GLN A C   1 
ATOM   1334 O  O   . GLN A 1 152 ? 6.485   21.072  18.152  1.00 17.06 ? 1831 GLN A O   1 
ATOM   1335 C  CB  . GLN A 1 152 ? 6.866   23.650  19.446  1.00 21.02 ? 1831 GLN A CB  1 
ATOM   1336 C  CG  . GLN A 1 152 ? 5.981   24.664  20.089  1.00 29.13 ? 1831 GLN A CG  1 
ATOM   1337 C  CD  . GLN A 1 152 ? 5.968   25.954  19.294  1.00 30.22 ? 1831 GLN A CD  1 
ATOM   1338 O  OE1 . GLN A 1 152 ? 7.015   26.563  19.054  1.00 33.10 ? 1831 GLN A OE1 1 
ATOM   1339 N  NE2 . GLN A 1 152 ? 4.785   26.369  18.869  1.00 34.88 ? 1831 GLN A NE2 1 
ATOM   1340 N  N   . MET A 1 153 ? 5.015   20.835  19.833  1.00 13.56 ? 1832 MET A N   1 
ATOM   1341 C  CA  . MET A 1 153 ? 4.133   20.033  19.009  1.00 14.15 ? 1832 MET A CA  1 
ATOM   1342 C  C   . MET A 1 153 ? 3.166   20.965  18.288  1.00 15.09 ? 1832 MET A C   1 
ATOM   1343 O  O   . MET A 1 153 ? 2.428   21.696  18.936  1.00 18.36 ? 1832 MET A O   1 
ATOM   1344 C  CB  . MET A 1 153 ? 3.351   19.037  19.859  1.00 13.43 ? 1832 MET A CB  1 
ATOM   1345 C  CG  . MET A 1 153 ? 2.464   18.137  19.005  1.00 16.25 ? 1832 MET A CG  1 
ATOM   1346 S  SD  . MET A 1 153 ? 1.750   16.778  19.934  1.00 18.58 ? 1832 MET A SD  1 
ATOM   1347 C  CE  . MET A 1 153 ? 0.710   17.671  21.094  1.00 21.10 ? 1832 MET A CE  1 
ATOM   1348 N  N   . LEU A 1 154 ? 3.213   20.956  16.961  1.00 15.29 ? 1833 LEU A N   1 
ATOM   1349 C  CA  . LEU A 1 154 ? 2.393   21.846  16.142  1.00 15.28 ? 1833 LEU A CA  1 
ATOM   1350 C  C   . LEU A 1 154 ? 0.994   21.282  15.919  1.00 17.40 ? 1833 LEU A C   1 
ATOM   1351 O  O   . LEU A 1 154 ? 0.012   22.024  15.860  1.00 21.25 ? 1833 LEU A O   1 
ATOM   1352 C  CB  . LEU A 1 154 ? 3.061   22.088  14.786  1.00 17.92 ? 1833 LEU A CB  1 
ATOM   1353 C  CG  . LEU A 1 154 ? 4.464   22.709  14.801  1.00 20.41 ? 1833 LEU A CG  1 
ATOM   1354 C  CD1 . LEU A 1 154 ? 4.982   22.930  13.392  1.00 25.90 ? 1833 LEU A CD1 1 
ATOM   1355 C  CD2 . LEU A 1 154 ? 4.499   24.019  15.600  1.00 23.51 ? 1833 LEU A CD2 1 
ATOM   1356 N  N   . SER A 1 155 ? 0.910   19.973  15.769  1.00 17.03 ? 1834 SER A N   1 
ATOM   1357 C  CA  . SER A 1 155 ? -0.366  19.352  15.453  1.00 16.40 ? 1834 SER A CA  1 
ATOM   1358 C  C   . SER A 1 155 ? -0.393  17.906  15.891  1.00 16.14 ? 1834 SER A C   1 
ATOM   1359 O  O   . SER A 1 155 ? 0.646   17.253  16.012  1.00 15.95 ? 1834 SER A O   1 
ATOM   1360 C  CB  . SER A 1 155 ? -0.670  19.442  13.953  1.00 19.24 ? 1834 SER A CB  1 
ATOM   1361 O  OG  . SER A 1 155 ? 0.252   18.673  13.193  1.00 20.62 ? 1834 SER A OG  1 
ATOM   1362 N  N   . GLU A 1 156 ? -1.601  17.410  16.097  1.00 17.83 ? 1835 GLU A N   1 
ATOM   1363 C  CA  . GLU A 1 156 ? -1.812  16.049  16.530  1.00 17.88 ? 1835 GLU A CA  1 
ATOM   1364 C  C   . GLU A 1 156 ? -3.134  15.613  15.900  1.00 17.14 ? 1835 GLU A C   1 
ATOM   1365 O  O   . GLU A 1 156 ? -4.195  16.156  16.221  1.00 21.50 ? 1835 GLU A O   1 
ATOM   1366 C  CB  . GLU A 1 156 ? -1.890  16.016  18.050  1.00 20.30 ? 1835 GLU A CB  1 
ATOM   1367 C  CG  . GLU A 1 156 ? -2.213  14.685  18.673  1.00 22.00 ? 1835 GLU A CG  1 
ATOM   1368 C  CD  . GLU A 1 156 ? -2.085  14.755  20.180  1.00 25.03 ? 1835 GLU A CD  1 
ATOM   1369 O  OE1 . GLU A 1 156 ? -2.976  15.347  20.820  1.00 30.81 ? 1835 GLU A OE1 1 
ATOM   1370 O  OE2 . GLU A 1 156 ? -1.090  14.238  20.734  1.00 26.67 ? 1835 GLU A OE2 1 
ATOM   1371 N  N   . SER A 1 157 ? -3.052  14.660  14.978  1.00 19.10 ? 1836 SER A N   1 
ATOM   1372 C  CA  A SER A 1 157 ? -4.223  14.194  14.252  0.50 18.09 ? 1836 SER A CA  1 
ATOM   1373 C  CA  B SER A 1 157 ? -4.214  14.186  14.220  0.50 18.07 ? 1836 SER A CA  1 
ATOM   1374 C  C   . SER A 1 157 ? -4.477  12.716  14.543  1.00 18.86 ? 1836 SER A C   1 
ATOM   1375 O  O   . SER A 1 157 ? -3.708  11.846  14.121  1.00 17.29 ? 1836 SER A O   1 
ATOM   1376 C  CB  A SER A 1 157 ? -4.026  14.429  12.760  0.50 19.81 ? 1836 SER A CB  1 
ATOM   1377 C  CB  B SER A 1 157 ? -3.945  14.321  12.720  0.50 19.63 ? 1836 SER A CB  1 
ATOM   1378 O  OG  A SER A 1 157 ? -3.866  15.815  12.507  0.50 19.58 ? 1836 SER A OG  1 
ATOM   1379 O  OG  B SER A 1 157 ? -4.949  13.666  11.957  0.50 20.83 ? 1836 SER A OG  1 
ATOM   1380 N  N   . VAL A 1 158 ? -5.557  12.445  15.280  1.00 20.20 ? 1837 VAL A N   1 
ATOM   1381 C  CA  . VAL A 1 158 ? -5.893  11.095  15.723  1.00 21.01 ? 1837 VAL A CA  1 
ATOM   1382 C  C   . VAL A 1 158 ? -6.851  10.456  14.728  1.00 19.84 ? 1837 VAL A C   1 
ATOM   1383 O  O   . VAL A 1 158 ? -8.018  10.864  14.617  1.00 23.51 ? 1837 VAL A O   1 
ATOM   1384 C  CB  . VAL A 1 158 ? -6.566  11.091  17.124  1.00 22.20 ? 1837 VAL A CB  1 
ATOM   1385 C  CG1 . VAL A 1 158 ? -6.902  9.663   17.571  1.00 24.95 ? 1837 VAL A CG1 1 
ATOM   1386 C  CG2 . VAL A 1 158 ? -5.699  11.794  18.141  1.00 25.51 ? 1837 VAL A CG2 1 
ATOM   1387 N  N   . LEU A 1 159 ? -6.356  9.465   14.001  1.00 17.58 ? 1838 LEU A N   1 
ATOM   1388 C  CA  . LEU A 1 159 ? -7.155  8.761   13.025  1.00 14.53 ? 1838 LEU A CA  1 
ATOM   1389 C  C   . LEU A 1 159 ? -7.485  7.357   13.531  1.00 14.21 ? 1838 LEU A C   1 
ATOM   1390 O  O   . LEU A 1 159 ? -6.985  6.936   14.550  1.00 14.89 ? 1838 LEU A O   1 
ATOM   1391 C  CB  . LEU A 1 159 ? -6.441  8.751   11.681  1.00 16.03 ? 1838 LEU A CB  1 
ATOM   1392 C  CG  . LEU A 1 159 ? -6.017  10.155  11.227  1.00 22.28 ? 1838 LEU A CG  1 
ATOM   1393 C  CD1 . LEU A 1 159 ? -5.100  10.106  10.023  1.00 24.57 ? 1838 LEU A CD1 1 
ATOM   1394 C  CD2 . LEU A 1 159 ? -7.250  10.978  10.913  1.00 26.00 ? 1838 LEU A CD2 1 
ATOM   1395 N  N   . PRO A 1 160 ? -8.375  6.644   12.843  1.00 12.95 ? 1839 PRO A N   1 
ATOM   1396 C  CA  . PRO A 1 160 ? -8.823  5.367   13.389  1.00 13.69 ? 1839 PRO A CA  1 
ATOM   1397 C  C   . PRO A 1 160 ? -7.727  4.358   13.750  1.00 13.57 ? 1839 PRO A C   1 
ATOM   1398 O  O   . PRO A 1 160 ? -7.871  3.655   14.746  1.00 18.42 ? 1839 PRO A O   1 
ATOM   1399 C  CB  . PRO A 1 160 ? -9.762  4.833   12.296  1.00 15.06 ? 1839 PRO A CB  1 
ATOM   1400 C  CG  . PRO A 1 160 ? -10.311 6.087   11.655  1.00 15.47 ? 1839 PRO A CG  1 
ATOM   1401 C  CD  . PRO A 1 160 ? -9.124  7.032   11.626  1.00 12.70 ? 1839 PRO A CD  1 
ATOM   1402 N  N   . GLU A 1 161 ? -6.670  4.265   12.951  1.00 11.58 ? 1840 GLU A N   1 
ATOM   1403 C  CA  . GLU A 1 161 ? -5.662  3.232   13.173  1.00 11.86 ? 1840 GLU A CA  1 
ATOM   1404 C  C   . GLU A 1 161 ? -4.283  3.798   13.461  1.00 11.10 ? 1840 GLU A C   1 
ATOM   1405 O  O   . GLU A 1 161 ? -3.359  3.049   13.753  1.00 11.20 ? 1840 GLU A O   1 
ATOM   1406 C  CB  . GLU A 1 161 ? -5.624  2.269   11.974  1.00 12.63 ? 1840 GLU A CB  1 
ATOM   1407 C  CG  . GLU A 1 161 ? -6.950  1.513   11.769  1.00 14.06 ? 1840 GLU A CG  1 
ATOM   1408 C  CD  . GLU A 1 161 ? -7.096  0.863   10.382  1.00 20.54 ? 1840 GLU A CD  1 
ATOM   1409 O  OE1 . GLU A 1 161 ? -6.768  1.500   9.359   1.00 25.96 ? 1840 GLU A OE1 1 
ATOM   1410 O  OE2 . GLU A 1 161 ? -7.577  -0.289  10.307  1.00 24.39 ? 1840 GLU A OE2 1 
ATOM   1411 N  N   . TRP A 1 162 ? -4.135  5.113   13.356  1.00 10.07 ? 1841 TRP A N   1 
ATOM   1412 C  CA  . TRP A 1 162 ? -2.869  5.763   13.679  1.00 9.38  ? 1841 TRP A CA  1 
ATOM   1413 C  C   . TRP A 1 162 ? -3.061  7.233   13.973  1.00 9.90  ? 1841 TRP A C   1 
ATOM   1414 O  O   . TRP A 1 162 ? -4.097  7.821   13.632  1.00 12.01 ? 1841 TRP A O   1 
ATOM   1415 C  CB  . TRP A 1 162 ? -1.825  5.594   12.574  1.00 10.21 ? 1841 TRP A CB  1 
ATOM   1416 C  CG  . TRP A 1 162 ? -2.267  5.983   11.195  1.00 11.20 ? 1841 TRP A CG  1 
ATOM   1417 C  CD1 . TRP A 1 162 ? -2.293  7.247   10.654  1.00 13.27 ? 1841 TRP A CD1 1 
ATOM   1418 C  CD2 . TRP A 1 162 ? -2.722  5.091   10.158  1.00 12.34 ? 1841 TRP A CD2 1 
ATOM   1419 N  NE1 . TRP A 1 162 ? -2.737  7.182   9.338   1.00 14.59 ? 1841 TRP A NE1 1 
ATOM   1420 C  CE2 . TRP A 1 162 ? -2.999  5.874   9.020   1.00 14.31 ? 1841 TRP A CE2 1 
ATOM   1421 C  CE3 . TRP A 1 162 ? -2.903  3.697   10.083  1.00 12.59 ? 1841 TRP A CE3 1 
ATOM   1422 C  CZ2 . TRP A 1 162 ? -3.473  5.320   7.828   1.00 15.66 ? 1841 TRP A CZ2 1 
ATOM   1423 C  CZ3 . TRP A 1 162 ? -3.387  3.148   8.898   1.00 12.65 ? 1841 TRP A CZ3 1 
ATOM   1424 C  CH2 . TRP A 1 162 ? -3.662  3.965   7.787   1.00 14.00 ? 1841 TRP A CH2 1 
ATOM   1425 N  N   . THR A 1 163 ? -2.052  7.813   14.619  1.00 11.08 ? 1842 THR A N   1 
ATOM   1426 C  CA  . THR A 1 163 ? -2.030  9.221   14.964  1.00 12.87 ? 1842 THR A CA  1 
ATOM   1427 C  C   . THR A 1 163 ? -0.779  9.848   14.380  1.00 11.82 ? 1842 THR A C   1 
ATOM   1428 O  O   . THR A 1 163 ? 0.314   9.266   14.463  1.00 13.19 ? 1842 THR A O   1 
ATOM   1429 C  CB  . THR A 1 163 ? -2.078  9.389   16.496  1.00 14.21 ? 1842 THR A CB  1 
ATOM   1430 O  OG1 . THR A 1 163 ? -3.339  8.892   16.983  1.00 16.37 ? 1842 THR A OG1 1 
ATOM   1431 C  CG2 . THR A 1 163 ? -1.878  10.861  16.935  1.00 15.19 ? 1842 THR A CG2 1 
ATOM   1432 N  N   . ILE A 1 164 ? -0.925  11.033  13.792  1.00 12.38 ? 1843 ILE A N   1 
ATOM   1433 C  CA  . ILE A 1 164 ? 0.195   11.719  13.155  1.00 12.68 ? 1843 ILE A CA  1 
ATOM   1434 C  C   . ILE A 1 164 ? 0.421   13.054  13.866  1.00 12.41 ? 1843 ILE A C   1 
ATOM   1435 O  O   . ILE A 1 164 ? -0.494  13.866  14.010  1.00 15.32 ? 1843 ILE A O   1 
ATOM   1436 C  CB  . ILE A 1 164 ? -0.041  11.939  11.635  1.00 14.57 ? 1843 ILE A CB  1 
ATOM   1437 C  CG1 . ILE A 1 164 ? -0.231  10.593  10.930  1.00 16.76 ? 1843 ILE A CG1 1 
ATOM   1438 C  CG2 . ILE A 1 164 ? 1.131   12.693  10.999  1.00 15.70 ? 1843 ILE A CG2 1 
ATOM   1439 C  CD1 . ILE A 1 164 ? -0.513  10.703  9.455   1.00 20.40 ? 1843 ILE A CD1 1 
ATOM   1440 N  N   . ARG A 1 165 ? 1.644   13.262  14.331  1.00 12.99 ? 1844 ARG A N   1 
ATOM   1441 C  CA  . ARG A 1 165 ? 1.993   14.509  15.005  1.00 13.38 ? 1844 ARG A CA  1 
ATOM   1442 C  C   . ARG A 1 165 ? 3.122   15.180  14.244  1.00 14.06 ? 1844 ARG A C   1 
ATOM   1443 O  O   . ARG A 1 165 ? 3.928   14.506  13.587  1.00 15.32 ? 1844 ARG A O   1 
ATOM   1444 C  CB  . ARG A 1 165 ? 2.405   14.240  16.454  1.00 13.96 ? 1844 ARG A CB  1 
ATOM   1445 C  CG  . ARG A 1 165 ? 1.295   13.652  17.312  1.00 15.91 ? 1844 ARG A CG  1 
ATOM   1446 C  CD  . ARG A 1 165 ? 1.818   13.176  18.646  1.00 15.88 ? 1844 ARG A CD  1 
ATOM   1447 N  NE  . ARG A 1 165 ? 0.768   12.686  19.538  1.00 19.42 ? 1844 ARG A NE  1 
ATOM   1448 C  CZ  . ARG A 1 165 ? 0.426   11.405  19.686  1.00 15.88 ? 1844 ARG A CZ  1 
ATOM   1449 N  NH1 . ARG A 1 165 ? 1.026   10.454  18.982  1.00 18.78 ? 1844 ARG A NH1 1 
ATOM   1450 N  NH2 . ARG A 1 165 ? -0.520  11.077  20.552  1.00 21.82 ? 1844 ARG A NH2 1 
ATOM   1451 N  N   . GLU A 1 166 ? 3.174   16.510  14.336  1.00 13.29 ? 1845 GLU A N   1 
ATOM   1452 C  CA  . GLU A 1 166 ? 4.266   17.263  13.749  1.00 14.09 ? 1845 GLU A CA  1 
ATOM   1453 C  C   . GLU A 1 166 ? 4.895   18.092  14.867  1.00 14.72 ? 1845 GLU A C   1 
ATOM   1454 O  O   . GLU A 1 166 ? 4.179   18.701  15.664  1.00 15.66 ? 1845 GLU A O   1 
ATOM   1455 C  CB  . GLU A 1 166 ? 3.756   18.189  12.632  1.00 16.79 ? 1845 GLU A CB  1 
ATOM   1456 C  CG  . GLU A 1 166 ? 4.887   18.855  11.835  1.00 22.64 ? 1845 GLU A CG  1 
ATOM   1457 C  CD  . GLU A 1 166 ? 4.450   19.403  10.484  1.00 27.44 ? 1845 GLU A CD  1 
ATOM   1458 O  OE1 . GLU A 1 166 ? 3.245   19.664  10.307  1.00 38.16 ? 1845 GLU A OE1 1 
ATOM   1459 O  OE2 . GLU A 1 166 ? 5.315   19.571  9.594   1.00 30.89 ? 1845 GLU A OE2 1 
ATOM   1460 N  N   . PHE A 1 167 ? 6.224   18.072  14.938  1.00 14.39 ? 1846 PHE A N   1 
ATOM   1461 C  CA  . PHE A 1 167 ? 6.970   18.796  15.972  1.00 13.72 ? 1846 PHE A CA  1 
ATOM   1462 C  C   . PHE A 1 167 ? 7.900   19.771  15.284  1.00 15.30 ? 1846 PHE A C   1 
ATOM   1463 O  O   . PHE A 1 167 ? 8.424   19.475  14.210  1.00 17.58 ? 1846 PHE A O   1 
ATOM   1464 C  CB  . PHE A 1 167 ? 7.843   17.830  16.788  1.00 15.73 ? 1846 PHE A CB  1 
ATOM   1465 C  CG  . PHE A 1 167 ? 7.061   16.755  17.485  1.00 16.79 ? 1846 PHE A CG  1 
ATOM   1466 C  CD1 . PHE A 1 167 ? 7.162   15.437  17.079  1.00 20.40 ? 1846 PHE A CD1 1 
ATOM   1467 C  CD2 . PHE A 1 167 ? 6.232   17.060  18.544  1.00 17.70 ? 1846 PHE A CD2 1 
ATOM   1468 C  CE1 . PHE A 1 167 ? 6.439   14.429  17.718  1.00 19.74 ? 1846 PHE A CE1 1 
ATOM   1469 C  CE2 . PHE A 1 167 ? 5.503   16.062  19.174  1.00 17.87 ? 1846 PHE A CE2 1 
ATOM   1470 C  CZ  . PHE A 1 167 ? 5.594   14.744  18.743  1.00 16.16 ? 1846 PHE A CZ  1 
ATOM   1471 N  N   . LYS A 1 168 ? 8.115   20.925  15.918  1.00 13.64 ? 1847 LYS A N   1 
ATOM   1472 C  CA  . LYS A 1 168 ? 9.201   21.801  15.523  1.00 14.98 ? 1847 LYS A CA  1 
ATOM   1473 C  C   . LYS A 1 168 ? 10.282  21.677  16.578  1.00 13.98 ? 1847 LYS A C   1 
ATOM   1474 O  O   . LYS A 1 168 ? 9.989   21.768  17.762  1.00 15.92 ? 1847 LYS A O   1 
ATOM   1475 C  CB  . LYS A 1 168 ? 8.712   23.240  15.514  1.00 18.20 ? 1847 LYS A CB  1 
ATOM   1476 C  CG  . LYS A 1 168 ? 9.736   24.223  14.992  1.00 25.34 ? 1847 LYS A CG  1 
ATOM   1477 C  CD  . LYS A 1 168 ? 9.090   25.575  14.663  1.00 33.11 ? 1847 LYS A CD  1 
ATOM   1478 C  CE  . LYS A 1 168 ? 10.113  26.544  14.092  1.00 40.67 ? 1847 LYS A CE  1 
ATOM   1479 N  NZ  . LYS A 1 168 ? 9.653   27.959  14.207  1.00 48.25 ? 1847 LYS A NZ  1 
ATOM   1480 N  N   . ILE A 1 169 ? 11.520  21.467  16.152  1.00 13.45 ? 1848 ILE A N   1 
ATOM   1481 C  CA  . ILE A 1 169 ? 12.596  21.230  17.107  1.00 15.63 ? 1848 ILE A CA  1 
ATOM   1482 C  C   . ILE A 1 169 ? 13.751  22.163  16.799  1.00 16.32 ? 1848 ILE A C   1 
ATOM   1483 O  O   . ILE A 1 169 ? 14.037  22.465  15.640  1.00 16.32 ? 1848 ILE A O   1 
ATOM   1484 C  CB  . ILE A 1 169 ? 13.067  19.745  17.089  1.00 17.23 ? 1848 ILE A CB  1 
ATOM   1485 C  CG1 . ILE A 1 169 ? 14.122  19.491  18.156  1.00 19.62 ? 1848 ILE A CG1 1 
ATOM   1486 C  CG2 . ILE A 1 169 ? 13.612  19.366  15.733  1.00 20.10 ? 1848 ILE A CG2 1 
ATOM   1487 C  CD1 . ILE A 1 169 ? 14.339  17.997  18.428  1.00 28.37 ? 1848 ILE A CD1 1 
ATOM   1488 N  N   . CYS A 1 170 ? 14.387  22.668  17.842  1.00 20.04 ? 1849 CYS A N   1 
ATOM   1489 C  CA  A CYS A 1 170 ? 15.567  23.484  17.627  0.50 22.30 ? 1849 CYS A CA  1 
ATOM   1490 C  CA  B CYS A 1 170 ? 15.536  23.543  17.667  0.50 20.66 ? 1849 CYS A CA  1 
ATOM   1491 C  C   . CYS A 1 170 ? 16.668  23.161  18.615  1.00 19.81 ? 1849 CYS A C   1 
ATOM   1492 O  O   . CYS A 1 170 ? 16.444  23.047  19.806  1.00 18.70 ? 1849 CYS A O   1 
ATOM   1493 C  CB  A CYS A 1 170 ? 15.232  24.975  17.619  0.50 25.97 ? 1849 CYS A CB  1 
ATOM   1494 C  CB  B CYS A 1 170 ? 15.124  24.986  17.924  0.50 23.51 ? 1849 CYS A CB  1 
ATOM   1495 S  SG  A CYS A 1 170 ? 14.807  25.659  19.220  0.50 36.60 ? 1849 CYS A SG  1 
ATOM   1496 S  SG  B CYS A 1 170 ? 16.425  26.148  17.559  0.50 27.48 ? 1849 CYS A SG  1 
ATOM   1497 N  N   . GLY A 1 171 ? 17.874  22.989  18.083  1.00 23.13 ? 1850 GLY A N   1 
ATOM   1498 C  CA  . GLY A 1 171 ? 19.021  22.628  18.897  1.00 27.01 ? 1850 GLY A CA  1 
ATOM   1499 C  C   . GLY A 1 171 ? 20.215  23.483  18.548  1.00 30.02 ? 1850 GLY A C   1 
ATOM   1500 O  O   . GLY A 1 171 ? 20.056  24.566  17.996  1.00 30.34 ? 1850 GLY A O   1 
ATOM   1501 N  N   . GLU A 1 172 ? 21.405  22.984  18.876  1.00 33.75 ? 1851 GLU A N   1 
ATOM   1502 C  CA  A GLU A 1 172 ? 22.646  23.757  18.789  0.60 36.79 ? 1851 GLU A CA  1 
ATOM   1503 C  CA  B GLU A 1 172 ? 22.626  23.779  18.791  0.40 35.99 ? 1851 GLU A CA  1 
ATOM   1504 C  C   . GLU A 1 172 ? 23.046  24.027  17.343  1.00 37.82 ? 1851 GLU A C   1 
ATOM   1505 O  O   . GLU A 1 172 ? 22.397  24.795  16.632  1.00 40.32 ? 1851 GLU A O   1 
ATOM   1506 C  CB  A GLU A 1 172 ? 23.787  23.013  19.495  0.60 38.54 ? 1851 GLU A CB  1 
ATOM   1507 C  CB  B GLU A 1 172 ? 23.755  23.117  19.588  0.40 37.04 ? 1851 GLU A CB  1 
ATOM   1508 C  CG  A GLU A 1 172 ? 24.921  23.911  19.980  0.60 41.14 ? 1851 GLU A CG  1 
ATOM   1509 C  CG  B GLU A 1 172 ? 23.667  23.383  21.087  0.40 36.21 ? 1851 GLU A CG  1 
ATOM   1510 C  CD  A GLU A 1 172 ? 25.991  24.140  18.926  0.60 44.86 ? 1851 GLU A CD  1 
ATOM   1511 C  CD  B GLU A 1 172 ? 24.475  22.405  21.919  0.40 35.28 ? 1851 GLU A CD  1 
ATOM   1512 O  OE1 A GLU A 1 172 ? 27.149  23.727  19.152  0.60 45.28 ? 1851 GLU A OE1 1 
ATOM   1513 O  OE1 B GLU A 1 172 ? 23.947  21.321  22.250  0.40 26.21 ? 1851 GLU A OE1 1 
ATOM   1514 O  OE2 A GLU A 1 172 ? 25.676  24.737  17.874  0.60 47.77 ? 1851 GLU A OE2 1 
ATOM   1515 O  OE2 B GLU A 1 172 ? 25.635  22.731  22.255  0.40 37.95 ? 1851 GLU A OE2 1 
ATOM   1516 N  N   . HIS A 1 178 ? 16.134  25.142  13.055  1.00 32.23 ? 1857 HIS A N   1 
ATOM   1517 C  CA  . HIS A 1 178 ? 14.815  24.581  13.346  1.00 28.71 ? 1857 HIS A CA  1 
ATOM   1518 C  C   . HIS A 1 178 ? 14.384  23.604  12.266  1.00 26.64 ? 1857 HIS A C   1 
ATOM   1519 O  O   . HIS A 1 178 ? 14.643  23.798  11.074  1.00 29.43 ? 1857 HIS A O   1 
ATOM   1520 C  CB  . HIS A 1 178 ? 13.749  25.668  13.506  1.00 31.28 ? 1857 HIS A CB  1 
ATOM   1521 C  CG  . HIS A 1 178 ? 14.209  26.866  14.281  1.00 37.45 ? 1857 HIS A CG  1 
ATOM   1522 N  ND1 . HIS A 1 178 ? 13.530  27.348  15.380  1.00 44.50 ? 1857 HIS A ND1 1 
ATOM   1523 C  CD2 . HIS A 1 178 ? 15.278  27.683  14.113  1.00 41.81 ? 1857 HIS A CD2 1 
ATOM   1524 C  CE1 . HIS A 1 178 ? 14.159  28.409  15.856  1.00 45.43 ? 1857 HIS A CE1 1 
ATOM   1525 N  NE2 . HIS A 1 178 ? 15.223  28.635  15.104  1.00 41.89 ? 1857 HIS A NE2 1 
ATOM   1526 N  N   . ARG A 1 179 ? 13.728  22.540  12.700  1.00 20.26 ? 1858 ARG A N   1 
ATOM   1527 C  CA  A ARG A 1 179 ? 13.407  21.431  11.814  0.50 18.46 ? 1858 ARG A CA  1 
ATOM   1528 C  CA  B ARG A 1 179 ? 13.416  21.431  11.810  0.50 18.60 ? 1858 ARG A CA  1 
ATOM   1529 C  C   . ARG A 1 179 ? 12.016  20.948  12.138  1.00 17.46 ? 1858 ARG A C   1 
ATOM   1530 O  O   . ARG A 1 179 ? 11.602  20.985  13.298  1.00 18.98 ? 1858 ARG A O   1 
ATOM   1531 C  CB  A ARG A 1 179 ? 14.384  20.286  12.041  0.50 20.57 ? 1858 ARG A CB  1 
ATOM   1532 C  CB  B ARG A 1 179 ? 14.428  20.295  12.004  0.50 20.66 ? 1858 ARG A CB  1 
ATOM   1533 C  CG  A ARG A 1 179 ? 15.817  20.671  11.832  0.50 20.29 ? 1858 ARG A CG  1 
ATOM   1534 C  CG  B ARG A 1 179 ? 15.450  20.167  10.876  0.50 23.26 ? 1858 ARG A CG  1 
ATOM   1535 C  CD  A ARG A 1 179 ? 16.696  19.438  11.862  0.50 24.61 ? 1858 ARG A CD  1 
ATOM   1536 C  CD  B ARG A 1 179 ? 16.669  19.347  11.304  0.50 22.19 ? 1858 ARG A CD  1 
ATOM   1537 N  NE  A ARG A 1 179 ? 18.105  19.794  11.783  0.50 26.28 ? 1858 ARG A NE  1 
ATOM   1538 N  NE  B ARG A 1 179 ? 16.258  18.101  11.931  0.50 18.84 ? 1858 ARG A NE  1 
ATOM   1539 C  CZ  A ARG A 1 179 ? 19.094  18.988  12.144  0.50 22.64 ? 1858 ARG A CZ  1 
ATOM   1540 C  CZ  B ARG A 1 179 ? 17.022  17.359  12.728  0.50 14.28 ? 1858 ARG A CZ  1 
ATOM   1541 N  NH1 A ARG A 1 179 ? 18.823  17.775  12.609  0.50 17.81 ? 1858 ARG A NH1 1 
ATOM   1542 N  NH1 B ARG A 1 179 ? 18.270  17.742  12.991  0.50 10.25 ? 1858 ARG A NH1 1 
ATOM   1543 N  NH2 A ARG A 1 179 ? 20.348  19.400  12.045  0.50 25.09 ? 1858 ARG A NH2 1 
ATOM   1544 N  NH2 B ARG A 1 179 ? 16.523  16.229  13.254  0.50 8.71  ? 1858 ARG A NH2 1 
ATOM   1545 N  N   . LEU A 1 180 ? 11.309  20.488  11.111  1.00 16.73 ? 1859 LEU A N   1 
ATOM   1546 C  CA  A LEU A 1 180 ? 10.012  19.865  11.305  0.70 16.20 ? 1859 LEU A CA  1 
ATOM   1547 C  CA  B LEU A 1 180 ? 10.006  19.855  11.276  0.30 16.44 ? 1859 LEU A CA  1 
ATOM   1548 C  C   . LEU A 1 180 ? 10.176  18.344  11.311  1.00 15.89 ? 1859 LEU A C   1 
ATOM   1549 O  O   . LEU A 1 180 ? 10.831  17.772  10.441  1.00 18.47 ? 1859 LEU A O   1 
ATOM   1550 C  CB  A LEU A 1 180 ? 9.046   20.328  10.206  0.70 18.35 ? 1859 LEU A CB  1 
ATOM   1551 C  CB  B LEU A 1 180 ? 9.095   20.219  10.105  0.30 16.77 ? 1859 LEU A CB  1 
ATOM   1552 C  CG  A LEU A 1 180 ? 8.841   21.850  10.234  0.70 18.76 ? 1859 LEU A CG  1 
ATOM   1553 C  CG  B LEU A 1 180 ? 7.686   19.635  10.199  0.30 15.49 ? 1859 LEU A CG  1 
ATOM   1554 C  CD1 A LEU A 1 180 ? 8.153   22.401  8.988   0.70 22.65 ? 1859 LEU A CD1 1 
ATOM   1555 C  CD1 B LEU A 1 180 ? 6.670   20.771  10.253  0.30 18.90 ? 1859 LEU A CD1 1 
ATOM   1556 C  CD2 A LEU A 1 180 ? 8.123   22.296  11.505  0.70 18.06 ? 1859 LEU A CD2 1 
ATOM   1557 C  CD2 B LEU A 1 180 ? 7.381   18.660  9.052   0.30 16.64 ? 1859 LEU A CD2 1 
ATOM   1558 N  N   . ILE A 1 181 ? 9.589   17.702  12.312  1.00 15.08 ? 1860 ILE A N   1 
ATOM   1559 C  CA  . ILE A 1 181 ? 9.698   16.247  12.450  1.00 15.82 ? 1860 ILE A CA  1 
ATOM   1560 C  C   . ILE A 1 181 ? 8.264   15.724  12.442  1.00 13.25 ? 1860 ILE A C   1 
ATOM   1561 O  O   . ILE A 1 181 ? 7.388   16.329  13.046  1.00 16.37 ? 1860 ILE A O   1 
ATOM   1562 C  CB  . ILE A 1 181 ? 10.340  15.858  13.815  1.00 15.54 ? 1860 ILE A CB  1 
ATOM   1563 C  CG1 . ILE A 1 181 ? 11.839  16.203  13.874  1.00 23.90 ? 1860 ILE A CG1 1 
ATOM   1564 C  CG2 . ILE A 1 181 ? 10.154  14.348  14.098  1.00 20.55 ? 1860 ILE A CG2 1 
ATOM   1565 C  CD1 . ILE A 1 181 ? 12.411  16.749  12.597  1.00 30.31 ? 1860 ILE A CD1 1 
ATOM   1566 N  N   . ARG A 1 182 ? 8.025   14.615  11.754  1.00 11.21 ? 1861 ARG A N   1 
ATOM   1567 C  CA  . ARG A 1 182 ? 6.731   13.969  11.819  1.00 12.34 ? 1861 ARG A CA  1 
ATOM   1568 C  C   . ARG A 1 182 ? 6.828   12.664  12.573  1.00 10.48 ? 1861 ARG A C   1 
ATOM   1569 O  O   . ARG A 1 182 ? 7.863   11.971  12.526  1.00 12.86 ? 1861 ARG A O   1 
ATOM   1570 C  CB  . ARG A 1 182 ? 6.205   13.706  10.423  1.00 14.26 ? 1861 ARG A CB  1 
ATOM   1571 C  CG  . ARG A 1 182 ? 5.768   14.975  9.731   1.00 19.92 ? 1861 ARG A CG  1 
ATOM   1572 C  CD  . ARG A 1 182 ? 4.616   14.730  8.798   1.00 22.79 ? 1861 ARG A CD  1 
ATOM   1573 N  NE  . ARG A 1 182 ? 4.111   15.984  8.246   1.00 21.99 ? 1861 ARG A NE  1 
ATOM   1574 C  CZ  . ARG A 1 182 ? 4.747   16.702  7.324   1.00 26.67 ? 1861 ARG A CZ  1 
ATOM   1575 N  NH1 . ARG A 1 182 ? 5.912   16.289  6.838   1.00 26.59 ? 1861 ARG A NH1 1 
ATOM   1576 N  NH2 . ARG A 1 182 ? 4.208   17.831  6.878   1.00 29.74 ? 1861 ARG A NH2 1 
ATOM   1577 N  N   . HIS A 1 183 ? 5.746   12.332  13.265  1.00 12.57 ? 1862 HIS A N   1 
ATOM   1578 C  CA  . HIS A 1 183 ? 5.737   11.198  14.185  1.00 11.16 ? 1862 HIS A CA  1 
ATOM   1579 C  C   . HIS A 1 183 ? 4.478   10.415  13.861  1.00 10.21 ? 1862 HIS A C   1 
ATOM   1580 O  O   . HIS A 1 183 ? 3.375   10.982  13.835  1.00 12.35 ? 1862 HIS A O   1 
ATOM   1581 C  CB  . HIS A 1 183 ? 5.708   11.745  15.624  1.00 11.65 ? 1862 HIS A CB  1 
ATOM   1582 C  CG  . HIS A 1 183 ? 5.755   10.702  16.697  1.00 10.42 ? 1862 HIS A CG  1 
ATOM   1583 N  ND1 . HIS A 1 183 ? 4.629   10.050  17.151  1.00 14.03 ? 1862 HIS A ND1 1 
ATOM   1584 C  CD2 . HIS A 1 183 ? 6.790   10.240  17.447  1.00 10.52 ? 1862 HIS A CD2 1 
ATOM   1585 C  CE1 . HIS A 1 183 ? 4.967   9.221   18.125  1.00 13.60 ? 1862 HIS A CE1 1 
ATOM   1586 N  NE2 . HIS A 1 183 ? 6.275   9.324   18.328  1.00 12.50 ? 1862 HIS A NE2 1 
ATOM   1587 N  N   . PHE A 1 184 ? 4.663   9.137   13.538  1.00 9.84  ? 1863 PHE A N   1 
ATOM   1588 C  CA  . PHE A 1 184 ? 3.595   8.265   13.057  1.00 9.35  ? 1863 PHE A CA  1 
ATOM   1589 C  C   . PHE A 1 184 ? 3.385   7.160   14.073  1.00 8.55  ? 1863 PHE A C   1 
ATOM   1590 O  O   . PHE A 1 184 ? 4.266   6.300   14.244  1.00 9.72  ? 1863 PHE A O   1 
ATOM   1591 C  CB  . PHE A 1 184 ? 4.003   7.637   11.724  1.00 10.63 ? 1863 PHE A CB  1 
ATOM   1592 C  CG  . PHE A 1 184 ? 4.342   8.653   10.674  1.00 9.14  ? 1863 PHE A CG  1 
ATOM   1593 C  CD1 . PHE A 1 184 ? 5.633   9.134   10.551  1.00 11.94 ? 1863 PHE A CD1 1 
ATOM   1594 C  CD2 . PHE A 1 184 ? 3.348   9.168   9.849   1.00 13.71 ? 1863 PHE A CD2 1 
ATOM   1595 C  CE1 . PHE A 1 184 ? 5.939   10.110  9.615   1.00 13.03 ? 1863 PHE A CE1 1 
ATOM   1596 C  CE2 . PHE A 1 184 ? 3.645   10.142  8.901   1.00 15.33 ? 1863 PHE A CE2 1 
ATOM   1597 C  CZ  . PHE A 1 184 ? 4.942   10.606  8.772   1.00 14.36 ? 1863 PHE A CZ  1 
ATOM   1598 N  N   . HIS A 1 185 ? 2.232   7.190   14.737  1.00 8.68  ? 1864 HIS A N   1 
ATOM   1599 C  CA  . HIS A 1 185 ? 1.970   6.314   15.871  1.00 9.12  ? 1864 HIS A CA  1 
ATOM   1600 C  C   . HIS A 1 185 ? 0.853   5.350   15.503  1.00 9.92  ? 1864 HIS A C   1 
ATOM   1601 O  O   . HIS A 1 185 ? -0.309  5.753   15.361  1.00 10.53 ? 1864 HIS A O   1 
ATOM   1602 C  CB  . HIS A 1 185 ? 1.588   7.148   17.085  1.00 11.07 ? 1864 HIS A CB  1 
ATOM   1603 C  CG  . HIS A 1 185 ? 1.396   6.352   18.331  1.00 12.30 ? 1864 HIS A CG  1 
ATOM   1604 N  ND1 . HIS A 1 185 ? 0.812   6.883   19.461  1.00 17.51 ? 1864 HIS A ND1 1 
ATOM   1605 C  CD2 . HIS A 1 185 ? 1.728   5.074   18.640  1.00 11.67 ? 1864 HIS A CD2 1 
ATOM   1606 C  CE1 . HIS A 1 185 ? 0.787   5.964   20.411  1.00 19.27 ? 1864 HIS A CE1 1 
ATOM   1607 N  NE2 . HIS A 1 185 ? 1.341   4.860   19.938  1.00 14.62 ? 1864 HIS A NE2 1 
ATOM   1608 N  N   . TYR A 1 186 ? 1.211   4.093   15.262  1.00 10.12 ? 1865 TYR A N   1 
ATOM   1609 C  CA  . TYR A 1 186 ? 0.215   3.066   14.930  1.00 8.59  ? 1865 TYR A CA  1 
ATOM   1610 C  C   . TYR A 1 186 ? -0.434  2.585   16.192  1.00 11.63 ? 1865 TYR A C   1 
ATOM   1611 O  O   . TYR A 1 186 ? 0.260   2.193   17.138  1.00 12.21 ? 1865 TYR A O   1 
ATOM   1612 C  CB  . TYR A 1 186 ? 0.931   1.913   14.259  1.00 10.25 ? 1865 TYR A CB  1 
ATOM   1613 C  CG  . TYR A 1 186 ? 0.097   0.757   13.788  1.00 9.18  ? 1865 TYR A CG  1 
ATOM   1614 C  CD1 . TYR A 1 186 ? -0.639  0.818   12.607  1.00 12.07 ? 1865 TYR A CD1 1 
ATOM   1615 C  CD2 . TYR A 1 186 ? 0.152   -0.456  14.467  1.00 12.15 ? 1865 TYR A CD2 1 
ATOM   1616 C  CE1 . TYR A 1 186 ? -1.365  -0.316  12.157  1.00 12.75 ? 1865 TYR A CE1 1 
ATOM   1617 C  CE2 . TYR A 1 186 ? -0.543  -1.584  14.015  1.00 13.38 ? 1865 TYR A CE2 1 
ATOM   1618 C  CZ  . TYR A 1 186 ? -1.284  -1.516  12.873  1.00 12.73 ? 1865 TYR A CZ  1 
ATOM   1619 O  OH  . TYR A 1 186 ? -1.934  -2.672  12.451  1.00 16.09 ? 1865 TYR A OH  1 
ATOM   1620 N  N   . THR A 1 187 ? -1.765  2.592   16.221  1.00 10.97 ? 1866 THR A N   1 
ATOM   1621 C  CA  . THR A 1 187 ? -2.466  2.455   17.485  1.00 12.57 ? 1866 THR A CA  1 
ATOM   1622 C  C   . THR A 1 187 ? -3.397  1.241   17.558  1.00 13.37 ? 1866 THR A C   1 
ATOM   1623 O  O   . THR A 1 187 ? -4.239  1.135   18.464  1.00 18.76 ? 1866 THR A O   1 
ATOM   1624 C  CB  . THR A 1 187 ? -3.275  3.726   17.795  1.00 13.10 ? 1866 THR A CB  1 
ATOM   1625 O  OG1 . THR A 1 187 ? -4.204  3.953   16.733  1.00 14.70 ? 1866 THR A OG1 1 
ATOM   1626 C  CG2 . THR A 1 187 ? -2.336  4.932   17.891  1.00 13.56 ? 1866 THR A CG2 1 
ATOM   1627 N  N   . VAL A 1 188 ? -3.256  0.317   16.623  1.00 11.69 ? 1867 VAL A N   1 
ATOM   1628 C  CA  . VAL A 1 188 ? -4.058  -0.898  16.695  1.00 12.25 ? 1867 VAL A CA  1 
ATOM   1629 C  C   . VAL A 1 188 ? -3.251  -2.180  16.719  1.00 13.28 ? 1867 VAL A C   1 
ATOM   1630 O  O   . VAL A 1 188 ? -3.748  -3.232  16.356  1.00 17.21 ? 1867 VAL A O   1 
ATOM   1631 C  CB  . VAL A 1 188 ? -5.122  -0.950  15.591  1.00 13.77 ? 1867 VAL A CB  1 
ATOM   1632 C  CG1 . VAL A 1 188 ? -6.163  0.135   15.825  1.00 15.29 ? 1867 VAL A CG1 1 
ATOM   1633 C  CG2 . VAL A 1 188 ? -4.493  -0.832  14.202  1.00 13.55 ? 1867 VAL A CG2 1 
ATOM   1634 N  N   . TRP A 1 189 ? -2.010  -2.114  17.181  1.00 10.80 ? 1868 TRP A N   1 
ATOM   1635 C  CA  . TRP A 1 189 ? -1.264  -3.357  17.360  1.00 11.99 ? 1868 TRP A CA  1 
ATOM   1636 C  C   . TRP A 1 189 ? -1.725  -3.996  18.661  1.00 11.62 ? 1868 TRP A C   1 
ATOM   1637 O  O   . TRP A 1 189 ? -1.708  -3.341  19.700  1.00 13.11 ? 1868 TRP A O   1 
ATOM   1638 C  CB  . TRP A 1 189 ? 0.244   -3.091  17.418  1.00 11.13 ? 1868 TRP A CB  1 
ATOM   1639 C  CG  . TRP A 1 189 ? 1.042   -4.282  16.973  1.00 10.97 ? 1868 TRP A CG  1 
ATOM   1640 C  CD1 . TRP A 1 189 ? 1.012   -5.527  17.526  1.00 15.45 ? 1868 TRP A CD1 1 
ATOM   1641 C  CD2 . TRP A 1 189 ? 1.970   -4.349  15.882  1.00 11.93 ? 1868 TRP A CD2 1 
ATOM   1642 N  NE1 . TRP A 1 189 ? 1.867   -6.364  16.850  1.00 14.20 ? 1868 TRP A NE1 1 
ATOM   1643 C  CE2 . TRP A 1 189 ? 2.462   -5.666  15.834  1.00 12.85 ? 1868 TRP A CE2 1 
ATOM   1644 C  CE3 . TRP A 1 189 ? 2.449   -3.415  14.951  1.00 14.17 ? 1868 TRP A CE3 1 
ATOM   1645 C  CZ2 . TRP A 1 189 ? 3.412   -6.080  14.893  1.00 14.61 ? 1868 TRP A CZ2 1 
ATOM   1646 C  CZ3 . TRP A 1 189 ? 3.386   -3.831  14.015  1.00 14.78 ? 1868 TRP A CZ3 1 
ATOM   1647 C  CH2 . TRP A 1 189 ? 3.851   -5.159  13.995  1.00 15.60 ? 1868 TRP A CH2 1 
ATOM   1648 N  N   . PRO A 1 190 ? -2.199  -5.261  18.605  1.00 12.02 ? 1869 PRO A N   1 
ATOM   1649 C  CA  . PRO A 1 190 ? -2.642  -5.885  19.854  1.00 12.54 ? 1869 PRO A CA  1 
ATOM   1650 C  C   . PRO A 1 190 ? -1.519  -6.049  20.883  1.00 13.18 ? 1869 PRO A C   1 
ATOM   1651 O  O   . PRO A 1 190 ? -0.331  -6.049  20.528  1.00 15.48 ? 1869 PRO A O   1 
ATOM   1652 C  CB  . PRO A 1 190 ? -3.183  -7.258  19.411  1.00 14.23 ? 1869 PRO A CB  1 
ATOM   1653 C  CG  . PRO A 1 190 ? -3.474  -7.123  17.943  1.00 16.85 ? 1869 PRO A CG  1 
ATOM   1654 C  CD  . PRO A 1 190 ? -2.440  -6.120  17.434  1.00 13.37 ? 1869 PRO A CD  1 
ATOM   1655 N  N   . ASP A 1 191 ? -1.889  -6.239  22.151  1.00 12.70 ? 1870 ASP A N   1 
ATOM   1656 C  CA  . ASP A 1 191 ? -0.891  -6.365  23.218  1.00 15.79 ? 1870 ASP A CA  1 
ATOM   1657 C  C   . ASP A 1 191 ? 0.001   -7.575  22.994  1.00 17.07 ? 1870 ASP A C   1 
ATOM   1658 O  O   . ASP A 1 191 ? 1.192   -7.556  23.331  1.00 18.72 ? 1870 ASP A O   1 
ATOM   1659 C  CB  . ASP A 1 191 ? -1.579  -6.480  24.579  1.00 17.93 ? 1870 ASP A CB  1 
ATOM   1660 C  CG  . ASP A 1 191 ? -2.257  -5.196  24.996  1.00 17.01 ? 1870 ASP A CG  1 
ATOM   1661 O  OD1 . ASP A 1 191 ? -1.938  -4.130  24.407  1.00 20.07 ? 1870 ASP A OD1 1 
ATOM   1662 O  OD2 . ASP A 1 191 ? -3.098  -5.244  25.922  1.00 20.20 ? 1870 ASP A OD2 1 
ATOM   1663 N  N   . HIS A 1 192 ? -0.571  -8.632  22.427  1.00 14.59 ? 1871 HIS A N   1 
ATOM   1664 C  CA  . HIS A 1 192 ? 0.181   -9.823  22.097  1.00 17.57 ? 1871 HIS A CA  1 
ATOM   1665 C  C   . HIS A 1 192 ? -0.163  -10.256 20.682  1.00 15.48 ? 1871 HIS A C   1 
ATOM   1666 O  O   . HIS A 1 192 ? -1.259  -9.988  20.191  1.00 17.76 ? 1871 HIS A O   1 
ATOM   1667 C  CB  . HIS A 1 192 ? -0.077  -10.942 23.112  1.00 16.69 ? 1871 HIS A CB  1 
ATOM   1668 C  CG  . HIS A 1 192 ? 0.349   -10.589 24.506  1.00 19.24 ? 1871 HIS A CG  1 
ATOM   1669 N  ND1 . HIS A 1 192 ? -0.506  -10.014 25.422  1.00 20.11 ? 1871 HIS A ND1 1 
ATOM   1670 C  CD2 . HIS A 1 192 ? 1.550   -10.696 25.125  1.00 24.94 ? 1871 HIS A CD2 1 
ATOM   1671 C  CE1 . HIS A 1 192 ? 0.146   -9.796  26.551  1.00 21.52 ? 1871 HIS A CE1 1 
ATOM   1672 N  NE2 . HIS A 1 192 ? 1.396   -10.197 26.396  1.00 24.63 ? 1871 HIS A NE2 1 
ATOM   1673 N  N   . GLY A 1 193 ? 0.791   -10.896 20.026  1.00 17.03 ? 1872 GLY A N   1 
ATOM   1674 C  CA  . GLY A 1 193 ? 0.597   -11.373 18.670  1.00 17.18 ? 1872 GLY A CA  1 
ATOM   1675 C  C   . GLY A 1 193 ? 0.574   -10.265 17.640  1.00 17.69 ? 1872 GLY A C   1 
ATOM   1676 O  O   . GLY A 1 193 ? 0.994   -9.130  17.914  1.00 19.85 ? 1872 GLY A O   1 
ATOM   1677 N  N   . VAL A 1 194 ? 0.096   -10.607 16.449  1.00 15.68 ? 1873 VAL A N   1 
ATOM   1678 C  CA  . VAL A 1 194 ? 0.149   -9.728  15.291  1.00 16.38 ? 1873 VAL A CA  1 
ATOM   1679 C  C   . VAL A 1 194 ? -1.160  -9.010  15.074  1.00 17.92 ? 1873 VAL A C   1 
ATOM   1680 O  O   . VAL A 1 194 ? -2.199  -9.421  15.613  1.00 17.66 ? 1873 VAL A O   1 
ATOM   1681 C  CB  . VAL A 1 194 ? 0.549   -10.458 13.979  1.00 15.49 ? 1873 VAL A CB  1 
ATOM   1682 C  CG1 . VAL A 1 194 ? 1.980   -11.014 14.093  1.00 18.49 ? 1873 VAL A CG1 1 
ATOM   1683 C  CG2 . VAL A 1 194 ? -0.433  -11.559 13.625  1.00 18.18 ? 1873 VAL A CG2 1 
ATOM   1684 N  N   . PRO A 1 195 ? -1.115  -7.918  14.291  1.00 15.96 ? 1874 PRO A N   1 
ATOM   1685 C  CA  . PRO A 1 195 ? -2.349  -7.195  14.067  1.00 20.62 ? 1874 PRO A CA  1 
ATOM   1686 C  C   . PRO A 1 195 ? -3.445  -8.074  13.469  1.00 17.87 ? 1874 PRO A C   1 
ATOM   1687 O  O   . PRO A 1 195 ? -3.174  -9.129  12.821  1.00 19.15 ? 1874 PRO A O   1 
ATOM   1688 C  CB  . PRO A 1 195 ? -1.933  -6.068  13.117  1.00 16.86 ? 1874 PRO A CB  1 
ATOM   1689 C  CG  . PRO A 1 195 ? -0.453  -5.897  13.340  1.00 18.20 ? 1874 PRO A CG  1 
ATOM   1690 C  CD  . PRO A 1 195 ? 0.031   -7.291  13.610  1.00 18.26 ? 1874 PRO A CD  1 
ATOM   1691 N  N   . GLU A 1 196 ? -4.683  -7.641  13.682  1.00 20.27 ? 1875 GLU A N   1 
ATOM   1692 C  CA  A GLU A 1 196 ? -5.803  -8.523  13.441  0.60 21.08 ? 1875 GLU A CA  1 
ATOM   1693 C  CA  B GLU A 1 196 ? -5.870  -8.448  13.422  0.40 21.79 ? 1875 GLU A CA  1 
ATOM   1694 C  C   . GLU A 1 196 ? -6.206  -8.510  11.945  1.00 21.93 ? 1875 GLU A C   1 
ATOM   1695 O  O   . GLU A 1 196 ? -6.957  -9.372  11.503  1.00 24.72 ? 1875 GLU A O   1 
ATOM   1696 C  CB  A GLU A 1 196 ? -6.984  -8.209  14.400  0.60 20.76 ? 1875 GLU A CB  1 
ATOM   1697 C  CB  B GLU A 1 196 ? -7.067  -7.846  14.158  0.40 22.07 ? 1875 GLU A CB  1 
ATOM   1698 C  CG  A GLU A 1 196 ? -6.615  -7.609  15.816  0.60 25.54 ? 1875 GLU A CG  1 
ATOM   1699 C  CG  B GLU A 1 196 ? -7.099  -8.176  15.623  0.40 24.62 ? 1875 GLU A CG  1 
ATOM   1700 C  CD  A GLU A 1 196 ? -6.909  -8.567  17.004  0.60 27.19 ? 1875 GLU A CD  1 
ATOM   1701 C  CD  B GLU A 1 196 ? -6.520  -9.541  15.897  0.40 19.98 ? 1875 GLU A CD  1 
ATOM   1702 O  OE1 A GLU A 1 196 ? -7.052  -9.776  16.733  0.60 32.61 ? 1875 GLU A OE1 1 
ATOM   1703 O  OE1 B GLU A 1 196 ? -6.859  -10.491 15.149  0.40 21.62 ? 1875 GLU A OE1 1 
ATOM   1704 O  OE2 A GLU A 1 196 ? -7.001  -8.126  18.199  0.60 13.55 ? 1875 GLU A OE2 1 
ATOM   1705 O  OE2 B GLU A 1 196 ? -5.720  -9.663  16.849  0.40 29.80 ? 1875 GLU A OE2 1 
ATOM   1706 N  N   . THR A 1 197 ? -5.682  -7.555  11.177  1.00 20.36 ? 1876 THR A N   1 
ATOM   1707 C  CA  . THR A 1 197 ? -5.842  -7.541  9.713   1.00 19.01 ? 1876 THR A CA  1 
ATOM   1708 C  C   . THR A 1 197 ? -4.492  -7.227  9.069   1.00 16.94 ? 1876 THR A C   1 
ATOM   1709 O  O   . THR A 1 197 ? -3.657  -6.611  9.716   1.00 16.77 ? 1876 THR A O   1 
ATOM   1710 C  CB  . THR A 1 197 ? -6.874  -6.455  9.263   1.00 18.83 ? 1876 THR A CB  1 
ATOM   1711 O  OG1 . THR A 1 197 ? -6.338  -5.139  9.492   1.00 20.21 ? 1876 THR A OG1 1 
ATOM   1712 C  CG2 . THR A 1 197 ? -8.204  -6.622  10.015  1.00 22.68 ? 1876 THR A CG2 1 
ATOM   1713 N  N   . THR A 1 198 ? -4.287  -7.580  7.802   1.00 16.65 ? 1877 THR A N   1 
ATOM   1714 C  CA  . THR A 1 198 ? -3.089  -7.100  7.078   1.00 17.35 ? 1877 THR A CA  1 
ATOM   1715 C  C   . THR A 1 198 ? -3.245  -5.646  6.618   1.00 15.62 ? 1877 THR A C   1 
ATOM   1716 O  O   . THR A 1 198 ? -2.270  -4.879  6.551   1.00 16.01 ? 1877 THR A O   1 
ATOM   1717 C  CB  . THR A 1 198 ? -2.769  -7.957  5.839   1.00 16.30 ? 1877 THR A CB  1 
ATOM   1718 O  OG1 . THR A 1 198 ? -3.897  -7.944  4.951   1.00 18.64 ? 1877 THR A OG1 1 
ATOM   1719 C  CG2 . THR A 1 198 ? -2.463  -9.406  6.250   1.00 18.65 ? 1877 THR A CG2 1 
ATOM   1720 N  N   . GLN A 1 199 ? -4.469  -5.258  6.290   1.00 15.68 ? 1878 GLN A N   1 
ATOM   1721 C  CA  A GLN A 1 199 ? -4.682  -3.971  5.642   0.60 15.02 ? 1878 GLN A CA  1 
ATOM   1722 C  CA  B GLN A 1 199 ? -4.720  -3.980  5.648   0.40 16.38 ? 1878 GLN A CA  1 
ATOM   1723 C  C   . GLN A 1 199 ? -4.220  -2.816  6.507   1.00 14.32 ? 1878 GLN A C   1 
ATOM   1724 O  O   . GLN A 1 199 ? -3.693  -1.830  5.991   1.00 14.29 ? 1878 GLN A O   1 
ATOM   1725 C  CB  A GLN A 1 199 ? -6.145  -3.762  5.230   0.60 16.40 ? 1878 GLN A CB  1 
ATOM   1726 C  CB  B GLN A 1 199 ? -6.218  -3.831  5.335   0.40 18.28 ? 1878 GLN A CB  1 
ATOM   1727 C  CG  A GLN A 1 199 ? -7.171  -3.756  6.392   0.60 21.03 ? 1878 GLN A CG  1 
ATOM   1728 C  CG  B GLN A 1 199 ? -7.153  -4.562  6.321   0.40 24.18 ? 1878 GLN A CG  1 
ATOM   1729 C  CD  A GLN A 1 199 ? -7.279  -2.431  7.158   0.60 20.10 ? 1878 GLN A CD  1 
ATOM   1730 C  CD  B GLN A 1 199 ? -8.609  -4.615  5.855   0.40 27.95 ? 1878 GLN A CD  1 
ATOM   1731 O  OE1 A GLN A 1 199 ? -6.993  -1.347  6.632   0.60 22.82 ? 1878 GLN A OE1 1 
ATOM   1732 O  OE1 B GLN A 1 199 ? -9.271  -5.661  5.938   0.40 24.20 ? 1878 GLN A OE1 1 
ATOM   1733 N  NE2 A GLN A 1 199 ? -7.714  -2.523  8.413   0.60 16.99 ? 1878 GLN A NE2 1 
ATOM   1734 N  NE2 B GLN A 1 199 ? -9.115  -3.483  5.372   0.40 31.43 ? 1878 GLN A NE2 1 
ATOM   1735 N  N   . SER A 1 200 ? -4.400  -2.928  7.819   1.00 14.79 ? 1879 SER A N   1 
ATOM   1736 C  CA  A SER A 1 200 ? -4.065  -1.835  8.728   0.50 15.62 ? 1879 SER A CA  1 
ATOM   1737 C  CA  B SER A 1 200 ? -4.067  -1.806  8.699   0.50 13.64 ? 1879 SER A CA  1 
ATOM   1738 C  C   . SER A 1 200 ? -2.583  -1.488  8.643   1.00 13.30 ? 1879 SER A C   1 
ATOM   1739 O  O   . SER A 1 200 ? -2.200  -0.314  8.495   1.00 14.55 ? 1879 SER A O   1 
ATOM   1740 C  CB  A SER A 1 200 ? -4.421  -2.219  10.164  0.50 17.71 ? 1879 SER A CB  1 
ATOM   1741 C  CB  B SER A 1 200 ? -4.558  -1.997  10.149  0.50 13.55 ? 1879 SER A CB  1 
ATOM   1742 O  OG  A SER A 1 200 ? -4.289  -1.112  11.026  0.50 22.03 ? 1879 SER A OG  1 
ATOM   1743 O  OG  B SER A 1 200 ? -3.916  -3.076  10.817  0.50 9.89  ? 1879 SER A OG  1 
ATOM   1744 N  N   . LEU A 1 201 ? -1.744  -2.514  8.760   1.00 14.36 ? 1880 LEU A N   1 
ATOM   1745 C  CA  . LEU A 1 201 ? -0.304  -2.259  8.754   1.00 13.24 ? 1880 LEU A CA  1 
ATOM   1746 C  C   . LEU A 1 201 ? 0.191   -1.912  7.347   1.00 11.76 ? 1880 LEU A C   1 
ATOM   1747 O  O   . LEU A 1 201 ? 1.076   -1.067  7.178   1.00 12.26 ? 1880 LEU A O   1 
ATOM   1748 C  CB  . LEU A 1 201 ? 0.503   -3.395  9.398   1.00 14.58 ? 1880 LEU A CB  1 
ATOM   1749 C  CG  . LEU A 1 201 ? 1.941   -2.966  9.714   1.00 13.53 ? 1880 LEU A CG  1 
ATOM   1750 C  CD1 . LEU A 1 201 ? 1.939   -1.958  10.840  1.00 12.92 ? 1880 LEU A CD1 1 
ATOM   1751 C  CD2 . LEU A 1 201 ? 2.789   -4.190  10.114  1.00 14.50 ? 1880 LEU A CD2 1 
ATOM   1752 N  N   . ILE A 1 202 ? -0.395  -2.532  6.332   1.00 11.76 ? 1881 ILE A N   1 
ATOM   1753 C  CA  . ILE A 1 202 ? -0.025  -2.182  4.961   1.00 11.65 ? 1881 ILE A CA  1 
ATOM   1754 C  C   . ILE A 1 202 ? -0.289  -0.701  4.709   1.00 11.67 ? 1881 ILE A C   1 
ATOM   1755 O  O   . ILE A 1 202 ? 0.572   0.017   4.188   1.00 11.88 ? 1881 ILE A O   1 
ATOM   1756 C  CB  . ILE A 1 202 ? -0.798  -3.026  3.917   1.00 12.01 ? 1881 ILE A CB  1 
ATOM   1757 C  CG1 . ILE A 1 202 ? -0.366  -4.487  3.971   1.00 13.33 ? 1881 ILE A CG1 1 
ATOM   1758 C  CG2 . ILE A 1 202 ? -0.659  -2.451  2.497   1.00 14.26 ? 1881 ILE A CG2 1 
ATOM   1759 C  CD1 . ILE A 1 202 ? -1.338  -5.416  3.286   1.00 15.31 ? 1881 ILE A CD1 1 
ATOM   1760 N  N   . GLN A 1 203 ? -1.487  -0.237  5.058   1.00 12.05 ? 1882 GLN A N   1 
ATOM   1761 C  CA  . GLN A 1 203 ? -1.815  1.155   4.799   1.00 10.92 ? 1882 GLN A CA  1 
ATOM   1762 C  C   . GLN A 1 203 ? -0.959  2.116   5.644   1.00 9.85  ? 1882 GLN A C   1 
ATOM   1763 O  O   . GLN A 1 203 ? -0.545  3.181   5.173   1.00 12.31 ? 1882 GLN A O   1 
ATOM   1764 C  CB  . GLN A 1 203 ? -3.313  1.367   4.986   1.00 12.64 ? 1882 GLN A CB  1 
ATOM   1765 C  CG  . GLN A 1 203 ? -4.106  0.627   3.897   1.00 16.97 ? 1882 GLN A CG  1 
ATOM   1766 C  CD  . GLN A 1 203 ? -3.588  0.987   2.499   1.00 25.03 ? 1882 GLN A CD  1 
ATOM   1767 O  OE1 . GLN A 1 203 ? -3.475  2.165   2.159   1.00 32.43 ? 1882 GLN A OE1 1 
ATOM   1768 N  NE2 . GLN A 1 203 ? -3.248  -0.023  1.702   1.00 28.50 ? 1882 GLN A NE2 1 
ATOM   1769 N  N   . PHE A 1 204 ? -0.639  1.715   6.870   1.00 10.02 ? 1883 PHE A N   1 
ATOM   1770 C  CA  . PHE A 1 204 ? 0.221   2.544   7.714   1.00 9.94  ? 1883 PHE A CA  1 
ATOM   1771 C  C   . PHE A 1 204 ? 1.620   2.664   7.080   1.00 8.96  ? 1883 PHE A C   1 
ATOM   1772 O  O   . PHE A 1 204 ? 2.190   3.768   6.958   1.00 10.32 ? 1883 PHE A O   1 
ATOM   1773 C  CB  . PHE A 1 204 ? 0.316   1.922   9.098   1.00 9.91  ? 1883 PHE A CB  1 
ATOM   1774 C  CG  . PHE A 1 204 ? 1.198   2.684   10.035  1.00 8.76  ? 1883 PHE A CG  1 
ATOM   1775 C  CD1 . PHE A 1 204 ? 0.798   3.922   10.532  1.00 9.99  ? 1883 PHE A CD1 1 
ATOM   1776 C  CD2 . PHE A 1 204 ? 2.412   2.150   10.456  1.00 9.49  ? 1883 PHE A CD2 1 
ATOM   1777 C  CE1 . PHE A 1 204 ? 1.615   4.621   11.415  1.00 9.86  ? 1883 PHE A CE1 1 
ATOM   1778 C  CE2 . PHE A 1 204 ? 3.219   2.837   11.332  1.00 10.05 ? 1883 PHE A CE2 1 
ATOM   1779 C  CZ  . PHE A 1 204 ? 2.828   4.064   11.813  1.00 9.63  ? 1883 PHE A CZ  1 
ATOM   1780 N  N   . VAL A 1 205 ? 2.169   1.521   6.670   1.00 9.44  ? 1884 VAL A N   1 
ATOM   1781 C  CA  . VAL A 1 205 ? 3.502   1.513   6.041   1.00 8.61  ? 1884 VAL A CA  1 
ATOM   1782 C  C   . VAL A 1 205 ? 3.489   2.359   4.768   1.00 9.89  ? 1884 VAL A C   1 
ATOM   1783 O  O   . VAL A 1 205 ? 4.410   3.155   4.530   1.00 10.98 ? 1884 VAL A O   1 
ATOM   1784 C  CB  . VAL A 1 205 ? 3.954   0.081   5.728   1.00 9.51  ? 1884 VAL A CB  1 
ATOM   1785 C  CG1 . VAL A 1 205 ? 5.185   0.077   4.784   1.00 12.01 ? 1884 VAL A CG1 1 
ATOM   1786 C  CG2 . VAL A 1 205 ? 4.263   -0.659  7.042   1.00 11.02 ? 1884 VAL A CG2 1 
ATOM   1787 N  N   . ARG A 1 206 ? 2.441   2.214   3.954   1.00 9.84  ? 1885 ARG A N   1 
ATOM   1788 C  CA  . ARG A 1 206 ? 2.385   3.025   2.728   1.00 11.02 ? 1885 ARG A CA  1 
ATOM   1789 C  C   . ARG A 1 206 ? 2.398   4.527   3.014   1.00 11.94 ? 1885 ARG A C   1 
ATOM   1790 O  O   . ARG A 1 206 ? 3.046   5.313   2.288   1.00 13.85 ? 1885 ARG A O   1 
ATOM   1791 C  CB  . ARG A 1 206 ? 1.181   2.642   1.873   1.00 13.48 ? 1885 ARG A CB  1 
ATOM   1792 C  CG  . ARG A 1 206 ? 1.437   1.328   1.161   1.00 16.75 ? 1885 ARG A CG  1 
ATOM   1793 C  CD  . ARG A 1 206 ? 0.225   0.832   0.403   1.00 20.10 ? 1885 ARG A CD  1 
ATOM   1794 N  NE  . ARG A 1 206 ? 0.608   -0.258  -0.489  1.00 23.81 ? 1885 ARG A NE  1 
ATOM   1795 C  CZ  . ARG A 1 206 ? -0.256  -1.098  -1.049  1.00 27.52 ? 1885 ARG A CZ  1 
ATOM   1796 N  NH1 . ARG A 1 206 ? -1.555  -0.980  -0.798  1.00 24.90 ? 1885 ARG A NH1 1 
ATOM   1797 N  NH2 . ARG A 1 206 ? 0.181   -2.050  -1.856  1.00 30.45 ? 1885 ARG A NH2 1 
ATOM   1798 N  N   . THR A 1 207 ? 1.644   4.920   4.035   1.00 11.32 ? 1886 THR A N   1 
ATOM   1799 C  CA  . THR A 1 207 ? 1.548   6.315   4.445   1.00 13.13 ? 1886 THR A CA  1 
ATOM   1800 C  C   . THR A 1 207 ? 2.931   6.806   4.874   1.00 11.16 ? 1886 THR A C   1 
ATOM   1801 O  O   . THR A 1 207 ? 3.416   7.835   4.401   1.00 12.77 ? 1886 THR A O   1 
ATOM   1802 C  CB  . THR A 1 207 ? 0.539   6.447   5.591   1.00 13.37 ? 1886 THR A CB  1 
ATOM   1803 O  OG1 . THR A 1 207 ? -0.727  5.953   5.127   1.00 16.64 ? 1886 THR A OG1 1 
ATOM   1804 C  CG2 . THR A 1 207 ? 0.397   7.879   6.029   1.00 17.65 ? 1886 THR A CG2 1 
ATOM   1805 N  N   . VAL A 1 208 ? 3.581   6.054   5.756   1.00 10.30 ? 1887 VAL A N   1 
ATOM   1806 C  CA  . VAL A 1 208 ? 4.888   6.497   6.243   1.00 9.87  ? 1887 VAL A CA  1 
ATOM   1807 C  C   . VAL A 1 208 ? 5.873   6.569   5.073   1.00 10.33 ? 1887 VAL A C   1 
ATOM   1808 O  O   . VAL A 1 208 ? 6.658   7.522   4.967   1.00 11.61 ? 1887 VAL A O   1 
ATOM   1809 C  CB  . VAL A 1 208 ? 5.428   5.555   7.338   1.00 11.02 ? 1887 VAL A CB  1 
ATOM   1810 C  CG1 . VAL A 1 208 ? 6.841   5.976   7.727   1.00 11.05 ? 1887 VAL A CG1 1 
ATOM   1811 C  CG2 . VAL A 1 208 ? 4.515   5.578   8.561   1.00 12.01 ? 1887 VAL A CG2 1 
ATOM   1812 N  N   . ARG A 1 209 ? 5.853   5.562   4.197   1.00 10.24 ? 1888 ARG A N   1 
ATOM   1813 C  CA  . ARG A 1 209 ? 6.821   5.526   3.099   1.00 10.99 ? 1888 ARG A CA  1 
ATOM   1814 C  C   . ARG A 1 209 ? 6.610   6.750   2.174   1.00 10.95 ? 1888 ARG A C   1 
ATOM   1815 O  O   . ARG A 1 209 ? 7.546   7.330   1.665   1.00 12.58 ? 1888 ARG A O   1 
ATOM   1816 C  CB  . ARG A 1 209 ? 6.690   4.185   2.346   1.00 12.35 ? 1888 ARG A CB  1 
ATOM   1817 C  CG  . ARG A 1 209 ? 7.379   4.072   0.994   1.00 13.91 ? 1888 ARG A CG  1 
ATOM   1818 C  CD  . ARG A 1 209 ? 8.867   4.518   0.976   1.00 13.24 ? 1888 ARG A CD  1 
ATOM   1819 N  NE  . ARG A 1 209 ? 9.688   3.892   2.012   1.00 13.95 ? 1888 ARG A NE  1 
ATOM   1820 C  CZ  . ARG A 1 209 ? 10.955  4.248   2.231   1.00 13.75 ? 1888 ARG A CZ  1 
ATOM   1821 N  NH1 . ARG A 1 209 ? 11.517  5.192   1.470   1.00 15.15 ? 1888 ARG A NH1 1 
ATOM   1822 N  NH2 . ARG A 1 209 ? 11.663  3.667   3.191   1.00 13.65 ? 1888 ARG A NH2 1 
ATOM   1823 N  N   . ASP A 1 210 ? 5.357   7.142   1.956   1.00 12.18 ? 1889 ASP A N   1 
ATOM   1824 C  CA  A ASP A 1 210 ? 5.091   8.341   1.187   0.50 13.46 ? 1889 ASP A CA  1 
ATOM   1825 C  CA  B ASP A 1 210 ? 5.071   8.340   1.172   0.50 13.68 ? 1889 ASP A CA  1 
ATOM   1826 C  C   . ASP A 1 210 ? 5.816   9.546   1.785   1.00 13.71 ? 1889 ASP A C   1 
ATOM   1827 O  O   . ASP A 1 210 ? 6.480   10.309  1.076   1.00 18.13 ? 1889 ASP A O   1 
ATOM   1828 C  CB  A ASP A 1 210 ? 3.597   8.605   1.188   0.50 14.19 ? 1889 ASP A CB  1 
ATOM   1829 C  CB  B ASP A 1 210 ? 3.550   8.604   1.126   0.50 14.37 ? 1889 ASP A CB  1 
ATOM   1830 C  CG  A ASP A 1 210 ? 3.181   9.545   0.104   0.50 15.01 ? 1889 ASP A CG  1 
ATOM   1831 C  CG  B ASP A 1 210 ? 2.801   7.689   0.142   0.50 17.10 ? 1889 ASP A CG  1 
ATOM   1832 O  OD1 A ASP A 1 210 ? 1.974   9.587   -0.131  0.50 19.26 ? 1889 ASP A OD1 1 
ATOM   1833 O  OD1 B ASP A 1 210 ? 3.435   7.068   -0.731  0.50 22.63 ? 1889 ASP A OD1 1 
ATOM   1834 O  OD2 A ASP A 1 210 ? 4.046   10.209  -0.515  0.50 12.70 ? 1889 ASP A OD2 1 
ATOM   1835 O  OD2 B ASP A 1 210 ? 1.549   7.626   0.218   0.50 24.08 ? 1889 ASP A OD2 1 
ATOM   1836 N  N   . TYR A 1 211 ? 5.703   9.716   3.103   1.00 12.47 ? 1890 TYR A N   1 
ATOM   1837 C  CA  . TYR A 1 211 ? 6.385   10.815  3.783   1.00 13.48 ? 1890 TYR A CA  1 
ATOM   1838 C  C   . TYR A 1 211 ? 7.896   10.683  3.735   1.00 13.05 ? 1890 TYR A C   1 
ATOM   1839 O  O   . TYR A 1 211 ? 8.587   11.680  3.563   1.00 15.41 ? 1890 TYR A O   1 
ATOM   1840 C  CB  . TYR A 1 211 ? 5.957   10.942  5.241   1.00 13.26 ? 1890 TYR A CB  1 
ATOM   1841 C  CG  . TYR A 1 211 ? 4.611   11.609  5.433   1.00 15.65 ? 1890 TYR A CG  1 
ATOM   1842 C  CD1 . TYR A 1 211 ? 3.452   10.849  5.574   1.00 16.22 ? 1890 TYR A CD1 1 
ATOM   1843 C  CD2 . TYR A 1 211 ? 4.503   12.986  5.516   1.00 14.92 ? 1890 TYR A CD2 1 
ATOM   1844 C  CE1 . TYR A 1 211 ? 2.224   11.436  5.790   1.00 16.09 ? 1890 TYR A CE1 1 
ATOM   1845 C  CE2 . TYR A 1 211 ? 3.253   13.599  5.722   1.00 17.80 ? 1890 TYR A CE2 1 
ATOM   1846 C  CZ  . TYR A 1 211 ? 2.125   12.809  5.861   1.00 13.74 ? 1890 TYR A CZ  1 
ATOM   1847 O  OH  . TYR A 1 211 ? 0.879   13.355  6.069   1.00 19.56 ? 1890 TYR A OH  1 
ATOM   1848 N  N   . ILE A 1 212 ? 8.421   9.476   3.938   1.00 12.27 ? 1891 ILE A N   1 
ATOM   1849 C  CA  . ILE A 1 212 ? 9.879   9.303   3.856   1.00 13.18 ? 1891 ILE A CA  1 
ATOM   1850 C  C   . ILE A 1 212 ? 10.374  9.707   2.462   1.00 13.54 ? 1891 ILE A C   1 
ATOM   1851 O  O   . ILE A 1 212 ? 11.400  10.388  2.321   1.00 15.16 ? 1891 ILE A O   1 
ATOM   1852 C  CB  . ILE A 1 212 ? 10.312  7.843   4.120   1.00 12.55 ? 1891 ILE A CB  1 
ATOM   1853 C  CG1 . ILE A 1 212 ? 9.937   7.422   5.538   1.00 13.27 ? 1891 ILE A CG1 1 
ATOM   1854 C  CG2 . ILE A 1 212 ? 11.821  7.683   3.866   1.00 13.49 ? 1891 ILE A CG2 1 
ATOM   1855 C  CD1 . ILE A 1 212 ? 10.114  5.936   5.814   1.00 15.76 ? 1891 ILE A CD1 1 
ATOM   1856 N  N   . ASN A 1 213 ? 9.649   9.299   1.419   1.00 14.49 ? 1892 ASN A N   1 
ATOM   1857 C  CA  . ASN A 1 213 ? 10.073  9.648   0.055   1.00 16.86 ? 1892 ASN A CA  1 
ATOM   1858 C  C   . ASN A 1 213 ? 10.122  11.166  -0.187  1.00 16.30 ? 1892 ASN A C   1 
ATOM   1859 O  O   . ASN A 1 213 ? 10.903  11.653  -1.011  1.00 18.93 ? 1892 ASN A O   1 
ATOM   1860 C  CB  . ASN A 1 213 ? 9.169   8.977   -0.990  1.00 16.92 ? 1892 ASN A CB  1 
ATOM   1861 C  CG  . ASN A 1 213 ? 9.415   7.478   -1.100  1.00 19.13 ? 1892 ASN A CG  1 
ATOM   1862 O  OD1 . ASN A 1 213 ? 10.442  6.962   -0.639  1.00 19.55 ? 1892 ASN A OD1 1 
ATOM   1863 N  ND2 . ASN A 1 213 ? 8.466   6.770   -1.690  1.00 20.99 ? 1892 ASN A ND2 1 
ATOM   1864 N  N   . ARG A 1 214 ? 9.290   11.906  0.538   1.00 14.94 ? 1893 ARG A N   1 
ATOM   1865 C  CA  . ARG A 1 214 ? 9.231   13.346  0.411   1.00 16.86 ? 1893 ARG A CA  1 
ATOM   1866 C  C   . ARG A 1 214 ? 10.280  14.035  1.294   1.00 17.47 ? 1893 ARG A C   1 
ATOM   1867 O  O   . ARG A 1 214 ? 10.341  15.262  1.316   1.00 21.10 ? 1893 ARG A O   1 
ATOM   1868 C  CB  . ARG A 1 214 ? 7.819   13.851  0.721   1.00 16.69 ? 1893 ARG A CB  1 
ATOM   1869 C  CG  . ARG A 1 214 ? 6.804   13.387  -0.338  1.00 17.72 ? 1893 ARG A CG  1 
ATOM   1870 C  CD  . ARG A 1 214 ? 5.399   13.393  0.186   1.00 23.86 ? 1893 ARG A CD  1 
ATOM   1871 N  NE  . ARG A 1 214 ? 4.406   13.124  -0.856  1.00 26.86 ? 1893 ARG A NE  1 
ATOM   1872 C  CZ  . ARG A 1 214 ? 3.856   14.057  -1.628  1.00 28.89 ? 1893 ARG A CZ  1 
ATOM   1873 N  NH1 . ARG A 1 214 ? 4.215   15.330  -1.488  1.00 23.67 ? 1893 ARG A NH1 1 
ATOM   1874 N  NH2 . ARG A 1 214 ? 2.943   13.716  -2.533  1.00 26.12 ? 1893 ARG A NH2 1 
ATOM   1875 N  N   . SER A 1 215 ? 11.116  13.245  1.978   1.00 17.44 ? 1894 SER A N   1 
ATOM   1876 C  CA  . SER A 1 215 ? 12.198  13.764  2.831   1.00 18.80 ? 1894 SER A CA  1 
ATOM   1877 C  C   . SER A 1 215 ? 13.561  13.301  2.326   1.00 17.78 ? 1894 SER A C   1 
ATOM   1878 O  O   . SER A 1 215 ? 14.310  12.700  3.093   1.00 18.08 ? 1894 SER A O   1 
ATOM   1879 C  CB  . SER A 1 215 ? 12.059  13.218  4.265   1.00 22.41 ? 1894 SER A CB  1 
ATOM   1880 O  OG  . SER A 1 215 ? 10.774  13.434  4.813   1.00 27.14 ? 1894 SER A OG  1 
ATOM   1881 N  N   . PRO A 1 216 ? 13.879  13.536  1.040   1.00 17.64 ? 1895 PRO A N   1 
ATOM   1882 C  CA  . PRO A 1 216 ? 15.117  12.958  0.508   1.00 20.18 ? 1895 PRO A CA  1 
ATOM   1883 C  C   . PRO A 1 216 ? 16.389  13.433  1.224   1.00 20.97 ? 1895 PRO A C   1 
ATOM   1884 O  O   . PRO A 1 216 ? 17.417  12.756  1.161   1.00 25.90 ? 1895 PRO A O   1 
ATOM   1885 C  CB  . PRO A 1 216 ? 15.115  13.402  -0.962  1.00 22.31 ? 1895 PRO A CB  1 
ATOM   1886 C  CG  . PRO A 1 216 ? 14.181  14.572  -1.023  1.00 20.74 ? 1895 PRO A CG  1 
ATOM   1887 C  CD  . PRO A 1 216 ? 13.135  14.304  0.022   1.00 19.59 ? 1895 PRO A CD  1 
ATOM   1888 N  N   . GLY A 1 217 ? 16.327  14.576  1.898   1.00 23.12 ? 1896 GLY A N   1 
ATOM   1889 C  CA  . GLY A 1 217 ? 17.504  15.096  2.630   1.00 22.75 ? 1896 GLY A CA  1 
ATOM   1890 C  C   . GLY A 1 217 ? 17.757  14.451  3.988   1.00 22.63 ? 1896 GLY A C   1 
ATOM   1891 O  O   . GLY A 1 217 ? 18.806  14.663  4.616   1.00 24.63 ? 1896 GLY A O   1 
ATOM   1892 N  N   . ALA A 1 218 ? 16.800  13.657  4.458   1.00 19.56 ? 1897 ALA A N   1 
