data_2HCT
# 
_entry.id   2HCT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HCT         
RCSB  RCSB038204   
WWPDB D_1000038204 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HCT 
_pdbx_database_status.recvd_initial_deposition_date   2006-06-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liu, Q.'         1 
'Kriksunov, I.A.' 2 
'Hao, Q.'         3 
'Graeff, R.'      4 
'Lee, H.C.'       5 
# 
_citation.id                        primary 
_citation.title                     
;Acidic residues at the active sites of CD38 and ADP-ribosyl cyclase determine nicotinic acid adenine dinucleotide phosphate (NAADP) synthesis and hydrolysis activities.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                28951 
_citation.page_last                 28957 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16861223 
_citation.pdbx_database_id_DOI      10.1074/jbc.M604370200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Graeff, R.'      1 
primary 'Liu, Q.'         2 
primary 'Kriksunov, I.A.' 3 
primary 'Hao, Q.'         4 
primary 'Lee, H.C.'       5 
# 
_cell.entry_id           2HCT 
_cell.length_a           41.715 
_cell.length_b           52.823 
_cell.length_c           65.578 
_cell.angle_alpha        106.26 
_cell.angle_beta         91.85 
_cell.angle_gamma        95.25 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HCT 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ADP-ribosyl cyclase 1'                  30308.330 2   3.2.2.5 'Q49T, N100D, N164D, N209D, N219D, E226G' 
'enzymatic domain, residues 45-300' ? 
2 non-polymer syn 'BETA-NICOTINAMIDE RIBOSE MONOPHOSPHATE' 335.227   2   ?       ?                                         ? ? 
3 water       nat water                                    18.015    257 ?       ?                                         ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Cyclic ADP-ribose hydrolase 1, cADPr hydrolase 1, Lymphocyte differentiation antigen CD38, T10, Acute lymphoblastic leukemia cells antigen CD38
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KREAEARWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVP
CNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAE
AACDVVHVMLDGSRSKIFDKDSTFGSVGVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNI
YRPDKFLQCVKNPEDSSCTSEI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KREAEARWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVP
CNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAE
AACDVVHVMLDGSRSKIFDKDSTFGSVGVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNI
YRPDKFLQCVKNPEDSSCTSEI
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   ARG n 
1 3   GLU n 
1 4   ALA n 
1 5   GLU n 
1 6   ALA n 
1 7   ARG n 
1 8   TRP n 
1 9   ARG n 
1 10  GLN n 
1 11  THR n 
1 12  TRP n 
1 13  SER n 
1 14  GLY n 
1 15  PRO n 
1 16  GLY n 
1 17  THR n 
1 18  THR n 
1 19  LYS n 
1 20  ARG n 
1 21  PHE n 
1 22  PRO n 
1 23  GLU n 
1 24  THR n 
1 25  VAL n 
1 26  LEU n 
1 27  ALA n 
1 28  ARG n 
1 29  CYS n 
1 30  VAL n 
1 31  LYS n 
1 32  TYR n 
1 33  THR n 
1 34  GLU n 
1 35  ILE n 
1 36  HIS n 
1 37  PRO n 
1 38  GLU n 
1 39  MET n 
1 40  ARG n 
1 41  HIS n 
1 42  VAL n 
1 43  ASP n 
1 44  CYS n 
1 45  GLN n 
1 46  SER n 
1 47  VAL n 
1 48  TRP n 
1 49  ASP n 
1 50  ALA n 
1 51  PHE n 
1 52  LYS n 
1 53  GLY n 
1 54  ALA n 
1 55  PHE n 
1 56  ILE n 
1 57  SER n 
1 58  LYS n 
1 59  HIS n 
1 60  PRO n 
1 61  CYS n 
1 62  ASP n 
1 63  ILE n 
1 64  THR n 
1 65  GLU n 
1 66  GLU n 
1 67  ASP n 
1 68  TYR n 
1 69  GLN n 
1 70  PRO n 
1 71  LEU n 
1 72  MET n 
1 73  LYS n 
1 74  LEU n 
1 75  GLY n 
1 76  THR n 
1 77  GLN n 
1 78  THR n 
1 79  VAL n 
1 80  PRO n 
1 81  CYS n 
1 82  ASN n 
1 83  LYS n 
1 84  ILE n 
1 85  LEU n 
1 86  LEU n 
1 87  TRP n 
1 88  SER n 
1 89  ARG n 
1 90  ILE n 
1 91  LYS n 
1 92  ASP n 
1 93  LEU n 
1 94  ALA n 
1 95  HIS n 
1 96  GLN n 
1 97  PHE n 
1 98  THR n 
1 99  GLN n 
1 100 VAL n 
1 101 GLN n 
1 102 ARG n 
1 103 ASP n 
1 104 MET n 
1 105 PHE n 
1 106 THR n 
1 107 LEU n 
1 108 GLU n 
1 109 ASP n 
1 110 THR n 
1 111 LEU n 
1 112 LEU n 
1 113 GLY n 
1 114 TYR n 
1 115 LEU n 
1 116 ALA n 
1 117 ASP n 
1 118 ASP n 
1 119 LEU n 
1 120 THR n 
1 121 TRP n 
1 122 CYS n 
1 123 GLY n 
1 124 GLU n 
1 125 PHE n 
1 126 ASP n 
1 127 THR n 
1 128 SER n 
1 129 LYS n 
1 130 ILE n 
1 131 ASN n 
1 132 TYR n 
1 133 GLN n 
1 134 SER n 
1 135 CYS n 
1 136 PRO n 
1 137 ASP n 
1 138 TRP n 
1 139 ARG n 
1 140 LYS n 
1 141 ASP n 
1 142 CYS n 
1 143 SER n 
1 144 ASN n 
1 145 ASN n 
1 146 PRO n 
1 147 VAL n 
1 148 SER n 
1 149 VAL n 
1 150 PHE n 
1 151 TRP n 
1 152 LYS n 
1 153 THR n 
1 154 VAL n 
1 155 SER n 
1 156 ARG n 
1 157 ARG n 
1 158 PHE n 
1 159 ALA n 
1 160 GLU n 
1 161 ALA n 
1 162 ALA n 
1 163 CYS n 
1 164 ASP n 
1 165 VAL n 
1 166 VAL n 
1 167 HIS n 
1 168 VAL n 
1 169 MET n 
1 170 LEU n 
1 171 ASP n 
1 172 GLY n 
1 173 SER n 
1 174 ARG n 
1 175 SER n 
1 176 LYS n 
1 177 ILE n 
1 178 PHE n 
1 179 ASP n 
1 180 LYS n 
1 181 ASP n 
1 182 SER n 
1 183 THR n 
1 184 PHE n 
1 185 GLY n 
1 186 SER n 
1 187 VAL n 
1 188 GLY n 
1 189 VAL n 
1 190 HIS n 
1 191 ASN n 
1 192 LEU n 
1 193 GLN n 
1 194 PRO n 
1 195 GLU n 
1 196 LYS n 
1 197 VAL n 
1 198 GLN n 
1 199 THR n 
1 200 LEU n 
1 201 GLU n 
1 202 ALA n 
1 203 TRP n 
1 204 VAL n 
1 205 ILE n 
1 206 HIS n 
1 207 GLY n 
1 208 GLY n 
1 209 ARG n 
1 210 GLU n 
1 211 ASP n 
1 212 SER n 
1 213 ARG n 
1 214 ASP n 
1 215 LEU n 
1 216 CYS n 
1 217 GLN n 
1 218 ASP n 
1 219 PRO n 
1 220 THR n 
1 221 ILE n 
1 222 LYS n 
1 223 GLU n 
1 224 LEU n 
1 225 GLU n 
1 226 SER n 
1 227 ILE n 
1 228 ILE n 
1 229 SER n 
1 230 LYS n 
1 231 ARG n 
1 232 ASN n 
1 233 ILE n 
1 234 GLN n 
1 235 PHE n 
1 236 SER n 
1 237 CYS n 
1 238 LYS n 
1 239 ASN n 
1 240 ILE n 
1 241 TYR n 
1 242 ARG n 
1 243 PRO n 
1 244 ASP n 
1 245 LYS n 
1 246 PHE n 
1 247 LEU n 
1 248 GLN n 
1 249 CYS n 
1 250 VAL n 
1 251 LYS n 
1 252 ASN n 
1 253 PRO n 
1 254 GLU n 
1 255 ASP n 
1 256 SER n 
1 257 SER n 
1 258 CYS n 
1 259 THR n 
1 260 SER n 
1 261 GLU n 
1 262 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 CD38 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Pichia pastoris' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     Pichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pPICZaA 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CD38_HUMAN 
_struct_ref.pdbx_db_accession          P28907 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCNKILL
WSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVV
HVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKF
LQCVKNPEDSSCTSEI
;
_struct_ref.pdbx_align_begin           45 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2HCT A 7 ? 262 ? P28907 45 ? 300 ? 45 300 
2 1 2HCT B 7 ? 262 ? P28907 45 ? 300 ? 45 300 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2HCT LYS A 1   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 39  1  
1 2HCT ARG A 2   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 40  2  
1 2HCT GLU A 3   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 41  3  
1 2HCT ALA A 4   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 42  4  
1 2HCT GLU A 5   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 43  5  
1 2HCT ALA A 6   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 44  6  
1 2HCT THR A 11  ? UNP P28907 ?   ?   ENGINEERED         49  7  
1 2HCT ASP A 62  ? UNP P28907 ASN 100 ENGINEERED         100 8  
1 2HCT ASP A 126 ? UNP P28907 ASN 164 ENGINEERED         164 9  
1 2HCT ASP A 171 ? UNP P28907 ASN 209 ENGINEERED         209 10 
1 2HCT ASP A 181 ? UNP P28907 ASN 219 ENGINEERED         219 11 
1 2HCT GLY A 188 ? UNP P28907 GLU 226 ENGINEERED         226 12 
2 2HCT LYS B 1   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 39  13 
2 2HCT ARG B 2   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 40  14 
2 2HCT GLU B 3   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 41  15 
2 2HCT ALA B 4   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 42  16 
2 2HCT GLU B 5   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 43  17 
2 2HCT ALA B 6   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 44  18 
2 2HCT THR B 11  ? UNP P28907 GLN 49  ENGINEERED         49  19 
2 2HCT ASP B 62  ? UNP P28907 ASN 100 ENGINEERED         100 20 
2 2HCT ASP B 126 ? UNP P28907 ASN 164 ENGINEERED         164 21 
2 2HCT ASP B 171 ? UNP P28907 ASN 209 ENGINEERED         209 22 
2 2HCT ASP B 181 ? UNP P28907 ASN 219 ENGINEERED         219 23 
2 2HCT GLY B 188 ? UNP P28907 GLU 226 ENGINEERED         226 24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ?                             'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                             'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                             'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                             'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ?                             'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                ?                             'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                             'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                             'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                ?                             'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                    ?                             'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?                             'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?                             'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                   ?                             'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                               ?                             'C5 H11 N O2 S'     149.211 
NMN non-polymer         . 'BETA-NICOTINAMIDE RIBOSE MONOPHOSPHATE' 'NICOTINAMIDE MONONUCLEOTIDE' 'C11 H16 N2 O8 P 1' 335.227 
PHE 'L-peptide linking' y PHENYLALANINE                            ?                             'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                  ?                             'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                   ?                             'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                ?                             'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                             'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                 ?                             'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                   ?                             'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2HCT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.32 
_exptl_crystal.density_percent_sol   47.00 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    '100 mM MES, 12% PEG 4000, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2005-02-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.976 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.976 
# 
_reflns.entry_id                     2HCT 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.d_resolution_high            1.95 
_reflns.d_resolution_low             30.00 
_reflns.number_all                   38327 
_reflns.number_obs                   37216 
_reflns.percent_possible_obs         97.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              2.02 
_reflns_shell.percent_possible_all   95.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2HCT 
_refine.ls_number_reflns_obs                     35348 
_refine.ls_number_reflns_all                     35348 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.19807 
_refine.ls_R_factor_all                          0.205 
_refine.ls_R_factor_R_work                       0.19547 
_refine.ls_R_factor_R_free                       0.24755 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1856 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.958 
_refine.correlation_coeff_Fo_to_Fc_free          0.928 
_refine.B_iso_mean                               45.009 
_refine.aniso_B[1][1]                            -1.61 
_refine.aniso_B[2][2]                            1.56 
_refine.aniso_B[3][3]                            1.42 
_refine.aniso_B[1][2]                            1.17 
_refine.aniso_B[1][3]                            0.81 
_refine.aniso_B[2][3]                            1.95 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1YH3' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.189 
_refine.pdbx_overall_ESU_R_Free                  0.172 
_refine.overall_SU_ML                            0.182 
_refine.overall_SU_B                             13.409 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4006 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             257 
_refine_hist.number_atoms_total               4307 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.015  0.022  ? 4164 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.459  1.946  ? 5648 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.311  5.000  ? 502  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   38.354 23.958 ? 192  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   17.816 15.000 ? 708  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   20.570 15.000 ? 26   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.098  0.200  ? 600  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 3150 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.228  0.200  ? 1936 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.310  0.200  ? 2800 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.179  0.200  ? 237  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.171  0.200  ? 53   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.158  0.200  ? 19   'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.834  1.500  ? 2552 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.469  2.000  ? 4046 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.204  3.000  ? 1845 'X-RAY DIFFRACTION' ? 