ATOM   1893 C  CA  . ALA A 1 218 ? 16.763  13.307  5.868   1.00 17.76 ? 1897 ALA A CA  1 
ATOM   1894 C  C   . ALA A 1 218 ? 17.786  12.217  6.195   1.00 16.46 ? 1897 ALA A C   1 
ATOM   1895 O  O   . ALA A 1 218 ? 18.200  11.445  5.326   1.00 19.57 ? 1897 ALA A O   1 
ATOM   1896 C  CB  . ALA A 1 218 ? 15.371  12.863  6.272   1.00 18.21 ? 1897 ALA A CB  1 
ATOM   1897 N  N   . GLY A 1 219 ? 18.179  12.157  7.461   1.00 15.01 ? 1898 GLY A N   1 
ATOM   1898 C  CA  . GLY A 1 219 ? 18.910  11.006  7.973   1.00 13.74 ? 1898 GLY A CA  1 
ATOM   1899 C  C   . GLY A 1 219 ? 17.973  9.829   8.146   1.00 13.90 ? 1898 GLY A C   1 
ATOM   1900 O  O   . GLY A 1 219 ? 16.867  9.803   7.588   1.00 13.94 ? 1898 GLY A O   1 
ATOM   1901 N  N   . PRO A 1 220 ? 18.403  8.840   8.925   1.00 11.95 ? 1899 PRO A N   1 
ATOM   1902 C  CA  . PRO A 1 220 ? 17.624  7.626   9.061   1.00 10.68 ? 1899 PRO A CA  1 
ATOM   1903 C  C   . PRO A 1 220 ? 16.204  7.892   9.585   1.00 10.89 ? 1899 PRO A C   1 
ATOM   1904 O  O   . PRO A 1 220 ? 15.974  8.849   10.323  1.00 11.40 ? 1899 PRO A O   1 
ATOM   1905 C  CB  . PRO A 1 220 ? 18.421  6.808   10.081  1.00 11.71 ? 1899 PRO A CB  1 
ATOM   1906 C  CG  . PRO A 1 220 ? 19.816  7.378   10.053  1.00 14.81 ? 1899 PRO A CG  1 
ATOM   1907 C  CD  . PRO A 1 220 ? 19.641  8.833   9.734   1.00 13.48 ? 1899 PRO A CD  1 
ATOM   1908 N  N   . THR A 1 221 ? 15.267  7.014   9.238   1.00 10.55 ? 1900 THR A N   1 
ATOM   1909 C  CA  . THR A 1 221 ? 13.951  7.011   9.865   1.00 9.89  ? 1900 THR A CA  1 
ATOM   1910 C  C   . THR A 1 221 ? 14.041  6.236   11.170  1.00 8.91  ? 1900 THR A C   1 
ATOM   1911 O  O   . THR A 1 221 ? 14.562  5.110   11.196  1.00 10.00 ? 1900 THR A O   1 
ATOM   1912 C  CB  . THR A 1 221 ? 12.928  6.299   8.934   1.00 10.14 ? 1900 THR A CB  1 
ATOM   1913 O  OG1 . THR A 1 221 ? 12.838  6.992   7.677   1.00 11.34 ? 1900 THR A OG1 1 
ATOM   1914 C  CG2 . THR A 1 221 ? 11.551  6.231   9.571   1.00 12.35 ? 1900 THR A CG2 1 
ATOM   1915 N  N   . VAL A 1 222 ? 13.554  6.822   12.258  1.00 8.78  ? 1901 VAL A N   1 
ATOM   1916 C  CA  . VAL A 1 222 ? 13.572  6.123   13.552  1.00 7.95  ? 1901 VAL A CA  1 
ATOM   1917 C  C   . VAL A 1 222 ? 12.305  5.270   13.662  1.00 8.56  ? 1901 VAL A C   1 
ATOM   1918 O  O   . VAL A 1 222 ? 11.207  5.734   13.338  1.00 10.72 ? 1901 VAL A O   1 
ATOM   1919 C  CB  . VAL A 1 222 ? 13.642  7.142   14.714  1.00 9.52  ? 1901 VAL A CB  1 
ATOM   1920 C  CG1 . VAL A 1 222 ? 13.320  6.504   16.057  1.00 11.27 ? 1901 VAL A CG1 1 
ATOM   1921 C  CG2 . VAL A 1 222 ? 15.017  7.848   14.733  1.00 11.30 ? 1901 VAL A CG2 1 
ATOM   1922 N  N   . VAL A 1 223 ? 12.472  4.031   14.108  1.00 7.89  ? 1902 VAL A N   1 
ATOM   1923 C  CA  . VAL A 1 223 ? 11.356  3.114   14.332  1.00 8.76  ? 1902 VAL A CA  1 
ATOM   1924 C  C   . VAL A 1 223 ? 11.535  2.494   15.718  1.00 7.94  ? 1902 VAL A C   1 
ATOM   1925 O  O   . VAL A 1 223 ? 12.625  2.015   16.057  1.00 8.92  ? 1902 VAL A O   1 
ATOM   1926 C  CB  . VAL A 1 223 ? 11.313  1.982   13.279  1.00 8.36  ? 1902 VAL A CB  1 
ATOM   1927 C  CG1 . VAL A 1 223 ? 10.011  1.148   13.451  1.00 9.19  ? 1902 VAL A CG1 1 
ATOM   1928 C  CG2 . VAL A 1 223 ? 11.435  2.546   11.862  1.00 9.96  ? 1902 VAL A CG2 1 
ATOM   1929 N  N   . HIS A 1 224 ? 10.477  2.527   16.528  1.00 7.42  ? 1903 HIS A N   1 
ATOM   1930 C  CA  . HIS A 1 224 ? 10.546  1.918   17.852  1.00 8.00  ? 1903 HIS A CA  1 
ATOM   1931 C  C   . HIS A 1 224 ? 9.236   1.295   18.276  1.00 7.95  ? 1903 HIS A C   1 
ATOM   1932 O  O   . HIS A 1 224 ? 8.159   1.718   17.829  1.00 9.18  ? 1903 HIS A O   1 
ATOM   1933 C  CB  . HIS A 1 224 ? 11.064  2.895   18.911  1.00 8.83  ? 1903 HIS A CB  1 
ATOM   1934 C  CG  . HIS A 1 224 ? 10.052  3.889   19.398  1.00 8.25  ? 1903 HIS A CG  1 
ATOM   1935 N  ND1 . HIS A 1 224 ? 9.203   3.619   20.450  1.00 8.98  ? 1903 HIS A ND1 1 
ATOM   1936 C  CD2 . HIS A 1 224 ? 9.790   5.170   19.018  1.00 10.91 ? 1903 HIS A CD2 1 
ATOM   1937 C  CE1 . HIS A 1 224 ? 8.432   4.674   20.677  1.00 10.05 ? 1903 HIS A CE1 1 
ATOM   1938 N  NE2 . HIS A 1 224 ? 8.773   5.633   19.827  1.00 9.96  ? 1903 HIS A NE2 1 
ATOM   1939 N  N   . CYS A 1 225 ? 9.355   0.286   19.131  1.00 8.21  ? 1904 CYS A N   1 
ATOM   1940 C  CA  . CYS A 1 225 ? 8.230   -0.231  19.896  1.00 9.01  ? 1904 CYS A CA  1 
ATOM   1941 C  C   . CYS A 1 225 ? 8.588   -0.093  21.372  1.00 10.07 ? 1904 CYS A C   1 
ATOM   1942 O  O   . CYS A 1 225 ? 9.083   0.978   21.765  1.00 13.03 ? 1904 CYS A O   1 
ATOM   1943 C  CB  . CYS A 1 225 ? 7.873   -1.656  19.441  1.00 9.98  ? 1904 CYS A CB  1 
ATOM   1944 S  SG  . CYS A 1 225 ? 9.245   -2.877  19.510  1.00 14.56 ? 1904 CYS A SG  1 
ATOM   1945 N  N   . SER A 1 226 ? 8.331   -1.095  22.207  1.00 9.32  ? 1905 SER A N   1 
ATOM   1946 C  CA  . SER A 1 226 ? 8.786   -0.995  23.585  1.00 9.08  ? 1905 SER A CA  1 
ATOM   1947 C  C   . SER A 1 226 ? 10.278  -1.343  23.703  1.00 10.61 ? 1905 SER A C   1 
ATOM   1948 O  O   . SER A 1 226 ? 11.043  -0.607  24.301  1.00 12.30 ? 1905 SER A O   1 
ATOM   1949 C  CB  . SER A 1 226 ? 7.969   -1.907  24.503  1.00 9.52  ? 1905 SER A CB  1 
ATOM   1950 O  OG  . SER A 1 226 ? 8.346   -1.749  25.864  1.00 10.89 ? 1905 SER A OG  1 
ATOM   1951 N  N   . ALA A 1 227 ? 10.692  -2.453  23.120  1.00 12.80 ? 1906 ALA A N   1 
ATOM   1952 C  CA  . ALA A 1 227 ? 12.106  -2.860  23.211  1.00 11.16 ? 1906 ALA A CA  1 
ATOM   1953 C  C   . ALA A 1 227 ? 12.892  -2.609  21.922  1.00 10.79 ? 1906 ALA A C   1 
ATOM   1954 O  O   . ALA A 1 227 ? 14.114  -2.765  21.898  1.00 11.74 ? 1906 ALA A O   1 
ATOM   1955 C  CB  . ALA A 1 227 ? 12.191  -4.333  23.567  1.00 14.28 ? 1906 ALA A CB  1 
ATOM   1956 N  N   . GLY A 1 228 ? 12.205  -2.291  20.826  1.00 10.11 ? 1907 GLY A N   1 
ATOM   1957 C  CA  . GLY A 1 228 ? 12.884  -2.210  19.529  1.00 11.21 ? 1907 GLY A CA  1 
ATOM   1958 C  C   . GLY A 1 228 ? 13.209  -3.606  19.004  1.00 12.05 ? 1907 GLY A C   1 
ATOM   1959 O  O   . GLY A 1 228 ? 14.363  -3.953  18.719  1.00 15.54 ? 1907 GLY A O   1 
ATOM   1960 N  N   . VAL A 1 229 ? 12.180  -4.426  18.899  1.00 11.31 ? 1908 VAL A N   1 
ATOM   1961 C  CA  . VAL A 1 229 ? 12.333  -5.853  18.617  1.00 12.83 ? 1908 VAL A CA  1 
ATOM   1962 C  C   . VAL A 1 229 ? 11.328  -6.246  17.538  1.00 10.92 ? 1908 VAL A C   1 
ATOM   1963 O  O   . VAL A 1 229 ? 11.271  -5.606  16.506  1.00 13.39 ? 1908 VAL A O   1 
ATOM   1964 C  CB  . VAL A 1 229 ? 12.232  -6.710  19.912  1.00 14.09 ? 1908 VAL A CB  1 
ATOM   1965 C  CG1 . VAL A 1 229 ? 13.464  -6.479  20.814  1.00 15.77 ? 1908 VAL A CG1 1 
ATOM   1966 C  CG2 . VAL A 1 229 ? 10.937  -6.381  20.666  1.00 14.71 ? 1908 VAL A CG2 1 
ATOM   1967 N  N   . GLY A 1 230 ? 10.552  -7.300  17.742  1.00 12.43 ? 1909 GLY A N   1 
ATOM   1968 C  CA  . GLY A 1 230 ? 9.766   -7.872  16.668  1.00 12.38 ? 1909 GLY A CA  1 
ATOM   1969 C  C   . GLY A 1 230 ? 8.844   -6.926  15.903  1.00 10.97 ? 1909 GLY A C   1 
ATOM   1970 O  O   . GLY A 1 230 ? 8.802   -6.965  14.679  1.00 11.17 ? 1909 GLY A O   1 
ATOM   1971 N  N   . ARG A 1 231 ? 8.074   -6.100  16.606  1.00 11.26 ? 1910 ARG A N   1 
ATOM   1972 C  CA  . ARG A 1 231 ? 7.131   -5.218  15.894  1.00 10.83 ? 1910 ARG A CA  1 
ATOM   1973 C  C   . ARG A 1 231 ? 7.881   -4.242  15.000  1.00 9.35  ? 1910 ARG A C   1 
ATOM   1974 O  O   . ARG A 1 231 ? 7.454   -3.948  13.879  1.00 9.89  ? 1910 ARG A O   1 
ATOM   1975 C  CB  . ARG A 1 231 ? 6.297   -4.413  16.878  1.00 11.80 ? 1910 ARG A CB  1 
ATOM   1976 C  CG  . ARG A 1 231 ? 5.445   -5.230  17.820  1.00 12.87 ? 1910 ARG A CG  1 
ATOM   1977 C  CD  . ARG A 1 231 ? 4.572   -4.290  18.618  1.00 12.83 ? 1910 ARG A CD  1 
ATOM   1978 N  NE  . ARG A 1 231 ? 3.874   -4.969  19.688  1.00 13.65 ? 1910 ARG A NE  1 
ATOM   1979 C  CZ  . ARG A 1 231 ? 3.108   -4.345  20.574  1.00 15.29 ? 1910 ARG A CZ  1 
ATOM   1980 N  NH1 . ARG A 1 231 ? 2.928   -3.028  20.495  1.00 15.74 ? 1910 ARG A NH1 1 
ATOM   1981 N  NH2 . ARG A 1 231 ? 2.504   -5.046  21.530  1.00 19.05 ? 1910 ARG A NH2 1 
ATOM   1982 N  N   . THR A 1 232 ? 8.993   -3.712  15.504  1.00 9.75  ? 1911 THR A N   1 
ATOM   1983 C  CA  A THR A 1 232 ? 9.799   -2.802  14.708  0.50 9.16  ? 1911 THR A CA  1 
ATOM   1984 C  CA  B THR A 1 232 ? 9.807   -2.803  14.691  0.50 9.66  ? 1911 THR A CA  1 
ATOM   1985 C  C   . THR A 1 232 ? 10.393  -3.506  13.474  1.00 9.15  ? 1911 THR A C   1 
ATOM   1986 O  O   . THR A 1 232 ? 10.376  -2.969  12.352  1.00 9.49  ? 1911 THR A O   1 
ATOM   1987 C  CB  A THR A 1 232 ? 10.891  -2.171  15.588  0.50 8.63  ? 1911 THR A CB  1 
ATOM   1988 C  CB  B THR A 1 232 ? 10.942  -2.140  15.502  0.50 9.94  ? 1911 THR A CB  1 
ATOM   1989 O  OG1 A THR A 1 232 ? 10.298  -1.222  16.484  0.50 9.59  ? 1911 THR A OG1 1 
ATOM   1990 O  OG1 B THR A 1 232 ? 12.012  -3.078  15.712  0.50 11.51 ? 1911 THR A OG1 1 
ATOM   1991 C  CG2 A THR A 1 232 ? 11.910  -1.475  14.759  0.50 7.01  ? 1911 THR A CG2 1 
ATOM   1992 C  CG2 B THR A 1 232 ? 10.416  -1.636  16.843  0.50 8.32  ? 1911 THR A CG2 1 
ATOM   1993 N  N   . GLY A 1 233 ? 10.912  -4.718  13.672  1.00 9.42  ? 1912 GLY A N   1 
ATOM   1994 C  CA  . GLY A 1 233 ? 11.433  -5.476  12.556  1.00 9.37  ? 1912 GLY A CA  1 
ATOM   1995 C  C   . GLY A 1 233 ? 10.364  -5.792  11.519  1.00 9.09  ? 1912 GLY A C   1 
ATOM   1996 O  O   . GLY A 1 233 ? 10.628  -5.800  10.308  1.00 9.98  ? 1912 GLY A O   1 
ATOM   1997 N  N   . THR A 1 234 ? 9.153   -6.071  12.000  1.00 8.98  ? 1913 THR A N   1 
ATOM   1998 C  CA  . THR A 1 234 ? 8.043   -6.388  11.105  1.00 9.83  ? 1913 THR A CA  1 
ATOM   1999 C  C   . THR A 1 234 ? 7.651   -5.129  10.300  1.00 9.03  ? 1913 THR A C   1 
ATOM   2000 O  O   . THR A 1 234 ? 7.466   -5.200  9.092   1.00 9.54  ? 1913 THR A O   1 
ATOM   2001 C  CB  . THR A 1 234 ? 6.856   -6.918  11.917  1.00 9.73  ? 1913 THR A CB  1 
ATOM   2002 O  OG1 . THR A 1 234 ? 7.257   -8.095  12.623  1.00 11.15 ? 1913 THR A OG1 1 
ATOM   2003 C  CG2 . THR A 1 234 ? 5.629   -7.249  11.020  1.00 11.94 ? 1913 THR A CG2 1 
ATOM   2004 N  N   . PHE A 1 235 ? 7.594   -3.968  10.956  1.00 7.82  ? 1914 PHE A N   1 
ATOM   2005 C  CA  . PHE A 1 235 ? 7.357   -2.728  10.213  1.00 8.63  ? 1914 PHE A CA  1 
ATOM   2006 C  C   . PHE A 1 235 ? 8.407   -2.506  9.136   1.00 8.27  ? 1914 PHE A C   1 
ATOM   2007 O  O   . PHE A 1 235 ? 8.087   -2.193  7.986   1.00 8.92  ? 1914 PHE A O   1 
ATOM   2008 C  CB  . PHE A 1 235 ? 7.321   -1.511  11.157  1.00 8.37  ? 1914 PHE A CB  1 
ATOM   2009 C  CG  . PHE A 1 235 ? 7.201   -0.221  10.429  1.00 8.11  ? 1914 PHE A CG  1 
ATOM   2010 C  CD1 . PHE A 1 235 ? 5.955   0.310   10.120  1.00 10.30 ? 1914 PHE A CD1 1 
ATOM   2011 C  CD2 . PHE A 1 235 ? 8.332   0.437   9.983   1.00 10.56 ? 1914 PHE A CD2 1 
ATOM   2012 C  CE1 . PHE A 1 235 ? 5.854   1.477   9.397   1.00 9.43  ? 1914 PHE A CE1 1 
ATOM   2013 C  CE2 . PHE A 1 235 ? 8.235   1.586   9.258   1.00 10.67 ? 1914 PHE A CE2 1 
ATOM   2014 C  CZ  . PHE A 1 235 ? 6.992   2.124   8.959   1.00 10.07 ? 1914 PHE A CZ  1 
ATOM   2015 N  N   . ILE A 1 236 ? 9.681   -2.626  9.503   1.00 8.66  ? 1915 ILE A N   1 
ATOM   2016 C  CA  . ILE A 1 236 ? 10.732  -2.309  8.532   1.00 8.70  ? 1915 ILE A CA  1 
ATOM   2017 C  C   . ILE A 1 236 ? 10.735  -3.330  7.392   1.00 8.84  ? 1915 ILE A C   1 
ATOM   2018 O  O   . ILE A 1 236 ? 10.868  -2.972  6.223   1.00 9.83  ? 1915 ILE A O   1 
ATOM   2019 C  CB  . ILE A 1 236 ? 12.120  -2.253  9.232   1.00 9.11  ? 1915 ILE A CB  1 
ATOM   2020 C  CG1 . ILE A 1 236 ? 12.159  -1.006  10.119  1.00 9.17  ? 1915 ILE A CG1 1 
ATOM   2021 C  CG2 . ILE A 1 236 ? 13.253  -2.251  8.195   1.00 8.45  ? 1915 ILE A CG2 1 
ATOM   2022 C  CD1 . ILE A 1 236 ? 13.396  -0.935  10.994  1.00 11.53 ? 1915 ILE A CD1 1 
ATOM   2023 N  N   . ALA A 1 237 ? 10.602  -4.608  7.739   1.00 8.94  ? 1916 ALA A N   1 
ATOM   2024 C  CA  . ALA A 1 237 ? 10.563  -5.631  6.706   1.00 8.85  ? 1916 ALA A CA  1 
ATOM   2025 C  C   . ALA A 1 237 ? 9.407   -5.361  5.742   1.00 9.42  ? 1916 ALA A C   1 
ATOM   2026 O  O   . ALA A 1 237 ? 9.578   -5.462  4.533   1.00 10.46 ? 1916 ALA A O   1 
ATOM   2027 C  CB  . ALA A 1 237 ? 10.432  -7.016  7.324   1.00 9.70  ? 1916 ALA A CB  1 
ATOM   2028 N  N   . LEU A 1 238 ? 8.246   -4.986  6.282   1.00 8.77  ? 1917 LEU A N   1 
ATOM   2029 C  CA  . LEU A 1 238 ? 7.124   -4.684  5.398   1.00 9.89  ? 1917 LEU A CA  1 
ATOM   2030 C  C   . LEU A 1 238 ? 7.384   -3.452  4.520   1.00 9.68  ? 1917 LEU A C   1 
ATOM   2031 O  O   . LEU A 1 238 ? 7.071   -3.455  3.332   1.00 10.81 ? 1917 LEU A O   1 
ATOM   2032 C  CB  . LEU A 1 238 ? 5.836   -4.531  6.208   1.00 10.53 ? 1917 LEU A CB  1 
ATOM   2033 C  CG  . LEU A 1 238 ? 4.528   -4.393  5.412   1.00 10.59 ? 1917 LEU A CG  1 
ATOM   2034 C  CD1 . LEU A 1 238 ? 4.343   -5.581  4.451   1.00 12.97 ? 1917 LEU A CD1 1 
ATOM   2035 C  CD2 . LEU A 1 238 ? 3.318   -4.263  6.392   1.00 12.94 ? 1917 LEU A CD2 1 
ATOM   2036 N  N   . ASP A 1 239 ? 7.955   -2.397  5.097   1.00 9.42  ? 1918 ASP A N   1 
ATOM   2037 C  CA  . ASP A 1 239 ? 8.361   -1.243  4.276   1.00 9.63  ? 1918 ASP A CA  1 
ATOM   2038 C  C   . ASP A 1 239 ? 9.286   -1.679  3.122   1.00 10.50 ? 1918 ASP A C   1 
ATOM   2039 O  O   . ASP A 1 239 ? 9.118   -1.272  1.962   1.00 11.61 ? 1918 ASP A O   1 
ATOM   2040 C  CB  . ASP A 1 239 ? 9.044   -0.220  5.177   1.00 10.06 ? 1918 ASP A CB  1 
ATOM   2041 C  CG  . ASP A 1 239 ? 9.430   1.066   4.454   1.00 11.85 ? 1918 ASP A CG  1 
ATOM   2042 O  OD1 . ASP A 1 239 ? 8.669   1.551   3.577   1.00 12.42 ? 1918 ASP A OD1 1 
ATOM   2043 O  OD2 . ASP A 1 239 ? 10.504  1.632   4.815   1.00 13.45 ? 1918 ASP A OD2 1 
ATOM   2044 N  N   . ARG A 1 240 ? 10.288  -2.490  3.447   1.00 9.44  ? 1919 ARG A N   1 
ATOM   2045 C  CA  . ARG A 1 240 ? 11.225  -2.943  2.413   1.00 10.55 ? 1919 ARG A CA  1 
ATOM   2046 C  C   . ARG A 1 240 ? 10.538  -3.775  1.338   1.00 11.37 ? 1919 ARG A C   1 
ATOM   2047 O  O   . ARG A 1 240 ? 10.754  -3.562  0.154   1.00 13.54 ? 1919 ARG A O   1 
ATOM   2048 C  CB  . ARG A 1 240 ? 12.403  -3.723  3.021   1.00 11.65 ? 1919 ARG A CB  1 
ATOM   2049 C  CG  . ARG A 1 240 ? 13.302  -2.852  3.878   1.00 11.48 ? 1919 ARG A CG  1 
ATOM   2050 C  CD  . ARG A 1 240 ? 14.520  -3.611  4.432   1.00 15.32 ? 1919 ARG A CD  1 
ATOM   2051 N  NE  . ARG A 1 240 ? 15.322  -4.212  3.371   1.00 18.63 ? 1919 ARG A NE  1 
ATOM   2052 C  CZ  . ARG A 1 240 ? 16.581  -4.623  3.511   1.00 16.58 ? 1919 ARG A CZ  1 
ATOM   2053 N  NH1 . ARG A 1 240 ? 17.248  -4.433  4.645   1.00 17.00 ? 1919 ARG A NH1 1 
ATOM   2054 N  NH2 . ARG A 1 240 ? 17.195  -5.189  2.486   1.00 22.02 ? 1919 ARG A NH2 1 
ATOM   2055 N  N   . ILE A 1 241 ? 9.714   -4.730  1.740   1.00 11.93 ? 1920 ILE A N   1 
ATOM   2056 C  CA  A ILE A 1 241 ? 9.062   -5.645  0.807   0.60 14.02 ? 1920 ILE A CA  1 
ATOM   2057 C  CA  B ILE A 1 241 ? 9.125   -5.599  0.739   0.40 11.20 ? 1920 ILE A CA  1 
ATOM   2058 C  C   . ILE A 1 241 ? 8.029   -4.918  -0.072  1.00 13.93 ? 1920 ILE A C   1 
ATOM   2059 O  O   . ILE A 1 241 ? 7.882   -5.213  -1.255  1.00 14.96 ? 1920 ILE A O   1 
ATOM   2060 C  CB  A ILE A 1 241 ? 8.402   -6.806  1.575   0.60 17.05 ? 1920 ILE A CB  1 
ATOM   2061 C  CB  B ILE A 1 241 ? 8.677   -6.937  1.297   0.40 10.07 ? 1920 ILE A CB  1 
ATOM   2062 C  CG1 A ILE A 1 241 ? 9.483   -7.728  2.159   0.60 20.44 ? 1920 ILE A CG1 1 
ATOM   2063 C  CG1 B ILE A 1 241 ? 7.471   -6.740  2.225   0.40 7.90  ? 1920 ILE A CG1 1 
ATOM   2064 C  CG2 A ILE A 1 241 ? 7.424   -7.575  0.697   0.60 23.29 ? 1920 ILE A CG2 1 
ATOM   2065 C  CG2 B ILE A 1 241 ? 9.855   -7.610  1.998   0.40 10.06 ? 1920 ILE A CG2 1 
ATOM   2066 C  CD1 A ILE A 1 241 ? 9.158   -8.255  3.550   0.60 22.66 ? 1920 ILE A CD1 1 
ATOM   2067 C  CD1 B ILE A 1 241 ? 7.118   -7.953  3.085   0.40 9.30  ? 1920 ILE A CD1 1 
ATOM   2068 N  N   . LEU A 1 242 ? 7.291   -3.969  0.511   1.00 12.91 ? 1921 LEU A N   1 
ATOM   2069 C  CA  . LEU A 1 242 ? 6.302   -3.268  -0.326  1.00 13.31 ? 1921 LEU A CA  1 
ATOM   2070 C  C   . LEU A 1 242 ? 6.975   -2.394  -1.376  1.00 14.05 ? 1921 LEU A C   1 
ATOM   2071 O  O   . LEU A 1 242 ? 6.455   -2.232  -2.484  1.00 17.08 ? 1921 LEU A O   1 
ATOM   2072 C  CB  . LEU A 1 242 ? 5.310   -2.457  0.509   1.00 14.43 ? 1921 LEU A CB  1 
ATOM   2073 C  CG  . LEU A 1 242 ? 4.403   -3.280  1.426   1.00 13.31 ? 1921 LEU A CG  1 
ATOM   2074 C  CD1 . LEU A 1 242 ? 3.454   -2.349  2.194   1.00 15.80 ? 1921 LEU A CD1 1 
ATOM   2075 C  CD2 . LEU A 1 242 ? 3.608   -4.307  0.643   1.00 18.52 ? 1921 LEU A CD2 1 
ATOM   2076 N  N   . GLN A 1 243 ? 8.138   -1.835  -1.044  1.00 15.08 ? 1922 GLN A N   1 
ATOM   2077 C  CA  . GLN A 1 243 ? 8.897   -1.103  -2.053  1.00 15.77 ? 1922 GLN A CA  1 
ATOM   2078 C  C   . GLN A 1 243 ? 9.307   -2.048  -3.176  1.00 18.05 ? 1922 GLN A C   1 
ATOM   2079 O  O   . GLN A 1 243 ? 9.244   -1.684  -4.353  1.00 20.71 ? 1922 GLN A O   1 
ATOM   2080 C  CB  . GLN A 1 243 ? 10.134  -0.457  -1.452  1.00 15.71 ? 1922 GLN A CB  1 
ATOM   2081 C  CG  . GLN A 1 243 ? 9.851   0.772   -0.613  1.00 15.20 ? 1922 GLN A CG  1 
ATOM   2082 C  CD  . GLN A 1 243 ? 11.097  1.226   0.107   1.00 16.16 ? 1922 GLN A CD  1 
ATOM   2083 O  OE1 . GLN A 1 243 ? 11.890  2.009   -0.423  1.00 19.53 ? 1922 GLN A OE1 1 
ATOM   2084 N  NE2 . GLN A 1 243 ? 11.297  0.705   1.302   1.00 15.29 ? 1922 GLN A NE2 1 
ATOM   2085 N  N   . GLN A 1 244 ? 9.740   -3.258  -2.819  1.00 17.79 ? 1923 GLN A N   1 
ATOM   2086 C  CA  A GLN A 1 244 ? 10.093  -4.258  -3.824  0.60 19.69 ? 1923 GLN A CA  1 
ATOM   2087 C  CA  B GLN A 1 244 ? 10.092  -4.255  -3.825  0.40 19.55 ? 1923 GLN A CA  1 
ATOM   2088 C  C   . GLN A 1 244 ? 8.927   -4.577  -4.752  1.00 20.10 ? 1923 GLN A C   1 
ATOM   2089 O  O   . GLN A 1 244 ? 9.098   -4.647  -5.969  1.00 22.24 ? 1923 GLN A O   1 
ATOM   2090 C  CB  A GLN A 1 244 ? 10.587  -5.542  -3.167  0.60 19.91 ? 1923 GLN A CB  1 
ATOM   2091 C  CB  B GLN A 1 244 ? 10.596  -5.533  -3.167  0.40 19.64 ? 1923 GLN A CB  1 
ATOM   2092 C  CG  A GLN A 1 244 ? 11.941  -5.401  -2.519  0.60 19.59 ? 1923 GLN A CG  1 
ATOM   2093 C  CG  B GLN A 1 244 ? 11.998  -5.411  -2.629  0.40 19.41 ? 1923 GLN A CG  1 
ATOM   2094 C  CD  A GLN A 1 244 ? 12.233  -6.514  -1.526  0.60 22.64 ? 1923 GLN A CD  1 
ATOM   2095 C  CD  B GLN A 1 244 ? 12.655  -6.757  -2.412  0.40 19.36 ? 1923 GLN A CD  1 
ATOM   2096 O  OE1 A GLN A 1 244 ? 11.685  -7.619  -1.624  0.60 17.93 ? 1923 GLN A OE1 1 
ATOM   2097 O  OE1 B GLN A 1 244 ? 11.985  -7.785  -2.321  0.40 19.83 ? 1923 GLN A OE1 1 
ATOM   2098 N  NE2 A GLN A 1 244 ? 13.107  -6.228  -0.560  0.60 24.20 ? 1923 GLN A NE2 1 
ATOM   2099 N  NE2 B GLN A 1 244 ? 13.975  -6.756  -2.327  0.40 22.29 ? 1923 GLN A NE2 1 
ATOM   2100 N  N   . LEU A 1 245 ? 7.746   -4.775  -4.175  1.00 19.28 ? 1924 LEU A N   1 
ATOM   2101 C  CA  . LEU A 1 245 ? 6.551   -5.065  -4.975  1.00 21.04 ? 1924 LEU A CA  1 
ATOM   2102 C  C   . LEU A 1 245 ? 6.255   -3.948  -5.973  1.00 23.87 ? 1924 LEU A C   1 
ATOM   2103 O  O   . LEU A 1 245 ? 5.673   -4.199  -7.032  1.00 26.19 ? 1924 LEU A O   1 
ATOM   2104 C  CB  . LEU A 1 245 ? 5.331   -5.287  -4.078  1.00 21.88 ? 1924 LEU A CB  1 
ATOM   2105 C  CG  . LEU A 1 245 ? 5.314   -6.497  -3.143  1.00 21.04 ? 1924 LEU A CG  1 
ATOM   2106 C  CD1 . LEU A 1 245 ? 3.966   -6.595  -2.407  1.00 23.57 ? 1924 LEU A CD1 1 
ATOM   2107 C  CD2 . LEU A 1 245 ? 5.614   -7.785  -3.919  1.00 21.10 ? 1924 LEU A CD2 1 
ATOM   2108 N  N   . ASP A 1 246 ? 6.632   -2.715  -5.638  1.00 24.27 ? 1925 ASP A N   1 
ATOM   2109 C  CA  . ASP A 1 246 ? 6.346   -1.587  -6.528  1.00 27.33 ? 1925 ASP A CA  1 
ATOM   2110 C  C   . ASP A 1 246 ? 7.372   -1.383  -7.636  1.00 28.72 ? 1925 ASP A C   1 
ATOM   2111 O  O   . ASP A 1 246 ? 7.083   -0.699  -8.619  1.00 30.62 ? 1925 ASP A O   1 
ATOM   2112 C  CB  . ASP A 1 246 ? 6.143   -0.291  -5.743  1.00 26.92 ? 1925 ASP A CB  1 
ATOM   2113 C  CG  . ASP A 1 246 ? 4.862   -0.300  -4.945  1.00 34.39 ? 1925 ASP A CG  1 
ATOM   2114 O  OD1 . ASP A 1 246 ? 3.952   -1.074  -5.318  1.00 34.99 ? 1925 ASP A OD1 1 
ATOM   2115 O  OD2 . ASP A 1 246 ? 4.768   0.450   -3.947  1.00 39.28 ? 1925 ASP A OD2 1 
ATOM   2116 N  N   . SER A 1 247 ? 8.557   -1.973  -7.487  1.00 28.56 ? 1926 SER A N   1 
ATOM   2117 C  CA  . SER A 1 247 ? 9.685   -1.653  -8.365  1.00 30.45 ? 1926 SER A CA  1 
ATOM   2118 C  C   . SER A 1 247 ? 10.292  -2.876  -9.058  1.00 30.18 ? 1926 SER A C   1 
ATOM   2119 O  O   . SER A 1 247 ? 10.979  -2.734  -10.070 1.00 32.76 ? 1926 SER A O   1 
ATOM   2120 C  CB  . SER A 1 247 ? 10.770  -0.896  -7.598  1.00 30.76 ? 1926 SER A CB  1 
ATOM   2121 O  OG  . SER A 1 247 ? 11.258  -1.675  -6.522  1.00 33.93 ? 1926 SER A OG  1 
ATOM   2122 N  N   . LYS A 1 248 ? 10.039  -4.067  -8.515  1.00 29.82 ? 1927 LYS A N   1 
ATOM   2123 C  CA  . LYS A 1 248 ? 10.670  -5.306  -8.996  1.00 28.34 ? 1927 LYS A CA  1 
ATOM   2124 C  C   . LYS A 1 248 ? 9.643   -6.363  -9.409  1.00 27.56 ? 1927 LYS A C   1 
ATOM   2125 O  O   . LYS A 1 248 ? 8.458   -6.239  -9.101  1.00 29.17 ? 1927 LYS A O   1 
ATOM   2126 C  CB  . LYS A 1 248 ? 11.571  -5.898  -7.906  1.00 29.80 ? 1927 LYS A CB  1 
ATOM   2127 C  CG  . LYS A 1 248 ? 12.521  -4.907  -7.269  1.00 31.86 ? 1927 LYS A CG  1 
ATOM   2128 C  CD  . LYS A 1 248 ? 13.657  -4.566  -8.217  1.00 37.60 ? 1927 LYS A CD  1 
ATOM   2129 C  CE  . LYS A 1 248 ? 14.670  -3.658  -7.544  1.00 41.68 ? 1927 LYS A CE  1 
ATOM   2130 N  NZ  . LYS A 1 248 ? 14.356  -2.222  -7.772  1.00 43.18 ? 1927 LYS A NZ  1 
ATOM   2131 N  N   . ASP A 1 249 ? 10.110  -7.410  -10.092 1.00 28.39 ? 1928 ASP A N   1 
ATOM   2132 C  CA  . ASP A 1 249 ? 9.280   -8.577  -10.419 1.00 28.21 ? 1928 ASP A CA  1 
ATOM   2133 C  C   . ASP A 1 249 ? 9.492   -9.734  -9.445  1.00 25.72 ? 1928 ASP A C   1 
ATOM   2134 O  O   . ASP A 1 249 ? 8.915   -10.818 -9.591  1.00 23.93 ? 1928 ASP A O   1 
ATOM   2135 C  CB  . ASP A 1 249 ? 9.508   -9.016  -11.877 1.00 27.51 ? 1928 ASP A CB  1 
ATOM   2136 C  CG  . ASP A 1 249 ? 9.098   -7.942  -12.867 1.00 33.50 ? 1928 ASP A CG  1 
ATOM   2137 O  OD1 . ASP A 1 249 ? 8.077   -7.269  -12.606 1.00 38.75 ? 1928 ASP A OD1 1 
ATOM   2138 O  OD2 . ASP A 1 249 ? 9.797   -7.754  -13.887 1.00 38.15 ? 1928 ASP A OD2 1 
ATOM   2139 N  N   . SER A 1 250 ? 10.297  -9.481  -8.416  1.00 24.92 ? 1929 SER A N   1 
ATOM   2140 C  CA  A SER A 1 250 ? 10.584  -10.482 -7.393  0.60 24.76 ? 1929 SER A CA  1 
ATOM   2141 C  CA  B SER A 1 250 ? 10.545  -10.483 -7.394  0.40 23.21 ? 1929 SER A CA  1 
ATOM   2142 C  C   . SER A 1 250 ? 10.469  -9.849  -6.013  1.00 21.58 ? 1929 SER A C   1 
ATOM   2143 O  O   . SER A 1 250 ? 10.656  -8.648  -5.867  1.00 23.12 ? 1929 SER A O   1 
ATOM   2144 C  CB  A SER A 1 250 ? 12.002  -11.032 -7.580  0.60 25.47 ? 1929 SER A CB  1 
ATOM   2145 C  CB  B SER A 1 250 ? 11.916  -11.126 -7.611  0.40 23.17 ? 1929 SER A CB  1 
ATOM   2146 O  OG  A SER A 1 250 ? 12.158  -12.286 -6.930  0.60 32.91 ? 1929 SER A OG  1 
ATOM   2147 O  OG  B SER A 1 250 ? 11.921  -11.925 -8.784  0.40 22.62 ? 1929 SER A OG  1 
ATOM   2148 N  N   . VAL A 1 251 ? 10.183  -10.665 -5.007  1.00 20.83 ? 1930 VAL A N   1 
ATOM   2149 C  CA  . VAL A 1 251 ? 10.127  -10.177 -3.638  1.00 20.08 ? 1930 VAL A CA  1 
ATOM   2150 C  C   . VAL A 1 251 ? 10.901  -11.150 -2.746  1.00 19.95 ? 1930 VAL A C   1 
ATOM   2151 O  O   . VAL A 1 251 ? 10.880  -12.361 -2.985  1.00 20.23 ? 1930 VAL A O   1 
ATOM   2152 C  CB  . VAL A 1 251 ? 8.660   -10.007 -3.164  1.00 21.28 ? 1930 VAL A CB  1 
ATOM   2153 C  CG1 . VAL A 1 251 ? 7.938   -11.356 -3.087  1.00 21.09 ? 1930 VAL A CG1 1 
ATOM   2154 C  CG2 . VAL A 1 251 ? 8.600   -9.276  -1.834  1.00 19.42 ? 1930 VAL A CG2 1 
ATOM   2155 N  N   . ASP A 1 252 ? 11.611  -10.621 -1.747  1.00 17.00 ? 1931 ASP A N   1 
ATOM   2156 C  CA  . ASP A 1 252 ? 12.534  -11.430 -0.950  1.00 16.80 ? 1931 ASP A CA  1 
ATOM   2157 C  C   . ASP A 1 252 ? 12.316  -11.124 0.534   1.00 16.74 ? 1931 ASP A C   1 
ATOM   2158 O  O   . ASP A 1 252 ? 13.081  -10.377 1.148   1.00 16.43 ? 1931 ASP A O   1 
ATOM   2159 C  CB  . ASP A 1 252 ? 13.972  -11.100 -1.361  1.00 17.37 ? 1931 ASP A CB  1 
ATOM   2160 C  CG  . ASP A 1 252 ? 14.994  -12.023 -0.735  1.00 20.71 ? 1931 ASP A CG  1 
ATOM   2161 O  OD1 . ASP A 1 252 ? 14.592  -13.014 -0.097  1.00 16.78 ? 1931 ASP A OD1 1 
ATOM   2162 O  OD2 . ASP A 1 252 ? 16.204  -11.736 -0.894  1.00 23.37 ? 1931 ASP A OD2 1 
ATOM   2163 N  N   . ILE A 1 253 ? 11.271  -11.715 1.105   1.00 15.06 ? 1932 ILE A N   1 
ATOM   2164 C  CA  . ILE A 1 253 ? 10.956  -11.538 2.511   1.00 14.36 ? 1932 ILE A CA  1 
ATOM   2165 C  C   . ILE A 1 253 ? 12.072  -12.144 3.370   1.00 13.04 ? 1932 ILE A C   1 
ATOM   2166 O  O   . ILE A 1 253 ? 12.535  -11.529 4.345   1.00 13.21 ? 1932 ILE A O   1 
ATOM   2167 C  CB  . ILE A 1 253 ? 9.614   -12.226 2.861   1.00 15.25 ? 1932 ILE A CB  1 
ATOM   2168 C  CG1 . ILE A 1 253 ? 8.476   -11.594 2.043   1.00 15.92 ? 1932 ILE A CG1 1 
ATOM   2169 C  CG2 . ILE A 1 253 ? 9.346   -12.107 4.363   1.00 16.34 ? 1932 ILE A CG2 1 
ATOM   2170 C  CD1 . ILE A 1 253 ? 7.091   -12.207 2.308   1.00 15.61 ? 1932 ILE A CD1 1 
ATOM   2171 N  N   . TYR A 1 254 ? 12.493  -13.364 3.028   1.00 13.54 ? 1933 TYR A N   1 
ATOM   2172 C  CA  . TYR A 1 254 ? 13.601  -14.002 3.770   1.00 12.45 ? 1933 TYR A CA  1 
ATOM   2173 C  C   . TYR A 1 254 ? 14.848  -13.095 3.822   1.00 11.80 ? 1933 TYR A C   1 
ATOM   2174 O  O   . TYR A 1 254 ? 15.454  -12.902 4.880   1.00 13.95 ? 1933 TYR A O   1 
ATOM   2175 C  CB  . TYR A 1 254 ? 13.992  -15.304 3.076   1.00 13.42 ? 1933 TYR A CB  1 
ATOM   2176 C  CG  . TYR A 1 254 ? 15.078  -16.081 3.799   1.00 11.96 ? 1933 TYR A CG  1 
ATOM   2177 C  CD1 . TYR A 1 254 ? 14.759  -17.103 4.691   1.00 16.80 ? 1933 TYR A CD1 1 
ATOM   2178 C  CD2 . TYR A 1 254 ? 16.420  -15.801 3.577   1.00 16.46 ? 1933 TYR A CD2 1 
ATOM   2179 C  CE1 . TYR A 1 254 ? 15.759  -17.841 5.343   1.00 17.21 ? 1933 TYR A CE1 1 
ATOM   2180 C  CE2 . TYR A 1 254 ? 17.417  -16.515 4.228   1.00 16.67 ? 1933 TYR A CE2 1 
ATOM   2181 C  CZ  . TYR A 1 254 ? 17.079  -17.531 5.098   1.00 17.13 ? 1933 TYR A CZ  1 
ATOM   2182 O  OH  . TYR A 1 254 ? 18.078  -18.238 5.734   1.00 19.98 ? 1933 TYR A OH  1 
ATOM   2183 N  N   . GLY A 1 255 ? 15.245  -12.564 2.675   1.00 12.01 ? 1934 GLY A N   1 
ATOM   2184 C  CA  . GLY A 1 255 ? 16.439  -11.715 2.618   1.00 11.44 ? 1934 GLY A CA  1 
ATOM   2185 C  C   . GLY A 1 255 ? 16.291  -10.421 3.404   1.00 13.31 ? 1934 GLY A C   1 
ATOM   2186 O  O   . GLY A 1 255 ? 17.248  -9.948  4.020   1.00 14.18 ? 1934 GLY A O   1 
ATOM   2187 N  N   . ALA A 1 256 ? 15.095  -9.836  3.399   1.00 12.37 ? 1935 ALA A N   1 
ATOM   2188 C  CA  . ALA A 1 256 ? 14.835  -8.640  4.206   1.00 13.42 ? 1935 ALA A CA  1 
ATOM   2189 C  C   . ALA A 1 256 ? 15.041  -8.946  5.695   1.00 12.39 ? 1935 ALA A C   1 
ATOM   2190 O  O   . ALA A 1 256 ? 15.725  -8.206  6.420   1.00 13.79 ? 1935 ALA A O   1 
ATOM   2191 C  CB  . ALA A 1 256 ? 13.421  -8.084  3.935   1.00 13.97 ? 1935 ALA A CB  1 
ATOM   2192 N  N   . VAL A 1 257 ? 14.465  -10.050 6.152   1.00 11.31 ? 1936 VAL A N   1 
ATOM   2193 C  CA  . VAL A 1 257 ? 14.545  -10.395 7.553   1.00 11.87 ? 1936 VAL A CA  1 
ATOM   2194 C  C   . VAL A 1 257 ? 16.005  -10.754 7.910   1.00 11.25 ? 1936 VAL A C   1 
ATOM   2195 O  O   . VAL A 1 257 ? 16.515  -10.343 8.944   1.00 11.58 ? 1936 VAL A O   1 
ATOM   2196 C  CB  . VAL A 1 257 ? 13.562  -11.526 7.902   1.00 12.07 ? 1936 VAL A CB  1 
ATOM   2197 C  CG1 . VAL A 1 257 ? 13.733  -11.968 9.348   1.00 12.45 ? 1936 VAL A CG1 1 
ATOM   2198 C  CG2 . VAL A 1 257 ? 12.139  -11.059 7.660   1.00 13.51 ? 1936 VAL A CG2 1 
ATOM   2199 N  N   . HIS A 1 258 ? 16.672  -11.505 7.037   1.00 11.18 ? 1937 HIS A N   1 
ATOM   2200 C  CA  . HIS A 1 258 ? 18.074  -11.823 7.239   1.00 11.17 ? 1937 HIS A CA  1 
ATOM   2201 C  C   . HIS A 1 258 ? 18.903  -10.541 7.427   1.00 10.93 ? 1937 HIS A C   1 
ATOM   2202 O  O   . HIS A 1 258 ? 19.701  -10.422 8.366   1.00 11.85 ? 1937 HIS A O   1 
ATOM   2203 C  CB  . HIS A 1 258 ? 18.594  -12.630 6.050   1.00 12.14 ? 1937 HIS A CB  1 
ATOM   2204 C  CG  . HIS A 1 258 ? 20.024  -13.057 6.196   1.00 12.38 ? 1937 HIS A CG  1 
ATOM   2205 N  ND1 . HIS A 1 258 ? 21.085  -12.217 5.933   1.00 15.69 ? 1937 HIS A ND1 1 
ATOM   2206 C  CD2 . HIS A 1 258 ? 20.564  -14.230 6.609   1.00 15.41 ? 1937 HIS A CD2 1 
ATOM   2207 C  CE1 . HIS A 1 258 ? 22.221  -12.864 6.156   1.00 15.33 ? 1937 HIS A CE1 1 
ATOM   2208 N  NE2 . HIS A 1 258 ? 21.931  -14.080 6.584   1.00 17.64 ? 1937 HIS A NE2 1 
ATOM   2209 N  N   . ASP A 1 259 ? 18.720  -9.584  6.523   1.00 11.95 ? 1938 ASP A N   1 
ATOM   2210 C  CA  . ASP A 1 259 ? 19.498  -8.340  6.551   1.00 12.97 ? 1938 ASP A CA  1 
ATOM   2211 C  C   . ASP A 1 259 ? 19.242  -7.590  7.863   1.00 10.99 ? 1938 ASP A C   1 
ATOM   2212 O  O   . ASP A 1 259 ? 20.152  -7.000  8.446   1.00 14.04 ? 1938 ASP A O   1 
ATOM   2213 C  CB  . ASP A 1 259 ? 19.092  -7.475  5.351   1.00 14.62 ? 1938 ASP A CB  1 
ATOM   2214 C  CG  . ASP A 1 259 ? 20.223  -6.606  4.812   1.00 18.89 ? 1938 ASP A CG  1 
ATOM   2215 O  OD1 . ASP A 1 259 ? 21.380  -7.068  4.711   1.00 22.59 ? 1938 ASP A OD1 1 
ATOM   2216 O  OD2 . ASP A 1 259 ? 19.937  -5.448  4.418   1.00 21.48 ? 1938 ASP A OD2 1 
ATOM   2217 N  N   . LEU A 1 260 ? 17.992  -7.562  8.322   1.00 9.58  ? 1939 LEU A N   1 
ATOM   2218 C  CA  . LEU A 1 260 ? 17.683  -6.864  9.564   1.00 10.94 ? 1939 LEU A CA  1 
ATOM   2219 C  C   . LEU A 1 260 ? 18.338  -7.551  10.764  1.00 10.47 ? 1939 LEU A C   1 
ATOM   2220 O  O   . LEU A 1 260 ? 18.856  -6.887  11.663  1.00 10.83 ? 1939 LEU A O   1 
ATOM   2221 C  CB  . LEU A 1 260 ? 16.164  -6.779  9.773   1.00 10.70 ? 1939 LEU A CB  1 
ATOM   2222 C  CG  . LEU A 1 260 ? 15.367  -6.092  8.674   1.00 14.40 ? 1939 LEU A CG  1 
ATOM   2223 C  CD1 . LEU A 1 260 ? 13.873  -6.080  9.038   1.00 13.06 ? 1939 LEU A CD1 1 
ATOM   2224 C  CD2 . LEU A 1 260 ? 15.894  -4.788  8.118   1.00 15.68 ? 1939 LEU A CD2 1 
ATOM   2225 N  N   . ARG A 1 261 ? 18.283  -8.879  10.790  1.00 10.69 ? 1940 ARG A N   1 
ATOM   2226 C  CA  . ARG A 1 261 ? 18.819  -9.634  11.909  1.00 11.08 ? 1940 ARG A CA  1 
ATOM   2227 C  C   . ARG A 1 261 ? 20.323  -9.480  12.014  1.00 9.95  ? 1940 ARG A C   1 
ATOM   2228 O  O   . ARG A 1 261 ? 20.867  -9.585  13.106  1.00 12.33 ? 1940 ARG A O   1 
ATOM   2229 C  CB  . ARG A 1 261 ? 18.422  -11.110 11.812  1.00 13.47 ? 1940 ARG A CB  1 
ATOM   2230 C  CG  . ARG A 1 261 ? 16.935  -11.314 11.982  1.00 17.04 ? 1940 ARG A CG  1 
ATOM   2231 C  CD  . ARG A 1 261 ? 16.664  -12.316 13.049  1.00 26.32 ? 1940 ARG A CD  1 
ATOM   2232 N  NE  . ARG A 1 261 ? 15.259  -12.688 13.142  1.00 19.15 ? 1940 ARG A NE  1 
ATOM   2233 C  CZ  . ARG A 1 261 ? 14.837  -13.946 13.157  1.00 17.31 ? 1940 ARG A CZ  1 
ATOM   2234 N  NH1 . ARG A 1 261 ? 15.718  -14.938 13.056  1.00 21.89 ? 1940 ARG A NH1 1 
ATOM   2235 N  NH2 . ARG A 1 261 ? 13.548  -14.217 13.252  1.00 19.35 ? 1940 ARG A NH2 1 
ATOM   2236 N  N   . LEU A 1 262 ? 20.995  -9.222  10.898  1.00 10.89 ? 1941 LEU A N   1 
ATOM   2237 C  CA  . LEU A 1 262 ? 22.440  -8.955  10.952  1.00 10.55 ? 1941 LEU A CA  1 
ATOM   2238 C  C   . LEU A 1 262 ? 22.796  -7.739  11.810  1.00 11.57 ? 1941 LEU A C   1 
ATOM   2239 O  O   . LEU A 1 262 ? 23.939  -7.598  12.251  1.00 12.77 ? 1941 LEU A O   1 
ATOM   2240 C  CB  . LEU A 1 262 ? 22.996  -8.744  9.552   1.00 12.74 ? 1941 LEU A CB  1 
ATOM   2241 C  CG  . LEU A 1 262 ? 23.206  -9.978  8.683   1.00 14.86 ? 1941 LEU A CG  1 
ATOM   2242 C  CD1 . LEU A 1 262 ? 23.643  -9.515  7.309   1.00 18.97 ? 1941 LEU A CD1 1 
ATOM   2243 C  CD2 . LEU A 1 262 ? 24.260  -10.904 9.287   1.00 15.71 ? 1941 LEU A CD2 1 
ATOM   2244 N  N   . HIS A 1 263 ? 21.831  -6.843  12.017  1.00 10.05 ? 1942 HIS A N   1 
ATOM   2245 C  CA  . HIS A 1 263 ? 22.123  -5.519  12.602  1.00 9.53  ? 1942 HIS A CA  1 
ATOM   2246 C  C   . HIS A 1 263 ? 21.510  -5.243  13.975  1.00 9.66  ? 1942 HIS A C   1 
ATOM   2247 O  O   . HIS A 1 263 ? 21.972  -4.361  14.712  1.00 10.04 ? 1942 HIS A O   1 
ATOM   2248 C  CB  . HIS A 1 263 ? 21.766  -4.422  11.598  1.00 12.74 ? 1942 HIS A CB  1 
ATOM   2249 C  CG  . HIS A 1 263 ? 22.637  -4.458  10.391  1.00 14.62 ? 1942 HIS A CG  1 
ATOM   2250 N  ND1 . HIS A 1 263 ? 22.336  -5.213  9.279   1.00 14.80 ? 1942 HIS A ND1 1 
ATOM   2251 C  CD2 . HIS A 1 263 ? 23.844  -3.895  10.148  1.00 19.74 ? 1942 HIS A CD2 1 
ATOM   2252 C  CE1 . HIS A 1 263 ? 23.310  -5.095  8.391   1.00 13.81 ? 1942 HIS A CE1 1 
ATOM   2253 N  NE2 . HIS A 1 263 ? 24.228  -4.285  8.887   1.00 24.71 ? 1942 HIS A NE2 1 
ATOM   2254 N  N   . ARG A 1 264 ? 20.512  -6.034  14.358  1.00 9.29  ? 1943 ARG A N   1 
ATOM   2255 C  CA  . ARG A 1 264 ? 19.995  -5.939  15.721  1.00 8.54  ? 1943 ARG A CA  1 
ATOM   2256 C  C   . ARG A 1 264 ? 19.291  -7.259  16.077  1.00 8.14  ? 1943 ARG A C   1 
ATOM   2257 O  O   . ARG A 1 264 ? 18.712  -7.913  15.194  1.00 10.58 ? 1943 ARG A O   1 
ATOM   2258 C  CB  . ARG A 1 264 ? 19.005  -4.768  15.859  1.00 9.32  ? 1943 ARG A CB  1 
ATOM   2259 C  CG  . ARG A 1 264 ? 18.512  -4.544  17.311  1.00 8.94  ? 1943 ARG A CG  1 
ATOM   2260 C  CD  . ARG A 1 264 ? 17.715  -3.250  17.407  1.00 9.67  ? 1943 ARG A CD  1 
ATOM   2261 N  NE  . ARG A 1 264 ? 17.039  -3.049  18.690  1.00 9.07  ? 1943 ARG A NE  1 
ATOM   2262 C  CZ  . ARG A 1 264 ? 17.529  -2.353  19.725  1.00 9.05  ? 1943 ARG A CZ  1 
ATOM   2263 N  NH1 . ARG A 1 264 ? 18.748  -1.801  19.673  1.00 9.90  ? 1943 ARG A NH1 1 
ATOM   2264 N  NH2 . ARG A 1 264 ? 16.803  -2.227  20.834  1.00 10.30 ? 1943 ARG A NH2 1 
ATOM   2265 N  N   . VAL A 1 265 ? 19.337  -7.635  17.358  1.00 8.92  ? 1944 VAL A N   1 
ATOM   2266 C  CA  . VAL A 1 265 ? 18.673  -8.838  17.841  1.00 9.62  ? 1944 VAL A CA  1 
ATOM   2267 C  C   . VAL A 1 265 ? 17.136  -8.718  17.700  1.00 10.95 ? 1944 VAL A C   1 
ATOM   2268 O  O   . VAL A 1 265 ? 16.573  -7.631  17.795  1.00 11.05 ? 1944 VAL A O   1 
ATOM   2269 C  CB  . VAL A 1 265 ? 19.101  -9.116  19.304  1.00 10.91 ? 1944 VAL A CB  1 
ATOM   2270 C  CG1 . VAL A 1 265 ? 18.477  -8.118  20.277  1.00 10.37 ? 1944 VAL A CG1 1 
ATOM   2271 C  CG2 . VAL A 1 265 ? 18.860  -10.538 19.718  1.00 12.47 ? 1944 VAL A CG2 1 
ATOM   2272 N  N   . HIS A 1 266 ? 16.475  -9.847  17.446  1.00 13.50 ? 1945 HIS A N   1 
ATOM   2273 C  CA  . HIS A 1 266 ? 15.006  -9.939  17.495  1.00 13.57 ? 1945 HIS A CA  1 
ATOM   2274 C  C   . HIS A 1 266 ? 14.288  -9.141  16.418  1.00 14.03 ? 1945 HIS A C   1 
ATOM   2275 O  O   . HIS A 1 266 ? 13.113  -8.740  16.606  1.00 15.95 ? 1945 HIS A O   1 
ATOM   2276 C  CB  . HIS A 1 266 ? 14.447  -9.548  18.871  1.00 15.10 ? 1945 HIS A CB  1 
ATOM   2277 C  CG  . HIS A 1 266 ? 15.027  -10.329 20.005  1.00 15.50 ? 1945 HIS A CG  1 
ATOM   2278 N  ND1 . HIS A 1 266 ? 15.202  -11.698 19.956  1.00 15.93 ? 1945 HIS A ND1 1 
ATOM   2279 C  CD2 . HIS A 1 266 ? 15.453  -9.938  21.231  1.00 17.04 ? 1945 HIS A CD2 1 
ATOM   2280 C  CE1 . HIS A 1 266 ? 15.734  -12.111 21.094  1.00 20.15 ? 1945 HIS A CE1 1 
ATOM   2281 N  NE2 . HIS A 1 266 ? 15.896  -11.064 21.885  1.00 18.25 ? 1945 HIS A NE2 1 
ATOM   2282 N  N   . MET A 1 267 ? 14.962  -8.905  15.294  1.00 12.11 ? 1946 MET A N   1 
ATOM   2283 C  CA  . MET A 1 267 ? 14.307  -8.204  14.188  1.00 13.14 ? 1946 MET A CA  1 
ATOM   2284 C  C   . MET A 1 267 ? 13.417  -9.191  13.450  1.00 13.91 ? 1946 MET A C   1 
ATOM   2285 O  O   . MET A 1 267 ? 13.901  -9.981  12.633  1.00 17.48 ? 1946 MET A O   1 
ATOM   2286 C  CB  . MET A 1 267 ? 15.309  -7.566  13.236  1.00 12.79 ? 1946 MET A CB  1 
ATOM   2287 C  CG  . MET A 1 267 ? 16.117  -6.422  13.843  1.00 13.61 ? 1946 MET A CG  1 
ATOM   2288 S  SD  . MET A 1 267 ? 15.104  -4.935  14.203  1.00 15.56 ? 1946 MET A SD  1 
ATOM   2289 C  CE  . MET A 1 267 ? 14.647  -5.287  15.876  1.00 19.53 ? 1946 MET A CE  1 
ATOM   2290 N  N   . VAL A 1 268 ? 12.111  -9.093  13.717  1.00 12.46 ? 1947 VAL A N   1 
ATOM   2291 C  CA  . VAL A 1 268 ? 11.116  -10.124 13.428  1.00 12.35 ? 1947 VAL A CA  1 
ATOM   2292 C  C   . VAL A 1 268 ? 11.447  -11.277 14.352  1.00 15.97 ? 1947 VAL A C   1 
ATOM   2293 O  O   . VAL A 1 268 ? 12.437  -11.979 14.161  1.00 20.00 ? 1947 VAL A O   1 
ATOM   2294 C  CB  . VAL A 1 268 ? 11.089  -10.574 11.932  1.00 12.55 ? 1947 VAL A CB  1 
ATOM   2295 C  CG1 . VAL A 1 268 ? 9.942   -11.583 11.679  1.00 15.84 ? 1947 VAL A CG1 1 
ATOM   2296 C  CG2 . VAL A 1 268 ? 10.939  -9.348  10.981  1.00 12.86 ? 1947 VAL A CG2 1 
ATOM   2297 N  N   . GLN A 1 269 ? 10.670  -11.430 15.404  1.00 14.09 ? 1948 GLN A N   1 
ATOM   2298 C  CA  . GLN A 1 269 ? 11.094  -12.319 16.454  1.00 15.68 ? 1948 GLN A CA  1 
ATOM   2299 C  C   . GLN A 1 269 ? 10.222  -13.548 16.670  1.00 15.93 ? 1948 GLN A C   1 
ATOM   2300 O  O   . GLN A 1 269 ? 10.557  -14.418 17.472  1.00 18.01 ? 1948 GLN A O   1 
ATOM   2301 C  CB  . GLN A 1 269 ? 11.393  -11.537 17.726  1.00 21.20 ? 1948 GLN A CB  1 
ATOM   2302 C  CG  . GLN A 1 269 ? 10.314  -11.444 18.728  1.00 22.39 ? 1948 GLN A CG  1 
ATOM   2303 C  CD  . GLN A 1 269 ? 10.678  -10.507 19.867  1.00 19.44 ? 1948 GLN A CD  1 
ATOM   2304 O  OE1 . GLN A 1 269 ? 10.212  -9.384  19.904  1.00 18.74 ? 1948 GLN A OE1 1 
ATOM   2305 N  NE2 . GLN A 1 269 ? 11.510  -10.970 20.804  1.00 20.03 ? 1948 GLN A NE2 1 
ATOM   2306 N  N   . THR A 1 270 ? 9.111   -13.632 15.940  1.00 14.89 ? 1949 THR A N   1 
ATOM   2307 C  CA  . THR A 1 270 ? 8.263   -14.818 16.025  1.00 16.52 ? 1949 THR A CA  1 
ATOM   2308 C  C   . THR A 1 270 ? 7.925   -15.345 14.632  1.00 15.70 ? 1949 THR A C   1 
ATOM   2309 O  O   . THR A 1 270 ? 7.876   -14.591 13.647  1.00 14.81 ? 1949 THR A O   1 
ATOM   2310 C  CB  . THR A 1 270 ? 6.942   -14.521 16.764  1.00 17.17 ? 1949 THR A CB  1 
ATOM   2311 O  OG1 . THR A 1 270 ? 6.141   -13.636 15.969  1.00 18.72 ? 1949 THR A OG1 1 
ATOM   2312 C  CG2 . THR A 1 270 ? 7.204   -13.899 18.131  1.00 18.67 ? 1949 THR A CG2 1 
ATOM   2313 N  N   . GLU A 1 271 ? 7.657   -16.642 14.556  1.00 15.26 ? 1950 GLU A N   1 
ATOM   2314 C  CA  . GLU A 1 271 ? 7.155   -17.208 13.321  1.00 15.63 ? 1950 GLU A CA  1 
ATOM   2315 C  C   . GLU A 1 271 ? 5.859   -16.514 12.900  1.00 15.28 ? 1950 GLU A C   1 
ATOM   2316 O  O   . GLU A 1 271 ? 5.629   -16.326 11.722  1.00 15.88 ? 1950 GLU A O   1 
ATOM   2317 C  CB  . GLU A 1 271 ? 6.923   -18.717 13.442  1.00 19.00 ? 1950 GLU A CB  1 
ATOM   2318 C  CG  . GLU A 1 271 ? 6.782   -19.379 12.093  1.00 20.75 ? 1950 GLU A CG  1 
ATOM   2319 C  CD  . GLU A 1 271 ? 6.392   -20.837 12.213  1.00 27.99 ? 1950 GLU A CD  1 
ATOM   2320 O  OE1 . GLU A 1 271 ? 7.217   -21.609 12.724  1.00 30.03 ? 1950 GLU A OE1 1 
ATOM   2321 O  OE2 . GLU A 1 271 ? 5.260   -21.197 11.818  1.00 34.93 ? 1950 GLU A OE2 1 
ATOM   2322 N  N   . CYS A 1 272 ? 5.021   -16.158 13.875  1.00 15.70 ? 1951 CYS A N   1 
ATOM   2323 C  CA  B CYS A 1 272 ? 3.756   -15.474 13.588  0.50 16.38 ? 1951 CYS A CA  1 
ATOM   2324 C  CA  C CYS A 1 272 ? 3.763   -15.480 13.598  0.50 15.87 ? 1951 CYS A CA  1 
ATOM   2325 C  C   . CYS A 1 272 ? 4.000   -14.179 12.816  1.00 15.06 ? 1951 CYS A C   1 
ATOM   2326 O  O   . CYS A 1 272 ? 3.295   -13.873 11.864  1.00 15.23 ? 1951 CYS A O   1 
ATOM   2327 C  CB  B CYS A 1 272 ? 3.011   -15.159 14.887  0.50 17.73 ? 1951 CYS A CB  1 
ATOM   2328 C  CB  C CYS A 1 272 ? 3.066   -15.174 14.919  0.50 17.08 ? 1951 CYS A CB  1 
ATOM   2329 S  SG  B CYS A 1 272 ? 2.040   -16.526 15.516  0.50 26.76 ? 1951 CYS A SG  1 
ATOM   2330 S  SG  C CYS A 1 272 ? 1.387   -14.664 14.718  0.50 21.77 ? 1951 CYS A SG  1 
ATOM   2331 N  N   . GLN A 1 273 ? 5.009   -13.409 13.219  1.00 13.48 ? 1952 GLN A N   1 
ATOM   2332 C  CA  . GLN A 1 273 ? 5.346   -12.203 12.460  1.00 12.37 ? 1952 GLN A CA  1 
ATOM   2333 C  C   . GLN A 1 273 ? 5.830   -12.533 11.041  1.00 11.32 ? 1952 GLN A C   1 
ATOM   2334 O  O   . GLN A 1 273 ? 5.501   -11.837 10.081  1.00 12.08 ? 1952 GLN A O   1 
ATOM   2335 C  CB  . GLN A 1 273 ? 6.379   -11.363 13.200  1.00 12.48 ? 1952 GLN A CB  1 
ATOM   2336 C  CG  . GLN A 1 273 ? 5.822   -10.686 14.459  1.00 13.56 ? 1952 GLN A CG  1 
ATOM   2337 C  CD  . GLN A 1 273 ? 6.905   -10.139 15.408  1.00 14.04 ? 1952 GLN A CD  1 
ATOM   2338 O  OE1 . GLN A 1 273 ? 8.087   -10.448 15.271  1.00 14.58 ? 1952 GLN A OE1 1 
ATOM   2339 N  NE2 . GLN A 1 273 ? 6.493   -9.333  16.378  1.00 16.32 ? 1952 GLN A NE2 1 
ATOM   2340 N  N   . TYR A 1 274 ? 6.644   -13.585 10.914  1.00 12.25 ? 1953 TYR A N   1 
ATOM   2341 C  CA  . TYR A 1 274 ? 7.111   -13.999 9.613   1.00 12.60 ? 1953 TYR A CA  1 
ATOM   2342 C  C   . TYR A 1 274 ? 5.953   -14.390 8.693   1.00 15.17 ? 1953 TYR A C   1 
ATOM   2343 O  O   . TYR A 1 274 ? 5.925   -14.004 7.526   1.00 14.87 ? 1953 TYR A O   1 
ATOM   2344 C  CB  . TYR A 1 274 ? 8.109   -15.145 9.778   1.00 13.00 ? 1953 TYR A CB  1 
ATOM   2345 C  CG  . TYR A 1 274 ? 8.960   -15.429 8.572   1.00 13.13 ? 1953 TYR A CG  1 
ATOM   2346 C  CD1 . TYR A 1 274 ? 9.934   -14.505 8.152   1.00 15.10 ? 1953 TYR A CD1 1 
ATOM   2347 C  CD2 . TYR A 1 274 ? 8.854   -16.651 7.882   1.00 15.09 ? 1953 TYR A CD2 1 
ATOM   2348 C  CE1 . TYR A 1 274 ? 10.744  -14.767 7.057   1.00 12.46 ? 1953 TYR A CE1 1 
ATOM   2349 C  CE2 . TYR A 1 274 ? 9.678   -16.935 6.784   1.00 13.62 ? 1953 TYR A CE2 1 
ATOM   2350 C  CZ  . TYR A 1 274 ? 10.618  -15.983 6.376   1.00 13.96 ? 1953 TYR A CZ  1 
ATOM   2351 O  OH  . TYR A 1 274 ? 11.411  -16.236 5.286   1.00 16.95 ? 1953 TYR A OH  1 
ATOM   2352 N  N   . VAL A 1 275 ? 5.000   -15.148 9.233   1.00 13.54 ? 1954 VAL A N   1 
ATOM   2353 C  CA  . VAL A 1 275 ? 3.791   -15.528 8.488   1.00 16.07 ? 1954 VAL A CA  1 
ATOM   2354 C  C   . VAL A 1 275 ? 3.018   -14.266 8.099   1.00 14.64 ? 1954 VAL A C   1 
ATOM   2355 O  O   . VAL A 1 275 ? 2.570   -14.130 6.955   1.00 15.71 ? 1954 VAL A O   1 
ATOM   2356 C  CB  . VAL A 1 275 ? 2.906   -16.457 9.325   1.00 15.35 ? 1954 VAL A CB  1 
ATOM   2357 C  CG1 . VAL A 1 275 ? 1.540   -16.667 8.670   1.00 18.70 ? 1954 VAL A CG1 1 
ATOM   2358 C  CG2 . VAL A 1 275 ? 3.591   -17.804 9.526   1.00 20.11 ? 1954 VAL A CG2 1 
ATOM   2359 N  N   . TYR A 1 276 ? 2.888   -13.331 9.043   1.00 13.23 ? 1955 TYR A N   1 
ATOM   2360 C  CA  . TYR A 1 276 ? 2.123   -12.110 8.797   1.00 12.83 ? 1955 TYR A CA  1 
ATOM   2361 C  C   . TYR A 1 276 ? 2.712   -11.323 7.627   1.00 11.39 ? 1955 TYR A C   1 
ATOM   2362 O  O   . TYR A 1 276 ? 1.975   -10.772 6.805   1.00 13.39 ? 1955 TYR A O   1 
ATOM   2363 C  CB  . TYR A 1 276 ? 2.103   -11.265 10.060  1.00 13.59 ? 1955 TYR A CB  1 
ATOM   2364 C  CG  . TYR A 1 276 ? 1.281   -10.008 9.959   1.00 11.21 ? 1955 TYR A CG  1 
ATOM   2365 C  CD1 . TYR A 1 276 ? -0.116  -10.055 9.982   1.00 13.83 ? 1955 TYR A CD1 1 
ATOM   2366 C  CD2 . TYR A 1 276 ? 1.893   -8.768  9.873   1.00 13.97 ? 1955 TYR A CD2 1 
ATOM   2367 C  CE1 . TYR A 1 276 ? -0.863  -8.882  9.906   1.00 14.55 ? 1955 TYR A CE1 1 
ATOM   2368 C  CE2 . TYR A 1 276 ? 1.160   -7.612  9.779   1.00 14.71 ? 1955 TYR A CE2 1 
ATOM   2369 C  CZ  . TYR A 1 276 ? -0.209  -7.664  9.816   1.00 12.97 ? 1955 TYR A CZ  1 
ATOM   2370 O  OH  . TYR A 1 276 ? -0.901  -6.481  9.732   1.00 14.14 ? 1955 TYR A OH  1 
ATOM   2371 N  N   . LEU A 1 277 ? 4.046   -11.263 7.547   1.00 12.31 ? 1956 LEU A N   1 
ATOM   2372 C  CA  . LEU A 1 277 ? 4.676   -10.583 6.414   1.00 10.58 ? 1956 LEU A CA  1 
ATOM   2373 C  C   . LEU A 1 277 ? 4.282   -11.221 5.084   1.00 12.83 ? 1956 LEU A C   1 
ATOM   2374 O  O   . LEU A 1 277 ? 4.012   -10.522 4.099   1.00 14.04 ? 1956 LEU A O   1 
ATOM   2375 C  CB  . LEU A 1 277 ? 6.187   -10.634 6.547   1.00 11.73 ? 1956 LEU A CB  1 
ATOM   2376 C  CG  . LEU A 1 277 ? 6.746   -9.712  7.635   1.00 11.61 ? 1956 LEU A CG  1 
ATOM   2377 C  CD1 . LEU A 1 277 ? 8.237   -10.016 7.872   1.00 13.00 ? 1956 LEU A CD1 1 
ATOM   2378 C  CD2 . LEU A 1 277 ? 6.562   -8.238  7.263   1.00 12.87 ? 1956 LEU A CD2 1 
ATOM   2379 N  N   . HIS A 1 278 ? 4.265   -12.555 5.052   1.00 13.55 ? 1957 HIS A N   1 
ATOM   2380 C  CA  . HIS A 1 278 ? 3.841   -13.264 3.847   1.00 13.81 ? 1957 HIS A CA  1 
ATOM   2381 C  C   . HIS A 1 278 ? 2.367   -13.005 3.555   1.00 14.55 ? 1957 HIS A C   1 
ATOM   2382 O  O   . HIS A 1 278 ? 1.983   -12.870 2.393   1.00 17.09 ? 1957 HIS A O   1 
ATOM   2383 C  CB  . HIS A 1 278 ? 4.079   -14.770 3.992   1.00 14.96 ? 1957 HIS A CB  1 
ATOM   2384 C  CG  . HIS A 1 278 ? 5.523   -15.157 3.867   1.00 15.72 ? 1957 HIS A CG  1 
ATOM   2385 N  ND1 . HIS A 1 278 ? 6.447   -14.936 4.870   1.00 16.09 ? 1957 HIS A ND1 1 
ATOM   2386 C  CD2 . HIS A 1 278 ? 6.208   -15.734 2.850   1.00 15.17 ? 1957 HIS A CD2 1 
ATOM   2387 C  CE1 . HIS A 1 278 ? 7.633   -15.376 4.481   1.00 17.31 ? 1957 HIS A CE1 1 
ATOM   2388 N  NE2 . HIS A 1 278 ? 7.519   -15.857 3.256   1.00 17.42 ? 1957 HIS A NE2 1 
ATOM   2389 N  N   . GLN A 1 279 ? 1.542   -12.947 4.598   1.00 14.40 ? 1958 GLN A N   1 
ATOM   2390 C  CA  . GLN A 1 279 ? 0.110   -12.662 4.404   1.00 14.42 ? 1958 GLN A CA  1 
ATOM   2391 C  C   . GLN A 1 279 ? -0.116  -11.259 3.833   1.00 14.96 ? 1958 GLN A C   1 
ATOM   2392 O  O   . GLN A 1 279 ? -1.003  -11.053 3.009   1.00 17.52 ? 1958 GLN A O   1 
ATOM   2393 C  CB  . GLN A 1 279 ? -0.653  -12.830 5.714   1.00 17.50 ? 1958 GLN A CB  1 
ATOM   2394 C  CG  . GLN A 1 279 ? -0.776  -14.277 6.159   1.00 18.98 ? 1958 GLN A CG  1 
ATOM   2395 C  CD  . GLN A 1 279 ? -1.273  -14.434 7.588   1.00 23.95 ? 1958 GLN A CD  1 
ATOM   2396 O  OE1 . GLN A 1 279 ? -0.994  -13.592 8.454   1.00 25.42 ? 1958 GLN A OE1 1 
ATOM   2397 N  NE2 . GLN A 1 279 ? -2.010  -15.531 7.848   1.00 22.82 ? 1958 GLN A NE2 1 
ATOM   2398 N  N   . CYS A 1 280 ? 0.688   -10.295 4.278   1.00 13.74 ? 1959 CYS A N   1 
ATOM   2399 C  CA  . CYS A 1 280 ? 0.569   -8.946  3.746   1.00 15.28 ? 1959 CYS A CA  1 
ATOM   2400 C  C   . CYS A 1 280 ? 0.888   -8.918  2.258   1.00 14.43 ? 1959 CYS A C   1 
ATOM   2401 O  O   . CYS A 1 280 ? 0.149   -8.324  1.473   1.00 16.54 ? 1959 CYS A O   1 
ATOM   2402 C  CB  . CYS A 1 280 ? 1.491   -7.966  4.477   1.00 13.34 ? 1959 CYS A CB  1 
ATOM   2403 S  SG  . CYS A 1 280 ? 1.020   -7.600  6.165   1.00 14.76 ? 1959 CYS A SG  1 
ATOM   2404 N  N   . VAL A 1 281 ? 1.995   -9.544  1.872   1.00 16.41 ? 1960 VAL A N   1 
ATOM   2405 C  CA  . VAL A 1 281 ? 2.391   -9.562  0.477   1.00 14.53 ? 1960 VAL A CA  1 
ATOM   2406 C  C   . VAL A 1 281 ? 1.337   -10.281 -0.368  1.00 16.75 ? 1960 VAL A C   1 
ATOM   2407 O  O   . VAL A 1 281 ? 0.915   -9.767  -1.403  1.00 19.15 ? 1960 VAL A O   1 
ATOM   2408 C  CB  . VAL A 1 281 ? 3.795   -10.199 0.303   1.00 17.00 ? 1960 VAL A CB  1 
ATOM   2409 C  CG1 . VAL A 1 281 ? 4.073   -10.507 -1.163  1.00 19.75 ? 1960 VAL A CG1 1 
ATOM   2410 C  CG2 . VAL A 1 281 ? 4.860   -9.265  0.873   1.00 19.36 ? 1960 VAL A CG2 1 
ATOM   2411 N  N   . ARG A 1 282 ? 0.894   -11.444 0.097   1.00 15.69 ? 1961 ARG A N   1 
ATOM   2412 C  CA  . ARG A 1 282 ? -0.204  -12.175 -0.557  1.00 17.79 ? 1961 ARG A CA  1 
ATOM   2413 C  C   . ARG A 1 282 ? -1.395  -11.266 -0.782  1.00 19.78 ? 1961 ARG A C   1 
ATOM   2414 O  O   . ARG A 1 282 ? -1.992  -11.289 -1.859  1.00 20.40 ? 1961 ARG A O   1 
ATOM   2415 C  CB  . ARG A 1 282 ? -0.639  -13.356 0.304   1.00 19.57 ? 1961 ARG A CB  1 
ATOM   2416 C  CG  . ARG A 1 282 ? -1.687  -14.247 -0.349  1.00 21.15 ? 1961 ARG A CG  1 
ATOM   2417 C  CD  . ARG A 1 282 ? -2.339  -15.126 0.686   1.00 20.11 ? 1961 ARG A CD  1 
ATOM   2418 N  NE  . ARG A 1 282 ? -3.011  -14.337 1.703   1.00 19.24 ? 1961 ARG A NE  1 
ATOM   2419 C  CZ  . ARG A 1 282 ? -3.400  -14.808 2.880   1.00 22.48 ? 1961 ARG A CZ  1 
ATOM   2420 N  NH1 . ARG A 1 282 ? -3.196  -16.089 3.181   1.00 22.87 ? 1961 ARG A NH1 1 
ATOM   2421 N  NH2 . ARG A 1 282 ? -4.004  -14.000 3.749   1.00 27.95 ? 1961 ARG A NH2 1 
ATOM   2422 N  N   . ASP A 1 283 ? -1.793  -10.512 0.238   1.00 18.64 ? 1962 ASP A N   1 
ATOM   2423 C  CA  . ASP A 1 283 ? -3.064  -9.763  0.155   1.00 19.89 ? 1962 ASP A CA  1 
ATOM   2424 C  C   . ASP A 1 283 ? -2.914  -8.582  -0.799  1.00 19.26 ? 1962 ASP A C   1 
ATOM   2425 O  O   . ASP A 1 283 ? -3.858  -8.226  -1.528  1.00 22.41 ? 1962 ASP A O   1 
ATOM   2426 C  CB  . ASP A 1 283 ? -3.496  -9.273  1.530   1.00 20.11 ? 1962 ASP A CB  1 
ATOM   2427 C  CG  . ASP A 1 283 ? -4.021  -10.393 2.414   1.00 17.74 ? 1962 ASP A CG  1 
ATOM   2428 O  OD1 . ASP A 1 283 ? -4.191  -11.546 1.929   1.00 25.30 ? 1962 ASP A OD1 1 
ATOM   2429 O  OD2 . ASP A 1 283 ? -4.285  -10.124 3.605   1.00 23.94 ? 1962 ASP A OD2 1 
ATOM   2430 N  N   . VAL A 1 284 ? -1.727  -7.977  -0.805  1.00 19.09 ? 1963 VAL A N   1 
ATOM   2431 C  CA  . VAL A 1 284 ? -1.428  -6.928  -1.776  1.00 20.27 ? 1963 VAL A CA  1 
ATOM   2432 C  C   . VAL A 1 284 ? -1.516  -7.454  -3.214  1.00 20.65 ? 1963 VAL A C   1 
ATOM   2433 O  O   . VAL A 1 284 ? -2.148  -6.827  -4.070  1.00 22.10 ? 1963 VAL A O   1 
ATOM   2434 C  CB  . VAL A 1 284 ? -0.039  -6.297  -1.522  1.00 19.99 ? 1963 VAL A CB  1 
ATOM   2435 C  CG1 . VAL A 1 284 ? 0.411   -5.502  -2.715  1.00 20.07 ? 1963 VAL A CG1 1 
ATOM   2436 C  CG2 . VAL A 1 284 ? -0.061  -5.432  -0.276  1.00 20.03 ? 1963 VAL A CG2 1 
ATOM   2437 N  N   . LEU A 1 285 ? -0.889  -8.603  -3.468  1.00 20.79 ? 1964 LEU A N   1 
ATOM   2438 C  CA  . LEU A 1 285 ? -0.931  -9.227  -4.788  1.00 20.78 ? 1964 LEU A CA  1 
ATOM   2439 C  C   . LEU A 1 285 ? -2.336  -9.681  -5.214  1.00 20.92 ? 1964 LEU A C   1 
ATOM   2440 O  O   . LEU A 1 285 ? -2.716  -9.534  -6.381  1.00 25.07 ? 1964 LEU A O   1 
ATOM   2441 C  CB  . LEU A 1 285 ? 0.073   -10.379 -4.908  1.00 19.91 ? 1964 LEU A CB  1 
ATOM   2442 C  CG  . LEU A 1 285 ? 1.526   -9.939  -4.686  1.00 23.26 ? 1964 LEU A CG  1 
ATOM   2443 C  CD1 . LEU A 1 285 ? 2.477   -11.133 -4.706  1.00 22.88 ? 1964 LEU A CD1 1 
ATOM   2444 C  CD2 . LEU A 1 285 ? 1.956   -8.870  -5.697  1.00 22.69 ? 1964 LEU A CD2 1 
ATOM   2445 N  N   . ARG A 1 286 ? -3.111  -10.212 -4.273  1.00 21.07 ? 1965 ARG A N   1 
ATOM   2446 C  CA  . ARG A 1 286 ? -4.509  -10.580 -4.560  1.00 23.31 ? 1965 ARG A CA  1 
ATOM   2447 C  C   . ARG A 1 286 ? -5.339  -9.367  -4.942  1.00 25.13 ? 1965 ARG A C   1 
ATOM   2448 O  O   . ARG A 1 286 ? -6.220  -9.446  -5.799  1.00 25.73 ? 1965 ARG A O   1 
ATOM   2449 C  CB  . ARG A 1 286 ? -5.164  -11.228 -3.346  1.00 23.23 ? 1965 ARG A CB  1 
ATOM   2450 C  CG  . ARG A 1 286 ? -4.728  -12.635 -3.093  1.00 23.05 ? 1965 ARG A CG  1 
ATOM   2451 C  CD  . ARG A 1 286 ? -5.263  -13.111 -1.767  1.00 25.86 ? 1965 ARG A CD  1 