r_scangle_it             3.532  4.500  ? 1602 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.952 
_refine_ls_shell.d_res_low                        2.003 
_refine_ls_shell.number_reflns_R_work             2142 
_refine_ls_shell.R_factor_R_work                  0.28 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.314 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             108 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2HCT 
_struct.title                     
'Acidic residues at the active sites of CD38 and ADP-ribosyl cyclase determine NAAPD synthesis and hydrolysis activities' 
_struct.pdbx_descriptor           'ADP-ribosyl cyclase 1 (E.C.3.2.2.5)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HCT 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'BETA SHEETS, ALPHA BUNDLE, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'The asymmetric unit contains two biological units.' ? 
2 ?                                                    ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 20  ? HIS A 36  ? ARG A 58  HIS A 74  1 ? 17 
HELX_P HELX_P2  2  PRO A 37  ? ARG A 40  ? PRO A 75  ARG A 78  5 ? 4  
HELX_P HELX_P3  3  ASP A 43  ? ILE A 56  ? ASP A 81  ILE A 94  1 ? 14 
HELX_P HELX_P4  4  THR A 64  ? ASP A 67  ? THR A 102 ASP A 105 5 ? 4  
HELX_P HELX_P5  5  TYR A 68  ? GLY A 75  ? TYR A 106 GLY A 113 1 ? 8  
HELX_P HELX_P6  6  PRO A 80  ? LYS A 83  ? PRO A 118 LYS A 121 5 ? 4  
HELX_P HELX_P7  7  ILE A 90  ? GLN A 101 ? ILE A 128 GLN A 139 1 ? 12 
HELX_P HELX_P8  8  THR A 106 ? ASP A 109 ? THR A 144 ASP A 147 5 ? 4  
HELX_P HELX_P9  9  THR A 110 ? ASP A 117 ? THR A 148 ASP A 155 1 ? 8  
HELX_P HELX_P10 10 ASN A 145 ? ALA A 162 ? ASN A 183 ALA A 200 1 ? 18 
HELX_P HELX_P11 11 SER A 182 ? VAL A 187 ? SER A 220 VAL A 225 1 ? 6  
HELX_P HELX_P12 12 VAL A 187 ? LEU A 192 ? VAL A 225 LEU A 230 1 ? 6  
HELX_P HELX_P13 13 ASP A 214 ? GLN A 217 ? ASP A 252 GLN A 255 5 ? 4  
HELX_P HELX_P14 14 ASP A 218 ? ARG A 231 ? ASP A 256 ARG A 269 1 ? 14 
HELX_P HELX_P15 15 ARG A 242 ? ASN A 252 ? ARG A 280 ASN A 290 1 ? 11 
HELX_P HELX_P16 16 ARG B 20  ? HIS B 36  ? ARG B 58  HIS B 74  1 ? 17 
HELX_P HELX_P17 17 PRO B 37  ? ARG B 40  ? PRO B 75  ARG B 78  5 ? 4  
HELX_P HELX_P18 18 ASP B 43  ? ILE B 56  ? ASP B 81  ILE B 94  1 ? 14 
HELX_P HELX_P19 19 THR B 64  ? ASP B 67  ? THR B 102 ASP B 105 5 ? 4  
HELX_P HELX_P20 20 TYR B 68  ? GLY B 75  ? TYR B 106 GLY B 113 1 ? 8  
HELX_P HELX_P21 21 ILE B 90  ? GLN B 101 ? ILE B 128 GLN B 139 1 ? 12 
HELX_P HELX_P22 22 THR B 106 ? ASP B 109 ? THR B 144 ASP B 147 5 ? 4  
HELX_P HELX_P23 23 THR B 110 ? ASP B 117 ? THR B 148 ASP B 155 1 ? 8  
HELX_P HELX_P24 24 ASN B 145 ? ALA B 162 ? ASN B 183 ALA B 200 1 ? 18 
HELX_P HELX_P25 25 SER B 182 ? VAL B 187 ? SER B 220 VAL B 225 1 ? 6  
HELX_P HELX_P26 26 ASP B 214 ? GLN B 217 ? ASP B 252 GLN B 255 5 ? 4  
HELX_P HELX_P27 27 ASP B 218 ? ARG B 231 ? ASP B 256 ARG B 269 1 ? 14 
HELX_P HELX_P28 28 ARG B 242 ? ASN B 252 ? ARG B 280 ASN B 290 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 29  SG ? ? ? 1_555 A CYS 44  SG ? ? A CYS 67  A CYS 82  1_555 ? ? ? ? ? ? ? 2.087 ? 
disulf2  disulf ? ? A CYS 61  SG ? ? ? 1_555 A CYS 142 SG ? ? A CYS 99  A CYS 180 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf3  disulf ? ? A CYS 81  SG ? ? ? 1_555 A CYS 163 SG ? ? A CYS 119 A CYS 201 1_555 ? ? ? ? ? ? ? 2.099 ? 
disulf4  disulf ? ? A CYS 122 SG ? ? ? 1_555 A CYS 135 SG ? ? A CYS 160 A CYS 173 1_555 ? ? ? ? ? ? ? 2.085 ? 
disulf5  disulf ? ? A CYS 216 SG ? ? ? 1_555 A CYS 237 SG ? ? A CYS 254 A CYS 275 1_555 ? ? ? ? ? ? ? 2.116 ? 
disulf6  disulf ? ? A CYS 249 SG ? ? ? 1_555 A CYS 258 SG ? ? A CYS 287 A CYS 296 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf7  disulf ? ? B CYS 29  SG ? ? ? 1_555 B CYS 44  SG ? ? B CYS 67  B CYS 82  1_555 ? ? ? ? ? ? ? 2.073 ? 
disulf8  disulf ? ? B CYS 61  SG ? ? ? 1_555 B CYS 142 SG ? ? B CYS 99  B CYS 180 1_555 ? ? ? ? ? ? ? 2.081 ? 
disulf9  disulf ? ? B CYS 81  SG ? ? ? 1_555 B CYS 163 SG ? ? B CYS 119 B CYS 201 1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf10 disulf ? ? B CYS 122 SG ? ? ? 1_555 B CYS 135 SG ? ? B CYS 160 B CYS 173 1_555 ? ? ? ? ? ? ? 2.133 ? 
disulf11 disulf ? ? B CYS 216 SG ? ? ? 1_555 B CYS 237 SG ? ? B CYS 254 B CYS 275 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf12 disulf ? ? B CYS 249 SG ? ? ? 1_555 B CYS 258 SG ? ? B CYS 287 B CYS 296 1_555 ? ? ? ? ? ? ? 2.047 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 85  ? SER A 88  ? LEU A 123 SER A 126 
A 2 ASP A 164 ? ASP A 171 ? ASP A 202 ASP A 209 
A 3 VAL A 197 ? ILE A 205 ? VAL A 235 ILE A 243 
A 4 GLN A 234 ? ILE A 240 ? GLN A 272 ILE A 278 
B 1 GLY B 14  ? PRO B 15  ? GLY B 52  PRO B 53  
B 2 SER B 134 ? CYS B 135 ? SER B 172 CYS B 173 
C 1 LEU B 85  ? SER B 88  ? LEU B 123 SER B 126 
C 2 ASP B 164 ? ASP B 171 ? ASP B 202 ASP B 209 
C 3 VAL B 197 ? ILE B 205 ? VAL B 235 ILE B 243 
C 4 GLN B 234 ? ILE B 240 ? GLN B 272 ILE B 278 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 86  ? N LEU A 124 O HIS A 167 ? O HIS A 205 
A 2 3 N VAL A 168 ? N VAL A 206 O TRP A 203 ? O TRP A 241 
A 3 4 N VAL A 204 ? N VAL A 242 O ILE A 240 ? O ILE A 278 
B 1 2 N GLY B 14  ? N GLY B 52  O CYS B 135 ? O CYS B 173 
C 1 2 N LEU B 86  ? N LEU B 124 O HIS B 167 ? O HIS B 205 
C 2 3 N VAL B 166 ? N VAL B 204 O THR B 199 ? O THR B 237 
C 3 4 N ALA B 202 ? N ALA B 240 O SER B 236 ? O SER B 274 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE NMN A 301' 
AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE NMN B 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 TRP A 87  ? TRP A 125 . ? 1_555 ? 