ATOM   2452 N  NE  . ARG A 1 286 ? -5.038  -14.539 -1.549  1.00 29.78 ? 1965 ARG A NE  1 
ATOM   2453 C  CZ  . ARG A 1 286 ? -5.599  -15.230 -0.564  1.00 28.32 ? 1965 ARG A CZ  1 
ATOM   2454 N  NH1 . ARG A 1 286 ? -6.419  -14.628 0.290   1.00 29.60 ? 1965 ARG A NH1 1 
ATOM   2455 N  NH2 . ARG A 1 286 ? -5.341  -16.522 -0.426  1.00 34.26 ? 1965 ARG A NH2 1 
ATOM   2456 N  N   . ALA A 1 287 ? -5.081  -8.246  -4.280  1.00 23.42 ? 1966 ALA A N   1 
ATOM   2457 C  CA  . ALA A 1 287 ? -5.883  -7.045  -4.509  1.00 26.36 ? 1966 ALA A CA  1 
ATOM   2458 C  C   . ALA A 1 287 ? -5.551  -6.448  -5.867  1.00 27.39 ? 1966 ALA A C   1 
ATOM   2459 O  O   . ALA A 1 287 ? -6.441  -5.988  -6.589  1.00 29.02 ? 1966 ALA A O   1 
ATOM   2460 C  CB  . ALA A 1 287 ? -5.644  -6.034  -3.399  1.00 29.27 ? 1966 ALA A CB  1 
ATOM   2461 N  N   . ARG A 1 288 ? -4.271  -6.469  -6.223  1.00 29.35 ? 1967 ARG A N   1 
ATOM   2462 C  CA  . ARG A 1 288 ? -3.834  -6.112  -7.562  1.00 31.62 ? 1967 ARG A CA  1 
ATOM   2463 C  C   . ARG A 1 288 ? -4.695  -6.773  -8.632  1.00 32.66 ? 1967 ARG A C   1 
ATOM   2464 O  O   . ARG A 1 288 ? -5.055  -6.142  -9.623  1.00 32.43 ? 1967 ARG A O   1 
ATOM   2465 C  CB  . ARG A 1 288 ? -2.372  -6.508  -7.768  1.00 33.62 ? 1967 ARG A CB  1 
ATOM   2466 C  CG  . ARG A 1 288 ? -1.380  -5.449  -7.362  1.00 34.09 ? 1967 ARG A CG  1 
ATOM   2467 C  CD  . ARG A 1 288 ? 0.027   -5.947  -7.620  1.00 39.69 ? 1967 ARG A CD  1 
ATOM   2468 N  NE  . ARG A 1 288 ? 1.032   -4.967  -7.236  1.00 41.52 ? 1967 ARG A NE  1 
ATOM   2469 C  CZ  . ARG A 1 288 ? 2.341   -5.144  -7.384  1.00 42.52 ? 1967 ARG A CZ  1 
ATOM   2470 N  NH1 . ARG A 1 288 ? 2.806   -6.268  -7.916  1.00 48.85 ? 1967 ARG A NH1 1 
ATOM   2471 N  NH2 . ARG A 1 288 ? 3.184   -4.196  -7.005  1.00 41.89 ? 1967 ARG A NH2 1 
ATOM   2472 N  N   . LYS A 1 289 ? -5.014  -8.047  -8.430  1.00 32.71 ? 1968 LYS A N   1 
ATOM   2473 C  CA  . LYS A 1 289 ? -5.564  -8.871  -9.499  1.00 34.75 ? 1968 LYS A CA  1 
ATOM   2474 C  C   . LYS A 1 289 ? -7.076  -8.740  -9.598  1.00 37.31 ? 1968 LYS A C   1 
ATOM   2475 O  O   . LYS A 1 289 ? -7.682  -9.193  -10.571 1.00 37.24 ? 1968 LYS A O   1 
ATOM   2476 C  CB  . LYS A 1 289 ? -5.146  -10.332 -9.318  1.00 34.82 ? 1968 LYS A CB  1 
ATOM   2477 C  CG  . LYS A 1 289 ? -3.649  -10.536 -9.424  1.00 37.31 ? 1968 LYS A CG  1 
ATOM   2478 C  CD  . LYS A 1 289 ? -3.300  -11.997 -9.645  1.00 35.02 ? 1968 LYS A CD  1 
ATOM   2479 C  CE  . LYS A 1 289 ? -3.479  -12.792 -8.372  1.00 36.29 ? 1968 LYS A CE  1 
ATOM   2480 N  NZ  . LYS A 1 289 ? -2.547  -13.949 -8.308  1.00 37.27 ? 1968 LYS A NZ  1 
ATOM   2481 N  N   . LEU A 1 290 ? -7.684  -8.109  -8.598  1.00 39.87 ? 1969 LEU A N   1 
ATOM   2482 C  CA  . LEU A 1 290 ? -8.940  -7.381  -8.803  1.00 41.74 ? 1969 LEU A CA  1 
ATOM   2483 C  C   . LEU A 1 290 ? -9.271  -7.247  -10.289 1.00 45.08 ? 1969 LEU A C   1 
ATOM   2484 O  O   . LEU A 1 290 ? -10.389 -7.545  -10.721 1.00 49.28 ? 1969 LEU A O   1 
ATOM   2485 C  CB  . LEU A 1 290 ? -8.861  -5.994  -8.162  1.00 41.27 ? 1969 LEU A CB  1 
ATOM   2486 C  CG  . LEU A 1 290 ? -8.758  -4.760  -9.073  1.00 39.47 ? 1969 LEU A CG  1 
ATOM   2487 C  CD1 . LEU A 1 290 ? -8.566  -3.498  -8.248  1.00 39.31 ? 1969 LEU A CD1 1 
ATOM   2488 C  CD2 . LEU A 1 290 ? -7.639  -4.897  -10.094 1.00 39.78 ? 1969 LEU A CD2 1 
HETATM 2489 MG MG  . MG  B 2 .   ? 2.381   23.540  30.505  1.00 16.73 ? 401  MG  A MG  1 
HETATM 2490 NA NA  . NA  C 3 .   ? 3.849   -12.197 17.384  1.00 18.17 ? 402  NA  A NA  1 
HETATM 2491 NA NA  . NA  D 3 .   ? 10.989  22.941  29.561  1.00 19.71 ? 403  NA  A NA  1 
HETATM 2492 O  O   . HOH E 4 .   ? 3.776   22.180  29.579  1.00 15.93 ? 1    HOH A O   1 
HETATM 2493 O  O   . HOH E 4 .   ? 3.325   25.197  29.778  1.00 18.45 ? 2    HOH A O   1 
HETATM 2494 O  O   . HOH E 4 .   ? 3.585   23.543  32.167  1.00 21.92 ? 3    HOH A O   1 
HETATM 2495 O  O   . HOH E 4 .   ? 0.888   24.762  31.474  1.00 14.94 ? 4    HOH A O   1 
HETATM 2496 O  O   . HOH E 4 .   ? 1.249   23.481  28.803  1.00 18.05 ? 5    HOH A O   1 
HETATM 2497 O  O   . HOH E 4 .   ? 1.265   21.871  31.265  1.00 21.42 ? 6    HOH A O   1 
HETATM 2498 O  O   . HOH E 4 .   ? 21.291  -6.186  19.001  1.00 9.90  ? 8    HOH A O   1 
HETATM 2499 O  O   . HOH E 4 .   ? 4.447   21.204  22.428  1.00 14.28 ? 10   HOH A O   1 
HETATM 2500 O  O   . HOH E 4 .   ? 6.918   0.600   1.714   1.00 13.57 ? 11   HOH A O   1 
HETATM 2501 O  O   . HOH E 4 .   ? 13.956  0.641   2.678   1.00 13.41 ? 12   HOH A O   1 
HETATM 2502 O  O   . HOH E 4 .   ? 12.952  9.694   6.983   1.00 13.49 ? 13   HOH A O   1 
HETATM 2503 O  O   . HOH E 4 .   ? 18.940  4.363   25.823  1.00 11.29 ? 14   HOH A O   1 
HETATM 2504 O  O   . HOH E 4 .   ? 28.838  -6.142  17.856  1.00 15.88 ? 15   HOH A O   1 
HETATM 2505 O  O   . HOH E 4 .   ? 26.403  -2.406  22.955  1.00 12.76 ? 16   HOH A O   1 
HETATM 2506 O  O   . HOH E 4 .   ? 14.119  10.608  9.245   1.00 13.30 ? 17   HOH A O   1 
HETATM 2507 O  O   . HOH E 4 .   ? -0.224  5.492   23.905  1.00 16.84 ? 18   HOH A O   1 
HETATM 2508 O  O   . HOH E 4 .   ? 15.056  5.243   22.738  1.00 11.77 ? 19   HOH A O   1 
HETATM 2509 O  O   . HOH E 4 .   ? 16.249  5.155   25.198  1.00 11.83 ? 20   HOH A O   1 
HETATM 2510 O  O   . HOH E 4 .   ? 24.871  3.449   21.749  1.00 12.78 ? 21   HOH A O   1 
HETATM 2511 O  O   . HOH E 4 .   ? 14.183  6.209   33.625  1.00 17.03 ? 22   HOH A O   1 
HETATM 2512 O  O   . HOH E 4 .   ? 8.749   4.155   30.707  1.00 17.42 ? 23   HOH A O   1 
HETATM 2513 O  O   . HOH E 4 .   ? 15.871  -2.545  26.166  1.00 13.93 ? 24   HOH A O   1 
HETATM 2514 O  O   . HOH E 4 .   ? 8.829   -1.560  29.977  1.00 24.82 ? 25   HOH A O   1 
HETATM 2515 O  O   . HOH E 4 .   ? 20.528  6.554   26.484  1.00 14.41 ? 26   HOH A O   1 
HETATM 2516 O  O   . HOH E 4 .   ? 19.570  24.421  25.286  1.00 16.36 ? 27   HOH A O   1 
HETATM 2517 O  O   . HOH E 4 .   ? 11.376  -15.019 0.801   1.00 17.90 ? 28   HOH A O   1 
HETATM 2518 O  O   . HOH E 4 .   ? 3.704   21.351  26.963  1.00 15.86 ? 29   HOH A O   1 
HETATM 2519 O  O   . HOH E 4 .   ? 30.544  0.387   19.561  1.00 20.67 ? 30   HOH A O   1 
HETATM 2520 O  O   . HOH E 4 .   ? 24.354  -1.923  31.401  1.00 19.19 ? 31   HOH A O   1 
HETATM 2521 O  O   . HOH E 4 .   ? 31.165  -14.860 18.351  1.00 20.98 ? 32   HOH A O   1 
HETATM 2522 O  O   . HOH E 4 .   ? -6.168  5.426   10.342  1.00 18.38 ? 33   HOH A O   1 
HETATM 2523 O  O   . HOH E 4 .   ? 21.543  -9.828  4.436   1.00 21.72 ? 34   HOH A O   1 
HETATM 2524 O  O   . HOH E 4 .   ? 14.732  6.255   5.829   1.00 14.20 ? 35   HOH A O   1 
HETATM 2525 O  O   . HOH E 4 .   ? -0.428  -0.048  18.478  1.00 20.30 ? 36   HOH A O   1 
HETATM 2526 O  O   . HOH E 4 .   ? 26.701  6.894   15.489  1.00 19.07 ? 37   HOH A O   1 
HETATM 2527 O  O   . HOH E 4 .   ? -4.677  -6.149  22.739  1.00 18.85 ? 38   HOH A O   1 
HETATM 2528 O  O   . HOH E 4 .   ? -2.578  22.145  22.708  1.00 21.54 ? 39   HOH A O   1 
HETATM 2529 O  O   . HOH E 4 .   ? 4.912   -27.035 4.155   1.00 28.39 ? 40   HOH A O   1 
HETATM 2530 O  O   . HOH E 4 .   ? 24.219  8.177   27.355  1.00 23.61 ? 41   HOH A O   1 
HETATM 2531 O  O   . HOH E 4 .   ? 1.959   10.583  16.571  1.00 15.75 ? 42   HOH A O   1 
HETATM 2532 O  O   . HOH E 4 .   ? 18.282  11.341  28.606  1.00 21.15 ? 43   HOH A O   1 
HETATM 2533 O  O   . HOH E 4 .   ? 14.178  5.144   3.385   1.00 18.98 ? 44   HOH A O   1 
HETATM 2534 O  O   . HOH E 4 .   ? 17.744  -1.133  32.972  1.00 20.26 ? 45   HOH A O   1 
HETATM 2535 O  O   . HOH E 4 .   ? 15.637  12.249  29.914  1.00 20.39 ? 46   HOH A O   1 
HETATM 2536 O  O   . HOH E 4 .   ? 6.875   6.093   31.570  1.00 22.70 ? 47   HOH A O   1 
HETATM 2537 O  O   . HOH E 4 .   ? 20.524  -10.940 15.423  1.00 14.66 ? 48   HOH A O   1 
HETATM 2538 O  O   . HOH E 4 .   ? -1.123  -13.332 16.874  1.00 22.57 ? 49   HOH A O   1 
HETATM 2539 O  O   . HOH E 4 .   ? 32.055  -6.089  20.360  1.00 15.67 ? 50   HOH A O   1 
HETATM 2540 O  O   . HOH E 4 .   ? 2.884   24.609  19.166  1.00 21.49 ? 51   HOH A O   1 
HETATM 2541 O  O   . HOH E 4 .   ? 15.441  8.898   5.402   1.00 22.23 ? 52   HOH A O   1 
HETATM 2542 O  O   . HOH E 4 .   ? 4.691   -2.901  23.781  1.00 21.49 ? 53   HOH A O   1 
HETATM 2543 O  O   . HOH E 4 .   ? 1.907   17.116  -1.820  1.00 22.78 ? 54   HOH A O   1 
HETATM 2544 O  O   . HOH E 4 .   ? -5.372  -3.798  18.859  1.00 22.28 ? 55   HOH A O   1 
HETATM 2545 O  O   . HOH E 4 .   ? 23.323  -2.154  17.455  1.00 16.94 ? 56   HOH A O   1 
HETATM 2546 O  O   . HOH E 4 .   ? 22.025  -5.454  30.962  1.00 27.95 ? 57   HOH A O   1 
HETATM 2547 O  O   . HOH E 4 .   ? -1.215  3.910   26.388  1.00 22.37 ? 58   HOH A O   1 
HETATM 2548 O  O   . HOH E 4 .   ? 3.294   0.126   -1.658  1.00 23.59 ? 59   HOH A O   1 
HETATM 2549 O  O   . HOH E 4 .   ? -0.905  -17.741 -0.550  1.00 25.18 ? 60   HOH A O   1 
HETATM 2550 O  O   . HOH E 4 .   ? 18.088  16.350  23.774  1.00 25.73 ? 61   HOH A O   1 
HETATM 2551 O  O   . HOH E 4 .   ? 0.461   -14.749 11.745  1.00 26.95 ? 62   HOH A O   1 
HETATM 2552 O  O   . HOH E 4 .   ? 6.303   -3.300  21.883  1.00 20.50 ? 63   HOH A O   1 
HETATM 2553 O  O   . HOH E 4 .   ? 20.313  17.585  23.791  1.00 26.32 ? 64   HOH A O   1 
HETATM 2554 O  O   . HOH E 4 .   ? 9.593   -13.439 -0.638  1.00 20.87 ? 65   HOH A O   1 
HETATM 2555 O  O   . HOH E 4 .   ? 3.697   -8.909  17.081  1.00 22.95 ? 66   HOH A O   1 
HETATM 2556 O  O   . HOH E 4 .   ? 30.927  -5.046  29.143  1.00 24.56 ? 67   HOH A O   1 
HETATM 2557 O  O   . HOH E 4 .   ? 11.735  -24.528 3.756   1.00 29.71 ? 68   HOH A O   1 
HETATM 2558 O  O   . HOH E 4 .   ? 27.369  1.674   11.559  1.00 26.13 ? 69   HOH A O   1 
HETATM 2559 O  O   . HOH E 4 .   ? 10.635  24.507  18.883  1.00 29.99 ? 70   HOH A O   1 
HETATM 2560 O  O   . HOH E 4 .   ? 6.908   -3.985  -9.584  1.00 37.91 ? 71   HOH A O   1 
HETATM 2561 O  O   . HOH E 4 .   ? 15.589  -25.233 9.256   1.00 29.07 ? 72   HOH A O   1 
HETATM 2562 O  O   . HOH E 4 .   ? -5.301  -4.976  14.815  1.00 19.68 ? 73   HOH A O   1 
HETATM 2563 O  O   . HOH E 4 .   ? 3.962   4.132   -0.127  1.00 18.59 ? 74   HOH A O   1 
HETATM 2564 O  O   . HOH E 4 .   ? -7.003  -7.003  5.712   1.00 22.08 ? 75   HOH A O   1 
HETATM 2565 O  O   . HOH E 4 .   ? 14.679  -13.393 17.450  1.00 21.33 ? 76   HOH A O   1 
HETATM 2566 O  O   . HOH E 4 .   ? -4.090  -1.112  27.530  1.00 26.42 ? 77   HOH A O   1 
HETATM 2567 O  O   . HOH E 4 .   ? 8.127   14.214  7.328   1.00 21.60 ? 78   HOH A O   1 
HETATM 2568 O  O   . HOH E 4 .   ? 21.206  -2.975  31.051  1.00 25.63 ? 79   HOH A O   1 
HETATM 2569 O  O   . HOH E 4 .   ? 21.289  13.741  6.726   1.00 33.21 ? 80   HOH A O   1 
HETATM 2570 O  O   . HOH E 4 .   ? 18.807  -14.023 14.768  1.00 17.94 ? 81   HOH A O   1 
HETATM 2571 O  O   . HOH E 4 .   ? 9.654   -16.968 1.812   1.00 22.40 ? 82   HOH A O   1 
HETATM 2572 O  O   . HOH E 4 .   ? -3.406  -17.706 5.881   1.00 24.46 ? 83   HOH A O   1 
HETATM 2573 O  O   . HOH E 4 .   ? 1.106   19.663  29.520  1.00 27.20 ? 84   HOH A O   1 
HETATM 2574 O  O   . HOH E 4 .   ? 7.604   -8.440  19.134  1.00 25.01 ? 85   HOH A O   1 
HETATM 2575 O  O   . HOH E 4 .   ? -5.936  -4.183  12.325  1.00 23.22 ? 86   HOH A O   1 
HETATM 2576 O  O   . HOH E 4 .   ? 0.437   14.424  22.946  1.00 25.89 ? 87   HOH A O   1 
HETATM 2577 O  O   . HOH E 4 .   ? 23.972  10.891  17.485  1.00 27.50 ? 88   HOH A O   1 
HETATM 2578 O  O   . HOH E 4 .   ? 13.867  9.586   1.187   1.00 26.34 ? 89   HOH A O   1 
HETATM 2579 O  O   . HOH E 4 .   ? 7.532   14.330  27.375  1.00 25.15 ? 90   HOH A O   1 
HETATM 2580 O  O   . HOH E 4 .   ? 3.282   18.772  27.938  1.00 21.43 ? 91   HOH A O   1 
HETATM 2581 O  O   . HOH E 4 .   ? 14.362  -17.358 13.180  1.00 20.71 ? 92   HOH A O   1 
HETATM 2582 O  O   . HOH E 4 .   ? 14.736  18.855  29.635  1.00 22.14 ? 93   HOH A O   1 
HETATM 2583 O  O   . HOH E 4 .   ? 1.765   -7.826  20.125  1.00 19.51 ? 94   HOH A O   1 
HETATM 2584 O  O   . HOH E 4 .   ? 12.595  20.704  8.393   1.00 28.05 ? 95   HOH A O   1 
HETATM 2585 O  O   . HOH E 4 .   ? 29.181  3.896   27.069  1.00 25.74 ? 96   HOH A O   1 
HETATM 2586 O  O   . HOH E 4 .   ? -3.511  9.111   7.283   1.00 24.18 ? 97   HOH A O   1 
HETATM 2587 O  O   . HOH E 4 .   ? 32.937  -3.378  23.127  1.00 21.45 ? 98   HOH A O   1 
HETATM 2588 O  O   . HOH E 4 .   ? 8.124   14.252  4.483   1.00 24.56 ? 99   HOH A O   1 
HETATM 2589 O  O   . HOH E 4 .   ? -0.132  9.063   1.641   1.00 31.43 ? 100  HOH A O   1 
HETATM 2590 O  O   . HOH E 4 .   ? 4.942   -17.379 16.625  1.00 29.87 ? 101  HOH A O   1 
HETATM 2591 O  O   . HOH E 4 .   ? 14.289  16.601  2.358   1.00 30.99 ? 102  HOH A O   1 
HETATM 2592 O  O   . HOH E 4 .   ? 30.331  -2.092  12.190  1.00 22.78 ? 103  HOH A O   1 
HETATM 2593 O  O   . HOH E 4 .   ? 8.097   -18.268 16.884  1.00 27.44 ? 104  HOH A O   1 
HETATM 2594 O  O   . HOH E 4 .   ? 22.466  -3.541  17.171  1.00 25.72 ? 105  HOH A O   1 
HETATM 2595 O  O   . HOH E 4 .   ? 3.482   -2.402  -2.915  1.00 28.88 ? 106  HOH A O   1 
HETATM 2596 O  O   . HOH E 4 .   ? 23.626  -5.840  5.577   1.00 24.65 ? 108  HOH A O   1 
HETATM 2597 O  O   . HOH E 4 .   ? 25.236  -14.080 11.052  1.00 24.78 ? 109  HOH A O   1 
HETATM 2598 O  O   . HOH E 4 .   ? 10.712  18.935  29.536  1.00 24.47 ? 110  HOH A O   1 
HETATM 2599 O  O   . HOH E 4 .   ? -3.845  19.420  16.361  1.00 28.60 ? 111  HOH A O   1 
HETATM 2600 O  O   . HOH E 4 .   ? 23.475  5.173   4.761   1.00 30.74 ? 112  HOH A O   1 
HETATM 2601 O  O   . HOH E 4 .   ? -6.437  -9.438  6.785   1.00 28.95 ? 113  HOH A O   1 
HETATM 2602 O  O   . HOH E 4 .   ? 26.516  -7.971  10.858  1.00 27.17 ? 114  HOH A O   1 
HETATM 2603 O  O   . HOH E 4 .   ? 27.463  6.242   27.909  1.00 28.68 ? 115  HOH A O   1 
HETATM 2604 O  O   . HOH E 4 .   ? 4.362   5.337   30.302  1.00 30.26 ? 116  HOH A O   1 
HETATM 2605 O  O   . HOH E 4 .   ? -7.182  3.616   8.482   1.00 27.94 ? 117  HOH A O   1 
HETATM 2606 O  O   . HOH E 4 .   ? 23.975  -1.332  10.702  1.00 26.56 ? 119  HOH A O   1 
HETATM 2607 O  O   . HOH E 4 .   ? 1.365   10.887  -2.344  1.00 27.57 ? 120  HOH A O   1 
HETATM 2608 O  O   . HOH E 4 .   ? 21.356  20.884  20.765  1.00 39.16 ? 121  HOH A O   1 
HETATM 2609 O  O   . HOH E 4 .   ? 30.697  7.335   26.313  1.00 24.82 ? 122  HOH A O   1 
HETATM 2610 O  O   . HOH E 4 .   ? 22.407  11.475  9.576   1.00 29.55 ? 123  HOH A O   1 
HETATM 2611 O  O   . HOH E 4 .   ? 12.524  -13.611 20.934  1.00 25.02 ? 124  HOH A O   1 
HETATM 2612 O  O   . HOH E 4 .   ? 7.210   -4.993  30.372  1.00 34.10 ? 125  HOH A O   1 
HETATM 2613 O  O   . HOH E 4 .   ? -1.152  8.516   20.448  1.00 28.34 ? 126  HOH A O   1 
HETATM 2614 O  O   . HOH E 4 .   ? 20.594  -19.588 11.575  1.00 25.44 ? 127  HOH A O   1 
HETATM 2615 O  O   . HOH E 4 .   ? 1.414   -24.992 -3.620  1.00 29.21 ? 128  HOH A O   1 
HETATM 2616 O  O   . HOH E 4 .   ? 23.010  26.895  20.473  1.00 27.80 ? 129  HOH A O   1 
HETATM 2617 O  O   . HOH E 4 .   ? -0.247  16.176  12.353  1.00 26.42 ? 130  HOH A O   1 
HETATM 2618 O  O   . HOH E 4 .   ? 13.343  0.220   -3.249  1.00 31.38 ? 131  HOH A O   1 
HETATM 2619 O  O   . HOH E 4 .   ? 0.982   -5.926  28.242  1.00 42.72 ? 132  HOH A O   1 
HETATM 2620 O  O   . HOH E 4 .   ? 1.469   20.642  11.755  1.00 30.89 ? 133  HOH A O   1 
HETATM 2621 O  O   . HOH E 4 .   ? 33.230  -0.061  32.980  1.00 32.84 ? 134  HOH A O   1 
HETATM 2622 O  O   . HOH E 4 .   ? 24.470  3.071   1.614   1.00 35.24 ? 135  HOH A O   1 
HETATM 2623 O  O   . HOH E 4 .   ? 13.283  10.182  -1.739  1.00 36.67 ? 136  HOH A O   1 
HETATM 2624 O  O   . HOH E 4 .   ? 21.183  -17.488 -0.259  1.00 30.43 ? 137  HOH A O   1 
HETATM 2625 O  O   . HOH E 4 .   ? 4.405   -0.891  34.734  1.00 27.51 ? 138  HOH A O   1 
HETATM 2626 O  O   . HOH E 4 .   ? 11.392  3.479   -2.598  1.00 32.31 ? 139  HOH A O   1 
HETATM 2627 O  O   . HOH E 4 .   ? 22.623  4.111   33.499  1.00 36.80 ? 140  HOH A O   1 
HETATM 2628 O  O   . HOH E 4 .   ? -6.445  -8.615  -0.807  1.00 28.64 ? 141  HOH A O   1 
HETATM 2629 O  O   . HOH E 4 .   ? 8.924   -5.000  23.144  1.00 27.94 ? 142  HOH A O   1 
HETATM 2630 O  O   . HOH E 4 .   ? -3.488  -11.503 11.253  1.00 34.06 ? 143  HOH A O   1 
HETATM 2631 O  O   . HOH E 4 .   ? 27.679  4.668   16.071  1.00 31.43 ? 144  HOH A O   1 
HETATM 2632 O  O   . HOH E 4 .   ? 0.534   -20.150 8.236   1.00 39.23 ? 145  HOH A O   1 
HETATM 2633 O  O   . HOH E 4 .   ? 9.065   -27.924 10.159  1.00 30.43 ? 146  HOH A O   1 
HETATM 2634 O  O   . HOH E 4 .   ? 9.759   -17.865 -7.748  1.00 30.27 ? 147  HOH A O   1 
HETATM 2635 O  O   . HOH E 4 .   ? 15.161  -5.874  32.443  1.00 28.49 ? 148  HOH A O   1 
HETATM 2636 O  O   . HOH E 4 .   ? 27.818  1.703   14.218  1.00 24.38 ? 149  HOH A O   1 
HETATM 2637 O  O   . HOH E 4 .   ? 26.648  -5.864  11.698  1.00 28.84 ? 150  HOH A O   1 
HETATM 2638 O  O   . HOH E 4 .   ? 14.738  -8.148  0.392   1.00 24.80 ? 151  HOH A O   1 
HETATM 2639 O  O   . HOH E 4 .   ? 19.902  -10.646 2.417   1.00 27.93 ? 152  HOH A O   1 
HETATM 2640 O  O   . HOH E 4 .   ? 5.234   -25.869 11.932  1.00 32.00 ? 153  HOH A O   1 
HETATM 2641 O  O   . HOH E 4 .   ? 4.302   8.278   30.071  1.00 36.93 ? 154  HOH A O   1 
HETATM 2642 O  O   . HOH E 4 .   ? -2.860  -4.299  -3.806  1.00 29.98 ? 156  HOH A O   1 
HETATM 2643 O  O   . HOH E 4 .   ? -5.636  -11.443 5.202   1.00 31.92 ? 158  HOH A O   1 
HETATM 2644 O  O   . HOH E 4 .   ? 6.731   1.971   -2.600  1.00 31.22 ? 159  HOH A O   1 
HETATM 2645 O  O   . HOH E 4 .   ? 16.963  -12.368 16.237  1.00 25.31 ? 160  HOH A O   1 
HETATM 2646 O  O   . HOH E 4 .   ? -0.928  -3.091  22.153  1.00 30.33 ? 161  HOH A O   1 
HETATM 2647 O  O   . HOH E 4 .   ? 9.477   16.287  8.271   1.00 31.04 ? 162  HOH A O   1 
HETATM 2648 O  O   . HOH E 4 .   ? 12.923  16.672  29.506  1.00 34.40 ? 163  HOH A O   1 
HETATM 2649 O  O   . HOH E 4 .   ? 19.595  15.464  29.407  1.00 27.67 ? 164  HOH A O   1 
HETATM 2650 O  O   . HOH E 4 .   ? -6.603  -12.091 0.665   1.00 42.27 ? 165  HOH A O   1 
HETATM 2651 O  O   . HOH E 4 .   ? 30.918  10.537  21.768  1.00 24.64 ? 166  HOH A O   1 
HETATM 2652 O  O   . HOH E 4 .   ? -3.104  -1.685  23.733  1.00 35.24 ? 167  HOH A O   1 
HETATM 2653 O  O   . HOH E 4 .   ? 32.213  1.001   7.260   1.00 32.69 ? 168  HOH A O   1 
HETATM 2654 O  O   . HOH E 4 .   ? 31.771  8.102   21.227  1.00 29.88 ? 169  HOH A O   1 
HETATM 2655 O  O   . HOH E 4 .   ? 1.289   -18.306 -6.838  1.00 32.37 ? 170  HOH A O   1 
HETATM 2656 O  O   . HOH E 4 .   ? 17.460  1.337   -3.522  1.00 38.14 ? 171  HOH A O   1 
HETATM 2657 O  O   . HOH E 4 .   ? 22.981  22.017  16.998  1.00 31.42 ? 172  HOH A O   1 
HETATM 2658 O  O   . HOH E 4 .   ? 1.251   -15.086 -6.685  1.00 28.84 ? 173  HOH A O   1 
HETATM 2659 O  O   . HOH E 4 .   ? -5.689  2.311   21.856  1.00 28.95 ? 174  HOH A O   1 
HETATM 2660 O  O   . HOH E 4 .   ? 18.684  -23.035 12.398  1.00 32.21 ? 175  HOH A O   1 
HETATM 2661 O  O   . HOH E 4 .   ? -3.304  -3.249  -1.556  1.00 27.81 ? 176  HOH A O   1 
HETATM 2662 O  O   . HOH E 4 .   ? 20.463  -17.575 7.261   1.00 28.87 ? 177  HOH A O   1 
HETATM 2663 O  O   . HOH E 4 .   ? 27.417  12.892  26.035  1.00 41.92 ? 178  HOH A O   1 
HETATM 2664 O  O   . HOH E 4 .   ? 20.322  8.777   30.554  1.00 30.84 ? 179  HOH A O   1 
HETATM 2665 O  O   . HOH E 4 .   ? 23.776  17.678  19.979  1.00 28.38 ? 180  HOH A O   1 
HETATM 2666 O  O   . HOH E 4 .   ? 5.860   -7.902  -11.453 1.00 40.10 ? 181  HOH A O   1 
HETATM 2667 O  O   . HOH E 4 .   ? -4.730  -6.055  2.689   1.00 31.82 ? 182  HOH A O   1 
HETATM 2668 O  O   . HOH E 4 .   ? 14.217  6.753   1.271   1.00 29.27 ? 183  HOH A O   1 
HETATM 2669 O  O   . HOH E 4 .   ? -4.626  -19.583 -2.652  1.00 32.67 ? 184  HOH A O   1 
HETATM 2670 O  O   . HOH E 4 .   ? 5.035   -10.154 -12.085 1.00 38.80 ? 185  HOH A O   1 
HETATM 2671 O  O   . HOH E 4 .   ? 11.899  -9.530  23.152  1.00 31.15 ? 186  HOH A O   1 
HETATM 2672 O  O   . HOH E 4 .   ? 14.809  -5.760  0.892   1.00 30.09 ? 187  HOH A O   1 
HETATM 2673 O  O   . HOH E 4 .   ? 7.904   -5.693  19.731  1.00 33.55 ? 188  HOH A O   1 
HETATM 2674 O  O   . HOH E 4 .   ? 16.863  5.804   32.449  1.00 25.91 ? 189  HOH A O   1 
HETATM 2675 O  O   . HOH E 4 .   ? 19.987  -22.012 5.081   1.00 43.56 ? 190  HOH A O   1 
HETATM 2676 O  O   . HOH E 4 .   ? 31.862  14.146  20.469  1.00 34.52 ? 191  HOH A O   1 
HETATM 2677 O  O   . HOH E 4 .   ? 14.902  5.620   -1.057  1.00 36.01 ? 192  HOH A O   1 
HETATM 2678 O  O   . HOH E 4 .   ? 0.654   -19.852 11.005  1.00 39.95 ? 193  HOH A O   1 
HETATM 2679 O  O   . HOH E 4 .   ? 10.954  -26.397 11.601  1.00 35.53 ? 194  HOH A O   1 
HETATM 2680 O  O   . HOH E 4 .   ? -2.788  7.760   4.745   1.00 32.42 ? 195  HOH A O   1 
HETATM 2681 O  O   . HOH E 4 .   ? 24.804  12.137  25.761  1.00 34.60 ? 196  HOH A O   1 
HETATM 2682 O  O   . HOH E 4 .   ? 14.371  -18.553 -4.085  1.00 34.96 ? 197  HOH A O   1 
HETATM 2683 O  O   . HOH E 4 .   ? 1.702   16.192  9.925   1.00 32.28 ? 198  HOH A O   1 
HETATM 2684 O  O   . HOH E 4 .   ? 29.372  -16.858 18.145  1.00 31.05 ? 199  HOH A O   1 
HETATM 2685 O  O   . HOH E 4 .   ? 3.957   14.397  28.139  1.00 33.31 ? 200  HOH A O   1 
HETATM 2686 O  O   . HOH E 4 .   ? 15.966  10.228  3.229   1.00 29.94 ? 202  HOH A O   1 
HETATM 2687 O  O   . HOH E 4 .   ? 20.481  19.964  29.296  1.00 27.99 ? 203  HOH A O   1 
HETATM 2688 O  O   . HOH E 4 .   ? -3.501  8.988   19.572  1.00 29.46 ? 204  HOH A O   1 
HETATM 2689 O  O   . HOH E 4 .   ? 13.880  -0.276  32.858  1.00 41.82 ? 205  HOH A O   1 
HETATM 2690 O  O   . HOH E 4 .   ? 6.664   -12.045 -11.355 1.00 38.49 ? 207  HOH A O   1 
HETATM 2691 O  O   . HOH E 4 .   ? -1.412  14.297  25.338  1.00 45.75 ? 208  HOH A O   1 
HETATM 2692 O  O   . HOH E 4 .   ? 24.075  -15.642 7.445   1.00 34.40 ? 209  HOH A O   1 
HETATM 2693 O  O   . HOH E 4 .   ? 3.428   -11.090 21.380  1.00 31.45 ? 211  HOH A O   1 
HETATM 2694 O  O   . HOH E 4 .   ? 28.834  1.439   16.426  1.00 27.99 ? 214  HOH A O   1 
HETATM 2695 O  O   . HOH E 4 .   ? 21.828  -4.272  3.189   1.00 33.90 ? 215  HOH A O   1 
HETATM 2696 O  O   . HOH E 4 .   ? -0.797  -9.469  -8.252  1.00 30.24 ? 216  HOH A O   1 
HETATM 2697 O  O   . HOH E 4 .   ? 0.327   24.848  15.439  1.00 29.28 ? 217  HOH A O   1 
HETATM 2698 O  O   . HOH E 4 .   ? 18.576  22.387  10.603  1.00 31.41 ? 218  HOH A O   1 
HETATM 2699 O  O   . HOH E 4 .   ? -2.111  4.265   2.808   1.00 43.22 ? 219  HOH A O   1 
HETATM 2700 O  O   . HOH E 4 .   ? 30.655  4.362   25.365  1.00 30.26 ? 220  HOH A O   1 
HETATM 2701 O  O   . HOH E 4 .   ? -2.997  0.139   25.513  1.00 29.71 ? 221  HOH A O   1 
HETATM 2702 O  O   . HOH E 4 .   ? 15.663  -2.494  33.096  1.00 37.62 ? 222  HOH A O   1 
HETATM 2703 O  O   . HOH E 4 .   ? -3.941  -11.499 15.298  1.00 27.90 ? 223  HOH A O   1 
HETATM 2704 O  O   . HOH E 4 .   ? 4.403   -32.125 9.175   1.00 42.38 ? 224  HOH A O   1 
HETATM 2705 O  O   . HOH E 4 .   ? 20.293  -18.169 18.553  1.00 27.68 ? 225  HOH A O   1 
HETATM 2706 O  O   . HOH E 4 .   ? 13.629  -14.691 18.522  1.00 32.42 ? 226  HOH A O   1 
HETATM 2707 O  O   . HOH E 4 .   ? 24.212  19.271  17.888  1.00 36.49 ? 227  HOH A O   1 
HETATM 2708 O  O   . HOH E 4 .   ? 11.433  -2.476  31.879  1.00 37.45 ? 228  HOH A O   1 
HETATM 2709 O  O   . HOH E 4 .   ? -0.822  11.599  23.627  1.00 34.09 ? 229  HOH A O   1 
HETATM 2710 O  O   . HOH E 4 .   ? 20.500  16.813  3.870   1.00 38.25 ? 230  HOH A O   1 
HETATM 2711 O  O   . HOH E 4 .   ? 19.381  -14.049 -4.080  1.00 45.25 ? 232  HOH A O   1 
HETATM 2712 O  O   . HOH E 4 .   ? 25.727  -2.547  7.183   1.00 46.72 ? 233  HOH A O   1 
HETATM 2713 O  O   . HOH E 4 .   ? 25.328  6.187   6.304   1.00 33.86 ? 234  HOH A O   1 
HETATM 2714 O  O   . HOH E 4 .   ? 22.988  10.515  28.201  1.00 31.79 ? 235  HOH A O   1 
HETATM 2715 O  O   . HOH E 4 .   ? -5.165  -15.236 5.757   1.00 36.73 ? 239  HOH A O   1 
HETATM 2716 O  O   . HOH E 4 .   ? 3.126   -6.828  24.719  1.00 32.81 ? 241  HOH A O   1 
HETATM 2717 O  O   . HOH E 4 .   ? 28.260  -3.393  10.589  1.00 27.95 ? 245  HOH A O   1 
HETATM 2718 O  O   . HOH E 4 .   ? 33.317  6.610   16.448  1.00 17.05 ? 246  HOH A O   1 
HETATM 2719 O  O   . HOH E 4 .   ? 5.086   1.600   -0.061  1.00 20.72 ? 247  HOH A O   1 
HETATM 2720 O  O   . HOH E 4 .   ? -10.201 9.006   15.205  1.00 25.81 ? 248  HOH A O   1 
HETATM 2721 O  O   . HOH E 4 .   ? -5.292  -3.127  33.082  1.00 28.99 ? 249  HOH A O   1 
HETATM 2722 O  O   . HOH E 4 .   ? -5.084  -3.375  27.141  1.00 31.59 ? 250  HOH A O   1 
HETATM 2723 O  O   . HOH E 4 .   ? 3.196   -19.163 12.953  1.00 34.71 ? 251  HOH A O   1 
HETATM 2724 O  O   . HOH E 4 .   ? -2.642  20.690  28.496  1.00 32.87 ? 252  HOH A O   1 
HETATM 2725 O  O   . HOH E 4 .   ? 32.730  6.521   19.353  1.00 34.52 ? 253  HOH A O   1 
HETATM 2726 O  O   . HOH E 4 .   ? -3.478  0.170   30.065  1.00 28.54 ? 254  HOH A O   1 
HETATM 2727 O  O   . HOH E 4 .   ? 17.646  17.305  5.847   1.00 41.71 ? 255  HOH A O   1 
HETATM 2728 O  O   . HOH E 4 .   ? 20.910  -1.939  1.486   1.00 38.34 ? 256  HOH A O   1 
HETATM 2729 O  O   . HOH E 4 .   ? 8.932   4.128   -2.689  1.00 34.79 ? 257  HOH A O   1 
HETATM 2730 O  O   . HOH E 4 .   ? -1.105  -8.249  28.209  1.00 35.41 ? 258  HOH A O   1 
HETATM 2731 O  O   . HOH E 4 .   ? 5.062   -29.566 3.057   1.00 37.27 ? 259  HOH A O   1 
HETATM 2732 O  O   . HOH E 4 .   ? 4.966   5.615   -2.077  1.00 32.79 ? 260  HOH A O   1 
HETATM 2733 O  O   . HOH E 4 .   ? -1.235  -13.648 11.136  1.00 39.88 ? 263  HOH A O   1 
HETATM 2734 O  O   . HOH E 4 .   ? 17.903  -16.917 18.033  1.00 31.37 ? 265  HOH A O   1 
HETATM 2735 O  O   . HOH E 4 .   ? 13.799  10.439  4.426   1.00 32.53 ? 266  HOH A O   1 
HETATM 2736 O  O   . HOH E 4 .   ? 12.471  5.794   -2.151  1.00 34.69 ? 267  HOH A O   1 
HETATM 2737 O  O   . HOH E 4 .   ? 4.376   -7.899  19.763  1.00 31.61 ? 268  HOH A O   1 
HETATM 2738 O  O   . HOH E 4 .   ? 3.684   -8.464  22.911  1.00 35.92 ? 269  HOH A O   1 
HETATM 2739 O  O   . HOH E 4 .   ? 8.755   11.559  31.301  1.00 35.09 ? 270  HOH A O   1 
HETATM 2740 O  O   . HOH E 4 .   ? 17.498  -8.469  1.035   1.00 52.37 ? 271  HOH A O   1 
HETATM 2741 O  O   . HOH E 4 .   ? 5.273   10.635  -1.677  1.00 36.48 ? 272  HOH A O   1 
HETATM 2742 O  O   . HOH E 4 .   ? -4.460  -3.109  2.171   1.00 40.09 ? 273  HOH A O   1 
HETATM 2743 O  O   . HOH E 4 .   ? 0.928   13.110  28.442  1.00 35.04 ? 274  HOH A O   1 
HETATM 2744 O  O   . HOH E 4 .   ? 26.777  9.959   13.079  1.00 31.45 ? 275  HOH A O   1 
HETATM 2745 O  O   . HOH E 4 .   ? 5.571   -5.690  -9.317  1.00 39.14 ? 280  HOH A O   1 
HETATM 2746 O  O   . HOH E 4 .   ? 22.326  20.995  12.999  1.00 36.05 ? 286  HOH A O   1 
HETATM 2747 O  O   . HOH E 4 .   ? 12.752  -7.878  -10.759 1.00 35.62 ? 287  HOH A O   1 
HETATM 2748 O  O   . HOH E 4 .   ? -1.713  -28.854 3.580   1.00 38.07 ? 289  HOH A O   1 
HETATM 2749 O  O   . HOH E 4 .   ? -6.986  -4.789  31.746  1.00 26.66 ? 292  HOH A O   1 
HETATM 2750 O  O   . HOH E 4 .   ? 13.824  -11.036 24.572  1.00 22.42 ? 293  HOH A O   1 
HETATM 2751 O  O   . HOH E 4 .   ? 12.824  -11.232 27.153  1.00 29.15 ? 294  HOH A O   1 
HETATM 2752 O  O   . HOH E 4 .   ? 1.238   7.998   28.979  1.00 36.58 ? 295  HOH A O   1 
HETATM 2753 O  O   . HOH E 4 .   ? 0.566   -15.005 18.550  1.00 26.99 ? 296  HOH A O   1 
HETATM 2754 O  O   . HOH E 4 .   ? -1.199  11.676  5.768   1.00 29.77 ? 297  HOH A O   1 
HETATM 2755 O  O   . HOH E 4 .   ? 0.145   -2.905  -5.870  1.00 35.75 ? 298  HOH A O   1 
HETATM 2756 O  O   . HOH E 4 .   ? 12.880  -1.498  -4.007  1.00 31.70 ? 299  HOH A O   1 
HETATM 2757 O  O   . HOH E 4 .   ? 3.930   27.955  17.340  1.00 39.77 ? 302  HOH A O   1 
HETATM 2758 O  O   . HOH E 4 .   ? 0.527   -12.106 -8.829  1.00 25.62 ? 305  HOH A O   1 
HETATM 2759 O  O   . HOH E 4 .   ? 28.951  -5.828  32.483  1.00 35.75 ? 307  HOH A O   1 
HETATM 2760 O  O   . HOH E 4 .   ? 13.108  -14.789 -8.189  1.00 40.35 ? 308  HOH A O   1 
HETATM 2761 O  O   . HOH E 4 .   ? 11.874  -8.822  -15.105 1.00 42.98 ? 309  HOH A O   1 
HETATM 2762 O  O   . HOH E 4 .   ? -0.307  -12.258 -11.958 1.00 33.73 ? 315  HOH A O   1 
HETATM 2763 O  O   . HOH E 4 .   ? -2.630  17.356  22.694  1.00 34.51 ? 316  HOH A O   1 
HETATM 2764 O  O   . HOH E 4 .   ? 19.007  7.458   32.441  1.00 37.13 ? 320  HOH A O   1 
HETATM 2765 O  O   . HOH E 4 .   ? -2.362  19.518  21.035  1.00 31.81 ? 328  HOH A O   1 
HETATM 2766 O  O   . HOH E 4 .   ? 30.817  -7.601  28.680  1.00 35.27 ? 329  HOH A O   1 
HETATM 2767 O  O   . HOH E 4 .   ? 9.919   3.189   33.093  1.00 27.49 ? 330  HOH A O   1 
HETATM 2768 O  O   . HOH E 4 .   ? 6.257   -2.949  32.148  1.00 37.25 ? 331  HOH A O   1 
HETATM 2769 O  O   . HOH E 4 .   ? 21.298  18.211  21.060  1.00 33.41 ? 332  HOH A O   1 
HETATM 2770 O  O   . HOH E 4 .   ? 23.951  -18.085 17.875  1.00 34.68 ? 335  HOH A O   1 
HETATM 2771 O  O   . HOH E 4 .   ? -3.142  17.957  27.619  1.00 39.77 ? 336  HOH A O   1 
HETATM 2772 O  O   . HOH E 4 .   ? 16.335  1.019   33.374  1.00 42.39 ? 337  HOH A O   1 
HETATM 2773 O  O   . HOH E 4 .   ? 22.063  18.207  13.741  1.00 37.06 ? 341  HOH A O   1 
HETATM 2774 O  O   . HOH E 4 .   ? 0.352   5.505   -0.912  1.00 40.92 ? 342  HOH A O   1 
HETATM 2775 O  O   . HOH E 4 .   ? 9.264   17.110  -0.375  1.00 33.91 ? 343  HOH A O   1 
HETATM 2776 O  O   . HOH E 4 .   ? 20.929  4.623   -2.502  1.00 44.07 ? 345  HOH A O   1 
HETATM 2777 O  O   . HOH E 4 .   ? -2.931  -16.465 10.519  1.00 43.05 ? 349  HOH A O   1 
HETATM 2778 O  O   . HOH E 4 .   ? 9.260   1.050   -4.845  1.00 41.71 ? 350  HOH A O   1 
HETATM 2779 O  O   . HOH E 4 .   ? 21.237  7.550   6.944   1.00 39.46 ? 351  HOH A O   1 
HETATM 2780 O  O   . HOH E 4 .   ? 18.476  7.004   4.273   1.00 33.59 ? 359  HOH A O   1 
HETATM 2781 O  O   . HOH E 4 .   ? 25.425  -7.855  4.661   1.00 35.38 ? 360  HOH A O   1 
HETATM 2782 O  O   . HOH E 4 .   ? 24.212  -10.384 3.751   1.00 31.78 ? 361  HOH A O   1 
HETATM 2783 O  O   . HOH E 4 .   ? 25.529  -12.295 5.440   1.00 31.59 ? 362  HOH A O   1 
HETATM 2784 O  O   . HOH E 4 .   ? -4.612  21.242  24.290  1.00 32.29 ? 363  HOH A O   1 
HETATM 2785 O  O   . HOH E 4 .   ? -7.284  6.942   8.208   1.00 33.82 ? 364  HOH A O   1 
HETATM 2786 O  O   . HOH E 4 .   ? -6.365  3.553   5.592   1.00 29.87 ? 365  HOH A O   1 
HETATM 2787 O  O   . HOH E 4 .   ? 3.108   -14.809 18.610  1.00 34.69 ? 366  HOH A O   1 
HETATM 2788 O  O   . HOH E 4 .   ? 4.709   16.968  29.135  1.00 34.90 ? 367  HOH A O   1 
HETATM 2789 O  O   . HOH E 4 .   ? 32.673  -1.515  20.488  1.00 33.23 ? 368  HOH A O   1 
HETATM 2790 O  O   . HOH E 4 .   ? -3.560  11.722  7.149   1.00 29.08 ? 369  HOH A O   1 
HETATM 2791 O  O   . HOH E 4 .   ? 10.150  -7.522  24.278  1.00 30.03 ? 370  HOH A O   1 
HETATM 2792 O  O   . HOH E 4 .   ? 5.575   -11.114 19.776  1.00 29.92 ? 371  HOH A O   1 
HETATM 2793 O  O   . HOH E 4 .   ? 14.923  -29.031 16.037  1.00 33.69 ? 372  HOH A O   1 
HETATM 2794 O  O   . HOH E 4 .   ? 12.156  4.254   34.408  1.00 34.49 ? 373  HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . ASN A 2   ? 0.4451 0.4546 0.5309 0.0263  0.0245  -0.0406 1676 ASN A N   
2    C  CA  . ASN A 2   ? 0.4202 0.4589 0.4799 0.0323  -0.0004 -0.0360 1676 ASN A CA  
3    C  C   . ASN A 2   ? 0.3700 0.4178 0.4178 0.0509  -0.0052 -0.0559 1676 ASN A C   
4    O  O   . ASN A 2   ? 0.3958 0.4572 0.3856 0.0820  0.0083  -0.0837 1676 ASN A O   
5    C  CB  . ASN A 2   ? 0.4439 0.4618 0.5026 0.0268  -0.0140 -0.0311 1676 ASN A CB  
6    C  CG  . ASN A 2   ? 0.5284 0.5239 0.5876 0.0258  -0.0066 -0.0050 1676 ASN A CG  
7    O  OD1 . ASN A 2   ? 0.5834 0.5998 0.6938 -0.0082 -0.0088 -0.0006 1676 ASN A OD1 
8    N  ND2 . ASN A 2   ? 0.6345 0.5814 0.6146 0.0493  -0.0040 0.0060  1676 ASN A ND2 
9    N  N   . ARG A 3   ? 0.3184 0.3817 0.3372 0.0770  -0.0257 -0.0460 1677 ARG A N   
10   C  CA  . ARG A 3   ? 0.3359 0.3793 0.3514 0.0673  0.0029  -0.0406 1677 ARG A CA  
11   C  C   . ARG A 3   ? 0.2421 0.3191 0.3226 0.0800  -0.0066 -0.0609 1677 ARG A C   
12   O  O   . ARG A 3   ? 0.1966 0.3343 0.3013 0.1176  -0.0331 -0.0647 1677 ARG A O   
13   C  CB  . ARG A 3   ? 0.3892 0.3723 0.3639 0.0628  0.0193  -0.0384 1677 ARG A CB  
14   C  CG  . ARG A 3   ? 0.5096 0.4297 0.3886 0.0221  0.0240  -0.0442 1677 ARG A CG  
15   C  CD  . ARG A 3   ? 0.5089 0.4382 0.3896 0.0718  0.0131  -0.0709 1677 ARG A CD  
16   N  NE  . ARG A 3   ? 0.5048 0.4930 0.4669 0.0030  -0.0368 -0.0260 1677 ARG A NE  
17   C  CZ  . ARG A 3   ? 0.3520 0.2904 0.3947 0.0231  -0.0703 -0.0713 1677 ARG A CZ  
18   N  NH1 . ARG A 3   ? 0.4977 0.5046 0.5084 -0.0048 -0.0150 -0.0320 1677 ARG A NH1 
19   N  NH2 . ARG A 3   ? 0.5039 0.5066 0.4450 -0.0188 -0.0388 -0.0077 1677 ARG A NH2 
20   N  N   . LYS A 4   ? 0.2237 0.2952 0.3304 0.0581  -0.0302 -0.0544 1678 LYS A N   
21   C  CA  . LYS A 4   ? 0.2439 0.2668 0.3242 0.0457  -0.0431 -0.0523 1678 LYS A CA  
22   C  C   . LYS A 4   ? 0.1562 0.2557 0.2940 0.0334  -0.0488 -0.0676 1678 LYS A C   
23   O  O   . LYS A 4   ? 0.1684 0.2997 0.3123 0.0809  -0.0519 -0.0488 1678 LYS A O   
24   C  CB  . LYS A 4   ? 0.2626 0.2910 0.3877 -0.0026 -0.0601 -0.0483 1678 LYS A CB  
25   C  CG  . LYS A 4   ? 0.3937 0.4453 0.4349 -0.0182 -0.0211 -0.0104 1678 LYS A CG  
26   C  CD  . LYS A 4   ? 0.3152 0.4331 0.5079 0.0083  -0.0354 -0.0051 1678 LYS A CD  
27   C  CE  . LYS A 4   ? 0.4592 0.4864 0.5193 -0.0258 -0.0242 0.0221  1678 LYS A CE  
28   N  NZ  . LYS A 4   ? 0.4800 0.6205 0.5721 -0.0400 -0.0005 0.0146  1678 LYS A NZ  
29   N  N   . THR A 5   ? 0.1271 0.2385 0.2916 0.0640  -0.0230 -0.0645 1679 THR A N   
30   C  CA  . THR A 5   ? 0.1363 0.2791 0.3020 0.0420  -0.0329 -0.0642 1679 THR A CA  
31   C  C   . THR A 5   ? 0.1339 0.2534 0.2876 0.0538  -0.0348 -0.0666 1679 THR A C   
32   O  O   . THR A 5   ? 0.1762 0.2410 0.2911 0.0574  -0.0558 -0.0654 1679 THR A O   
33   C  CB  . THR A 5   ? 0.1293 0.3370 0.3289 0.0103  -0.0252 -0.0411 1679 THR A CB  
34   O  OG1 . THR A 5   ? 0.1893 0.4278 0.3568 -0.0076 -0.0015 -0.0272 1679 THR A OG1 
35   C  CG2 . THR A 5   ? 0.0983 0.3594 0.3573 0.0505  -0.0806 -0.0560 1679 THR A CG2 
36   N  N   . SER A 6   ? 0.1319 0.2578 0.2623 0.0817  -0.0513 -0.0672 1680 SER A N   
37   C  CA  . SER A 6   ? 0.1730 0.2759 0.2771 0.0494  -0.0558 -0.0247 1680 SER A CA  
38   C  C   . SER A 6   ? 0.1658 0.2813 0.2670 0.0603  -0.0498 -0.0609 1680 SER A C   
39   O  O   . SER A 6   ? 0.2086 0.2647 0.3144 0.0662  -0.0558 -0.0472 1680 SER A O   
40   C  CB  . SER A 6   ? 0.2151 0.3322 0.2772 0.0509  -0.0678 0.0176  1680 SER A CB  
41   O  OG  . SER A 6   ? 0.2829 0.4182 0.3373 0.0530  -0.0575 0.0144  1680 SER A OG  
42   N  N   . CYS A 7   ? 0.1558 0.2672 0.2769 0.0499  -0.0672 -0.0773 1681 CYS A N   
43   C  CA  A CYS A 7   ? 0.1937 0.2754 0.2866 0.0482  -0.0577 -0.0641 1681 CYS A CA  
44   C  CA  B CYS A 7   ? 0.1862 0.2560 0.2644 0.0441  -0.0664 -0.0700 1681 CYS A CA  
45   C  C   . CYS A 7   ? 0.1559 0.2691 0.2727 0.0670  -0.0518 -0.0592 1681 CYS A C   
46   O  O   . CYS A 7   ? 0.1601 0.3114 0.3103 0.0539  -0.0387 -0.0728 1681 CYS A O   
47   C  CB  A CYS A 7   ? 0.2397 0.2960 0.2900 0.0283  -0.0725 -0.0592 1681 CYS A CB  
48   C  CB  B CYS A 7   ? 0.2214 0.2496 0.2446 0.0331  -0.0966 -0.0625 1681 CYS A CB  
49   S  SG  A CYS A 7   ? 0.3278 0.3692 0.4713 0.0380  -0.0662 -0.0462 1681 CYS A SG  
50   S  SG  B CYS A 7   ? 0.3039 0.2668 0.3641 -0.0196 -0.1210 -0.0763 1681 CYS A SG  
51   N  N   . PRO A 8   ? 0.1679 0.2999 0.2775 0.0970  -0.0423 -0.0458 1682 PRO A N   
52   C  CA  . PRO A 8   ? 0.2022 0.3177 0.2700 0.0592  -0.0909 -0.0416 1682 PRO A CA  
53   C  C   . PRO A 8   ? 0.2354 0.3134 0.3197 0.0427  -0.0653 -0.0653 1682 PRO A C   
54   O  O   . PRO A 8   ? 0.2458 0.3525 0.3130 0.0549  -0.0974 -0.0812 1682 PRO A O   
55   C  CB  . PRO A 8   ? 0.2570 0.3157 0.3268 0.0330  -0.0623 -0.0423 1682 PRO A CB  
56   C  CG  . PRO A 8   ? 0.2667 0.3667 0.3528 0.0406  -0.0356 0.0009  1682 PRO A CG  
57   C  CD  . PRO A 8   ? 0.2177 0.3341 0.3230 0.0525  -0.0093 -0.0166 1682 PRO A CD  
58   N  N   . ILE A 9   ? 0.1986 0.3247 0.2563 0.0316  -0.0857 -0.0666 1683 ILE A N   
59   C  CA  A ILE A 9   ? 0.2295 0.3192 0.2689 0.0319  -0.0857 -0.0490 1683 ILE A CA  
60   C  CA  B ILE A 9   ? 0.2245 0.3148 0.2672 0.0341  -0.0861 -0.0488 1683 ILE A CA  
61   C  C   . ILE A 9   ? 0.2453 0.3296 0.2689 0.0417  -0.0782 -0.0541 1683 ILE A C   
62   O  O   . ILE A 9   ? 0.2778 0.3368 0.2505 0.0589  -0.1202 -0.0654 1683 ILE A O   
63   C  CB  A ILE A 9   ? 0.2433 0.3235 0.2724 0.0142  -0.0782 -0.0364 1683 ILE A CB  
64   C  CB  B ILE A 9   ? 0.2252 0.3175 0.2636 0.0233  -0.0818 -0.0347 1683 ILE A CB  
65   C  CG1 A ILE A 9   ? 0.2761 0.3087 0.2940 0.0070  -0.0519 -0.0246 1683 ILE A CG1 
66   C  CG1 B ILE A 9   ? 0.2257 0.2674 0.2837 0.0252  -0.0583 -0.0281 1683 ILE A CG1 
67   C  CG2 A ILE A 9   ? 0.1857 0.3481 0.3009 0.0202  -0.0906 -0.0504 1683 ILE A CG2 
68   C  CG2 B ILE A 9   ? 0.2077 0.3416 0.3143 0.0046  -0.0808 -0.0473 1683 ILE A CG2 
69   C  CD1 A ILE A 9   ? 0.2985 0.3651 0.3018 -0.0210 -0.0237 0.0137  1683 ILE A CD1 
70   C  CD1 B ILE A 9   ? 0.2205 0.2507 0.2328 0.0482  -0.0076 0.0249  1683 ILE A CD1 
71   N  N   . LYS A 10  ? 0.2406 0.3401 0.2494 0.0377  -0.0800 -0.0697 1684 LYS A N   
72   C  CA  A LYS A 10  ? 0.2589 0.3463 0.2260 0.0431  -0.0560 -0.0666 1684 LYS A CA  
73   C  CA  B LYS A 10  ? 0.2517 0.3366 0.2425 0.0385  -0.0468 -0.0546 1684 LYS A CA  
74   C  C   . LYS A 10  ? 0.2268 0.3306 0.2143 0.0342  -0.0459 -0.0525 1684 LYS A C   
75   O  O   . LYS A 10  ? 0.2344 0.3269 0.2680 0.0712  -0.0580 -0.0640 1684 LYS A O   
76   C  CB  A LYS A 10  ? 0.2174 0.3610 0.2174 0.0253  -0.0768 -0.0865 1684 LYS A CB  
77   C  CB  B LYS A 10  ? 0.2380 0.3396 0.2434 0.0260  -0.0451 -0.0564 1684 LYS A CB  
78   C  CG  A LYS A 10  ? 0.3030 0.4174 0.2852 0.0082  -0.0199 -0.0455 1684 LYS A CG  
79   C  CG  B LYS A 10  ? 0.2660 0.3483 0.2691 0.0306  -0.0055 -0.0425 1684 LYS A CG  
80   C  CD  A LYS A 10  ? 0.4173 0.4408 0.4181 0.0190  0.0055  -0.0367 1684 LYS A CD  
81   C  CD  B LYS A 10  ? 0.3253 0.3593 0.3285 0.0061  0.0000  -0.0259 1684 LYS A CD  
82   C  CE  A LYS A 10  ? 0.4427 0.4629 0.4545 0.0039  0.0127  -0.0086 1684 LYS A CE  
83   C  CE  B LYS A 10  ? 0.3488 0.4073 0.3681 -0.0049 0.0000  -0.0186 1684 LYS A CE  
84   N  NZ  A LYS A 10  ? 0.4854 0.4594 0.5049 0.0048  0.0064  0.0051  1684 LYS A NZ  
85   N  NZ  B LYS A 10  ? 0.4237 0.4185 0.4258 -0.0118 -0.0081 -0.0053 1684 LYS A NZ  
86   N  N   . ILE A 11  ? 0.2472 0.4082 0.2331 0.0290  -0.0543 -0.0733 1685 ILE A N   
87   C  CA  . ILE A 11  ? 0.2737 0.4096 0.3099 0.0256  -0.0580 -0.0616 1685 ILE A CA  
88   C  C   . ILE A 11  ? 0.2423 0.4151 0.3237 0.0038  -0.0526 -0.0538 1685 ILE A C   
89   O  O   . ILE A 11  ? 0.2339 0.4346 0.3403 0.0247  -0.0692 -0.0676 1685 ILE A O   
90   C  CB  . ILE A 11  ? 0.3076 0.4130 0.3177 0.0019  -0.0634 -0.0623 1685 ILE A CB  
91   C  CG1 . ILE A 11  ? 0.3300 0.3856 0.3154 0.0194  -0.0760 -0.0459 1685 ILE A CG1 
92   C  CG2 . ILE A 11  ? 0.3112 0.4579 0.3756 0.0394  -0.0187 -0.0567 1685 ILE A CG2 
93   C  CD1 . ILE A 11  ? 0.4509 0.4327 0.3487 0.0236  0.0137  -0.0291 1685 ILE A CD1 
94   N  N   . ASN A 12  ? 0.2702 0.3910 0.3631 0.0015  -0.0465 -0.0290 1686 ASN A N   
95   C  CA  A ASN A 12  ? 0.3196 0.3831 0.3651 -0.0112 -0.0584 -0.0264 1686 ASN A CA  
96   C  CA  B ASN A 12  ? 0.2871 0.3589 0.3255 -0.0064 -0.0525 -0.0328 1686 ASN A CA  
97   C  C   . ASN A 12  ? 0.2975 0.3734 0.3612 -0.0041 -0.0655 -0.0344 1686 ASN A C   
98   O  O   . ASN A 12  ? 0.3355 0.3734 0.3601 -0.0195 -0.0785 -0.0419 1686 ASN A O   
99   C  CB  A ASN A 12  ? 0.3637 0.4209 0.4001 -0.0122 -0.0348 -0.0142 1686 ASN A CB  
100  C  CB  B ASN A 12  ? 0.2890 0.3554 0.3227 -0.0041 -0.0304 -0.0216 1686 ASN A CB  
101  C  CG  A ASN A 12  ? 0.4373 0.4459 0.4926 -0.0048 -0.0167 0.0027  1686 ASN A CG  
102  C  CG  B ASN A 12  ? 0.2596 0.2789 0.2278 -0.0210 -0.0289 -0.0398 1686 ASN A CG  
103  O  OD1 A ASN A 12  ? 0.4402 0.5326 0.4771 -0.0187 -0.0464 0.0008  1686 ASN A OD1 
104  O  OD1 B ASN A 12  ? 0.2931 0.2758 0.1334 0.0024  -0.0295 -0.0637 1686 ASN A OD1 
105  N  ND2 A ASN A 12  ? 0.4614 0.5158 0.5516 0.0068  -0.0211 0.0022  1686 ASN A ND2 
106  N  ND2 B ASN A 12  ? 0.2284 0.2371 0.2165 -0.0581 -0.0622 -0.0142 1686 ASN A ND2 
107  N  N   . GLN A 13  ? 0.2618 0.3272 0.3342 0.0070  -0.1034 -0.0542 1687 GLN A N   
108  C  CA  . GLN A 13  ? 0.2819 0.3346 0.3305 0.0366  -0.0568 -0.0591 1687 GLN A CA  
109  C  C   . GLN A 13  ? 0.2588 0.2718 0.3149 0.0261  -0.0793 -0.0792 1687 GLN A C   
110  O  O   . GLN A 13  ? 0.2514 0.3557 0.3172 0.0299  -0.0918 -0.1016 1687 GLN A O   
111  C  CB  . GLN A 13  ? 0.2607 0.3208 0.3391 0.0407  -0.0196 -0.0547 1687 GLN A CB  
112  C  CG  . GLN A 13  ? 0.3859 0.3593 0.3708 0.0362  -0.0111 -0.0494 1687 GLN A CG  
113  C  CD  . GLN A 13  ? 0.4505 0.4480 0.5182 0.0371  0.0071  -0.0279 1687 GLN A CD  
114  O  OE1 . GLN A 13  ? 0.4971 0.4766 0.5482 0.0056  -0.0099 -0.0244 1687 GLN A OE1 
115  N  NE2 . GLN A 13  ? 0.5388 0.5727 0.6117 -0.0017 0.0400  -0.0072 1687 GLN A NE2 
116  N  N   . PHE A 14  ? 0.2635 0.3084 0.3338 0.0254  -0.0691 -0.0694 1688 PHE A N   
117  C  CA  . PHE A 14  ? 0.2671 0.2607 0.2942 0.0312  -0.0757 -0.0844 1688 PHE A CA  
118  C  C   . PHE A 14  ? 0.2487 0.2421 0.2692 0.0295  -0.0861 -0.0533 1688 PHE A C   
119  O  O   . PHE A 14  ? 0.2439 0.2561 0.3103 0.0149  -0.0903 -0.0955 1688 PHE A O   
120  C  CB  . PHE A 14  ? 0.2874 0.2849 0.3101 0.0111  -0.0691 -0.0563 1688 PHE A CB  
121  C  CG  . PHE A 14  ? 0.2151 0.3000 0.2849 -0.0119 -0.0784 -0.0673 1688 PHE A CG  
122  C  CD1 . PHE A 14  ? 0.1491 0.3082 0.2938 0.0312  -0.0711 -0.0735 1688 PHE A CD1 
123  C  CD2 . PHE A 14  ? 0.2537 0.2711 0.2968 0.0479  -0.0533 -0.0629 1688 PHE A CD2 
124  C  CE1 . PHE A 14  ? 0.2285 0.1939 0.2649 0.0168  -0.0811 -0.0798 1688 PHE A CE1 
125  C  CE2 . PHE A 14  ? 0.1961 0.2297 0.2213 0.0472  -0.0750 -0.1107 1688 PHE A CE2 
126  C  CZ  . PHE A 14  ? 0.1383 0.2431 0.3333 0.0080  -0.0791 -0.0740 1688 PHE A CZ  
127  N  N   . GLU A 15  ? 0.2513 0.2627 0.3357 0.0146  -0.0859 -0.0424 1689 GLU A N   
128  C  CA  . GLU A 15  ? 0.2189 0.2816 0.3371 0.0357  -0.0746 -0.0259 1689 GLU A CA  
129  C  C   . GLU A 15  ? 0.2104 0.2275 0.2454 -0.0068 -0.0852 -0.0388 1689 GLU A C   
130  O  O   . GLU A 15  ? 0.2212 0.2932 0.3256 -0.0061 -0.0949 -0.0431 1689 GLU A O   
131  C  CB  . GLU A 15  ? 0.2221 0.3143 0.3575 -0.0014 -0.0794 -0.0399 1689 GLU A CB  
132  C  CG  . GLU A 15  ? 0.2481 0.3432 0.4373 -0.0218 -0.0596 -0.0426 1689 GLU A CG  
133  C  CD  . GLU A 15  ? 0.2382 0.3959 0.4275 -0.0473 -0.0391 -0.0276 1689 GLU A CD  
134  O  OE1 . GLU A 15  ? 0.4419 0.3913 0.6141 -0.0505 -0.0275 -0.0262 1689 GLU A OE1 
135  O  OE2 . GLU A 15  ? 0.3251 0.3815 0.4971 -0.0703 -0.0497 -0.0069 1689 GLU A OE2 
136  N  N   . GLY A 16  ? 0.2160 0.3055 0.3762 0.0102  -0.0817 -0.0298 1690 GLY A N   
137  C  CA  . GLY A 16  ? 0.2632 0.2624 0.3423 0.0214  -0.0815 -0.0613 1690 GLY A CA  
138  C  C   . GLY A 16  ? 0.2364 0.2292 0.3808 0.0276  -0.0816 -0.0362 1690 GLY A C   
139  O  O   . GLY A 16  ? 0.2811 0.2463 0.4336 0.0126  -0.0431 -0.0775 1690 GLY A O   
140  N  N   . HIS A 17  ? 0.2656 0.2878 0.3929 0.0353  -0.0756 -0.0558 1691 HIS A N   
141  C  CA  . HIS A 17  ? 0.2323 0.2659 0.3764 0.0259  -0.0832 -0.0653 1691 HIS A CA  
142  C  C   . HIS A 17  ? 0.2483 0.2032 0.3509 0.0187  -0.0949 -0.0638 1691 HIS A C   
143  O  O   . HIS A 17  ? 0.2323 0.2640 0.3731 0.0121  -0.1033 -0.0683 1691 HIS A O   
144  C  CB  . HIS A 17  ? 0.2456 0.2800 0.3956 0.0307  -0.0993 -0.0550 1691 HIS A CB  
145  C  CG  . HIS A 17  ? 0.2669 0.3001 0.3849 0.0448  -0.0851 -0.0592 1691 HIS A CG  
146  N  ND1 . HIS A 17  ? 0.3160 0.2973 0.4137 0.0200  -0.0981 -0.1008 1691 HIS A ND1 
147  C  CD2 . HIS A 17  ? 0.1524 0.3469 0.3423 0.0541  -0.1120 -0.0928 1691 HIS A CD2 
148  C  CE1 . HIS A 17  ? 0.1826 0.3073 0.3503 0.0270  -0.0883 -0.0604 1691 HIS A CE1 
149  N  NE2 . HIS A 17  ? 0.2339 0.3581 0.3842 0.0501  -0.0819 -0.0736 1691 HIS A NE2 
150  N  N   . PHE A 18  ? 0.1600 0.1856 0.3364 0.0250  -0.0878 -0.0883 1692 PHE A N   
151  C  CA  . PHE A 18  ? 0.2277 0.1829 0.3628 0.0061  -0.0714 -0.0553 1692 PHE A CA  
152  C  C   . PHE A 18  ? 0.1705 0.1587 0.3005 -0.0173 -0.1071 -0.0307 1692 PHE A C   
153  O  O   . PHE A 18  ? 0.1875 0.1795 0.3755 -0.0152 -0.1158 -0.0492 1692 PHE A O   
154  C  CB  . PHE A 18  ? 0.1521 0.2015 0.3335 0.0204  -0.0765 -0.0431 1692 PHE A CB  
155  C  CG  . PHE A 18  ? 0.1953 0.1783 0.3832 -0.0215 -0.0597 -0.0581 1692 PHE A CG  
156  C  CD1 . PHE A 18  ? 0.1760 0.2183 0.3210 -0.0586 -0.0727 -0.0734 1692 PHE A CD1 
157  C  CD2 . PHE A 18  ? 0.1175 0.1961 0.3989 -0.0262 -0.0585 -0.0683 1692 PHE A CD2 
158  C  CE1 . PHE A 18  ? 0.1816 0.1834 0.3379 -0.0251 -0.0612 -0.0626 1692 PHE A CE1 
159  C  CE2 . PHE A 18  ? 0.2075 0.2324 0.4073 -0.0486 -0.0542 -0.0543 1692 PHE A CE2 
160  C  CZ  . PHE A 18  ? 0.2291 0.2270 0.3956 -0.0198 -0.0568 -0.0461 1692 PHE A CZ  
161  N  N   . MET A 19  ? 0.2120 0.2345 0.3660 0.0169  -0.0686 -0.0548 1693 MET A N   
162  C  CA  A MET A 19  ? 0.1880 0.2196 0.3401 0.0118  -0.0797 -0.0480 1693 MET A CA  
163  C  CA  B MET A 19  ? 0.2297 0.2413 0.3771 0.0016  -0.0732 -0.0395 1693 MET A CA  
164  C  C   . MET A 19  ? 0.1979 0.2267 0.3614 -0.0081 -0.0669 -0.0355 1693 MET A C   
165  O  O   . MET A 19  ? 0.2332 0.2527 0.3872 -0.0123 -0.1120 -0.0623 1693 MET A O   
166  C  CB  A MET A 19  ? 0.1611 0.2166 0.2900 0.0321  -0.0689 -0.0422 1693 MET A CB  
167  C  CB  B MET A 19  ? 0.2487 0.2583 0.3818 0.0095  -0.0585 -0.0426 1693 MET A CB  
168  C  CG  A MET A 19  ? 0.1522 0.2158 0.2493 0.0322  -0.0100 -0.0516 1693 MET A CG  
169  C  CG  B MET A 19  ? 0.2572 0.2879 0.3641 -0.0316 -0.0269 -0.0083 1693 MET A CG  
170  S  SD  A MET A 19  ? 0.1550 0.1986 0.1694 -0.0320 -0.0741 -0.0082 1693 MET A SD  
171  S  SD  B MET A 19  ? 0.2496 0.2039 0.3834 -0.0180 0.0109  -0.0403 1693 MET A SD  
172  C  CE  A MET A 19  ? 0.0854 0.1977 0.2558 -0.0541 0.0084  -0.0132 1693 MET A CE  
173  C  CE  B MET A 19  ? 0.1841 0.1870 0.2285 0.0194  -0.0455 -0.0717 1693 MET A CE  
174  N  N   . LYS A 20  ? 0.2853 0.1990 0.3622 -0.0013 -0.0633 -0.0864 1694 LYS A N   
175  C  CA  A LYS A 20  ? 0.2811 0.2568 0.3993 0.0070  -0.0551 -0.0537 1694 LYS A CA  
176  C  CA  B LYS A 20  ? 0.2710 0.2537 0.3901 0.0017  -0.0521 -0.0487 1694 LYS A CA  
177  C  C   . LYS A 20  ? 0.2542 0.2474 0.4195 -0.0173 -0.0621 -0.0449 1694 LYS A C   
178  O  O   . LYS A 20  ? 0.2278 0.2491 0.4540 -0.0467 -0.0929 -0.0667 1694 LYS A O   
179  C  CB  A LYS A 20  ? 0.2914 0.2665 0.4252 -0.0137 -0.0270 -0.0284 1694 LYS A CB  
180  C  CB  B LYS A 20  ? 0.2873 0.2617 0.4002 -0.0036 -0.0314 -0.0318 1694 LYS A CB  
181  C  CG  A LYS A 20  ? 0.3508 0.3214 0.4386 0.0077  -0.0296 -0.0158 1694 LYS A CG  
182  C  CG  B LYS A 20  ? 0.3053 0.3266 0.3860 0.0235  -0.0258 -0.0132 1694 LYS A CG  
183  C  CD  A LYS A 20  ? 0.4034 0.4156 0.5221 -0.0094 0.0104  -0.0106 1694 LYS A CD  
184  C  CD  B LYS A 20  ? 0.3201 0.3525 0.3852 -0.0161 -0.0064 0.0030  1694 LYS A CD  
185  C  CE  A LYS A 20  ? 0.4387 0.4229 0.4911 -0.0172 -0.0295 0.0021  1694 LYS A CE  
186  C  CE  B LYS A 20  ? 0.2755 0.3425 0.3622 0.0072  -0.0207 -0.0056 1694 LYS A CE  
187  N  NZ  A LYS A 20  ? 0.5117 0.4946 0.5344 -0.0165 0.0023  0.0197  1694 LYS A NZ  
188  N  NZ  B LYS A 20  ? 0.3228 0.3478 0.3933 -0.0229 -0.0020 -0.0127 1694 LYS A NZ  
189  N  N   . LEU A 21  ? 0.2366 0.2067 0.4094 0.0127  -0.0818 -0.0735 1695 LEU A N   
190  C  CA  . LEU A 21  ? 0.2030 0.2234 0.4090 0.0036  -0.0773 -0.0665 1695 LEU A CA  
191  C  C   . LEU A 21  ? 0.2244 0.2047 0.3934 -0.0320 -0.1132 -0.0311 1695 LEU A C   
192  O  O   . LEU A 21  ? 0.1870 0.2210 0.5141 -0.0268 -0.1240 -0.0241 1695 LEU A O   
193  C  CB  . LEU A 21  ? 0.2251 0.1971 0.4082 -0.0030 -0.0830 -0.0391 1695 LEU A CB  
194  C  CG  . LEU A 21  ? 0.2615 0.2001 0.3815 0.0317  -0.0497 -0.0602 1695 LEU A CG  
195  C  CD1 . LEU A 21  ? 0.2344 0.2422 0.3918 -0.0512 -0.0812 -0.0752 1695 LEU A CD1 
196  C  CD2 . LEU A 21  ? 0.2365 0.2443 0.4467 0.0458  -0.0311 0.0224  1695 LEU A CD2 
197  N  N   . GLN A 22  ? 0.1834 0.1822 0.4391 -0.0194 -0.0830 -0.0480 1696 GLN A N   
198  C  CA  . GLN A 22  ? 0.1882 0.2038 0.4137 -0.0311 -0.0760 -0.0349 1696 GLN A CA  
199  C  C   . GLN A 22  ? 0.1910 0.2183 0.4186 -0.0383 -0.0563 -0.0160 1696 GLN A C   
200  O  O   . GLN A 22  ? 0.1869 0.2568 0.4336 -0.0547 -0.0774 -0.0379 1696 GLN A O   
201  C  CB  . GLN A 22  ? 0.2019 0.2000 0.4198 -0.0131 -0.0496 -0.0173 1696 GLN A CB  
202  C  CG  . GLN A 22  ? 0.1830 0.1889 0.4174 -0.0264 -0.0827 -0.0490 1696 GLN A CG  
203  C  CD  . GLN A 22  ? 0.2050 0.2501 0.4134 0.0128  -0.0417 -0.0138 1696 GLN A CD  
204  O  OE1 . GLN A 22  ? 0.2319 0.2573 0.4714 0.0082  -0.0743 -0.0240 1696 GLN A OE1 
205  N  NE2 . GLN A 22  ? 0.3047 0.2812 0.4407 -0.0269 -0.0055 -0.0118 1696 GLN A NE2 
206  N  N   . ALA A 23  ? 0.1933 0.2171 0.4176 -0.0601 -0.0952 -0.0400 1697 ALA A N   
207  C  CA  . ALA A 23  ? 0.2500 0.2402 0.4412 -0.0623 -0.0757 -0.0322 1697 ALA A CA  
208  C  C   . ALA A 23  ? 0.3238 0.2754 0.4897 -0.0380 -0.0475 -0.0176 1697 ALA A C   
209  O  O   . ALA A 23  ? 0.3044 0.2090 0.4961 -0.0185 -0.0719 -0.0122 1697 ALA A O   
210  C  CB  . ALA A 23  ? 0.2550 0.2623 0.4402 -0.0672 -0.0546 -0.0591 1697 ALA A CB  
211  N  N   . ASP A 24  ? 0.3370 0.3169 0.5097 -0.0376 -0.0384 -0.0030 1698 ASP A N   
212  C  CA  A ASP A 24  ? 0.3698 0.3600 0.5049 -0.0306 -0.0356 -0.0133 1698 ASP A CA  
213  C  CA  B ASP A 24  ? 0.3621 0.3534 0.5006 -0.0324 -0.0361 -0.0162 1698 ASP A CA  
214  C  C   . ASP A 24  ? 0.3707 0.3524 0.5108 -0.0375 -0.0349 -0.0144 1698 ASP A C   
215  O  O   . ASP A 24  ? 0.3693 0.3285 0.5410 -0.0441 -0.0614 -0.0285 1698 ASP A O   
216  C  CB  A ASP A 24  ? 0.4073 0.3937 0.5144 -0.0185 -0.0233 -0.0168 1698 ASP A CB  
217  C  CB  B ASP A 24  ? 0.3951 0.3740 0.5078 -0.0217 -0.0242 -0.0184 1698 ASP A CB  
218  C  CG  A ASP A 24  ? 0.4783 0.4493 0.5280 -0.0023 -0.0077 0.0065  1698 ASP A CG  
219  C  CG  B ASP A 24  ? 0.4358 0.4229 0.4956 -0.0149 -0.0120 -0.0212 1698 ASP A CG  
220  O  OD1 A ASP A 24  ? 0.5142 0.4913 0.5776 -0.0259 -0.0027 0.0085  1698 ASP A OD1 
221  O  OD1 B ASP A 24  ? 0.4444 0.4281 0.5471 -0.0109 -0.0031 -0.0170 1698 ASP A OD1 
222  O  OD2 A ASP A 24  ? 0.5244 0.4890 0.5732 0.0240  -0.0045 0.0112  1698 ASP A OD2 
223  O  OD2 B ASP A 24  ? 0.4576 0.4400 0.5414 -0.0230 0.0174  -0.0058 1698 ASP A OD2 
224  N  N   . SER A 25  ? 0.3138 0.3243 0.5021 -0.0404 -0.0380 -0.0131 1699 SER A N   
225  C  CA  . SER A 25  ? 0.3147 0.3534 0.4808 -0.0656 -0.0254 0.0126  1699 SER A CA  
226  C  C   . SER A 25  ? 0.3003 0.3373 0.4728 -0.0641 -0.0487 -0.0083 1699 SER A C   
227  O  O   . SER A 25  ? 0.3310 0.3389 0.4989 -0.0561 -0.0438 -0.0084 1699 SER A O   
228  C  CB  . SER A 25  ? 0.3528 0.3832 0.4915 -0.0558 -0.0203 0.0055  1699 SER A CB  
229  O  OG  . SER A 25  ? 0.3994 0.4451 0.5586 -0.0927 -0.0116 -0.0086 1699 SER A OG  
230  N  N   . ASN A 26  ? 0.2438 0.2792 0.4693 -0.0954 -0.0397 -0.0051 1700 ASN A N   
231  C  CA  . ASN A 26  ? 0.2573 0.2720 0.4343 -0.0649 -0.0607 -0.0326 1700 ASN A CA  
232  C  C   . ASN A 26  ? 0.2574 0.2658 0.4408 -0.0345 -0.0449 -0.0205 1700 ASN A C   
233  O  O   . ASN A 26  ? 0.2298 0.2611 0.4292 -0.0538 -0.0862 -0.0167 1700 ASN A O   
234  C  CB  . ASN A 26  ? 0.2964 0.3048 0.3996 -0.0350 -0.0329 -0.0129 1700 ASN A CB  
235  C  CG  . ASN A 26  ? 0.3278 0.3172 0.4502 -0.0159 -0.0394 -0.0277 1700 ASN A CG  
236  O  OD1 . ASN A 26  ? 0.3864 0.3016 0.4997 -0.0382 -0.0738 -0.0421 1700 ASN A OD1 
237  N  ND2 . ASN A 26  ? 0.3520 0.3176 0.4600 0.0227  -0.0375 -0.0256 1700 ASN A ND2 
238  N  N   . TYR A 27  ? 0.2269 0.2369 0.4636 -0.0348 -0.0757 -0.0428 1701 TYR A N   
239  C  CA  . TYR A 27  ? 0.2922 0.2678 0.4676 -0.0049 -0.0651 -0.0300 1701 TYR A CA  
240  C  C   . TYR A 27  ? 0.2867 0.2898 0.4614 0.0054  -0.0689 -0.0327 1701 TYR A C   
241  O  O   . TYR A 27  ? 0.2697 0.3003 0.4850 0.0253  -0.0997 -0.0181 1701 TYR A O   
242  C  CB  . TYR A 27  ? 0.3152 0.2792 0.4829 0.0202  -0.0638 -0.0238 1701 TYR A CB  
243  C  CG  . TYR A 27  ? 0.2991 0.2462 0.4855 -0.0173 -0.0407 -0.0308 1701 TYR A CG  
244  C  CD1 . TYR A 27  ? 0.4310 0.4049 0.5040 0.0212  -0.0202 -0.0161 1701 TYR A CD1 
245  C  CD2 . TYR A 27  ? 0.3187 0.3054 0.5155 0.0223  -0.0092 -0.0551 1701 TYR A CD2 
246  C  CE1 . TYR A 27  ? 0.4189 0.4565 0.5178 0.0245  -0.0304 -0.0025 1701 TYR A CE1 
247  C  CE2 . TYR A 27  ? 0.3679 0.3628 0.5340 0.0699  -0.0080 -0.0096 1701 TYR A CE2 
248  C  CZ  . TYR A 27  ? 0.4007 0.4244 0.5429 0.0575  -0.0118 -0.0186 1701 TYR A CZ  
249  O  OH  . TYR A 27  ? 0.4790 0.4205 0.6378 0.0801  -0.0345 -0.0113 1701 TYR A OH  
250  N  N   . LEU A 28  ? 0.2039 0.2156 0.4285 0.0314  -0.0820 -0.0436 1702 LEU A N   
251  C  CA  . LEU A 28  ? 0.2423 0.2310 0.4282 0.0262  -0.0347 -0.0652 1702 LEU A CA  
252  C  C   . LEU A 28  ? 0.1955 0.1881 0.4088 0.0189  -0.0599 -0.0549 1702 LEU A C   
253  O  O   . LEU A 28  ? 0.1588 0.1997 0.4515 -0.0022 -0.0930 -0.0533 1702 LEU A O   
254  C  CB  . LEU A 28  ? 0.2445 0.2056 0.3965 0.0546  -0.0519 -0.0727 1702 LEU A CB  
255  C  CG  . LEU A 28  ? 0.3194 0.2106 0.3692 0.0524  -0.0396 -0.0573 1702 LEU A CG  
256  C  CD1 . LEU A 28  ? 0.3332 0.2836 0.3616 0.0810  -0.0260 -0.0712 1702 LEU A CD1 
257  C  CD2 . LEU A 28  ? 0.2882 0.3108 0.4330 0.0457  -0.0325 -0.0448 1702 LEU A CD2 
258  N  N   . LEU A 29  ? 0.1920 0.1699 0.4359 0.0282  -0.0558 -0.0501 1703 LEU A N   
259  C  CA  . LEU A 29  ? 0.2008 0.1875 0.4335 0.0243  -0.0556 -0.0437 1703 LEU A CA  
260  C  C   . LEU A 29  ? 0.1768 0.1904 0.4351 -0.0004 -0.0431 -0.0212 1703 LEU A C   
261  O  O   . LEU A 29  ? 0.1428 0.1723 0.4894 -0.0088 -0.0544 -0.0518 1703 LEU A O   
262  C  CB  . LEU A 29  ? 0.1622 0.1940 0.4288 0.0279  -0.0320 -0.0532 1703 LEU A CB  
263  C  CG  . LEU A 29  ? 0.1880 0.2286 0.4508 0.0762  -0.0423 -0.0224 1703 LEU A CG  
264  C  CD1 . LEU A 29  ? 0.3265 0.3522 0.5271 0.0885  -0.0293 0.0404  1703 LEU A CD1 
265  C  CD2 . LEU A 29  ? 0.2020 0.3076 0.4603 0.0108  -0.0132 -0.0576 1703 LEU A CD2 
266  N  N   . SER A 30  ? 0.2295 0.1913 0.4177 -0.0111 -0.0622 -0.0302 1704 SER A N   
267  C  CA  . SER A 30  ? 0.1682 0.1922 0.4266 0.0089  -0.0618 0.0106  1704 SER A CA  
268  C  C   . SER A 30  ? 0.1845 0.2057 0.4246 -0.0030 -0.0618 -0.0329 1704 SER A C   
269  O  O   . SER A 30  ? 0.1990 0.1870 0.4793 -0.0266 -0.0734 -0.0334 1704 SER A O   
270  C  CB  . SER A 30  ? 0.2043 0.2375 0.4198 0.0057  -0.0505 -0.0070 1704 SER A CB  
271  O  OG  . SER A 30  ? 0.2216 0.2346 0.5380 -0.0139 -0.0230 0.0069  1704 SER A OG  
272  N  N   . LYS A 31  ? 0.1574 0.1842 0.4549 0.0109  -0.0626 -0.0362 1705 LYS A N   
273  C  CA  . LYS A 31  ? 0.1973 0.2098 0.4268 0.0339  -0.0484 -0.0234 1705 LYS A CA  
274  C  C   . LYS A 31  ? 0.1852 0.2235 0.4218 0.0200  -0.0472 -0.0160 1705 LYS A C   
275  O  O   . LYS A 31  ? 0.1779 0.1716 0.4468 0.0309  -0.0660 -0.0440 1705 LYS A O   
276  C  CB  . LYS A 31  ? 0.2556 0.2649 0.4069 0.0145  -0.0656 -0.0170 1705 LYS A CB  
277  C  CG  . LYS A 31  ? 0.3711 0.3019 0.4668 0.0353  -0.0226 -0.0160 1705 LYS A CG  
278  C  CD  . LYS A 31  ? 0.5062 0.4430 0.4730 -0.0047 -0.0008 -0.0367 1705 LYS A CD  
279  C  CE  . LYS A 31  ? 0.5332 0.5078 0.5430 0.0135  -0.0076 -0.0525 1705 LYS A CE  
280  N  NZ  . LYS A 31  ? 0.5659 0.4664 0.5662 0.0314  0.0131  -0.0442 1705 LYS A NZ  
281  N  N   . GLU A 32  ? 0.1880 0.1755 0.4171 0.0224  -0.0488 -0.0053 1706 GLU A N   
282  C  CA  . GLU A 32  ? 0.1468 0.2046 0.3784 0.0376  -0.0353 -0.0094 1706 GLU A CA  
283  C  C   . GLU A 32  ? 0.1497 0.1927 0.3748 0.0035  -0.0404 -0.0159 1706 GLU A C   
284  O  O   . GLU A 32  ? 0.0826 0.2243 0.3910 0.0154  -0.0619 -0.0268 1706 GLU A O   
285  C  CB  . GLU A 32  ? 0.1820 0.1811 0.3796 0.0025  -0.0679 0.0223  1706 GLU A CB  
286  C  CG  . GLU A 32  ? 0.1751 0.1988 0.3704 0.0158  -0.0948 -0.0245 1706 GLU A CG  
287  C  CD  . GLU A 32  ? 0.2600 0.2651 0.3372 0.0217  -0.0811 -0.0203 1706 GLU A CD  
288  O  OE1 . GLU A 32  ? 0.3891 0.2888 0.4104 0.0485  -0.0323 -0.0742 1706 GLU A OE1 
289  O  OE2 . GLU A 32  ? 0.1342 0.2449 0.4560 0.0396  -0.0825 -0.0678 1706 GLU A OE2 
290  N  N   . TYR A 33  ? 0.1564 0.1964 0.3782 -0.0001 -0.0314 -0.0197 1707 TYR A N   
291  C  CA  . TYR A 33  ? 0.1348 0.2300 0.3670 0.0236  -0.0284 -0.0259 1707 TYR A CA  
292  C  C   . TYR A 33  ? 0.1599 0.1682 0.3839 -0.0017 -0.0268 -0.0173 1707 TYR A C   
293  O  O   . TYR A 33  ? 0.1197 0.1702 0.3696 -0.0123 -0.0385 -0.0502 1707 TYR A O   
294  C  CB  . TYR A 33  ? 0.1507 0.2131 0.3821 -0.0050 0.0131  -0.0325 1707 TYR A CB  
295  C  CG  . TYR A 33  ? 0.1229 0.2341 0.3461 0.0136  -0.0206 -0.0054 1707 TYR A CG  
296  C  CD1 . TYR A 33  ? 0.1242 0.2304 0.3652 0.0097  -0.0321 -0.0120 1707 TYR A CD1 
297  C  CD2 . TYR A 33  ? 0.1189 0.2848 0.3667 0.0056  0.0296  -0.0177 1707 TYR A CD2 
298  C  CE1 . TYR A 33  ? 0.1074 0.2809 0.2707 0.0225  -0.0375 -0.0292 1707 TYR A CE1 
299  C  CE2 . TYR A 33  ? 0.1545 0.2805 0.4073 0.0428  -0.0167 -0.0176 1707 TYR A CE2 
300  C  CZ  . TYR A 33  ? 0.1083 0.3170 0.3555 0.0705  0.0078  -0.0033 1707 TYR A CZ  
301  O  OH  . TYR A 33  ? 0.1670 0.3400 0.3816 0.0192  -0.0425 -0.0330 1707 TYR A OH  
302  N  N   . GLU A 34  ? 0.1576 0.1637 0.3554 0.0197  -0.0359 0.0070  1708 GLU A N   
303  C  CA  A GLU A 34  ? 0.1753 0.1763 0.3655 -0.0093 -0.0397 -0.0051 1708 GLU A CA  
304  C  CA  B GLU A 34  ? 0.1803 0.1765 0.3467 0.0030  -0.0374 -0.0056 1708 GLU A CA  
305  C  C   . GLU A 34  ? 0.1876 0.1590 0.3518 -0.0120 -0.0415 -0.0114 1708 GLU A C   
306  O  O   . GLU A 34  ? 0.2034 0.1771 0.3674 -0.0071 -0.0799 -0.0111 1708 GLU A O   
307  C  CB  A GLU A 34  ? 0.2331 0.2008 0.3482 0.0088  -0.0613 -0.0056 1708 GLU A CB  
308  C  CB  B GLU A 34  ? 0.2161 0.1947 0.3364 0.0117  -0.0378 -0.0037 1708 GLU A CB  
309  C  CG  A GLU A 34  ? 0.3355 0.3209 0.4144 -0.0361 -0.0133 -0.0215 1708 GLU A CG  
310  C  CG  B GLU A 34  ? 0.2583 0.2282 0.3252 0.0235  -0.0237 -0.0024 1708 GLU A CG  
311  C  CD  A GLU A 34  ? 0.5161 0.4564 0.5521 -0.0086 -0.0091 0.0132  1708 GLU A CD  
312  C  CD  B GLU A 34  ? 0.3511 0.3177 0.3662 0.0069  -0.0087 -0.0002 1708 GLU A CD  
313  O  OE1 A GLU A 34  ? 0.5421 0.5945 0.6229 0.0289  -0.0097 -0.0042 1708 GLU A OE1 
314  O  OE1 B GLU A 34  ? 0.3484 0.3479 0.3799 0.0007  -0.0123 -0.0046 1708 GLU A OE1 
315  O  OE2 A GLU A 34  ? 0.5612 0.5396 0.5856 -0.0461 -0.0047 -0.0031 1708 GLU A OE2 
316  O  OE2 B GLU A 34  ? 0.3698 0.3618 0.4022 0.0094  -0.0203 0.0143  1708 GLU A OE2 
317  N  N   . GLU A 35  ? 0.1432 0.1480 0.3504 0.0135  -0.0650 -0.0315 1709 GLU A N   
318  C  CA  . GLU A 35  ? 0.1590 0.1770 0.3621 0.0175  -0.0404 -0.0443 1709 GLU A CA  
319  C  C   . GLU A 35  ? 0.1070 0.1540 0.3506 0.0152  -0.0529 -0.0512 1709 GLU A C   
320  O  O   . GLU A 35  ? 0.1278 0.1869 0.3885 0.0168  -0.0400 -0.0527 1709 GLU A O   
321  C  CB  . GLU A 35  ? 0.2055 0.2021 0.3638 0.0042  -0.0584 -0.0398 1709 GLU A CB  
322  C  CG  . GLU A 35  ? 0.2893 0.2343 0.4389 0.0160  -0.0544 -0.0321 1709 GLU A CG  
323  C  CD  . GLU A 35  ? 0.5196 0.4521 0.5136 0.0025  -0.0201 -0.0091 1709 GLU A CD  
324  O  OE1 . GLU A 35  ? 0.5566 0.5807 0.5927 -0.0166 0.0165  0.0152  1709 GLU A OE1 
325  O  OE2 . GLU A 35  ? 0.5521 0.5436 0.5995 -0.0157 -0.0696 -0.0219 1709 GLU A OE2 
326  N  N   . LEU A 36  ? 0.1221 0.1265 0.2786 0.0269  -0.0442 -0.0765 1710 LEU A N   
327  C  CA  . LEU A 36  ? 0.0975 0.1437 0.2640 0.0298  -0.0296 -0.0276 1710 LEU A CA  
328  C  C   . LEU A 36  ? 0.1112 0.1666 0.2637 0.0160  -0.0350 -0.0150 1710 LEU A C   
329  O  O   . LEU A 36  ? 0.1318 0.1472 0.2598 0.0129  -0.0470 -0.0258 1710 LEU A O   
330  C  CB  . LEU A 36  ? 0.0978 0.1540 0.2579 0.0317  -0.0235 -0.0033 1710 LEU A CB  
331  C  CG  . LEU A 36  ? 0.0957 0.1818 0.2408 0.0186  -0.0607 -0.0053 1710 LEU A CG  
332  C  CD1 . LEU A 36  ? 0.1210 0.2049 0.2993 0.0639  -0.0692 0.0240  1710 LEU A CD1 
333  C  CD2 . LEU A 36  ? 0.1614 0.2605 0.2407 -0.0181 -0.0160 -0.0248 1710 LEU A CD2 
334  N  N   . LYS A 37  ? 0.1438 0.1714 0.2629 0.0201  -0.0364 -0.0089 1711 LYS A N   
335  C  CA  . LYS A 37  ? 0.1610 0.1580 0.2731 -0.0028 -0.0357 0.0065  1711 LYS A CA  
336  C  C   . LYS A 37  ? 0.1517 0.1691 0.2325 0.0236  -0.0365 -0.0275 1711 LYS A C   
337  O  O   . LYS A 37  ? 0.2061 0.1828 0.2703 0.0285  -0.0380 -0.0224 1711 LYS A O   
338  C  CB  . LYS A 37  ? 0.2084 0.1924 0.3100 -0.0234 -0.0245 0.0026  1711 LYS A CB  
339  C  CG  . LYS A 37  ? 0.3469 0.2509 0.3602 0.0003  -0.0499 -0.0221 1711 LYS A CG  
340  C  CD  . LYS A 37  ? 0.4590 0.3189 0.4544 -0.0123 -0.0444 0.0380  1711 LYS A CD  
341  C  CE  . LYS A 37  ? 0.4553 0.3212 0.4676 -0.0091 -0.0027 0.0199  1711 LYS A CE  
342  N  NZ  . LYS A 37  ? 0.5049 0.4081 0.5649 0.0382  0.0046  0.0103  1711 LYS A NZ  
343  N  N   . ASP A 38  ? 0.1199 0.1679 0.2519 0.0098  -0.0703 -0.0182 1712 ASP A N   
344  C  CA  . ASP A 38  ? 0.1370 0.1856 0.2490 0.0200  -0.0740 -0.0200 1712 ASP A CA  
345  C  C   . ASP A 38  ? 0.1566 0.1811 0.2293 0.0148  -0.0704 -0.0149 1712 ASP A C   
346  O  O   . ASP A 38  ? 0.1545 0.1954 0.2487 0.0262  -0.0917 -0.0236 1712 ASP A O   
347  C  CB  . ASP A 38  ? 0.2010 0.1635 0.2854 0.0318  -0.0555 0.0005  1712 ASP A CB  
348  C  CG  . ASP A 38  ? 0.2130 0.2473 0.3221 0.0448  -0.0750 -0.0085 1712 ASP A CG  
349  O  OD1 . ASP A 38  ? 0.4264 0.2907 0.3348 -0.0025 -0.0610 -0.0165 1712 ASP A OD1 
350  O  OD2 . ASP A 38  ? 0.4641 0.2916 0.5002 0.0244  -0.0909 -0.0043 1712 ASP A OD2 
351  N  N   . VAL A 39  ? 0.1670 0.1615 0.1936 0.0197  -0.0492 -0.0297 1713 VAL A N   
352  C  CA  . VAL A 39  ? 0.1197 0.1620 0.1595 0.0149  -0.0515 -0.0180 1713 VAL A CA  
353  C  C   . VAL A 39  ? 0.1355 0.1797 0.1975 -0.0200 -0.0485 -0.0318 1713 VAL A C   
354  O  O   . VAL A 39  ? 0.1750 0.1576 0.2098 -0.0005 -0.0607 -0.0407 1713 VAL A O   
355  C  CB  . VAL A 39  ? 0.1434 0.1678 0.1671 0.0134  -0.0569 -0.0263 1713 VAL A CB  
356  C  CG1 . VAL A 39  ? 0.1223 0.1651 0.2012 -0.0192 -0.0344 -0.0281 1713 VAL A CG1 
357  C  CG2 . VAL A 39  ? 0.1404 0.1878 0.1952 -0.0052 -0.0259 -0.0652 1713 VAL A CG2 
358  N  N   . GLY A 40  ? 0.1172 0.1727 0.2189 -0.0336 -0.0729 -0.0323 1714 GLY A N   
359  C  CA  . GLY A 40  ? 0.1768 0.1906 0.1933 -0.0025 -0.0819 -0.0286 1714 GLY A CA  
360  C  C   . GLY A 40  ? 0.1614 0.1949 0.2263 0.0196  -0.0797 -0.0263 1714 GLY A C   
361  O  O   . GLY A 40  ? 0.1350 0.2428 0.2154 -0.0058 -0.0686 -0.0333 1714 GLY A O   
362  N  N   . ARG A 41  ? 0.1959 0.2004 0.2205 0.0128  -0.0683 -0.0077 1715 ARG A N   
363  C  CA  . ARG A 41  ? 0.1896 0.2476 0.2671 0.0255  -0.0751 -0.0084 1715 ARG A CA  
364  C  C   . ARG A 41  ? 0.1955 0.2492 0.2661 0.0545  -0.0438 -0.0384 1715 ARG A C   
365  O  O   . ARG A 41  ? 0.2554 0.2603 0.2586 0.0730  -0.0836 -0.0569 1715 ARG A O   
366  C  CB  . ARG A 41  ? 0.1432 0.2357 0.2963 0.0258  -0.0390 -0.0115 1715 ARG A CB  
367  C  CG  . ARG A 41  ? 0.2116 0.2789 0.3125 0.0854  -0.0353 0.0047  1715 ARG A CG  
368  C  CD  . ARG A 41  ? 0.1279 0.2501 0.2895 0.0814  -0.0767 -0.0370 1715 ARG A CD  
369  N  NE  . ARG A 41  ? 0.2109 0.2385 0.3172 -0.0017 -0.0315 -0.0247 1715 ARG A NE  
370  C  CZ  . ARG A 41  ? 0.2110 0.2216 0.3196 0.0245  -0.0228 -0.0231 1715 ARG A CZ  
371  N  NH1 . ARG A 41  ? 0.2153 0.2642 0.2623 0.0035  -0.0792 0.0175  1715 ARG A NH1 
372  N  NH2 . ARG A 41  ? 0.1849 0.2327 0.3842 0.0458  -0.0287 -0.0231 1715 ARG A NH2 
373  N  N   . ASN A 42  ? 0.1937 0.2242 0.2636 0.0747  -0.0813 -0.0554 1716 ASN A N   
374  C  CA  A ASN A 42  ? 0.1803 0.2642 0.2777 0.0586  -0.0372 -0.0463 1716 ASN A CA  
375  C  CA  B ASN A 42  ? 0.1949 0.2820 0.2859 0.0506  -0.0366 -0.0498 1716 ASN A CA  
376  C  C   . ASN A 42  ? 0.1880 0.2866 0.3038 0.0607  -0.0559 -0.0542 1716 ASN A C   
377  O  O   . ASN A 42  ? 0.1207 0.3345 0.3259 0.0752  -0.0741 -0.0738 1716 ASN A O   
378  C  CB  A ASN A 42  ? 0.2270 0.2561 0.3146 0.0774  -0.0188 -0.0406 1716 ASN A CB  
379  C  CB  B ASN A 42  ? 0.2556 0.3089 0.3271 0.0549  -0.0193 -0.0453 1716 ASN A CB  
380  C  CG  A ASN A 42  ? 0.2735 0.2961 0.3037 0.0339  -0.0059 -0.0125 1716 ASN A CG  
381  C  CG  B ASN A 42  ? 0.3385 0.3718 0.3222 0.0129  -0.0069 -0.0259 1716 ASN A CG  
382  O  OD1 A ASN A 42  ? 0.3739 0.2419 0.3712 -0.0066 0.0027  -0.0412 1716 ASN A OD1 
383  O  OD1 B ASN A 42  ? 0.3576 0.3545 0.3347 0.0452  0.0194  -0.0475 1716 ASN A OD1 
384  N  ND2 A ASN A 42  ? 0.3479 0.3317 0.3566 0.0435  -0.0455 0.0032  1716 ASN A ND2 
385  N  ND2 B ASN A 42  ? 0.4150 0.3618 0.4068 -0.0119 0.0180  0.0078  1716 ASN A ND2 
386  N  N   . GLN A 43  ? 0.1146 0.2134 0.2573 0.0747  -0.0411 -0.0577 1717 GLN A N   
387  C  CA  . GLN A 43  ? 0.0852 0.2391 0.1959 0.0443  -0.0234 -0.0196 1717 GLN A CA  
388  C  C   . GLN A 43  ? 0.1143 0.2008 0.1709 0.0146  -0.0137 -0.0214 1717 GLN A C   
389  O  O   . GLN A 43  ? 0.0956 0.2087 0.2341 0.0083  -0.0163 -0.0307 1717 GLN A O   
390  C  CB  . GLN A 43  ? 0.0917 0.2316 0.1518 0.0306  -0.0320 0.0091  1717 GLN A CB  
391  C  CG  . GLN A 43  ? 0.1562 0.3276 0.1707 0.0251  -0.0335 0.0310  1717 GLN A CG  
392  C  CD  . GLN A 43  ? 0.1776 0.2563 0.2561 0.0365  -0.0278 0.0179  1717 GLN A CD  
393  O  OE1 . GLN A 43  ? 0.1327 0.3702 0.3570 -0.0463 -0.0795 0.0141  1717 GLN A OE1 
394  N  NE2 . GLN A 43  ? 0.0606 0.2610 0.2341 -0.0105 -0.0771 -0.0337 1717 GLN A NE2 
395  N  N   . SER A 44  ? 0.0939 0.1401 0.1588 0.0304  -0.0384 -0.0082 1718 SER A N   
396  C  CA  . SER A 44  ? 0.0653 0.1299 0.1625 0.0230  -0.0212 -0.0105 1718 SER A CA  
397  C  C   . SER A 44  ? 0.0969 0.1010 0.1639 0.0099  -0.0213 0.0048  1718 SER A C   
398  O  O   . SER A 44  ? 0.0888 0.1506 0.1794 0.0254  -0.0221 0.0036  1718 SER A O   
399  C  CB  . SER A 44  ? 0.0702 0.1237 0.2135 0.0236  -0.0437 0.0058  1718 SER A CB  
400  O  OG  . SER A 44  ? 0.0843 0.1562 0.2012 0.0252  -0.0270 0.0230  1718 SER A OG  
401  N  N   . CYS A 45  ? 0.0703 0.1239 0.1957 0.0136  -0.0192 0.0094  1719 CYS A N   
402  C  CA  A CYS A 45  ? 0.0730 0.1295 0.1843 0.0211  -0.0083 -0.0242 1719 CYS A CA  
403  C  CA  B CYS A 45  ? 0.0925 0.1543 0.2047 0.0133  -0.0150 -0.0136 1719 CYS A CA  
404  C  C   . CYS A 45  ? 0.1255 0.1516 0.1767 0.0104  -0.0212 -0.0137 1719 CYS A C   
405  O  O   . CYS A 45  ? 0.1010 0.1443 0.1850 0.0049  -0.0326 -0.0251 1719 CYS A O   
406  C  CB  A CYS A 45  ? 0.0743 0.1475 0.2096 -0.0051 0.0084  0.0183  1719 CYS A CB  
407  C  CB  B CYS A 45  ? 0.0979 0.1863 0.2214 0.0043  -0.0036 0.0006  1719 CYS A CB  
408  S  SG  A CYS A 45  ? 0.0571 0.1279 0.1788 0.0019  -0.0439 -0.0068 1719 CYS A SG  
409  S  SG  B CYS A 45  ? 0.1253 0.2852 0.3056 0.0048  -0.0214 0.0167  1719 CYS A SG  
410  N  N   . ASP A 46  ? 0.1005 0.1221 0.1980 0.0305  -0.0366 -0.0107 1720 ASP A N   
411  C  CA  . ASP A 46  ? 0.1007 0.1264 0.2070 0.0100  -0.0345 -0.0196 1720 ASP A CA  
412  C  C   . ASP A 46  ? 0.0978 0.1439 0.1757 0.0224  -0.0608 -0.0142 1720 ASP A C   
413  O  O   . ASP A 46  ? 0.1519 0.1648 0.1795 0.0146  -0.0479 -0.0324 1720 ASP A O   
414  C  CB  . ASP A 46  ? 0.0820 0.1553 0.2573 0.0166  -0.0182 -0.0148 1720 ASP A CB  
415  C  CG  . ASP A 46  ? 0.1274 0.1892 0.1638 0.0235  -0.0240 -0.0025 1720 ASP A CG  
416  O  OD1 . ASP A 46  ? 0.1178 0.1345 0.2239 0.0213  -0.0378 0.0247  1720 ASP A OD1 
417  O  OD2 . ASP A 46  ? 0.1124 0.1601 0.2989 0.0027  -0.0173 0.0186  1720 ASP A OD2 
418  N  N   . ILE A 47  ? 0.0936 0.1543 0.1988 -0.0095 -0.0490 -0.0143 1721 ILE A N   
419  C  CA  . ILE A 47  ? 0.1044 0.1415 0.1880 -0.0102 -0.0258 -0.0066 1721 ILE A CA  
420  C  C   . ILE A 47  ? 0.0990 0.1277 0.1628 -0.0043 -0.0634 -0.0150 1721 ILE A C   
421  O  O   . ILE A 47  ? 0.0944 0.1487 0.2004 0.0201  -0.0495 -0.0234 1721 ILE A O   
422  C  CB  . ILE A 47  ? 0.0899 0.1504 0.1970 -0.0158 -0.0341 -0.0141 1721 ILE A CB  
423  C  CG1 . ILE A 47  ? 0.0463 0.2137 0.2647 -0.0294 -0.0449 0.0022  1721 ILE A CG1 
424  C  CG2 . ILE A 47  ? 0.1152 0.1708 0.2274 -0.0093 -0.0609 0.0093  1721 ILE A CG2 
425  C  CD1 . ILE A 47  ? 0.1414 0.2059 0.2852 -0.0504 -0.0377 -0.0362 1721 ILE A CD1 
426  N  N   . ALA A 48  ? 0.1024 0.1358 0.1741 -0.0096 -0.0425 0.0051  1722 ALA A N   
427  C  CA  . ALA A 48  ? 0.0947 0.1517 0.1457 -0.0069 -0.0222 -0.0068 1722 ALA A CA  
428  C  C   . ALA A 48  ? 0.0932 0.1402 0.1496 0.0134  -0.0243 0.0011  1722 ALA A C   
429  O  O   . ALA A 48  ? 0.1069 0.1494 0.1710 0.0317  -0.0183 -0.0151 1722 ALA A O   
430  C  CB  . ALA A 48  ? 0.1209 0.1353 0.1628 -0.0048 -0.0606 -0.0109 1722 ALA A CB  
431  N  N   . LEU A 49  ? 0.0764 0.1488 0.1917 0.0277  -0.0367 -0.0008 1723 LEU A N   
432  C  CA  . LEU A 49  ? 0.1311 0.1514 0.1597 0.0256  -0.0408 -0.0037 1723 LEU A CA  
433  C  C   . LEU A 49  ? 0.1396 0.1845 0.1942 0.0034  -0.0411 0.0039  1723 LEU A C   
434  O  O   . LEU A 49  ? 0.1745 0.1967 0.1803 0.0191  -0.0482 -0.0024 1723 LEU A O   
435  C  CB  . LEU A 49  ? 0.1105 0.1455 0.1997 0.0089  -0.0266 0.0035  1723 LEU A CB  
436  C  CG  . LEU A 49  ? 0.1236 0.1755 0.1795 0.0164  -0.0352 -0.0149 1723 LEU A CG  
437  C  CD1 . LEU A 49  ? 0.1121 0.1597 0.3055 0.0359  -0.0282 -0.0321 1723 LEU A CD1 
438  C  CD2 . LEU A 49  ? 0.1514 0.2026 0.1532 -0.0046 -0.0162 0.0094  1723 LEU A CD2 
439  N  N   . LEU A 50  ? 0.1275 0.1717 0.1541 0.0090  -0.0462 -0.0125 1724 LEU A N   
440  C  CA  . LEU A 50  ? 0.1123 0.2067 0.1856 0.0250  -0.0671 -0.0366 1724 LEU A CA  
441  C  C   . LEU A 50  ? 0.1933 0.1996 0.1456 0.0193  -0.0644 -0.0251 1724 LEU A C   
442  O  O   . LEU A 50  ? 0.1801 0.1804 0.1962 0.0412  -0.0544 -0.0225 1724 LEU A O   
443  C  CB  . LEU A 50  ? 0.1197 0.2176 0.1994 -0.0009 -0.0688 -0.0161 1724 LEU A CB  
444  C  CG  . LEU A 50  ? 0.1430 0.2302 0.1867 0.0122  -0.0700 0.0272  1724 LEU A CG  
445  C  CD1 . LEU A 50  ? 0.1821 0.2543 0.2786 -0.0471 -0.0961 0.0296  1724 LEU A CD1 
446  C  CD2 . LEU A 50  ? 0.1734 0.2741 0.2708 0.0639  -0.0768 -0.0082 1724 LEU A CD2 
447  N  N   . PRO A 51  ? 0.2034 0.2492 0.1958 0.0907  -0.0504 -0.0189 1725 PRO A N   
448  C  CA  . PRO A 51  ? 0.2785 0.2821 0.1799 0.0722  -0.0724 -0.0204 1725 PRO A CA  
449  C  C   . PRO A 51  ? 0.2672 0.2977 0.2230 0.0562  -0.0746 -0.0135 1725 PRO A C   
450  O  O   . PRO A 51  ? 0.3236 0.3386 0.2140 0.0864  -0.0860 -0.0105 1725 PRO A O   
451  C  CB  . PRO A 51  ? 0.3154 0.2896 0.2047 0.0823  -0.0991 -0.0090 1725 PRO A CB  
452  C  CG  . PRO A 51  ? 0.3112 0.3404 0.2264 0.0786  -0.0476 -0.0304 1725 PRO A CG  
453  C  CD  . PRO A 51  ? 0.2089 0.2663 0.1872 0.0783  -0.0722 -0.0133 1725 PRO A CD  
454  N  N   . GLU A 52  ? 0.2706 0.2476 0.2129 0.0469  -0.1166 -0.0278 1726 GLU A N   
455  C  CA  A GLU A 52  ? 0.2504 0.2665 0.2595 0.0313  -0.0834 -0.0399 1726 GLU A CA  
456  C  CA  B GLU A 52  ? 0.2450 0.2456 0.2376 0.0372  -0.0810 -0.0275 1726 GLU A CA  
457  C  C   . GLU A 52  ? 0.2382 0.2098 0.2455 0.0391  -0.1078 -0.0372 1726 GLU A C   
458  O  O   . GLU A 52  ? 0.2475 0.2406 0.2956 0.0657  -0.0983 -0.0623 1726 GLU A O   
459  C  CB  A GLU A 52  ? 0.2471 0.2876 0.2597 -0.0046 -0.1091 -0.0345 1726 GLU A CB  
460  C  CB  B GLU A 52  ? 0.2510 0.2520 0.2386 0.0179  -0.0837 -0.0210 1726 GLU A CB  
461  C  CG  A GLU A 52  ? 0.3217 0.3834 0.3759 -0.0006 -0.0480 -0.0302 1726 GLU A CG  
462  C  CG  B GLU A 52  ? 0.2493 0.2499 0.2302 0.0425  -0.0644 0.0198  1726 GLU A CG  
463  C  CD  A GLU A 52  ? 0.3012 0.3687 0.3533 -0.0189 -0.0303 0.0031  1726 GLU A CD  
464  C  CD  B GLU A 52  ? 0.2985 0.2858 0.2734 0.0184  -0.0376 0.0138  1726 GLU A CD  
465  O  OE1 A GLU A 52  ? 0.3747 0.4653 0.5030 -0.0422 0.0017  -0.0111 1726 GLU A OE1 
466  O  OE1 B GLU A 52  ? 0.2423 0.3361 0.3436 -0.0013 -0.0640 0.0196  1726 GLU A OE1 
467  O  OE2 A GLU A 52  ? 0.3210 0.2511 0.3493 -0.0368 -0.0995 -0.0282 1726 GLU A OE2 
468  O  OE2 B GLU A 52  ? 0.2931 0.3210 0.2447 -0.0115 -0.0537 0.0133  1726 GLU A OE2 
469  N  N   . ASN A 53  ? 0.1805 0.2090 0.2040 0.0502  -0.0949 -0.0232 1727 ASN A N   
470  C  CA  . ASN A 53  ? 0.1912 0.2026 0.1948 0.0301  -0.0780 -0.0035 1727 ASN A CA  
471  C  C   . ASN A 53  ? 0.2200 0.2064 0.2280 0.0402  -0.0557 -0.0043 1727 ASN A C   
472  O  O   . ASN A 53  ? 0.1505 0.2086 0.2272 0.0607  -0.0663 -0.0058 1727 ASN A O   
473  C  CB  . ASN A 53  ? 0.1704 0.1564 0.2199 0.0286  -0.0487 0.0122  1727 ASN A CB  
474  C  CG  . ASN A 53  ? 0.1425 0.1651 0.2147 0.0021  -0.0708 -0.0045 1727 ASN A CG  
475  O  OD1 . ASN A 53  ? 0.1663 0.1558 0.2515 0.0052  -0.0543 -0.0049 1727 ASN A OD1 
476  N  ND2 . ASN A 53  ? 0.1223 0.1800 0.2275 -0.0002 -0.0672 -0.0370 1727 ASN A ND2 
477  N  N   . ARG A 54  ? 0.2286 0.2293 0.2617 0.0450  -0.0290 0.0268  1728 ARG A N   
478  C  CA  A ARG A 54  ? 0.2550 0.2466 0.2668 0.0432  -0.0442 0.0330  1728 ARG A CA  
479  C  CA  B ARG A 54  ? 0.2275 0.2356 0.2411 0.0332  -0.0389 0.0221  1728 ARG A CA  
480  C  C   . ARG A 54  ? 0.2278 0.2605 0.2257 0.0331  -0.0586 -0.0033 1728 ARG A C   
481  O  O   . ARG A 54  ? 0.1993 0.2228 0.3004 0.0352  -0.0578 0.0248  1728 ARG A O   
482  C  CB  A ARG A 54  ? 0.2961 0.3097 0.2908 0.0312  -0.0526 0.0321  1728 ARG A CB  
483  C  CB  B ARG A 54  ? 0.2365 0.2608 0.2456 0.0157  -0.0412 0.0248  1728 ARG A CB  
484  C  CG  A ARG A 54  ? 0.3780 0.3508 0.3784 0.0091  -0.0374 0.0152  1728 ARG A CG  
485  C  CG  B ARG A 54  ? 0.1980 0.2676 0.2328 -0.0055 -0.0009 0.0320  1728 ARG A CG  
486  C  CD  A ARG A 54  ? 0.5401 0.4833 0.4592 0.0098  -0.0053 0.0291  1728 ARG A CD  
487  C  CD  B ARG A 54  ? 0.3252 0.3218 0.2710 -0.0056 -0.0239 0.0332  1728 ARG A CD  
488  N  NE  A ARG A 54  ? 0.5658 0.5424 0.5093 -0.0023 -0.0177 -0.0131 1728 ARG A NE  
489  N  NE  B ARG A 54  ? 0.3617 0.4297 0.3794 -0.0130 0.0043  0.0172  1728 ARG A NE  
490  C  CZ  A ARG A 54  ? 0.5625 0.5616 0.5514 -0.0008 -0.0061 0.0029  1728 ARG A CZ  
491  C  CZ  B ARG A 54  ? 0.4284 0.4593 0.4149 0.0017  -0.0002 -0.0010 1728 ARG A CZ  
492  N  NH1 A ARG A 54  ? 0.5084 0.5650 0.5387 -0.0007 -0.0207 -0.0142 1728 ARG A NH1 
493  N  NH1 B ARG A 54  ? 0.4270 0.4689 0.4398 -0.0059 0.0028  -0.0015 1728 ARG A NH1 
494  N  NH2 A ARG A 54  ? 0.5735 0.5692 0.6060 -0.0090 -0.0167 0.0006  1728 ARG A NH2 
495  N  NH2 B ARG A 54  ? 0.4544 0.4707 0.4833 0.0004  -0.0017 0.0020  1728 ARG A NH2 
496  N  N   . GLY A 55  ? 0.2210 0.1969 0.1854 0.0644  -0.0557 0.0041  1729 GLY A N   
497  C  CA  . GLY A 55  ? 0.1795 0.2293 0.1799 0.0686  -0.0293 -0.0183 1729 GLY A CA  
498  C  C   . GLY A 55  ? 0.1401 0.2157 0.1715 0.0167  -0.0575 -0.0222 1729 GLY A C   
499  O  O   . GLY A 55  ? 0.1886 0.3005 0.2028 0.0603  -0.0536 -0.0176 1729 GLY A O   
500  N  N   . LYS A 56  ? 0.1348 0.1880 0.1296 0.0117  -0.0585 -0.0264 1730 LYS A N   
501  C  CA  . LYS A 56  ? 0.1375 0.1716 0.1570 -0.0085 -0.0308 -0.0192 1730 LYS A CA  
502  C  C   . LYS A 56  ? 0.1153 0.1363 0.1606 0.0154  -0.0345 -0.0247 1730 LYS A C   
503  O  O   . LYS A 56  ? 0.1410 0.1331 0.1583 0.0112  -0.0585 -0.0067 1730 LYS A O   
504  C  CB  . LYS A 56  ? 0.1195 0.1598 0.1978 -0.0140 -0.0406 0.0023  1730 LYS A CB  
505  C  CG  . LYS A 56  ? 0.1768 0.2011 0.2536 -0.0506 -0.0325 -0.0423 1730 LYS A CG  
506  C  CD  . LYS A 56  ? 0.1301 0.2648 0.2678 -0.0160 -0.0455 -0.0701 1730 LYS A CD  
507  C  CE  . LYS A 56  ? 0.2961 0.3987 0.3313 -0.0685 -0.0657 -0.0503 1730 LYS A CE  
508  N  NZ  . LYS A 56  ? 0.2574 0.4177 0.3791 -0.0517 -0.0654 -0.0378 1730 LYS A NZ  
509  N  N   . ASN A 57  ? 0.1243 0.1299 0.1584 0.0092  -0.0545 -0.0177 1731 ASN A N   
510  C  CA  . ASN A 57  ? 0.1073 0.1283 0.1610 0.0269  -0.0285 0.0063  1731 ASN A CA  
511  C  C   . ASN A 57  ? 0.1277 0.1415 0.1634 0.0297  -0.0289 0.0287  1731 ASN A C   
512  O  O   . ASN A 57  ? 0.1118 0.1711 0.1739 0.0149  -0.0167 0.0248  1731 ASN A O   
513  C  CB  . ASN A 57  ? 0.1089 0.1258 0.1525 0.0119  -0.0020 0.0298  1731 ASN A CB  
514  C  CG  . ASN A 57  ? 0.1089 0.1375 0.1278 -0.0078 -0.0352 0.0068  1731 ASN A CG  
515  O  OD1 . ASN A 57  ? 0.1011 0.1650 0.1606 -0.0071 -0.0272 0.0149  1731 ASN A OD1 
516  N  ND2 . ASN A 57  ? 0.1042 0.1605 0.1645 0.0068  -0.0563 -0.0083 1731 ASN A ND2 
517  N  N   . ARG A 58  ? 0.1159 0.1223 0.1627 0.0267  -0.0281 0.0085  1732 ARG A N   
518  C  CA  . ARG A 58  ? 0.1248 0.1306 0.1613 0.0149  -0.0012 0.0257  1732 ARG A CA  
519  C  C   . ARG A 58  ? 0.1199 0.1620 0.1632 0.0346  -0.0009 0.0275  1732 ARG A C   
520  O  O   . ARG A 58  ? 0.1622 0.1656 0.1870 0.0309  0.0084  0.0346  1732 ARG A O   
521  C  CB  . ARG A 58  ? 0.1203 0.1437 0.1686 0.0118  -0.0337 0.0384  1732 ARG A CB  
522  C  CG  . ARG A 58  ? 0.1051 0.1948 0.1663 0.0335  -0.0148 0.0541  1732 ARG A CG  
523  C  CD  . ARG A 58  ? 0.1599 0.1348 0.2074 0.0419  -0.0506 -0.0043 1732 ARG A CD  
524  N  NE  . ARG A 58  ? 0.0843 0.1900 0.2226 -0.0029 -0.0462 0.0262  1732 ARG A NE  
525  C  CZ  . ARG A 58  ? 0.0979 0.2167 0.2067 0.0439  -0.0704 0.0145  1732 ARG A CZ  
526  N  NH1 . ARG A 58  ? 0.1288 0.1772 0.2164 0.0248  -0.0229 0.0030  1732 ARG A NH1 
527  N  NH2 . ARG A 58  ? 0.1651 0.1544 0.2567 0.0296  -0.0891 0.0242  1732 ARG A NH2 
528  N  N   . TYR A 59  ? 0.1343 0.1412 0.1794 0.0200  -0.0011 0.0077  1733 TYR A N   
529  C  CA  . TYR A 59  ? 0.1337 0.1555 0.2159 0.0230  0.0025  0.0268  1733 TYR A CA  
530  C  C   . TYR A 59  ? 0.1487 0.1420 0.2025 0.0226  -0.0135 0.0258  1733 TYR A C   
531  O  O   . TYR A 59  ? 0.1313 0.1546 0.1995 0.0299  -0.0154 0.0267  1733 TYR A O   
532  C  CB  . TYR A 59  ? 0.0754 0.1608 0.2717 0.0065  -0.0066 0.0113  1733 TYR A CB  
533  C  CG  . TYR A 59  ? 0.1051 0.1774 0.2448 0.0282  0.0005  0.0114  1733 TYR A CG  
534  C  CD1 . TYR A 59  ? 0.1168 0.2035 0.3065 0.0112  -0.0144 0.0424  1733 TYR A CD1 
535  C  CD2 . TYR A 59  ? 0.0775 0.2216 0.2299 -0.0090 -0.0128 0.0011  1733 TYR A CD2 
536  C  CE1 . TYR A 59  ? 0.1372 0.1876 0.3373 0.0120  0.0017  0.0774  1733 TYR A CE1 
537  C  CE2 . TYR A 59  ? 0.1139 0.1563 0.2650 -0.0107 -0.0098 0.0112  1733 TYR A CE2 
538  C  CZ  . TYR A 59  ? 0.1056 0.1802 0.2543 -0.0093 0.0089  0.0126  1733 TYR A CZ  
539  O  OH  . TYR A 59  ? 0.1116 0.2736 0.3669 0.0442  -0.0044 0.0399  1733 TYR A OH  
540  N  N   . ASN A 60  ? 0.1501 0.1816 0.1968 0.0440  -0.0044 0.0239  1734 ASN A N   
541  C  CA  . ASN A 60  ? 0.1668 0.2091 0.1738 0.0458  -0.0283 0.0163  1734 ASN A CA  
542  C  C   . ASN A 60  ? 0.1610 0.1989 0.1693 0.0247  -0.0213 0.0323  1734 ASN A C   
543  O  O   . ASN A 60  ? 0.1255 0.2366 0.2324 0.0232  -0.0257 0.0142  1734 ASN A O   
544  C  CB  . ASN A 60  ? 0.2091 0.2831 0.1886 0.0285  -0.0344 0.0106  1734 ASN A CB  
545  C  CG  . ASN A 60  ? 0.2917 0.3102 0.2048 0.0587  -0.0001 0.0331  1734 ASN A CG  
546  O  OD1 . ASN A 60  ? 0.3825 0.4957 0.3495 0.0477  -0.0344 0.0747  1734 ASN A OD1 
547  N  ND2 . ASN A 60  ? 0.2941 0.2776 0.2331 0.0344  -0.0331 -0.0278 1734 ASN A ND2 
548  N  N   . ASN A 61  ? 0.1422 0.1449 0.1988 0.0105  -0.0356 0.0249  1735 ASN A N   
549  C  CA  . ASN A 61  ? 0.1386 0.1324 0.1875 -0.0037 -0.0219 0.0216  1735 ASN A CA  
550  C  C   . ASN A 61  ? 0.1056 0.1218 0.1989 -0.0058 -0.0288 0.0096  1735 ASN A C   
551  O  O   . ASN A 61  ? 0.1514 0.1222 0.2166 -0.0093 -0.0023 0.0149  1735 ASN A O   
552  C  CB  . ASN A 61  ? 0.1417 0.1546 0.1903 0.0181  0.0028  0.0553  1735 ASN A CB  
553  C  CG  . ASN A 61  ? 0.1475 0.1513 0.3083 -0.0127 0.0085  0.0554  1735 ASN A CG  
554  O  OD1 . ASN A 61  ? 0.1599 0.1786 0.2682 -0.0066 0.0010  0.0591  1735 ASN A OD1 
555  N  ND2 . ASN A 61  ? 0.1584 0.1579 0.2698 0.0105  -0.0261 0.0530  1735 ASN A ND2 
556  N  N   . ILE A 62  ? 0.0920 0.1177 0.1655 0.0087  -0.0151 0.0320  1736 ILE A N   
557  C  CA  A ILE A 62  ? 0.0792 0.1158 0.1754 0.0054  -0.0102 0.0106  1736 ILE A CA  
558  C  CA  B ILE A 62  ? 0.0408 0.1103 0.1841 -0.0034 -0.0055 0.0136  1736 ILE A CA  
559  C  C   . ILE A 62  ? 0.1047 0.0909 0.1473 0.0114  -0.0147 -0.0010 1736 ILE A C   
560  O  O   . ILE A 62  ? 0.0748 0.1025 0.1938 0.0123  -0.0082 0.0011  1736 ILE A O   
561  C  CB  A ILE A 62  ? 0.0867 0.1242 0.1832 -0.0032 -0.0099 0.0195  1736 ILE A CB  
562  C  CB  B ILE A 62  ? 0.0651 0.0996 0.2020 -0.0156 -0.0034 0.0344  1736 ILE A CB  
563  C  CG1 A ILE A 62  ? 0.0950 0.1213 0.1844 0.0023  0.0032  -0.0102 1736 ILE A CG1 
564  C  CG1 B ILE A 62  ? 0.0658 0.1315 0.2048 0.0054  -0.0314 -0.0013 1736 ILE A CG1 
565  C  CG2 A ILE A 62  ? 0.1333 0.1173 0.1760 0.0350  -0.0094 -0.0005 1736 ILE A CG2 
566  C  CG2 B ILE A 62  ? 0.0756 0.1706 0.2034 0.0235  -0.0612 -0.0055 1736 ILE A CG2 
567  C  CD1 A ILE A 62  ? 0.1371 0.0723 0.1448 0.0111  0.0440  -0.0166 1736 ILE A CD1 
568  C  CD1 B ILE A 62  ? 0.0417 0.1744 0.2009 -0.0285 -0.0068 0.0215  1736 ILE A CD1 
569  N  N   . LEU A 63  ? 0.0566 0.1177 0.1678 -0.0027 -0.0066 -0.0029 1737 LEU A N   
570  C  CA  . LEU A 63  ? 0.0560 0.0993 0.1489 0.0105  -0.0439 0.0135  1737 LEU A CA  
571  C  C   . LEU A 63  ? 0.0647 0.1371 0.1588 0.0019  -0.0258 -0.0167 1737 LEU A C   
572  O  O   . LEU A 63  ? 0.0740 0.1268 0.1577 0.0026  -0.0255 -0.0126 1737 LEU A O   
573  C  CB  . LEU A 63  ? 0.0767 0.1545 0.1571 0.0310  -0.0315 0.0240  1737 LEU A CB  
574  C  CG  . LEU A 63  ? 0.0767 0.1410 0.1544 0.0149  -0.0398 0.0094  1737 LEU A CG  
575  C  CD1 . LEU A 63  ? 0.1226 0.1944 0.1785 -0.0009 -0.0655 0.0395  1737 LEU A CD1 
576  C  CD2 . LEU A 63  ? 0.1179 0.1532 0.1474 0.0074  -0.0185 -0.0246 1737 LEU A CD2 
577  N  N   . PRO A 64  ? 0.0585 0.1125 0.1368 0.0147  -0.0300 -0.0014 1738 PRO A N   
578  C  CA  . PRO A 64  ? 0.0628 0.0863 0.1279 0.0251  -0.0049 0.0054  1738 PRO A CA  
579  C  C   . PRO A 64  ? 0.0790 0.1258 0.1284 0.0323  -0.0148 -0.0078 1738 PRO A C   
580  O  O   . PRO A 64  ? 0.0887 0.1264 0.1450 0.0040  -0.0450 -0.0018 1738 PRO A O   
581  C  CB  . PRO A 64  ? 0.0776 0.1247 0.1742 -0.0002 -0.0428 0.0049  1738 PRO A CB  
582  C  CG  . PRO A 64  ? 0.0631 0.1472 0.1465 -0.0081 -0.0211 0.0061  1738 PRO A CG  
583  C  CD  . PRO A 64  ? 0.0796 0.1191 0.1487 -0.0079 -0.0032 -0.0321 1738 PRO A CD  
584  N  N   . TYR A 65  ? 0.0531 0.1293 0.1509 0.0093  -0.0212 0.0047  1739 TYR A N   
585  C  CA  . TYR A 65  ? 0.0474 0.1221 0.1518 0.0267  -0.0205 -0.0041 1739 TYR A CA  
586  C  C   . TYR A 65  ? 0.0827 0.1146 0.1754 0.0042  -0.0201 0.0045  1739 TYR A C   
587  O  O   . TYR A 65  ? 0.0649 0.1320 0.1830 0.0116  -0.0166 0.0179  1739 TYR A O   
588  C  CB  . TYR A 65  ? 0.0509 0.1555 0.1540 0.0175  0.0017  -0.0055 1739 TYR A CB  
589  C  CG  . TYR A 65  ? 0.0597 0.1434 0.1875 0.0003  -0.0167 0.0323  1739 TYR A CG  
590  C  CD1 . TYR A 65  ? 0.0799 0.1216 0.1795 0.0111  0.0039  0.0126  1739 TYR A CD1 
591  C  CD2 . TYR A 65  ? 0.1017 0.1521 0.1398 0.0101  0.0000  -0.0197 1739 TYR A CD2 
592  C  CE1 . TYR A 65  ? 0.0830 0.1118 0.1499 0.0109  -0.0268 0.0122  1739 TYR A CE1 
593  C  CE2 . TYR A 65  ? 0.0770 0.1523 0.1774 0.0179  -0.0058 -0.0028 1739 TYR A CE2 
594  C  CZ  . TYR A 65  ? 0.0876 0.1458 0.1628 0.0034  -0.0157 0.0164  1739 TYR A CZ  
595  O  OH  . TYR A 65  ? 0.1131 0.1477 0.1954 0.0031  -0.0272 -0.0181 1739 TYR A OH  
596  N  N   . ASP A 66  ? 0.0346 0.1366 0.1792 0.0019  -0.0124 0.0158  1740 ASP A N   
597  C  CA  . ASP A 66  ? 0.0772 0.1584 0.1755 -0.0080 -0.0399 0.0434  1740 ASP A CA  
598  C  C   . ASP A 66  ? 0.0602 0.1582 0.1846 0.0038  -0.0282 0.0199  1740 ASP A C   
599  O  O   . ASP A 66  ? 0.1342 0.1685 0.1984 -0.0284 -0.0371 0.0167  1740 ASP A O   
600  C  CB  . ASP A 66  ? 0.0383 0.1775 0.2098 0.0177  -0.0358 0.0435  1740 ASP A CB  
601  C  CG  . ASP A 66  ? 0.0675 0.1784 0.2472 -0.0253 -0.0335 0.0153  1740 ASP A CG  
602  O  OD1 . ASP A 66  ? 0.0750 0.2289 0.1823 0.0406  -0.0561 0.0093  1740 ASP A OD1 
603  O  OD2 . ASP A 66  ? 0.1278 0.2008 0.2670 0.0298  -0.0310 0.0405  1740 ASP A OD2 
604  N  N   . ALA A 67  ? 0.0833 0.1825 0.1692 0.0290  -0.0347 0.0316  1741 ALA A N   
605  C  CA  . ALA A 67  ? 0.1204 0.1800 0.1930 0.0362  -0.0226 0.0280  1741 ALA A CA  
606  C  C   . ALA A 67  ? 0.0765 0.1843 0.1661 0.0245  -0.0235 0.0606  1741 ALA A C   
607  O  O   . ALA A 67  ? 0.0835 0.2620 0.2069 -0.0005 -0.0253 0.0711  1741 ALA A O   
608  C  CB  . ALA A 67  ? 0.1164 0.2145 0.2297 0.0501  -0.0453 0.0017  1741 ALA A CB  
609  N  N   . THR A 68  ? 0.0597 0.1659 0.1854 0.0151  -0.0291 0.0214  1742 THR A N   
610  C  CA  . THR A 68  ? 0.0628 0.1372 0.1726 0.0052  -0.0373 0.0052  1742 THR A CA  
611  C  C   . THR A 68  ? 0.0704 0.1447 0.1554 0.0000  -0.0227 0.0164  1742 THR A C   
612  O  O   . THR A 68  ? 0.0793 0.1559 0.2179 0.0376  -0.0378 0.0440  1742 THR A O   
613  C  CB  . THR A 68  ? 0.0896 0.1605 0.1666 -0.0083 -0.0361 -0.0195 1742 THR A CB  
614  O  OG1 . THR A 68  ? 0.0778 0.2132 0.2117 -0.0167 -0.0105 0.0276  1742 THR A OG1 
615  C  CG2 . THR A 68  ? 0.0897 0.2226 0.2275 -0.0035 -0.0226 -0.0275 1742 THR A CG2 
616  N  N   . ARG A 69  ? 0.0531 0.1448 0.1840 0.0007  -0.0288 0.0019  1743 ARG A N   
617  C  CA  . ARG A 69  ? 0.0986 0.1184 0.1791 0.0022  -0.0356 0.0030  1743 ARG A CA  
618  C  C   . ARG A 69  ? 0.0875 0.1132 0.1758 0.0015  -0.0054 0.0132  1743 ARG A C   
619  O  O   . ARG A 69  ? 0.1012 0.1679 0.2299 -0.0093 0.0100  0.0346  1743 ARG A O   
620  C  CB  . ARG A 69  ? 0.0753 0.1641 0.2169 -0.0118 -0.0249 0.0140  1743 ARG A CB  
621  C  CG  . ARG A 69  ? 0.1017 0.1553 0.2314 -0.0321 -0.0274 0.0387  1743 ARG A CG  
622  C  CD  . ARG A 69  ? 0.0833 0.2110 0.2242 -0.0366 -0.0610 0.0083  1743 ARG A CD  
623  N  NE  . ARG A 69  ? 0.0854 0.2259 0.2159 -0.0379 -0.0528 0.0181  1743 ARG A NE  
624  C  CZ  . ARG A 69  ? 0.1196 0.2282 0.2324 -0.0210 -0.0772 0.0148  1743 ARG A CZ  
625  N  NH1 . ARG A 69  ? 0.0925 0.1643 0.2539 -0.0278 -0.0406 0.0388  1743 ARG A NH1 
626  N  NH2 . ARG A 69  ? 0.1139 0.2519 0.2593 -0.0311 -0.0934 0.0298  1743 ARG A NH2 
627  N  N   . VAL A 70  ? 0.0964 0.1232 0.1813 0.0205  -0.0284 0.0224  1744 VAL A N   
628  C  CA  . VAL A 70  ? 0.1072 0.1340 0.1779 -0.0105 -0.0320 0.0253  1744 VAL A CA  
629  C  C   . VAL A 70  ? 0.1331 0.1426 0.2109 0.0127  -0.0362 0.0299  1744 VAL A C   
630  O  O   . VAL A 70  ? 0.1830 0.1710 0.2236 -0.0186 -0.0762 -0.0104 1744 VAL A O   
631  C  CB  . VAL A 70  ? 0.0618 0.1038 0.2071 0.0307  -0.0343 0.0236  1744 VAL A CB  
632  C  CG1 . VAL A 70  ? 0.1298 0.0993 0.2216 -0.0006 -0.0472 0.0393  1744 VAL A CG1 
633  C  CG2 . VAL A 70  ? 0.0747 0.1328 0.1658 -0.0249 -0.0250 0.0153  1744 VAL A CG2 
634  N  N   . LYS A 71  ? 0.1942 0.1670 0.2241 -0.0391 -0.0735 0.0306  1745 LYS A N   
635  C  CA  A LYS A 71  ? 0.2293 0.1986 0.2591 -0.0378 -0.0767 0.0214  1745 LYS A CA  
636  C  CA  B LYS A 71  ? 0.2423 0.2064 0.2545 -0.0347 -0.0778 0.0202  1745 LYS A CA  
637  C  C   . LYS A 71  ? 0.2672 0.1778 0.2589 -0.0468 -0.0823 0.0269  1745 LYS A C   
638  O  O   . LYS A 71  ? 0.3365 0.2229 0.2757 -0.0749 -0.1215 0.0115  1745 LYS A O   
639  C  CB  A LYS A 71  ? 0.2319 0.2211 0.3088 -0.0301 -0.0599 0.0346  1745 LYS A CB  
640  C  CB  B LYS A 71  ? 0.2322 0.2093 0.2997 -0.0444 -0.0580 0.0325  1745 LYS A CB  
641  C  CG  A LYS A 71  ? 0.1487 0.2064 0.2875 -0.0298 -0.0443 0.0278  1745 LYS A CG  
642  C  CG  B LYS A 71  ? 0.2841 0.3048 0.2555 -0.0019 -0.0615 0.0195  1745 LYS A CG  
643  C  CD  A LYS A 71  ? 0.2486 0.2495 0.3575 0.0069  -0.0142 0.0089  1745 LYS A CD  
644  C  CD  B LYS A 71  ? 0.2785 0.3440 0.3376 0.0031  -0.0251 0.0099  1745 LYS A CD  
645  C  CE  A LYS A 71  ? 0.1853 0.2466 0.3583 0.0307  0.0324  0.0022  1745 LYS A CE  
646  C  CE  B LYS A 71  ? 0.3004 0.3764 0.3729 -0.0278 -0.0084 0.0005  1745 LYS A CE  
647  N  NZ  A LYS A 71  ? 0.1281 0.2283 0.3603 0.0468  -0.0072 0.0098  1745 LYS A NZ  
648  N  NZ  B LYS A 71  ? 0.3966 0.3785 0.4264 0.0284  -0.0117 0.0304  1745 LYS A NZ  
649  N  N   . LEU A 72  ? 0.2145 0.1652 0.3001 -0.0453 -0.0737 0.0222  1746 LEU A N   
650  C  CA  . LEU A 72  ? 0.2063 0.1451 0.2794 -0.0659 -0.0883 0.0000  1746 LEU A CA  
651  C  C   . LEU A 72  ? 0.2163 0.1616 0.3480 -0.0678 -0.1031 0.0317  1746 LEU A C   
652  O  O   . LEU A 72  ? 0.2424 0.2081 0.3643 -0.0866 -0.1173 0.0649  1746 LEU A O   
653  C  CB  . LEU A 72  ? 0.1894 0.2061 0.3426 -0.0680 -0.0720 0.0173  1746 LEU A CB  
654  C  CG  . LEU A 72  ? 0.1436 0.1817 0.3420 -0.0485 -0.0572 0.0058  1746 LEU A CG  
655  C  CD1 . LEU A 72  ? 0.1781 0.2392 0.3318 -0.0198 -0.0243 0.0034  1746 LEU A CD1 
656  C  CD2 . LEU A 72  ? 0.2101 0.2410 0.3426 -0.0190 -0.1151 0.0105  1746 LEU A CD2 
657  N  N   . SER A 73  ? 0.2555 0.1903 0.4035 -0.0638 -0.1324 0.0300  1747 SER A N   
658  C  CA  . SER A 73  ? 0.2903 0.2023 0.4065 -0.0659 -0.1058 0.0280  1747 SER A CA  
659  C  C   . SER A 73  ? 0.2780 0.2443 0.4173 -0.0932 -0.0940 -0.0244 1747 SER A C   
660  O  O   . SER A 73  ? 0.2911 0.2884 0.4523 -0.0750 -0.1053 -0.0333 1747 SER A O   
661  C  CB  . SER A 73  ? 0.3396 0.2573 0.4292 -0.0632 -0.1143 0.0032  1747 SER A CB  
662  O  OG  . SER A 73  ? 0.3412 0.1917 0.4918 -0.0801 -0.1520 -0.0311 1747 SER A OG  
663  N  N   . GLY A 74  ? 0.2713 0.2675 0.4020 -0.0675 -0.1216 -0.0330 1748 GLY A N   
664  C  CA  . GLY A 74  ? 0.3162 0.2336 0.3732 -0.0578 -0.1114 -0.0510 1748 GLY A CA  
665  C  C   . GLY A 74  ? 0.3323 0.2760 0.3787 -0.0547 -0.1077 -0.0380 1748 GLY A C   
666  O  O   . GLY A 74  ? 0.3734 0.3582 0.4002 -0.0052 -0.0844 -0.0370 1748 GLY A O   
667  N  N   . GLY A 75  ? 0.3747 0.3000 0.3774 -0.0618 -0.0794 -0.0220 1749 GLY A N   
668  C  CA  . GLY A 75  ? 0.3417 0.3221 0.4257 -0.0724 -0.0935 -0.0130 1749 GLY A CA  
669  C  C   . GLY A 75  ? 0.3613 0.2984 0.4318 -0.0695 -0.0869 0.0032  1749 GLY A C   
670  O  O   . GLY A 75  ? 0.3829 0.3346 0.4783 -0.1019 -0.0957 -0.0161 1749 GLY A O   
671  N  N   . SER A 76  ? 0.3324 0.2835 0.4073 -0.0575 -0.0837 -0.0110 1755 SER A N   
672  C  CA  . SER A 76  ? 0.3159 0.3149 0.3421 -0.0655 -0.0677 -0.0240 1755 SER A CA  
673  C  C   . SER A 76  ? 0.2605 0.2566 0.3225 -0.0674 -0.0973 -0.0448 1755 SER A C   
674  O  O   . SER A 76  ? 0.3018 0.2716 0.3554 -0.0645 -0.0745 -0.0462 1755 SER A O   
675  C  CB  . SER A 76  ? 0.3631 0.3680 0.3560 -0.0282 -0.0670 -0.0364 1755 SER A CB  
676  O  OG  . SER A 76  ? 0.4848 0.4913 0.4105 -0.0232 -0.0325 -0.0274 1755 SER A OG  
677  N  N   . ASP A 77  ? 0.2179 0.2147 0.2764 -0.0702 -0.0882 -0.0289 1756 ASP A N   
678  C  CA  . ASP A 77  ? 0.2474 0.1823 0.2711 -0.0751 -0.0901 -0.0187 1756 ASP A CA  
679  C  C   . ASP A 77  ? 0.2226 0.1407 0.2657 -0.0797 -0.0709 0.0177  1756 ASP A C   
680  O  O   . ASP A 77  ? 0.2221 0.1545 0.2581 -0.0521 -0.1005 0.0404  1756 ASP A O   
681  C  CB  . ASP A 77  ? 0.2272 0.1862 0.3221 -0.0775 -0.0595 0.0290  1756 ASP A CB  
682  C  CG  . ASP A 77  ? 0.2325 0.2298 0.3283 -0.0367 -0.0916 0.0052  1756 ASP A CG  
683  O  OD1 . ASP A 77  ? 0.1979 0.2049 0.3755 -0.0607 -0.1135 -0.0120 1756 ASP A OD1 
684  O  OD2 . ASP A 77  ? 0.2315 0.2513 0.4143 -0.0381 -0.0646 0.0406  1756 ASP A OD2 
685  N  N   . TYR A 78  ? 0.1782 0.1444 0.2555 -0.0506 -0.0997 -0.0031 1757 TYR A N   
686  C  CA  . TYR A 78  ? 0.1389 0.1251 0.2573 -0.0324 -0.0837 0.0190  1757 TYR A CA  
687  C  C   . TYR A 78  ? 0.1379 0.1408 0.2233 -0.0158 -0.0619 -0.0246 1757 TYR A C   
688  O  O   . TYR A 78  ? 0.1370 0.1381 0.2474 -0.0377 -0.0819 -0.0296 1757 TYR A O   
689  C  CB  . TYR A 78  ? 0.1863 0.1366 0.1910 -0.0425 -0.0791 0.0166  1757 TYR A CB  
690  C  CG  . TYR A 78  ? 0.1201 0.1317 0.1818 -0.0155 -0.0572 -0.0114 1757 TYR A CG  
691  C  CD1 . TYR A 78  ? 0.1204 0.1353 0.2251 0.0166  -0.0455 0.0035  1757 TYR A CD1 
692  C  CD2 . TYR A 78  ? 0.1559 0.1374 0.1643 -0.0369 -0.0635 0.0040  1757 TYR A CD2 
693  C  CE1 . TYR A 78  ? 0.0996 0.1212 0.1638 -0.0017 -0.0497 0.0201  1757 TYR A CE1 
694  C  CE2 . TYR A 78  ? 0.1494 0.1212 0.1700 -0.0012 -0.0691 0.0215  1757 TYR A CE2 
695  C  CZ  . TYR A 78  ? 0.1195 0.1203 0.1679 0.0050  -0.0425 -0.0283 1757 TYR A CZ  
696  O  OH  . TYR A 78  ? 0.0945 0.1165 0.1710 -0.0006 -0.0298 0.0104  1757 TYR A OH  
697  N  N   . ILE A 79  ? 0.1121 0.1168 0.2129 -0.0282 -0.0608 0.0106  1758 ILE A N   
698  C  CA  . ILE A 79  ? 0.1051 0.1085 0.2024 -0.0099 -0.0625 0.0078  1758 ILE A CA  
699  C  C   . ILE A 79  ? 0.1141 0.0958 0.1334 -0.0143 -0.0151 0.0098  1758 ILE A C   
700  O  O   . ILE A 79  ? 0.0803 0.1147 0.1656 -0.0135 -0.0468 0.0049  1758 ILE A O   
701  C  CB  . ILE A 79  ? 0.1256 0.1239 0.2007 -0.0201 -0.0496 0.0043  1758 ILE A CB  
702  C  CG1 . ILE A 79  ? 0.1092 0.0925 0.2554 0.0057  -0.0610 0.0057  1758 ILE A CG1 
703  C  CG2 . ILE A 79  ? 0.1420 0.1098 0.1956 -0.0143 -0.0244 -0.0219 1758 ILE A CG2 
704  C  CD1 . ILE A 79  ? 0.1798 0.1179 0.2338 0.0150  -0.0641 0.0080  1758 ILE A CD1 
705  N  N   . ASN A 80  ? 0.0923 0.0827 0.1567 0.0011  -0.0397 0.0197  1759 ASN A N   
706  C  CA  . ASN A 80  ? 0.1032 0.0912 0.1207 -0.0120 -0.0340 -0.0022 1759 ASN A CA  
707  C  C   . ASN A 80  ? 0.0896 0.0937 0.1181 -0.0099 -0.0069 -0.0016 1759 ASN A C   
708  O  O   . ASN A 80  ? 0.0590 0.1226 0.1744 0.0146  -0.0176 0.0035  1759 ASN A O   
709  C  CB  . ASN A 80  ? 0.1057 0.0870 0.1542 0.0141  -0.0005 -0.0034 1759 ASN A CB  
710  C  CG  . ASN A 80  ? 0.0811 0.0924 0.1708 0.0132  -0.0230 -0.0011 1759 ASN A CG  
711  O  OD1 . ASN A 80  ? 0.0811 0.1124 0.1516 -0.0058 -0.0471 -0.0033 1759 ASN A OD1 
712  N  ND2 . ASN A 80  ? 0.0869 0.1007 0.1572 -0.0024 -0.0273 0.0131  1759 ASN A ND2 
713  N  N   . ALA A 81  ? 0.0839 0.1044 0.1058 0.0159  -0.0194 0.0012  1760 ALA A N   
714  C  CA  . ALA A 81  ? 0.1018 0.0827 0.1279 0.0031  -0.0013 0.0126  1760 ALA A CA  
715  C  C   . ALA A 81  ? 0.0674 0.1142 0.1270 -0.0066 -0.0103 0.0009  1760 ALA A C   
716  O  O   . ALA A 81  ? 0.0438 0.1388 0.1570 -0.0055 -0.0249 0.0017  1760 ALA A O   
717  C  CB  . ALA A 81  ? 0.0685 0.0986 0.1437 0.0114  -0.0190 0.0085  1760 ALA A CB  
718  N  N   . SER A 82  ? 0.0921 0.1129 0.1205 0.0180  -0.0130 0.0116  1761 SER A N   
719  C  CA  . SER A 82  ? 0.0723 0.1210 0.0977 -0.0056 -0.0174 -0.0144 1761 SER A CA  
720  C  C   . SER A 82  ? 0.0784 0.1060 0.1104 0.0092  -0.0127 0.0034  1761 SER A C   
721  O  O   . SER A 82  ? 0.0572 0.1256 0.1578 0.0225  -0.0308 0.0205  1761 SER A O   
722  C  CB  . SER A 82  ? 0.0847 0.1308 0.1289 -0.0069 -0.0216 -0.0340 1761 SER A CB  
723  O  OG  . SER A 82  ? 0.0933 0.1346 0.1169 0.0063  -0.0192 0.0160  1761 SER A OG  
724  N  N   . TYR A 83  ? 0.0924 0.1247 0.0968 -0.0042 -0.0217 0.0105  1762 TYR A N   
725  C  CA  . TYR A 83  ? 0.0842 0.1514 0.1374 0.0181  -0.0002 -0.0021 1762 TYR A CA  
726  C  C   . TYR A 83  ? 0.0971 0.1311 0.1316 -0.0018 -0.0238 0.0086  1762 TYR A C   
727  O  O   . TYR A 83  ? 0.1422 0.1433 0.1713 0.0039  -0.0546 0.0097  1762 TYR A O   
728  C  CB  . TYR A 83  ? 0.0965 0.1348 0.1707 -0.0229 0.0146  0.0102  1762 TYR A CB  
729  C  CG  . TYR A 83  ? 0.1082 0.1453 0.1889 0.0053  -0.0047 0.0273  1762 TYR A CG  
730  C  CD1 . TYR A 83  ? 0.1081 0.1710 0.2103 -0.0018 0.0133  0.0344  1762 TYR A CD1 
731  C  CD2 . TYR A 83  ? 0.1076 0.1491 0.1522 -0.0242 -0.0061 0.0285  1762 TYR A CD2 
732  C  CE1 . TYR A 83  ? 0.1208 0.1669 0.2313 -0.0152 -0.0408 0.0256  1762 TYR A CE1 
733  C  CE2 . TYR A 83  ? 0.0880 0.1307 0.2365 0.0148  0.0118  0.0585  1762 TYR A CE2 
734  C  CZ  . TYR A 83  ? 0.1148 0.1350 0.1749 0.0027  -0.0186 0.0228  1762 TYR A CZ  
735  O  OH  . TYR A 83  ? 0.1053 0.1530 0.2719 -0.0202 -0.0166 0.0168  1762 TYR A OH  
736  N  N   . ILE A 84  ? 0.0832 0.1665 0.1378 0.0116  -0.0400 0.0141  1763 ILE A N   
737  C  CA  . ILE A 84  ? 0.0947 0.1430 0.1602 0.0055  0.0024  -0.0018 1763 ILE A CA  
738  C  C   . ILE A 84  ? 0.0859 0.1421 0.1464 0.0036  -0.0402 -0.0175 1763 ILE A C   
739  O  O   . ILE A 84  ? 0.0973 0.1274 0.1838 0.0201  -0.0214 -0.0091 1763 ILE A O   
740  C  CB  . ILE A 84  ? 0.0992 0.1851 0.1828 -0.0052 -0.0150 -0.0225 1763 ILE A CB  
741  C  CG1 . ILE A 84  ? 0.1685 0.1842 0.2123 -0.0390 0.0134  -0.0126 1763 ILE A CG1 
742  C  CG2 . ILE A 84  ? 0.1191 0.2166 0.1915 -0.0567 -0.0205 0.0023  1763 ILE A CG2 
743  C  CD1 . ILE A 84  ? 0.1896 0.1927 0.1948 0.0138  -0.0078 0.0200  1763 ILE A CD1 
744  N  N   . PRO A 85  ? 0.1089 0.1745 0.1583 0.0211  -0.0377 -0.0159 1764 PRO A N   
745  C  CA  . PRO A 85  ? 0.1205 0.1855 0.1770 0.0210  -0.0243 -0.0142 1764 PRO A CA  
746  C  C   . PRO A 85  ? 0.1293 0.1594 0.1793 0.0206  -0.0187 0.0122  1764 PRO A C   
747  O  O   . PRO A 85  ? 0.1400 0.1789 0.1723 0.0354  -0.0245 0.0022  1764 PRO A O   
748  C  CB  . PRO A 85  ? 0.1339 0.1830 0.2318 0.0411  -0.0012 -0.0190 1764 PRO A CB  
749  C  CG  . PRO A 85  ? 0.2076 0.2074 0.2157 0.0458  -0.0318 -0.0360 1764 PRO A CG  
750  C  CD  . PRO A 85  ? 0.1526 0.1576 0.1638 0.0434  -0.0370 -0.0237 1764 PRO A CD  
751  N  N   . GLY A 86  ? 0.1227 0.1699 0.1858 0.0236  -0.0351 -0.0081 1765 GLY A N   
752  C  CA  . GLY A 86  ? 0.1507 0.2121 0.1523 0.0090  -0.0498 -0.0235 1765 GLY A CA  
753  C  C   . GLY A 86  ? 0.1651 0.2570 0.2011 0.0318  -0.0150 -0.0244 1765 GLY A C   
754  O  O   . GLY A 86  ? 0.1582 0.3339 0.2425 0.0534  -0.0258 -0.0325 1765 GLY A O   
755  N  N   . ASN A 87  ? 0.1874 0.2701 0.1747 0.0191  -0.0309 -0.0031 1766 ASN A N   
756  C  CA  . ASN A 87  ? 0.2258 0.3446 0.2056 -0.0070 -0.0379 -0.0093 1766 ASN A CA  
757  C  C   . ASN A 87  ? 0.3037 0.3871 0.2315 -0.0084 -0.0169 -0.0066 1766 ASN A C   
758  O  O   . ASN A 87  ? 0.3429 0.4791 0.2968 -0.0535 0.0256  0.0120  1766 ASN A O   
759  C  CB  . ASN A 87  ? 0.2201 0.3461 0.2094 -0.0085 -0.0586 0.0140  1766 ASN A CB  
760  C  CG  . ASN A 87  ? 0.2180 0.3180 0.2426 -0.0007 -0.0028 0.0105  1766 ASN A CG  
761  O  OD1 . ASN A 87  ? 0.2138 0.3591 0.3337 -0.0042 -0.0330 0.0021  1766 ASN A OD1 
762  N  ND2 . ASN A 87  ? 0.2647 0.3595 0.2442 0.0844  -0.0597 -0.0451 1766 ASN A ND2 
763  N  N   . ASN A 88  ? 0.3120 0.3826 0.2450 -0.0419 -0.0504 0.0133  1767 ASN A N   
764  C  CA  . ASN A 88  ? 0.3470 0.4385 0.3180 -0.0388 -0.0509 -0.0061 1767 ASN A CA  
765  C  C   . ASN A 88  ? 0.3326 0.4473 0.3032 -0.0492 -0.0331 0.0156  1767 ASN A C   
766  O  O   . ASN A 88  ? 0.4281 0.5344 0.3097 -0.0654 -0.0306 0.0166  1767 ASN A O   
767  C  CB  . ASN A 88  ? 0.3992 0.4554 0.3533 -0.0228 -0.0541 0.0063  1767 ASN A CB  
768  C  CG  . ASN A 88  ? 0.3608 0.4790 0.2699 -0.0120 0.0175  -0.0221 1767 ASN A CG  
769  O  OD1 . ASN A 88  ? 0.4471 0.5336 0.2717 -0.0134 -0.0840 -0.0030 1767 ASN A OD1 
770  N  ND2 . ASN A 88  ? 0.1640 0.3365 0.2342 -0.0357 -0.0365 0.0076  1767 ASN A ND2 
771  N  N   . PHE A 89  ? 0.3129 0.3899 0.2815 -0.0567 -0.0374 0.0453  1768 PHE A N   
772  C  CA  . PHE A 89  ? 0.2824 0.3615 0.2989 -0.0412 -0.0148 0.0166  1768 PHE A CA  
773  C  C   . PHE A 89  ? 0.2100 0.3194 0.2754 -0.0348 -0.0289 0.0136  1768 PHE A C   
774  O  O   . PHE A 89  ? 0.1509 0.2589 0.2742 -0.0428 -0.0047 0.0130  1768 PHE A O   
775  C  CB  . PHE A 89  ? 0.3107 0.3380 0.3577 -0.0529 -0.0456 0.0369  1768 PHE A CB  
776  C  CG  . PHE A 89  ? 0.3621 0.3588 0.4437 -0.0204 -0.0181 0.0424  1768 PHE A CG  
777  C  CD1 . PHE A 89  ? 0.4373 0.4857 0.4789 -0.0021 0.0019  0.0428  1768 PHE A CD1 
778  C  CD2 . PHE A 89  ? 0.3654 0.4099 0.4107 0.0118  -0.0465 0.0597  1768 PHE A CD2 
779  C  CE1 . PHE A 89  ? 0.5250 0.5036 0.5092 0.0089  -0.0021 0.0412  1768 PHE A CE1 
780  C  CE2 . PHE A 89  ? 0.4880 0.5126 0.4695 -0.0069 -0.0417 0.0696  1768 PHE A CE2 
781  C  CZ  . PHE A 89  ? 0.4867 0.5180 0.5063 -0.0190 -0.0216 0.0293  1768 PHE A CZ  
782  N  N   . ARG A 90  ? 0.1510 0.3276 0.3139 -0.0230 0.0147  -0.0016 1769 ARG A N   
783  C  CA  . ARG A 90  ? 0.1164 0.2997 0.2992 0.0004  0.0154  -0.0114 1769 ARG A CA  
784  C  C   . ARG A 90  ? 0.1458 0.3027 0.3045 -0.0415 -0.0148 -0.0001 1769 ARG A C   
785  O  O   . ARG A 90  ? 0.1647 0.3272 0.3249 -0.0157 0.0025  0.0268  1769 ARG A O   
786  C  CB  . ARG A 90  ? 0.1639 0.3734 0.3357 -0.0107 0.0064  0.0088  1769 ARG A CB  
787  C  CG  . ARG A 90  ? 0.2817 0.4167 0.3739 0.0138  0.0193  -0.0077 1769 ARG A CG  
788  C  CD  . ARG A 90  ? 0.2526 0.4955 0.3945 0.0184  -0.0239 0.0394  1769 ARG A CD  
789  N  NE  . ARG A 90  ? 0.2724 0.4627 0.3932 -0.0320 -0.0584 0.0107  1769 ARG A NE  
790  C  CZ  . ARG A 90  ? 0.3727 0.4374 0.4669 0.0317  -0.0170 0.0203  1769 ARG A CZ  
791  N  NH1 . ARG A 90  ? 0.3758 0.3393 0.4674 0.0007  -0.0191 0.0154  1769 ARG A NH1 
792  N  NH2 . ARG A 90  ? 0.3542 0.4565 0.4754 0.0080  0.0121  -0.0004 1769 ARG A NH2 
793  N  N   . ARG A 91  ? 0.0798 0.2870 0.3111 -0.0256 -0.0294 -0.0431 1770 ARG A N   
794  C  CA  . ARG A 91  ? 0.0938 0.2223 0.2229 -0.0341 -0.0209 -0.0075 1770 ARG A CA  
795  C  C   . ARG A 91  ? 0.1232 0.1914 0.1968 -0.0351 0.0045  -0.0001 1770 ARG A C   
796  O  O   . ARG A 91  ? 0.1616 0.2065 0.2730 -0.0107 -0.0627 -0.0124 1770 ARG A O   
797  C  CB  . ARG A 91  ? 0.1076 0.2135 0.2438 -0.0251 -0.0297 -0.0045 1770 ARG A CB  
798  C  CG  . ARG A 91  ? 0.1114 0.2199 0.2239 -0.0402 -0.0354 -0.0032 1770 ARG A CG  
799  C  CD  . ARG A 91  ? 0.1419 0.3003 0.3445 -0.0465 -0.0393 -0.0130 1770 ARG A CD  
800  N  NE  . ARG A 91  ? 0.1361 0.3581 0.2921 -0.0391 0.0251  0.0275  1770 ARG A NE  
801  C  CZ  . ARG A 91  ? 0.2308 0.3621 0.3180 -0.0130 -0.0210 -0.0061 1770 ARG A CZ  