2  AC1 13 SER A 88  ? SER A 126 . ? 1_555 ? 
3  AC1 13 ARG A 89  ? ARG A 127 . ? 1_555 ? 
4  AC1 13 LEU A 107 ? LEU A 145 . ? 1_555 ? 
5  AC1 13 GLU A 108 ? GLU A 146 . ? 1_555 ? 
6  AC1 13 ASP A 117 ? ASP A 155 . ? 1_555 ? 
7  AC1 13 ASP A 118 ? ASP A 156 . ? 1_555 ? 
8  AC1 13 TRP A 151 ? TRP A 189 . ? 1_555 ? 
9  AC1 13 SER A 155 ? SER A 193 . ? 1_555 ? 
10 AC1 13 SER A 182 ? SER A 220 . ? 1_555 ? 
11 AC1 13 THR A 183 ? THR A 221 . ? 1_555 ? 
12 AC1 13 PHE A 184 ? PHE A 222 . ? 1_555 ? 
13 AC1 13 HOH E .   ? HOH A 404 . ? 1_555 ? 
14 AC2 14 TRP B 87  ? TRP B 125 . ? 1_555 ? 
15 AC2 14 SER B 88  ? SER B 126 . ? 1_555 ? 
16 AC2 14 ARG B 89  ? ARG B 127 . ? 1_555 ? 
17 AC2 14 LYS B 91  ? LYS B 129 . ? 1_555 ? 
18 AC2 14 LEU B 107 ? LEU B 145 . ? 1_555 ? 
19 AC2 14 GLU B 108 ? GLU B 146 . ? 1_555 ? 
20 AC2 14 ASP B 117 ? ASP B 155 . ? 1_555 ? 
21 AC2 14 ASP B 118 ? ASP B 156 . ? 1_555 ? 
22 AC2 14 TRP B 151 ? TRP B 189 . ? 1_555 ? 
23 AC2 14 SER B 155 ? SER B 193 . ? 1_555 ? 
24 AC2 14 SER B 182 ? SER B 220 . ? 1_555 ? 
25 AC2 14 THR B 183 ? THR B 221 . ? 1_555 ? 
26 AC2 14 PHE B 184 ? PHE B 222 . ? 1_555 ? 
27 AC2 14 HOH F .   ? HOH B 415 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2HCT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HCT 
_atom_sites.fract_transf_matrix[1][1]   0.023972 
_atom_sites.fract_transf_matrix[1][2]   0.002201 
_atom_sites.fract_transf_matrix[1][3]   0.001461 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019011 
_atom_sites.fract_transf_matrix[2][3]   0.005636 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015913 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 7   ? 20.761  -21.992 14.820  1.00 53.19 ? 45  ARG A N   1 
ATOM   2    C CA  . ARG A 1 7   ? 21.791  -20.958 14.496  1.00 53.17 ? 45  ARG A CA  1 
ATOM   3    C C   . ARG A 1 7   ? 21.534  -19.573 15.084  1.00 52.54 ? 45  ARG A C   1 
ATOM   4    O O   . ARG A 1 7   ? 20.419  -19.054 15.091  1.00 52.40 ? 45  ARG A O   1 
ATOM   5    C CB  . ARG A 1 7   ? 22.078  -20.867 12.991  1.00 53.35 ? 45  ARG A CB  1 
ATOM   6    C CG  . ARG A 1 7   ? 23.185  -21.837 12.531  1.00 55.01 ? 45  ARG A CG  1 
ATOM   7    C CD  . ARG A 1 7   ? 24.049  -21.223 11.424  1.00 56.12 ? 45  ARG A CD  1 
ATOM   8    N NE  . ARG A 1 7   ? 23.272  -20.839 10.239  1.00 55.56 ? 45  ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 7   ? 23.726  -20.045 9.272   1.00 56.64 ? 45  ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 7   ? 24.953  -19.526 9.338   1.00 56.60 ? 45  ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 7   ? 22.945  -19.751 8.241   1.00 57.05 ? 45  ARG A NH2 1 
ATOM   12   N N   . TRP A 1 8   ? 22.632  -18.998 15.549  1.00 52.02 ? 46  TRP A N   1 
ATOM   13   C CA  . TRP A 1 8   ? 22.676  -17.798 16.349  1.00 51.30 ? 46  TRP A CA  1 
ATOM   14   C C   . TRP A 1 8   ? 22.973  -16.601 15.469  1.00 51.16 ? 46  TRP A C   1 
ATOM   15   O O   . TRP A 1 8   ? 23.005  -15.471 15.955  1.00 51.36 ? 46  TRP A O   1 
ATOM   16   C CB  . TRP A 1 8   ? 23.779  -17.962 17.391  1.00 51.08 ? 46  TRP A CB  1 
ATOM   17   C CG  . TRP A 1 8   ? 25.052  -18.521 16.800  1.00 50.70 ? 46  TRP A CG  1 
ATOM   18   C CD1 . TRP A 1 8   ? 26.168  -17.819 16.447  1.00 50.61 ? 46  TRP A CD1 1 
ATOM   19   C CD2 . TRP A 1 8   ? 25.325  -19.894 16.475  1.00 50.35 ? 46  TRP A CD2 1 
ATOM   20   N NE1 . TRP A 1 8   ? 27.123  -18.666 15.936  1.00 50.15 ? 46  TRP A NE1 1 
ATOM   21   C CE2 . TRP A 1 8   ? 26.628  -19.943 15.934  1.00 50.14 ? 46  TRP A CE2 1 
ATOM   22   C CE3 . TRP A 1 8   ? 24.595  -21.084 16.591  1.00 49.55 ? 46  TRP A CE3 1 
ATOM   23   C CZ2 . TRP A 1 8   ? 27.216  -21.133 15.510  1.00 50.74 ? 46  TRP A CZ2 1 
ATOM   24   C CZ3 . TRP A 1 8   ? 25.171  -22.258 16.161  1.00 50.34 ? 46  TRP A CZ3 1 
ATOM   25   C CH2 . TRP A 1 8   ? 26.474  -22.279 15.633  1.00 50.96 ? 46  TRP A CH2 1 
ATOM   26   N N   . ARG A 1 9   ? 23.215  -16.853 14.182  1.00 50.85 ? 47  ARG A N   1 
ATOM   27   C CA  . ARG A 1 9   ? 23.259  -15.775 13.183  1.00 50.82 ? 47  ARG A CA  1 
ATOM   28   C C   . ARG A 1 9   ? 22.515  -16.132 11.888  1.00 50.23 ? 47  ARG A C   1 
ATOM   29   O O   . ARG A 1 9   ? 22.835  -17.113 11.211  1.00 50.63 ? 47  ARG A O   1 
ATOM   30   C CB  . ARG A 1 9   ? 24.691  -15.306 12.891  1.00 50.77 ? 47  ARG A CB  1 
ATOM   31   C CG  . ARG A 1 9   ? 25.592  -16.343 12.243  1.00 52.52 ? 47  ARG A CG  1 
ATOM   32   C CD  . ARG A 1 9   ? 27.065  -15.945 12.371  1.00 54.77 ? 47  ARG A CD  1 
ATOM   33   N NE  . ARG A 1 9   ? 27.950  -17.109 12.394  1.00 55.89 ? 47  ARG A NE  1 
ATOM   34   C CZ  . ARG A 1 9   ? 29.185  -17.111 12.897  1.00 57.59 ? 47  ARG A CZ  1 
ATOM   35   N NH1 . ARG A 1 9   ? 29.706  -16.005 13.427  1.00 58.31 ? 47  ARG A NH1 1 
ATOM   36   N NH2 . ARG A 1 9   ? 29.907  -18.225 12.874  1.00 57.76 ? 47  ARG A NH2 1 
ATOM   37   N N   . GLN A 1 10  ? 21.512  -15.335 11.553  1.00 49.49 ? 48  GLN A N   1 
ATOM   38   C CA  . GLN A 1 10  ? 20.779  -15.559 10.316  1.00 48.67 ? 48  GLN A CA  1 
ATOM   39   C C   . GLN A 1 10  ? 21.500  -14.869 9.154   1.00 47.92 ? 48  GLN A C   1 
ATOM   40   O O   . GLN A 1 10  ? 22.518  -14.210 9.364   1.00 47.95 ? 48  GLN A O   1 
ATOM   41   C CB  . GLN A 1 10  ? 19.294  -15.156 10.452  1.00 48.69 ? 48  GLN A CB  1 
ATOM   42   C CG  . GLN A 1 10  ? 18.451  -16.082 11.389  1.00 48.82 ? 48  GLN A CG  1 
ATOM   43   C CD  . GLN A 1 10  ? 18.819  -17.586 11.306  1.00 48.58 ? 48  GLN A CD  1 
ATOM   44   O OE1 . GLN A 1 10  ? 18.692  -18.215 10.256  1.00 47.75 ? 48  GLN A OE1 1 
ATOM   45   N NE2 . GLN A 1 10  ? 19.277  -18.153 12.426  1.00 49.18 ? 48  GLN A NE2 1 
ATOM   46   N N   . THR A 1 11  ? 20.996  -15.051 7.937   1.00 46.76 ? 49  THR A N   1 
ATOM   47   C CA  . THR A 1 11  ? 21.649  -14.525 6.746   1.00 45.32 ? 49  THR A CA  1 
ATOM   48   C C   . THR A 1 11  ? 21.339  -13.057 6.589   1.00 44.51 ? 49  THR A C   1 
ATOM   49   O O   . THR A 1 11  ? 22.212  -12.261 6.272   1.00 44.44 ? 49  THR A O   1 
ATOM   50   C CB  . THR A 1 11  ? 21.241  -15.319 5.493   1.00 45.41 ? 49  THR A CB  1 
ATOM   51   O OG1 . THR A 1 11  ? 21.775  -16.642 5.601   1.00 44.56 ? 49  THR A OG1 1 
ATOM   52   C CG2 . THR A 1 11  ? 21.778  -14.678 4.221   1.00 45.47 ? 49  THR A CG2 1 
ATOM   53   N N   . TRP A 1 12  ? 20.097  -12.702 6.845   1.00 43.22 ? 50  TRP A N   1 
ATOM   54   C CA  . TRP A 1 12  ? 19.654  -11.348 6.633   1.00 43.00 ? 50  TRP A CA  1 
ATOM   55   C C   . TRP A 1 12  ? 19.262  -10.741 7.971   1.00 42.91 ? 50  TRP A C   1 
ATOM   56   O O   . TRP A 1 12  ? 19.214  -11.444 8.984   1.00 42.52 ? 50  TRP A O   1 
ATOM   57   C CB  . TRP A 1 12  ? 18.481  -11.306 5.635   1.00 42.47 ? 50  TRP A CB  1 
ATOM   58   C CG  . TRP A 1 12  ? 18.731  -12.013 4.324   1.00 41.58 ? 50  TRP A CG  1 
ATOM   59   C CD1 . TRP A 1 12  ? 18.136  -13.161 3.892   1.00 41.65 ? 50  TRP A CD1 1 
ATOM   60   C CD2 . TRP A 1 12  ? 19.638  -11.616 3.278   1.00 41.56 ? 50  TRP A CD2 1 
ATOM   61   N NE1 . TRP A 1 12  ? 18.609  -13.505 2.650   1.00 40.91 ? 50  TRP A NE1 1 
ATOM   62   C CE2 . TRP A 1 12  ? 19.536  -12.578 2.250   1.00 41.74 ? 50  TRP A CE2 1 
ATOM   63   C CE3 . TRP A 1 12  ? 20.531  -10.548 3.114   1.00 41.71 ? 50  TRP A CE3 1 
ATOM   64   C CZ2 . TRP A 1 12  ? 20.288  -12.500 1.065   1.00 41.82 ? 50  TRP A CZ2 1 
ATOM   65   C CZ3 . TRP A 1 12  ? 21.280  -10.470 1.934   1.00 42.01 ? 50  TRP A CZ3 1 
ATOM   66   C CH2 . TRP A 1 12  ? 21.148  -11.445 0.926   1.00 41.39 ? 50  TRP A CH2 1 
ATOM   67   N N   . SER A 1 13  ? 18.977  -9.440  7.948   1.00 43.20 ? 51  SER A N   1 
ATOM   68   C CA  . SER A 1 13  ? 18.670  -8.653  9.139   1.00 43.48 ? 51  SER A CA  1 
ATOM   69   C C   . SER A 1 13  ? 17.180  -8.548  9.434   1.00 43.68 ? 51  SER A C   1 
ATOM   70   O O   . SER A 1 13  ? 16.799  -8.142  10.537  1.00 44.54 ? 51  SER A O   1 
ATOM   71   C CB  . SER A 1 13  ? 19.240  -7.250  8.978   1.00 43.39 ? 51  SER A CB  1 
ATOM   72   O OG  . SER A 1 13  ? 20.659  -7.295  8.973   1.00 44.18 ? 51  SER A OG  1 
ATOM   73   N N   . GLY A 1 14  ? 16.340  -8.899  8.462   1.00 43.21 ? 52  GLY A N   1 
ATOM   74   C CA  . GLY A 1 14  ? 14.880  -8.815  8.635   1.00 42.23 ? 52  GLY A CA  1 
ATOM   75   C C   . GLY A 1 14  ? 14.286  -10.107 9.176   1.00 42.08 ? 52  GLY A C   1 
ATOM   76   O O   . GLY A 1 14  ? 14.875  -11.174 9.024   1.00 41.86 ? 52  GLY A O   1 
ATOM   77   N N   . PRO A 1 15  ? 13.112  -10.025 9.829   1.00 42.06 ? 53  PRO A N   1 
ATOM   78   C CA  . PRO A 1 15  ? 12.335  -11.241 10.128  1.00 41.29 ? 53  PRO A CA  1 
ATOM   79   C C   . PRO A 1 15  ? 12.086  -12.121 8.879   1.00 40.35 ? 53  PRO A C   1 
ATOM   80   O O   . PRO A 1 15  ? 11.948  -11.604 7.764   1.00 40.50 ? 53  PRO A O   1 
ATOM   81   C CB  . PRO A 1 15  ? 11.016  -10.692 10.700  1.00 40.95 ? 53  PRO A CB  1 
ATOM   82   C CG  . PRO A 1 15  ? 10.999  -9.222  10.352  1.00 42.21 ? 53  PRO A CG  1 
ATOM   83   C CD  . PRO A 1 15  ? 12.451  -8.817  10.355  1.00 42.27 ? 53  PRO A CD  1 
ATOM   84   N N   . GLY A 1 16  ? 12.063  -13.436 9.079   1.00 39.67 ? 54  GLY A N   1 
ATOM   85   C CA  . GLY A 1 16  ? 11.899  -14.406 7.992   1.00 39.15 ? 54  GLY A CA  1 
ATOM   86   C C   . GLY A 1 16  ? 10.459  -14.505 7.532   1.00 39.08 ? 54  GLY A C   1 
ATOM   87   O O   . GLY A 1 16  ? 9.595   -13.767 8.025   1.00 38.57 ? 54  GLY A O   1 
ATOM   88   N N   . THR A 1 17  ? 10.196  -15.403 6.581   1.00 38.78 ? 55  THR A N   1 
ATOM   89   C CA  . THR A 1 17  ? 8.873   -15.478 5.952   1.00 38.45 ? 55  THR A CA  1 
ATOM   90   C C   . THR A 1 17  ? 7.807   -15.819 7.000   1.00 38.93 ? 55  THR A C   1 
ATOM   91   O O   . THR A 1 17  ? 8.054   -16.634 7.879   1.00 39.11 ? 55  THR A O   1 
ATOM   92   C CB  . THR A 1 17  ? 8.867   -16.485 4.793   1.00 38.41 ? 55  THR A CB  1 
ATOM   93   O OG1 . THR A 1 17  ? 9.843   -16.093 3.814   1.00 38.09 ? 55  THR A OG1 1 
ATOM   94   C CG2 . THR A 1 17  ? 7.502   -16.571 4.137   1.00 36.60 ? 55  THR A CG2 1 
ATOM   95   N N   . THR A 1 18  ? 6.640   -15.177 6.934   1.00 38.90 ? 56  THR A N   1 
ATOM   96   C CA  . THR A 1 18  ? 5.570   -15.451 7.915   1.00 38.87 ? 56  THR A CA  1 
ATOM   97   C C   . THR A 1 18  ? 5.273   -16.944 7.905   1.00 39.22 ? 56  THR A C   1 
ATOM   98   O O   . THR A 1 18  ? 5.183   -17.534 6.837   1.00 39.75 ? 56  THR A O   1 
ATOM   99   C CB  . THR A 1 18  ? 4.304   -14.631 7.610   1.00 38.70 ? 56  THR A CB  1 
ATOM   100  O OG1 . THR A 1 18  ? 4.705   -13.295 7.325   1.00 36.92 ? 56  THR A OG1 1 
ATOM   101  C CG2 . THR A 1 18  ? 3.340   -14.624 8.796   1.00 38.81 ? 56  THR A CG2 1 
ATOM   102  N N   . LYS A 1 19  ? 5.170   -17.564 9.077   1.00 39.46 ? 57  LYS A N   1 
ATOM   103  C CA  . LYS A 1 19  ? 4.905   -19.006 9.118   1.00 40.21 ? 57  LYS A CA  1 
ATOM   104  C C   . LYS A 1 19  ? 3.609   -19.357 8.391   1.00 39.82 ? 57  LYS A C   1 
ATOM   105  O O   . LYS A 1 19  ? 2.651   -18.567 8.390   1.00 39.50 ? 57  LYS A O   1 
ATOM   106  C CB  . LYS A 1 19  ? 4.916   -19.549 10.544  1.00 41.06 ? 57  LYS A CB  1 
ATOM   107  C CG  . LYS A 1 19  ? 3.766   -19.106 11.444  1.00 43.40 ? 57  LYS A CG  1 
ATOM   108  C CD  . LYS A 1 19  ? 3.895   -19.842 12.774  1.00 47.61 ? 57  LYS A CD  1 
ATOM   109  C CE  . LYS A 1 19  ? 2.915   -19.342 13.844  1.00 49.54 ? 57  LYS A CE  1 
ATOM   110  N NZ  . LYS A 1 19  ? 3.093   -20.173 15.103  1.00 49.91 ? 57  LYS A NZ  1 
ATOM   111  N N   . ARG A 1 20  ? 3.602   -20.519 7.734   1.00 39.55 ? 58  ARG A N   1 
ATOM   112  C CA  . ARG A 1 20  ? 2.472   -20.931 6.862   1.00 39.84 ? 58  ARG A CA  1 
ATOM   113  C C   . ARG A 1 20  ? 2.117   -19.914 5.737   1.00 38.71 ? 58  ARG A C   1 
ATOM   114  O O   . ARG A 1 20  ? 0.964   -19.761 5.350   1.00 38.60 ? 58  ARG A O   1 
ATOM   115  C CB  . ARG A 1 20  ? 1.236   -21.277 7.701   1.00 39.76 ? 58  ARG A CB  1 
ATOM   116  C CG  . ARG A 1 20  ? 1.445   -22.467 8.596   1.00 43.88 ? 58  ARG A CG  1 
ATOM   117  C CD  . ARG A 1 20  ? 0.120   -23.022 9.061   1.00 48.17 ? 58  ARG A CD  1 
ATOM   118  N NE  . ARG A 1 20  ? 0.333   -23.916 10.193  1.00 53.73 ? 58  ARG A NE  1 
ATOM   119  C CZ  . ARG A 1 20  ? -0.627  -24.327 11.019  1.00 55.96 ? 58  ARG A CZ  1 
ATOM   120  N NH1 . ARG A 1 20  ? -1.891  -23.933 10.845  1.00 57.49 ? 58  ARG A NH1 1 
ATOM   121  N NH2 . ARG A 1 20  ? -0.320  -25.131 12.030  1.00 57.50 ? 58  ARG A NH2 1 
ATOM   122  N N   . PHE A 1 21  ? 3.133   -19.261 5.195   1.00 37.82 ? 59  PHE A N   1 
ATOM   123  C CA  . PHE A 1 21  ? 2.939   -18.288 4.132   1.00 37.61 ? 59  PHE A CA  1 
ATOM   124  C C   . PHE A 1 21  ? 2.063   -18.820 2.985   1.00 37.59 ? 59  PHE A C   1 
ATOM   125  O O   . PHE A 1 21  ? 1.086   -18.159 2.630   1.00 38.14 ? 59  PHE A O   1 
ATOM   126  C CB  . PHE A 1 21  ? 4.290   -17.740 3.616   1.00 36.00 ? 59  PHE A CB  1 
ATOM   127  C CG  . PHE A 1 21  ? 4.151   -16.596 2.667   1.00 35.97 ? 59  PHE A CG  1 
ATOM   128  C CD1 . PHE A 1 21  ? 3.592   -15.390 3.079   1.00 34.99 ? 59  PHE A CD1 1 