802  N  NH1 . ARG A 91  ? 0.2953 0.4731 0.3369 -0.0743 0.0460  0.0191  1770 ARG A NH1 
803  N  NH2 . ARG A 91  ? 0.1465 0.4042 0.4292 0.0380  -0.0317 -0.0456 1770 ARG A NH2 
804  N  N   . GLU A 92  ? 0.0870 0.1748 0.1829 -0.0157 -0.0156 0.0111  1771 GLU A N   
805  C  CA  . GLU A 92  ? 0.1117 0.1834 0.1556 0.0142  -0.0147 0.0096  1771 GLU A CA  
806  C  C   . GLU A 92  ? 0.1114 0.1162 0.1386 -0.0265 -0.0322 -0.0007 1771 GLU A C   
807  O  O   . GLU A 92  ? 0.1161 0.1220 0.1669 0.0164  -0.0201 0.0253  1771 GLU A O   
808  C  CB  . GLU A 92  ? 0.1444 0.2330 0.1517 -0.0187 -0.0216 -0.0082 1771 GLU A CB  
809  C  CG  . GLU A 92  ? 0.2273 0.2705 0.2504 -0.0178 0.0073  -0.0107 1771 GLU A CG  
810  C  CD  . GLU A 92  ? 0.2487 0.2386 0.2086 -0.0098 -0.0132 -0.0160 1771 GLU A CD  
811  O  OE1 . GLU A 92  ? 0.2764 0.3115 0.2905 -0.0220 -0.0349 -0.0101 1771 GLU A OE1 
812  O  OE2 . GLU A 92  ? 0.2569 0.2985 0.2512 0.0023  -0.1150 0.0170  1771 GLU A OE2 
813  N  N   . TYR A 93  ? 0.0742 0.1382 0.1299 -0.0112 -0.0270 0.0118  1772 TYR A N   
814  C  CA  . TYR A 93  ? 0.1090 0.1141 0.1246 -0.0066 -0.0127 0.0115  1772 TYR A CA  
815  C  C   . TYR A 93  ? 0.1152 0.1091 0.1229 0.0077  -0.0182 -0.0045 1772 TYR A C   
816  O  O   . TYR A 93  ? 0.0872 0.1233 0.1593 0.0204  -0.0180 0.0175  1772 TYR A O   
817  C  CB  . TYR A 93  ? 0.1001 0.1430 0.1659 -0.0267 -0.0286 0.0120  1772 TYR A CB  
818  C  CG  . TYR A 93  ? 0.0893 0.1370 0.1532 -0.0152 -0.0083 -0.0051 1772 TYR A CG  
819  C  CD1 . TYR A 93  ? 0.0833 0.1508 0.1242 -0.0269 -0.0308 0.0040  1772 TYR A CD1 
820  C  CD2 . TYR A 93  ? 0.0877 0.1441 0.1922 0.0056  -0.0147 0.0120  1772 TYR A CD2 
821  C  CE1 . TYR A 93  ? 0.0704 0.1695 0.1713 -0.0277 -0.0280 0.0013  1772 TYR A CE1 
822  C  CE2 . TYR A 93  ? 0.0890 0.1452 0.1523 -0.0186 -0.0291 -0.0030 1772 TYR A CE2 
823  C  CZ  . TYR A 93  ? 0.0978 0.1688 0.1516 -0.0092 -0.0286 -0.0186 1772 TYR A CZ  
824  O  OH  . TYR A 93  ? 0.1152 0.2071 0.1511 -0.0180 -0.0298 -0.0102 1772 TYR A OH  
825  N  N   . ILE A 94  ? 0.0948 0.1242 0.1106 -0.0130 -0.0377 0.0071  1773 ILE A N   
826  C  CA  . ILE A 94  ? 0.0887 0.1171 0.1251 -0.0074 -0.0187 -0.0044 1773 ILE A CA  
827  C  C   . ILE A 94  ? 0.0678 0.1122 0.1689 0.0090  -0.0112 0.0077  1773 ILE A C   
828  O  O   . ILE A 94  ? 0.0565 0.1435 0.1739 0.0293  -0.0102 0.0103  1773 ILE A O   
829  C  CB  . ILE A 94  ? 0.0909 0.1280 0.1534 0.0017  -0.0261 0.0217  1773 ILE A CB  
830  C  CG1 . ILE A 94  ? 0.0889 0.1308 0.1592 -0.0177 -0.0305 0.0159  1773 ILE A CG1 
831  C  CG2 . ILE A 94  ? 0.1042 0.1249 0.1711 -0.0147 -0.0266 0.0142  1773 ILE A CG2 
832  C  CD1 . ILE A 94  ? 0.1200 0.1253 0.1823 -0.0194 -0.0127 -0.0089 1773 ILE A CD1 
833  N  N   . VAL A 95  ? 0.0701 0.1243 0.1457 0.0047  -0.0196 -0.0056 1774 VAL A N   
834  C  CA  . VAL A 95  ? 0.0831 0.1011 0.1277 0.0048  -0.0176 -0.0025 1774 VAL A CA  
835  C  C   . VAL A 95  ? 0.0745 0.1207 0.1232 -0.0035 -0.0003 -0.0066 1774 VAL A C   
836  O  O   . VAL A 95  ? 0.0538 0.1675 0.1541 0.0105  -0.0378 -0.0013 1774 VAL A O   
837  C  CB  . VAL A 95  ? 0.1066 0.1165 0.1432 -0.0038 -0.0240 0.0127  1774 VAL A CB  
838  C  CG1 . VAL A 95  ? 0.1372 0.1311 0.1818 -0.0031 -0.0188 -0.0079 1774 VAL A CG1 
839  C  CG2 . VAL A 95  ? 0.1351 0.1407 0.2213 -0.0069 -0.0427 -0.0241 1774 VAL A CG2 
840  N  N   . THR A 96  ? 0.0917 0.1054 0.1228 0.0023  -0.0040 0.0057  1775 THR A N   
841  C  CA  . THR A 96  ? 0.1055 0.1062 0.1219 -0.0001 0.0040  -0.0011 1775 THR A CA  
842  C  C   . THR A 96  ? 0.0806 0.1077 0.1032 0.0090  -0.0134 0.0040  1775 THR A C   
843  O  O   . THR A 96  ? 0.0678 0.1268 0.1483 -0.0027 -0.0190 0.0145  1775 THR A O   
844  C  CB  . THR A 96  ? 0.1202 0.1095 0.1717 0.0110  -0.0298 0.0005  1775 THR A CB  
845  O  OG1 . THR A 96  ? 0.1231 0.1478 0.1464 0.0159  -0.0247 -0.0265 1775 THR A OG1 
846  C  CG2 . THR A 96  ? 0.0740 0.1146 0.1931 0.0465  -0.0300 -0.0028 1775 THR A CG2 
847  N  N   . GLN A 97  ? 0.0891 0.1331 0.1146 0.0007  -0.0173 0.0092  1776 GLN A N   
848  C  CA  . GLN A 97  ? 0.0975 0.1076 0.0960 0.0029  -0.0242 0.0164  1776 GLN A CA  
849  C  C   . GLN A 97  ? 0.0889 0.1127 0.1296 0.0023  -0.0327 0.0130  1776 GLN A C   
850  O  O   . GLN A 97  ? 0.1001 0.1251 0.1521 0.0021  -0.0403 0.0112  1776 GLN A O   
851  C  CB  . GLN A 97  ? 0.0987 0.1216 0.1463 -0.0303 -0.0129 0.0041  1776 GLN A CB  
852  C  CG  . GLN A 97  ? 0.1108 0.1036 0.1327 0.0014  -0.0680 0.0028  1776 GLN A CG  
853  C  CD  . GLN A 97  ? 0.1077 0.1497 0.1135 0.0090  -0.0236 0.0183  1776 GLN A CD  
854  O  OE1 . GLN A 97  ? 0.1107 0.1162 0.1737 0.0194  -0.0305 0.0211  1776 GLN A OE1 
855  N  NE2 . GLN A 97  ? 0.1143 0.1530 0.1713 0.0229  -0.0563 -0.0237 1776 GLN A NE2 
856  N  N   . GLY A 98  ? 0.0790 0.1278 0.1745 -0.0007 -0.0224 -0.0071 1777 GLY A N   
857  C  CA  . GLY A 98  ? 0.0761 0.0852 0.2013 -0.0012 -0.0339 -0.0043 1777 GLY A CA  
858  C  C   . GLY A 98  ? 0.0883 0.0957 0.1472 0.0001  -0.0343 -0.0021 1777 GLY A C   
859  O  O   . GLY A 98  ? 0.1282 0.1200 0.1892 0.0245  -0.0493 -0.0036 1777 GLY A O   
860  N  N   . PRO A 99  ? 0.1059 0.1046 0.1712 0.0088  -0.0370 -0.0044 1778 PRO A N   
861  C  CA  . PRO A 99  ? 0.1370 0.1075 0.1729 -0.0038 -0.0312 -0.0109 1778 PRO A CA  
862  C  C   . PRO A 99  ? 0.1182 0.1369 0.1833 0.0045  -0.0212 -0.0201 1778 PRO A C   
863  O  O   . PRO A 99  ? 0.1129 0.1423 0.2049 0.0165  -0.0139 -0.0147 1778 PRO A O   
864  C  CB  . PRO A 99  ? 0.1611 0.1209 0.2159 -0.0188 -0.0054 0.0064  1778 PRO A CB  
865  C  CG  . PRO A 99  ? 0.1261 0.0971 0.2341 -0.0061 -0.0357 0.0384  1778 PRO A CG  
866  C  CD  . PRO A 99  ? 0.0972 0.0983 0.1970 0.0060  -0.0379 0.0276  1778 PRO A CD  
867  N  N   . LEU A 100 ? 0.1320 0.1518 0.1759 0.0087  -0.0571 -0.0525 1779 LEU A N   
868  C  CA  . LEU A 100 ? 0.1488 0.1645 0.1743 0.0178  -0.0440 -0.0191 1779 LEU A CA  
869  C  C   . LEU A 100 ? 0.1582 0.1604 0.1650 0.0353  -0.0561 -0.0112 1779 LEU A C   
870  O  O   . LEU A 100 ? 0.1869 0.1583 0.1881 0.0393  -0.0461 -0.0111 1779 LEU A O   
871  C  CB  . LEU A 100 ? 0.1354 0.1341 0.1850 0.0297  -0.0439 -0.0295 1779 LEU A CB  
872  C  CG  . LEU A 100 ? 0.1280 0.1104 0.2104 0.0123  -0.0255 -0.0020 1779 LEU A CG  
873  C  CD1 . LEU A 100 ? 0.1274 0.1614 0.2726 0.0360  -0.0546 0.0015  1779 LEU A CD1 
874  C  CD2 . LEU A 100 ? 0.1642 0.1759 0.2583 0.0128  -0.0486 0.0396  1779 LEU A CD2 
875  N  N   . PRO A 101 ? 0.1900 0.1558 0.2189 0.0138  -0.0296 -0.0295 1780 PRO A N   
876  C  CA  . PRO A 101 ? 0.2177 0.1834 0.2188 0.0190  -0.0202 -0.0441 1780 PRO A CA  
877  C  C   . PRO A 101 ? 0.2346 0.1484 0.2136 0.0187  -0.0557 -0.0294 1780 PRO A C   
878  O  O   . PRO A 101 ? 0.2521 0.1998 0.2409 0.0011  -0.0603 -0.0220 1780 PRO A O   
879  C  CB  . PRO A 101 ? 0.2512 0.2379 0.2585 0.0232  -0.0085 -0.0367 1780 PRO A CB  
880  C  CG  . PRO A 101 ? 0.2816 0.2279 0.2535 0.0127  -0.0110 -0.0404 1780 PRO A CG  
881  C  CD  . PRO A 101 ? 0.2387 0.1943 0.2164 0.0078  -0.0207 -0.0134 1780 PRO A CD  
882  N  N   . GLY A 102 ? 0.1952 0.1739 0.1712 0.0161  -0.0300 -0.0321 1781 GLY A N   
883  C  CA  . GLY A 102 ? 0.2014 0.1684 0.1862 -0.0038 -0.0485 -0.0210 1781 GLY A CA  
884  C  C   . GLY A 102 ? 0.2156 0.1983 0.2197 -0.0085 -0.0296 -0.0133 1781 GLY A C   
885  O  O   . GLY A 102 ? 0.2366 0.2161 0.2317 -0.0274 -0.0310 0.0051  1781 GLY A O   
886  N  N   . THR A 103 ? 0.1914 0.1322 0.1883 0.0202  -0.0345 -0.0185 1782 THR A N   
887  C  CA  . THR A 103 ? 0.1743 0.1125 0.1867 -0.0023 -0.0512 -0.0040 1782 THR A CA  
888  C  C   . THR A 103 ? 0.1622 0.1307 0.1494 -0.0100 -0.0422 -0.0270 1782 THR A C   
889  O  O   . THR A 103 ? 0.1816 0.1240 0.1587 0.0119  -0.0343 -0.0222 1782 THR A O   
890  C  CB  . THR A 103 ? 0.1234 0.1081 0.1931 -0.0058 -0.0684 -0.0071 1782 THR A CB  
891  O  OG1 . THR A 103 ? 0.1381 0.0999 0.2217 0.0044  -0.0629 -0.0218 1782 THR A OG1 
892  C  CG2 . THR A 103 ? 0.1439 0.1266 0.2070 0.0151  -0.0660 0.0117  1782 THR A CG2 
893  N  N   . LYS A 104 ? 0.1705 0.1414 0.1826 -0.0010 -0.0569 -0.0034 1783 LYS A N   
894  C  CA  A LYS A 104 ? 0.1517 0.1561 0.1873 0.0161  -0.0604 0.0081  1783 LYS A CA  
895  C  CA  B LYS A 104 ? 0.1606 0.1534 0.1875 0.0101  -0.0445 -0.0031 1783 LYS A CA  
896  C  C   . LYS A 104 ? 0.1571 0.1457 0.1613 0.0101  -0.0538 -0.0091 1783 LYS A C   
897  O  O   . LYS A 104 ? 0.1778 0.1287 0.1777 -0.0121 -0.0450 -0.0114 1783 LYS A O   
898  C  CB  A LYS A 104 ? 0.1700 0.2142 0.2001 0.0150  -0.0671 0.0163  1783 LYS A CB  
899  C  CB  B LYS A 104 ? 0.1791 0.1771 0.2002 0.0113  -0.0318 -0.0009 1783 LYS A CB  
900  C  CG  A LYS A 104 ? 0.1678 0.1981 0.1835 0.0315  -0.0574 0.0022  1783 LYS A CG  
901  C  CG  B LYS A 104 ? 0.1635 0.2190 0.2301 0.0224  -0.0134 -0.0132 1783 LYS A CG  
902  C  CD  A LYS A 104 ? 0.1680 0.2419 0.2514 -0.0300 -0.0191 0.0341  1783 LYS A CD  
903  C  CD  B LYS A 104 ? 0.2067 0.2454 0.2375 0.0297  0.0016  0.0094  1783 LYS A CD  
904  C  CE  A LYS A 104 ? 0.2596 0.3094 0.2519 0.0217  -0.0320 -0.0138 1783 LYS A CE  
905  C  CE  B LYS A 104 ? 0.1570 0.2671 0.2530 0.0336  -0.0005 0.0119  1783 LYS A CE  
906  N  NZ  A LYS A 104 ? 0.2259 0.3465 0.2818 0.0341  -0.0268 -0.0229 1783 LYS A NZ  
907  N  NZ  B LYS A 104 ? 0.2277 0.2130 0.2954 0.0159  0.0492  0.0006  1783 LYS A NZ  
908  N  N   . ASP A 105 ? 0.1408 0.1453 0.1900 0.0197  -0.0550 0.0030  1784 ASP A N   
909  C  CA  . ASP A 105 ? 0.1686 0.1236 0.2104 -0.0144 -0.0598 -0.0179 1784 ASP A CA  
910  C  C   . ASP A 105 ? 0.1815 0.1331 0.1657 -0.0123 -0.0616 -0.0056 1784 ASP A C   
911  O  O   . ASP A 105 ? 0.2020 0.1279 0.2190 -0.0076 -0.0687 0.0092  1784 ASP A O   
912  C  CB  . ASP A 105 ? 0.2307 0.1371 0.1912 0.0044  -0.0487 -0.0280 1784 ASP A CB  
913  C  CG  . ASP A 105 ? 0.2514 0.1976 0.2339 0.0054  -0.0627 -0.0197 1784 ASP A CG  
914  O  OD1 . ASP A 105 ? 0.2353 0.1543 0.3572 0.0408  -0.0585 -0.0323 1784 ASP A OD1 
915  O  OD2 . ASP A 105 ? 0.3158 0.2935 0.3012 0.0872  -0.0754 -0.0534 1784 ASP A OD2 
916  N  N   . ASP A 106 ? 0.1854 0.1078 0.2193 0.0007  -0.0822 -0.0164 1785 ASP A N   
917  C  CA  . ASP A 106 ? 0.1896 0.1572 0.2017 0.0299  -0.0469 -0.0129 1785 ASP A CA  
918  C  C   . ASP A 106 ? 0.1523 0.1014 0.1972 -0.0005 -0.0376 0.0091  1785 ASP A C   
919  O  O   . ASP A 106 ? 0.1369 0.1180 0.1954 0.0201  -0.0508 -0.0072 1785 ASP A O   
920  C  CB  . ASP A 106 ? 0.2116 0.1790 0.2399 0.0364  -0.0861 -0.0051 1785 ASP A CB  
921  C  CG  . ASP A 106 ? 0.2671 0.2314 0.3437 0.0190  -0.0546 -0.0281 1785 ASP A CG  
922  O  OD1 . ASP A 106 ? 0.3357 0.2150 0.4120 0.0387  -0.1350 -0.0438 1785 ASP A OD1 
923  O  OD2 . ASP A 106 ? 0.2980 0.2019 0.3836 -0.0089 -0.0582 -0.1268 1785 ASP A OD2 
924  N  N   . PHE A 107 ? 0.1663 0.0955 0.1873 -0.0191 -0.0380 0.0048  1786 PHE A N   
925  C  CA  . PHE A 107 ? 0.1433 0.1125 0.1758 -0.0080 -0.0462 0.0190  1786 PHE A CA  
926  C  C   . PHE A 107 ? 0.1336 0.0939 0.1663 -0.0134 -0.0243 -0.0098 1786 PHE A C   
927  O  O   . PHE A 107 ? 0.1501 0.1012 0.1628 -0.0004 -0.0420 -0.0087 1786 PHE A O   
928  C  CB  . PHE A 107 ? 0.1799 0.1077 0.1839 -0.0054 -0.0463 0.0004  1786 PHE A CB  
929  C  CG  . PHE A 107 ? 0.1691 0.0883 0.1691 0.0186  -0.0730 0.0048  1786 PHE A CG  
930  C  CD1 . PHE A 107 ? 0.1443 0.1129 0.2062 0.0140  -0.0741 -0.0055 1786 PHE A CD1 
931  C  CD2 . PHE A 107 ? 0.1235 0.0916 0.1762 0.0006  -0.0542 0.0298  1786 PHE A CD2 
932  C  CE1 . PHE A 107 ? 0.1925 0.0845 0.2214 0.0234  -0.0405 -0.0199 1786 PHE A CE1 
933  C  CE2 . PHE A 107 ? 0.1808 0.1031 0.1657 0.0078  -0.0511 -0.0105 1786 PHE A CE2 
934  C  CZ  . PHE A 107 ? 0.1574 0.1108 0.1768 0.0252  -0.0471 -0.0089 1786 PHE A CZ  
935  N  N   . TRP A 108 ? 0.1417 0.1057 0.1818 -0.0176 -0.0354 0.0032  1787 TRP A N   
936  C  CA  . TRP A 108 ? 0.1525 0.0842 0.1927 0.0039  -0.0454 0.0045  1787 TRP A CA  
937  C  C   . TRP A 108 ? 0.1443 0.1242 0.1751 -0.0287 -0.0580 -0.0088 1787 TRP A C   
938  O  O   . TRP A 108 ? 0.1702 0.1020 0.2128 -0.0126 -0.0608 0.0102  1787 TRP A O   
939  C  CB  . TRP A 108 ? 0.1710 0.1196 0.2316 0.0010  -0.0339 -0.0247 1787 TRP A CB  
940  C  CG  . TRP A 108 ? 0.1654 0.0844 0.2283 0.0188  -0.0476 -0.0242 1787 TRP A CG  
941  C  CD1 . TRP A 108 ? 0.1415 0.1044 0.2469 0.0285  -0.0341 -0.0181 1787 TRP A CD1 
942  C  CD2 . TRP A 108 ? 0.1985 0.0954 0.1995 -0.0026 -0.0513 0.0014  1787 TRP A CD2 
943  N  NE1 . TRP A 108 ? 0.1596 0.0922 0.2116 0.0097  -0.0324 -0.0023 1787 TRP A NE1 
944  C  CE2 . TRP A 108 ? 0.1778 0.0985 0.1978 0.0264  -0.0672 0.0290  1787 TRP A CE2 
945  C  CE3 . TRP A 108 ? 0.1851 0.0894 0.2305 0.0176  -0.0678 -0.0045 1787 TRP A CE3 
946  C  CZ2 . TRP A 108 ? 0.1514 0.1268 0.2177 0.0246  -0.0412 -0.0061 1787 TRP A CZ2 
947  C  CZ3 . TRP A 108 ? 0.1698 0.1353 0.2003 0.0185  -0.0570 0.0090  1787 TRP A CZ3 
948  C  CH2 . TRP A 108 ? 0.2006 0.1103 0.2339 0.0440  -0.0518 -0.0082 1787 TRP A CH2 
949  N  N   . LYS A 109 ? 0.1684 0.0981 0.1979 -0.0124 -0.0429 0.0059  1788 LYS A N   
950  C  CA  . LYS A 109 ? 0.1687 0.1098 0.2081 -0.0135 -0.0296 0.0008  1788 LYS A CA  
951  C  C   . LYS A 109 ? 0.1255 0.1113 0.2100 -0.0001 -0.0365 0.0126  1788 LYS A C   
952  O  O   . LYS A 109 ? 0.1611 0.1087 0.2457 -0.0310 -0.0695 0.0218  1788 LYS A O   
953  C  CB  . LYS A 109 ? 0.1982 0.1164 0.2034 -0.0229 -0.0683 -0.0109 1788 LYS A CB  
954  C  CG  . LYS A 109 ? 0.1393 0.1726 0.2426 -0.0413 -0.0869 0.0128  1788 LYS A CG  
955  C  CD  . LYS A 109 ? 0.1603 0.2647 0.2896 -0.0682 -0.0694 0.0101  1788 LYS A CD  
956  C  CE  . LYS A 109 ? 0.2467 0.2966 0.3019 -0.0767 -0.0755 0.0217  1788 LYS A CE  
957  N  NZ  . LYS A 109 ? 0.3106 0.4131 0.3828 -0.0467 -0.1329 0.0412  1788 LYS A NZ  
958  N  N   . MET A 110 ? 0.1540 0.0715 0.2063 -0.0070 -0.0491 -0.0017 1789 MET A N   
959  C  CA  . MET A 110 ? 0.1610 0.0984 0.1755 -0.0262 -0.0558 0.0030  1789 MET A CA  
960  C  C   . MET A 110 ? 0.1672 0.1022 0.1841 -0.0217 -0.0314 0.0014  1789 MET A C   
961  O  O   . MET A 110 ? 0.1405 0.1052 0.2064 -0.0111 -0.0254 0.0123  1789 MET A O   
962  C  CB  . MET A 110 ? 0.1736 0.0639 0.2220 -0.0436 -0.0233 -0.0036 1789 MET A CB  
963  C  CG  . MET A 110 ? 0.1461 0.0836 0.2330 -0.0217 -0.0142 -0.0018 1789 MET A CG  
964  S  SD  . MET A 110 ? 0.1384 0.1162 0.2275 -0.0060 -0.0503 0.0010  1789 MET A SD  
965  C  CE  . MET A 110 ? 0.1093 0.1859 0.2476 -0.0200 0.0000  0.0168  1789 MET A CE  
966  N  N   . VAL A 111 ? 0.1490 0.1259 0.1688 -0.0267 -0.0395 0.0150  1790 VAL A N   
967  C  CA  . VAL A 111 ? 0.1412 0.1246 0.1750 -0.0265 -0.0370 0.0122  1790 VAL A CA  
968  C  C   . VAL A 111 ? 0.1292 0.1024 0.1874 -0.0139 -0.0439 0.0052  1790 VAL A C   
969  O  O   . VAL A 111 ? 0.1783 0.1060 0.1987 -0.0359 -0.0230 0.0200  1790 VAL A O   
970  C  CB  . VAL A 111 ? 0.1418 0.1184 0.1959 -0.0215 -0.0328 0.0337  1790 VAL A CB  
971  C  CG1 . VAL A 111 ? 0.1568 0.1085 0.1950 -0.0300 -0.0556 0.0243  1790 VAL A CG1 
972  C  CG2 . VAL A 111 ? 0.1574 0.1145 0.1455 -0.0188 -0.0170 0.0418  1790 VAL A CG2 
973  N  N   . TRP A 112 ? 0.1535 0.1068 0.2005 -0.0186 -0.0634 0.0174  1791 TRP A N   
974  C  CA  . TRP A 112 ? 0.1674 0.1213 0.1798 -0.0272 -0.0285 0.0163  1791 TRP A CA  
975  C  C   . TRP A 112 ? 0.1640 0.1309 0.1882 -0.0299 -0.0576 0.0260  1791 TRP A C   
976  O  O   . TRP A 112 ? 0.1936 0.1471 0.2272 -0.0153 -0.0630 0.0364  1791 TRP A O   
977  C  CB  . TRP A 112 ? 0.2108 0.1169 0.2025 -0.0221 -0.0500 0.0030  1791 TRP A CB  
978  C  CG  . TRP A 112 ? 0.1977 0.1296 0.2327 -0.0405 -0.0159 0.0363  1791 TRP A CG  
979  C  CD1 . TRP A 112 ? 0.2428 0.1744 0.2641 -0.0329 -0.0277 0.0138  1791 TRP A CD1 
980  C  CD2 . TRP A 112 ? 0.1852 0.1377 0.1896 -0.0321 -0.0246 0.0028  1791 TRP A CD2 
981  N  NE1 . TRP A 112 ? 0.2229 0.1687 0.2966 -0.0568 -0.0353 0.0362  1791 TRP A NE1 
982  C  CE2 . TRP A 112 ? 0.2270 0.1353 0.2593 -0.0231 -0.0154 0.0362  1791 TRP A CE2 
983  C  CE3 . TRP A 112 ? 0.2296 0.1302 0.2198 -0.0125 -0.0463 0.0233  1791 TRP A CE3 
984  C  CZ2 . TRP A 112 ? 0.2350 0.1371 0.2472 -0.0142 -0.0386 0.0162  1791 TRP A CZ2 
985  C  CZ3 . TRP A 112 ? 0.2687 0.1560 0.2357 -0.0121 -0.0137 0.0259  1791 TRP A CZ3 
986  C  CH2 . TRP A 112 ? 0.2410 0.1603 0.2594 0.0027  -0.0125 0.0361  1791 TRP A CH2 
987  N  N   . GLU A 113 ? 0.1710 0.1531 0.2198 -0.0294 -0.0608 0.0137  1792 GLU A N   
988  C  CA  . GLU A 113 ? 0.1671 0.1696 0.2141 -0.0381 -0.0305 0.0264  1792 GLU A CA  
989  C  C   . GLU A 113 ? 0.1667 0.1530 0.2022 -0.0562 0.0006  0.0352  1792 GLU A C   
990  O  O   . GLU A 113 ? 0.2087 0.1784 0.2232 -0.0567 -0.0248 0.0462  1792 GLU A O   
991  C  CB  . GLU A 113 ? 0.1663 0.1932 0.2112 -0.0403 -0.0576 0.0215  1792 GLU A CB  
992  C  CG  . GLU A 113 ? 0.1941 0.1999 0.2716 -0.0373 -0.0821 -0.0152 1792 GLU A CG  
993  C  CD  . GLU A 113 ? 0.2691 0.2084 0.3153 -0.0499 -0.0890 0.0042  1792 GLU A CD  
994  O  OE1 . GLU A 113 ? 0.2300 0.2207 0.3723 -0.0338 -0.1489 -0.0152 1792 GLU A OE1 
995  O  OE2 . GLU A 113 ? 0.3575 0.2763 0.3169 -0.0662 -0.0944 0.0003  1792 GLU A OE2 
996  N  N   . GLN A 114 ? 0.1305 0.1247 0.2310 -0.0317 -0.0279 0.0235  1793 GLN A N   
997  C  CA  . GLN A 114 ? 0.1684 0.1217 0.2031 -0.0270 -0.0316 0.0291  1793 GLN A CA  
998  C  C   . GLN A 114 ? 0.1524 0.1234 0.2232 -0.0275 -0.0274 -0.0018 1793 GLN A C   
999  O  O   . GLN A 114 ? 0.1642 0.1553 0.2339 -0.0142 -0.0271 0.0198  1793 GLN A O   
1000 C  CB  . GLN A 114 ? 0.1865 0.1249 0.2075 -0.0215 -0.0307 0.0309  1793 GLN A CB  
1001 C  CG  . GLN A 114 ? 0.1909 0.1498 0.2062 0.0089  -0.0051 0.0354  1793 GLN A CG  
1002 C  CD  . GLN A 114 ? 0.2035 0.2014 0.3396 -0.0024 -0.0228 0.0429  1793 GLN A CD  
1003 O  OE1 . GLN A 114 ? 0.1898 0.2322 0.3726 -0.0279 -0.0052 0.0405  1793 GLN A OE1 
1004 N  NE2 . GLN A 114 ? 0.1819 0.2164 0.4588 0.0127  -0.0822 0.0653  1793 GLN A NE2 
1005 N  N   . ASN A 115 ? 0.1542 0.1294 0.2304 -0.0287 -0.0382 0.0280  1794 ASN A N   
1006 C  CA  . ASN A 115 ? 0.1591 0.1338 0.2050 -0.0534 -0.0425 0.0199  1794 ASN A CA  
1007 C  C   . ASN A 115 ? 0.1721 0.1387 0.1940 -0.0260 -0.0278 0.0220  1794 ASN A C   
1008 O  O   . ASN A 115 ? 0.1895 0.1535 0.2212 -0.0272 -0.0216 0.0229  1794 ASN A O   
1009 C  CB  . ASN A 115 ? 0.1822 0.2335 0.1964 -0.0337 -0.0697 0.0425  1794 ASN A CB  
1010 C  CG  . ASN A 115 ? 0.2017 0.1755 0.2474 -0.0150 -0.0423 0.0153  1794 ASN A CG  
1011 O  OD1 . ASN A 115 ? 0.3114 0.2122 0.2868 -0.0263 -0.0757 0.0301  1794 ASN A OD1 
1012 N  ND2 . ASN A 115 ? 0.3026 0.2415 0.2813 -0.0980 0.0094  0.0604  1794 ASN A ND2 
1013 N  N   . VAL A 116 ? 0.1432 0.1246 0.2073 -0.0127 -0.0333 0.0382  1795 VAL A N   
1014 C  CA  . VAL A 116 ? 0.1366 0.1278 0.1983 -0.0182 -0.0246 0.0132  1795 VAL A CA  
1015 C  C   . VAL A 116 ? 0.1664 0.1257 0.1926 -0.0157 -0.0270 -0.0049 1795 VAL A C   
1016 O  O   . VAL A 116 ? 0.1764 0.1308 0.2318 -0.0019 -0.0606 -0.0116 1795 VAL A O   
1017 C  CB  . VAL A 116 ? 0.1244 0.1184 0.1581 -0.0211 -0.0385 0.0088  1795 VAL A CB  
1018 C  CG1 . VAL A 116 ? 0.1322 0.1403 0.2281 -0.0288 -0.0284 0.0138  1795 VAL A CG1 
1019 C  CG2 . VAL A 116 ? 0.1135 0.1218 0.2058 -0.0201 -0.0191 0.0155  1795 VAL A CG2 
1020 N  N   . HIS A 117 ? 0.1297 0.1191 0.1899 -0.0008 -0.0380 0.0202  1796 HIS A N   
1021 C  CA  . HIS A 117 ? 0.1194 0.1146 0.1956 0.0036  -0.0347 0.0451  1796 HIS A CA  
1022 C  C   . HIS A 117 ? 0.1452 0.1247 0.1800 -0.0060 -0.0157 0.0216  1796 HIS A C   
1023 O  O   . HIS A 117 ? 0.1369 0.1201 0.2541 0.0197  -0.0114 0.0193  1796 HIS A O   
1024 C  CB  . HIS A 117 ? 0.1621 0.1661 0.2063 -0.0199 -0.0400 0.0560  1796 HIS A CB  
1025 C  CG  . HIS A 117 ? 0.1867 0.1590 0.2918 -0.0043 -0.0213 0.0507  1796 HIS A CG  
1026 N  ND1 . HIS A 117 ? 0.2587 0.1768 0.3475 -0.0654 -0.0166 0.0560  1796 HIS A ND1 
1027 C  CD2 . HIS A 117 ? 0.2967 0.1749 0.3891 -0.0222 -0.0482 0.0262  1796 HIS A CD2 
1028 C  CE1 . HIS A 117 ? 0.1912 0.1564 0.3657 -0.0278 0.0161  0.0582  1796 HIS A CE1 
1029 N  NE2 . HIS A 117 ? 0.2754 0.2514 0.4224 -0.0298 0.0075  0.0581  1796 HIS A NE2 
1030 N  N   . ASN A 118 ? 0.1252 0.1181 0.1595 0.0034  -0.0016 0.0431  1797 ASN A N   
1031 C  CA  . ASN A 118 ? 0.1353 0.1159 0.1553 -0.0167 -0.0140 0.0422  1797 ASN A CA  
1032 C  C   . ASN A 118 ? 0.1257 0.0944 0.1544 0.0100  -0.0484 0.0272  1797 ASN A C   
1033 O  O   . ASN A 118 ? 0.1120 0.1119 0.1803 0.0075  -0.0228 0.0207  1797 ASN A O   
1034 C  CB  . ASN A 118 ? 0.1462 0.1385 0.1510 -0.0071 -0.0455 0.0435  1797 ASN A CB  
1035 C  CG  . ASN A 118 ? 0.1666 0.1447 0.1757 0.0034  -0.0236 0.0324  1797 ASN A CG  
1036 O  OD1 . ASN A 118 ? 0.1713 0.2011 0.2430 0.0025  -0.0235 0.0360  1797 ASN A OD1 
1037 N  ND2 . ASN A 118 ? 0.1654 0.1188 0.1701 -0.0138 -0.0516 0.0461  1797 ASN A ND2 
1038 N  N   . ILE A 119 ? 0.1288 0.1003 0.1638 -0.0063 -0.0248 0.0274  1798 ILE A N   
1039 C  CA  . ILE A 119 ? 0.1139 0.1072 0.1584 -0.0016 -0.0298 0.0055  1798 ILE A CA  
1040 C  C   . ILE A 119 ? 0.1226 0.0759 0.1664 0.0036  -0.0335 0.0163  1798 ILE A C   
1041 O  O   . ILE A 119 ? 0.0968 0.0940 0.1947 0.0434  -0.0397 -0.0015 1798 ILE A O   
1042 C  CB  . ILE A 119 ? 0.1296 0.1064 0.1662 0.0027  -0.0257 0.0202  1798 ILE A CB  
1043 C  CG1 . ILE A 119 ? 0.1314 0.0782 0.2182 0.0139  -0.0305 -0.0003 1798 ILE A CG1 
1044 C  CG2 . ILE A 119 ? 0.1147 0.1427 0.1538 0.0251  -0.0110 0.0198  1798 ILE A CG2 
1045 C  CD1 . ILE A 119 ? 0.1529 0.1140 0.2267 0.0150  -0.0520 -0.0017 1798 ILE A CD1 
1046 N  N   . VAL A 120 ? 0.0762 0.0951 0.1538 0.0087  -0.0402 0.0006  1799 VAL A N   
1047 C  CA  . VAL A 120 ? 0.0731 0.0857 0.1411 0.0007  -0.0056 -0.0090 1799 VAL A CA  
1048 C  C   . VAL A 120 ? 0.0726 0.0884 0.1382 0.0083  -0.0094 0.0142  1799 VAL A C   
1049 O  O   . VAL A 120 ? 0.0601 0.1150 0.1649 0.0237  -0.0379 0.0050  1799 VAL A O   
1050 C  CB  . VAL A 120 ? 0.0955 0.1015 0.1325 0.0020  -0.0157 0.0043  1799 VAL A CB  
1051 C  CG1 . VAL A 120 ? 0.0781 0.1325 0.1920 -0.0336 -0.0126 -0.0324 1799 VAL A CG1 
1052 C  CG2 . VAL A 120 ? 0.1202 0.1466 0.1467 0.0168  -0.0129 0.0080  1799 VAL A CG2 
1053 N  N   . MET A 121 ? 0.0604 0.1043 0.1527 -0.0010 0.0154  0.0124  1800 MET A N   
1054 C  CA  . MET A 121 ? 0.0733 0.0950 0.1499 0.0088  -0.0052 -0.0067 1800 MET A CA  
1055 C  C   . MET A 121 ? 0.0799 0.0882 0.1673 0.0059  -0.0302 0.0239  1800 MET A C   
1056 O  O   . MET A 121 ? 0.0647 0.1345 0.1827 0.0301  -0.0455 0.0013  1800 MET A O   
1057 C  CB  . MET A 121 ? 0.0905 0.1568 0.1289 0.0375  -0.0257 -0.0146 1800 MET A CB  
1058 C  CG  . MET A 121 ? 0.1123 0.1425 0.1670 0.0274  -0.0176 -0.0269 1800 MET A CG  
1059 S  SD  . MET A 121 ? 0.1321 0.1470 0.1677 0.0183  -0.0303 -0.0098 1800 MET A SD  
1060 C  CE  . MET A 121 ? 0.1414 0.2034 0.2266 -0.0002 -0.0440 -0.0162 1800 MET A CE  
1061 N  N   . VAL A 122 ? 0.0768 0.0910 0.1445 0.0007  -0.0166 0.0023  1801 VAL A N   
1062 C  CA  . VAL A 122 ? 0.0822 0.1013 0.1533 -0.0156 -0.0157 0.0002  1801 VAL A CA  
1063 C  C   . VAL A 122 ? 0.0627 0.1357 0.1739 -0.0165 -0.0176 0.0284  1801 VAL A C   
1064 O  O   . VAL A 122 ? 0.2024 0.1455 0.2164 -0.0009 -0.0177 0.0186  1801 VAL A O   
1065 C  CB  . VAL A 122 ? 0.0834 0.1506 0.1597 0.0212  -0.0211 -0.0128 1801 VAL A CB  
1066 C  CG1 . VAL A 122 ? 0.1936 0.2031 0.1454 0.0246  -0.0109 -0.0201 1801 VAL A CG1 
1067 C  CG2 . VAL A 122 ? 0.0995 0.1921 0.2514 0.0213  0.0176  -0.0098 1801 VAL A CG2 
1068 N  N   . THR A 123 ? 0.1279 0.1692 0.2146 -0.0168 0.0105  -0.0037 1802 THR A N   
1069 C  CA  . THR A 123 ? 0.0981 0.1462 0.2134 0.0128  0.0030  0.0147  1802 THR A CA  
1070 C  C   . THR A 123 ? 0.1097 0.1428 0.2214 -0.0186 0.0121  0.0178  1802 THR A C   
1071 O  O   . THR A 123 ? 0.1084 0.1605 0.2162 0.0052  0.0220  0.0119  1802 THR A O   
1072 C  CB  . THR A 123 ? 0.1395 0.1830 0.2206 -0.0204 -0.0191 0.0129  1802 THR A CB  
1073 O  OG1 . THR A 123 ? 0.1278 0.2017 0.2564 0.0239  -0.0104 0.0147  1802 THR A OG1 
1074 C  CG2 . THR A 123 ? 0.1043 0.1926 0.2607 -0.0052 -0.0257 -0.0341 1802 THR A CG2 
1075 N  N   . GLN A 124 ? 0.1192 0.2044 0.1994 0.0308  0.0068  0.0114  1803 GLN A N   
1076 C  CA  . GLN A 124 ? 0.1245 0.2582 0.1937 0.0257  0.0246  0.0038  1803 GLN A CA  
1077 C  C   . GLN A 124 ? 0.1201 0.2124 0.1927 0.0279  -0.0062 -0.0083 1803 GLN A C   
1078 O  O   . GLN A 124 ? 0.1084 0.2100 0.2246 0.0477  -0.0101 -0.0096 1803 GLN A O   
1079 C  CB  . GLN A 124 ? 0.0842 0.3232 0.2330 0.0094  -0.0104 -0.0013 1803 GLN A CB  
1080 C  CG  . GLN A 124 ? 0.1929 0.3862 0.2843 0.0046  -0.0394 -0.0124 1803 GLN A CG  
1081 C  CD  . GLN A 124 ? 0.3662 0.4114 0.3735 0.0084  -0.0348 -0.0061 1803 GLN A CD  
1082 O  OE1 . GLN A 124 ? 0.4253 0.4859 0.5372 0.0313  0.0177  -0.0305 1803 GLN A OE1 
1083 N  NE2 . GLN A 124 ? 0.4633 0.5312 0.4304 -0.0128 -0.0606 -0.0274 1803 GLN A NE2 
1084 N  N   . CYS A 125 ? 0.1008 0.1929 0.2140 0.0273  -0.0065 -0.0159 1804 CYS A N   
1085 C  CA  . CYS A 125 ? 0.1212 0.2124 0.2093 0.0279  -0.0179 0.0016  1804 CYS A CA  
1086 C  C   . CYS A 125 ? 0.0928 0.2225 0.1929 0.0165  -0.0138 -0.0059 1804 CYS A C   
1087 O  O   . CYS A 125 ? 0.1142 0.1863 0.2150 0.0224  -0.0315 0.0142  1804 CYS A O   
1088 C  CB  . CYS A 125 ? 0.1584 0.1993 0.2166 0.0494  -0.0116 -0.0105 1804 CYS A CB  
1089 S  SG  . CYS A 125 ? 0.1919 0.2148 0.2709 0.0285  -0.0312 -0.0017 1804 CYS A SG  
1090 N  N   . VAL A 126 ? 0.0961 0.2502 0.1859 0.0091  0.0121  0.0160  1805 VAL A N   
1091 C  CA  . VAL A 126 ? 0.1049 0.2452 0.1862 -0.0026 -0.0210 -0.0214 1805 VAL A CA  
1092 C  C   . VAL A 126 ? 0.1363 0.2369 0.1895 -0.0262 -0.0156 -0.0065 1805 VAL A C   
1093 O  O   . VAL A 126 ? 0.1453 0.3190 0.2513 -0.0069 -0.0483 0.0094  1805 VAL A O   
1094 C  CB  . VAL A 126 ? 0.1501 0.2491 0.1903 -0.0008 -0.0193 -0.0396 1805 VAL A CB  
1095 C  CG1 . VAL A 126 ? 0.2139 0.2838 0.2545 -0.0175 0.0351  -0.0316 1805 VAL A CG1 
1096 C  CG2 . VAL A 126 ? 0.1695 0.2350 0.2645 0.0060  0.0013  -0.0480 1805 VAL A CG2 
1097 N  N   . GLU A 127 ? 0.1017 0.2430 0.2278 -0.0227 -0.0611 -0.0356 1806 GLU A N   
1098 C  CA  A GLU A 127 ? 0.1230 0.2615 0.2567 -0.0106 -0.0254 -0.0545 1806 GLU A CA  
1099 C  CA  B GLU A 127 ? 0.1360 0.2577 0.2586 -0.0172 -0.0262 -0.0466 1806 GLU A CA  
1100 C  C   . GLU A 127 ? 0.1646 0.2731 0.3248 -0.0186 -0.0519 -0.0353 1806 GLU A C   
1101 O  O   . GLU A 127 ? 0.1168 0.2729 0.3743 -0.0564 -0.0875 -0.0467 1806 GLU A O   
1102 C  CB  A GLU A 127 ? 0.1351 0.2617 0.2388 0.0035  -0.0500 -0.0464 1806 GLU A CB  
1103 C  CB  B GLU A 127 ? 0.1594 0.2542 0.2836 0.0130  -0.0495 -0.0449 1806 GLU A CB  
1104 C  CG  A GLU A 127 ? 0.1447 0.2691 0.2459 0.0105  -0.0387 -0.0531 1806 GLU A CG  
1105 C  CG  B GLU A 127 ? 0.1289 0.1869 0.2092 -0.0394 -0.0147 0.0251  1806 GLU A CG  
1106 C  CD  A GLU A 127 ? 0.2482 0.2094 0.2197 -0.0148 -0.0073 0.0280  1806 GLU A CD  
1107 C  CD  B GLU A 127 ? 0.1029 0.1999 0.2229 0.0181  -0.0658 0.0452  1806 GLU A CD  
1108 O  OE1 A GLU A 127 ? 0.1030 0.1568 0.2446 0.0132  -0.0086 -0.0273 1806 GLU A OE1 
1109 O  OE1 B GLU A 127 ? 0.1991 0.3038 0.2898 -0.0164 0.0134  0.0037  1806 GLU A OE1 
1110 O  OE2 A GLU A 127 ? 0.0643 0.1327 0.3016 0.0000  0.0055  0.0183  1806 GLU A OE2 
1111 O  OE2 B GLU A 127 ? 0.0932 0.2444 0.2515 0.0045  0.0033  0.0546  1806 GLU A OE2 
1112 N  N   . LYS A 128 ? 0.1159 0.2795 0.3212 -0.0536 -0.0161 -0.0333 1807 LYS A N   
1113 C  CA  . LYS A 128 ? 0.2217 0.3195 0.3445 -0.0372 -0.0472 -0.0216 1807 LYS A CA  
1114 C  C   . LYS A 128 ? 0.1608 0.3330 0.3451 -0.0437 -0.0213 0.0167  1807 LYS A C   
1115 O  O   . LYS A 128 ? 0.1879 0.3484 0.4046 -0.0743 -0.0415 0.0495  1807 LYS A O   
1116 C  CB  . LYS A 128 ? 0.2597 0.3357 0.3593 -0.0438 -0.0793 0.0014  1807 LYS A CB  
1117 C  CG  . LYS A 128 ? 0.2137 0.3231 0.3677 -0.0940 -0.0541 -0.0383 1807 LYS A CG  
1118 C  CD  . LYS A 128 ? 0.2953 0.3045 0.2774 -0.1020 -0.0597 0.0737  1807 LYS A CD  
1119 C  CE  . LYS A 128 ? 0.1883 0.3829 0.3801 0.0061  -0.0804 0.0088  1807 LYS A CE  
1120 N  NZ  . LYS A 128 ? 0.2136 0.1819 0.3614 -0.0668 -0.0114 -0.0069 1807 LYS A NZ  
1121 N  N   . GLY A 129 ? 0.1764 0.3057 0.3557 -0.0404 0.0101  0.0016  1808 GLY A N   
1122 C  CA  . GLY A 129 ? 0.1517 0.3556 0.3267 -0.0514 -0.0026 0.0089  1808 GLY A CA  
1123 C  C   . GLY A 129 ? 0.1494 0.3318 0.2885 -0.0447 -0.0310 -0.0056 1808 GLY A C   
1124 O  O   . GLY A 129 ? 0.2212 0.3908 0.3041 -0.0638 -0.0073 -0.0223 1808 GLY A O   
1125 N  N   . ARG A 130 ? 0.1282 0.2890 0.3047 -0.0481 -0.0247 0.0103  1809 ARG A N   
1126 C  CA  A ARG A 130 ? 0.1048 0.2805 0.2750 -0.0419 -0.0468 0.0090  1809 ARG A CA  
1127 C  CA  B ARG A 130 ? 0.1465 0.2779 0.2649 -0.0282 -0.0273 0.0060  1809 ARG A CA  
1128 C  C   . ARG A 130 ? 0.1450 0.2718 0.2452 -0.0132 -0.0234 0.0018  1809 ARG A C   
1129 O  O   . ARG A 130 ? 0.1045 0.2565 0.2286 -0.0339 -0.0144 -0.0072 1809 ARG A O   
1130 C  CB  A ARG A 130 ? 0.1526 0.3038 0.2961 0.0067  -0.0504 0.0233  1809 ARG A CB  
1131 C  CB  B ARG A 130 ? 0.1710 0.2872 0.2746 -0.0075 -0.0301 0.0105  1809 ARG A CB  
1132 C  CG  A ARG A 130 ? 0.1948 0.3436 0.3526 -0.0206 -0.0120 0.0188  1809 ARG A CG  
1133 C  CG  B ARG A 130 ? 0.2810 0.2839 0.2858 0.0015  0.0039  0.0085  1809 ARG A CG  
1134 C  CD  A ARG A 130 ? 0.3179 0.4108 0.4265 0.0199  0.0044  0.0173  1809 ARG A CD  
1135 C  CD  B ARG A 130 ? 0.2468 0.3502 0.2969 -0.0371 -0.0028 -0.0051 1809 ARG A CD  
1136 N  NE  A ARG A 130 ? 0.4409 0.3840 0.4817 0.0258  -0.0095 0.0314  1809 ARG A NE  
1137 N  NE  B ARG A 130 ? 0.3096 0.4013 0.3627 -0.0116 -0.0072 -0.0112 1809 ARG A NE  
1138 C  CZ  A ARG A 130 ? 0.4183 0.3943 0.4521 0.0222  -0.0170 0.0238  1809 ARG A CZ  
1139 C  CZ  B ARG A 130 ? 0.3649 0.3944 0.3693 -0.0207 0.0039  -0.0117 1809 ARG A CZ  
1140 N  NH1 A ARG A 130 ? 0.3886 0.3541 0.4651 0.0235  -0.0420 0.0242  1809 ARG A NH1 
1141 N  NH1 B ARG A 130 ? 0.3899 0.3916 0.3064 -0.0050 -0.0111 0.0012  1809 ARG A NH1 
1142 N  NH2 A ARG A 130 ? 0.4656 0.5156 0.4902 0.0070  0.0135  0.0203  1809 ARG A NH2 
1143 N  NH2 B ARG A 130 ? 0.2596 0.3782 0.3247 -0.0248 -0.0669 0.0008  1809 ARG A NH2 
1144 N  N   . VAL A 131 ? 0.1425 0.2561 0.2162 -0.0381 -0.0257 0.0092  1810 VAL A N   
1145 C  CA  . VAL A 131 ? 0.1577 0.2146 0.1953 -0.0199 -0.0040 -0.0179 1810 VAL A CA  
1146 C  C   . VAL A 131 ? 0.1164 0.1839 0.1706 -0.0031 0.0223  0.0177  1810 VAL A C   
1147 O  O   . VAL A 131 ? 0.1572 0.2296 0.2570 0.0518  -0.0308 0.0180  1810 VAL A O   
1148 C  CB  . VAL A 131 ? 0.1896 0.2446 0.2157 -0.0413 -0.0197 -0.0508 1810 VAL A CB  
1149 C  CG1 . VAL A 131 ? 0.2386 0.2937 0.2574 -0.0559 -0.0207 -0.0305 1810 VAL A CG1 
1150 C  CG2 . VAL A 131 ? 0.2212 0.2850 0.2645 -0.0503 -0.0183 -0.0746 1810 VAL A CG2 
1151 N  N   . LYS A 132 ? 0.1223 0.1837 0.1795 -0.0136 -0.0052 -0.0022 1811 LYS A N   
1152 C  CA  . LYS A 132 ? 0.1257 0.1493 0.1599 -0.0123 0.0000  0.0080  1811 LYS A CA  
1153 C  C   . LYS A 132 ? 0.1056 0.1392 0.1782 0.0266  -0.0143 -0.0078 1811 LYS A C   
1154 O  O   . LYS A 132 ? 0.0847 0.1377 0.2276 0.0404  0.0032  0.0049  1811 LYS A O   
1155 C  CB  . LYS A 132 ? 0.1189 0.1651 0.2084 -0.0151 -0.0336 -0.0080 1811 LYS A CB  
1156 C  CG  . LYS A 132 ? 0.1698 0.1735 0.2523 -0.0267 -0.0177 -0.0046 1811 LYS A CG  
1157 C  CD  . LYS A 132 ? 0.2132 0.1514 0.3236 -0.0259 -0.0994 0.0358  1811 LYS A CD  
1158 C  CE  . LYS A 132 ? 0.3465 0.2558 0.4087 0.0415  -0.0511 0.0263  1811 LYS A CE  
1159 N  NZ  . LYS A 132 ? 0.4093 0.2447 0.4306 0.1020  -0.0291 -0.0014 1811 LYS A NZ  
1160 N  N   . CYS A 133 ? 0.1255 0.1450 0.2020 0.0291  -0.0161 0.0152  1812 CYS A N   
1161 C  CA  . CYS A 133 ? 0.1343 0.1345 0.1682 0.0255  -0.0213 0.0066  1812 CYS A CA  
1162 C  C   . CYS A 133 ? 0.1452 0.1407 0.1963 0.0150  -0.0259 -0.0087 1812 CYS A C   
1163 O  O   . CYS A 133 ? 0.1166 0.1910 0.2721 0.0179  0.0001  -0.0377 1812 CYS A O   
1164 C  CB  . CYS A 133 ? 0.1310 0.1677 0.1535 0.0245  -0.0114 -0.0072 1812 CYS A CB  
1165 S  SG  . CYS A 133 ? 0.1203 0.1597 0.1917 0.0122  -0.0205 0.0031  1812 CYS A SG  
1166 N  N   . ASP A 134 ? 0.1290 0.1317 0.2015 0.0270  -0.0330 -0.0204 1813 ASP A N   
1167 C  CA  . ASP A 134 ? 0.1730 0.1420 0.1903 0.0180  -0.0378 -0.0256 1813 ASP A CA  
1168 C  C   . ASP A 134 ? 0.1556 0.1521 0.1905 0.0305  -0.0245 -0.0349 1813 ASP A C   
1169 O  O   . ASP A 134 ? 0.1669 0.1385 0.1966 0.0454  -0.0351 -0.0215 1813 ASP A O   
1170 C  CB  . ASP A 134 ? 0.1551 0.1429 0.2441 0.0083  -0.0494 -0.0527 1813 ASP A CB  
1171 C  CG  . ASP A 134 ? 0.2218 0.1793 0.2820 0.0454  -0.0270 -0.0032 1813 ASP A CG  
1172 O  OD1 . ASP A 134 ? 0.1901 0.1781 0.3941 0.0070  -0.0334 -0.0507 1813 ASP A OD1 
1173 O  OD2 . ASP A 134 ? 0.3438 0.2870 0.2912 0.0969  0.0105  -0.0330 1813 ASP A OD2 
1174 N  N   . HIS A 135 ? 0.1673 0.1678 0.1977 0.0333  -0.0338 0.0058  1814 HIS A N   
1175 C  CA  . HIS A 135 ? 0.1392 0.1410 0.2273 0.0544  -0.0268 -0.0074 1814 HIS A CA  
1176 C  C   . HIS A 135 ? 0.1592 0.1276 0.2020 0.0208  -0.0327 -0.0445 1814 HIS A C   
1177 O  O   . HIS A 135 ? 0.1570 0.1905 0.2875 0.0392  -0.0222 -0.0580 1814 HIS A O   
1178 C  CB  . HIS A 135 ? 0.1715 0.2082 0.1918 0.0400  -0.0142 0.0059  1814 HIS A CB  
1179 C  CG  . HIS A 135 ? 0.1480 0.1855 0.2637 0.0374  -0.0516 -0.0065 1814 HIS A CG  
1180 N  ND1 . HIS A 135 ? 0.1527 0.1909 0.3216 0.0306  -0.0881 0.0121  1814 HIS A ND1 
1181 C  CD2 . HIS A 135 ? 0.1627 0.2240 0.3425 0.0550  -0.0499 -0.0319 1814 HIS A CD2 
1182 C  CE1 . HIS A 135 ? 0.1774 0.1578 0.3137 0.0215  -0.0579 0.0341  1814 HIS A CE1 
1183 N  NE2 . HIS A 135 ? 0.1451 0.2346 0.3125 0.0340  -0.0688 -0.0143 1814 HIS A NE2 
1184 N  N   . TYR A 136 ? 0.0988 0.1367 0.2076 0.0139  -0.0407 -0.0162 1815 TYR A N   
1185 C  CA  . TYR A 136 ? 0.1026 0.1069 0.2211 0.0400  -0.0456 -0.0190 1815 TYR A CA  
1186 C  C   . TYR A 136 ? 0.1437 0.1182 0.2144 0.0281  -0.0368 -0.0247 1815 TYR A C   
1187 O  O   . TYR A 136 ? 0.1266 0.1235 0.2347 0.0117  -0.0316 -0.0258 1815 TYR A O   
1188 C  CB  . TYR A 136 ? 0.1125 0.1463 0.1581 0.0553  -0.0432 -0.0414 1815 TYR A CB  
1189 C  CG  . TYR A 136 ? 0.1084 0.1169 0.1776 0.0249  -0.0449 -0.0154 1815 TYR A CG  
1190 C  CD1 . TYR A 136 ? 0.1382 0.1314 0.1578 0.0018  -0.0446 -0.0164 1815 TYR A CD1 
1191 C  CD2 . TYR A 136 ? 0.0946 0.1048 0.1904 0.0330  -0.0397 -0.0055 1815 TYR A CD2 
1192 C  CE1 . TYR A 136 ? 0.1261 0.1020 0.1880 0.0187  -0.0468 -0.0205 1815 TYR A CE1 
1193 C  CE2 . TYR A 136 ? 0.1246 0.1106 0.1354 0.0356  -0.0212 -0.0143 1815 TYR A CE2 
1194 C  CZ  . TYR A 136 ? 0.0935 0.1235 0.1857 0.0349  -0.0312 -0.0334 1815 TYR A CZ  
1195 O  OH  . TYR A 136 ? 0.1289 0.1183 0.1666 0.0207  -0.0489 -0.0109 1815 TYR A OH  
1196 N  N   . TRP A 137 ? 0.1674 0.1153 0.2141 0.0278  -0.0786 0.0013  1816 TRP A N   
1197 C  CA  . TRP A 137 ? 0.1657 0.1369 0.2158 0.0057  -0.0735 -0.0016 1816 TRP A CA  
1198 C  C   . TRP A 137 ? 0.1592 0.1250 0.2378 0.0077  -0.0869 0.0183  1816 TRP A C   
1199 O  O   . TRP A 137 ? 0.1541 0.1362 0.2783 0.0069  -0.0765 0.0200  1816 TRP A O   
1200 C  CB  . TRP A 137 ? 0.1637 0.1828 0.2104 0.0045  -0.0696 -0.0006 1816 TRP A CB  
1201 C  CG  . TRP A 137 ? 0.1689 0.1561 0.2909 0.0148  -0.0496 -0.0039 1816 TRP A CG  
1202 C  CD1 . TRP A 137 ? 0.1644 0.1598 0.2220 0.0138  -0.1070 -0.0286 1816 TRP A CD1 
1203 C  CD2 . TRP A 137 ? 0.1531 0.1710 0.2250 0.0232  -0.0933 -0.0318 1816 TRP A CD2 
1204 N  NE1 . TRP A 137 ? 0.1790 0.1580 0.2849 0.0365  -0.1127 -0.0447 1816 TRP A NE1 
1205 C  CE2 . TRP A 137 ? 0.1612 0.1513 0.2352 0.0363  -0.0922 -0.0417 1816 TRP A CE2 
1206 C  CE3 . TRP A 137 ? 0.1479 0.1686 0.2182 0.0329  -0.0606 -0.0453 1816 TRP A CE3 
1207 C  CZ2 . TRP A 137 ? 0.1462 0.1494 0.2073 0.0237  -0.0432 -0.0350 1816 TRP A CZ2 
1208 C  CZ3 . TRP A 137 ? 0.1130 0.1637 0.2539 0.0059  -0.0264 -0.0721 1816 TRP A CZ3 
1209 C  CH2 . TRP A 137 ? 0.1312 0.1400 0.3292 0.0488  -0.0228 -0.0595 1816 TRP A CH2 
1210 N  N   . PRO A 138 ? 0.1838 0.1407 0.2551 0.0163  -0.0563 0.0217  1817 PRO A N   
1211 C  CA  . PRO A 138 ? 0.1918 0.1236 0.3264 0.0074  -0.0349 0.0041  1817 PRO A CA  
1212 C  C   . PRO A 138 ? 0.1746 0.1442 0.2997 0.0360  -0.0490 -0.0235 1817 PRO A C   
1213 O  O   . PRO A 138 ? 0.1771 0.1672 0.3353 0.0288  -0.0761 -0.0343 1817 PRO A O   
1214 C  CB  . PRO A 138 ? 0.1961 0.1598 0.3468 0.0008  -0.0466 0.0131  1817 PRO A CB  
1215 C  CG  . PRO A 138 ? 0.1885 0.1568 0.3235 0.0299  -0.0490 -0.0142 1817 PRO A CG  
1216 C  CD  . PRO A 138 ? 0.1974 0.1329 0.3061 0.0299  -0.0493 0.0150  1817 PRO A CD  
1217 N  N   . ALA A 139 ? 0.1714 0.1563 0.3147 -0.0244 -0.0364 0.0022  1818 ALA A N   
1218 C  CA  . ALA A 139 ? 0.1776 0.1681 0.3510 -0.0502 -0.0284 -0.0076 1818 ALA A CA  
1219 C  C   . ALA A 139 ? 0.1592 0.2019 0.3426 -0.0272 -0.0356 -0.0193 1818 ALA A C   
1220 O  O   . ALA A 139 ? 0.1763 0.2158 0.4607 -0.0878 -0.0592 0.0009  1818 ALA A O   
1221 C  CB  . ALA A 139 ? 0.2888 0.2236 0.3764 -0.0567 -0.0432 -0.0106 1818 ALA A CB  
1222 N  N   . ASP A 140 ? 0.1450 0.1561 0.2859 -0.0447 -0.0650 0.0091  1819 ASP A N   
1223 C  CA  . ASP A 140 ? 0.1397 0.1770 0.2857 -0.0131 -0.0395 -0.0164 1819 ASP A CA  
1224 C  C   . ASP A 140 ? 0.1154 0.1531 0.2443 -0.0165 -0.0613 -0.0139 1819 ASP A C   
1225 O  O   . ASP A 140 ? 0.1446 0.1532 0.2397 -0.0136 -0.0452 -0.0404 1819 ASP A O   
1226 C  CB  . ASP A 140 ? 0.1203 0.2119 0.2643 -0.0424 -0.0629 -0.0235 1819 ASP A CB  
1227 C  CG  . ASP A 140 ? 0.1419 0.2401 0.2376 -0.0041 -0.0831 0.0020  1819 ASP A CG  
1228 O  OD1 . ASP A 140 ? 0.1276 0.1845 0.2573 -0.0274 -0.0399 -0.0351 1819 ASP A OD1 
1229 O  OD2 . ASP A 140 ? 0.1427 0.2582 0.3191 -0.0576 -0.0605 0.0373  1819 ASP A OD2 
1230 N  N   . GLN A 141 ? 0.1476 0.1578 0.2213 -0.0247 -0.0686 -0.0271 1820 GLN A N   
1231 C  CA  . GLN A 141 ? 0.1160 0.1856 0.2171 -0.0013 -0.0830 -0.0106 1820 GLN A CA  
1232 C  C   . GLN A 141 ? 0.1443 0.1545 0.2036 -0.0086 -0.0685 -0.0233 1820 GLN A C   
1233 O  O   . GLN A 141 ? 0.1815 0.1822 0.2378 0.0203  -0.0667 -0.0158 1820 GLN A O   
1234 C  CB  . GLN A 141 ? 0.1379 0.2296 0.2744 0.0023  -0.0844 -0.0174 1820 GLN A CB  
1235 C  CG  . GLN A 141 ? 0.1971 0.3157 0.2671 0.0294  -0.1086 -0.0477 1820 GLN A CG  
1236 C  CD  . GLN A 141 ? 0.3289 0.4171 0.3915 0.0563  -0.0745 -0.0047 1820 GLN A CD  
1237 O  OE1 . GLN A 141 ? 0.3483 0.5004 0.4246 0.0551  -0.0969 -0.0296 1820 GLN A OE1 
1238 N  NE2 . GLN A 141 ? 0.3524 0.4451 0.3813 -0.0142 -0.0879 -0.0404 1820 GLN A NE2 
1239 N  N   . ASP A 142 ? 0.0915 0.1208 0.1999 0.0040  -0.0429 -0.0314 1821 ASP A N   
1240 C  CA  . ASP A 142 ? 0.0807 0.1420 0.2220 0.0013  -0.0461 -0.0357 1821 ASP A CA  
1241 C  C   . ASP A 142 ? 0.0805 0.1089 0.2032 -0.0087 -0.0473 -0.0083 1821 ASP A C   
1242 O  O   . ASP A 142 ? 0.0800 0.1149 0.2309 -0.0114 -0.0372 -0.0100 1821 ASP A O   
1243 C  CB  . ASP A 142 ? 0.0807 0.1493 0.2264 0.0001  -0.0447 -0.0486 1821 ASP A CB  
1244 C  CG  . ASP A 142 ? 0.0914 0.1857 0.1785 -0.0071 -0.0249 -0.0095 1821 ASP A CG  
1245 O  OD1 . ASP A 142 ? 0.1280 0.1924 0.2573 0.0169  -0.0373 -0.0267 1821 ASP A OD1 
1246 O  OD2 . ASP A 142 ? 0.1052 0.2303 0.2465 0.0138  0.0085  -0.0576 1821 ASP A OD2 
1247 N  N   . SER A 143 ? 0.0748 0.1041 0.2131 -0.0138 -0.0306 -0.0086 1822 SER A N   
1248 C  CA  . SER A 143 ? 0.0730 0.1392 0.2108 -0.0047 -0.0375 0.0031  1822 SER A CA  
1249 C  C   . SER A 143 ? 0.1149 0.1321 0.1640 -0.0145 -0.0286 -0.0195 1822 SER A C   
1250 O  O   . SER A 143 ? 0.0828 0.1585 0.1878 -0.0108 -0.0430 -0.0198 1822 SER A O   
1251 C  CB  . SER A 143 ? 0.1000 0.1022 0.2101 -0.0238 -0.0243 -0.0169 1822 SER A CB  
1252 O  OG  . SER A 143 ? 0.1194 0.1424 0.1817 -0.0358 -0.0460 -0.0176 1822 SER A OG  
1253 N  N   . LEU A 144 ? 0.1216 0.1093 0.1658 -0.0137 -0.0549 0.0085  1823 LEU A N   
1254 C  CA  . LEU A 144 ? 0.1202 0.1282 0.1813 -0.0086 -0.0386 0.0045  1823 LEU A CA  
1255 C  C   . LEU A 144 ? 0.1285 0.1274 0.1285 -0.0004 -0.0258 -0.0035 1823 LEU A C   
1256 O  O   . LEU A 144 ? 0.1135 0.1336 0.1927 0.0281  -0.0483 -0.0263 1823 LEU A O   
1257 C  CB  . LEU A 144 ? 0.1130 0.1381 0.2301 -0.0117 -0.0397 0.0244  1823 LEU A CB  
1258 C  CG  . LEU A 144 ? 0.1271 0.1813 0.3004 -0.0236 -0.0405 0.0247  1823 LEU A CG  
1259 C  CD1 . LEU A 144 ? 0.1893 0.2480 0.2825 -0.0760 -0.0430 0.0902  1823 LEU A CD1 
1260 C  CD2 . LEU A 144 ? 0.1144 0.2918 0.2188 -0.0269 -0.0096 0.0112  1823 LEU A CD2 
1261 N  N   . TYR A 145 ? 0.1051 0.0969 0.1818 -0.0008 -0.0708 0.0017  1824 TYR A N   
1262 C  CA  . TYR A 145 ? 0.1141 0.0697 0.2245 -0.0061 -0.0448 -0.0073 1824 TYR A CA  
1263 C  C   . TYR A 145 ? 0.1300 0.1202 0.1987 -0.0177 -0.0708 -0.0120 1824 TYR A C   
1264 O  O   . TYR A 145 ? 0.1461 0.1015 0.2496 -0.0004 -0.0552 0.0336  1824 TYR A O   
1265 C  CB  . TYR A 145 ? 0.1130 0.1046 0.2008 -0.0291 -0.0724 0.0088  1824 TYR A CB  
1266 C  CG  . TYR A 145 ? 0.1339 0.0946 0.1566 -0.0048 -0.0416 0.0263  1824 TYR A CG  
1267 C  CD1 . TYR A 145 ? 0.1567 0.1370 0.1661 -0.0035 -0.0157 -0.0378 1824 TYR A CD1 
1268 C  CD2 . TYR A 145 ? 0.0839 0.0929 0.2751 -0.0199 -0.0264 -0.0226 1824 TYR A CD2 
1269 C  CE1 . TYR A 145 ? 0.1221 0.1270 0.1907 -0.0236 -0.0133 -0.0096 1824 TYR A CE1 
1270 C  CE2 . TYR A 145 ? 0.1029 0.1188 0.2499 -0.0313 -0.0162 0.0035  1824 TYR A CE2 
1271 C  CZ  . TYR A 145 ? 0.0902 0.1264 0.2049 -0.0182 -0.0201 0.0264  1824 TYR A CZ  
1272 O  OH  . TYR A 145 ? 0.1413 0.1263 0.2319 -0.0397 -0.0104 0.0263  1824 TYR A OH  
1273 N  N   . TYR A 146 ? 0.1295 0.0959 0.2383 -0.0029 -0.0625 -0.0200 1825 TYR A N   
1274 C  CA  . TYR A 146 ? 0.1300 0.0988 0.2525 0.0045  -0.0652 -0.0243 1825 TYR A CA  
1275 C  C   . TYR A 146 ? 0.1362 0.1130 0.2276 0.0195  -0.0448 -0.0058 1825 TYR A C   
1276 O  O   . TYR A 146 ? 0.1589 0.1388 0.2494 -0.0046 -0.0326 -0.0232 1825 TYR A O   
1277 C  CB  . TYR A 146 ? 0.1270 0.1172 0.2679 0.0148  -0.0695 -0.0082 1825 TYR A CB  
1278 C  CG  . TYR A 146 ? 0.1217 0.1158 0.2450 0.0010  -0.0667 -0.0279 1825 TYR A CG  
1279 C  CD1 . TYR A 146 ? 0.1483 0.1274 0.2600 -0.0319 -0.0344 -0.0185 1825 TYR A CD1 
1280 C  CD2 . TYR A 146 ? 0.1335 0.1301 0.2901 -0.0129 -0.0900 -0.0082 1825 TYR A CD2 
1281 C  CE1 . TYR A 146 ? 0.1533 0.2037 0.2767 -0.0197 -0.0804 -0.0090 1825 TYR A CE1 
1282 C  CE2 . TYR A 146 ? 0.1357 0.1685 0.2956 -0.0541 -0.0752 0.0132  1825 TYR A CE2 
1283 C  CZ  . TYR A 146 ? 0.0940 0.1453 0.2284 -0.0353 -0.0575 -0.0081 1825 TYR A CZ  
1284 O  OH  . TYR A 146 ? 0.1286 0.2035 0.3178 -0.0324 -0.0776 -0.0153 1825 TYR A OH  
1285 N  N   . GLY A 147 ? 0.1427 0.1440 0.2558 -0.0224 -0.0822 0.0289  1826 GLY A N   
1286 C  CA  . GLY A 147 ? 0.1210 0.1571 0.2706 -0.0062 -0.0319 0.0182  1826 GLY A CA  
1287 C  C   . GLY A 147 ? 0.1293 0.1322 0.2214 0.0193  -0.0592 0.0161  1826 GLY A C   
1288 O  O   . GLY A 147 ? 0.1882 0.1590 0.3018 0.0197  -0.0485 -0.0152 1826 GLY A O   
1289 N  N   . ASP A 148 ? 0.1238 0.1613 0.2714 0.0025  -0.0631 -0.0042 1827 ASP A N   
1290 C  CA  . ASP A 148 ? 0.1490 0.1537 0.2770 0.0234  -0.0292 -0.0016 1827 ASP A CA  
1291 C  C   . ASP A 148 ? 0.1985 0.1491 0.3019 -0.0126 -0.0277 0.0039  1827 ASP A C   
1292 O  O   . ASP A 148 ? 0.2613 0.2543 0.3098 -0.0668 -0.0782 0.0560  1827 ASP A O   
1293 C  CB  . ASP A 148 ? 0.1582 0.1986 0.2844 0.0026  -0.0181 -0.0134 1827 ASP A CB  
1294 C  CG  . ASP A 148 ? 0.2212 0.2554 0.3588 0.0422  -0.0383 -0.0455 1827 ASP A CG  
1295 O  OD1 . ASP A 148 ? 0.2215 0.4156 0.3697 0.1322  -0.0940 -0.0471 1827 ASP A OD1 
1296 O  OD2 . ASP A 148 ? 0.2565 0.3871 0.5273 0.1041  -0.0516 -0.0263 1827 ASP A OD2 
1297 N  N   . LEU A 149 ? 0.1213 0.1605 0.2228 0.0072  -0.0393 -0.0395 1828 LEU A N   
1298 C  CA  . LEU A 149 ? 0.1549 0.1570 0.2337 0.0161  -0.0297 -0.0116 1828 LEU A CA  
1299 C  C   . LEU A 149 ? 0.1263 0.1421 0.1936 -0.0086 -0.0408 -0.0129 1828 LEU A C   
1300 O  O   . LEU A 149 ? 0.1420 0.1290 0.2075 0.0219  -0.0289 0.0019  1828 LEU A O   
1301 C  CB  . LEU A 149 ? 0.1637 0.2245 0.2614 0.0414  -0.0200 -0.0678 1828 LEU A CB  
1302 C  CG  . LEU A 149 ? 0.2608 0.1967 0.3274 0.0126  0.0069  -0.0279 1828 LEU A CG  
1303 C  CD1 . LEU A 149 ? 0.4019 0.1926 0.3666 0.0006  0.0312  -0.0742 1828 LEU A CD1 
1304 C  CD2 . LEU A 149 ? 0.3520 0.2560 0.3726 0.0063  0.0681  0.0232  1828 LEU A CD2 
1305 N  N   . ILE A 150 ? 0.1297 0.1121 0.2079 -0.0002 -0.0377 -0.0156 1829 ILE A N   
1306 C  CA  A ILE A 150 ? 0.1309 0.1448 0.2073 0.0161  -0.0379 -0.0260 1829 ILE A CA  
1307 C  CA  B ILE A 150 ? 0.1028 0.1507 0.1897 0.0227  -0.0413 -0.0187 1829 ILE A CA  
1308 C  C   . ILE A 150 ? 0.1536 0.1684 0.2031 0.0246  -0.0313 -0.0164 1829 ILE A C   
1309 O  O   . ILE A 150 ? 0.1614 0.1656 0.2533 -0.0081 -0.0262 -0.0267 1829 ILE A O   
1310 C  CB  A ILE A 150 ? 0.1963 0.1984 0.2482 0.0250  -0.0032 -0.0318 1829 ILE A CB  
1311 C  CB  B ILE A 150 ? 0.1213 0.1994 0.2235 0.0275  -0.0050 -0.0296 1829 ILE A CB  
1312 C  CG1 A ILE A 150 ? 0.1931 0.1627 0.2042 0.0307  -0.0195 -0.0480 1829 ILE A CG1 
1313 C  CG1 B ILE A 150 ? 0.1126 0.1637 0.1978 0.0685  0.0085  0.0198  1829 ILE A CG1 
1314 C  CG2 A ILE A 150 ? 0.2054 0.1344 0.3184 0.0185  0.0100  -0.0132 1829 ILE A CG2 
1315 C  CG2 B ILE A 150 ? 0.1504 0.2162 0.1892 -0.0016 -0.0339 -0.0372 1829 ILE A CG2 
1316 C  CD1 A ILE A 150 ? 0.2133 0.1061 0.3070 -0.0286 -0.0098 -0.0715 1829 ILE A CD1 
1317 C  CD1 B ILE A 150 ? 0.1054 0.1892 0.1971 -0.0202 -0.0361 -0.0541 1829 ILE A CD1 
1318 N  N   . LEU A 151 ? 0.1258 0.1728 0.1893 0.0198  -0.0619 -0.0233 1830 LEU A N   
1319 C  CA  A LEU A 151 ? 0.1528 0.1621 0.2169 0.0081  -0.0495 -0.0288 1830 LEU A CA  
1320 C  CA  B LEU A 151 ? 0.1514 0.1656 0.2148 0.0057  -0.0483 -0.0222 1830 LEU A CA  
1321 C  C   . LEU A 151 ? 0.1638 0.1653 0.2088 0.0067  -0.0391 -0.0206 1830 LEU A C   
1322 O  O   . LEU A 151 ? 0.1280 0.1717 0.1982 0.0011  -0.0552 -0.0351 1830 LEU A O   
1323 C  CB  A LEU A 151 ? 0.1719 0.1517 0.2495 0.0033  -0.0555 -0.0337 1830 LEU A CB  
1324 C  CB  B LEU A 151 ? 0.1431 0.1504 0.2402 -0.0059 -0.0544 -0.0194 1830 LEU A CB  
1325 C  CG  A LEU A 151 ? 0.2430 0.1884 0.2599 -0.0072 -0.0211 -0.0264 1830 LEU A CG  
1326 C  CG  B LEU A 151 ? 0.2670 0.2037 0.2245 -0.0263 -0.0201 0.0060  1830 LEU A CG  
1327 C  CD1 A LEU A 151 ? 0.2178 0.1165 0.1902 -0.0199 0.0050  -0.0473 1830 LEU A CD1 
1328 C  CD1 B LEU A 151 ? 0.2820 0.2155 0.2104 -0.0280 0.0137  -0.0118 1830 LEU A CD1 
1329 C  CD2 A LEU A 151 ? 0.2088 0.1986 0.2139 -0.0161 -0.0003 -0.0256 1830 LEU A CD2 
1330 C  CD2 B LEU A 151 ? 0.2448 0.1304 0.2378 -0.0348 -0.0149 -0.0054 1830 LEU A CD2 
1331 N  N   . GLN A 152 ? 0.1506 0.1497 0.2381 0.0200  -0.0629 -0.0303 1831 GLN A N   
1332 C  CA  . GLN A 152 ? 0.1694 0.1480 0.2696 0.0101  -0.0707 -0.0269 1831 GLN A CA  
1333 C  C   . GLN A 152 ? 0.1544 0.1497 0.2176 0.0283  -0.0732 -0.0178 1831 GLN A C   
1334 O  O   . GLN A 152 ? 0.1964 0.2222 0.2294 -0.0213 -0.0599 -0.0600 1831 GLN A O   
1335 C  CB  . GLN A 152 ? 0.2462 0.1508 0.4017 0.0205  -0.0597 -0.0429 1831 GLN A CB  
1336 C  CG  . GLN A 152 ? 0.4235 0.3055 0.3775 0.0419  0.0018  0.0022  1831 GLN A CG  
1337 C  CD  . GLN A 152 ? 0.4136 0.2536 0.4808 0.0184  -0.0181 0.0419  1831 GLN A CD  
1338 O  OE1 . GLN A 152 ? 0.4748 0.3323 0.4503 -0.0946 -0.0615 0.0381  1831 GLN A OE1 
1339 N  NE2 . GLN A 152 ? 0.4664 0.3923 0.4665 -0.0282 -0.0785 -0.0045 1831 GLN A NE2 
1340 N  N   . MET A 153 ? 0.1628 0.1325 0.2199 0.0165  -0.0470 -0.0194 1832 MET A N   
1341 C  CA  . MET A 153 ? 0.1485 0.1669 0.2222 0.0500  -0.0752 -0.0104 1832 MET A CA  
1342 C  C   . MET A 153 ? 0.1782 0.1642 0.2306 0.0511  -0.0657 -0.0201 1832 MET A C   
1343 O  O   . MET A 153 ? 0.2379 0.2140 0.2455 0.1124  -0.0762 -0.0449 1832 MET A O   
1344 C  CB  . MET A 153 ? 0.1436 0.1378 0.2287 0.0226  -0.0927 -0.0375 1832 MET A CB  
1345 C  CG  . MET A 153 ? 0.1658 0.1760 0.2755 0.0043  -0.0645 -0.0579 1832 MET A CG  
1346 S  SD  . MET A 153 ? 0.1909 0.1766 0.3384 0.0061  -0.0878 -0.0601 1832 MET A SD  
1347 C  CE  . MET A 153 ? 0.2571 0.2258 0.3188 0.0015  -0.0478 -0.0089 1832 MET A CE  
1348 N  N   . LEU A 154 ? 0.2060 0.1335 0.2412 0.0543  -0.0975 -0.0117 1833 LEU A N   
1349 C  CA  . LEU A 154 ? 0.1726 0.1377 0.2699 0.0452  -0.1052 -0.0080 1833 LEU A CA  
1350 C  C   . LEU A 154 ? 0.2058 0.1380 0.3172 0.0359  -0.0887 -0.0351 1833 LEU A C   
1351 O  O   . LEU A 154 ? 0.2182 0.1629 0.4263 0.0735  -0.1080 -0.0273 1833 LEU A O   
1352 C  CB  . LEU A 154 ? 0.2380 0.1851 0.2575 0.0591  -0.0960 -0.0034 1833 LEU A CB  
1353 C  CG  . LEU A 154 ? 0.3010 0.1910 0.2833 0.0173  -0.0378 -0.0036 1833 LEU A CG  
1354 C  CD1 . LEU A 154 ? 0.3573 0.3376 0.2888 0.0205  -0.0358 -0.0131 1833 LEU A CD1 
1355 C  CD2 . LEU A 154 ? 0.3486 0.2276 0.3169 0.0074  -0.0973 -0.0580 1833 LEU A CD2 
1356 N  N   . SER A 155 ? 0.1865 0.1332 0.3271 0.0318  -0.0917 -0.0400 1834 SER A N   
1357 C  CA  . SER A 155 ? 0.1951 0.1557 0.2720 0.0394  -0.0987 -0.0390 1834 SER A CA  
1358 C  C   . SER A 155 ? 0.2017 0.1207 0.2908 0.0328  -0.0888 -0.0417 1834 SER A C   
1359 O  O   . SER A 155 ? 0.1545 0.1584 0.2930 0.0611  -0.0839 -0.0485 1834 SER A O   
1360 C  CB  . SER A 155 ? 0.2465 0.1871 0.2974 0.0481  -0.1008 -0.0120 1834 SER A CB  
1361 O  OG  . SER A 155 ? 0.2829 0.2388 0.2616 0.0296  -0.1136 -0.0319 1834 SER A OG  
1362 N  N   . GLU A 156 ? 0.1973 0.1420 0.3382 0.0510  -0.0713 -0.0611 1835 GLU A N   
1363 C  CA  . GLU A 156 ? 0.1847 0.1661 0.3285 0.0278  -0.0780 -0.0421 1835 GLU A CA  
1364 C  C   . GLU A 156 ? 0.1489 0.1826 0.3196 0.0681  -0.0824 -0.0523 1835 GLU A C   
1365 O  O   . GLU A 156 ? 0.1885 0.2051 0.4231 0.0867  -0.0461 -0.0612 1835 GLU A O   
1366 C  CB  . GLU A 156 ? 0.2015 0.2119 0.3577 0.0546  -0.0486 -0.0405 1835 GLU A CB  
1367 C  CG  . GLU A 156 ? 0.2228 0.2612 0.3519 0.0731  -0.0171 -0.0064 1835 GLU A CG  
1368 C  CD  . GLU A 156 ? 0.2823 0.3142 0.3543 0.0597  0.0084  -0.0021 1835 GLU A CD  
1369 O  OE1 . GLU A 156 ? 0.2919 0.3763 0.5024 0.0806  0.0064  -0.0340 1835 GLU A OE1 
1370 O  OE2 . GLU A 156 ? 0.2423 0.3047 0.4661 0.0687  -0.0310 -0.0154 1835 GLU A OE2 
1371 N  N   . SER A 157 ? 0.1736 0.1941 0.3580 0.0597  -0.0963 -0.0504 1836 SER A N   
1372 C  CA  A SER A 157 ? 0.1823 0.1812 0.3236 0.0541  -0.0680 -0.0339 1836 SER A CA  
1373 C  CA  B SER A 157 ? 0.1764 0.1832 0.3269 0.0543  -0.0652 -0.0399 1836 SER A CA  
1374 C  C   . SER A 157 ? 0.2002 0.1940 0.3221 0.0488  -0.0611 -0.0244 1836 SER A C   
1375 O  O   . SER A 157 ? 0.1495 0.2008 0.3064 0.0870  -0.0804 -0.0564 1836 SER A O   
1376 C  CB  A SER A 157 ? 0.2075 0.2010 0.3438 0.0283  -0.0799 -0.0195 1836 SER A CB  
1377 C  CB  B SER A 157 ? 0.1944 0.2070 0.3444 0.0373  -0.0798 -0.0249 1836 SER A CB  
1378 O  OG  A SER A 157 ? 0.2708 0.1767 0.2962 0.0405  -0.1007 0.0247  1836 SER A OG  
1379 O  OG  B SER A 157 ? 0.2464 0.1913 0.3537 0.0328  -0.0589 -0.0405 1836 SER A OG  
1380 N  N   . VAL A 158 ? 0.1948 0.2311 0.3414 0.0758  -0.0432 -0.0431 1837 VAL A N   
1381 C  CA  . VAL A 158 ? 0.1707 0.2727 0.3546 0.0699  -0.0349 -0.0243 1837 VAL A CA  
1382 C  C   . VAL A 158 ? 0.1629 0.2412 0.3497 0.0855  -0.0442 -0.0335 1837 VAL A C   
1383 O  O   . VAL A 158 ? 0.1678 0.2716 0.4539 0.1145  -0.0279 -0.0545 1837 VAL A O   
1384 C  CB  . VAL A 158 ? 0.2161 0.2716 0.3556 0.0642  -0.0166 -0.0251 1837 VAL A CB  
1385 C  CG1 . VAL A 158 ? 0.2294 0.3166 0.4018 0.0693  -0.0178 -0.0009 1837 VAL A CG1 
1386 C  CG2 . VAL A 158 ? 0.2615 0.2967 0.4111 0.0657  -0.0113 -0.0502 1837 VAL A CG2 
1387 N  N   . LEU A 159 ? 0.1145 0.2135 0.3398 0.0530  -0.0656 -0.0236 1838 LEU A N   
1388 C  CA  . LEU A 159 ? 0.0947 0.1868 0.2705 0.0687  -0.0737 0.0279  1838 LEU A CA  
1389 C  C   . LEU A 159 ? 0.0949 0.2060 0.2390 0.0444  -0.0264 0.0180  1838 LEU A C   
1390 O  O   . LEU A 159 ? 0.1107 0.2396 0.2153 0.0489  -0.0514 -0.0097 1838 LEU A O   
1391 C  CB  . LEU A 159 ? 0.1685 0.1591 0.2813 0.0253  -0.0440 0.0582  1838 LEU A CB  
1392 C  CG  . LEU A 159 ? 0.2690 0.2439 0.3333 0.0500  -0.0207 0.0507  1838 LEU A CG  
1393 C  CD1 . LEU A 159 ? 0.2973 0.3022 0.3338 0.0831  0.0140  0.0572  1838 LEU A CD1 
1394 C  CD2 . LEU A 159 ? 0.3251 0.2911 0.3716 0.0748  -0.0153 0.1127  1838 LEU A CD2 
1395 N  N   . PRO A 160 ? 0.0785 0.1752 0.2384 0.0445  -0.0372 0.0532  1839 PRO A N   
1396 C  CA  . PRO A 160 ? 0.0924 0.1802 0.2476 0.0345  -0.0238 0.0330  1839 PRO A CA  
1397 C  C   . PRO A 160 ? 0.0809 0.2122 0.2224 0.0338  -0.0019 0.0317  1839 PRO A C   
1398 O  O   . PRO A 160 ? 0.1057 0.2842 0.3096 0.0820  0.0409  0.0716  1839 PRO A O   
1399 C  CB  . PRO A 160 ? 0.0961 0.1933 0.2828 0.0277  -0.0419 0.0085  1839 PRO A CB  
1400 C  CG  . PRO A 160 ? 0.1042 0.1808 0.3025 -0.0013 -0.0119 0.0134  1839 PRO A CG  
1401 C  CD  . PRO A 160 ? 0.0562 0.2016 0.2246 0.0139  -0.0347 0.0363  1839 PRO A CD  
1402 N  N   . GLU A 161 ? 0.0644 0.1749 0.2006 0.0241  -0.0086 0.0328  1840 GLU A N   
1403 C  CA  . GLU A 161 ? 0.0690 0.1674 0.2140 0.0063  -0.0268 0.0259  1840 GLU A CA  
1404 C  C   . GLU A 161 ? 0.0883 0.1431 0.1904 0.0158  -0.0078 0.0139  1840 GLU A C   
1405 O  O   . GLU A 161 ? 0.0830 0.1412 0.2012 0.0313  -0.0315 0.0279  1840 GLU A O   
1406 C  CB  . GLU A 161 ? 0.0565 0.1626 0.2605 0.0201  -0.0295 0.0107  1840 GLU A CB  
1407 C  CG  . GLU A 161 ? 0.0338 0.2349 0.2652 -0.0407 -0.0154 0.0183  1840 GLU A CG  
1408 C  CD  . GLU A 161 ? 0.1847 0.2644 0.3312 -0.0481 -0.0321 0.0057  1840 GLU A CD  
1409 O  OE1 . GLU A 161 ? 0.2575 0.4192 0.3094 -0.0921 -0.0788 0.0439  1840 GLU A OE1 
1410 O  OE2 . GLU A 161 ? 0.3075 0.2760 0.3429 -0.0818 0.0024  -0.0030 1840 GLU A OE2 
1411 N  N   . TRP A 162 ? 0.0589 0.1474 0.1764 0.0183  -0.0333 0.0064  1841 TRP A N   
1412 C  CA  . TRP A 162 ? 0.0675 0.1303 0.1586 -0.0079 0.0008  -0.0061 1841 TRP A CA  
1413 C  C   . TRP A 162 ? 0.0825 0.1209 0.1725 0.0379  -0.0291 0.0085  1841 TRP A C   
1414 O  O   . TRP A 162 ? 0.0961 0.1369 0.2230 0.0572  -0.0554 0.0044  1841 TRP A O   
1415 C  CB  . TRP A 162 ? 0.1193 0.1156 0.1530 0.0162  -0.0005 0.0026  1841 TRP A CB  
1416 C  CG  . TRP A 162 ? 0.1156 0.1357 0.1741 -0.0114 -0.0232 0.0206  1841 TRP A CG  
1417 C  CD1 . TRP A 162 ? 0.1182 0.1748 0.2108 0.0157  -0.0287 0.0055  1841 TRP A CD1 
1418 C  CD2 . TRP A 162 ? 0.0836 0.1990 0.1862 0.0202  -0.0367 -0.0163 1841 TRP A CD2 
1419 N  NE1 . TRP A 162 ? 0.1663 0.1861 0.2020 -0.0110 -0.0529 0.0350  1841 TRP A NE1 
1420 C  CE2 . TRP A 162 ? 0.0883 0.2232 0.2319 0.0019  -0.0479 -0.0166 1841 TRP A CE2 
1421 C  CE3 . TRP A 162 ? 0.0724 0.1665 0.2394 0.0265  -0.0224 -0.0471 1841 TRP A CE3 
1422 C  CZ2 . TRP A 162 ? 0.1612 0.2507 0.1829 0.0082  -0.0097 0.0146  1841 TRP A CZ2 
1423 C  CZ3 . TRP A 162 ? 0.0591 0.2233 0.1982 0.0325  -0.0131 -0.0106 1841 TRP A CZ3 
1424 C  CH2 . TRP A 162 ? 0.0918 0.2261 0.2140 0.0187  -0.0227 -0.0304 1841 TRP A CH2 
1425 N  N   . THR A 163 ? 0.1047 0.1247 0.1915 0.0256  -0.0357 -0.0062 1842 THR A N   
1426 C  CA  . THR A 163 ? 0.1358 0.1390 0.2142 0.0626  -0.0366 -0.0119 1842 THR A CA  
1427 C  C   . THR A 163 ? 0.1520 0.0997 0.1971 0.0453  -0.0512 -0.0044 1842 THR A C   
1428 O  O   . THR A 163 ? 0.1121 0.1209 0.2680 0.0668  -0.0868 0.0036  1842 THR A O   
1429 C  CB  . THR A 163 ? 0.1734 0.1558 0.2106 0.0446  -0.0366 -0.0400 1842 THR A CB  
1430 O  OG1 . THR A 163 ? 0.1631 0.2091 0.2496 0.0453  -0.0068 -0.0504 1842 THR A OG1 
1431 C  CG2 . THR A 163 ? 0.2071 0.1754 0.1945 0.0223  -0.0626 -0.0197 1842 THR A CG2 
1432 N  N   . ILE A 164 ? 0.1577 0.1155 0.1969 0.0462  -0.0629 -0.0254 1843 ILE A N   
1433 C  CA  . ILE A 164 ? 0.1756 0.1129 0.1929 0.0493  -0.0538 -0.0214 1843 ILE A CA  
1434 C  C   . ILE A 164 ? 0.1528 0.1221 0.1964 0.0405  -0.0721 -0.0353 1843 ILE A C   
1435 O  O   . ILE A 164 ? 0.1572 0.1367 0.2879 0.0643  -0.0910 -0.0534 1843 ILE A O   
1436 C  CB  . ILE A 164 ? 0.1839 0.1691 0.2003 0.0100  -0.0397 -0.0166 1843 ILE A CB  
1437 C  CG1 . ILE A 164 ? 0.2587 0.2075 0.1705 0.0240  -0.0115 -0.0173 1843 ILE A CG1 
1438 C  CG2 . ILE A 164 ? 0.1535 0.2108 0.2321 0.0122  -0.0629 0.0327  1843 ILE A CG2 
1439 C  CD1 . ILE A 164 ? 0.2900 0.2823 0.2025 0.0179  -0.0394 -0.0268 1843 ILE A CD1 
1440 N  N   . ARG A 165 ? 0.1559 0.1252 0.2123 0.0412  -0.0877 -0.0283 1844 ARG A N   
1441 C  CA  . ARG A 165 ? 0.1784 0.1148 0.2150 0.0303  -0.0775 -0.0439 1844 ARG A CA  
1442 C  C   . ARG A 165 ? 0.1789 0.1296 0.2256 0.0463  -0.0716 -0.0218 1844 ARG A C   
1443 O  O   . ARG A 165 ? 0.1643 0.1195 0.2980 0.0276  -0.0565 -0.0264 1844 ARG A O   
1444 C  CB  . ARG A 165 ? 0.2042 0.1253 0.2006 0.0599  -0.0419 -0.0309 1844 ARG A CB  
1445 C  CG  . ARG A 165 ? 0.2366 0.1966 0.1710 0.0235  -0.0570 0.0041  1844 ARG A CG  
1446 C  CD  . ARG A 165 ? 0.2179 0.2225 0.1628 0.0070  -0.0607 -0.0235 1844 ARG A CD  
1447 N  NE  . ARG A 165 ? 0.2082 0.2725 0.2569 0.0416  -0.0817 0.0097  1844 ARG A NE  
1448 C  CZ  . ARG A 165 ? 0.1524 0.2715 0.1792 0.0138  -0.0446 0.0136  1844 ARG A CZ  
1449 N  NH1 . ARG A 165 ? 0.2230 0.2166 0.2739 0.0262  -0.0667 -0.0186 1844 ARG A NH1 
1450 N  NH2 . ARG A 165 ? 0.1989 0.3636 0.2664 0.0248  -0.0640 0.0528  1844 ARG A NH2 
1451 N  N   . GLU A 166 ? 0.1696 0.1008 0.2344 0.0442  -0.0735 -0.0149 1845 GLU A N   
1452 C  CA  . GLU A 166 ? 0.2000 0.1184 0.2168 0.0165  -0.0803 -0.0036 1845 GLU A CA  
1453 C  C   . GLU A 166 ? 0.2016 0.1385 0.2191 0.0199  -0.0704 -0.0391 1845 GLU A C   
1454 O  O   . GLU A 166 ? 0.2242 0.1582 0.2124 0.0319  -0.0807 -0.0500 1845 GLU A O   
1455 C  CB  . GLU A 166 ? 0.2223 0.1537 0.2617 0.0345  -0.0660 0.0059  1845 GLU A CB  
1456 C  CG  . GLU A 166 ? 0.2765 0.2809 0.3026 -0.0047 -0.0682 0.0272  1845 GLU A CG  
1457 C  CD  . GLU A 166 ? 0.3253 0.3432 0.3739 -0.0274 0.0002  0.0428  1845 GLU A CD  
1458 O  OE1 . GLU A 166 ? 0.3740 0.5603 0.5153 0.1206  -0.0691 0.0823  1845 GLU A OE1 
1459 O  OE2 . GLU A 166 ? 0.3986 0.3746 0.4002 -0.0286 -0.0299 0.0652  1845 GLU A OE2 
1460 N  N   . PHE A 167 ? 0.1826 0.1448 0.2193 -0.0041 -0.0684 -0.0159 1846 PHE A N   
1461 C  CA  . PHE A 167 ? 0.1886 0.1284 0.2042 -0.0048 -0.0766 -0.0098 1846 PHE A CA  
1462 C  C   . PHE A 167 ? 0.1897 0.1788 0.2128 -0.0017 -0.0578 -0.0107 1846 PHE A C   
1463 O  O   . PHE A 167 ? 0.2570 0.1471 0.2637 -0.0001 -0.0439 -0.0009 1846 PHE A O   
1464 C  CB  . PHE A 167 ? 0.1955 0.1731 0.2290 -0.0183 -0.0997 0.0171  1846 PHE A CB  
1465 C  CG  . PHE A 167 ? 0.2385 0.1882 0.2111 -0.0175 -0.0595 0.0269  1846 PHE A CG  
1466 C  CD1 . PHE A 167 ? 0.3254 0.2169 0.2326 -0.0720 -0.0075 -0.0082 1846 PHE A CD1 
1467 C  CD2 . PHE A 167 ? 0.2195 0.1813 0.2714 0.0180  -0.0611 0.0641  1846 PHE A CD2 
1468 C  CE1 . PHE A 167 ? 0.3104 0.2168 0.2228 -0.0836 -0.0047 -0.0319 1846 PHE A CE1 
1469 C  CE2 . PHE A 167 ? 0.1920 0.2404 0.2465 0.0275  -0.0474 0.0490  1846 PHE A CE2 
1470 C  CZ  . PHE A 167 ? 0.1170 0.2791 0.2177 -0.0426 -0.0861 -0.0185 1846 PHE A CZ  
1471 N  N   . LYS A 168 ? 0.1756 0.1268 0.2159 0.0075  -0.0768 -0.0128 1847 LYS A N   
1472 C  CA  . LYS A 168 ? 0.1963 0.1775 0.1952 0.0026  -0.0860 0.0057  1847 LYS A CA  
1473 C  C   . LYS A 168 ? 0.2007 0.1504 0.1798 -0.0049 -0.0622 0.0084  1847 LYS A C   
1474 O  O   . LYS A 168 ? 0.1948 0.2334 0.1766 -0.0005 -0.0601 -0.0161 1847 LYS A O   
1475 C  CB  . LYS A 168 ? 0.2644 0.1564 0.2706 0.0315  -0.0619 0.0164  1847 LYS A CB  
1476 C  CG  . LYS A 168 ? 0.3280 0.2536 0.3811 -0.0037 -0.0336 0.0333  1847 LYS A CG  
1477 C  CD  . LYS A 168 ? 0.5152 0.2948 0.4481 0.0081  -0.0337 0.0392  1847 LYS A CD  
1478 C  CE  . LYS A 168 ? 0.5353 0.4609 0.5491 -0.0170 0.0018  0.0193  1847 LYS A CE  
1479 N  NZ  . LYS A 168 ? 0.6694 0.5319 0.6320 0.0131  -0.0129 0.0107  1847 LYS A NZ  
1480 N  N   . ILE A 169 ? 0.1732 0.1510 0.1866 -0.0091 -0.0767 -0.0074 1848 ILE A N   
1481 C  CA  . ILE A 169 ? 0.2071 0.1644 0.2222 -0.0136 -0.0681 0.0031  1848 ILE A CA  
1482 C  C   . ILE A 169 ? 0.2066 0.2022 0.2113 -0.0041 -0.0585 -0.0139 1848 ILE A C   
1483 O  O   . ILE A 169 ? 0.2109 0.1746 0.2346 -0.0117 -0.0260 -0.0025 1848 ILE A O   
1484 C  CB  . ILE A 169 ? 0.2353 0.1996 0.2195 0.0177  -0.0708 -0.0013 1848 ILE A CB  
1485 C  CG1 . ILE A 169 ? 0.2364 0.1959 0.3129 0.0135  -0.0603 0.0370  1848 ILE A CG1 
1486 C  CG2 . ILE A 169 ? 0.2764 0.1818 0.3053 0.0061  -0.0220 0.0268  1848 ILE A CG2 
1487 C  CD1 . ILE A 169 ? 0.4013 0.3168 0.3597 0.0116  -0.0134 0.0302  1848 ILE A CD1 
1488 N  N   . CYS A 170 ? 0.2434 0.2640 0.2539 -0.0188 -0.0463 -0.0253 1849 CYS A N   
1489 C  CA  A CYS A 170 ? 0.2728 0.2860 0.2883 -0.0289 -0.0405 -0.0324 1849 CYS A CA  
1490 C  CA  B CYS A 170 ? 0.2557 0.2505 0.2787 -0.0388 -0.0495 -0.0364 1849 CYS A CA  
1491 C  C   . CYS A 170 ? 0.2428 0.2346 0.2752 -0.0478 -0.0454 -0.0533 1849 CYS A C   
1492 O  O   . CYS A 170 ? 0.1900 0.2135 0.3071 -0.0562 -0.0166 -0.0429 1849 CYS A O   
1493 C  CB  A CYS A 170 ? 0.3148 0.3382 0.3336 -0.0186 -0.0417 -0.0197 1849 CYS A CB  
1494 C  CB  B CYS A 170 ? 0.2948 0.3010 0.2972 -0.0229 -0.0427 -0.0287 1849 CYS A CB  
1495 S  SG  A CYS A 170 ? 0.4509 0.5029 0.4366 0.0382  -0.0365 -0.0336 1849 CYS A SG  
1496 S  SG  B CYS A 170 ? 0.3189 0.2893 0.4357 -0.0439 -0.1275 -0.0466 1849 CYS A SG  
1497 N  N   . GLY A 171 ? 0.2741 0.3082 0.2965 -0.0238 -0.0313 -0.0730 1850 GLY A N   
1498 C  CA  . GLY A 171 ? 0.3379 0.3431 0.3449 -0.0206 -0.0201 -0.0581 1850 GLY A CA  
1499 C  C   . GLY A 171 ? 0.3892 0.3707 0.3808 -0.0216 -0.0054 -0.0415 1850 GLY A C   
1500 O  O   . GLY A 171 ? 0.3444 0.4280 0.3802 -0.0339 -0.0103 0.0028  1850 GLY A O   
1501 N  N   . GLU A 172 ? 0.4339 0.4197 0.4287 0.0027  -0.0029 -0.0506 1851 GLU A N   
1502 C  CA  A GLU A 172 ? 0.4757 0.4487 0.4732 -0.0025 0.0031  -0.0168 1851 GLU A CA  
1503 C  CA  B GLU A 172 ? 0.4659 0.4396 0.4618 -0.0027 0.0000  -0.0176 1851 GLU A CA  
1504 C  C   . GLU A 172 ? 0.5046 0.4559 0.4763 0.0014  -0.0063 -0.0105 1851 GLU A C   
1505 O  O   . GLU A 172 ? 0.5216 0.4569 0.5531 -0.0120 0.0003  -0.0033 1851 GLU A O   
1506 C  CB  A GLU A 172 ? 0.5015 0.4758 0.4870 -0.0017 0.0028  -0.0175 1851 GLU A CB  
1507 C  CB  B GLU A 172 ? 0.4808 0.4583 0.4680 -0.0053 -0.0015 -0.0175 1851 GLU A CB  
1508 C  CG  A GLU A 172 ? 0.5092 0.5225 0.5313 -0.0052 -0.0079 -0.0113 1851 GLU A CG  
1509 C  CG  B GLU A 172 ? 0.4607 0.4601 0.4549 -0.0066 -0.0114 -0.0057 1851 GLU A CG  
1510 C  CD  A GLU A 172 ? 0.5661 0.5759 0.5624 0.0080  0.0038  -0.0049 1851 GLU A CD  
1511 C  CD  B GLU A 172 ? 0.4319 0.4343 0.4743 -0.0061 -0.0133 0.0044  1851 GLU A CD  
1512 O  OE1 A GLU A 172 ? 0.5615 0.5945 0.5644 0.0032  -0.0314 -0.0042 1851 GLU A OE1 
1513 O  OE1 B GLU A 172 ? 0.3053 0.3311 0.3591 0.0365  -0.0435 0.0040  1851 GLU A OE1 
1514 O  OE2 A GLU A 172 ? 0.6203 0.6016 0.5930 0.0167  -0.0062 0.0062  1851 GLU A OE2 
1515 O  OE2 B GLU A 172 ? 0.4678 0.4860 0.4881 -0.0071 -0.0245 0.0061  1851 GLU A OE2 
1516 N  N   . HIS A 178 ? 0.4792 0.3586 0.3867 -0.0555 0.0052  -0.0221 1857 HIS A N   
1517 C  CA  . HIS A 178 ? 0.4197 0.3239 0.3471 -0.0633 -0.0043 -0.0374 1857 HIS A CA  
1518 C  C   . HIS A 178 ? 0.3794 0.3177 0.3149 -0.0439 0.0005  -0.0112 1857 HIS A C   
1519 O  O   . HIS A 178 ? 0.4345 0.3552 0.3285 -0.0714 -0.0060 -0.0097 1857 HIS A O   
1520 C  CB  . HIS A 178 ? 0.4331 0.3773 0.3780 -0.0354 -0.0408 -0.0464 1857 HIS A CB  
1521 C  CG  . HIS A 178 ? 0.5295 0.4088 0.4843 -0.0293 -0.0072 -0.0390 1857 HIS A CG  
1522 N  ND1 . HIS A 178 ? 0.5929 0.5377 0.5600 -0.0200 0.0239  -0.0148 1857 HIS A ND1 
1523 C  CD2 . HIS A 178 ? 0.5413 0.5068 0.5402 -0.0555 -0.0246 -0.0217 1857 HIS A CD2 
1524 C  CE1 . HIS A 178 ? 0.5697 0.5865 0.5700 -0.0276 -0.0133 -0.0228 1857 HIS A CE1 
1525 N  NE2 . HIS A 178 ? 0.5340 0.5458 0.5118 -0.0468 -0.0217 -0.0251 1857 HIS A NE2 
1526 N  N   . ARG A 179 ? 0.2816 0.2105 0.2777 -0.0035 -0.0088 -0.0017 1858 ARG A N   
1527 C  CA  A ARG A 179 ? 0.2402 0.2106 0.2504 -0.0015 -0.0299 -0.0049 1858 ARG A CA  
1528 C  CA  B ARG A 179 ? 0.2339 0.2159 0.2569 0.0050  -0.0322 0.0016  1858 ARG A CA  
1529 C  C   . ARG A 179 ? 0.2421 0.1824 0.2389 0.0144  -0.0248 0.0027  1858 ARG A C   
1530 O  O   . ARG A 179 ? 0.2565 0.2288 0.2355 0.0005  -0.0429 -0.0210 1858 ARG A O   
1531 C  CB  A ARG A 179 ? 0.2628 0.2505 0.2682 0.0227  -0.0116 0.0117  1858 ARG A CB  
1532 C  CB  B ARG A 179 ? 0.2558 0.2530 0.2761 0.0302  -0.0157 0.0199  1858 ARG A CB  
1533 C  CG  A ARG A 179 ? 0.2951 0.2429 0.2328 -0.0021 -0.0074 -0.0241 1858 ARG A CG  
1534 C  CG  B ARG A 179 ? 0.2616 0.3236 0.2983 0.0511  -0.0216 0.0377  1858 ARG A CG  
1535 C  CD  A ARG A 179 ? 0.3134 0.3388 0.2829 0.0518  -0.0221 0.0251  1858 ARG A CD  
1536 C  CD  B ARG A 179 ? 0.3183 0.2551 0.2693 0.0478  -0.0165 0.0095  1858 ARG A CD  
1537 N  NE  A ARG A 179 ? 0.3222 0.3584 0.3178 0.0414  0.0218  0.0076  1858 ARG A NE  
1538 N  NE  B ARG A 179 ? 0.2773 0.1813 0.2569 0.0091  -0.0189 0.0580  1858 ARG A NE  
1539 C  CZ  A ARG A 179 ? 0.3230 0.2602 0.2767 0.0535  0.0022  0.0183  1858 ARG A CZ  
1540 C  CZ  B ARG A 179 ? 0.1690 0.1691 0.2042 -0.0571 -0.0334 -0.0139 1858 ARG A CZ  
1541 N  NH1 A ARG A 179 ? 0.2377 0.2064 0.2326 -0.0455 0.0554  -0.0185 1858 ARG A NH1 
1542 N  NH1 B ARG A 179 ? 0.1496 0.0792 0.1604 -0.0091 0.0041  0.0047  1858 ARG A NH1 
1543 N  NH2 A ARG A 179 ? 0.3646 0.2522 0.3365 0.0290  0.0120  0.0446  1858 ARG A NH2 
1544 N  NH2 B ARG A 179 ? 0.1496 0.0427 0.1384 -0.0403 -0.0678 0.0038  1858 ARG A NH2 
1545 N  N   . LEU A 180 ? 0.2533 0.1626 0.2197 0.0082  -0.0576 -0.0078 1859 LEU A N   
1546 C  CA  A LEU A 180 ? 0.2586 0.1512 0.2057 0.0184  -0.0269 0.0140  1859 LEU A CA  
1547 C  CA  B LEU A 180 ? 0.2391 0.1665 0.2189 0.0102  -0.0319 -0.0040 1859 LEU A CA  
1548 C  C   . LEU A 180 ? 0.2324 0.1572 0.2138 -0.0067 -0.0320 -0.0203 1859 LEU A C   
1549 O  O   . LEU A 180 ? 0.2180 0.2022 0.2815 -0.0035 -0.0147 -0.0375 1859 LEU A O   
1550 C  CB  A LEU A 180 ? 0.2703 0.2094 0.2174 0.0177  -0.0439 -0.0141 1859 LEU A CB  
1551 C  CB  B LEU A 180 ? 0.2367 0.1820 0.2183 0.0124  -0.0383 -0.0152 1859 LEU A CB  
1552 C  CG  A LEU A 180 ? 0.2919 0.2432 0.1777 0.0188  -0.0293 0.0427  1859 LEU A CG  
1553 C  CG  B LEU A 180 ? 0.2086 0.1922 0.1877 0.0166  -0.0437 -0.0152 1859 LEU A CG  
1554 C  CD1 A LEU A 180 ? 0.3060 0.3616 0.1928 -0.0074 -0.0664 0.0062  1859 LEU A CD1 
1555 C  CD1 B LEU A 180 ? 0.2693 0.1968 0.2520 0.0149  -0.0374 -0.0278 1859 LEU A CD1 
1556 C  CD2 A LEU A 180 ? 0.2973 0.1969 0.1918 0.0669  -0.0403 -0.0307 1859 LEU A CD2 
1557 C  CD2 B LEU A 180 ? 0.1583 0.2254 0.2484 -0.0289 -0.0402 -0.0157 1859 LEU A CD2 
1558 N  N   . ILE A 181 ? 0.2121 0.1376 0.2231 -0.0126 -0.0459 -0.0165 1860 ILE A N   
1559 C  CA  . ILE A 181 ? 0.2238 0.1115 0.2654 -0.0110 -0.0461 -0.0013 1860 ILE A CA  
1560 C  C   . ILE A 181 ? 0.1963 0.1106 0.1965 0.0227  -0.0483 -0.0229 1860 ILE A C   
1561 O  O   . ILE A 181 ? 0.1968 0.1589 0.2662 0.0219  -0.0206 -0.0438 1860 ILE A O   
1562 C  CB  . ILE A 181 ? 0.2002 0.0937 0.2965 -0.0134 -0.0837 0.0205  1860 ILE A CB  
1563 C  CG1 . ILE A 181 ? 0.3239 0.2067 0.3773 -0.0597 -0.0353 -0.0145 1860 ILE A CG1 
1564 C  CG2 . ILE A 181 ? 0.3316 0.1572 0.2917 0.0276  -0.0727 0.0397  1860 ILE A CG2 
1565 C  CD1 . ILE A 181 ? 0.3719 0.3615 0.4180 -0.0076 -0.0106 0.0048  1860 ILE A CD1 
1566 N  N   . ARG A 182 ? 0.1534 0.1030 0.1693 0.0209  -0.0360 -0.0025 1861 ARG A N   
1567 C  CA  . ARG A 182 ? 0.1532 0.1099 0.2057 0.0176  -0.0500 0.0240  1861 ARG A CA  
1568 C  C   . ARG A 182 ? 0.1417 0.0679 0.1885 0.0248  -0.0174 0.0070  1861 ARG A C   
1569 O  O   . ARG A 182 ? 0.1274 0.1000 0.2610 0.0382  -0.0022 0.0166  1861 ARG A O   
1570 C  CB  . ARG A 182 ? 0.2053 0.1404 0.1959 0.0074  -0.0572 0.0418  1861 ARG A CB  
1571 C  CG  . ARG A 182 ? 0.2237 0.2376 0.2954 0.0370  -0.0432 0.0495  1861 ARG A CG  
1572 C  CD  . ARG A 182 ? 0.3240 0.2547 0.2871 -0.0025 -0.1254 0.0275  1861 ARG A CD  
1573 N  NE  . ARG A 182 ? 0.3238 0.2721 0.2394 0.0544  -0.0812 0.0375  1861 ARG A NE  
1574 C  CZ  . ARG A 182 ? 0.3811 0.2618 0.3704 0.0434  -0.0403 0.0342  1861 ARG A CZ  
1575 N  NH1 . ARG A 182 ? 0.3421 0.3327 0.3352 -0.0108 -0.0570 0.0411  1861 ARG A NH1 
1576 N  NH2 . ARG A 182 ? 0.4497 0.2912 0.3890 0.0574  -0.0986 0.0414  1861 ARG A NH2 
1577 N  N   . HIS A 183 ? 0.1401 0.1057 0.2318 0.0050  -0.0402 0.0260  1862 HIS A N   
1578 C  CA  . HIS A 183 ? 0.1350 0.1084 0.1805 -0.0074 -0.0489 0.0064  1862 HIS A CA  
1579 C  C   . HIS A 183 ? 0.0846 0.0996 0.2035 0.0372  -0.0504 -0.0086 1862 HIS A C   
1580 O  O   . HIS A 183 ? 0.0992 0.1190 0.2509 0.0374  -0.0688 -0.0171 1862 HIS A O   
1581 C  CB  . HIS A 183 ? 0.1462 0.1157 0.1806 0.0157  -0.0426 -0.0092 1862 HIS A CB  
1582 C  CG  . HIS A 183 ? 0.1325 0.1034 0.1597 0.0248  -0.0316 -0.0168 1862 HIS A CG  
1583 N  ND1 . HIS A 183 ? 0.1395 0.1498 0.2437 0.0113  -0.0575 0.0208  1862 HIS A ND1 
1584 C  CD2 . HIS A 183 ? 0.0814 0.1158 0.2025 0.0288  -0.0642 -0.0268 1862 HIS A CD2 
1585 C  CE1 . HIS A 183 ? 0.1480 0.1867 0.1819 0.0240  -0.0158 0.0477  1862 HIS A CE1 
1586 N  NE2 . HIS A 183 ? 0.1100 0.1384 0.2263 -0.0098 -0.0337 0.0081  1862 HIS A NE2 
1587 N  N   . PHE A 184 ? 0.0817 0.1031 0.1888 0.0133  -0.0479 0.0026  1863 PHE A N   
1588 C  CA  . PHE A 184 ? 0.0904 0.1017 0.1629 0.0028  -0.0361 -0.0031 1863 PHE A CA  
1589 C  C   . PHE A 184 ? 0.0651 0.1178 0.1419 0.0082  -0.0302 -0.0064 1863 PHE A C   
1590 O  O   . PHE A 184 ? 0.0787 0.1157 0.1749 0.0408  -0.0370 0.0091  1863 PHE A O   
1591 C  CB  . PHE A 184 ? 0.1245 0.1229 0.1562 0.0346  -0.0279 0.0110  1863 PHE A CB  
1592 C  CG  . PHE A 184 ? 0.1241 0.1170 0.1060 0.0144  -0.0147 0.0109  1863 PHE A CG  
1593 C  CD1 . PHE A 184 ? 0.1570 0.1243 0.1722 0.0157  -0.0112 0.0030  1863 PHE A CD1 
1594 C  CD2 . PHE A 184 ? 0.1864 0.1438 0.1908 0.0610  -0.0424 0.0040  1863 PHE A CD2 
1595 C  CE1 . PHE A 184 ? 0.1659 0.1436 0.1853 0.0197  -0.0027 0.0294  1863 PHE A CE1 
1596 C  CE2 . PHE A 184 ? 0.2096 0.1463 0.2263 0.0350  -0.0295 0.0265  1863 PHE A CE2 
1597 C  CZ  . PHE A 184 ? 0.2301 0.1111 0.2042 0.0106  -0.0163 0.0213  1863 PHE A CZ  
1598 N  N   . HIS A 185 ? 0.0658 0.1032 0.1608 0.0038  -0.0071 0.0094  1864 HIS A N   
1599 C  CA  . HIS A 185 ? 0.0686 0.1423 0.1352 0.0159  -0.0052 -0.0127 1864 HIS A CA  
1600 C  C   . HIS A 185 ? 0.0901 0.1227 0.1637 0.0145  -0.0086 -0.0208 1864 HIS A C   
1601 O  O   . HIS A 185 ? 0.0584 0.1166 0.2250 0.0172  -0.0321 0.0072  1864 HIS A O   
1602 C  CB  . HIS A 185 ? 0.0921 0.1687 0.1597 0.0376  -0.0345 -0.0134 1864 HIS A CB  
1603 C  CG  . HIS A 185 ? 0.1032 0.2125 0.1514 0.0809  -0.0495 -0.0322 1864 HIS A CG  
1604 N  ND1 . HIS A 185 ? 0.1845 0.3009 0.1797 0.0963  -0.0305 -0.0469 1864 HIS A ND1 
1605 C  CD2 . HIS A 185 ? 0.0930 0.1907 0.1596 0.0584  -0.0427 0.0248  1864 HIS A CD2 
1606 C  CE1 . HIS A 185 ? 0.2332 0.2782 0.2204 0.0672  0.0167  0.0116  1864 HIS A CE1 
1607 N  NE2 . HIS A 185 ? 0.1510 0.2688 0.1356 0.0692  -0.0195 -0.0016 1864 HIS A NE2 
1608 N  N   . TYR A 186 ? 0.0724 0.1168 0.1952 -0.0065 -0.0230 0.0022  1865 TYR A N   
1609 C  CA  . TYR A 186 ? 0.0632 0.0904 0.1725 0.0194  -0.0045 0.0062  1865 TYR A CA  
1610 C  C   . TYR A 186 ? 0.0938 0.1490 0.1990 0.0050  -0.0256 0.0410  1865 TYR A C   
1611 O  O   . TYR A 186 ? 0.0987 0.1854 0.1796 0.0163  -0.0325 0.0515  1865 TYR A O   
1612 C  CB  . TYR A 186 ? 0.0806 0.1305 0.1780 0.0038  -0.0152 0.0062  1865 TYR A CB  
1613 C  CG  . TYR A 186 ? 0.0843 0.1282 0.1363 0.0095  0.0018  -0.0030 1865 TYR A CG  
1614 C  CD1 . TYR A 186 ? 0.0910 0.1786 0.1889 -0.0197 0.0146  -0.0152 1865 TYR A CD1 
1615 C  CD2 . TYR A 186 ? 0.1131 0.1223 0.2262 -0.0341 0.0085  -0.0184 1865 TYR A CD2 
1616 C  CE1 . TYR A 186 ? 0.1199 0.1730 0.1914 -0.0251 0.0056  -0.0185 1865 TYR A CE1 
1617 C  CE2 . TYR A 186 ? 0.1244 0.1870 0.1969 -0.0261 0.0085  -0.0413 1865 TYR A CE2 
1618 C  CZ  . TYR A 186 ? 0.0687 0.2060 0.2087 -0.0622 -0.0210 -0.0197 1865 TYR A CZ  
1619 O  OH  . TYR A 186 ? 0.1261 0.1886 0.2966 -0.0694 -0.0266 -0.0128 1865 TYR A OH  
1620 N  N   . THR A 187 ? 0.0699 0.1710 0.1756 0.0048  -0.0147 0.0216  1866 THR A N   
1621 C  CA  . THR A 187 ? 0.1128 0.1738 0.1909 0.0313  0.0127  0.0169  1866 THR A CA  
1622 C  C   . THR A 187 ? 0.1092 0.2038 0.1949 0.0345  0.0303  0.0333  1866 THR A C   
1623 O  O   . THR A 187 ? 0.2046 0.2512 0.2567 0.0386  0.0879  0.0408  1866 THR A O   
1624 C  CB  . THR A 187 ? 0.1176 0.1775 0.2026 0.0429  -0.0060 -0.0026 1866 THR A CB  
1625 O  OG1 . THR A 187 ? 0.1069 0.2048 0.2467 0.0339  -0.0384 -0.0074 1866 THR A OG1 
1626 C  CG2 . THR A 187 ? 0.1623 0.1592 0.1935 0.0442  0.0037  -0.0169 1866 THR A CG2 
1627 N  N   . VAL A 188 ? 0.0753 0.1735 0.1951 0.0176  -0.0112 0.0319  1867 VAL A N   
1628 C  CA  . VAL A 188 ? 0.1040 0.1629 0.1986 0.0029  -0.0188 0.0399  1867 VAL A CA  
1629 C  C   . VAL A 188 ? 0.1130 0.1496 0.2419 0.0084  -0.0133 0.0289  1867 VAL A C   
1630 O  O   . VAL A 188 ? 0.1405 0.1626 0.3506 -0.0032 -0.0628 0.0426  1867 VAL A O   
1631 C  CB  . VAL A 188 ? 0.1066 0.2180 0.1985 0.0090  0.0005  0.0728  1867 VAL A CB  
1632 C  CG1 . VAL A 188 ? 0.0931 0.2316 0.2560 0.0249  0.0019  0.0495  1867 VAL A CG1 
1633 C  CG2 . VAL A 188 ? 0.0899 0.2349 0.1898 0.0060  -0.0113 0.0092  1867 VAL A CG2 
1634 N  N   . TRP A 189 ? 0.0715 0.1469 0.1919 0.0032  -0.0183 0.0306  1868 TRP A N   
1635 C  CA  . TRP A 189 ? 0.0920 0.1515 0.2120 0.0050  -0.0091 0.0181  1868 TRP A CA  
1636 C  C   . TRP A 189 ? 0.0762 0.1512 0.2140 0.0167  0.0075  0.0284  1868 TRP A C   
1637 O  O   . TRP A 189 ? 0.1202 0.1631 0.2145 -0.0261 0.0074  0.0226  1868 TRP A O   
1638 C  CB  . TRP A 189 ? 0.0672 0.1348 0.2207 0.0032  -0.0080 0.0064  1868 TRP A CB  
1639 C  CG  . TRP A 189 ? 0.0840 0.1324 0.2000 -0.0328 -0.0063 0.0242  1868 TRP A CG  
1640 C  CD1 . TRP A 189 ? 0.1246 0.1783 0.2841 0.0307  0.0103  0.0232  1868 TRP A CD1 
1641 C  CD2 . TRP A 189 ? 0.0986 0.1479 0.2067 0.0320  -0.0047 -0.0066 1868 TRP A CD2 
1642 N  NE1 . TRP A 189 ? 0.0780 0.1668 0.2946 0.0079  0.0089  0.0240  1868 TRP A NE1 
1643 C  CE2 . TRP A 189 ? 0.0931 0.1623 0.2325 0.0147  0.0351  0.0219  1868 TRP A CE2 
1644 C  CE3 . TRP A 189 ? 0.0910 0.2255 0.2217 0.0285  -0.0243 0.0017  1868 TRP A CE3 
1645 C  CZ2 . TRP A 189 ? 0.1258 0.1933 0.2359 0.0076  -0.0141 -0.0264 1868 TRP A CZ2 
1646 C  CZ3 . TRP A 189 ? 0.1115 0.2344 0.2155 0.0273  -0.0583 -0.0027 1868 TRP A CZ3 
1647 C  CH2 . TRP A 189 ? 0.1322 0.2242 0.2361 0.0164  -0.0227 -0.0143 1868 TRP A CH2 
1648 N  N   . PRO A 190 ? 0.0647 0.1599 0.2321 0.0131  -0.0102 0.0346  1869 PRO A N   
1649 C  CA  . PRO A 190 ? 0.0983 0.1565 0.2215 -0.0261 -0.0272 0.0513  1869 PRO A CA  
1650 C  C   . PRO A 190 ? 0.0799 0.1740 0.2467 -0.0081 -0.0304 0.0515  1869 PRO A C   
1651 O  O   . PRO A 190 ? 0.0866 0.2092 0.2923 -0.0161 -0.0039 0.0595  1869 PRO A O   
1652 C  CB  . PRO A 190 ? 0.1130 0.1532 0.2744 -0.0349 -0.0098 0.0327  1869 PRO A CB  
1653 C  CG  . PRO A 190 ? 0.1745 0.1533 0.3124 -0.0316 -0.0106 0.0537  1869 PRO A CG  
1654 C  CD  . PRO A 190 ? 0.1104 0.1728 0.2248 -0.0164 0.0146  0.0495  1869 PRO A CD  
1655 N  N   . ASP A 191 ? 0.1033 0.1771 0.2020 -0.0077 -0.0393 0.0569  1870 ASP A N   
1656 C  CA  . ASP A 191 ? 0.1063 0.2289 0.2647 -0.0296 -0.0520 0.0450  1870 ASP A CA  
1657 C  C   . ASP A 191 ? 0.1106 0.2329 0.3049 -0.0247 -0.0299 0.0357  1870 ASP A C   
1658 O  O   . ASP A 191 ? 0.0852 0.2853 0.3405 -0.0102 -0.0785 0.0910  1870 ASP A O   
1659 C  CB  . ASP A 191 ? 0.1665 0.2392 0.2752 -0.0266 -0.0424 0.0150  1870 ASP A CB  
1660 C  CG  . ASP A 191 ? 0.1494 0.2207 0.2758 -0.0540 -0.0758 0.0174  1870 ASP A CG  
1661 O  OD1 . ASP A 191 ? 0.2412 0.2516 0.2695 -0.0822 -0.0689 0.0499  1870 ASP A OD1 
1662 O  OD2 . ASP A 191 ? 0.2553 0.2131 0.2988 -0.0257 -0.0079 0.0094  1870 ASP A OD2 
1663 N  N   . HIS A 192 ? 0.0855 0.1971 0.2718 0.0132  -0.0204 0.0517  1871 HIS A N   
1664 C  CA  . HIS A 192 ? 0.1431 0.2178 0.3067 0.0024  -0.0069 0.0478  1871 HIS A CA  
1665 C  C   . HIS A 192 ? 0.1368 0.1594 0.2919 0.0055  0.0141  0.0565  1871 HIS A C   
1666 O  O   . HIS A 192 ? 0.1144 0.2421 0.3183 0.0400  -0.0089 0.0270  1871 HIS A O   
1667 C  CB  . HIS A 192 ? 0.1242 0.2452 0.2647 0.0041  -0.0170 0.0508  1871 HIS A CB  
1668 C  CG  . HIS A 192 ? 0.1503 0.2889 0.2917 0.0082  -0.0560 0.0856  1871 HIS A CG  
1669 N  ND1 . HIS A 192 ? 0.2177 0.2881 0.2581 -0.0246 -0.0397 0.0424  1871 HIS A ND1 
1670 C  CD2 . HIS A 192 ? 0.1854 0.4219 0.3402 0.0158  -0.0502 0.0356  1871 HIS A CD2 
1671 C  CE1 . HIS A 192 ? 0.1264 0.3695 0.3216 0.0180  -0.0346 0.0706  1871 HIS A CE1 
1672 N  NE2 . HIS A 192 ? 0.1880 0.3844 0.3631 0.0012  -0.0369 0.0316  1871 HIS A NE2 
1673 N  N   . GLY A 193 ? 0.1586 0.1836 0.3047 0.0130  0.0388  0.0473  1872 GLY A N   
1674 C  CA  . GLY A 193 ? 0.1631 0.1836 0.3059 0.0254  0.0384  0.0321  1872 GLY A CA  
1675 C  C   . GLY A 193 ? 0.1663 0.1889 0.3167 0.0037  0.0226  0.0173  1872 GLY A C   
1676 O  O   . GLY A 193 ? 0.2680 0.2124 0.2737 -0.0424 0.0012  0.0300  1872 GLY A O   
1677 N  N   . VAL A 194 ? 0.1014 0.2032 0.2911 0.0034  0.0099  -0.0136 1873 VAL A N   
1678 C  CA  . VAL A 194 ? 0.1084 0.1922 0.3215 -0.0189 0.0118  -0.0133 1873 VAL A CA  
1679 C  C   . VAL A 194 ? 0.1857 0.1865 0.3086 0.0057  0.0105  -0.0323 1873 VAL A C   
1680 O  O   . VAL A 194 ? 0.1302 0.2177 0.3227 0.0622  -0.0022 -0.0255 1873 VAL A O   
1681 C  CB  . VAL A 194 ? 0.0661 0.2081 0.3142 -0.0104 0.0022  -0.0364 1873 VAL A CB  
1682 C  CG1 . VAL A 194 ? 0.0296 0.3024 0.3705 0.0344  -0.0083 -0.0343 1873 VAL A CG1 
1683 C  CG2 . VAL A 194 ? 0.1275 0.2036 0.3595 -0.0243 -0.0369 -0.0291 1873 VAL A CG2 
1684 N  N   . PRO A 195 ? 0.1331 0.1828 0.2905 0.0174  -0.0075 -0.0224 1874 PRO A N   
1685 C  CA  . PRO A 195 ? 0.1893 0.2410 0.3529 0.0128  -0.0134 -0.0167 1874 PRO A CA  
1686 C  C   . PRO A 195 ? 0.1246 0.2101 0.3440 0.0286  0.0078  -0.0392 1874 PRO A C   
1687 O  O   . PRO A 195 ? 0.1010 0.2594 0.3672 0.0248  -0.0284 -0.0515 1874 PRO A O   
1688 C  CB  . PRO A 195 ? 0.1249 0.2191 0.2964 0.0073  -0.0227 0.0011  1874 PRO A CB  
1689 C  CG  . PRO A 195 ? 0.1037 0.2713 0.3164 -0.0071 -0.0613 -0.0109 1874 PRO A CG  
1690 C  CD  . PRO A 195 ? 0.2025 0.1782 0.3128 -0.0029 -0.0013 -0.0155 1874 PRO A CD  
1691 N  N   . GLU A 196 ? 0.1408 0.2444 0.3847 -0.0017 -0.0125 -0.0287 1875 GLU A N   
1692 C  CA  A GLU A 196 ? 0.1734 0.2605 0.3668 -0.0353 0.0101  -0.0311 1875 GLU A CA  
1693 C  CA  B GLU A 196 ? 0.1905 0.2641 0.3731 -0.0279 0.0007  -0.0239 1875 GLU A CA  
1694 C  C   . GLU A 196 ? 0.1698 0.2627 0.4005 -0.0058 -0.0020 -0.0078 1875 GLU A C   
1695 O  O   . GLU A 196 ? 0.2559 0.2435 0.4396 -0.0489 -0.0709 -0.0437 1875 GLU A O   
1696 C  CB  A GLU A 196 ? 0.1503 0.2685 0.3698 0.0088  0.0378  -0.0249 1875 GLU A CB  
1697 C  CB  B GLU A 196 ? 0.1866 0.2775 0.3741 -0.0073 0.0177  -0.0102 1875 GLU A CB  
1698 C  CG  A GLU A 196 ? 0.2127 0.3771 0.3805 -0.0482 -0.0041 -0.0106 1875 GLU A CG  
1699 C  CG  B GLU A 196 ? 0.2549 0.3367 0.3436 -0.0388 0.0047  0.0003  1875 GLU A CG  
1700 C  CD  A GLU A 196 ? 0.3399 0.3444 0.3487 -0.0055 -0.0436 -0.0276 1875 GLU A CD  
1701 C  CD  B GLU A 196 ? 0.1723 0.3141 0.2726 -0.0099 0.0693  -0.0030 1875 GLU A CD  
1702 O  OE1 A GLU A 196 ? 0.4107 0.3653 0.4630 0.0398  -0.0014 -0.0141 1875 GLU A OE1 
1703 O  OE1 B GLU A 196 ? 0.2355 0.2876 0.2982 -0.0390 0.0498  0.0248  1875 GLU A OE1 
1704 O  OE2 A GLU A 196 ? 0.0947 0.1363 0.2837 -0.0176 -0.0288 -0.0258 1875 GLU A OE2 
1705 O  OE2 B GLU A 196 ? 0.3522 0.4058 0.3739 -0.0215 0.0074  -0.0165 1875 GLU A OE2 
1706 N  N   . THR A 197 ? 0.1218 0.2576 0.3941 0.0138  -0.0167 -0.0049 1876 THR A N   
1707 C  CA  . THR A 197 ? 0.0962 0.2639 0.3621 0.0216  -0.0095 -0.0199 1876 THR A CA  
1708 C  C   . THR A 197 ? 0.1109 0.1964 0.3361 0.0053  -0.0100 -0.0363 1876 THR A C   
1709 O  O   . THR A 197 ? 0.0718 0.2032 0.3621 0.0131  -0.0403 -0.0601 1876 THR A O   
1710 C  CB  . THR A 197 ? 0.0685 0.2237 0.4231 -0.0088 -0.0457 -0.0247 1876 THR A CB  
1711 O  OG1 . THR A 197 ? 0.1393 0.2347 0.3938 0.0465  -0.0298 -0.0372 1876 THR A OG1 
1712 C  CG2 . THR A 197 ? 0.1434 0.2966 0.4216 -0.0435 0.0098  0.0258  1876 THR A CG2 
1713 N  N   . THR A 198 ? 0.0955 0.1974 0.3396 -0.0207 -0.0313 -0.0259 1877 THR A N   
1714 C  CA  . THR A 198 ? 0.1301 0.2103 0.3188 -0.0124 -0.0390 -0.0312 1877 THR A CA  
1715 C  C   . THR A 198 ? 0.1151 0.1938 0.2843 -0.0083 -0.0375 -0.0177 1877 THR A C   
1716 O  O   . THR A 198 ? 0.1050 0.2070 0.2962 -0.0422 -0.0299 -0.0408 1877 THR A O   
1717 C  CB  . THR A 198 ? 0.0918 0.2366 0.2907 0.0049  -0.0750 -0.0256 1877 THR A CB  
1718 O  OG1 . THR A 198 ? 0.1452 0.2408 0.3219 0.0247  -0.1094 -0.0512 1877 THR A OG1 
1719 C  CG2 . THR A 198 ? 0.1430 0.1892 0.3762 0.0273  -0.0745 -0.0318 1877 THR A CG2 
1720 N  N   . GLN A 199 ? 0.1155 0.1925 0.2877 -0.0261 -0.0434 -0.0176 1878 GLN A N   
1721 C  CA  A GLN A 199 ? 0.1075 0.1799 0.2833 0.0016  -0.0495 -0.0105 1878 GLN A CA  
1722 C  CA  B GLN A 199 ? 0.1341 0.2012 0.2869 -0.0059 -0.0354 -0.0128 1878 GLN A CA  
1723 C  C   . GLN A 199 ? 0.0800 0.2178 0.2460 0.0113  -0.0226 -0.0105 1878 GLN A C   
1724 O  O   . GLN A 199 ? 0.0898 0.1851 0.2677 -0.0116 -0.0171 -0.0287 1878 GLN A O   
1725 C  CB  A GLN A 199 ? 0.1339 0.2052 0.2839 0.0101  -0.0566 0.0018  1878 GLN A CB  
1726 C  CB  B GLN A 199 ? 0.1642 0.2280 0.3023 -0.0015 -0.0395 -0.0075 1878 GLN A CB  
1727 C  CG  A GLN A 199 ? 0.1893 0.2820 0.3276 0.0152  -0.0108 -0.0039 1878 GLN A CG  
1728 C  CG  B GLN A 199 ? 0.2626 0.3120 0.3441 -0.0021 -0.0075 0.0050  1878 GLN A CG  
1729 C  CD  A GLN A 199 ? 0.1931 0.3107 0.2600 0.0085  -0.0166 0.0388  1878 GLN A CD  
1730 C  CD  B GLN A 199 ? 0.3250 0.3410 0.3958 -0.0094 -0.0238 -0.0034 1878 GLN A CD  
1731 O  OE1 A GLN A 199 ? 0.1442 0.3355 0.3873 0.1142  -0.0374 0.0520  1878 GLN A OE1 
1732 O  OE1 B GLN A 199 ? 0.2235 0.3055 0.3902 0.0332  -0.0323 0.0001  1878 GLN A OE1 
1733 N  NE2 A GLN A 199 ? 0.0978 0.3095 0.2379 0.0480  0.0148  0.0182  1878 GLN A NE2 
1734 N  NE2 B GLN A 199 ? 0.3621 0.3926 0.4393 0.0196  -0.0357 0.0030  1878 GLN A NE2 
1735 N  N   . SER A 200 ? 0.0850 0.2237 0.2532 -0.0007 -0.0301 -0.0155 1879 SER A N   
1736 C  CA  A SER A 200 ? 0.0999 0.2451 0.2483 -0.0031 -0.0205 -0.0126 1879 SER A CA  
1737 C  CA  B SER A 200 ? 0.0788 0.2150 0.2245 -0.0035 -0.0143 -0.0139 1879 SER A CA  
1738 C  C   . SER A 200 ? 0.0702 0.1829 0.2522 -0.0180 -0.0169 0.0038  1879 SER A C   
1739 O  O   . SER A 200 ? 0.1075 0.1971 0.2482 0.0091  -0.0100 -0.0211 1879 SER A O   
1740 C  CB  A SER A 200 ? 0.1175 0.2719 0.2832 -0.0045 0.0009  0.0096  1879 SER A CB  
1741 C  CB  B SER A 200 ? 0.0774 0.1902 0.2471 0.0025  0.0168  -0.0034 1879 SER A CB  
1742 O  OG  A SER A 200 ? 0.1486 0.3617 0.3266 0.0404  -0.0277 0.0012  1879 SER A OG  
1743 O  OG  B SER A 200 ? 0.0285 0.1530 0.1941 0.0202  -0.0007 0.0100  1879 SER A OG  
1744 N  N   . LEU A 201 ? 0.1020 0.2014 0.2420 -0.0241 -0.0157 -0.0080 1880 LEU A N   
1745 C  CA  . LEU A 201 ? 0.0972 0.1621 0.2436 -0.0266 -0.0206 -0.0069 1880 LEU A CA  
1746 C  C   . LEU A 201 ? 0.1147 0.1575 0.1747 -0.0094 -0.0339 -0.0042 1880 LEU A C   
1747 O  O   . LEU A 201 ? 0.0941 0.1553 0.2164 -0.0310 -0.0560 0.0075  1880 LEU A O   
1748 C  CB  . LEU A 201 ? 0.1350 0.1796 0.2393 -0.0224 -0.0212 -0.0098 1880 LEU A CB  
1749 C  CG  . LEU A 201 ? 0.1022 0.1758 0.2359 0.0090  -0.0353 -0.0262 1880 LEU A CG  
1750 C  CD1 . LEU A 201 ? 0.1099 0.1577 0.2230 -0.0358 -0.0064 -0.0061 1880 LEU A CD1 
1751 C  CD2 . LEU A 201 ? 0.1042 0.1620 0.2845 0.0042  -0.0403 -0.0020 1880 LEU A CD2 
1752 N  N   . ILE A 202 ? 0.0793 0.1768 0.1906 -0.0051 -0.0244 -0.0265 1881 ILE A N   
1753 C  CA  . ILE A 202 ? 0.1128 0.1539 0.1757 -0.0029 -0.0412 -0.0338 1881 ILE A CA  
1754 C  C   . ILE A 202 ? 0.0965 0.1731 0.1736 0.0160  -0.0181 -0.0146 1881 ILE A C   
1755 O  O   . ILE A 202 ? 0.0802 0.1631 0.2081 -0.0060 -0.0109 -0.0079 1881 ILE A O   
1756 C  CB  . ILE A 202 ? 0.0946 0.1680 0.1935 -0.0079 -0.0636 -0.0256 1881 ILE A CB  
1757 C  CG1 . ILE A 202 ? 0.1199 0.1556 0.2308 0.0150  -0.0528 -0.0422 1881 ILE A CG1 
1758 C  CG2 . ILE A 202 ? 0.1461 0.1915 0.2041 0.0178  -0.0454 -0.0226 1881 ILE A CG2 
1759 C  CD1 . ILE A 202 ? 0.1272 0.1933 0.2610 0.0168  -0.0594 -0.0341 1881 ILE A CD1 
1760 N  N   . GLN A 203 ? 0.1057 0.1586 0.1933 0.0138  -0.0388 -0.0199 1882 GLN A N   
1761 C  CA  . GLN A 203 ? 0.0659 0.1626 0.1861 0.0058  -0.0469 -0.0125 1882 GLN A CA  
1762 C  C   . GLN A 203 ? 0.0670 0.1556 0.1514 0.0351  -0.0243 0.0058  1882 GLN A C   
1763 O  O   . GLN A 203 ? 0.1004 0.1793 0.1877 0.0143  -0.0432 0.0017  1882 GLN A O   
1764 C  CB  . GLN A 203 ? 0.0809 0.2188 0.1804 -0.0033 -0.0503 -0.0519 1882 GLN A CB  
1765 C  CG  . GLN A 203 ? 0.1497 0.2535 0.2416 0.0232  -0.0518 -0.0243 1882 GLN A CG  
1766 C  CD  . GLN A 203 ? 0.2917 0.3919 0.2671 0.0196  -0.0535 0.0032  1882 GLN A CD  
1767 O  OE1 . GLN A 203 ? 0.3782 0.4555 0.3983 0.0082  -0.0830 0.0286  1882 GLN A OE1 
1768 N  NE2 . GLN A 203 ? 0.3245 0.3710 0.3873 0.0301  -0.0935 -0.0385 1882 GLN A NE2 
1769 N  N   . PHE A 204 ? 0.0733 0.1649 0.1422 0.0075  -0.0246 -0.0267 1883 PHE A N   
1770 C  CA  . PHE A 204 ? 0.0600 0.1858 0.1318 -0.0149 -0.0170 -0.0053 1883 PHE A CA  
1771 C  C   . PHE A 204 ? 0.0652 0.1293 0.1459 0.0015  -0.0174 -0.0077 1883 PHE A C   
1772 O  O   . PHE A 204 ? 0.0914 0.1375 0.1629 0.0001  -0.0262 0.0131  1883 PHE A O   
1773 C  CB  . PHE A 204 ? 0.0710 0.1575 0.1481 -0.0120 -0.0305 -0.0223 1883 PHE A CB  
1774 C  CG  . PHE A 204 ? 0.0372 0.1518 0.1436 -0.0006 -0.0298 -0.0132 1883 PHE A CG  
1775 C  CD1 . PHE A 204 ? 0.0815 0.1225 0.1754 -0.0055 -0.0400 -0.0176 1883 PHE A CD1 
1776 C  CD2 . PHE A 204 ? 0.0722 0.1149 0.1735 -0.0182 -0.0141 0.0014  1883 PHE A CD2 
1777 C  CE1 . PHE A 204 ? 0.0584 0.1282 0.1878 0.0078  -0.0091 -0.0081 1883 PHE A CE1 
1778 C  CE2 . PHE A 204 ? 0.0891 0.1253 0.1674 -0.0130 -0.0155 -0.0256 1883 PHE A CE2 
1779 C  CZ  . PHE A 204 ? 0.0793 0.1327 0.1538 -0.0020 -0.0024 -0.0289 1883 PHE A CZ  
1780 N  N   . VAL A 205 ? 0.0692 0.1301 0.1593 0.0062  -0.0066 -0.0099 1884 VAL A N   
1781 C  CA  . VAL A 205 ? 0.0748 0.1283 0.1239 0.0134  -0.0152 0.0011  1884 VAL A CA  
1782 C  C   . VAL A 205 ? 0.0910 0.1405 0.1440 0.0181  -0.0262 0.0168  1884 VAL A C   
1783 O  O   . VAL A 205 ? 0.1100 0.1430 0.1640 -0.0119 -0.0261 0.0058  1884 VAL A O   
1784 C  CB  . VAL A 205 ? 0.0790 0.1621 0.1201 0.0052  -0.0044 -0.0296 1884 VAL A CB  
1785 C  CG1 . VAL A 205 ? 0.0854 0.1842 0.1867 0.0156  0.0493  -0.0021 1884 VAL A CG1 
1786 C  CG2 . VAL A 205 ? 0.1299 0.1319 0.1567 -0.0237 -0.0457 -0.0127 1884 VAL A CG2 
1787 N  N   . ARG A 206 ? 0.0866 0.1696 0.1175 0.0233  -0.0389 0.0031  1885 ARG A N   
1788 C  CA  . ARG A 206 ? 0.1037 0.1721 0.1428 0.0161  -0.0439 0.0004  1885 ARG A CA  
1789 C  C   . ARG A 206 ? 0.1221 0.1807 0.1507 0.0161  -0.0495 0.0013  1885 ARG A C   
1790 O  O   . ARG A 206 ? 0.1479 0.1977 0.1804 0.0321  -0.0273 0.0107  1885 ARG A O   
1791 C  CB  . ARG A 206 ? 0.1281 0.1979 0.1860 0.0322  -0.0609 0.0066  1885 ARG A CB  
1792 C  CG  . ARG A 206 ? 0.1770 0.2304 0.2288 -0.0003 -0.0718 -0.0018 1885 ARG A CG  
1793 C  CD  . ARG A 206 ? 0.2286 0.2363 0.2989 0.0184  -0.0757 -0.0268 1885 ARG A CD  
1794 N  NE  . ARG A 206 ? 0.3978 0.2478 0.2588 0.0037  -0.0989 -0.0382 1885 ARG A NE  
1795 C  CZ  . ARG A 206 ? 0.3818 0.3071 0.3564 0.0151  -0.0496 -0.0306 1885 ARG A CZ  
1796 N  NH1 . ARG A 206 ? 0.3431 0.3014 0.3013 -0.0256 -0.0969 -0.0015 1885 ARG A NH1 
1797 N  NH2 . ARG A 206 ? 0.5498 0.3006 0.3064 0.0161  -0.0414 -0.0709 1885 ARG A NH2 
1798 N  N   . THR A 207 ? 0.1064 0.1667 0.1568 0.0050  -0.0617 -0.0003 1886 THR A N   
1799 C  CA  . THR A 207 ? 0.1233 0.1870 0.1884 0.0137  -0.0252 0.0001  1886 THR A CA  
1800 C  C   . THR A 207 ? 0.1372 0.1193 0.1676 0.0038  -0.0336 0.0092  1886 THR A C   
1801 O  O   . THR A 207 ? 0.1484 0.1529 0.1839 0.0182  -0.0412 0.0182  1886 THR A O   
1802 C  CB  . THR A 207 ? 0.1280 0.1860 0.1939 0.0180  -0.0347 -0.0124 1886 THR A CB  
1803 O  OG1 . THR A 207 ? 0.1282 0.2012 0.3028 0.0230  -0.0489 -0.0201 1886 THR A OG1 
1804 C  CG2 . THR A 207 ? 0.2056 0.2040 0.2609 0.0165  -0.0256 -0.0277 1886 THR A CG2 
1805 N  N   . VAL A 208 ? 0.0804 0.1405 0.1704 0.0147  -0.0297 0.0029  1887 VAL A N   
1806 C  CA  . VAL A 208 ? 0.0846 0.1397 0.1505 0.0139  -0.0277 0.0338  1887 VAL A CA  
1807 C  C   . VAL A 208 ? 0.1268 0.1315 0.1341 0.0113  -0.0412 0.0127  1887 VAL A C   
1808 O  O   . VAL A 208 ? 0.1213 0.1496 0.1699 -0.0033 -0.0191 0.0245  1887 VAL A O   
1809 C  CB  . VAL A 208 ? 0.0934 0.1464 0.1787 0.0147  -0.0263 0.0124  1887 VAL A CB  
1810 C  CG1 . VAL A 208 ? 0.0849 0.1707 0.1641 -0.0035 -0.0528 0.0017  1887 VAL A CG1 
1811 C  CG2 . VAL A 208 ? 0.1466 0.1573 0.1524 0.0075  -0.0076 0.0032  1887 VAL A CG2 
1812 N  N   . ARG A 209 ? 0.1205 0.1526 0.1160 0.0075  -0.0357 0.0121  1888 ARG A N   
1813 C  CA  . ARG A 209 ? 0.1588 0.1491 0.1096 0.0090  -0.0176 0.0177  1888 ARG A CA  
1814 C  C   . ARG A 209 ? 0.1193 0.1651 0.1316 0.0065  -0.0088 0.0248  1888 ARG A C   
1815 O  O   . ARG A 209 ? 0.1633 0.1573 0.1570 -0.0030 -0.0053 0.0333  1888 ARG A O   
1816 C  CB  . ARG A 209 ? 0.1515 0.1754 0.1423 0.0187  -0.0181 -0.0308 1888 ARG A CB  
1817 C  CG  . ARG A 209 ? 0.1285 0.2302 0.1697 -0.0104 0.0146  -0.0068 1888 ARG A CG  
1818 C  CD  . ARG A 209 ? 0.1485 0.1732 0.1813 0.0639  -0.0193 0.0095  1888 ARG A CD  
1819 N  NE  . ARG A 209 ? 0.1091 0.2005 0.2204 0.0197  -0.0134 0.0300  1888 ARG A NE  
1820 C  CZ  . ARG A 209 ? 0.1053 0.1709 0.2458 -0.0118 0.0017  0.0196  1888 ARG A CZ  
1821 N  NH1 . ARG A 209 ? 0.1787 0.1684 0.2285 -0.0283 -0.0085 0.0243  1888 ARG A NH1 
1822 N  NH2 . ARG A 209 ? 0.1465 0.1666 0.2055 -0.0015 -0.0344 -0.0113 1888 ARG A NH2 
1823 N  N   . ASP A 210 ? 0.1508 0.1586 0.1532 0.0242  -0.0411 0.0426  1889 ASP A N   
1824 C  CA  A ASP A 210 ? 0.1836 0.1619 0.1659 0.0139  -0.0315 0.0233  1889 ASP A CA  
1825 C  CA  B ASP A 210 ? 0.1787 0.1684 0.1725 0.0182  -0.0306 0.0250  1889 ASP A CA  
1826 C  C   . ASP A 210 ? 0.2076 0.1448 0.1683 0.0238  -0.0081 0.0398  1889 ASP A C   
1827 O  O   . ASP A 210 ? 0.3038 0.1791 0.2058 0.0002  -0.0066 0.0252  1889 ASP A O   
1828 C  CB  A ASP A 210 ? 0.1794 0.1661 0.1936 0.0158  -0.0560 0.0351  1889 ASP A CB  
1829 C  CB  B ASP A 210 ? 0.1733 0.1796 0.1931 0.0270  -0.0594 0.0445  1889 ASP A CB  
1830 C  CG  A ASP A 210 ? 0.2152 0.1507 0.2044 0.0012  -0.0230 0.0129  1889 ASP A CG  
1831 C  CG  B ASP A 210 ? 0.1476 0.2150 0.2870 0.0255  -0.0189 0.0083  1889 ASP A CG  
1832 O  OD1 A ASP A 210 ? 0.2001 0.2056 0.3259 0.0340  -0.1294 0.0242  1889 ASP A OD1 
1833 O  OD1 B ASP A 210 ? 0.1982 0.3365 0.3250 0.0755  -0.0879 -0.0105 1889 ASP A OD1 
1834 O  OD2 A ASP A 210 ? 0.1614 0.1611 0.1599 0.0360  -0.0413 0.0491  1889 ASP A OD2 
1835 O  OD2 B ASP A 210 ? 0.2480 0.2957 0.3710 0.0162  -0.0140 0.0392  1889 ASP A OD2 
1836 N  N   . TYR A 211 ? 0.1571 0.1503 0.1664 0.0177  -0.0187 0.0280  1890 TYR A N   
1837 C  CA  . TYR A 211 ? 0.1879 0.1725 0.1518 0.0159  0.0083  0.0009  1890 TYR A CA  
1838 C  C   . TYR A 211 ? 0.1605 0.1486 0.1867 0.0091  0.0074  0.0408  1890 TYR A C   
1839 O  O   . TYR A 211 ? 0.1987 0.1507 0.2357 -0.0101 -0.0094 0.0401  1890 TYR A O   
1840 C  CB  . TYR A 211 ? 0.1634 0.1561 0.1840 0.0311  -0.0210 0.0000  1890 TYR A CB  
1841 C  CG  . TYR A 211 ? 0.1751 0.1745 0.2447 0.0500  -0.0187 0.0561  1890 TYR A CG  
1842 C  CD1 . TYR A 211 ? 0.1319 0.2223 0.2620 0.0420  -0.0136 0.0235  1890 TYR A CD1 
1843 C  CD2 . TYR A 211 ? 0.1716 0.1494 0.2456 0.0523  -0.0464 0.0284  1890 TYR A CD2 
1844 C  CE1 . TYR A 211 ? 0.2065 0.1391 0.2655 0.0483  0.0029  0.0141  1890 TYR A CE1 
1845 C  CE2 . TYR A 211 ? 0.1936 0.2067 0.2760 0.0390  -0.0238 -0.0163 1890 TYR A CE2 
1846 C  CZ  . TYR A 211 ? 0.1904 0.1444 0.1873 0.0714  -0.0126 0.0141  1890 TYR A CZ  
1847 O  OH  . TYR A 211 ? 0.1954 0.2424 0.3052 0.0926  -0.0100 0.0009  1890 TYR A OH  
1848 N  N   . ILE A 212 ? 0.1380 0.1656 0.1624 0.0094  -0.0133 0.0328  1891 ILE A N   
1849 C  CA  . ILE A 212 ? 0.1380 0.1627 0.2000 -0.0043 -0.0012 0.0257  1891 ILE A CA  
1850 C  C   . ILE A 212 ? 0.1454 0.1853 0.1836 -0.0184 -0.0096 0.0335  1891 ILE A C   
1851 O  O   . ILE A 212 ? 0.1525 0.2092 0.2143 -0.0188 -0.0015 0.0732  1891 ILE A O   
1852 C  CB  . ILE A 212 ? 0.1131 0.1676 0.1960 -0.0007 0.0118  0.0129  1891 ILE A CB  
1853 C  CG1 . ILE A 212 ? 0.1415 0.1580 0.2046 -0.0423 -0.0330 0.0049  1891 ILE A CG1 
1854 C  CG2 . ILE A 212 ? 0.1028 0.2112 0.1985 0.0277  -0.0013 0.0308  1891 ILE A CG2 
1855 C  CD1 . ILE A 212 ? 0.1754 0.1692 0.2540 -0.0451 -0.0125 -0.0016 1891 ILE A CD1 
1856 N  N   . ASN A 213 ? 0.2028 0.1962 0.1515 -0.0095 -0.0060 0.0320  1892 ASN A N   
1857 C  CA  . ASN A 213 ? 0.2726 0.2054 0.1624 -0.0097 -0.0004 0.0320  1892 ASN A CA  
1858 C  C   . ASN A 213 ? 0.2498 0.2116 0.1577 -0.0097 -0.0093 0.0345  1892 ASN A C   
1859 O  O   . ASN A 213 ? 0.2948 0.2055 0.2189 -0.0089 0.0028  0.0515  1892 ASN A O   
1860 C  CB  . ASN A 213 ? 0.2442 0.2066 0.1921 -0.0211 -0.0268 0.0273  1892 ASN A CB  
1861 C  CG  . ASN A 213 ? 0.3045 0.2520 0.1701 -0.0160 -0.0437 0.0540  1892 ASN A CG  
1862 O  OD1 . ASN A 213 ? 0.2972 0.2082 0.2372 0.0248  0.0168  0.0566  1892 ASN A OD1 
1863 N  ND2 . ASN A 213 ? 0.3580 0.2736 0.1657 -0.0387 -0.0292 0.0034  1892 ASN A ND2 
1864 N  N   . ARG A 214 ? 0.1797 0.1777 0.2101 -0.0280 -0.0246 0.0480  1893 ARG A N   
1865 C  CA  . ARG A 214 ? 0.1938 0.2221 0.2247 -0.0061 -0.0382 0.0302  1893 ARG A CA  
1866 C  C   . ARG A 214 ? 0.2143 0.2099 0.2393 -0.0206 -0.0424 0.0356  1893 ARG A C   
1867 O  O   . ARG A 214 ? 0.2555 0.2270 0.3190 -0.0090 -0.0436 0.0209  1893 ARG A O   
1868 C  CB  . ARG A 214 ? 0.1887 0.2245 0.2208 -0.0143 -0.0451 0.0484  1893 ARG A CB  
1869 C  CG  . ARG A 214 ? 0.1966 0.2335 0.2430 0.0014  -0.0474 0.0402  1893 ARG A CG  
1870 C  CD  . ARG A 214 ? 0.2705 0.3238 0.3120 0.0066  -0.0309 0.0288  1893 ARG A CD  
1871 N  NE  . ARG A 214 ? 0.3038 0.3903 0.3264 0.0750  -0.0968 0.0488  1893 ARG A NE  
1872 C  CZ  . ARG A 214 ? 0.3766 0.3764 0.3444 0.0373  -0.0325 0.0227  1893 ARG A CZ  
1873 N  NH1 . ARG A 214 ? 0.1684 0.3790 0.3518 0.0353  -0.0407 0.0985  1893 ARG A NH1 
1874 N  NH2 . ARG A 214 ? 0.2532 0.3680 0.3711 0.0487  -0.0431 0.0310  1893 ARG A NH2 
1875 N  N   . SER A 215 ? 0.2060 0.2321 0.2245 -0.0386 -0.0468 0.0518  1894 SER A N   
1876 C  CA  . SER A 215 ? 0.2263 0.2601 0.2276 -0.0172 -0.0206 0.0568  1894 SER A CA  
1877 C  C   . SER A 215 ? 0.1953 0.2611 0.2191 -0.0486 -0.0143 0.0769  1894 SER A C   
1878 O  O   . SER A 215 ? 0.1847 0.2554 0.2467 -0.0363 -0.0306 0.0802  1894 SER A O   
1879 C  CB  . SER A 215 ? 0.2448 0.3622 0.2443 -0.0223 -0.0353 0.0290  1894 SER A CB  
1880 O  OG  . SER A 215 ? 0.3600 0.4030 0.2680 0.0151  -0.0141 0.0922  1894 SER A OG  
1881 N  N   . PRO A 216 ? 0.1886 0.2531 0.2284 -0.0199 -0.0247 0.0657  1895 PRO A N   
1882 C  CA  . PRO A 216 ? 0.2235 0.2983 0.2446 -0.0465 0.0081  0.0631  1895 PRO A CA  
1883 C  C   . PRO A 216 ? 0.2206 0.3117 0.2643 -0.0511 0.0210  0.0458  1895 PRO A C   
1884 O  O   . PRO A 216 ? 0.3193 0.3736 0.2908 -0.0145 0.0014  0.0666  1895 PRO A O   
1885 C  CB  . PRO A 216 ? 0.2574 0.3335 0.2566 -0.0280 0.0064  0.0605  1895 PRO A CB  
1886 C  CG  . PRO A 216 ? 0.2669 0.3131 0.2079 -0.0095 -0.0066 0.0687  1895 PRO A CG  
1887 C  CD  . PRO A 216 ? 0.2376 0.2908 0.2158 -0.0206 0.0003  0.0923  1895 PRO A CD  
1888 N  N   . GLY A 217 ? 0.2353 0.3414 0.3014 -0.0861 0.0042  0.0433  1896 GLY A N   
1889 C  CA  . GLY A 217 ? 0.2570 0.3144 0.2928 -0.0609 -0.0485 0.0589  1896 GLY A CA  
1890 C  C   . GLY A 217 ? 0.2501 0.3244 0.2854 -0.0734 -0.0521 0.0616  1896 GLY A C   
1891 O  O   . GLY A 217 ? 0.2928 0.3518 0.2910 -0.0866 -0.0698 0.0802  1896 GLY A O   
1892 N  N   . ALA A 218 ? 0.2383 0.2398 0.2650 -0.0615 -0.0322 0.0743  1897 ALA A N   
1893 C  CA  . ALA A 218 ? 0.2439 0.1999 0.2308 -0.0425 -0.0467 0.0271  1897 ALA A CA  
1894 C  C   . ALA A 218 ? 0.2209 0.1885 0.2157 -0.0378 -0.0111 0.0296  1897 ALA A C   
1895 O  O   . ALA A 218 ? 0.2518 0.2454 0.2463 -0.0217 0.0035  0.0531  1897 ALA A O   
1896 C  CB  . ALA A 218 ? 0.2207 0.2125 0.2584 -0.0008 -0.0242 0.0464  1897 ALA A CB  
1897 N  N   . GLY A 219 ? 0.1878 0.1756 0.2067 -0.0455 -0.0260 0.0261  1898 GLY A N   
1898 C  CA  . GLY A 219 ? 0.1705 0.1344 0.2169 -0.0526 -0.0082 0.0514  1898 GLY A CA  
1899 C  C   . GLY A 219 ? 0.1307 0.1754 0.2221 -0.0226 -0.0244 0.0301  1898 GLY A C   
1900 O  O   . GLY A 219 ? 0.1515 0.1666 0.2116 -0.0165 -0.0535 0.0497  1898 GLY A O   
1901 N  N   . PRO A 220 ? 0.1303 0.1435 0.1801 -0.0369 -0.0360 0.0327  1899 PRO A N   
1902 C  CA  . PRO A 220 ? 0.1008 0.1159 0.1890 -0.0121 -0.0272 0.0201  1899 PRO A CA  
1903 C  C   . PRO A 220 ? 0.1388 0.1034 0.1715 0.0111  -0.0286 0.0284  1899 PRO A C   
1904 O  O   . PRO A 220 ? 0.1060 0.1203 0.2067 -0.0046 -0.0112 0.0088  1899 PRO A O   
1905 C  CB  . PRO A 220 ? 0.1462 0.1215 0.1769 -0.0014 -0.0338 0.0482  1899 PRO A CB  
1906 C  CG  . PRO A 220 ? 0.1188 0.1561 0.2876 -0.0561 -0.0213 0.0461  1899 PRO A CG  
1907 C  CD  . PRO A 220 ? 0.1372 0.1657 0.2089 -0.0363 -0.0748 0.0359  1899 PRO A CD  
1908 N  N   . THR A 221 ? 0.1025 0.1340 0.1641 -0.0094 -0.0214 0.0305  1900 THR A N   
1909 C  CA  . THR A 221 ? 0.1120 0.1436 0.1199 -0.0007 -0.0165 0.0165  1900 THR A CA  
1910 C  C   . THR A 221 ? 0.0810 0.1441 0.1132 -0.0092 -0.0334 0.0024  1900 THR A C   
1911 O  O   . THR A 221 ? 0.0925 0.1232 0.1641 0.0164  -0.0214 0.0224  1900 THR A O   
1912 C  CB  . THR A 221 ? 0.1066 0.1493 0.1293 0.0028  -0.0229 -0.0045 1900 THR A CB  
1913 O  OG1 . THR A 221 ? 0.1191 0.1444 0.1671 -0.0030 -0.0439 0.0268  1900 THR A OG1 
1914 C  CG2 . THR A 221 ? 0.1139 0.1695 0.1857 0.0053  -0.0135 -0.0056 1900 THR A CG2 
1915 N  N   . VAL A 222 ? 0.0924 0.1131 0.1279 -0.0019 -0.0179 0.0042  1901 VAL A N   
1916 C  CA  . VAL A 222 ? 0.0735 0.1032 0.1254 -0.0265 -0.0173 0.0096  1901 VAL A CA  
1917 C  C   . VAL A 222 ? 0.0885 0.0934 0.1434 0.0024  -0.0129 0.0272  1901 VAL A C   
1918 O  O   . VAL A 222 ? 0.0765 0.1257 0.2050 0.0160  -0.0200 0.0248  1901 VAL A O   
1919 C  CB  . VAL A 222 ? 0.0879 0.1183 0.1555 0.0088  -0.0298 0.0012  1901 VAL A CB  
1920 C  CG1 . VAL A 222 ? 0.1231 0.1401 0.1650 0.0124  -0.0258 0.0257  1901 VAL A CG1 
1921 C  CG2 . VAL A 222 ? 0.0852 0.1206 0.2235 -0.0013 -0.0530 -0.0194 1901 VAL A CG2 
1922 N  N   . VAL A 223 ? 0.0677 0.0859 0.1460 -0.0052 -0.0155 0.0182  1902 VAL A N   
1923 C  CA  . VAL A 223 ? 0.0922 0.0980 0.1424 -0.0101 -0.0072 0.0042  1902 VAL A CA  
1924 C  C   . VAL A 223 ? 0.0778 0.0856 0.1381 -0.0084 -0.0159 0.0178  1902 VAL A C   
1925 O  O   . VAL A 223 ? 0.0578 0.1209 0.1600 0.0182  -0.0275 0.0162  1902 VAL A O   
1926 C  CB  . VAL A 223 ? 0.0784 0.1115 0.1275 0.0067  0.0000  -0.0201 1902 VAL A CB  
1927 C  CG1 . VAL A 223 ? 0.0687 0.1235 0.1568 -0.0333 -0.0287 0.0145  1902 VAL A CG1 
1928 C  CG2 . VAL A 223 ? 0.1056 0.1396 0.1332 -0.0073 -0.0128 0.0042  1902 VAL A CG2 
1929 N  N   . HIS A 224 ? 0.0718 0.0991 0.1108 -0.0076 -0.0111 0.0104  1903 HIS A N   
1930 C  CA  . HIS A 224 ? 0.0725 0.0955 0.1357 -0.0146 0.0051  0.0102  1903 HIS A CA  
1931 C  C   . HIS A 224 ? 0.0526 0.1006 0.1486 0.0136  -0.0057 0.0045  1903 HIS A C   
1932 O  O   . HIS A 224 ? 0.0442 0.1210 0.1834 0.0088  -0.0407 -0.0012 1903 HIS A O   
1933 C  CB  . HIS A 224 ? 0.0967 0.1096 0.1290 -0.0039 -0.0342 -0.0235 1903 HIS A CB  
1934 C  CG  . HIS A 224 ? 0.0772 0.0911 0.1450 0.0121  -0.0301 -0.0127 1903 HIS A CG  
1935 N  ND1 . HIS A 224 ? 0.0622 0.1422 0.1365 0.0067  -0.0219 -0.0161 1903 HIS A ND1 
1936 C  CD2 . HIS A 224 ? 0.1270 0.1259 0.1616 0.0083  -0.0752 -0.0293 1903 HIS A CD2 
1937 C  CE1 . HIS A 224 ? 0.0787 0.1258 0.1773 0.0243  -0.0253 0.0189  1903 HIS A CE1 
1938 N  NE2 . HIS A 224 ? 0.1186 0.1215 0.1383 0.0088  -0.0384 -0.0084 1903 HIS A NE2 
1939 N  N   . CYS A 225 ? 0.0500 0.1134 0.1482 0.0094  -0.0005 0.0239  1904 CYS A N   
1940 C  CA  . CYS A 225 ? 0.0841 0.0996 0.1583 0.0143  -0.0008 0.0194  1904 CYS A CA  
1941 C  C   . CYS A 225 ? 0.0906 0.1287 0.1634 0.0313  -0.0103 0.0283  1904 CYS A C   
1942 O  O   . CYS A 225 ? 0.1592 0.1512 0.1844 -0.0531 -0.0255 0.0491  1904 CYS A O   
1943 C  CB  . CYS A 225 ? 0.0902 0.1192 0.1695 0.0021  -0.0286 0.0028  1904 CYS A CB  
1944 S  SG  . CYS A 225 ? 0.0991 0.1350 0.3189 0.0080  -0.0245 -0.0140 1904 CYS A SG  
1945 N  N   . SER A 226 ? 0.0945 0.1190 0.1405 0.0067  -0.0300 0.0157  1905 SER A N   
1946 C  CA  . SER A 226 ? 0.0873 0.0978 0.1597 0.0250  -0.0095 0.0004  1905 SER A CA  
1947 C  C   . SER A 226 ? 0.0871 0.1451 0.1706 0.0261  -0.0406 0.0082  1905 SER A C   
1948 O  O   . SER A 226 ? 0.0977 0.1497 0.2196 0.0042  -0.0441 -0.0022 1905 SER A O   
1949 C  CB  . SER A 226 ? 0.0872 0.1226 0.1517 -0.0076 0.0113  0.0140  1905 SER A CB  
1950 O  OG  . SER A 226 ? 0.0964 0.1426 0.1747 -0.0019 -0.0219 0.0078  1905 SER A OG  
1951 N  N   . ALA A 227 ? 0.0859 0.1775 0.2229 0.0338  -0.0123 -0.0039 1906 ALA A N   
1952 C  CA  . ALA A 227 ? 0.0708 0.1457 0.2076 0.0359  -0.0291 0.0015  1906 ALA A CA  
1953 C  C   . ALA A 227 ? 0.0819 0.1316 0.1962 0.0199  0.0027  0.0236  1906 ALA A C   
1954 O  O   . ALA A 227 ? 0.0458 0.1732 0.2270 0.0084  -0.0030 0.0219  1906 ALA A O   
1955 C  CB  . ALA A 227 ? 0.1330 0.1827 0.2266 0.0367  -0.0085 0.0301  1906 ALA A CB  
1956 N  N   . GLY A 228 ? 0.0820 0.1103 0.1915 0.0201  -0.0050 -0.0027 1907 GLY A N   
1957 C  CA  . GLY A 228 ? 0.0792 0.1421 0.2046 0.0065  -0.0239 -0.0291 1907 GLY A CA  