ATOM   129  C CD2 . PHE A 1 21  ? 4.576   -16.719 1.355   1.00 34.32 ? 59  PHE A CD2 1 
ATOM   130  C CE1 . PHE A 1 21  ? 3.468   -14.313 2.181   1.00 33.63 ? 59  PHE A CE1 1 
ATOM   131  C CE2 . PHE A 1 21  ? 4.438   -15.684 0.451   1.00 33.67 ? 59  PHE A CE2 1 
ATOM   132  C CZ  . PHE A 1 21  ? 3.885   -14.461 0.866   1.00 34.07 ? 59  PHE A CZ  1 
ATOM   133  N N   . PRO A 1 22  ? 2.426   -19.973 2.380   1.00 37.27 ? 60  PRO A N   1 
ATOM   134  C CA  . PRO A 1 22  ? 1.641   -20.521 1.272   1.00 37.40 ? 60  PRO A CA  1 
ATOM   135  C C   . PRO A 1 22  ? 0.163   -20.658 1.614   1.00 37.70 ? 60  PRO A C   1 
ATOM   136  O O   . PRO A 1 22  ? -0.702  -20.189 0.874   1.00 37.58 ? 60  PRO A O   1 
ATOM   137  C CB  . PRO A 1 22  ? 2.262   -21.908 1.060   1.00 36.82 ? 60  PRO A CB  1 
ATOM   138  C CG  . PRO A 1 22  ? 3.657   -21.725 1.451   1.00 38.58 ? 60  PRO A CG  1 
ATOM   139  C CD  . PRO A 1 22  ? 3.636   -20.786 2.626   1.00 37.48 ? 60  PRO A CD  1 
ATOM   140  N N   . GLU A 1 23  ? -0.101  -21.286 2.750   1.00 38.39 ? 61  GLU A N   1 
ATOM   141  C CA  . GLU A 1 23  ? -1.455  -21.608 3.181   1.00 39.17 ? 61  GLU A CA  1 
ATOM   142  C C   . GLU A 1 23  ? -2.204  -20.326 3.540   1.00 39.05 ? 61  GLU A C   1 
ATOM   143  O O   . GLU A 1 23  ? -3.372  -20.201 3.228   1.00 39.30 ? 61  GLU A O   1 
ATOM   144  C CB  . GLU A 1 23  ? -1.423  -22.585 4.369   1.00 39.27 ? 61  GLU A CB  1 
ATOM   145  C CG  . GLU A 1 23  ? -0.731  -23.934 4.097   1.00 41.38 ? 61  GLU A CG  1 
ATOM   146  C CD  . GLU A 1 23  ? 0.697   -24.048 4.668   1.00 45.66 ? 61  GLU A CD  1 
ATOM   147  O OE1 . GLU A 1 23  ? 1.547   -23.146 4.466   1.00 47.63 ? 61  GLU A OE1 1 
ATOM   148  O OE2 . GLU A 1 23  ? 0.989   -25.083 5.309   1.00 47.61 ? 61  GLU A OE2 1 
ATOM   149  N N   . THR A 1 24  ? -1.521  -19.372 4.171   1.00 39.58 ? 62  THR A N   1 
ATOM   150  C CA  . THR A 1 24  ? -2.132  -18.086 4.531   1.00 39.71 ? 62  THR A CA  1 
ATOM   151  C C   . THR A 1 24  ? -2.536  -17.276 3.304   1.00 39.70 ? 62  THR A C   1 
ATOM   152  O O   . THR A 1 24  ? -3.679  -16.789 3.243   1.00 40.06 ? 62  THR A O   1 
ATOM   153  C CB  . THR A 1 24  ? -1.197  -17.226 5.375   1.00 40.08 ? 62  THR A CB  1 
ATOM   154  O OG1 . THR A 1 24  ? -0.823  -17.951 6.548   1.00 42.20 ? 62  THR A OG1 1 
ATOM   155  C CG2 . THR A 1 24  ? -1.867  -15.885 5.766   1.00 39.73 ? 62  THR A CG2 1 
ATOM   156  N N   . VAL A 1 25  ? -1.619  -17.126 2.341   1.00 38.43 ? 63  VAL A N   1 
ATOM   157  C CA  . VAL A 1 25  ? -1.920  -16.399 1.106   1.00 38.24 ? 63  VAL A CA  1 
ATOM   158  C C   . VAL A 1 25  ? -3.093  -17.071 0.410   1.00 38.12 ? 63  VAL A C   1 
ATOM   159  O O   . VAL A 1 25  ? -4.041  -16.400 0.034   1.00 36.93 ? 63  VAL A O   1 
ATOM   160  C CB  . VAL A 1 25  ? -0.705  -16.307 0.156   1.00 38.30 ? 63  VAL A CB  1 
ATOM   161  C CG1 . VAL A 1 25  ? -1.094  -15.720 -1.197  1.00 37.78 ? 63  VAL A CG1 1 
ATOM   162  C CG2 . VAL A 1 25  ? 0.369   -15.457 0.772   1.00 37.34 ? 63  VAL A CG2 1 
ATOM   163  N N   . LEU A 1 26  ? -3.025  -18.400 0.265   1.00 38.55 ? 64  LEU A N   1 
ATOM   164  C CA  . LEU A 1 26  ? -4.073  -19.162 -0.419  1.00 39.12 ? 64  LEU A CA  1 
ATOM   165  C C   . LEU A 1 26  ? -5.456  -19.013 0.246   1.00 39.26 ? 64  LEU A C   1 
ATOM   166  O O   . LEU A 1 26  ? -6.461  -18.786 -0.450  1.00 39.10 ? 64  LEU A O   1 
ATOM   167  C CB  . LEU A 1 26  ? -3.669  -20.641 -0.533  1.00 39.42 ? 64  LEU A CB  1 
ATOM   168  C CG  . LEU A 1 26  ? -4.354  -21.482 -1.620  1.00 41.09 ? 64  LEU A CG  1 
ATOM   169  C CD1 . LEU A 1 26  ? -3.770  -21.166 -3.011  1.00 41.72 ? 64  LEU A CD1 1 
ATOM   170  C CD2 . LEU A 1 26  ? -4.245  -23.012 -1.311  1.00 40.38 ? 64  LEU A CD2 1 
ATOM   171  N N   . ALA A 1 27  ? -5.517  -19.144 1.576   1.00 39.20 ? 65  ALA A N   1 
ATOM   172  C CA  . ALA A 1 27  ? -6.775  -18.947 2.307   1.00 39.09 ? 65  ALA A CA  1 
ATOM   173  C C   . ALA A 1 27  ? -7.283  -17.499 2.179   1.00 39.39 ? 65  ALA A C   1 
ATOM   174  O O   . ALA A 1 27  ? -8.497  -17.270 2.042   1.00 38.91 ? 65  ALA A O   1 
ATOM   175  C CB  . ALA A 1 27  ? -6.632  -19.342 3.761   1.00 38.97 ? 65  ALA A CB  1 
ATOM   176  N N   . ARG A 1 28  ? -6.369  -16.532 2.224   1.00 38.89 ? 66  ARG A N   1 
ATOM   177  C CA  . ARG A 1 28  ? -6.726  -15.116 2.014   1.00 39.90 ? 66  ARG A CA  1 
ATOM   178  C C   . ARG A 1 28  ? -7.325  -14.904 0.640   1.00 40.78 ? 66  ARG A C   1 
ATOM   179  O O   . ARG A 1 28  ? -8.293  -14.191 0.512   1.00 42.08 ? 66  ARG A O   1 
ATOM   180  C CB  . ARG A 1 28  ? -5.525  -14.187 2.204   1.00 38.60 ? 66  ARG A CB  1 
ATOM   181  C CG  . ARG A 1 28  ? -5.193  -13.950 3.653   1.00 37.33 ? 66  ARG A CG  1 
ATOM   182  C CD  . ARG A 1 28  ? -4.138  -12.908 3.779   1.00 37.77 ? 66  ARG A CD  1 
ATOM   183  N NE  . ARG A 1 28  ? -3.748  -12.705 5.168   1.00 38.15 ? 66  ARG A NE  1 
ATOM   184  C CZ  . ARG A 1 28  ? -2.912  -11.746 5.560   1.00 38.92 ? 66  ARG A CZ  1 
ATOM   185  N NH1 . ARG A 1 28  ? -2.421  -10.886 4.687   1.00 37.03 ? 66  ARG A NH1 1 
ATOM   186  N NH2 . ARG A 1 28  ? -2.582  -11.625 6.833   1.00 39.83 ? 66  ARG A NH2 1 
ATOM   187  N N   . CYS A 1 29  ? -6.760  -15.556 -0.371  1.00 42.21 ? 67  CYS A N   1 
ATOM   188  C CA  . CYS A 1 29  ? -7.306  -15.525 -1.726  1.00 42.71 ? 67  CYS A CA  1 
ATOM   189  C C   . CYS A 1 29  ? -8.716  -16.123 -1.787  1.00 42.69 ? 67  CYS A C   1 
ATOM   190  O O   . CYS A 1 29  ? -9.632  -15.507 -2.333  1.00 42.33 ? 67  CYS A O   1 
ATOM   191  C CB  . CYS A 1 29  ? -6.358  -16.229 -2.717  1.00 43.02 ? 67  CYS A CB  1 
ATOM   192  S SG  . CYS A 1 29  ? -6.823  -15.991 -4.450  1.00 44.17 ? 67  CYS A SG  1 
ATOM   193  N N   . VAL A 1 30  ? -8.897  -17.324 -1.240  1.00 42.74 ? 68  VAL A N   1 
ATOM   194  C CA  . VAL A 1 30  ? -10.254 -17.884 -1.110  1.00 42.54 ? 68  VAL A CA  1 
ATOM   195  C C   . VAL A 1 30  ? -11.226 -16.895 -0.436  1.00 43.03 ? 68  VAL A C   1 
ATOM   196  O O   . VAL A 1 30  ? -12.250 -16.505 -1.030  1.00 43.04 ? 68  VAL A O   1 
ATOM   197  C CB  . VAL A 1 30  ? -10.264 -19.286 -0.415  1.00 43.01 ? 68  VAL A CB  1 
ATOM   198  C CG1 . VAL A 1 30  ? -11.709 -19.797 -0.193  1.00 41.14 ? 68  VAL A CG1 1 
ATOM   199  C CG2 . VAL A 1 30  ? -9.478  -20.291 -1.242  1.00 41.97 ? 68  VAL A CG2 1 
ATOM   200  N N   . LYS A 1 31  ? -10.892 -16.468 0.781   1.00 42.78 ? 69  LYS A N   1 
ATOM   201  C CA  . LYS A 1 31  ? -11.756 -15.574 1.544   1.00 43.03 ? 69  LYS A CA  1 
ATOM   202  C C   . LYS A 1 31  ? -12.136 -14.301 0.770   1.00 42.47 ? 69  LYS A C   1 
ATOM   203  O O   . LYS A 1 31  ? -13.304 -13.924 0.747   1.00 41.76 ? 69  LYS A O   1 
ATOM   204  C CB  . LYS A 1 31  ? -11.132 -15.237 2.899   1.00 43.45 ? 69  LYS A CB  1 
ATOM   205  C CG  . LYS A 1 31  ? -11.898 -14.164 3.635   1.00 46.89 ? 69  LYS A CG  1 
ATOM   206  C CD  . LYS A 1 31  ? -12.107 -14.491 5.114   1.00 53.07 ? 69  LYS A CD  1 
ATOM   207  C CE  . LYS A 1 31  ? -13.249 -13.633 5.689   1.00 56.21 ? 69  LYS A CE  1 
ATOM   208  N NZ  . LYS A 1 31  ? -13.578 -13.986 7.116   1.00 59.40 ? 69  LYS A NZ  1 
ATOM   209  N N   . TYR A 1 32  ? -11.153 -13.670 0.125   1.00 41.53 ? 70  TYR A N   1 
ATOM   210  C CA  . TYR A 1 32  ? -11.376 -12.468 -0.686  1.00 40.98 ? 70  TYR A CA  1 
ATOM   211  C C   . TYR A 1 32  ? -12.310 -12.715 -1.874  1.00 41.09 ? 70  TYR A C   1 
ATOM   212  O O   . TYR A 1 32  ? -13.241 -11.930 -2.112  1.00 40.69 ? 70  TYR A O   1 
ATOM   213  C CB  . TYR A 1 32  ? -10.046 -11.864 -1.199  1.00 40.02 ? 70  TYR A CB  1 
ATOM   214  C CG  . TYR A 1 32  ? -10.226 -10.432 -1.706  1.00 40.40 ? 70  TYR A CG  1 
ATOM   215  C CD1 . TYR A 1 32  ? -9.972  -9.344  -0.877  1.00 38.28 ? 70  TYR A CD1 1 
ATOM   216  C CD2 . TYR A 1 32  ? -10.695 -10.173 -3.003  1.00 39.84 ? 70  TYR A CD2 1 
ATOM   217  C CE1 . TYR A 1 32  ? -10.162 -8.025  -1.324  1.00 37.44 ? 70  TYR A CE1 1 
ATOM   218  C CE2 . TYR A 1 32  ? -10.881 -8.850  -3.458  1.00 40.08 ? 70  TYR A CE2 1 
ATOM   219  C CZ  . TYR A 1 32  ? -10.617 -7.796  -2.616  1.00 39.39 ? 70  TYR A CZ  1 
ATOM   220  O OH  . TYR A 1 32  ? -10.815 -6.509  -3.076  1.00 41.71 ? 70  TYR A OH  1 
ATOM   221  N N   . THR A 1 33  ? -12.052 -13.793 -2.625  1.00 41.20 ? 71  THR A N   1 
ATOM   222  C CA  . THR A 1 33  ? -12.821 -14.075 -3.839  1.00 42.21 ? 71  THR A CA  1 
ATOM   223  C C   . THR A 1 33  ? -14.242 -14.537 -3.528  1.00 42.59 ? 71  THR A C   1 
ATOM   224  O O   . THR A 1 33  ? -15.138 -14.375 -4.347  1.00 42.55 ? 71  THR A O   1 
ATOM   225  C CB  . THR A 1 33  ? -12.118 -15.071 -4.763  1.00 42.33 ? 71  THR A CB  1 
ATOM   226  O OG1 . THR A 1 33  ? -11.781 -16.246 -4.017  1.00 43.18 ? 71  THR A OG1 1 
ATOM   227  C CG2 . THR A 1 33  ? -10.834 -14.432 -5.358  1.00 41.83 ? 71  THR A CG2 1 
ATOM   228  N N   . GLU A 1 34  ? -14.441 -15.093 -2.338  1.00 43.40 ? 72  GLU A N   1 
ATOM   229  C CA  . GLU A 1 34  ? -15.778 -15.465 -1.877  1.00 44.95 ? 72  GLU A CA  1 
ATOM   230  C C   . GLU A 1 34  ? -16.554 -14.226 -1.532  1.00 45.02 ? 72  GLU A C   1 
ATOM   231  O O   . GLU A 1 34  ? -17.747 -14.144 -1.802  1.00 44.96 ? 72  GLU A O   1 
ATOM   232  C CB  . GLU A 1 34  ? -15.710 -16.361 -0.636  1.00 44.82 ? 72  GLU A CB  1 
ATOM   233  C CG  . GLU A 1 34  ? -15.429 -17.831 -0.938  1.00 46.63 ? 72  GLU A CG  1 
ATOM   234  C CD  . GLU A 1 34  ? -15.016 -18.635 0.292   1.00 46.73 ? 72  GLU A CD  1 
ATOM   235  O OE1 . GLU A 1 34  ? -14.532 -18.032 1.284   1.00 49.19 ? 72  GLU A OE1 1 
ATOM   236  O OE2 . GLU A 1 34  ? -15.153 -19.882 0.248   1.00 47.96 ? 72  GLU A OE2 1 
ATOM   237  N N   . ILE A 1 35  ? -15.874 -13.254 -0.931  1.00 45.33 ? 73  ILE A N   1 
ATOM   238  C CA  . ILE A 1 35  ? -16.539 -12.061 -0.431  1.00 45.90 ? 73  ILE A CA  1 
ATOM   239  C C   . ILE A 1 35  ? -16.823 -11.059 -1.551  1.00 45.97 ? 73  ILE A C   1 
ATOM   240  O O   . ILE A 1 35  ? -17.927 -10.500 -1.629  1.00 45.97 ? 73  ILE A O   1 
ATOM   241  C CB  . ILE A 1 35  ? -15.744 -11.439 0.754   1.00 46.46 ? 73  ILE A CB  1 
ATOM   242  C CG1 . ILE A 1 35  ? -15.729 -12.388 1.966   1.00 47.51 ? 73  ILE A CG1 1 
ATOM   243  C CG2 . ILE A 1 35  ? -16.272 -10.073 1.154   1.00 46.69 ? 73  ILE A CG2 1 
ATOM   244  C CD1 . ILE A 1 35  ? -17.056 -13.117 2.284   1.00 50.18 ? 73  ILE A CD1 1 
ATOM   245  N N   . HIS A 1 36  ? -15.844 -10.844 -2.423  1.00 46.89 ? 74  HIS A N   1 
ATOM   246  C CA  . HIS A 1 36  ? -15.925 -9.793  -3.438  1.00 47.41 ? 74  HIS A CA  1 
ATOM   247  C C   . HIS A 1 36  ? -16.332 -10.369 -4.773  1.00 48.18 ? 74  HIS A C   1 
ATOM   248  O O   . HIS A 1 36  ? -15.564 -11.086 -5.405  1.00 48.03 ? 74  HIS A O   1 
ATOM   249  C CB  . HIS A 1 36  ? -14.611 -9.046  -3.546  1.00 47.85 ? 74  HIS A CB  1 
ATOM   250  C CG  . HIS A 1 36  ? -14.271 -8.281  -2.314  1.00 49.10 ? 74  HIS A CG  1 
ATOM   251  N ND1 . HIS A 1 36  ? -13.597 -8.846  -1.253  1.00 50.38 ? 74  HIS A ND1 1 
ATOM   252  C CD2 . HIS A 1 36  ? -14.549 -7.007  -1.951  1.00 49.36 ? 74  HIS A CD2 1 
ATOM   253  C CE1 . HIS A 1 36  ? -13.453 -7.945  -0.297  1.00 48.44 ? 74  HIS A CE1 1 
ATOM   254  N NE2 . HIS A 1 36  ? -14.024 -6.822  -0.697  1.00 49.89 ? 74  HIS A NE2 1 
ATOM   255  N N   . PRO A 1 37  ? -17.564 -10.060 -5.207  1.00 48.84 ? 75  PRO A N   1 
ATOM   256  C CA  . PRO A 1 37  ? -18.145 -10.766 -6.356  1.00 49.36 ? 75  PRO A CA  1 
ATOM   257  C C   . PRO A 1 37  ? -17.410 -10.511 -7.690  1.00 50.21 ? 75  PRO A C   1 
ATOM   258  O O   . PRO A 1 37  ? -17.372 -11.397 -8.556  1.00 49.62 ? 75  PRO A O   1 
ATOM   259  C CB  . PRO A 1 37  ? -19.588 -10.238 -6.398  1.00 48.88 ? 75  PRO A CB  1 
ATOM   260  C CG  . PRO A 1 37  ? -19.515 -8.890  -5.700  1.00 48.49 ? 75  PRO A CG  1 
ATOM   261  C CD  . PRO A 1 37  ? -18.476 -9.033  -4.646  1.00 48.82 ? 75  PRO A CD  1 
ATOM   262  N N   . GLU A 1 38  ? -16.847 -9.306  -7.843  1.00 51.37 ? 76  GLU A N   1 
ATOM   263  C CA  . GLU A 1 38  ? -16.109 -8.933  -9.052  1.00 53.03 ? 76  GLU A CA  1 
ATOM   264  C C   . GLU A 1 38  ? -14.876 -9.825  -9.259  1.00 53.08 ? 76  GLU A C   1 
ATOM   265  O O   . GLU A 1 38  ? -14.476 -10.071 -10.389 1.00 53.54 ? 76  GLU A O   1 
ATOM   266  C CB  . GLU A 1 38  ? -15.698 -7.454  -9.012  1.00 53.53 ? 76  GLU A CB  1 
ATOM   267  C CG  . GLU A 1 38  ? -14.500 -7.162  -8.120  1.00 56.94 ? 76  GLU A CG  1 
ATOM   268  C CD  . GLU A 1 38  ? -14.871 -6.670  -6.718  1.00 61.09 ? 76  GLU A CD  1 
ATOM   269  O OE1 . GLU A 1 38  ? -16.012 -6.927  -6.258  1.00 61.34 ? 76  GLU A OE1 1 
ATOM   270  O OE2 . GLU A 1 38  ? -13.999 -6.008  -6.086  1.00 63.49 ? 76  GLU A OE2 1 
ATOM   271  N N   . MET A 1 39  ? -14.300 -10.318 -8.165  1.00 53.32 ? 77  MET A N   1 
ATOM   272  C CA  . MET A 1 39  ? -13.152 -11.219 -8.225  1.00 53.35 ? 77  MET A CA  1 
ATOM   273  C C   . MET A 1 39  ? -13.514 -12.707 -8.197  1.00 53.48 ? 77  MET A C   1 
ATOM   274  O O   . MET A 1 39  ? -12.680 -13.527 -7.851  1.00 53.28 ? 77  MET A O   1 
ATOM   275  C CB  . MET A 1 39  ? -12.166 -10.896 -7.090  1.00 53.25 ? 77  MET A CB  1 