1958 C  C   . GLY A 228 ? 0.0821 0.1593 0.2165 0.0110  -0.0182 -0.0515 1907 GLY A C   
1959 O  O   . GLY A 228 ? 0.0830 0.2057 0.3017 -0.0291 -0.0230 -0.0606 1907 GLY A O   
1960 N  N   . VAL A 229 ? 0.0917 0.1210 0.2169 0.0039  -0.0550 -0.0249 1908 VAL A N   
1961 C  CA  . VAL A 229 ? 0.1293 0.1483 0.2098 0.0139  -0.0403 -0.0007 1908 VAL A CA  
1962 C  C   . VAL A 229 ? 0.1143 0.1218 0.1786 0.0039  -0.0317 0.0298  1908 VAL A C   
1963 O  O   . VAL A 229 ? 0.1095 0.1921 0.2069 -0.0492 -0.0265 0.0225  1908 VAL A O   
1964 C  CB  . VAL A 229 ? 0.1285 0.1952 0.2115 -0.0500 -0.0514 -0.0002 1908 VAL A CB  
1965 C  CG1 . VAL A 229 ? 0.1638 0.1801 0.2551 0.0117  -0.0590 0.0118  1908 VAL A CG1 
1966 C  CG2 . VAL A 229 ? 0.1834 0.1833 0.1921 -0.0124 0.0048  0.0113  1908 VAL A CG2 
1967 N  N   . GLY A 230 ? 0.1024 0.1655 0.2043 0.0192  -0.0207 0.0009  1909 GLY A N   
1968 C  CA  . GLY A 230 ? 0.1148 0.1448 0.2106 0.0033  -0.0655 0.0078  1909 GLY A CA  
1969 C  C   . GLY A 230 ? 0.1167 0.1287 0.1712 -0.0212 -0.0132 0.0196  1909 GLY A C   
1970 O  O   . GLY A 230 ? 0.0952 0.1381 0.1909 0.0073  -0.0232 0.0102  1909 GLY A O   
1971 N  N   . ARG A 231 ? 0.0983 0.1280 0.2012 -0.0320 -0.0473 0.0245  1910 ARG A N   
1972 C  CA  . ARG A 231 ? 0.1127 0.1315 0.1670 -0.0096 -0.0304 0.0282  1910 ARG A CA  
1973 C  C   . ARG A 231 ? 0.0989 0.1047 0.1516 -0.0288 -0.0370 -0.0108 1910 ARG A C   
1974 O  O   . ARG A 231 ? 0.0724 0.1477 0.1555 0.0015  -0.0240 -0.0089 1910 ARG A O   
1975 C  CB  . ARG A 231 ? 0.1032 0.1380 0.2071 -0.0357 -0.0071 0.0072  1910 ARG A CB  
1976 C  CG  . ARG A 231 ? 0.1100 0.1517 0.2270 -0.0306 0.0036  -0.0106 1910 ARG A CG  
1977 C  CD  . ARG A 231 ? 0.0710 0.1724 0.2441 -0.0051 0.0357  0.0240  1910 ARG A CD  
1978 N  NE  . ARG A 231 ? 0.1039 0.1492 0.2656 -0.0082 0.0413  -0.0064 1910 ARG A NE  
1979 C  CZ  . ARG A 231 ? 0.0966 0.1681 0.3160 -0.0259 0.0347  -0.0269 1910 ARG A CZ  
1980 N  NH1 . ARG A 231 ? 0.1394 0.1658 0.2926 -0.0249 0.0321  -0.0016 1910 ARG A NH1 
1981 N  NH2 . ARG A 231 ? 0.1893 0.2044 0.3299 -0.0211 0.0639  0.0211  1910 ARG A NH2 
1982 N  N   . THR A 232 ? 0.0811 0.1084 0.1810 -0.0243 -0.0332 0.0025  1911 THR A N   
1983 C  CA  A THR A 232 ? 0.0756 0.1258 0.1465 -0.0112 -0.0162 -0.0005 1911 THR A CA  
1984 C  CA  B THR A 232 ? 0.0870 0.1258 0.1542 -0.0118 -0.0214 0.0032  1911 THR A CA  
1985 C  C   . THR A 232 ? 0.0784 0.1149 0.1540 -0.0072 -0.0128 0.0269  1911 THR A C   
1986 O  O   . THR A 232 ? 0.0815 0.1164 0.1626 -0.0037 -0.0425 0.0063  1911 THR A O   
1987 C  CB  A THR A 232 ? 0.0607 0.1248 0.1420 0.0058  -0.0347 -0.0088 1911 THR A CB  
1988 C  CB  B THR A 232 ? 0.0968 0.1235 0.1572 0.0085  -0.0437 -0.0009 1911 THR A CB  
1989 O  OG1 A THR A 232 ? 0.0737 0.1285 0.1619 0.0323  -0.0172 -0.0299 1911 THR A OG1 
1990 O  OG1 B THR A 232 ? 0.0867 0.1549 0.1955 0.0084  -0.0246 -0.0248 1911 THR A OG1 
1991 C  CG2 A THR A 232 ? 0.0337 0.1328 0.0996 0.0002  0.0079  0.0052  1911 THR A CG2 
1992 C  CG2 B THR A 232 ? 0.0913 0.0984 0.1264 0.0069  -0.0547 0.0210  1911 THR A CG2 
1993 N  N   . GLY A 233 ? 0.0628 0.1119 0.1832 -0.0083 -0.0264 -0.0072 1912 GLY A N   
1994 C  CA  . GLY A 233 ? 0.0745 0.1405 0.1408 0.0025  -0.0465 -0.0017 1912 GLY A CA  
1995 C  C   . GLY A 233 ? 0.1001 0.0897 0.1552 0.0157  -0.0146 0.0068  1912 GLY A C   
1996 O  O   . GLY A 233 ? 0.0966 0.1344 0.1481 0.0023  -0.0156 0.0082  1912 GLY A O   
1997 N  N   . THR A 234 ? 0.0675 0.1187 0.1549 -0.0140 -0.0186 -0.0027 1913 THR A N   
1998 C  CA  . THR A 234 ? 0.0929 0.1148 0.1654 0.0123  -0.0234 -0.0049 1913 THR A CA  
1999 C  C   . THR A 234 ? 0.0769 0.1095 0.1564 0.0013  -0.0161 -0.0047 1913 THR A C   
2000 O  O   . THR A 234 ? 0.0819 0.1187 0.1618 0.0096  -0.0251 -0.0148 1913 THR A O   
2001 C  CB  . THR A 234 ? 0.0957 0.1134 0.1606 -0.0251 -0.0213 0.0153  1913 THR A CB  
2002 O  OG1 . THR A 234 ? 0.0837 0.1275 0.2123 -0.0185 -0.0300 0.0181  1913 THR A OG1 
2003 C  CG2 . THR A 234 ? 0.1087 0.1595 0.1855 -0.0235 -0.0543 -0.0306 1913 THR A CG2 
2004 N  N   . PHE A 235 ? 0.0611 0.0814 0.1542 -0.0057 -0.0086 -0.0029 1914 PHE A N   
2005 C  CA  . PHE A 235 ? 0.0982 0.1057 0.1241 -0.0168 -0.0142 -0.0082 1914 PHE A CA  
2006 C  C   . PHE A 235 ? 0.0994 0.0824 0.1321 0.0056  -0.0267 0.0123  1914 PHE A C   
2007 O  O   . PHE A 235 ? 0.0819 0.1248 0.1320 0.0124  -0.0329 -0.0061 1914 PHE A O   
2008 C  CB  . PHE A 235 ? 0.0959 0.1018 0.1199 0.0074  -0.0303 -0.0377 1914 PHE A CB  
2009 C  CG  . PHE A 235 ? 0.0780 0.0819 0.1479 0.0078  -0.0106 -0.0026 1914 PHE A CG  
2010 C  CD1 . PHE A 235 ? 0.0897 0.1474 0.1540 0.0312  -0.0190 -0.0101 1914 PHE A CD1 
2011 C  CD2 . PHE A 235 ? 0.1201 0.1235 0.1576 -0.0064 -0.0027 0.0003  1914 PHE A CD2 
2012 C  CE1 . PHE A 235 ? 0.0794 0.1423 0.1363 -0.0096 -0.0100 0.0005  1914 PHE A CE1 
2013 C  CE2 . PHE A 235 ? 0.1175 0.0863 0.2013 0.0045  -0.0305 -0.0119 1914 PHE A CE2 
2014 C  CZ  . PHE A 235 ? 0.1021 0.1046 0.1756 0.0139  -0.0484 -0.0122 1914 PHE A CZ  
2015 N  N   . ILE A 236 ? 0.0759 0.1118 0.1413 0.0070  -0.0130 -0.0070 1915 ILE A N   
2016 C  CA  . ILE A 236 ? 0.0674 0.1360 0.1271 0.0020  -0.0244 -0.0307 1915 ILE A CA  
2017 C  C   . ILE A 236 ? 0.0582 0.1229 0.1545 -0.0038 -0.0051 0.0010  1915 ILE A C   
2018 O  O   . ILE A 236 ? 0.0640 0.1412 0.1682 -0.0052 -0.0107 -0.0083 1915 ILE A O   
2019 C  CB  . ILE A 236 ? 0.0756 0.1388 0.1315 0.0178  -0.0184 -0.0141 1915 ILE A CB  
2020 C  CG1 . ILE A 236 ? 0.0560 0.1339 0.1585 -0.0150 -0.0371 -0.0191 1915 ILE A CG1 
2021 C  CG2 . ILE A 236 ? 0.0706 0.1187 0.1315 -0.0162 0.0074  -0.0090 1915 ILE A CG2 
2022 C  CD1 . ILE A 236 ? 0.0796 0.1847 0.1738 -0.0163 -0.0506 -0.0135 1915 ILE A CD1 
2023 N  N   . ALA A 237 ? 0.0585 0.1235 0.1573 0.0167  -0.0068 -0.0108 1916 ALA A N   
2024 C  CA  . ALA A 237 ? 0.0673 0.1096 0.1590 0.0145  -0.0261 -0.0154 1916 ALA A CA  
2025 C  C   . ALA A 237 ? 0.1026 0.1241 0.1310 0.0137  -0.0011 -0.0178 1916 ALA A C   
2026 O  O   . ALA A 237 ? 0.0858 0.1656 0.1459 0.0196  -0.0182 -0.0262 1916 ALA A O   
2027 C  CB  . ALA A 237 ? 0.0909 0.1048 0.1728 0.0066  -0.0026 0.0026  1916 ALA A CB  
2028 N  N   . LEU A 238 ? 0.0766 0.1191 0.1373 0.0253  -0.0362 -0.0121 1917 LEU A N   
2029 C  CA  . LEU A 238 ? 0.0904 0.1457 0.1396 0.0231  -0.0156 0.0034  1917 LEU A CA  
2030 C  C   . LEU A 238 ? 0.0696 0.1484 0.1495 0.0206  -0.0244 -0.0161 1917 LEU A C   
2031 O  O   . LEU A 238 ? 0.0923 0.1756 0.1428 0.0065  -0.0375 -0.0020 1917 LEU A O   
2032 C  CB  . LEU A 238 ? 0.0940 0.1582 0.1477 0.0127  -0.0158 -0.0132 1917 LEU A CB  
2033 C  CG  . LEU A 238 ? 0.0736 0.1588 0.1700 0.0156  -0.0524 -0.0406 1917 LEU A CG  
2034 C  CD1 . LEU A 238 ? 0.0905 0.2266 0.1755 0.0032  -0.0422 -0.0300 1917 LEU A CD1 
2035 C  CD2 . LEU A 238 ? 0.0839 0.1918 0.2158 0.0179  -0.0045 -0.0156 1917 LEU A CD2 
2036 N  N   . ASP A 239 ? 0.0807 0.1371 0.1399 0.0131  -0.0134 -0.0045 1918 ASP A N   
2037 C  CA  . ASP A 239 ? 0.0888 0.1433 0.1336 -0.0022 -0.0090 0.0026  1918 ASP A CA  
2038 C  C   . ASP A 239 ? 0.1042 0.1695 0.1253 -0.0050 -0.0205 0.0019  1918 ASP A C   
2039 O  O   . ASP A 239 ? 0.1069 0.1949 0.1392 0.0314  -0.0102 -0.0223 1918 ASP A O   
2040 C  CB  . ASP A 239 ? 0.0803 0.1578 0.1439 -0.0022 -0.0303 -0.0098 1918 ASP A CB  
2041 C  CG  . ASP A 239 ? 0.0973 0.1515 0.2014 0.0010  -0.0579 0.0116  1918 ASP A CG  
2042 O  OD1 . ASP A 239 ? 0.0955 0.1843 0.1921 0.0012  -0.0431 0.0108  1918 ASP A OD1 
2043 O  OD2 . ASP A 239 ? 0.0880 0.1545 0.2681 -0.0164 -0.0658 0.0383  1918 ASP A OD2 
2044 N  N   . ARG A 240 ? 0.0830 0.1534 0.1222 0.0247  -0.0018 -0.0227 1919 ARG A N   
2045 C  CA  . ARG A 240 ? 0.1080 0.1830 0.1098 0.0254  -0.0053 -0.0263 1919 ARG A CA  
2046 C  C   . ARG A 240 ? 0.1081 0.1604 0.1635 0.0296  -0.0074 -0.0087 1919 ARG A C   
2047 O  O   . ARG A 240 ? 0.1484 0.2114 0.1546 0.0111  -0.0202 -0.0171 1919 ARG A O   
2048 C  CB  . ARG A 240 ? 0.0875 0.1831 0.1718 0.0450  -0.0144 -0.0250 1919 ARG A CB  
2049 C  CG  . ARG A 240 ? 0.0837 0.1888 0.1636 0.0111  -0.0402 -0.0327 1919 ARG A CG  
2050 C  CD  . ARG A 240 ? 0.0850 0.2741 0.2229 0.0562  -0.0327 -0.0072 1919 ARG A CD  
2051 N  NE  . ARG A 240 ? 0.0836 0.3394 0.2846 0.0503  -0.0205 -0.0419 1919 ARG A NE  
2052 C  CZ  . ARG A 240 ? 0.0952 0.2905 0.2441 0.0248  -0.0442 -0.0254 1919 ARG A CZ  
2053 N  NH1 . ARG A 240 ? 0.1397 0.2168 0.2894 0.0210  -0.0184 0.0038  1919 ARG A NH1 
2054 N  NH2 . ARG A 240 ? 0.2004 0.3137 0.3224 0.0151  0.0419  -0.1334 1919 ARG A NH2 
2055 N  N   . ILE A 241 ? 0.1200 0.1801 0.1530 0.0222  -0.0330 -0.0244 1920 ILE A N   
2056 C  CA  A ILE A 241 ? 0.1574 0.2022 0.1732 0.0223  -0.0410 -0.0106 1920 ILE A CA  
2057 C  CA  B ILE A 241 ? 0.1142 0.1660 0.1451 0.0272  -0.0354 -0.0182 1920 ILE A CA  
2058 C  C   . ILE A 241 ? 0.1667 0.1907 0.1718 0.0472  -0.0278 -0.0197 1920 ILE A C   
2059 O  O   . ILE A 241 ? 0.1735 0.2142 0.1804 0.0589  -0.0515 -0.0419 1920 ILE A O   
2060 C  CB  A ILE A 241 ? 0.2141 0.2250 0.2087 0.0109  -0.0629 0.0057  1920 ILE A CB  
2061 C  CB  B ILE A 241 ? 0.0915 0.1693 0.1215 0.0304  -0.0599 -0.0067 1920 ILE A CB  
2062 C  CG1 A ILE A 241 ? 0.2294 0.3054 0.2415 0.0315  -0.0381 0.0066  1920 ILE A CG1 
2063 C  CG1 B ILE A 241 ? 0.1017 0.1027 0.0958 0.0280  -0.0047 -0.0451 1920 ILE A CG1 
2064 C  CG2 A ILE A 241 ? 0.2843 0.3161 0.2844 -0.0117 -0.0250 0.0002  1920 ILE A CG2 
2065 C  CG2 B ILE A 241 ? 0.0455 0.1825 0.1541 0.0185  -0.0487 -0.0050 1920 ILE A CG2 
2066 C  CD1 A ILE A 241 ? 0.3203 0.2584 0.2821 -0.0208 -0.0525 0.0290  1920 ILE A CD1 
2067 C  CD1 B ILE A 241 ? 0.0987 0.1253 0.1291 -0.0079 -0.0397 -0.0295 1920 ILE A CD1 
2068 N  N   . LEU A 242 ? 0.1416 0.1826 0.1661 0.0214  -0.0433 -0.0126 1921 LEU A N   
2069 C  CA  . LEU A 242 ? 0.1570 0.1995 0.1491 0.0327  -0.0445 -0.0323 1921 LEU A CA  
2070 C  C   . LEU A 242 ? 0.1779 0.2105 0.1451 0.0176  -0.0582 -0.0332 1921 LEU A C   
2071 O  O   . LEU A 242 ? 0.1861 0.2749 0.1877 0.0241  -0.0743 -0.0059 1921 LEU A O   
2072 C  CB  . LEU A 242 ? 0.1424 0.1973 0.2085 0.0258  -0.0365 -0.0366 1921 LEU A CB  
2073 C  CG  . LEU A 242 ? 0.1401 0.1777 0.1880 0.0168  -0.0510 -0.0497 1921 LEU A CG  
2074 C  CD1 . LEU A 242 ? 0.0856 0.2918 0.2229 0.0613  -0.0539 -0.0614 1921 LEU A CD1 
2075 C  CD2 . LEU A 242 ? 0.1715 0.2765 0.2556 -0.0506 -0.0432 -0.0766 1921 LEU A CD2 
2076 N  N   . GLN A 243 ? 0.1490 0.2135 0.2105 0.0058  -0.0176 -0.0327 1922 GLN A N   
2077 C  CA  . GLN A 243 ? 0.1910 0.2278 0.1802 0.0118  -0.0412 -0.0278 1922 GLN A CA  
2078 C  C   . GLN A 243 ? 0.2159 0.2541 0.2155 0.0261  -0.0150 -0.0261 1922 GLN A C   
2079 O  O   . GLN A 243 ? 0.2657 0.2897 0.2313 0.0142  -0.0265 -0.0325 1922 GLN A O   
2080 C  CB  . GLN A 243 ? 0.1708 0.2267 0.1992 -0.0118 -0.0205 -0.0163 1922 GLN A CB  
2081 C  CG  . GLN A 243 ? 0.1532 0.2292 0.1949 0.0027  -0.0248 -0.0170 1922 GLN A CG  
2082 C  CD  . GLN A 243 ? 0.1616 0.2376 0.2147 0.0062  -0.0080 -0.0008 1922 GLN A CD  
2083 O  OE1 . GLN A 243 ? 0.2071 0.3113 0.2234 -0.0296 0.0108  0.0253  1922 GLN A OE1 
2084 N  NE2 . GLN A 243 ? 0.1670 0.1898 0.2241 0.0257  0.0014  -0.0047 1922 GLN A NE2 
2085 N  N   . GLN A 244 ? 0.2281 0.2610 0.1868 0.0454  -0.0062 -0.0247 1923 GLN A N   
2086 C  CA  A GLN A 244 ? 0.2574 0.2719 0.2185 0.0516  -0.0209 -0.0240 1923 GLN A CA  
2087 C  CA  B GLN A 244 ? 0.2562 0.2702 0.2162 0.0469  -0.0169 -0.0261 1923 GLN A CA  
2088 C  C   . GLN A 244 ? 0.2765 0.2683 0.2187 0.0457  -0.0192 -0.0445 1923 GLN A C   
2089 O  O   . GLN A 244 ? 0.3197 0.3183 0.2069 0.0858  -0.0347 -0.0561 1923 GLN A O   
2090 C  CB  A GLN A 244 ? 0.2431 0.2731 0.2400 0.0574  -0.0224 -0.0177 1923 GLN A CB  
2091 C  CB  B GLN A 244 ? 0.2443 0.2689 0.2328 0.0489  -0.0149 -0.0203 1923 GLN A CB  
2092 C  CG  A GLN A 244 ? 0.1673 0.2985 0.2784 0.0094  -0.0385 -0.0173 1923 GLN A CG  
2093 C  CG  B GLN A 244 ? 0.1954 0.2809 0.2609 0.0092  -0.0150 -0.0174 1923 GLN A CG  
2094 C  CD  A GLN A 244 ? 0.2618 0.2849 0.3134 0.0107  -0.0566 -0.0102 1923 GLN A CD  
2095 C  CD  B GLN A 244 ? 0.2115 0.2675 0.2565 0.0236  0.0054  -0.0254 1923 GLN A CD  
2096 O  OE1 A GLN A 244 ? 0.1993 0.2329 0.2489 0.0539  -0.1101 -0.0399 1923 GLN A OE1 
2097 O  OE1 B GLN A 244 ? 0.2201 0.2521 0.2812 0.0219  -0.0337 -0.0672 1923 GLN A OE1 
2098 N  NE2 A GLN A 244 ? 0.2314 0.3622 0.3259 0.0689  -0.0543 -0.0138 1923 GLN A NE2 
2099 N  NE2 B GLN A 244 ? 0.1990 0.3187 0.3289 0.0203  0.0061  -0.0352 1923 GLN A NE2 
2100 N  N   . LEU A 245 ? 0.2564 0.2943 0.1817 0.0443  -0.0337 -0.0400 1924 LEU A N   
2101 C  CA  . LEU A 245 ? 0.2914 0.2793 0.2286 0.0137  -0.0432 -0.0362 1924 LEU A CA  
2102 C  C   . LEU A 245 ? 0.3415 0.3198 0.2455 0.0059  -0.0479 -0.0150 1924 LEU A C   
2103 O  O   . LEU A 245 ? 0.3524 0.3766 0.2658 0.0150  -0.0983 -0.0082 1924 LEU A O   
2104 C  CB  . LEU A 245 ? 0.3004 0.3028 0.2279 0.0031  -0.0341 -0.0627 1924 LEU A CB  
2105 C  CG  . LEU A 245 ? 0.2939 0.2437 0.2617 0.0244  0.0090  -0.0839 1924 LEU A CG  
2106 C  CD1 . LEU A 245 ? 0.2899 0.2539 0.3517 0.0247  -0.0045 -0.0747 1924 LEU A CD1 
2107 C  CD2 . LEU A 245 ? 0.2339 0.2867 0.2808 0.0151  -0.0856 -0.0553 1924 LEU A CD2 
2108 N  N   . ASP A 246 ? 0.3399 0.3253 0.2567 0.0277  -0.0497 0.0034  1925 ASP A N   
2109 C  CA  . ASP A 246 ? 0.3956 0.3470 0.2958 0.0294  -0.0470 -0.0013 1925 ASP A CA  
2110 C  C   . ASP A 246 ? 0.4060 0.3719 0.3131 0.0202  -0.0347 0.0150  1925 ASP A C   
2111 O  O   . ASP A 246 ? 0.4402 0.3961 0.3268 0.0326  -0.0461 0.0349  1925 ASP A O   
2112 C  CB  . ASP A 246 ? 0.3933 0.3225 0.3069 0.0318  -0.0294 -0.0035 1925 ASP A CB  
2113 C  CG  . ASP A 246 ? 0.4280 0.4314 0.4470 0.0251  -0.0263 -0.0037 1925 ASP A CG  
2114 O  OD1 . ASP A 246 ? 0.3978 0.4730 0.4586 0.0643  -0.0789 0.0149  1925 ASP A OD1 
2115 O  OD2 . ASP A 246 ? 0.4797 0.4880 0.5247 0.0394  -0.0006 -0.0518 1925 ASP A OD2 
2116 N  N   . SER A 247 ? 0.4033 0.3671 0.3145 0.0354  -0.0157 0.0209  1926 SER A N   
2117 C  CA  . SER A 247 ? 0.4173 0.3993 0.3403 0.0221  -0.0165 0.0005  1926 SER A CA  
2118 C  C   . SER A 247 ? 0.4208 0.3982 0.3276 0.0185  0.0072  -0.0034 1926 SER A C   
2119 O  O   . SER A 247 ? 0.4668 0.4266 0.3510 0.0280  0.0153  0.0200  1926 SER A O   
2120 C  CB  . SER A 247 ? 0.4127 0.3996 0.3562 0.0018  0.0062  0.0145  1926 SER A CB  
2121 O  OG  . SER A 247 ? 0.4803 0.4613 0.3475 -0.0106 -0.0341 -0.0320 1926 SER A OG  
2122 N  N   . LYS A 248 ? 0.4168 0.4074 0.3087 0.0294  -0.0124 -0.0028 1927 LYS A N   
2123 C  CA  . LYS A 248 ? 0.3987 0.3987 0.2793 0.0528  -0.0099 -0.0136 1927 LYS A CA  
2124 C  C   . LYS A 248 ? 0.3885 0.4116 0.2470 0.0560  -0.0197 -0.0348 1927 LYS A C   
2125 O  O   . LYS A 248 ? 0.4158 0.4303 0.2622 0.0503  -0.0365 -0.0631 1927 LYS A O   
2126 C  CB  . LYS A 248 ? 0.4053 0.4168 0.3100 0.0331  -0.0188 -0.0080 1927 LYS A CB  
2127 C  CG  . LYS A 248 ? 0.4293 0.4053 0.3759 -0.0094 -0.0007 0.0013  1927 LYS A CG  
2128 C  CD  . LYS A 248 ? 0.4299 0.5008 0.4978 0.0100  0.0125  0.0083  1927 LYS A CD  
2129 C  CE  . LYS A 248 ? 0.5340 0.5115 0.5379 0.0063  -0.0135 -0.0217 1927 LYS A CE  
2130 N  NZ  . LYS A 248 ? 0.5611 0.5202 0.5591 0.0099  -0.0292 0.0022  1927 LYS A NZ  
2131 N  N   . ASP A 249 ? 0.4059 0.3890 0.2836 0.0638  -0.0385 -0.0340 1928 ASP A N   
2132 C  CA  . ASP A 249 ? 0.4035 0.4019 0.2662 0.0690  -0.0382 -0.0465 1928 ASP A CA  
2133 C  C   . ASP A 249 ? 0.3662 0.3551 0.2558 0.0686  -0.0600 -0.0579 1928 ASP A C   
2134 O  O   . ASP A 249 ? 0.3436 0.3378 0.2276 0.1068  -0.1022 -0.0759 1928 ASP A O   
2135 C  CB  . ASP A 249 ? 0.3931 0.3883 0.2638 0.0739  -0.0711 -0.0298 1928 ASP A CB  
2136 C  CG  . ASP A 249 ? 0.4722 0.4749 0.3256 0.0613  -0.0271 0.0034  1928 ASP A CG  
2137 O  OD1 . ASP A 249 ? 0.5021 0.5475 0.4224 0.0943  -0.0265 -0.0066 1928 ASP A OD1 
2138 O  OD2 . ASP A 249 ? 0.4994 0.5521 0.3978 0.0959  -0.0215 0.0299  1928 ASP A OD2 
2139 N  N   . SER A 250 ? 0.3329 0.3515 0.2624 0.1006  -0.0521 -0.0528 1929 SER A N   
2140 C  CA  A SER A 250 ? 0.3396 0.3506 0.2503 0.0821  -0.0282 -0.0420 1929 SER A CA  
2141 C  CA  B SER A 250 ? 0.3122 0.3351 0.2345 0.0834  -0.0289 -0.0421 1929 SER A CA  
2142 C  C   . SER A 250 ? 0.2725 0.3163 0.2308 0.0900  -0.0361 -0.0351 1929 SER A C   
2143 O  O   . SER A 250 ? 0.3169 0.3310 0.2304 0.0976  -0.0531 -0.0450 1929 SER A O   
2144 C  CB  A SER A 250 ? 0.3517 0.3365 0.2792 0.1038  -0.0264 -0.0292 1929 SER A CB  
2145 C  CB  B SER A 250 ? 0.3214 0.3106 0.2482 0.1027  -0.0295 -0.0266 1929 SER A CB  
2146 O  OG  A SER A 250 ? 0.4816 0.4081 0.3606 0.0394  -0.0244 -0.0041 1929 SER A OG  
2147 O  OG  B SER A 250 ? 0.3029 0.3495 0.2068 0.0666  -0.0189 -0.0187 1929 SER A OG  
2148 N  N   . VAL A 251 ? 0.2360 0.3370 0.2182 0.0950  -0.0568 -0.0554 1930 VAL A N   
2149 C  CA  . VAL A 251 ? 0.2207 0.3171 0.2251 0.0907  -0.0419 -0.0332 1930 VAL A CA  
2150 C  C   . VAL A 251 ? 0.2080 0.3120 0.2377 0.0742  -0.0679 -0.0408 1930 VAL A C   
2151 O  O   . VAL A 251 ? 0.1991 0.3014 0.2679 0.0852  -0.0840 -0.0346 1930 VAL A O   
2152 C  CB  . VAL A 251 ? 0.2166 0.3452 0.2465 0.0706  -0.0473 -0.0458 1930 VAL A CB  
2153 C  CG1 . VAL A 251 ? 0.1873 0.3633 0.2505 0.0518  -0.0571 -0.0327 1930 VAL A CG1 
2154 C  CG2 . VAL A 251 ? 0.1661 0.3073 0.2643 0.0877  -0.0278 -0.0432 1930 VAL A CG2 
2155 N  N   . ASP A 252 ? 0.1868 0.2640 0.1948 0.0774  -0.0861 -0.0354 1931 ASP A N   
2156 C  CA  . ASP A 252 ? 0.1502 0.2625 0.2256 0.0521  -0.0481 -0.0242 1931 ASP A CA  
2157 C  C   . ASP A 252 ? 0.1591 0.2226 0.2543 0.0607  -0.0413 -0.0181 1931 ASP A C   
2158 O  O   . ASP A 252 ? 0.1304 0.2403 0.2535 0.0350  -0.0433 -0.0471 1931 ASP A O   
2159 C  CB  . ASP A 252 ? 0.1517 0.2609 0.2471 0.0641  -0.0520 -0.0162 1931 ASP A CB  
2160 C  CG  . ASP A 252 ? 0.2305 0.2980 0.2581 0.0463  -0.0512 -0.0059 1931 ASP A CG  
2161 O  OD1 . ASP A 252 ? 0.1220 0.2664 0.2491 0.0664  -0.0512 -0.0702 1931 ASP A OD1 
2162 O  OD2 . ASP A 252 ? 0.1923 0.3708 0.3248 0.0641  -0.0349 0.0153  1931 ASP A OD2 
2163 N  N   . ILE A 253 ? 0.1217 0.1972 0.2530 0.0466  -0.0283 -0.0371 1932 ILE A N   
2164 C  CA  . ILE A 253 ? 0.1080 0.1841 0.2532 0.0441  -0.0405 -0.0202 1932 ILE A CA  
2165 C  C   . ILE A 253 ? 0.1236 0.1780 0.1938 0.0602  -0.0542 -0.0614 1932 ILE A C   
2166 O  O   . ILE A 253 ? 0.0994 0.1895 0.2130 0.0372  -0.0569 -0.0559 1932 ILE A O   
2167 C  CB  . ILE A 253 ? 0.1335 0.1962 0.2496 0.0263  -0.0430 -0.0140 1932 ILE A CB  
2168 C  CG1 . ILE A 253 ? 0.1217 0.2059 0.2769 0.0593  -0.0489 -0.0215 1932 ILE A CG1 
2169 C  CG2 . ILE A 253 ? 0.1500 0.2152 0.2554 -0.0205 -0.0137 -0.0610 1932 ILE A CG2 
2170 C  CD1 . ILE A 253 ? 0.1068 0.2330 0.2530 0.0008  -0.0870 -0.0577 1932 ILE A CD1 
2171 N  N   . TYR A 254 ? 0.1162 0.1696 0.2287 0.0531  -0.0481 -0.0476 1933 TYR A N   
2172 C  CA  . TYR A 254 ? 0.1164 0.1467 0.2100 0.0298  -0.0366 -0.0449 1933 TYR A CA  
2173 C  C   . TYR A 254 ? 0.1102 0.1617 0.1765 0.0188  -0.0233 -0.0448 1933 TYR A C   
2174 O  O   . TYR A 254 ? 0.1360 0.1767 0.2173 0.0110  -0.0432 -0.0716 1933 TYR A O   
2175 C  CB  . TYR A 254 ? 0.1289 0.1518 0.2292 0.0654  -0.0551 -0.0601 1933 TYR A CB  
2176 C  CG  . TYR A 254 ? 0.0907 0.1733 0.1904 0.0481  -0.0340 -0.0383 1933 TYR A CG  
2177 C  CD1 . TYR A 254 ? 0.1388 0.2362 0.2632 0.0636  -0.0283 -0.0072 1933 TYR A CD1 
2178 C  CD2 . TYR A 254 ? 0.1671 0.2064 0.2517 0.0449  -0.0295 -0.0576 1933 TYR A CD2 
2179 C  CE1 . TYR A 254 ? 0.1482 0.2162 0.2893 0.0497  -0.0766 -0.0122 1933 TYR A CE1 
2180 C  CE2 . TYR A 254 ? 0.1550 0.2512 0.2270 0.0701  -0.0706 0.0008  1933 TYR A CE2 
2181 C  CZ  . TYR A 254 ? 0.1554 0.2249 0.2706 0.0829  -0.0376 -0.0011 1933 TYR A CZ  
2182 O  OH  . TYR A 254 ? 0.1703 0.2714 0.3172 0.0905  -0.0698 0.0171  1933 TYR A OH  
2183 N  N   . GLY A 255 ? 0.0914 0.1752 0.1898 0.0267  -0.0376 -0.0525 1934 GLY A N   
2184 C  CA  . GLY A 255 ? 0.0880 0.1822 0.1643 0.0141  -0.0424 -0.0355 1934 GLY A CA  
2185 C  C   . GLY A 255 ? 0.0922 0.2171 0.1964 0.0184  -0.0365 -0.0462 1934 GLY A C   
2186 O  O   . GLY A 255 ? 0.1228 0.2001 0.2158 0.0077  -0.0588 -0.0209 1934 GLY A O   
2187 N  N   . ALA A 256 ? 0.0965 0.1800 0.1935 0.0369  -0.0173 -0.0266 1935 ALA A N   
2188 C  CA  . ALA A 256 ? 0.1194 0.1748 0.2155 0.0260  -0.0262 -0.0250 1935 ALA A CA  
2189 C  C   . ALA A 256 ? 0.0991 0.1508 0.2205 0.0521  -0.0215 -0.0275 1935 ALA A C   
2190 O  O   . ALA A 256 ? 0.1073 0.1819 0.2348 -0.0018 -0.0451 -0.0429 1935 ALA A O   
2191 C  CB  . ALA A 256 ? 0.0815 0.1892 0.2597 0.0561  -0.0627 -0.0325 1935 ALA A CB  
2192 N  N   . VAL A 257 ? 0.0799 0.1456 0.2043 0.0286  -0.0115 -0.0453 1936 VAL A N   
2193 C  CA  . VAL A 257 ? 0.1019 0.1301 0.2187 0.0202  -0.0023 -0.0219 1936 VAL A CA  
2194 C  C   . VAL A 257 ? 0.1113 0.1330 0.1829 0.0351  -0.0045 -0.0427 1936 VAL A C   
2195 O  O   . VAL A 257 ? 0.0811 0.1780 0.1809 0.0005  -0.0083 -0.0469 1936 VAL A O   
2196 C  CB  . VAL A 257 ? 0.1029 0.1245 0.2311 -0.0114 -0.0155 -0.0287 1936 VAL A CB  
2197 C  CG1 . VAL A 257 ? 0.1009 0.1513 0.2205 -0.0228 -0.0113 -0.0248 1936 VAL A CG1 
2198 C  CG2 . VAL A 257 ? 0.0703 0.1906 0.2523 0.0336  -0.0329 -0.0266 1936 VAL A CG2 
2199 N  N   . HIS A 258 ? 0.0498 0.1734 0.2016 0.0176  -0.0096 -0.0471 1937 HIS A N   
2200 C  CA  . HIS A 258 ? 0.0845 0.1645 0.1753 0.0166  -0.0047 -0.0414 1937 HIS A CA  
2201 C  C   . HIS A 258 ? 0.1058 0.1397 0.1695 0.0148  -0.0090 -0.0326 1937 HIS A C   
2202 O  O   . HIS A 258 ? 0.0914 0.1561 0.2027 0.0272  -0.0306 -0.0323 1937 HIS A O   
2203 C  CB  . HIS A 258 ? 0.0788 0.1806 0.2016 0.0303  -0.0155 -0.0586 1937 HIS A CB  
2204 C  CG  . HIS A 258 ? 0.0687 0.2028 0.1986 0.0281  -0.0214 -0.0274 1937 HIS A CG  
2205 N  ND1 . HIS A 258 ? 0.1006 0.2383 0.2573 0.0481  -0.0044 -0.0688 1937 HIS A ND1 
2206 C  CD2 . HIS A 258 ? 0.1422 0.2103 0.2330 0.0622  0.0001  -0.0221 1937 HIS A CD2 
2207 C  CE1 . HIS A 258 ? 0.0853 0.2354 0.2618 0.0297  -0.0191 -0.0680 1937 HIS A CE1 
2208 N  NE2 . HIS A 258 ? 0.1351 0.2691 0.2660 0.0683  -0.0032 -0.0656 1937 HIS A NE2 
2209 N  N   . ASP A 259 ? 0.0935 0.1600 0.2005 0.0051  -0.0068 -0.0205 1938 ASP A N   
2210 C  CA  . ASP A 259 ? 0.0873 0.1786 0.2268 0.0052  -0.0005 -0.0276 1938 ASP A CA  
2211 C  C   . ASP A 259 ? 0.0714 0.1290 0.2170 0.0113  -0.0122 -0.0355 1938 ASP A C   
2212 O  O   . ASP A 259 ? 0.0793 0.1918 0.2620 -0.0325 -0.0333 -0.0443 1938 ASP A O   
2213 C  CB  . ASP A 259 ? 0.1513 0.1840 0.2201 0.0119  0.0097  -0.0006 1938 ASP A CB  
2214 C  CG  . ASP A 259 ? 0.1686 0.2396 0.3093 0.0344  0.0112  -0.0527 1938 ASP A CG  
2215 O  OD1 . ASP A 259 ? 0.1165 0.3189 0.4227 -0.0084 -0.0020 -0.0101 1938 ASP A OD1 
2216 O  OD2 . ASP A 259 ? 0.1196 0.2777 0.4188 0.0254  0.0085  -0.0848 1938 ASP A OD2 
2217 N  N   . LEU A 260 ? 0.0599 0.1425 0.1614 0.0150  -0.0088 -0.0188 1939 LEU A N   
2218 C  CA  . LEU A 260 ? 0.0495 0.1676 0.1983 0.0188  -0.0196 -0.0219 1939 LEU A CA  
2219 C  C   . LEU A 260 ? 0.1254 0.1065 0.1657 0.0403  -0.0181 -0.0509 1939 LEU A C   
2220 O  O   . LEU A 260 ? 0.0864 0.1294 0.1957 0.0129  -0.0332 -0.0543 1939 LEU A O   
2221 C  CB  . LEU A 260 ? 0.0561 0.1795 0.1707 0.0283  -0.0186 -0.0312 1939 LEU A CB  
2222 C  CG  . LEU A 260 ? 0.0977 0.1663 0.2829 0.0187  -0.0270 0.0432  1939 LEU A CG  
2223 C  CD1 . LEU A 260 ? 0.0345 0.1973 0.2643 0.0304  -0.0300 0.0008  1939 LEU A CD1 
2224 C  CD2 . LEU A 260 ? 0.1070 0.2213 0.2675 0.0003  -0.0403 0.0386  1939 LEU A CD2 
2225 N  N   . ARG A 261 ? 0.1056 0.1277 0.1727 0.0212  -0.0179 -0.0410 1940 ARG A N   
2226 C  CA  . ARG A 261 ? 0.0968 0.0983 0.2257 0.0085  -0.0232 -0.0046 1940 ARG A CA  
2227 C  C   . ARG A 261 ? 0.1088 0.1191 0.1502 0.0069  -0.0191 -0.0062 1940 ARG A C   
2228 O  O   . ARG A 261 ? 0.1091 0.1621 0.1973 0.0186  -0.0246 0.0214  1940 ARG A O   
2229 C  CB  . ARG A 261 ? 0.1324 0.1509 0.2285 -0.0058 -0.0195 0.0103  1940 ARG A CB  
2230 C  CG  . ARG A 261 ? 0.0939 0.2438 0.3094 -0.0265 -0.0305 0.0291  1940 ARG A CG  
2231 C  CD  . ARG A 261 ? 0.1256 0.4169 0.4576 -0.0206 -0.0092 0.0957  1940 ARG A CD  
2232 N  NE  . ARG A 261 ? 0.0775 0.2366 0.4132 0.0372  0.0683  0.0646  1940 ARG A NE  
2233 C  CZ  . ARG A 261 ? 0.1464 0.2194 0.2919 0.0503  -0.0290 0.0126  1940 ARG A CZ  
2234 N  NH1 . ARG A 261 ? 0.2287 0.2683 0.3347 0.0924  -0.0005 -0.0023 1940 ARG A NH1 
2235 N  NH2 . ARG A 261 ? 0.1593 0.2011 0.3745 0.0258  -0.0272 0.0354  1940 ARG A NH2 
2236 N  N   . LEU A 262 ? 0.0861 0.1411 0.1862 0.0014  -0.0170 -0.0355 1941 LEU A N   
2237 C  CA  . LEU A 262 ? 0.0694 0.1589 0.1723 0.0071  -0.0191 -0.0380 1941 LEU A CA  
2238 C  C   . LEU A 262 ? 0.0859 0.1590 0.1947 0.0038  -0.0388 -0.0438 1941 LEU A C   
2239 O  O   . LEU A 262 ? 0.0805 0.1921 0.2123 -0.0163 -0.0669 -0.0285 1941 LEU A O   
2240 C  CB  . LEU A 262 ? 0.0666 0.2052 0.2121 -0.0008 -0.0037 -0.0225 1941 LEU A CB  
2241 C  CG  . LEU A 262 ? 0.1151 0.2064 0.2431 0.0240  -0.0485 -0.0497 1941 LEU A CG  
2242 C  CD1 . LEU A 262 ? 0.1751 0.2722 0.2735 -0.0128 0.0277  -0.0553 1941 LEU A CD1 
2243 C  CD2 . LEU A 262 ? 0.0690 0.2185 0.3090 0.0385  -0.0092 -0.0437 1941 LEU A CD2 
2244 N  N   . HIS A 263 ? 0.0819 0.1443 0.1554 0.0181  -0.0252 -0.0415 1942 HIS A N   
2245 C  CA  . HIS A 263 ? 0.0962 0.1321 0.1336 -0.0123 -0.0332 -0.0208 1942 HIS A CA  
2246 C  C   . HIS A 263 ? 0.1029 0.1302 0.1339 0.0000  0.0011  -0.0152 1942 HIS A C   
2247 O  O   . HIS A 263 ? 0.0998 0.1261 0.1554 -0.0212 -0.0204 -0.0245 1942 HIS A O   
2248 C  CB  . HIS A 263 ? 0.1547 0.1464 0.1828 -0.0137 -0.0483 0.0057  1942 HIS A CB  
2249 C  CG  . HIS A 263 ? 0.1407 0.2283 0.1863 0.0015  -0.0133 0.0105  1942 HIS A CG  
2250 N  ND1 . HIS A 263 ? 0.1438 0.2368 0.1815 0.0335  0.0221  0.0033  1942 HIS A ND1 
2251 C  CD2 . HIS A 263 ? 0.1901 0.3212 0.2386 -0.1388 0.0121  -0.0248 1942 HIS A CD2 
2252 C  CE1 . HIS A 263 ? 0.1468 0.2407 0.1369 -0.0269 -0.0539 -0.0096 1942 HIS A CE1 
2253 N  NE2 . HIS A 263 ? 0.2671 0.4248 0.2469 -0.0950 0.0110  -0.0487 1942 HIS A NE2 
2254 N  N   . ARG A 264 ? 0.0774 0.1213 0.1542 -0.0029 -0.0150 -0.0141 1943 ARG A N   
2255 C  CA  . ARG A 264 ? 0.0801 0.0939 0.1503 0.0013  0.0122  -0.0100 1943 ARG A CA  
2256 C  C   . ARG A 264 ? 0.1138 0.0942 0.1011 0.0020  0.0072  0.0014  1943 ARG A C   
2257 O  O   . ARG A 264 ? 0.1299 0.1250 0.1470 -0.0138 -0.0283 -0.0188 1943 ARG A O   
2258 C  CB  . ARG A 264 ? 0.0656 0.1222 0.1662 0.0017  -0.0057 0.0117  1943 ARG A CB  
2259 C  CG  . ARG A 264 ? 0.0774 0.1353 0.1269 0.0225  -0.0090 -0.0115 1943 ARG A CG  
2260 C  CD  . ARG A 264 ? 0.0898 0.1197 0.1578 -0.0105 -0.0236 -0.0079 1943 ARG A CD  
2261 N  NE  . ARG A 264 ? 0.0706 0.1269 0.1470 0.0187  -0.0022 -0.0121 1943 ARG A NE  
2262 C  CZ  . ARG A 264 ? 0.0947 0.1146 0.1343 -0.0005 -0.0222 -0.0098 1943 ARG A CZ  
2263 N  NH1 . ARG A 264 ? 0.0829 0.1226 0.1706 -0.0095 -0.0224 0.0134  1943 ARG A NH1 
2264 N  NH2 . ARG A 264 ? 0.0775 0.1459 0.1679 0.0011  -0.0247 0.0060  1943 ARG A NH2 
2265 N  N   . VAL A 265 ? 0.0979 0.0858 0.1552 -0.0029 -0.0143 0.0082  1944 VAL A N   
2266 C  CA  . VAL A 265 ? 0.1117 0.1203 0.1336 -0.0140 -0.0128 0.0146  1944 VAL A CA  
2267 C  C   . VAL A 265 ? 0.1057 0.1175 0.1926 -0.0165 -0.0070 0.0033  1944 VAL A C   
2268 O  O   . VAL A 265 ? 0.1200 0.1353 0.1644 -0.0366 -0.0272 0.0081  1944 VAL A O   
2269 C  CB  . VAL A 265 ? 0.1224 0.1290 0.1631 -0.0049 -0.0299 0.0127  1944 VAL A CB  
2270 C  CG1 . VAL A 265 ? 0.1233 0.1568 0.1137 -0.0406 -0.0248 -0.0164 1944 VAL A CG1 
2271 C  CG2 . VAL A 265 ? 0.1618 0.1286 0.1830 -0.0484 -0.0175 0.0186  1944 VAL A CG2 
2272 N  N   . HIS A 266 ? 0.1395 0.1550 0.2184 -0.0436 -0.0101 -0.0319 1945 HIS A N   
2273 C  CA  . HIS A 266 ? 0.0995 0.1961 0.2196 -0.0583 0.0003  -0.0140 1945 HIS A CA  
2274 C  C   . HIS A 266 ? 0.1228 0.2059 0.2041 -0.0157 0.0038  -0.0261 1945 HIS A C   
2275 O  O   . HIS A 266 ? 0.1063 0.2437 0.2558 -0.0212 0.0014  -0.0418 1945 HIS A O   
2276 C  CB  . HIS A 266 ? 0.1043 0.2362 0.2332 -0.0311 0.0143  0.0065  1945 HIS A CB  
2277 C  CG  . HIS A 266 ? 0.1430 0.1918 0.2542 -0.0439 -0.0226 0.0288  1945 HIS A CG  
2278 N  ND1 . HIS A 266 ? 0.2076 0.1912 0.2062 -0.0336 -0.0375 0.0092  1945 HIS A ND1 
2279 C  CD2 . HIS A 266 ? 0.1602 0.2204 0.2667 -0.0446 -0.0200 0.0162  1945 HIS A CD2 
2280 C  CE1 . HIS A 266 ? 0.3044 0.2440 0.2170 -0.0566 0.0093  0.0193  1945 HIS A CE1 
2281 N  NE2 . HIS A 266 ? 0.2084 0.1782 0.3068 -0.0203 0.0224  -0.0084 1945 HIS A NE2 
2282 N  N   . MET A 267 ? 0.0977 0.1476 0.2146 -0.0259 -0.0162 -0.0499 1946 MET A N   
2283 C  CA  . MET A 267 ? 0.0975 0.1764 0.2252 0.0099  -0.0269 -0.0258 1946 MET A CA  
2284 C  C   . MET A 267 ? 0.1057 0.1750 0.2476 0.0347  -0.0410 -0.0774 1946 MET A C   
2285 O  O   . MET A 267 ? 0.0839 0.2568 0.3234 0.0237  -0.0467 -0.1194 1946 MET A O   
2286 C  CB  . MET A 267 ? 0.1231 0.1528 0.2097 0.0034  -0.0345 -0.0192 1946 MET A CB  
2287 C  CG  . MET A 267 ? 0.0931 0.1647 0.2594 0.0011  -0.0256 -0.0483 1946 MET A CG  
2288 S  SD  . MET A 267 ? 0.1363 0.1675 0.2873 -0.0090 -0.0312 -0.0258 1946 MET A SD  
2289 C  CE  . MET A 267 ? 0.2991 0.1840 0.2590 0.0032  -0.0383 -0.0012 1946 MET A CE  
2290 N  N   . VAL A 268 ? 0.0643 0.1722 0.2368 0.0217  -0.0290 -0.0278 1947 VAL A N   
2291 C  CA  . VAL A 268 ? 0.0984 0.1587 0.2118 0.0107  -0.0250 0.0058  1947 VAL A CA  
2292 C  C   . VAL A 268 ? 0.1575 0.1974 0.2516 0.0152  -0.0186 -0.0042 1947 VAL A C   
2293 O  O   . VAL A 268 ? 0.1816 0.2332 0.3449 0.0776  -0.0116 0.0131  1947 VAL A O   
2294 C  CB  . VAL A 268 ? 0.0922 0.1443 0.2401 -0.0173 -0.0016 -0.0247 1947 VAL A CB  
2295 C  CG1 . VAL A 268 ? 0.0867 0.1968 0.3181 -0.0191 0.0029  -0.0780 1947 VAL A CG1 
2296 C  CG2 . VAL A 268 ? 0.0887 0.1888 0.2110 0.0221  -0.0336 -0.0221 1947 VAL A CG2 
2297 N  N   . GLN A 269 ? 0.1118 0.2031 0.2203 -0.0099 -0.0546 0.0306  1948 GLN A N   
2298 C  CA  . GLN A 269 ? 0.1476 0.1987 0.2494 -0.0038 -0.0245 0.0330  1948 GLN A CA  
2299 C  C   . GLN A 269 ? 0.1456 0.2276 0.2318 0.0037  -0.0399 0.0381  1948 GLN A C   
2300 O  O   . GLN A 269 ? 0.1826 0.2146 0.2870 0.0042  -0.0392 0.0469  1948 GLN A O   
2301 C  CB  . GLN A 269 ? 0.2569 0.2737 0.2749 -0.0354 -0.0137 0.0079  1948 GLN A CB  
2302 C  CG  . GLN A 269 ? 0.2518 0.2432 0.3556 -0.0073 0.0618  -0.0763 1948 GLN A CG  
2303 C  CD  . GLN A 269 ? 0.2441 0.1748 0.3197 -0.0229 0.0354  0.0230  1948 GLN A CD  
2304 O  OE1 . GLN A 269 ? 0.2221 0.1378 0.3520 -0.0401 0.0393  0.0198  1948 GLN A OE1 
2305 N  NE2 . GLN A 269 ? 0.2192 0.2627 0.2789 -0.0313 0.0307  0.0524  1948 GLN A NE2 
2306 N  N   . THR A 270 ? 0.1273 0.1605 0.2779 0.0044  -0.0419 0.0212  1949 THR A N   
2307 C  CA  . THR A 270 ? 0.1244 0.1920 0.3111 0.0046  -0.0134 0.0195  1949 THR A CA  
2308 C  C   . THR A 270 ? 0.1278 0.1734 0.2952 -0.0075 -0.0097 0.0227  1949 THR A C   
2309 O  O   . THR A 270 ? 0.0862 0.1827 0.2938 -0.0352 -0.0352 0.0036  1949 THR A O   
2310 C  CB  . THR A 270 ? 0.1335 0.1961 0.3227 0.0198  0.0044  0.0186  1949 THR A CB  
2311 O  OG1 . THR A 270 ? 0.1534 0.2152 0.3426 0.0161  -0.0378 0.0353  1949 THR A OG1 
2312 C  CG2 . THR A 270 ? 0.1437 0.2183 0.3473 0.0324  -0.0162 0.0264  1949 THR A CG2 
2313 N  N   . GLU A 271 ? 0.1179 0.1488 0.3130 -0.0072 -0.0234 0.0369  1950 GLU A N   
2314 C  CA  . GLU A 271 ? 0.1532 0.1417 0.2988 0.0057  -0.0221 0.0277  1950 GLU A CA  
2315 C  C   . GLU A 271 ? 0.1500 0.1274 0.3030 -0.0150 -0.0066 0.0076  1950 GLU A C   
2316 O  O   . GLU A 271 ? 0.1286 0.1342 0.3404 -0.0106 -0.0205 0.0030  1950 GLU A O   
2317 C  CB  . GLU A 271 ? 0.1905 0.1823 0.3489 -0.0371 -0.0260 0.0142  1950 GLU A CB  
2318 C  CG  . GLU A 271 ? 0.1934 0.1831 0.4119 0.0007  -0.0410 0.0028  1950 GLU A CG  
2319 C  CD  . GLU A 271 ? 0.3173 0.2275 0.5184 -0.0217 -0.0509 -0.0036 1950 GLU A CD  
2320 O  OE1 . GLU A 271 ? 0.3120 0.2573 0.5714 0.0200  -0.0571 0.0189  1950 GLU A OE1 
2321 O  OE2 . GLU A 271 ? 0.3947 0.3202 0.6123 -0.0409 -0.0515 -0.0015 1950 GLU A OE2 
2322 N  N   . CYS A 272 ? 0.1031 0.1526 0.3406 -0.0134 -0.0303 0.0158  1951 CYS A N   
2323 C  CA  B CYS A 272 ? 0.1272 0.1736 0.3214 -0.0097 -0.0055 0.0161  1951 CYS A CA  
2324 C  CA  C CYS A 272 ? 0.1178 0.1699 0.3152 -0.0068 -0.0061 0.0092  1951 CYS A CA  
2325 C  C   . CYS A 272 ? 0.1000 0.1697 0.3026 -0.0130 -0.0176 0.0174  1951 CYS A C   
2326 O  O   . CYS A 272 ? 0.0895 0.1626 0.3266 -0.0195 -0.0314 0.0028  1951 CYS A O   
2327 C  CB  B CYS A 272 ? 0.1335 0.1975 0.3427 -0.0136 -0.0042 0.0245  1951 CYS A CB  
2328 C  CB  C CYS A 272 ? 0.1224 0.1916 0.3346 -0.0175 -0.0028 0.0225  1951 CYS A CB  
2329 S  SG  B CYS A 272 ? 0.2566 0.2920 0.4680 -0.0259 0.0273  0.0659  1951 CYS A SG  
2330 S  SG  C CYS A 272 ? 0.1510 0.2605 0.4157 0.0067  0.0039  -0.0016 1951 CYS A SG  
2331 N  N   . GLN A 273 ? 0.0939 0.1408 0.2772 -0.0248 -0.0161 0.0170  1952 GLN A N   
2332 C  CA  . GLN A 273 ? 0.0826 0.1220 0.2652 0.0050  -0.0276 0.0042  1952 GLN A CA  
2333 C  C   . GLN A 273 ? 0.0679 0.1232 0.2387 -0.0012 -0.0202 -0.0062 1952 GLN A C   
2334 O  O   . GLN A 273 ? 0.0801 0.1189 0.2599 -0.0003 -0.0371 -0.0200 1952 GLN A O   
2335 C  CB  . GLN A 273 ? 0.0822 0.1642 0.2277 -0.0400 -0.0511 -0.0264 1952 GLN A CB  
2336 C  CG  . GLN A 273 ? 0.1355 0.1484 0.2311 -0.0105 -0.0382 -0.0373 1952 GLN A CG  
2337 C  CD  . GLN A 273 ? 0.1178 0.1503 0.2652 -0.0086 -0.0186 -0.0298 1952 GLN A CD  
2338 O  OE1 . GLN A 273 ? 0.0799 0.1799 0.2938 -0.0072 -0.0190 -0.0216 1952 GLN A OE1 
2339 N  NE2 . GLN A 273 ? 0.1048 0.1958 0.3194 0.0037  -0.0200 -0.0139 1952 GLN A NE2 
2340 N  N   . TYR A 274 ? 0.0776 0.1263 0.2614 0.0142  -0.0363 -0.0217 1953 TYR A N   
2341 C  CA  . TYR A 274 ? 0.0605 0.1511 0.2670 -0.0013 -0.0366 -0.0243 1953 TYR A CA  
2342 C  C   . TYR A 274 ? 0.1545 0.1486 0.2731 0.0063  -0.0196 -0.0290 1953 TYR A C   
2343 O  O   . TYR A 274 ? 0.1039 0.1529 0.3079 0.0099  -0.0454 -0.0374 1953 TYR A O   
2344 C  CB  . TYR A 274 ? 0.1142 0.1252 0.2543 0.0290  -0.0262 -0.0081 1953 TYR A CB  
2345 C  CG  . TYR A 274 ? 0.0695 0.1566 0.2727 -0.0018 -0.0333 -0.0194 1953 TYR A CG  
2346 C  CD1 . TYR A 274 ? 0.1340 0.1417 0.2977 0.0135  -0.0170 -0.0069 1953 TYR A CD1 
2347 C  CD2 . TYR A 274 ? 0.1191 0.1675 0.2866 0.0250  -0.0280 -0.0279 1953 TYR A CD2 
2348 C  CE1 . TYR A 274 ? 0.1145 0.1476 0.2113 0.0032  -0.0330 -0.0296 1953 TYR A CE1 
2349 C  CE2 . TYR A 274 ? 0.0740 0.1558 0.2876 0.0279  -0.0416 -0.0143 1953 TYR A CE2 
2350 C  CZ  . TYR A 274 ? 0.0768 0.1686 0.2849 0.0330  0.0011  -0.0279 1953 TYR A CZ  
2351 O  OH  . TYR A 274 ? 0.0818 0.2356 0.3263 0.0179  -0.0231 -0.0352 1953 TYR A OH  
2352 N  N   . VAL A 275 ? 0.0956 0.1112 0.3073 0.0084  -0.0569 -0.0195 1954 VAL A N   
2353 C  CA  . VAL A 275 ? 0.1252 0.1591 0.3260 -0.0028 -0.0512 -0.0251 1954 VAL A CA  
2354 C  C   . VAL A 275 ? 0.1110 0.1405 0.3044 -0.0124 -0.0467 -0.0380 1954 VAL A C   
2355 O  O   . VAL A 275 ? 0.1016 0.1692 0.3259 -0.0100 -0.0508 -0.0509 1954 VAL A O   
2356 C  CB  . VAL A 275 ? 0.1188 0.1448 0.3196 -0.0010 -0.0736 -0.0095 1954 VAL A CB  
2357 C  CG1 . VAL A 275 ? 0.1426 0.1791 0.3888 -0.0270 -0.0920 0.0089  1954 VAL A CG1 
2358 C  CG2 . VAL A 275 ? 0.2027 0.1526 0.4086 -0.0049 -0.0758 -0.0369 1954 VAL A CG2 
2359 N  N   . TYR A 276 ? 0.0690 0.1340 0.2994 0.0061  -0.0240 -0.0155 1955 TYR A N   
2360 C  CA  . TYR A 276 ? 0.0835 0.1460 0.2578 -0.0035 -0.0365 -0.0247 1955 TYR A CA  
2361 C  C   . TYR A 276 ? 0.0662 0.1289 0.2375 0.0101  -0.0337 -0.0357 1955 TYR A C   
2362 O  O   . TYR A 276 ? 0.0847 0.1468 0.2771 -0.0122 -0.0593 -0.0500 1955 TYR A O   
2363 C  CB  . TYR A 276 ? 0.0897 0.1645 0.2620 0.0206  -0.0161 -0.0379 1955 TYR A CB  
2364 C  CG  . TYR A 276 ? 0.0506 0.1330 0.2423 -0.0075 -0.0221 -0.0316 1955 TYR A CG  
2365 C  CD1 . TYR A 276 ? 0.0629 0.1757 0.2866 0.0221  0.0021  -0.0177 1955 TYR A CD1 
2366 C  CD2 . TYR A 276 ? 0.0985 0.1225 0.3096 0.0021  -0.0232 -0.0036 1955 TYR A CD2 
2367 C  CE1 . TYR A 276 ? 0.0977 0.1616 0.2932 -0.0079 -0.0387 -0.0189 1955 TYR A CE1 
2368 C  CE2 . TYR A 276 ? 0.0424 0.1564 0.3598 0.0085  -0.0151 -0.0281 1955 TYR A CE2 
2369 C  CZ  . TYR A 276 ? 0.1078 0.1272 0.2577 0.0324  -0.0085 -0.0186 1955 TYR A CZ  
2370 O  OH  . TYR A 276 ? 0.0763 0.1764 0.2845 0.0075  -0.0379 -0.0553 1955 TYR A OH  
2371 N  N   . LEU A 277 ? 0.0824 0.1493 0.2359 0.0001  -0.0266 -0.0479 1956 LEU A N   
2372 C  CA  . LEU A 277 ? 0.0668 0.1290 0.2059 0.0067  -0.0343 -0.0222 1956 LEU A CA  
2373 C  C   . LEU A 277 ? 0.1037 0.1254 0.2583 -0.0064 -0.0591 -0.0354 1956 LEU A C   
2374 O  O   . LEU A 277 ? 0.1174 0.1381 0.2780 -0.0048 -0.0705 -0.0556 1956 LEU A O   
2375 C  CB  . LEU A 277 ? 0.0622 0.1529 0.2305 0.0122  -0.0431 -0.0272 1956 LEU A CB  
2376 C  CG  . LEU A 277 ? 0.0855 0.1451 0.2106 -0.0015 -0.0333 -0.0088 1956 LEU A CG  
2377 C  CD1 . LEU A 277 ? 0.0602 0.1819 0.2518 0.0010  -0.0787 -0.0210 1956 LEU A CD1 
2378 C  CD2 . LEU A 277 ? 0.1299 0.1498 0.2091 0.0047  -0.0753 -0.0271 1956 LEU A CD2 
2379 N  N   . HIS A 278 ? 0.1281 0.1222 0.2643 0.0105  -0.0647 -0.0615 1957 HIS A N   
2380 C  CA  . HIS A 278 ? 0.1115 0.1463 0.2669 0.0450  -0.0833 -0.0743 1957 HIS A CA  
2381 C  C   . HIS A 278 ? 0.1186 0.1444 0.2897 0.0187  -0.0560 -0.0773 1957 HIS A C   
2382 O  O   . HIS A 278 ? 0.1237 0.1881 0.3372 0.0195  -0.0827 -0.0719 1957 HIS A O   
2383 C  CB  . HIS A 278 ? 0.1476 0.1268 0.2937 0.0234  -0.0633 -0.0799 1957 HIS A CB  
2384 C  CG  . HIS A 278 ? 0.1057 0.2161 0.2753 0.0267  -0.0762 -0.0391 1957 HIS A CG  
2385 N  ND1 . HIS A 278 ? 0.1306 0.1596 0.3208 0.0379  -0.0987 -0.0776 1957 HIS A ND1 
2386 C  CD2 . HIS A 278 ? 0.1029 0.1836 0.2898 0.0252  -0.0564 -0.0505 1957 HIS A CD2 
2387 C  CE1 . HIS A 278 ? 0.1572 0.1643 0.3360 0.0381  -0.0852 -0.0583 1957 HIS A CE1 
2388 N  NE2 . HIS A 278 ? 0.1201 0.1927 0.3491 0.0590  -0.0658 -0.0688 1957 HIS A NE2 
2389 N  N   . GLN A 279 ? 0.0958 0.1635 0.2879 0.0121  -0.0697 -0.0443 1958 GLN A N   
2390 C  CA  . GLN A 279 ? 0.0821 0.1525 0.3129 0.0133  -0.0831 -0.0481 1958 GLN A CA  
2391 C  C   . GLN A 279 ? 0.0865 0.1694 0.3124 -0.0112 -0.0711 -0.0600 1958 GLN A C   
2392 O  O   . GLN A 279 ? 0.1235 0.1862 0.3560 0.0067  -0.0887 -0.0465 1958 GLN A O   
2393 C  CB  . GLN A 279 ? 0.0866 0.2001 0.3782 -0.0005 -0.0784 -0.0156 1958 GLN A CB  
2394 C  CG  . GLN A 279 ? 0.1488 0.1905 0.3819 -0.0098 -0.0665 0.0074  1958 GLN A CG  
2395 C  CD  . GLN A 279 ? 0.2159 0.2683 0.4257 -0.0206 -0.0228 -0.0246 1958 GLN A CD  
2396 O  OE1 . GLN A 279 ? 0.2126 0.2447 0.5083 -0.0308 -0.0037 -0.0191 1958 GLN A OE1 
2397 N  NE2 . GLN A 279 ? 0.1261 0.2340 0.5070 -0.0212 -0.0416 -0.0115 1958 GLN A NE2 
2398 N  N   . CYS A 280 ? 0.0627 0.1399 0.3192 -0.0319 -0.0681 -0.0388 1959 CYS A N   
2399 C  CA  . CYS A 280 ? 0.1215 0.1510 0.3079 -0.0147 -0.0498 -0.0439 1959 CYS A CA  
2400 C  C   . CYS A 280 ? 0.1080 0.1767 0.2634 0.0221  -0.0607 -0.0655 1959 CYS A C   
2401 O  O   . CYS A 280 ? 0.1479 0.2053 0.2749 0.0416  -0.0652 -0.0862 1959 CYS A O   
2402 C  CB  . CYS A 280 ? 0.0686 0.1532 0.2849 -0.0085 -0.0910 -0.0510 1959 CYS A CB  
2403 S  SG  . CYS A 280 ? 0.1089 0.1531 0.2987 0.0100  -0.0753 -0.0413 1959 CYS A SG  
2404 N  N   . VAL A 281 ? 0.1538 0.2041 0.2655 0.0307  -0.0433 -0.0689 1960 VAL A N   
2405 C  CA  . VAL A 281 ? 0.0977 0.1829 0.2712 0.0411  -0.0703 -0.0555 1960 VAL A CA  
2406 C  C   . VAL A 281 ? 0.1456 0.2016 0.2889 0.0565  -0.0581 -0.0701 1960 VAL A C   
2407 O  O   . VAL A 281 ? 0.2008 0.2204 0.3062 0.0138  -0.0960 -0.0685 1960 VAL A O   
2408 C  CB  . VAL A 281 ? 0.1173 0.2249 0.3036 0.0513  -0.0354 -0.0630 1960 VAL A CB  
2409 C  CG1 . VAL A 281 ? 0.1932 0.2377 0.3195 0.0801  -0.0620 -0.0566 1960 VAL A CG1 
2410 C  CG2 . VAL A 281 ? 0.1365 0.2895 0.3093 0.0184  -0.0878 -0.0290 1960 VAL A CG2 
2411 N  N   . ARG A 282 ? 0.1073 0.1967 0.2919 0.0389  -0.1104 -0.0826 1961 ARG A N   
2412 C  CA  . ARG A 282 ? 0.1439 0.2179 0.3141 0.0141  -0.0886 -0.0730 1961 ARG A CA  
2413 C  C   . ARG A 282 ? 0.1922 0.2414 0.3177 0.0061  -0.0816 -0.0725 1961 ARG A C   
2414 O  O   . ARG A 282 ? 0.1968 0.2354 0.3426 0.0473  -0.1597 -0.0795 1961 ARG A O   
2415 C  CB  . ARG A 282 ? 0.1688 0.2509 0.3239 -0.0184 -0.1092 -0.0662 1961 ARG A CB  
2416 C  CG  . ARG A 282 ? 0.2003 0.2485 0.3548 0.0142  -0.1113 -0.0748 1961 ARG A CG  
2417 C  CD  . ARG A 282 ? 0.1589 0.2618 0.3433 -0.0125 -0.1409 -0.0618 1961 ARG A CD  
2418 N  NE  . ARG A 282 ? 0.0996 0.2380 0.3933 -0.0307 -0.1314 -0.0331 1961 ARG A NE  
2419 C  CZ  . ARG A 282 ? 0.1121 0.3222 0.4197 -0.0594 -0.0664 -0.0099 1961 ARG A CZ  
2420 N  NH1 . ARG A 282 ? 0.1955 0.2197 0.4537 -0.0161 -0.0876 -0.0276 1961 ARG A NH1 
2421 N  NH2 . ARG A 282 ? 0.2109 0.3414 0.5095 -0.0222 -0.0677 -0.0312 1961 ARG A NH2 
2422 N  N   . ASP A 283 ? 0.1675 0.2241 0.3164 0.0265  -0.1065 -0.0663 1962 ASP A N   
2423 C  CA  . ASP A 283 ? 0.1540 0.2765 0.3252 0.0161  -0.1006 -0.0616 1962 ASP A CA  
2424 C  C   . ASP A 283 ? 0.1407 0.2485 0.3426 0.0056  -0.1067 -0.0510 1962 ASP A C   
2425 O  O   . ASP A 283 ? 0.1994 0.2796 0.3725 0.0345  -0.1123 -0.0440 1962 ASP A O   
2426 C  CB  . ASP A 283 ? 0.1651 0.2566 0.3424 0.0398  -0.0615 -0.0506 1962 ASP A CB  
2427 C  CG  . ASP A 283 ? 0.1004 0.2182 0.3554 -0.0084 -0.0667 -0.0631 1962 ASP A CG  
2428 O  OD1 . ASP A 283 ? 0.2287 0.2398 0.4927 0.0259  -0.1052 -0.0741 1962 ASP A OD1 
2429 O  OD2 . ASP A 283 ? 0.1775 0.2896 0.4423 -0.0091 -0.0735 -0.0390 1962 ASP A OD2 
2430 N  N   . VAL A 284 ? 0.1613 0.2465 0.3174 0.0127  -0.0832 -0.0452 1963 VAL A N   
2431 C  CA  . VAL A 284 ? 0.2004 0.2675 0.3022 0.0247  -0.0857 -0.0411 1963 VAL A CA  
2432 C  C   . VAL A 284 ? 0.2023 0.2707 0.3115 0.0400  -0.0972 -0.0346 1963 VAL A C   
2433 O  O   . VAL A 284 ? 0.2592 0.2718 0.3087 0.0445  -0.1346 -0.0515 1963 VAL A O   
2434 C  CB  . VAL A 284 ? 0.1871 0.2732 0.2991 0.0224  -0.0855 -0.0479 1963 VAL A CB  
2435 C  CG1 . VAL A 284 ? 0.2022 0.2889 0.2712 0.0278  -0.0863 -0.0527 1963 VAL A CG1 
2436 C  CG2 . VAL A 284 ? 0.2101 0.2397 0.3110 -0.0190 -0.0570 -0.0556 1963 VAL A CG2 
2437 N  N   . LEU A 285 ? 0.2480 0.2334 0.3085 0.0531  -0.0940 -0.0647 1964 LEU A N   
2438 C  CA  . LEU A 285 ? 0.2427 0.2595 0.2872 0.0576  -0.1084 -0.0611 1964 LEU A CA  
2439 C  C   . LEU A 285 ? 0.2315 0.2705 0.2927 0.0312  -0.1162 -0.0484 1964 LEU A C   
2440 O  O   . LEU A 285 ? 0.3075 0.3126 0.3324 0.0451  -0.1434 -0.0311 1964 LEU A O   
2441 C  CB  . LEU A 285 ? 0.2612 0.2612 0.2341 0.0529  -0.0969 -0.0780 1964 LEU A CB  
2442 C  CG  . LEU A 285 ? 0.2692 0.3271 0.2871 0.0826  -0.0525 -0.0444 1964 LEU A CG  
2443 C  CD1 . LEU A 285 ? 0.2666 0.3210 0.2816 0.1387  -0.0312 -0.0695 1964 LEU A CD1 
2444 C  CD2 . LEU A 285 ? 0.2467 0.3237 0.2915 0.0360  -0.0722 -0.0432 1964 LEU A CD2 
2445 N  N   . ARG A 286 ? 0.2373 0.2891 0.2740 0.0218  -0.1492 -0.0390 1965 ARG A N   
2446 C  CA  . ARG A 286 ? 0.2373 0.3121 0.3364 0.0200  -0.1209 -0.0330 1965 ARG A CA  
2447 C  C   . ARG A 286 ? 0.2460 0.3340 0.3747 0.0346  -0.1328 -0.0314 1965 ARG A C   
2448 O  O   . ARG A 286 ? 0.2621 0.3392 0.3762 0.0531  -0.1603 -0.0403 1965 ARG A O   
2449 C  CB  . ARG A 286 ? 0.2284 0.3240 0.3301 -0.0075 -0.1346 -0.0406 1965 ARG A CB  
2450 C  CG  . ARG A 286 ? 0.2039 0.3087 0.3632 0.0166  -0.1403 -0.0074 1965 ARG A CG  
2451 C  CD  . ARG A 286 ? 0.1693 0.4010 0.4120 -0.0200 -0.0821 -0.0055 1965 ARG A CD  
2452 N  NE  . ARG A 286 ? 0.2782 0.4170 0.4362 0.0084  -0.1207 0.0412  1965 ARG A NE  
2453 C  CZ  . ARG A 286 ? 0.2625 0.3841 0.4292 -0.0004 -0.0511 -0.0050 1965 ARG A CZ  
2454 N  NH1 . ARG A 286 ? 0.2761 0.4150 0.4333 0.0294  -0.0730 -0.0074 1965 ARG A NH1 
2455 N  NH2 . ARG A 286 ? 0.3352 0.4107 0.5558 0.0043  -0.0401 -0.0069 1965 ARG A NH2 
2456 N  N   . ALA A 287 ? 0.2288 0.2977 0.3631 0.0774  -0.1169 -0.0267 1966 ALA A N   
2457 C  CA  . ALA A 287 ? 0.2579 0.3318 0.4116 0.0633  -0.1080 -0.0274 1966 ALA A CA  
2458 C  C   . ALA A 287 ? 0.2776 0.3562 0.4069 0.0503  -0.0962 -0.0270 1966 ALA A C   
2459 O  O   . ALA A 287 ? 0.2872 0.3799 0.4356 0.0951  -0.1173 -0.0040 1966 ALA A O   
2460 C  CB  . ALA A 287 ? 0.3090 0.4021 0.4010 0.0493  -0.0720 -0.0423 1966 ALA A CB  
2461 N  N   . ARG A 288 ? 0.3354 0.3581 0.4215 0.0246  -0.0815 -0.0248 1967 ARG A N   
2462 C  CA  . ARG A 288 ? 0.3721 0.3873 0.4417 0.0066  -0.0781 -0.0141 1967 ARG A CA  
2463 C  C   . ARG A 288 ? 0.4137 0.3897 0.4375 -0.0110 -0.0728 -0.0104 1967 ARG A C   
2464 O  O   . ARG A 288 ? 0.4165 0.3634 0.4523 -0.0103 -0.0961 0.0069  1967 ARG A O   
2465 C  CB  . ARG A 288 ? 0.3978 0.4095 0.4700 0.0095  -0.0518 -0.0158 1967 ARG A CB  
2466 C  CG  . ARG A 288 ? 0.4167 0.4159 0.4624 0.0036  -0.0299 0.0106  1967 ARG A CG  
2467 C  CD  . ARG A 288 ? 0.4750 0.5155 0.5175 0.0139  -0.0163 0.0076  1967 ARG A CD  
2468 N  NE  . ARG A 288 ? 0.5198 0.5157 0.5419 -0.0126 -0.0161 0.0145  1967 ARG A NE  
2469 C  CZ  . ARG A 288 ? 0.5379 0.5423 0.5352 0.0192  -0.0229 0.0084  1967 ARG A CZ  
2470 N  NH1 . ARG A 288 ? 0.6278 0.6276 0.6006 0.0376  -0.0125 0.0005  1967 ARG A NH1 
2471 N  NH2 . ARG A 288 ? 0.5263 0.5271 0.5379 -0.0083 -0.0297 0.0145  1967 ARG A NH2 
2472 N  N   . LYS A 289 ? 0.4281 0.3762 0.4384 0.0096  -0.0754 -0.0157 1968 LYS A N   
2473 C  CA  . LYS A 289 ? 0.4536 0.4080 0.4587 0.0114  -0.0641 -0.0204 1968 LYS A CA  
2474 C  C   . LYS A 289 ? 0.4840 0.4485 0.4850 0.0177  -0.0591 -0.0231 1968 LYS A C   
2475 O  O   . LYS A 289 ? 0.4820 0.4760 0.4568 0.0231  -0.0995 -0.0261 1968 LYS A O   
2476 C  CB  . LYS A 289 ? 0.4539 0.4115 0.4575 0.0010  -0.0562 -0.0237 1968 LYS A CB  
2477 C  CG  . LYS A 289 ? 0.4732 0.4597 0.4844 0.0164  -0.0335 -0.0100 1968 LYS A CG  
2478 C  CD  . LYS A 289 ? 0.4635 0.4299 0.4370 -0.0140 -0.0447 -0.0335 1968 LYS A CD  
2479 C  CE  . LYS A 289 ? 0.4998 0.4375 0.4413 0.0134  -0.0208 -0.0293 1968 LYS A CE  
2480 N  NZ  . LYS A 289 ? 0.4633 0.4921 0.4605 0.0175  -0.0577 -0.0405 1968 LYS A NZ  
2481 N  N   . LEU A 290 ? 0.4958 0.5092 0.5097 0.0269  -0.0540 -0.0184 1969 LEU A N   
2482 C  CA  . LEU A 290 ? 0.5105 0.5319 0.5433 0.0228  -0.0463 -0.0011 1969 LEU A CA  
2483 C  C   . LEU A 290 ? 0.5518 0.5796 0.5814 0.0121  -0.0358 0.0052  1969 LEU A C   
2484 O  O   . LEU A 290 ? 0.5789 0.6404 0.6531 0.0090  -0.0325 0.0168  1969 LEU A O   
2485 C  CB  . LEU A 290 ? 0.5125 0.5036 0.5520 0.0222  -0.0309 0.0073  1969 LEU A CB  
2486 C  CG  . LEU A 290 ? 0.4897 0.5284 0.4816 0.0293  -0.0478 0.0223  1969 LEU A CG  
2487 C  CD1 . LEU A 290 ? 0.4496 0.5002 0.5438 0.0581  -0.0457 0.0214  1969 LEU A CD1 
2488 C  CD2 . LEU A 290 ? 0.4618 0.5412 0.5084 0.0580  -0.0554 0.0016  1969 LEU A CD2 
2489 MG MG  . MG  B .   ? 0.1498 0.1959 0.2897 -0.0645 -0.0827 0.0149  401  MG  A MG  
2490 NA NA  . NA  C .   ? 0.1173 0.2219 0.3511 0.0068  0.0096  0.0244  402  NA  A NA  
2491 NA NA  . NA  D .   ? 0.2148 0.2492 0.2849 -0.0377 -0.0570 -0.0124 403  NA  A NA  
2492 O  O   . HOH E .   ? 0.1414 0.1886 0.2752 -0.0192 -0.0752 0.0011  1    HOH A O   
2493 O  O   . HOH E .   ? 0.1292 0.1949 0.3767 0.0292  0.0582  0.0610  2    HOH A O   
2494 O  O   . HOH E .   ? 0.2774 0.2659 0.2893 0.0096  -0.1368 -0.0201 3    HOH A O   
2495 O  O   . HOH E .   ? 0.1363 0.2116 0.2196 -0.0201 0.0008  -0.0157 4    HOH A O   
2496 O  O   . HOH E .   ? 0.1342 0.2815 0.2699 0.0283  -0.0779 -0.0223 5    HOH A O   
2497 O  O   . HOH E .   ? 0.2341 0.2077 0.3719 -0.0510 -0.0267 -0.0050 6    HOH A O   
2498 O  O   . HOH E .   ? 0.0621 0.1340 0.1799 0.0005  -0.0314 0.0048  8    HOH A O   
2499 O  O   . HOH E .   ? 0.1651 0.1340 0.2431 0.0169  -0.0885 -0.0332 10   HOH A O   
2500 O  O   . HOH E .   ? 0.1317 0.1794 0.2043 0.0100  -0.0568 0.0098  11   HOH A O   
2501 O  O   . HOH E .   ? 0.1219 0.2063 0.1813 0.0244  -0.0360 0.0108  12   HOH A O   
2502 O  O   . HOH E .   ? 0.1591 0.1514 0.2019 0.0209  -0.0525 0.0164  13   HOH A O   
2503 O  O   . HOH E .   ? 0.1636 0.1165 0.1488 0.0143  -0.0368 -0.0223 14   HOH A O   
2504 O  O   . HOH E .   ? 0.1132 0.1611 0.3290 0.0206  -0.0078 0.0346  15   HOH A O   
2505 O  O   . HOH E .   ? 0.1025 0.1933 0.1887 0.0271  -0.0481 0.0077  16   HOH A O   
2506 O  O   . HOH E .   ? 0.1440 0.1141 0.2470 -0.0098 -0.0490 -0.0128 17   HOH A O   
2507 O  O   . HOH E .   ? 0.1216 0.2681 0.2500 0.1219  -0.0426 -0.0118 18   HOH A O   
2508 O  O   . HOH E .   ? 0.1062 0.1421 0.1989 0.0204  -0.0451 -0.0114 19   HOH A O   
2509 O  O   . HOH E .   ? 0.1483 0.1253 0.1759 0.0074  -0.0417 -0.0048 20   HOH A O   
2510 O  O   . HOH E .   ? 0.0949 0.1532 0.2374 -0.0058 -0.0558 -0.0041 21   HOH A O   
2511 O  O   . HOH E .   ? 0.2036 0.2243 0.2191 0.0508  -0.0709 0.0085  22   HOH A O   
2512 O  O   . HOH E .   ? 0.1996 0.2278 0.2343 0.0166  -0.0244 -0.0174 23   HOH A O   
2513 O  O   . HOH E .   ? 0.1704 0.1613 0.1973 -0.0112 0.0035  0.0031  24   HOH A O   
2514 O  O   . HOH E .   ? 0.2754 0.2257 0.4417 0.0138  0.1087  0.0495  25   HOH A O   
2515 O  O   . HOH E .   ? 0.1793 0.1275 0.2407 -0.0191 -0.0776 -0.0211 26   HOH A O   
2516 O  O   . HOH E .   ? 0.2113 0.1620 0.2481 0.0202  -0.0989 -0.0291 27   HOH A O   
2517 O  O   . HOH E .   ? 0.1640 0.2447 0.2713 0.0378  -0.1033 -0.0812 28   HOH A O   
2518 O  O   . HOH E .   ? 0.1145 0.2152 0.2726 -0.0241 -0.0353 0.0537  29   HOH A O   
2519 O  O   . HOH E .   ? 0.0859 0.3433 0.3560 -0.0661 -0.0396 -0.0573 30   HOH A O   
2520 O  O   . HOH E .   ? 0.1771 0.3214 0.2304 0.0612  -0.0551 0.0164  31   HOH A O   
2521 O  O   . HOH E .   ? 0.2186 0.2979 0.2806 -0.0051 -0.0577 -0.0389 32   HOH A O   
2522 O  O   . HOH E .   ? 0.1301 0.2784 0.2899 0.0492  0.0022  0.0666  33   HOH A O   
2523 O  O   . HOH E .   ? 0.2173 0.2861 0.3216 0.0092  0.0331  -0.0067 34   HOH A O   
2524 O  O   . HOH E .   ? 0.1561 0.2024 0.1809 0.0265  -0.0347 0.0155  35   HOH A O   
2525 O  O   . HOH E .   ? 0.2260 0.2482 0.2968 -0.0205 -0.1135 0.0436  36   HOH A O   
2526 O  O   . HOH E .   ? 0.1402 0.2563 0.3280 -0.0193 -0.0575 0.0303  37   HOH A O   
2527 O  O   . HOH E .   ? 0.0911 0.3351 0.2899 -0.0174 -0.0263 0.0165  38   HOH A O   
2528 O  O   . HOH E .   ? 0.1233 0.2742 0.4207 0.0270  -0.0817 -0.0418 39   HOH A O   
2529 O  O   . HOH E .   ? 0.2433 0.2453 0.5898 0.0020  -0.1326 -0.0559 40   HOH A O   
2530 O  O   . HOH E .   ? 0.3124 0.2899 0.2945 -0.0969 -0.0627 -0.0827 41   HOH A O   
2531 O  O   . HOH E .   ? 0.1348 0.1938 0.2699 0.0295  -0.0542 -0.0053 42   HOH A O   
2532 O  O   . HOH E .   ? 0.2983 0.2523 0.2527 -0.0116 -0.0958 0.0208  43   HOH A O   
2533 O  O   . HOH E .   ? 0.1430 0.3302 0.2477 -0.0487 -0.0407 -0.0143 44   HOH A O   
2534 O  O   . HOH E .   ? 0.2127 0.3083 0.2486 0.0365  -0.0346 0.0071  45   HOH A O   
2535 O  O   . HOH E .   ? 0.2633 0.2189 0.2925 -0.0251 -0.1289 -0.0057 46   HOH A O   