ATOM   276  C CG  . MET A 1 39  ? -11.648 -9.472  -7.068  1.00 53.33 ? 77  MET A CG  1 
ATOM   277  S SD  . MET A 1 39  ? -10.930 -8.940  -8.631  1.00 52.95 ? 77  MET A SD  1 
ATOM   278  C CE  . MET A 1 39  ? -9.244  -9.474  -8.489  1.00 50.73 ? 77  MET A CE  1 
ATOM   279  N N   . ARG A 1 40  ? -14.748 -13.059 -8.567  1.00 54.36 ? 78  ARG A N   1 
ATOM   280  C CA  . ARG A 1 40  ? -15.232 -14.456 -8.533  1.00 55.02 ? 78  ARG A CA  1 
ATOM   281  C C   . ARG A 1 40  ? -14.572 -15.424 -9.510  1.00 55.26 ? 78  ARG A C   1 
ATOM   282  O O   . ARG A 1 40  ? -14.542 -16.633 -9.255  1.00 55.54 ? 78  ARG A O   1 
ATOM   283  C CB  . ARG A 1 40  ? -16.739 -14.522 -8.789  1.00 55.18 ? 78  ARG A CB  1 
ATOM   284  C CG  . ARG A 1 40  ? -17.585 -14.736 -7.565  1.00 56.41 ? 78  ARG A CG  1 
ATOM   285  C CD  . ARG A 1 40  ? -19.050 -14.509 -7.910  1.00 58.99 ? 78  ARG A CD  1 
ATOM   286  N NE  . ARG A 1 40  ? -19.256 -13.140 -8.379  1.00 61.43 ? 78  ARG A NE  1 
ATOM   287  C CZ  . ARG A 1 40  ? -19.751 -12.789 -9.565  1.00 61.71 ? 78  ARG A CZ  1 
ATOM   288  N NH1 . ARG A 1 40  ? -20.133 -13.707 -10.448 1.00 59.30 ? 78  ARG A NH1 1 
ATOM   289  N NH2 . ARG A 1 40  ? -19.866 -11.493 -9.857  1.00 61.74 ? 78  ARG A NH2 1 
ATOM   290  N N   . HIS A 1 41  ? -14.082 -14.908 -10.636 1.00 55.27 ? 79  HIS A N   1 
ATOM   291  C CA  . HIS A 1 41  ? -13.490 -15.762 -11.675 1.00 55.07 ? 79  HIS A CA  1 
ATOM   292  C C   . HIS A 1 41  ? -12.113 -16.273 -11.252 1.00 54.43 ? 79  HIS A C   1 
ATOM   293  O O   . HIS A 1 41  ? -11.651 -17.308 -11.745 1.00 54.79 ? 79  HIS A O   1 
ATOM   294  C CB  . HIS A 1 41  ? -13.383 -15.008 -13.009 1.00 55.37 ? 79  HIS A CB  1 
ATOM   295  C CG  . HIS A 1 41  ? -12.463 -13.825 -12.965 1.00 56.71 ? 79  HIS A CG  1 
ATOM   296  N ND1 . HIS A 1 41  ? -12.834 -12.613 -12.423 1.00 57.50 ? 79  HIS A ND1 1 
ATOM   297  C CD2 . HIS A 1 41  ? -11.190 -13.669 -13.397 1.00 57.91 ? 79  HIS A CD2 1 
ATOM   298  C CE1 . HIS A 1 41  ? -11.830 -11.760 -12.523 1.00 58.98 ? 79  HIS A CE1 1 
ATOM   299  N NE2 . HIS A 1 41  ? -10.819 -12.376 -13.108 1.00 59.39 ? 79  HIS A NE2 1 
ATOM   300  N N   . VAL A 1 42  ? -11.484 -15.555 -10.325 1.00 53.07 ? 80  VAL A N   1 
ATOM   301  C CA  . VAL A 1 42  ? -10.079 -15.771 -9.972  1.00 52.07 ? 80  VAL A CA  1 
ATOM   302  C C   . VAL A 1 42  ? -9.797  -17.168 -9.397  1.00 51.06 ? 80  VAL A C   1 
ATOM   303  O O   . VAL A 1 42  ? -10.387 -17.584 -8.389  1.00 50.68 ? 80  VAL A O   1 
ATOM   304  C CB  . VAL A 1 42  ? -9.554  -14.656 -9.036  1.00 52.03 ? 80  VAL A CB  1 
ATOM   305  C CG1 . VAL A 1 42  ? -8.223  -15.038 -8.412  1.00 52.35 ? 80  VAL A CG1 1 
ATOM   306  C CG2 . VAL A 1 42  ? -9.415  -13.342 -9.798  1.00 52.65 ? 80  VAL A CG2 1 
ATOM   307  N N   . ASP A 1 43  ? -8.901  -17.879 -10.080 1.00 49.82 ? 81  ASP A N   1 
ATOM   308  C CA  . ASP A 1 43  ? -8.356  -19.148 -9.619  1.00 48.59 ? 81  ASP A CA  1 
ATOM   309  C C   . ASP A 1 43  ? -7.240  -18.857 -8.639  1.00 47.46 ? 81  ASP A C   1 
ATOM   310  O O   . ASP A 1 43  ? -6.213  -18.284 -9.002  1.00 47.15 ? 81  ASP A O   1 
ATOM   311  C CB  . ASP A 1 43  ? -7.784  -19.918 -10.803 1.00 48.97 ? 81  ASP A CB  1 
ATOM   312  C CG  . ASP A 1 43  ? -7.300  -21.312 -10.430 1.00 49.69 ? 81  ASP A CG  1 
ATOM   313  O OD1 . ASP A 1 43  ? -6.695  -21.503 -9.347  1.00 49.97 ? 81  ASP A OD1 1 
ATOM   314  O OD2 . ASP A 1 43  ? -7.509  -22.222 -11.255 1.00 52.09 ? 81  ASP A OD2 1 
ATOM   315  N N   . CYS A 1 44  ? -7.430  -19.281 -7.402  1.00 46.23 ? 82  CYS A N   1 
ATOM   316  C CA  . CYS A 1 44  ? -6.507  -18.927 -6.353  1.00 45.60 ? 82  CYS A CA  1 
ATOM   317  C C   . CYS A 1 44  ? -5.196  -19.694 -6.391  1.00 44.48 ? 82  CYS A C   1 
ATOM   318  O O   . CYS A 1 44  ? -4.152  -19.176 -5.993  1.00 44.25 ? 82  CYS A O   1 
ATOM   319  C CB  . CYS A 1 44  ? -7.194  -19.002 -5.000  1.00 45.69 ? 82  CYS A CB  1 
ATOM   320  S SG  . CYS A 1 44  ? -8.213  -17.521 -4.740  1.00 49.35 ? 82  CYS A SG  1 
ATOM   321  N N   . GLN A 1 45  ? -5.245  -20.915 -6.903  1.00 43.39 ? 83  GLN A N   1 
ATOM   322  C CA  . GLN A 1 45  ? -4.049  -21.688 -7.080  1.00 42.77 ? 83  GLN A CA  1 
ATOM   323  C C   . GLN A 1 45  ? -3.131  -21.004 -8.093  1.00 41.67 ? 83  GLN A C   1 
ATOM   324  O O   . GLN A 1 45  ? -1.925  -20.939 -7.891  1.00 41.73 ? 83  GLN A O   1 
ATOM   325  C CB  . GLN A 1 45  ? -4.387  -23.133 -7.490  1.00 42.71 ? 83  GLN A CB  1 
ATOM   326  C CG  . GLN A 1 45  ? -3.168  -24.032 -7.670  1.00 45.55 ? 83  GLN A CG  1 
ATOM   327  C CD  . GLN A 1 45  ? -2.280  -24.133 -6.423  1.00 48.85 ? 83  GLN A CD  1 
ATOM   328  O OE1 . GLN A 1 45  ? -1.048  -23.970 -6.494  1.00 50.39 ? 83  GLN A OE1 1 
ATOM   329  N NE2 . GLN A 1 45  ? -2.902  -24.406 -5.278  1.00 49.50 ? 83  GLN A NE2 1 
ATOM   330  N N   . SER A 1 46  ? -3.698  -20.495 -9.178  1.00 41.17 ? 84  SER A N   1 
ATOM   331  C CA  . SER A 1 46  ? -2.923  -19.712 -10.140 1.00 41.54 ? 84  SER A CA  1 
ATOM   332  C C   . SER A 1 46  ? -2.355  -18.441 -9.484  1.00 41.16 ? 84  SER A C   1 
ATOM   333  O O   . SER A 1 46  ? -1.219  -18.060 -9.745  1.00 41.64 ? 84  SER A O   1 
ATOM   334  C CB  . SER A 1 46  ? -3.773  -19.301 -11.334 1.00 41.20 ? 84  SER A CB  1 
ATOM   335  O OG  . SER A 1 46  ? -4.680  -20.326 -11.695 1.00 43.87 ? 84  SER A OG  1 
ATOM   336  N N   . VAL A 1 47  ? -3.139  -17.793 -8.631  1.00 41.03 ? 85  VAL A N   1 
ATOM   337  C CA  . VAL A 1 47  ? -2.644  -16.590 -7.954  1.00 40.68 ? 85  VAL A CA  1 
ATOM   338  C C   . VAL A 1 47  ? -1.440  -16.993 -7.123  1.00 40.71 ? 85  VAL A C   1 
ATOM   339  O O   . VAL A 1 47  ? -0.396  -16.368 -7.217  1.00 40.20 ? 85  VAL A O   1 
ATOM   340  C CB  . VAL A 1 47  ? -3.709  -15.902 -7.100  1.00 40.49 ? 85  VAL A CB  1 
ATOM   341  C CG1 . VAL A 1 47  ? -3.075  -14.850 -6.227  1.00 37.65 ? 85  VAL A CG1 1 
ATOM   342  C CG2 . VAL A 1 47  ? -4.761  -15.259 -8.009  1.00 40.93 ? 85  VAL A CG2 1 
ATOM   343  N N   . TRP A 1 48  ? -1.580  -18.076 -6.355  1.00 41.52 ? 86  TRP A N   1 
ATOM   344  C CA  . TRP A 1 48  ? -0.459  -18.585 -5.572  1.00 41.60 ? 86  TRP A CA  1 
ATOM   345  C C   . TRP A 1 48  ? 0.728   -18.927 -6.458  1.00 41.93 ? 86  TRP A C   1 
ATOM   346  O O   . TRP A 1 48  ? 1.862   -18.550 -6.129  1.00 43.27 ? 86  TRP A O   1 
ATOM   347  C CB  . TRP A 1 48  ? -0.837  -19.784 -4.691  1.00 41.76 ? 86  TRP A CB  1 
ATOM   348  C CG  . TRP A 1 48  ? 0.373   -20.365 -3.995  1.00 41.58 ? 86  TRP A CG  1 