2536 O  O   . HOH E .   ? 0.2231 0.3383 0.3010 0.0440  -0.0439 -0.0258 47   HOH A O   
2537 O  O   . HOH E .   ? 0.1905 0.1715 0.1948 -0.0029 -0.0353 -0.0320 48   HOH A O   
2538 O  O   . HOH E .   ? 0.2664 0.1897 0.4015 -0.0185 0.0120  -0.0458 49   HOH A O   
2539 O  O   . HOH E .   ? 0.1060 0.2011 0.2882 0.0048  -0.0061 0.0151  50   HOH A O   
2540 O  O   . HOH E .   ? 0.2571 0.2191 0.3403 0.0205  -0.0322 -0.0251 51   HOH A O   
2541 O  O   . HOH E .   ? 0.3145 0.2787 0.2512 -0.0805 -0.0711 0.0055  52   HOH A O   
2542 O  O   . HOH E .   ? 0.1909 0.2713 0.3540 -0.0407 -0.0799 -0.0116 53   HOH A O   
2543 O  O   . HOH E .   ? 0.1620 0.1900 0.5134 0.0400  -0.1389 0.0503  54   HOH A O   
2544 O  O   . HOH E .   ? 0.2089 0.2800 0.3576 0.0201  0.0851  0.0916  55   HOH A O   
2545 O  O   . HOH E .   ? 0.0995 0.2342 0.3098 0.0195  -0.0312 0.0596  56   HOH A O   
2546 O  O   . HOH E .   ? 0.3090 0.4218 0.3312 0.0195  0.0084  -0.0191 57   HOH A O   
2547 O  O   . HOH E .   ? 0.1095 0.4426 0.2977 0.1376  -0.0176 0.0436  58   HOH A O   
2548 O  O   . HOH E .   ? 0.2723 0.3607 0.2632 0.0522  -0.0782 -0.0486 59   HOH A O   
2549 O  O   . HOH E .   ? 0.2753 0.1916 0.4895 -0.0056 -0.1746 -0.0820 60   HOH A O   
2550 O  O   . HOH E .   ? 0.3925 0.1614 0.4237 -0.0142 0.0579  -0.0044 61   HOH A O   
2551 O  O   . HOH E .   ? 0.1919 0.3503 0.4816 -0.0134 -0.0051 -0.0752 62   HOH A O   
2552 O  O   . HOH E .   ? 0.1983 0.3038 0.2765 -0.0678 -0.0543 0.0818  63   HOH A O   
2553 O  O   . HOH E .   ? 0.2568 0.1925 0.5507 0.0423  -0.0388 -0.1086 64   HOH A O   
2554 O  O   . HOH E .   ? 0.1608 0.2868 0.3452 0.0289  -0.0591 -0.0746 65   HOH A O   
2555 O  O   . HOH E .   ? 0.0835 0.2906 0.4976 0.0492  0.0703  -0.0098 66   HOH A O   
2556 O  O   . HOH E .   ? 0.2919 0.3550 0.2860 0.1123  -0.2161 -0.0263 67   HOH A O   
2557 O  O   . HOH E .   ? 0.2839 0.3206 0.5240 0.0180  -0.0748 -0.0633 68   HOH A O   
2558 O  O   . HOH E .   ? 0.2420 0.3246 0.4259 -0.0631 -0.0263 0.0493  69   HOH A O   
2559 O  O   . HOH E .   ? 0.4759 0.3158 0.3476 -0.0644 -0.1123 -0.0402 70   HOH A O   
2560 O  O   . HOH E .   ? 0.4717 0.4430 0.5255 0.0423  -0.0201 -0.0562 71   HOH A O   
2561 O  O   . HOH E .   ? 0.3198 0.2306 0.5540 0.0648  -0.1316 -0.0041 72   HOH A O   
2562 O  O   . HOH E .   ? 0.1475 0.2545 0.3458 0.0042  -0.0249 -0.0527 73   HOH A O   
2563 O  O   . HOH E .   ? 0.2102 0.2665 0.2293 0.0043  -0.0294 -0.0162 74   HOH A O   
2564 O  O   . HOH E .   ? 0.1486 0.2837 0.4065 -0.0660 -0.0924 -0.0835 75   HOH A O   
2565 O  O   . HOH E .   ? 0.1876 0.2396 0.3832 0.0370  -0.0309 -0.0004 76   HOH A O   
2566 O  O   . HOH E .   ? 0.1567 0.4164 0.4307 0.0423  -0.0403 0.0044  77   HOH A O   
2567 O  O   . HOH E .   ? 0.3419 0.1884 0.2903 0.0579  0.0011  0.0635  78   HOH A O   
2568 O  O   . HOH E .   ? 0.2326 0.4102 0.3311 0.0435  -0.0440 0.0609  79   HOH A O   
2569 O  O   . HOH E .   ? 0.3522 0.4791 0.4303 -0.1220 0.0600  -0.0012 80   HOH A O   
2570 O  O   . HOH E .   ? 0.1440 0.2106 0.3270 0.0275  -0.0740 -0.0221 81   HOH A O   
2571 O  O   . HOH E .   ? 0.1704 0.2742 0.4063 0.0417  -0.0573 -0.1300 82   HOH A O   
2572 O  O   . HOH E .   ? 0.2032 0.1761 0.5501 0.0024  -0.0878 0.0093  83   HOH A O   
2573 O  O   . HOH E .   ? 0.3612 0.2731 0.3990 -0.1086 -0.0475 -0.0797 84   HOH A O   
2574 O  O   . HOH E .   ? 0.1495 0.4824 0.3180 0.0291  -0.0242 0.0202  85   HOH A O   
2575 O  O   . HOH E .   ? 0.1393 0.2956 0.4471 -0.0430 0.0122  -0.0316 86   HOH A O   
2576 O  O   . HOH E .   ? 0.2292 0.2447 0.5095 0.0332  -0.1198 -0.0307 87   HOH A O   
2577 O  O   . HOH E .   ? 0.4331 0.2440 0.3675 0.0120  -0.1901 -0.0034 88   HOH A O   
2578 O  O   . HOH E .   ? 0.2845 0.3641 0.3518 -0.0380 0.0128  0.0621  89   HOH A O   
2579 O  O   . HOH E .   ? 0.2333 0.3385 0.3835 -0.0054 -0.0470 -0.0920 90   HOH A O   
2580 O  O   . HOH E .   ? 0.2016 0.2267 0.3860 -0.0628 -0.0996 0.0123  91   HOH A O   
2581 O  O   . HOH E .   ? 0.1948 0.2385 0.3533 0.0450  -0.0278 -0.0132 92   HOH A O   
2582 O  O   . HOH E .   ? 0.2482 0.2483 0.3444 -0.0286 -0.0940 -0.0017 93   HOH A O   
2583 O  O   . HOH E .   ? 0.1899 0.2013 0.3499 -0.0177 -0.0681 0.0276  94   HOH A O   
2584 O  O   . HOH E .   ? 0.3445 0.4513 0.2698 -0.0206 -0.0439 0.0164  95   HOH A O   
2585 O  O   . HOH E .   ? 0.2109 0.2029 0.5641 -0.0598 0.0772  -0.0872 96   HOH A O   
2586 O  O   . HOH E .   ? 0.3257 0.3366 0.2564 0.0762  -0.0678 0.0984  97   HOH A O   
2587 O  O   . HOH E .   ? 0.1615 0.2848 0.3686 -0.0115 -0.0279 -0.0112 98   HOH A O   
2588 O  O   . HOH E .   ? 0.3509 0.2247 0.3572 0.0301  0.0015  0.0377  99   HOH A O   
2589 O  O   . HOH E .   ? 0.3825 0.4216 0.3897 -0.0109 -0.0376 0.0515  100  HOH A O   
2590 O  O   . HOH E .   ? 0.2943 0.2848 0.5556 -0.0493 -0.0354 0.0473  101  HOH A O   
2591 O  O   . HOH E .   ? 0.2867 0.3567 0.5338 0.0060  -0.0430 0.0206  102  HOH A O   
2592 O  O   . HOH E .   ? 0.2564 0.2797 0.3293 -0.0866 0.0701  0.0352  103  HOH A O   
2593 O  O   . HOH E .   ? 0.3610 0.2241 0.4573 0.0356  -0.0273 0.0830  104  HOH A O   
2594 O  O   . HOH E .   ? 0.3383 0.3311 0.3074 0.0278  -0.0839 -0.0276 105  HOH A O   
2595 O  O   . HOH E .   ? 0.3523 0.4395 0.3051 0.0602  -0.0764 -0.0746 106  HOH A O   
2596 O  O   . HOH E .   ? 0.2357 0.3528 0.3479 -0.0313 0.0113  0.0009  108  HOH A O   
2597 O  O   . HOH E .   ? 0.1854 0.3627 0.3932 0.0603  0.0105  -0.0210 109  HOH A O   
2598 O  O   . HOH E .   ? 0.2346 0.3738 0.3213 -0.0216 -0.0219 0.0177  110  HOH A O   
2599 O  O   . HOH E .   ? 0.2092 0.2846 0.5927 0.1307  -0.0285 -0.0049 111  HOH A O   
2600 O  O   . HOH E .   ? 0.4244 0.3871 0.3562 -0.1018 -0.0250 0.0113  112  HOH A O   
2601 O  O   . HOH E .   ? 0.2566 0.3021 0.5413 -0.0250 -0.0829 0.0405  113  HOH A O   
2602 O  O   . HOH E .   ? 0.1617 0.4236 0.4471 -0.0142 -0.0525 0.0289  114  HOH A O   
2603 O  O   . HOH E .   ? 0.3342 0.3412 0.4142 -0.1118 -0.0201 -0.0881 115  HOH A O   
2604 O  O   . HOH E .   ? 0.2816 0.5386 0.3292 0.0048  0.0436  -0.0352 116  HOH A O   
2605 O  O   . HOH E .   ? 0.1710 0.4379 0.4526 -0.0106 0.0043  0.0110  117  HOH A O   
2606 O  O   . HOH E .   ? 0.1803 0.3405 0.4883 -0.0305 0.0376  -0.0504 119  HOH A O   
2607 O  O   . HOH E .   ? 0.3212 0.3088 0.4173 0.0497  -0.0728 0.0539  120  HOH A O   
2608 O  O   . HOH E .   ? 0.5356 0.4520 0.5003 -0.0174 -0.0058 -0.0359 121  HOH A O   
2609 O  O   . HOH E .   ? 0.1846 0.3566 0.4018 -0.0478 -0.1679 -0.0131 122  HOH A O   
2610 O  O   . HOH E .   ? 0.3239 0.3897 0.4090 0.0209  -0.0145 -0.0652 123  HOH A O   
2611 O  O   . HOH E .   ? 0.2541 0.2768 0.4198 0.0166  -0.0427 0.0176  124  HOH A O   
2612 O  O   . HOH E .   ? 0.2685 0.5508 0.4763 -0.0139 -0.0139 0.0140  125  HOH A O   
2613 O  O   . HOH E .   ? 0.3644 0.3150 0.3974 0.1536  0.0511  0.0406  126  HOH A O   
2614 O  O   . HOH E .   ? 0.1860 0.4113 0.3691 0.1228  -0.1383 -0.1798 127  HOH A O   
2615 O  O   . HOH E .   ? 0.2711 0.5511 0.2877 -0.0885 -0.0488 -0.1013 128  HOH A O   
2616 O  O   . HOH E .   ? 0.2046 0.2961 0.5556 -0.0306 0.0721  -0.0725 129  HOH A O   
2617 O  O   . HOH E .   ? 0.4396 0.1675 0.3964 0.0910  -0.1556 0.0472  130  HOH A O   
2618 O  O   . HOH E .   ? 0.3137 0.3949 0.4837 -0.0308 -0.0030 -0.0425 131  HOH A O   
2619 O  O   . HOH E .   ? 0.3691 0.5930 0.6609 0.0816  -0.0124 0.0432  132  HOH A O   
2620 O  O   . HOH E .   ? 0.3756 0.4013 0.3968 0.0358  -0.0572 0.0200  133  HOH A O   
2621 O  O   . HOH E .   ? 0.2158 0.5603 0.4714 0.0022  -0.0474 -0.1298 134  HOH A O   
2622 O  O   . HOH E .   ? 0.3373 0.5807 0.4206 -0.0798 0.0499  0.0784  135  HOH A O   
2623 O  O   . HOH E .   ? 0.4294 0.4322 0.5314 -0.1241 0.0796  0.0264  136  HOH A O   
2624 O  O   . HOH E .   ? 0.4758 0.3572 0.3229 0.1137  -0.0235 -0.0510 137  HOH A O   
2625 O  O   . HOH E .   ? 0.3211 0.4725 0.2515 -0.0906 -0.0857 0.0956  138  HOH A O   
2626 O  O   . HOH E .   ? 0.4928 0.4582 0.2766 -0.0578 -0.0189 0.0722  139  HOH A O   
2627 O  O   . HOH E .   ? 0.3226 0.4951 0.5802 0.0707  -0.0438 -0.0735 140  HOH A O   
2628 O  O   . HOH E .   ? 0.1509 0.4748 0.4623 0.0165  -0.0768 -0.0079 141  HOH A O   
2629 O  O   . HOH E .   ? 0.1866 0.3129 0.5621 -0.0404 -0.0168 -0.0927 142  HOH A O   
2630 O  O   . HOH E .   ? 0.3727 0.4443 0.4771 -0.1731 -0.0094 -0.0924 143  HOH A O   
2631 O  O   . HOH E .   ? 0.4217 0.4294 0.3430 0.0441  -0.0087 0.0714  144  HOH A O   
2632 O  O   . HOH E .   ? 0.4958 0.4422 0.5524 -0.0637 -0.0695 0.0048  145  HOH A O   
2633 O  O   . HOH E .   ? 0.3327 0.2303 0.5930 0.0064  -0.1281 -0.0191 146  HOH A O   
2634 O  O   . HOH E .   ? 0.4097 0.3570 0.3831 0.0681  -0.1032 -0.1160 147  HOH A O   
2635 O  O   . HOH E .   ? 0.2710 0.5060 0.3052 0.0356  0.0660  0.0743  148  HOH A O   
2636 O  O   . HOH E .   ? 0.2590 0.2637 0.4033 -0.0312 -0.0480 0.1140  149  HOH A O   
2637 O  O   . HOH E .   ? 0.1422 0.5946 0.3590 0.1435  0.0211  0.0100  150  HOH A O   
2638 O  O   . HOH E .   ? 0.2280 0.3746 0.3396 0.0336  -0.0295 0.0138  151  HOH A O   
2639 O  O   . HOH E .   ? 0.2491 0.3470 0.4649 -0.0431 -0.0749 -0.0135 152  HOH A O   
2640 O  O   . HOH E .   ? 0.3230 0.2204 0.6722 -0.0781 0.0174  0.0252  153  HOH A O   
2641 O  O   . HOH E .   ? 0.4839 0.4764 0.4427 0.1131  0.0596  0.0423  154  HOH A O   
2642 O  O   . HOH E .   ? 0.4183 0.3180 0.4028 0.0953  -0.1019 -0.0411 156  HOH A O   
2643 O  O   . HOH E .   ? 0.2328 0.3730 0.6069 0.0160  -0.1271 0.0020  158  HOH A O   
2644 O  O   . HOH E .   ? 0.3471 0.4090 0.4299 0.0017  -0.0494 -0.0151 159  HOH A O   
2645 O  O   . HOH E .   ? 0.3281 0.1469 0.4865 0.0352  -0.0417 -0.0436 160  HOH A O   
2646 O  O   . HOH E .   ? 0.4383 0.3943 0.3197 -0.1494 -0.0792 0.0316  161  HOH A O   
2647 O  O   . HOH E .   ? 0.3432 0.4421 0.3940 0.0592  -0.1009 -0.0268 162  HOH A O   
2648 O  O   . HOH E .   ? 0.3039 0.5084 0.4945 -0.0189 -0.0980 0.0260  163  HOH A O   
2649 O  O   . HOH E .   ? 0.2858 0.2833 0.4820 -0.0039 -0.0613 -0.0179 164  HOH A O   
2650 O  O   . HOH E .   ? 0.4189 0.5482 0.6388 -0.0586 -0.0218 0.0069  165  HOH A O   
2651 O  O   . HOH E .   ? 0.2487 0.2571 0.4304 0.0020  0.0034  0.0384  166  HOH A O   
2652 O  O   . HOH E .   ? 0.3996 0.4404 0.4987 0.0398  -0.1033 0.0053  167  HOH A O   
2653 O  O   . HOH E .   ? 0.3029 0.5417 0.3974 -0.0450 -0.0544 -0.0174 168  HOH A O   
2654 O  O   . HOH E .   ? 0.3996 0.2859 0.4497 0.0915  0.0775  -0.0262 169  HOH A O   
2655 O  O   . HOH E .   ? 0.3057 0.3038 0.6201 0.0168  0.0269  -0.0803 170  HOH A O   
2656 O  O   . HOH E .   ? 0.3935 0.5726 0.4829 0.0370  -0.0804 0.0078  171  HOH A O   
2657 O  O   . HOH E .   ? 0.3149 0.4100 0.4688 -0.0924 0.0239  -0.0493 172  HOH A O   
2658 O  O   . HOH E .   ? 0.2389 0.5451 0.3115 0.0225  -0.0861 -0.0241 173  HOH A O   
2659 O  O   . HOH E .   ? 0.1302 0.3756 0.5939 -0.0334 -0.0506 0.0132  174  HOH A O   
2660 O  O   . HOH E .   ? 0.3678 0.3531 0.5026 0.1022  -0.0893 -0.0075 175  HOH A O   
2661 O  O   . HOH E .   ? 0.2806 0.2493 0.5266 -0.0031 -0.1066 -0.1129 176  HOH A O   
2662 O  O   . HOH E .   ? 0.3640 0.2783 0.4545 0.0540  0.0248  -0.0512 177  HOH A O   
2663 O  O   . HOH E .   ? 0.4681 0.5027 0.6217 0.0300  -0.0204 0.0338  178  HOH A O   
2664 O  O   . HOH E .   ? 0.3441 0.3918 0.4356 0.0040  -0.0574 -0.1196 179  HOH A O   
2665 O  O   . HOH E .   ? 0.2910 0.3481 0.4390 -0.0074 -0.0652 -0.0636 180  HOH A O   
2666 O  O   . HOH E .   ? 0.5416 0.5763 0.4057 -0.0408 -0.0383 -0.0069 181  HOH A O   
2667 O  O   . HOH E .   ? 0.3323 0.4442 0.4325 0.0257  -0.1095 -0.0159 182  HOH A O   
2668 O  O   . HOH E .   ? 0.3986 0.3612 0.3522 0.0497  0.0875  0.0418  183  HOH A O   
2669 O  O   . HOH E .   ? 0.3824 0.3124 0.5463 0.0683  0.0031  0.0703  184  HOH A O   
2670 O  O   . HOH E .   ? 0.4554 0.5397 0.4789 0.0596  -0.0906 0.0483  185  HOH A O   
2671 O  O   . HOH E .   ? 0.3211 0.4399 0.4223 0.0493  -0.1627 -0.0875 186  HOH A O   
2672 O  O   . HOH E .   ? 0.2829 0.5019 0.3582 -0.0213 -0.0934 -0.0029 187  HOH A O   
2673 O  O   . HOH E .   ? 0.2844 0.4082 0.5818 0.0866  -0.1055 0.0631  188  HOH A O   
2674 O  O   . HOH E .   ? 0.2618 0.3296 0.3930 0.0986  -0.0815 0.0189  189  HOH A O   
2675 O  O   . HOH E .   ? 0.4788 0.4918 0.6844 -0.0060 -0.0092 -0.0281 190  HOH A O   
2676 O  O   . HOH E .   ? 0.4347 0.4585 0.4181 0.0376  -0.0005 -0.0588 191  HOH A O   
2677 O  O   . HOH E .   ? 0.4248 0.5264 0.4171 0.0043  0.0137  -0.0088 192  HOH A O   
2678 O  O   . HOH E .   ? 0.5277 0.3946 0.5953 -0.1323 0.0243  -0.0149 193  HOH A O   
2679 O  O   . HOH E .   ? 0.4761 0.3686 0.5052 -0.0305 -0.0549 -0.0583 194  HOH A O   
2680 O  O   . HOH E .   ? 0.3297 0.4559 0.4459 0.0976  -0.0494 0.0635  195  HOH A O   
2681 O  O   . HOH E .   ? 0.4236 0.3824 0.5084 -0.0723 -0.0846 -0.0260 196  HOH A O   
2682 O  O   . HOH E .   ? 0.5345 0.3406 0.4532 0.0715  -0.0498 -0.0310 197  HOH A O   
2683 O  O   . HOH E .   ? 0.3483 0.4241 0.4540 0.0778  -0.0953 0.0489  198  HOH A O   
2684 O  O   . HOH E .   ? 0.3698 0.3590 0.4507 -0.0746 0.0157  -0.0822 199  HOH A O   
2685 O  O   . HOH E .   ? 0.5244 0.3661 0.3749 0.0573  -0.0719 0.0152  200  HOH A O   
2686 O  O   . HOH E .   ? 0.3330 0.5034 0.3011 0.0148  0.0515  0.0352  202  HOH A O   
2687 O  O   . HOH E .   ? 0.3416 0.3469 0.3750 -0.0585 -0.1226 0.0003  203  HOH A O   
2688 O  O   . HOH E .   ? 0.4024 0.3835 0.3334 0.0147  0.0205  -0.0022 204  HOH A O   
2689 O  O   . HOH E .   ? 0.6961 0.4895 0.4031 0.0341  0.0331  0.0051  205  HOH A O   
2690 O  O   . HOH E .   ? 0.5594 0.4250 0.4778 0.0796  -0.0578 -0.0339 207  HOH A O   
2691 O  O   . HOH E .   ? 0.5275 0.5519 0.6588 -0.1150 0.0326  -0.0426 208  HOH A O   
2692 O  O   . HOH E .   ? 0.1623 0.5956 0.5490 0.1222  -0.0163 -0.0166 209  HOH A O   
2693 O  O   . HOH E .   ? 0.2208 0.4341 0.5398 0.0523  -0.0013 0.0669  211  HOH A O   
2694 O  O   . HOH E .   ? 0.3124 0.3119 0.4389 -0.0917 0.0094  0.0163  214  HOH A O   
2695 O  O   . HOH E .   ? 0.2706 0.5035 0.5138 -0.0312 -0.0042 -0.0222 215  HOH A O   
2696 O  O   . HOH E .   ? 0.3679 0.3303 0.4507 -0.0541 -0.1083 0.0189  216  HOH A O   
2697 O  O   . HOH E .   ? 0.4712 0.2689 0.3723 0.0879  -0.0906 -0.0022 217  HOH A O   
2698 O  O   . HOH E .   ? 0.4027 0.3196 0.4710 -0.0303 -0.0272 0.0273  218  HOH A O   
2699 O  O   . HOH E .   ? 0.4732 0.6171 0.5519 0.0256  -0.0670 -0.0164 219  HOH A O   
2700 O  O   . HOH E .   ? 0.3908 0.3222 0.4365 -0.0783 -0.0593 -0.0189 220  HOH A O   
2701 O  O   . HOH E .   ? 0.1746 0.5777 0.3763 -0.0327 -0.0577 0.0013  221  HOH A O   
2702 O  O   . HOH E .   ? 0.5607 0.4985 0.3700 0.0080  -0.1082 0.0210  222  HOH A O   
2703 O  O   . HOH E .   ? 0.2564 0.3331 0.4706 -0.0392 0.0766  -0.0086 223  HOH A O   
2704 O  O   . HOH E .   ? 0.4971 0.5282 0.5848 0.0095  -0.0431 -0.0009 224  HOH A O   
2705 O  O   . HOH E .   ? 0.3225 0.2900 0.4392 -0.0130 -0.0935 0.0790  225  HOH A O   
2706 O  O   . HOH E .   ? 0.3524 0.4311 0.4479 0.1186  -0.1379 -0.0116 226  HOH A O   
2707 O  O   . HOH E .   ? 0.3435 0.4031 0.6398 -0.0446 0.0444  0.0382  227  HOH A O   
2708 O  O   . HOH E .   ? 0.3975 0.5738 0.4515 0.0446  0.0938  -0.0303 228  HOH A O   
2709 O  O   . HOH E .   ? 0.2855 0.5394 0.4701 0.1144  -0.0606 -0.0166 229  HOH A O   
2710 O  O   . HOH E .   ? 0.4376 0.4177 0.5980 -0.1285 -0.0053 0.0216  230  HOH A O   
2711 O  O   . HOH E .   ? 0.5718 0.5923 0.5551 -0.0083 0.0362  -0.0095 232  HOH A O   
2712 O  O   . HOH E .   ? 0.6167 0.6129 0.5452 0.0232  -0.0153 0.0220  233  HOH A O   
2713 O  O   . HOH E .   ? 0.4169 0.4477 0.4219 -0.0596 0.0241  0.1387  234  HOH A O   
2714 O  O   . HOH E .   ? 0.3148 0.4665 0.4262 -0.0178 -0.1303 -0.0284 235  HOH A O   
2715 O  O   . HOH E .   ? 0.4927 0.4222 0.4804 0.0340  -0.0216 -0.0051 239  HOH A O   
2716 O  O   . HOH E .   ? 0.3655 0.4332 0.4478 -0.0398 -0.0430 -0.0721 241  HOH A O   
2717 O  O   . HOH E .   ? 0.2337 0.4143 0.4137 0.0321  0.0169  0.0136  245  HOH A O   
2718 O  O   . HOH E .   ? 0.1681 0.2139 0.2655 0.0543  -0.0142 -0.0224 246  HOH A O   
2719 O  O   . HOH E .   ? 0.2005 0.3060 0.2805 0.0149  -0.1201 -0.0049 247  HOH A O   
2720 O  O   . HOH E .   ? 0.1118 0.3127 0.5562 -0.0950 -0.0134 -0.0004 248  HOH A O   
2721 O  O   . HOH E .   ? 0.2027 0.4419 0.4568 0.0262  -0.0526 -0.0202 249  HOH A O   
2722 O  O   . HOH E .   ? 0.2845 0.3399 0.5755 -0.0266 -0.0642 -0.0241 250  HOH A O   
2723 O  O   . HOH E .   ? 0.2744 0.3779 0.6663 -0.0462 -0.0095 0.0176  251  HOH A O   
2724 O  O   . HOH E .   ? 0.3159 0.4337 0.4992 -0.1500 -0.0045 0.0248  252  HOH A O   
2725 O  O   . HOH E .   ? 0.3607 0.5504 0.4005 0.0938  0.0553  0.0214  253  HOH A O   
2726 O  O   . HOH E .   ? 0.2715 0.3183 0.4945 -0.0151 -0.0583 0.0414  254  HOH A O   
2727 O  O   . HOH E .   ? 0.5791 0.4548 0.5508 0.0367  0.0140  0.0519  255  HOH A O   
2728 O  O   . HOH E .   ? 0.2426 0.5567 0.6574 0.0953  0.0565  0.0102  256  HOH A O   
2729 O  O   . HOH E .   ? 0.6084 0.3632 0.3503 0.0504  0.0169  -0.0021 257  HOH A O   
2730 O  O   . HOH E .   ? 0.2951 0.4718 0.5782 -0.0269 -0.0840 0.0041  258  HOH A O   
2731 O  O   . HOH E .   ? 0.5166 0.3066 0.5926 0.0363  -0.0703 -0.0701 259  HOH A O   
2732 O  O   . HOH E .   ? 0.3707 0.5468 0.3283 -0.0812 -0.0349 0.0988  260  HOH A O   
2733 O  O   . HOH E .   ? 0.4973 0.4343 0.5835 -0.0427 -0.0372 -0.0714 263  HOH A O   
2734 O  O   . HOH E .   ? 0.3956 0.3914 0.4048 0.0450  -0.0916 0.0144  265  HOH A O   
2735 O  O   . HOH E .   ? 0.4486 0.3926 0.3945 -0.1004 -0.0323 0.0539  266  HOH A O   
2736 O  O   . HOH E .   ? 0.3771 0.5212 0.4198 0.0050  -0.0287 -0.0009 267  HOH A O   
2737 O  O   . HOH E .   ? 0.3591 0.3089 0.5328 -0.0460 0.0000  0.0321  268  HOH A O   
2738 O  O   . HOH E .   ? 0.2889 0.6136 0.4620 0.0238  -0.0406 0.0295  269  HOH A O   
2739 O  O   . HOH E .   ? 0.3856 0.4046 0.5431 -0.0098 0.0081  -0.1040 270  HOH A O   
2740 O  O   . HOH E .   ? 0.7005 0.6437 0.6454 0.0041  0.0168  0.0625  271  HOH A O   
2741 O  O   . HOH E .   ? 0.4879 0.4813 0.4169 0.0652  -0.0834 0.1341  272  HOH A O   
2742 O  O   . HOH E .   ? 0.3765 0.5929 0.5538 0.0704  -0.0884 0.0732  273  HOH A O   
2743 O  O   . HOH E .   ? 0.4250 0.4265 0.4798 -0.0239 0.0169  0.0400  274  HOH A O   
2744 O  O   . HOH E .   ? 0.2663 0.3537 0.5746 0.0475  -0.0351 -0.0139 275  HOH A O   
2745 O  O   . HOH E .   ? 0.5237 0.4755 0.4879 0.1027  0.0294  -0.0548 280  HOH A O   
2746 O  O   . HOH E .   ? 0.4905 0.5226 0.3567 0.0122  -0.0379 -0.0410 286  HOH A O   
2747 O  O   . HOH E .   ? 0.4221 0.5021 0.4289 0.0552  0.0804  0.0105  287  HOH A O   
2748 O  O   . HOH E .   ? 0.3086 0.4693 0.6683 -0.1769 -0.0778 -0.0926 289  HOH A O   
2749 O  O   . HOH E .   ? 0.3516 0.3397 0.3214 -0.0211 -0.1209 0.0596  292  HOH A O   
2750 O  O   . HOH E .   ? 0.2297 0.2114 0.4106 -0.0182 -0.0599 0.0521  293  HOH A O   
2751 O  O   . HOH E .   ? 0.2442 0.3896 0.4737 -0.0363 -0.0555 0.0247  294  HOH A O   
2752 O  O   . HOH E .   ? 0.4212 0.5052 0.4633 0.0204  -0.0057 0.0130  295  HOH A O   
2753 O  O   . HOH E .   ? 0.2478 0.3145 0.4632 0.0105  0.0114  0.0763  296  HOH A O   
2754 O  O   . HOH E .   ? 0.3254 0.2772 0.5282 -0.0294 0.0702  -0.0462 297  HOH A O   
2755 O  O   . HOH E .   ? 0.4163 0.4119 0.5300 -0.0322 -0.0427 0.0444  298  HOH A O   
2756 O  O   . HOH E .   ? 0.2871 0.5692 0.3482 0.0397  -0.0101 0.1014  299  HOH A O   
2757 O  O   . HOH E .   ? 0.4618 0.4442 0.6050 -0.0530 -0.0048 -0.0033 302  HOH A O   
2758 O  O   . HOH E .   ? 0.2611 0.2917 0.4206 0.0230  -0.0703 -0.0297 305  HOH A O   
2759 O  O   . HOH E .   ? 0.3759 0.5055 0.4769 0.1492  -0.0825 0.0480  307  HOH A O   
2760 O  O   . HOH E .   ? 0.4129 0.6251 0.4949 0.0120  -0.0523 -0.0331 308  HOH A O   
2761 O  O   . HOH E .   ? 0.5333 0.5626 0.5371 0.0023  -0.0140 -0.0214 309  HOH A O   
2762 O  O   . HOH E .   ? 0.4973 0.3564 0.4276 -0.0127 -0.0560 -0.0586 315  HOH A O   
2763 O  O   . HOH E .   ? 0.3197 0.4494 0.5420 -0.0022 -0.0428 -0.0031 316  HOH A O   
2764 O  O   . HOH E .   ? 0.5123 0.4214 0.4768 0.0978  -0.0875 -0.0022 320  HOH A O   
2765 O  O   . HOH E .   ? 0.3557 0.3685 0.4842 0.0329  -0.0813 -0.0244 328  HOH A O   
2766 O  O   . HOH E .   ? 0.5297 0.4239 0.3864 0.1044  -0.1087 -0.0064 329  HOH A O   
2767 O  O   . HOH E .   ? 0.3317 0.3895 0.3231 0.1053  -0.0020 0.0507  330  HOH A O   
2768 O  O   . HOH E .   ? 0.5342 0.3732 0.5079 0.0322  -0.0056 0.0506  331  HOH A O   
2769 O  O   . HOH E .   ? 0.3905 0.3553 0.5233 0.0106  -0.0446 -0.0013 332  HOH A O   
2770 O  O   . HOH E .   ? 0.3835 0.3408 0.5933 -0.0511 -0.1099 -0.0160 335  HOH A O   
2771 O  O   . HOH E .   ? 0.4367 0.4078 0.6662 -0.0900 0.0413  -0.0606 336  HOH A O   
2772 O  O   . HOH E .   ? 0.5286 0.5849 0.4971 -0.0243 -0.0335 0.0252  337  HOH A O   
2773 O  O   . HOH E .   ? 0.3868 0.4972 0.5239 -0.0777 0.0100  0.0147  341  HOH A O   
2774 O  O   . HOH E .   ? 0.4640 0.5100 0.5805 0.1255  -0.0823 0.0753  342  HOH A O   
2775 O  O   . HOH E .   ? 0.4238 0.3631 0.5015 0.0287  -0.0710 0.0954  343  HOH A O   
2776 O  O   . HOH E .   ? 0.5047 0.6273 0.5422 0.0201  -0.0362 0.0314  345  HOH A O   
2777 O  O   . HOH E .   ? 0.4744 0.5602 0.6011 -0.0779 -0.0304 -0.0193 349  HOH A O   
2778 O  O   . HOH E .   ? 0.5665 0.5105 0.5076 -0.0392 -0.0250 0.0233  350  HOH A O   
2779 O  O   . HOH E .   ? 0.4565 0.5025 0.5400 -0.0890 0.0901  -0.0099 351  HOH A O   
2780 O  O   . HOH E .   ? 0.4787 0.3705 0.4269 -0.0133 0.0098  0.1832  359  HOH A O   
2781 O  O   . HOH E .   ? 0.4006 0.4734 0.4702 -0.0127 0.0563  0.0337  360  HOH A O   
2782 O  O   . HOH E .   ? 0.3063 0.4438 0.4573 0.0617  0.0459  -0.0847 361  HOH A O   
2783 O  O   . HOH E .   ? 0.2502 0.4447 0.5053 0.0502  0.0106  -0.0789 362  HOH A O   
2784 O  O   . HOH E .   ? 0.2009 0.4727 0.5532 -0.0712 -0.0264 -0.0249 363  HOH A O   
2785 O  O   . HOH E .   ? 0.4921 0.4308 0.3618 0.1274  -0.0129 0.0524  364  HOH A O   
2786 O  O   . HOH E .   ? 0.2082 0.5359 0.3907 -0.0317 -0.0704 0.0324  365  HOH A O   
2787 O  O   . HOH E .   ? 0.3963 0.5299 0.3918 -0.0965 -0.0057 0.0370  366  HOH A O   
2788 O  O   . HOH E .   ? 0.3858 0.3709 0.5693 -0.0141 -0.0473 0.1148  367  HOH A O   
2789 O  O   . HOH E .   ? 0.2740 0.4669 0.5217 -0.0241 -0.0568 0.0158  368  HOH A O   
2790 O  O   . HOH E .   ? 0.3164 0.3985 0.3898 -0.0118 -0.0654 -0.0169 369  HOH A O   
2791 O  O   . HOH E .   ? 0.2476 0.3963 0.4970 -0.0339 -0.0589 0.0404  370  HOH A O   
2792 O  O   . HOH E .   ? 0.2662 0.3825 0.4881 0.0037  -0.0717 0.0194  371  HOH A O   
2793 O  O   . HOH E .   ? 0.3288 0.4162 0.5350 -0.0678 -0.0477 0.0724  372  HOH A O   
2794 O  O   . HOH E .   ? 0.4196 0.4745 0.4161 -0.0779 -0.0400 0.0008  373  HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1675 ?    ?   ?   A . n 
A 1 2   ASN 2   1676 1676 ASN ASN A . n 
A 1 3   ARG 3   1677 1677 ARG ARG A . n 
A 1 4   LYS 4   1678 1678 LYS LYS A . n 
A 1 5   THR 5   1679 1679 THR THR A . n 
A 1 6   SER 6   1680 1680 SER SER A . n 
A 1 7   CYS 7   1681 1681 CYS CYS A . n 
A 1 8   PRO 8   1682 1682 PRO PRO A . n 
A 1 9   ILE 9   1683 1683 ILE ILE A . n 
A 1 10  LYS 10  1684 1684 LYS LYS A . n 
A 1 11  ILE 11  1685 1685 ILE ILE A . n 
A 1 12  ASN 12  1686 1686 ASN ASN A . n 
A 1 13  GLN 13  1687 1687 GLN GLN A . n 
A 1 14  PHE 14  1688 1688 PHE PHE A . n 
A 1 15  GLU 15  1689 1689 GLU GLU A . n 
A 1 16  GLY 16  1690 1690 GLY GLY A . n 
A 1 17  HIS 17  1691 1691 HIS HIS A . n 
A 1 18  PHE 18  1692 1692 PHE PHE A . n 
A 1 19  MET 19  1693 1693 MET MET A . n 
A 1 20  LYS 20  1694 1694 LYS LYS A . n 
A 1 21  LEU 21  1695 1695 LEU LEU A . n 
A 1 22  GLN 22  1696 1696 GLN GLN A . n 
A 1 23  ALA 23  1697 1697 ALA ALA A . n 
A 1 24  ASP 24  1698 1698 ASP ASP A . n 
A 1 25  SER 25  1699 1699 SER SER A . n 
A 1 26  ASN 26  1700 1700 ASN ASN A . n 
A 1 27  TYR 27  1701 1701 TYR TYR A . n 
A 1 28  LEU 28  1702 1702 LEU LEU A . n 
A 1 29  LEU 29  1703 1703 LEU LEU A . n 
A 1 30  SER 30  1704 1704 SER SER A . n 
A 1 31  LYS 31  1705 1705 LYS LYS A . n 
A 1 32  GLU 32  1706 1706 GLU GLU A . n 
A 1 33  TYR 33  1707 1707 TYR TYR A . n 
A 1 34  GLU 34  1708 1708 GLU GLU A . n 
A 1 35  GLU 35  1709 1709 GLU GLU A . n 
A 1 36  LEU 36  1710 1710 LEU LEU A . n 
A 1 37  LYS 37  1711 1711 LYS LYS A . n 
A 1 38  ASP 38  1712 1712 ASP ASP A . n 
A 1 39  VAL 39  1713 1713 VAL VAL A . n 
A 1 40  GLY 40  1714 1714 GLY GLY A . n 
A 1 41  ARG 41  1715 1715 ARG ARG A . n 
A 1 42  ASN 42  1716 1716 ASN ASN A . n 
A 1 43  GLN 43  1717 1717 GLN GLN A . n 
A 1 44  SER 44  1718 1718 SER SER A . n 
A 1 45  CYS 45  1719 1719 CYS CYS A . n 
A 1 46  ASP 46  1720 1720 ASP ASP A . n 
A 1 47  ILE 47  1721 1721 ILE ILE A . n 
A 1 48  ALA 48  1722 1722 ALA ALA A . n 
A 1 49  LEU 49  1723 1723 LEU LEU A . n 
A 1 50  LEU 50  1724 1724 LEU LEU A . n 
A 1 51  PRO 51  1725 1725 PRO PRO A . n 
A 1 52  GLU 52  1726 1726 GLU GLU A . n 
A 1 53  ASN 53  1727 1727 ASN ASN A . n 
A 1 54  ARG 54  1728 1728 ARG ARG A . n 
A 1 55  GLY 55  1729 1729 GLY GLY A . n 
A 1 56  LYS 56  1730 1730 LYS LYS A . n 
A 1 57  ASN 57  1731 1731 ASN ASN A . n 
A 1 58  ARG 58  1732 1732 ARG ARG A . n 
A 1 59  TYR 59  1733 1733 TYR TYR A . n 
A 1 60  ASN 60  1734 1734 ASN ASN A . n 
A 1 61  ASN 61  1735 1735 ASN ASN A . n 
A 1 62  ILE 62  1736 1736 ILE ILE A . n 
A 1 63  LEU 63  1737 1737 LEU LEU A . n 
A 1 64  PRO 64  1738 1738 PRO PRO A . n 
A 1 65  TYR 65  1739 1739 TYR TYR A . n 
A 1 66  ASP 66  1740 1740 ASP ASP A . n 
A 1 67  ALA 67  1741 1741 ALA ALA A . n 
A 1 68  THR 68  1742 1742 THR THR A . n 
A 1 69  ARG 69  1743 1743 ARG ARG A . n 
A 1 70  VAL 70  1744 1744 VAL VAL A . n 
A 1 71  LYS 71  1745 1745 LYS LYS A . n 
A 1 72  LEU 72  1746 1746 LEU LEU A . n 
A 1 73  SER 73  1747 1747 SER SER A . n 
A 1 74  GLY 74  1748 1748 GLY GLY A . n 
A 1 75  GLY 75  1749 1749 GLY GLY A . n 
A 1 76  SER 76  1755 1755 SER SER A . n 
A 1 77  ASP 77  1756 1756 ASP ASP A . n 
A 1 78  TYR 78  1757 1757 TYR TYR A . n 
A 1 79  ILE 79  1758 1758 ILE ILE A . n 
A 1 80  ASN 80  1759 1759 ASN ASN A . n 
A 1 81  ALA 81  1760 1760 ALA ALA A . n 
A 1 82  SER 82  1761 1761 SER SER A . n 
A 1 83  TYR 83  1762 1762 TYR TYR A . n 
A 1 84  ILE 84  1763 1763 ILE ILE A . n 
A 1 85  PRO 85  1764 1764 PRO PRO A . n 
A 1 86  GLY 86  1765 1765 GLY GLY A . n 
A 1 87  ASN 87  1766 1766 ASN ASN A . n 
A 1 88  ASN 88  1767 1767 ASN ASN A . n 
A 1 89  PHE 89  1768 1768 PHE PHE A . n 
A 1 90  ARG 90  1769 1769 ARG ARG A . n 
A 1 91  ARG 91  1770 1770 ARG ARG A . n 
A 1 92  GLU 92  1771 1771 GLU GLU A . n 
A 1 93  TYR 93  1772 1772 TYR TYR A . n 
A 1 94  ILE 94  1773 1773 ILE ILE A . n 
A 1 95  VAL 95  1774 1774 VAL VAL A . n 
A 1 96  THR 96  1775 1775 THR THR A . n 
A 1 97  GLN 97  1776 1776 GLN GLN A . n 
A 1 98  GLY 98  1777 1777 GLY GLY A . n 
A 1 99  PRO 99  1778 1778 PRO PRO A . n 
A 1 100 LEU 100 1779 1779 LEU LEU A . n 
A 1 101 PRO 101 1780 1780 PRO PRO A . n 
A 1 102 GLY 102 1781 1781 GLY GLY A . n 
A 1 103 THR 103 1782 1782 THR THR A . n 
A 1 104 LYS 104 1783 1783 LYS LYS A . n 
A 1 105 ASP 105 1784 1784 ASP ASP A . n 
A 1 106 ASP 106 1785 1785 ASP ASP A . n 
A 1 107 PHE 107 1786 1786 PHE PHE A . n 
A 1 108 TRP 108 1787 1787 TRP TRP A . n 
A 1 109 LYS 109 1788 1788 LYS LYS A . n 
A 1 110 MET 110 1789 1789 MET MET A . n 
A 1 111 VAL 111 1790 1790 VAL VAL A . n 
A 1 112 TRP 112 1791 1791 TRP TRP A . n 
A 1 113 GLU 113 1792 1792 GLU GLU A . n 
A 1 114 GLN 114 1793 1793 GLN GLN A . n 
A 1 115 ASN 115 1794 1794 ASN ASN A . n 
A 1 116 VAL 116 1795 1795 VAL VAL A . n 
A 1 117 HIS 117 1796 1796 HIS HIS A . n 
A 1 118 ASN 118 1797 1797 ASN ASN A . n 
A 1 119 ILE 119 1798 1798 ILE ILE A . n 
A 1 120 VAL 120 1799 1799 VAL VAL A . n 
A 1 121 MET 121 1800 1800 MET MET A . n 
A 1 122 VAL 122 1801 1801 VAL VAL A . n 
A 1 123 THR 123 1802 1802 THR THR A . n 
A 1 124 GLN 124 1803 1803 GLN GLN A . n 
A 1 125 CYS 125 1804 1804 CYS CYS A . n 
A 1 126 VAL 126 1805 1805 VAL VAL A . n 
A 1 127 GLU 127 1806 1806 GLU GLU A . n 
A 1 128 LYS 128 1807 1807 LYS LYS A . n 
A 1 129 GLY 129 1808 1808 GLY GLY A . n 
A 1 130 ARG 130 1809 1809 ARG ARG A . n 
A 1 131 VAL 131 1810 1810 VAL VAL A . n 
A 1 132 LYS 132 1811 1811 LYS LYS A . n 
A 1 133 CYS 133 1812 1812 CYS CYS A . n 
A 1 134 ASP 134 1813 1813 ASP ASP A . n 
A 1 135 HIS 135 1814 1814 HIS HIS A . n 
A 1 136 TYR 136 1815 1815 TYR TYR A . n 
A 1 137 TRP 137 1816 1816 TRP TRP A . n 
A 1 138 PRO 138 1817 1817 PRO PRO A . n 
A 1 139 ALA 139 1818 1818 ALA ALA A . n 
A 1 140 ASP 140 1819 1819 ASP ASP A . n 
A 1 141 GLN 141 1820 1820 GLN GLN A . n 
A 1 142 ASP 142 1821 1821 ASP ASP A . n 
A 1 143 SER 143 1822 1822 SER SER A . n 
A 1 144 LEU 144 1823 1823 LEU LEU A . n 
A 1 145 TYR 145 1824 1824 TYR TYR A . n 
A 1 146 TYR 146 1825 1825 TYR TYR A . n 
A 1 147 GLY 147 1826 1826 GLY GLY A . n 
A 1 148 ASP 148 1827 1827 ASP ASP A . n 
A 1 149 LEU 149 1828 1828 LEU LEU A . n 
A 1 150 ILE 150 1829 1829 ILE ILE A . n 
A 1 151 LEU 151 1830 1830 LEU LEU A . n 
A 1 152 GLN 152 1831 1831 GLN GLN A . n 
A 1 153 MET 153 1832 1832 MET MET A . n 
A 1 154 LEU 154 1833 1833 LEU LEU A . n 
A 1 155 SER 155 1834 1834 SER SER A . n 
A 1 156 GLU 156 1835 1835 GLU GLU A . n 
A 1 157 SER 157 1836 1836 SER SER A . n 
A 1 158 VAL 158 1837 1837 VAL VAL A . n 
A 1 159 LEU 159 1838 1838 LEU LEU A . n 
A 1 160 PRO 160 1839 1839 PRO PRO A . n 
A 1 161 GLU 161 1840 1840 GLU GLU A . n 
A 1 162 TRP 162 1841 1841 TRP TRP A . n 
A 1 163 THR 163 1842 1842 THR THR A . n 
A 1 164 ILE 164 1843 1843 ILE ILE A . n 
A 1 165 ARG 165 1844 1844 ARG ARG A . n 
A 1 166 GLU 166 1845 1845 GLU GLU A . n 
A 1 167 PHE 167 1846 1846 PHE PHE A . n 
A 1 168 LYS 168 1847 1847 LYS LYS A . n 
A 1 169 ILE 169 1848 1848 ILE ILE A . n 
A 1 170 CYS 170 1849 1849 CYS CYS A . n 
A 1 171 GLY 171 1850 1850 GLY GLY A . n 
A 1 172 GLU 172 1851 1851 GLU GLU A . n 
A 1 173 GLU 173 1852 ?    ?   ?   A . n 
A 1 174 GLN 174 1853 ?    ?   ?   A . n 
A 1 175 LEU 175 1854 ?    ?   ?   A . n 
A 1 176 ASP 176 1855 ?    ?   ?   A . n 
A 1 177 ALA 177 1856 ?    ?   ?   A . n 
A 1 178 HIS 178 1857 1857 HIS HIS A . n 
A 1 179 ARG 179 1858 1858 ARG ARG A . n 
A 1 180 LEU 180 1859 1859 LEU LEU A . n 
A 1 181 ILE 181 1860 1860 ILE ILE A . n 
A 1 182 ARG 182 1861 1861 ARG ARG A . n 
A 1 183 HIS 183 1862 1862 HIS HIS A . n 
A 1 184 PHE 184 1863 1863 PHE PHE A . n 
A 1 185 HIS 185 1864 1864 HIS HIS A . n 
A 1 186 TYR 186 1865 1865 TYR TYR A . n 
A 1 187 THR 187 1866 1866 THR THR A . n 
A 1 188 VAL 188 1867 1867 VAL VAL A . n 
A 1 189 TRP 189 1868 1868 TRP TRP A . n 
A 1 190 PRO 190 1869 1869 PRO PRO A . n 
A 1 191 ASP 191 1870 1870 ASP ASP A . n 
A 1 192 HIS 192 1871 1871 HIS HIS A . n 
A 1 193 GLY 193 1872 1872 GLY GLY A . n 
A 1 194 VAL 194 1873 1873 VAL VAL A . n 
A 1 195 PRO 195 1874 1874 PRO PRO A . n 
A 1 196 GLU 196 1875 1875 GLU GLU A . n 
A 1 197 THR 197 1876 1876 THR THR A . n 
A 1 198 THR 198 1877 1877 THR THR A . n 
A 1 199 GLN 199 1878 1878 GLN GLN A . n 
A 1 200 SER 200 1879 1879 SER SER A . n 
A 1 201 LEU 201 1880 1880 LEU LEU A . n 
A 1 202 ILE 202 1881 1881 ILE ILE A . n 
A 1 203 GLN 203 1882 1882 GLN GLN A . n 
A 1 204 PHE 204 1883 1883 PHE PHE A . n 
A 1 205 VAL 205 1884 1884 VAL VAL A . n 
A 1 206 ARG 206 1885 1885 ARG ARG A . n 
A 1 207 THR 207 1886 1886 THR THR A . n 
A 1 208 VAL 208 1887 1887 VAL VAL A . n 
A 1 209 ARG 209 1888 1888 ARG ARG A . n 
A 1 210 ASP 210 1889 1889 ASP ASP A . n 
A 1 211 TYR 211 1890 1890 TYR TYR A . n 
A 1 212 ILE 212 1891 1891 ILE ILE A . n 
A 1 213 ASN 213 1892 1892 ASN ASN A . n 
A 1 214 ARG 214 1893 1893 ARG ARG A . n 
A 1 215 SER 215 1894 1894 SER SER A . n 
A 1 216 PRO 216 1895 1895 PRO PRO A . n 
A 1 217 GLY 217 1896 1896 GLY GLY A . n 
A 1 218 ALA 218 1897 1897 ALA ALA A . n 
A 1 219 GLY 219 1898 1898 GLY GLY A . n 
A 1 220 PRO 220 1899 1899 PRO PRO A . n 
A 1 221 THR 221 1900 1900 THR THR A . n 
A 1 222 VAL 222 1901 1901 VAL VAL A . n 
A 1 223 VAL 223 1902 1902 VAL VAL A . n 
A 1 224 HIS 224 1903 1903 HIS HIS A . n 
A 1 225 CYS 225 1904 1904 CYS CYS A . n 
A 1 226 SER 226 1905 1905 SER SER A . n 
A 1 227 ALA 227 1906 1906 ALA ALA A . n 
A 1 228 GLY 228 1907 1907 GLY GLY A . n 
A 1 229 VAL 229 1908 1908 VAL VAL A . n 
A 1 230 GLY 230 1909 1909 GLY GLY A . n 
A 1 231 ARG 231 1910 1910 ARG ARG A . n 
A 1 232 THR 232 1911 1911 THR THR A . n 
A 1 233 GLY 233 1912 1912 GLY GLY A . n 
A 1 234 THR 234 1913 1913 THR THR A . n 
A 1 235 PHE 235 1914 1914 PHE PHE A . n 
A 1 236 ILE 236 1915 1915 ILE ILE A . n 
A 1 237 ALA 237 1916 1916 ALA ALA A . n 
A 1 238 LEU 238 1917 1917 LEU LEU A . n 
A 1 239 ASP 239 1918 1918 ASP ASP A . n 
A 1 240 ARG 240 1919 1919 ARG ARG A . n 
A 1 241 ILE 241 1920 1920 ILE ILE A . n 
A 1 242 LEU 242 1921 1921 LEU LEU A . n 
A 1 243 GLN 243 1922 1922 GLN GLN A . n 
A 1 244 GLN 244 1923 1923 GLN GLN A . n 
A 1 245 LEU 245 1924 1924 LEU LEU A . n 
A 1 246 ASP 246 1925 1925 ASP ASP A . n 
A 1 247 SER 247 1926 1926 SER SER A . n 
A 1 248 LYS 248 1927 1927 LYS LYS A . n 
A 1 249 ASP 249 1928 1928 ASP ASP A . n 
A 1 250 SER 250 1929 1929 SER SER A . n 
A 1 251 VAL 251 1930 1930 VAL VAL A . n 
A 1 252 ASP 252 1931 1931 ASP ASP A . n 
A 1 253 ILE 253 1932 1932 ILE ILE A . n 
A 1 254 TYR 254 1933 1933 TYR TYR A . n 
A 1 255 GLY 255 1934 1934 GLY GLY A . n 
A 1 256 ALA 256 1935 1935 ALA ALA A . n 
A 1 257 VAL 257 1936 1936 VAL VAL A . n 
A 1 258 HIS 258 1937 1937 HIS HIS A . n 
A 1 259 ASP 259 1938 1938 ASP ASP A . n 
A 1 260 LEU 260 1939 1939 LEU LEU A . n 
A 1 261 ARG 261 1940 1940 ARG ARG A . n 
A 1 262 LEU 262 1941 1941 LEU LEU A . n 
A 1 263 HIS 263 1942 1942 HIS HIS A . n 
A 1 264 ARG 264 1943 1943 ARG ARG A . n 
A 1 265 VAL 265 1944 1944 VAL VAL A . n 
A 1 266 HIS 266 1945 1945 HIS HIS A . n 
A 1 267 MET 267 1946 1946 MET MET A . n 
A 1 268 VAL 268 1947 1947 VAL VAL A . n 
A 1 269 GLN 269 1948 1948 GLN GLN A . n 
A 1 270 THR 270 1949 1949 THR THR A . n 
A 1 271 GLU 271 1950 1950 GLU GLU A . n 
A 1 272 CYS 272 1951 1951 CYS CYS A . n 
A 1 273 GLN 273 1952 1952 GLN GLN A . n 
A 1 274 TYR 274 1953 1953 TYR TYR A . n 
A 1 275 VAL 275 1954 1954 VAL VAL A . n 
A 1 276 TYR 276 1955 1955 TYR TYR A . n 
A 1 277 LEU 277 1956 1956 LEU LEU A . n 
A 1 278 HIS 278 1957 1957 HIS HIS A . n 
A 1 279 GLN 279 1958 1958 GLN GLN A . n 
A 1 280 CYS 280 1959 1959 CYS CYS A . n 
A 1 281 VAL 281 1960 1960 VAL VAL A . n 
A 1 282 ARG 282 1961 1961 ARG ARG A . n 
A 1 283 ASP 283 1962 1962 ASP ASP A . n 
A 1 284 VAL 284 1963 1963 VAL VAL A . n 
A 1 285 LEU 285 1964 1964 LEU LEU A . n 
A 1 286 ARG 286 1965 1965 ARG ARG A . n 
A 1 287 ALA 287 1966 1966 ALA ALA A . n 
A 1 288 ARG 288 1967 1967 ARG ARG A . n 
A 1 289 LYS 289 1968 1968 LYS LYS A . n 
A 1 290 LEU 290 1969 1969 LEU LEU A . n 
A 1 291 ARG 291 1970 ?    ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   401 1   MG  MG  A . 
C 3 NA  1   402 2   NA  NA  A . 
D 3 NA  1   403 3   NA  NA  A . 
E 4 HOH 1   1   1   HOH HOH A . 
E 4 HOH 2   2   2   HOH HOH A . 
E 4 HOH 3   3   3   HOH HOH A . 
E 4 HOH 4   4   4   HOH HOH A . 
E 4 HOH 5   5   5   HOH HOH A . 
E 4 HOH 6   6   6   HOH HOH A . 
E 4 HOH 7   8   8   HOH HOH A . 
E 4 HOH 8   10  10  HOH HOH A . 
E 4 HOH 9   11  11  HOH HOH A . 
E 4 HOH 10  12  12  HOH HOH A . 
E 4 HOH 11  13  13  HOH HOH A . 
E 4 HOH 12  14  14  HOH HOH A . 
E 4 HOH 13  15  15  HOH HOH A . 
E 4 HOH 14  16  16  HOH HOH A . 
E 4 HOH 15  17  17  HOH HOH A . 
E 4 HOH 16  18  18  HOH HOH A . 
E 4 HOH 17  19  19  HOH HOH A . 
E 4 HOH 18  20  20  HOH HOH A . 
E 4 HOH 19  21  21  HOH HOH A . 
E 4 HOH 20  22  22  HOH HOH A . 
E 4 HOH 21  23  23  HOH HOH A . 
E 4 HOH 22  24  24  HOH HOH A . 
E 4 HOH 23  25  25  HOH HOH A . 
E 4 HOH 24  26  26  HOH HOH A . 
E 4 HOH 25  27  27  HOH HOH A . 
E 4 HOH 26  28  28  HOH HOH A . 
E 4 HOH 27  29  29  HOH HOH A . 
E 4 HOH 28  30  30  HOH HOH A . 
E 4 HOH 29  31  31  HOH HOH A . 
E 4 HOH 30  32  32  HOH HOH A . 
E 4 HOH 31  33  33  HOH HOH A . 
E 4 HOH 32  34  34  HOH HOH A . 
E 4 HOH 33  35  35  HOH HOH A . 
E 4 HOH 34  36  36  HOH HOH A . 
E 4 HOH 35  37  37  HOH HOH A . 
E 4 HOH 36  38  38  HOH HOH A . 
E 4 HOH 37  39  39  HOH HOH A . 
E 4 HOH 38  40  40  HOH HOH A . 
E 4 HOH 39  41  41  HOH HOH A . 
E 4 HOH 40  42  42  HOH HOH A . 
E 4 HOH 41  43  43  HOH HOH A . 
E 4 HOH 42  44  44  HOH HOH A . 
E 4 HOH 43  45  45  HOH HOH A . 
E 4 HOH 44  46  46  HOH HOH A . 
E 4 HOH 45  47  47  HOH HOH A . 
E 4 HOH 46  48  48  HOH HOH A . 
E 4 HOH 47  49  49  HOH HOH A . 
E 4 HOH 48  50  50  HOH HOH A . 
E 4 HOH 49  51  51  HOH HOH A . 
E 4 HOH 50  52  52  HOH HOH A . 
E 4 HOH 51  53  53  HOH HOH A . 
E 4 HOH 52  54  54  HOH HOH A . 
E 4 HOH 53  55  55  HOH HOH A . 
E 4 HOH 54  56  56  HOH HOH A . 
E 4 HOH 55  57  57  HOH HOH A . 
E 4 HOH 56  58  58  HOH HOH A . 
E 4 HOH 57  59  59  HOH HOH A . 
E 4 HOH 58  60  60  HOH HOH A . 
E 4 HOH 59  61  61  HOH HOH A . 
E 4 HOH 60  62  62  HOH HOH A . 
E 4 HOH 61  63  63  HOH HOH A . 
E 4 HOH 62  64  64  HOH HOH A . 
E 4 HOH 63  65  65  HOH HOH A . 
E 4 HOH 64  66  66  HOH HOH A . 
E 4 HOH 65  67  67  HOH HOH A . 
E 4 HOH 66  68  68  HOH HOH A . 
E 4 HOH 67  69  69  HOH HOH A . 
E 4 HOH 68  70  70  HOH HOH A . 
E 4 HOH 69  71  71  HOH HOH A . 
E 4 HOH 70  72  72  HOH HOH A . 
E 4 HOH 71  73  73  HOH HOH A . 
E 4 HOH 72  74  74  HOH HOH A . 
E 4 HOH 73  75  75  HOH HOH A . 
E 4 HOH 74  76  76  HOH HOH A . 
E 4 HOH 75  77  77  HOH HOH A . 
E 4 HOH 76  78  78  HOH HOH A . 
E 4 HOH 77  79  79  HOH HOH A . 
E 4 HOH 78  80  80  HOH HOH A . 
E 4 HOH 79  81  81  HOH HOH A . 
E 4 HOH 80  82  82  HOH HOH A . 
E 4 HOH 81  83  83  HOH HOH A . 
E 4 HOH 82  84  84  HOH HOH A . 
E 4 HOH 83  85  85  HOH HOH A . 
E 4 HOH 84  86  86  HOH HOH A . 
E 4 HOH 85  87  87  HOH HOH A . 
E 4 HOH 86  88  88  HOH HOH A . 
E 4 HOH 87  89  89  HOH HOH A . 
E 4 HOH 88  90  90  HOH HOH A . 
E 4 HOH 89  91  91  HOH HOH A . 
E 4 HOH 90  92  92  HOH HOH A . 
E 4 HOH 91  93  93  HOH HOH A . 
E 4 HOH 92  94  94  HOH HOH A . 
E 4 HOH 93  95  95  HOH HOH A . 
E 4 HOH 94  96  96  HOH HOH A . 
E 4 HOH 95  97  97  HOH HOH A . 
E 4 HOH 96  98  98  HOH HOH A . 
E 4 HOH 97  99  99  HOH HOH A . 
E 4 HOH 98  100 100 HOH HOH A . 
E 4 HOH 99  101 101 HOH HOH A . 
E 4 HOH 100 102 102 HOH HOH A . 
E 4 HOH 101 103 103 HOH HOH A . 
E 4 HOH 102 104 104 HOH HOH A . 
E 4 HOH 103 105 105 HOH HOH A . 
E 4 HOH 104 106 106 HOH HOH A . 
E 4 HOH 105 108 108 HOH HOH A . 
E 4 HOH 106 109 109 HOH HOH A . 
E 4 HOH 107 110 110 HOH HOH A . 
E 4 HOH 108 111 111 HOH HOH A . 
E 4 HOH 109 112 112 HOH HOH A . 
E 4 HOH 110 113 113 HOH HOH A . 
E 4 HOH 111 114 114 HOH HOH A . 
E 4 HOH 112 115 115 HOH HOH A . 
E 4 HOH 113 116 116 HOH HOH A . 
E 4 HOH 114 117 117 HOH HOH A . 
E 4 HOH 115 119 119 HOH HOH A . 
E 4 HOH 116 120 120 HOH HOH A . 
E 4 HOH 117 121 121 HOH HOH A . 
E 4 HOH 118 122 122 HOH HOH A . 
E 4 HOH 119 123 123 HOH HOH A . 
E 4 HOH 120 124 124 HOH HOH A . 
E 4 HOH 121 125 125 HOH HOH A . 
E 4 HOH 122 126 126 HOH HOH A . 
E 4 HOH 123 127 127 HOH HOH A . 
E 4 HOH 124 128 128 HOH HOH A . 
E 4 HOH 125 129 129 HOH HOH A . 
E 4 HOH 126 130 130 HOH HOH A . 
E 4 HOH 127 131 131 HOH HOH A . 
E 4 HOH 128 132 132 HOH HOH A . 
E 4 HOH 129 133 133 HOH HOH A . 
E 4 HOH 130 134 134 HOH HOH A . 
E 4 HOH 131 135 135 HOH HOH A . 
E 4 HOH 132 136 136 HOH HOH A . 
E 4 HOH 133 137 137 HOH HOH A . 
E 4 HOH 134 138 138 HOH HOH A . 
E 4 HOH 135 139 139 HOH HOH A . 
E 4 HOH 136 140 140 HOH HOH A . 
E 4 HOH 137 141 141 HOH HOH A . 
E 4 HOH 138 142 142 HOH HOH A . 
E 4 HOH 139 143 143 HOH HOH A . 
E 4 HOH 140 144 144 HOH HOH A . 
E 4 HOH 141 145 145 HOH HOH A . 
E 4 HOH 142 146 146 HOH HOH A . 
E 4 HOH 143 147 147 HOH HOH A . 
E 4 HOH 144 148 148 HOH HOH A . 
E 4 HOH 145 149 149 HOH HOH A . 
E 4 HOH 146 150 150 HOH HOH A . 
E 4 HOH 147 151 151 HOH HOH A . 
E 4 HOH 148 152 152 HOH HOH A . 
E 4 HOH 149 153 153 HOH HOH A . 
E 4 HOH 150 154 154 HOH HOH A . 
E 4 HOH 151 156 156 HOH HOH A . 
E 4 HOH 152 158 158 HOH HOH A . 
E 4 HOH 153 159 159 HOH HOH A . 
E 4 HOH 154 160 160 HOH HOH A . 
E 4 HOH 155 161 161 HOH HOH A . 
E 4 HOH 156 162 162 HOH HOH A . 
E 4 HOH 157 163 163 HOH HOH A . 
E 4 HOH 158 164 164 HOH HOH A . 
E 4 HOH 159 165 165 HOH HOH A . 
E 4 HOH 160 166 166 HOH HOH A . 
E 4 HOH 161 167 167 HOH HOH A . 
E 4 HOH 162 168 168 HOH HOH A . 
E 4 HOH 163 169 169 HOH HOH A . 
E 4 HOH 164 170 170 HOH HOH A . 
E 4 HOH 165 171 171 HOH HOH A . 
E 4 HOH 166 172 172 HOH HOH A . 
E 4 HOH 167 173 173 HOH HOH A . 
E 4 HOH 168 174 174 HOH HOH A . 
E 4 HOH 169 175 175 HOH HOH A . 
E 4 HOH 170 176 176 HOH HOH A . 
E 4 HOH 171 177 177 HOH HOH A . 
E 4 HOH 172 178 178 HOH HOH A . 
E 4 HOH 173 179 179 HOH HOH A . 
E 4 HOH 174 180 180 HOH HOH A . 
E 4 HOH 175 181 181 HOH HOH A . 
E 4 HOH 176 182 182 HOH HOH A . 
E 4 HOH 177 183 183 HOH HOH A . 
E 4 HOH 178 184 184 HOH HOH A . 
E 4 HOH 179 185 185 HOH HOH A . 
E 4 HOH 180 186 186 HOH HOH A . 
E 4 HOH 181 187 187 HOH HOH A . 
E 4 HOH 182 188 188 HOH HOH A . 
E 4 HOH 183 189 189 HOH HOH A . 
E 4 HOH 184 190 190 HOH HOH A . 
E 4 HOH 185 191 191 HOH HOH A . 
E 4 HOH 186 192 192 HOH HOH A . 
E 4 HOH 187 193 193 HOH HOH A . 
E 4 HOH 188 194 194 HOH HOH A . 
E 4 HOH 189 195 195 HOH HOH A . 
E 4 HOH 190 196 196 HOH HOH A . 
E 4 HOH 191 197 197 HOH HOH A . 
E 4 HOH 192 198 198 HOH HOH A . 
E 4 HOH 193 199 199 HOH HOH A . 
E 4 HOH 194 200 200 HOH HOH A . 
E 4 HOH 195 202 202 HOH HOH A . 
E 4 HOH 196 203 203 HOH HOH A . 
E 4 HOH 197 204 204 HOH HOH A . 
E 4 HOH 198 205 205 HOH HOH A . 
E 4 HOH 199 207 207 HOH HOH A . 
E 4 HOH 200 208 208 HOH HOH A . 
E 4 HOH 201 209 209 HOH HOH A . 
E 4 HOH 202 211 211 HOH HOH A . 
E 4 HOH 203 214 214 HOH HOH A . 
E 4 HOH 204 215 215 HOH HOH A . 
E 4 HOH 205 216 216 HOH HOH A . 
E 4 HOH 206 217 217 HOH HOH A . 
E 4 HOH 207 218 218 HOH HOH A . 
E 4 HOH 208 219 219 HOH HOH A . 
E 4 HOH 209 220 220 HOH HOH A . 
E 4 HOH 210 221 221 HOH HOH A . 
E 4 HOH 211 222 222 HOH HOH A . 
E 4 HOH 212 223 223 HOH HOH A . 
E 4 HOH 213 224 224 HOH HOH A . 
E 4 HOH 214 225 225 HOH HOH A . 
E 4 HOH 215 226 226 HOH HOH A . 
E 4 HOH 216 227 227 HOH HOH A . 
E 4 HOH 217 228 228 HOH HOH A . 
E 4 HOH 218 229 229 HOH HOH A . 
E 4 HOH 219 230 230 HOH HOH A . 
E 4 HOH 220 232 232 HOH HOH A . 
E 4 HOH 221 233 233 HOH HOH A . 
E 4 HOH 222 234 234 HOH HOH A . 
E 4 HOH 223 235 235 HOH HOH A . 
E 4 HOH 224 239 239 HOH HOH A . 
E 4 HOH 225 241 241 HOH HOH A . 
E 4 HOH 226 245 245 HOH HOH A . 
E 4 HOH 227 246 246 HOH HOH A . 
E 4 HOH 228 247 247 HOH HOH A . 
E 4 HOH 229 248 248 HOH HOH A . 
E 4 HOH 230 249 249 HOH HOH A . 
E 4 HOH 231 250 250 HOH HOH A . 
E 4 HOH 232 251 251 HOH HOH A . 
E 4 HOH 233 252 252 HOH HOH A . 
E 4 HOH 234 253 253 HOH HOH A . 
E 4 HOH 235 254 254 HOH HOH A . 
E 4 HOH 236 255 255 HOH HOH A . 
E 4 HOH 237 256 256 HOH HOH A . 
E 4 HOH 238 257 257 HOH HOH A . 
E 4 HOH 239 258 258 HOH HOH A . 
E 4 HOH 240 259 259 HOH HOH A . 
E 4 HOH 241 260 260 HOH HOH A . 
E 4 HOH 242 263 263 HOH HOH A . 
E 4 HOH 243 265 265 HOH HOH A . 
E 4 HOH 244 266 266 HOH HOH A . 
E 4 HOH 245 267 267 HOH HOH A . 
E 4 HOH 246 268 268 HOH HOH A . 
E 4 HOH 247 269 269 HOH HOH A . 
E 4 HOH 248 270 270 HOH HOH A . 
E 4 HOH 249 271 271 HOH HOH A . 
E 4 HOH 250 272 272 HOH HOH A . 
E 4 HOH 251 273 273 HOH HOH A . 
E 4 HOH 252 274 274 HOH HOH A . 
E 4 HOH 253 275 275 HOH HOH A . 
E 4 HOH 254 280 280 HOH HOH A . 
E 4 HOH 255 286 286 HOH HOH A . 
E 4 HOH 256 287 287 HOH HOH A . 
E 4 HOH 257 289 289 HOH HOH A . 
E 4 HOH 258 292 292 HOH HOH A . 
E 4 HOH 259 293 293 HOH HOH A . 
E 4 HOH 260 294 294 HOH HOH A . 
E 4 HOH 261 295 295 HOH HOH A . 
E 4 HOH 262 296 296 HOH HOH A . 
E 4 HOH 263 297 297 HOH HOH A . 
E 4 HOH 264 298 298 HOH HOH A . 
E 4 HOH 265 299 299 HOH HOH A . 
E 4 HOH 266 302 302 HOH HOH A . 
E 4 HOH 267 305 305 HOH HOH A . 
E 4 HOH 268 307 307 HOH HOH A . 
E 4 HOH 269 308 308 HOH HOH A . 
E 4 HOH 270 309 309 HOH HOH A . 
E 4 HOH 271 315 315 HOH HOH A . 
E 4 HOH 272 316 316 HOH HOH A . 
E 4 HOH 273 320 320 HOH HOH A . 
E 4 HOH 274 328 328 HOH HOH A . 
E 4 HOH 275 329 329 HOH HOH A . 
E 4 HOH 276 330 330 HOH HOH A . 
E 4 HOH 277 331 331 HOH HOH A . 
E 4 HOH 278 332 332 HOH HOH A . 
E 4 HOH 279 335 335 HOH HOH A . 
E 4 HOH 280 336 336 HOH HOH A . 
E 4 HOH 281 337 337 HOH HOH A . 
E 4 HOH 282 341 341 HOH HOH A . 
E 4 HOH 283 342 342 HOH HOH A . 
E 4 HOH 284 343 343 HOH HOH A . 
E 4 HOH 285 345 345 HOH HOH A . 
E 4 HOH 286 349 349 HOH HOH A . 
E 4 HOH 287 350 350 HOH HOH A . 
E 4 HOH 288 351 351 HOH HOH A . 
E 4 HOH 289 359 359 HOH HOH A . 
E 4 HOH 290 360 360 HOH HOH A . 
E 4 HOH 291 361 361 HOH HOH A . 
E 4 HOH 292 362 362 HOH HOH A . 
E 4 HOH 293 363 363 HOH HOH A . 
E 4 HOH 294 364 364 HOH HOH A . 
E 4 HOH 295 365 365 HOH HOH A . 
E 4 HOH 296 366 366 HOH HOH A . 
E 4 HOH 297 367 367 HOH HOH A . 
E 4 HOH 298 368 368 HOH HOH A . 
E 4 HOH 299 369 369 HOH HOH A . 
E 4 HOH 300 370 370 HOH HOH A . 
E 4 HOH 301 371 371 HOH HOH A . 
E 4 HOH 302 372 372 HOH HOH A . 
E 4 HOH 303 373 373 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? E HOH . ? A HOH 1 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 2 ? 1_555 93.4  ? 
2  O ? E HOH . ? A HOH 1 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 3 ? 1_555 88.2  ? 
3  O ? E HOH . ? A HOH 2 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 3 ? 1_555 90.9  ? 
4  O ? E HOH . ? A HOH 1 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 4 ? 1_555 175.4 ? 
5  O ? E HOH . ? A HOH 2 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 4 ? 1_555 91.2  ? 
6  O ? E HOH . ? A HOH 3 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 4 ? 1_555 92.4  ? 
7  O ? E HOH . ? A HOH 1 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 5 ? 1_555 89.0  ? 
8  O ? E HOH . ? A HOH 2 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 5 ? 1_555 89.0  ? 
9  O ? E HOH . ? A HOH 3 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 5 ? 1_555 177.2 ? 
10 O ? E HOH . ? A HOH 4 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 5 ? 1_555 90.4  ? 
11 O ? E HOH . ? A HOH 1 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 6 ? 1_555 89.9  ? 
12 O ? E HOH . ? A HOH 2 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 6 ? 1_555 176.2 ? 
13 O ? E HOH . ? A HOH 3 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 6 ? 1_555 91.1  ? 
14 O ? E HOH . ? A HOH 4 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 6 ? 1_555 85.5  ? 
15 O ? E HOH . ? A HOH 5 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 6 ? 1_555 89.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-06-27 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
5 'Structure model' 1 4 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
4 5 'Structure model' 'Database references'       
5 5 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software               
2 5 'Structure model' database_2             
3 5 'Structure model' pdbx_struct_conn_angle 
4 5 'Structure model' struct_conn            
5 5 'Structure model' struct_ref_seq_dif     
6 5 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_software.classification'                  
2  4 'Structure model' '_software.name'                            
3  5 'Structure model' '_database_2.pdbx_DOI'                      
4  5 'Structure model' '_database_2.pdbx_database_accession'       
5  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 
6  5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 
7  5 'Structure model' '_pdbx_struct_conn_angle.value'             
8  5 'Structure model' '_struct_conn.pdbx_dist_value'              
9  5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'           
10 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'            
11 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'          
12 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'          
13 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'          
14 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'           
15 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'           
16 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'            
17 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'          
18 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'          
19 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'          
20 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'           
21 5 'Structure model' '_struct_ref_seq_dif.details'               
22 5 'Structure model' '_struct_site.pdbx_auth_asym_id'            
23 5 'Structure model' '_struct_site.pdbx_auth_comp_id'            
24 5 'Structure model' '_struct_site.pdbx_auth_seq_id'             
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      .     ?                program 'Murshudov, G.N.' ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html  Fortran_77 ? 1 
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/ C++        ? 2 
MAR345      .     ?                ?       ?                 ?                        'data collection' ? ?          ? 3 
HKL-2000    .     ?                ?       ?                 ?                        'data scaling'    ? ?          ? 4 
AMoRE       .     ?                ?       ?                 ?                        phasing           ? ?          ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 56   ? ? O   A HOH 105  ? ? 1.65 
2 1 OD2 A ASP 1889 ? A O   A HOH 272  ? ? 1.74 
3 1 CD  A ARG 1677 ? ? O   A HOH 177  ? ? 1.78 
4 1 OE2 A GLU 1845 ? ? CD1 A LEU 1859 ? B 1.93 
5 1 O   A HOH 131  ? ? O   A HOH 299  ? ? 1.93 
6 1 O   A HOH 76   ? ? O   A HOH 226  ? ? 1.98 
7 1 C   A GLU 1851 ? ? O   A HOH 172  ? ? 2.04 
8 1 O   A HOH 62   ? ? O   A HOH 263  ? ? 2.11 
9 1 O   A HOH 71   ? ? O   A HOH 280  ? ? 2.18 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    CG 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    GLU 
_pdbx_validate_symm_contact.auth_seq_id_1     1851 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    B 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     294 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_656 
_pdbx_validate_symm_contact.dist              1.78 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 1894 ? ? -118.45 53.55   
2 1 CYS A 1904 ? ? -121.16 -136.40 
3 1 VAL A 1908 ? ? -134.34 -129.81 
4 1 VAL A 1947 ? ? 67.56   103.83  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 1675 ? A SER 1   
2 1 Y 1 A GLU 1852 ? A GLU 173 
3 1 Y 1 A GLN 1853 ? A GLN 174 
4 1 Y 1 A LEU 1854 ? A LEU 175 
5 1 Y 1 A ASP 1855 ? A ASP 176 
6 1 Y 1 A ALA 1856 ? A ALA 177 
7 1 Y 1 A ARG 1970 ? A ARG 291 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION' MG  
3 'SODIUM ION'    NA  
4 water           HOH 
#