ATOM   349  C CD1 . TRP A 1 48  ? 0.829   -21.637 -4.083  1.00 40.95 ? 86  TRP A CD1 1 
ATOM   350  C CD2 . TRP A 1 48  ? 1.297   -19.657 -3.141  1.00 41.90 ? 86  TRP A CD2 1 
ATOM   351  N NE1 . TRP A 1 48  ? 1.971   -21.780 -3.332  1.00 41.89 ? 86  TRP A NE1 1 
ATOM   352  C CE2 . TRP A 1 48  ? 2.277   -20.583 -2.737  1.00 41.38 ? 86  TRP A CE2 1 
ATOM   353  C CE3 . TRP A 1 48  ? 1.381   -18.324 -2.675  1.00 39.86 ? 86  TRP A CE3 1 
ATOM   354  C CZ2 . TRP A 1 48  ? 3.344   -20.226 -1.892  1.00 42.28 ? 86  TRP A CZ2 1 
ATOM   355  C CZ3 . TRP A 1 48  ? 2.428   -17.971 -1.830  1.00 40.65 ? 86  TRP A CZ3 1 
ATOM   356  C CH2 . TRP A 1 48  ? 3.402   -18.917 -1.452  1.00 41.00 ? 86  TRP A CH2 1 
ATOM   357  N N   . ASP A 1 49  ? 0.474   -19.602 -7.579  1.00 41.74 ? 87  ASP A N   1 
ATOM   358  C CA  . ASP A 1 49  ? 1.541   -19.976 -8.518  1.00 41.83 ? 87  ASP A CA  1 
ATOM   359  C C   . ASP A 1 49  ? 2.342   -18.761 -8.957  1.00 41.25 ? 87  ASP A C   1 
ATOM   360  O O   . ASP A 1 49  ? 3.572   -18.784 -8.894  1.00 41.29 ? 87  ASP A O   1 
ATOM   361  C CB  . ASP A 1 49  ? 0.990   -20.681 -9.763  1.00 42.01 ? 87  ASP A CB  1 
ATOM   362  C CG  . ASP A 1 49  ? 0.619   -22.142 -9.517  1.00 45.09 ? 87  ASP A CG  1 
ATOM   363  O OD1 . ASP A 1 49  ? 1.052   -22.737 -8.490  1.00 47.89 ? 87  ASP A OD1 1 
ATOM   364  O OD2 . ASP A 1 49  ? -0.115  -22.707 -10.377 1.00 46.40 ? 87  ASP A OD2 1 
ATOM   365  N N   . ALA A 1 50  ? 1.649   -17.696 -9.379  1.00 40.77 ? 88  ALA A N   1 
ATOM   366  C CA  . ALA A 1 50  ? 2.311   -16.474 -9.870  1.00 40.08 ? 88  ALA A CA  1 
ATOM   367  C C   . ALA A 1 50  ? 3.028   -15.697 -8.782  1.00 39.81 ? 88  ALA A C   1 
ATOM   368  O O   . ALA A 1 50  ? 4.043   -15.062 -9.043  1.00 40.37 ? 88  ALA A O   1 
ATOM   369  C CB  . ALA A 1 50  ? 1.337   -15.591 -10.586 1.00 40.29 ? 88  ALA A CB  1 
ATOM   370  N N   . PHE A 1 51  ? 2.486   -15.730 -7.569  1.00 39.64 ? 89  PHE A N   1 
ATOM   371  C CA  . PHE A 1 51  ? 3.085   -15.064 -6.425  1.00 39.21 ? 89  PHE A CA  1 
ATOM   372  C C   . PHE A 1 51  ? 4.422   -15.736 -6.088  1.00 39.05 ? 89  PHE A C   1 
ATOM   373  O O   . PHE A 1 51  ? 5.462   -15.056 -5.963  1.00 39.19 ? 89  PHE A O   1 
ATOM   374  C CB  . PHE A 1 51  ? 2.118   -15.115 -5.230  1.00 39.64 ? 89  PHE A CB  1 
ATOM   375  C CG  . PHE A 1 51  ? 2.372   -14.087 -4.178  1.00 39.58 ? 89  PHE A CG  1 
ATOM   376  C CD1 . PHE A 1 51  ? 3.659   -13.759 -3.770  1.00 42.11 ? 89  PHE A CD1 1 
ATOM   377  C CD2 . PHE A 1 51  ? 1.308   -13.464 -3.545  1.00 43.60 ? 89  PHE A CD2 1 
ATOM   378  C CE1 . PHE A 1 51  ? 3.884   -12.793 -2.776  1.00 40.37 ? 89  PHE A CE1 1 
ATOM   379  C CE2 . PHE A 1 51  ? 1.525   -12.480 -2.543  1.00 41.35 ? 89  PHE A CE2 1 
ATOM   380  C CZ  . PHE A 1 51  ? 2.826   -12.172 -2.162  1.00 40.80 ? 89  PHE A CZ  1 
ATOM   381  N N   . LYS A 1 52  ? 4.388   -17.061 -5.933  1.00 38.87 ? 90  LYS A N   1 
ATOM   382  C CA  . LYS A 1 52  ? 5.590   -17.893 -5.837  1.00 38.58 ? 90  LYS A CA  1 
ATOM   383  C C   . LYS A 1 52  ? 6.634   -17.579 -6.926  1.00 38.29 ? 90  LYS A C   1 
ATOM   384  O O   . LYS A 1 52  ? 7.816   -17.361 -6.637  1.00 37.58 ? 90  LYS A O   1 
ATOM   385  C CB  . LYS A 1 52  ? 5.207   -19.366 -5.989  1.00 39.39 ? 90  LYS A CB  1 
ATOM   386  C CG  . LYS A 1 52  ? 5.050   -20.158 -4.732  1.00 40.34 ? 90  LYS A CG  1 
ATOM   387  C CD  . LYS A 1 52  ? 5.250   -21.673 -5.008  1.00 42.16 ? 90  LYS A CD  1 
ATOM   388  C CE  . LYS A 1 52  ? 4.367   -22.185 -6.166  1.00 44.30 ? 90  LYS A CE  1 
ATOM   389  N NZ  . LYS A 1 52  ? 4.017   -23.657 -6.093  1.00 45.44 ? 90  LYS A NZ  1 
ATOM   390  N N   . GLY A 1 53  ? 6.191   -17.587 -8.184  1.00 37.89 ? 91  GLY A N   1 
ATOM   391  C CA  . GLY A 1 53  ? 7.074   -17.352 -9.334  1.00 37.13 ? 91  GLY A CA  1 
ATOM   392  C C   . GLY A 1 53  ? 7.838   -16.043 -9.245  1.00 36.45 ? 91  GLY A C   1 
ATOM   393  O O   . GLY A 1 53  ? 8.942   -15.934 -9.784  1.00 37.19 ? 91  GLY A O   1 
ATOM   394  N N   . ALA A 1 54  ? 7.270   -15.041 -8.569  1.00 35.50 ? 92  ALA A N   1 
ATOM   395  C CA  . ALA A 1 54  ? 7.962   -13.763 -8.443  1.00 34.61 ? 92  ALA A CA  1 
ATOM   396  C C   . ALA A 1 54  ? 9.256   -13.871 -7.625  1.00 34.58 ? 92  ALA A C   1 
ATOM   397  O O   . ALA A 1 54  ? 10.198  -13.157 -7.909  1.00 34.80 ? 92  ALA A O   1 
ATOM   398  C CB  . ALA A 1 54  ? 7.021   -12.663 -7.857  1.00 34.32 ? 92  ALA A CB  1 
ATOM   399  N N   . PHE A 1 55  ? 9.324   -14.749 -6.625  1.00 34.66 ? 93  PHE A N   1 
ATOM   400  C CA  . PHE A 1 55  ? 10.474  -14.701 -5.690  1.00 35.36 ? 93  PHE A CA  1 
ATOM   401  C C   . PHE A 1 55  ? 11.190  -16.019 -5.375  1.00 35.44 ? 93  PHE A C   1 
ATOM   402  O O   . PHE A 1 55  ? 12.300  -16.026 -4.813  1.00 36.37 ? 93  PHE A O   1 
ATOM   403  C CB  . PHE A 1 55  ? 10.045  -14.014 -4.387  1.00 35.10 ? 93  PHE A CB  1 
ATOM   404  C CG  . PHE A 1 55  ? 9.166   -14.865 -3.505  1.00 35.21 ? 93  PHE A CG  1 
ATOM   405  C CD1 . PHE A 1 55  ? 9.730   -15.707 -2.540  1.00 34.63 ? 93  PHE A CD1 1 
ATOM   406  C CD2 . PHE A 1 55  ? 7.787   -14.829 -3.640  1.00 34.45 ? 93  PHE A CD2 1 
ATOM   407  C CE1 . PHE A 1 55  ? 8.929   -16.469 -1.725  1.00 34.88 ? 93  PHE A CE1 1 
ATOM   408  C CE2 . PHE A 1 55  ? 6.982   -15.596 -2.833  1.00 32.04 ? 93  PHE A CE2 1 
ATOM   409  C CZ  . PHE A 1 55  ? 7.559   -16.431 -1.881  1.00 34.14 ? 93  PHE A CZ  1 
ATOM   410  N N   . ILE A 1 56  ? 10.558  -17.134 -5.695  1.00 35.84 ? 94  ILE A N   1 
ATOM   411  C CA  . ILE A 1 56  ? 11.170  -18.454 -5.441  1.00 36.42 ? 94  ILE A CA  1 
ATOM   412  C C   . ILE A 1 56  ? 12.324  -18.653 -6.412  1.00 36.15 ? 94  ILE A C   1 
ATOM   413  O O   . ILE A 1 56  ? 12.225  -18.246 -7.574  1.00 36.26 ? 94  ILE A O   1 
ATOM   414  C CB  . ILE A 1 56  ? 10.133  -19.612 -5.541  1.00 36.08 ? 94  ILE A CB  1 
ATOM   415  C CG1 . ILE A 1 56  ? 9.143   -19.558 -4.369  1.00 39.03 ? 94  ILE A CG1 1 
ATOM   416  C CG2 . ILE A 1 56  ? 10.813  -20.961 -5.537  1.00 36.46 ? 94  ILE A CG2 1 
ATOM   417  C CD1 . ILE A 1 56  ? 9.713   -20.016 -3.008  1.00 40.22 ? 94  ILE A CD1 1 
ATOM   418  N N   . SER A 1 57  ? 13.423  -19.218 -5.915  1.00 36.25 ? 95  SER A N   1 
ATOM   419  C CA  . SER A 1 57  ? 14.635  -19.493 -6.718  1.00 37.37 ? 95  SER A CA  1 
ATOM   420  C C   . SER A 1 57  ? 15.309  -18.253 -7.300  1.00 37.48 ? 95  SER A C   1 
ATOM   421  O O   . SER A 1 57  ? 16.125  -18.346 -8.220  1.00 38.04 ? 95  SER A O   1 
ATOM   422  C CB  . SER A 1 57  ? 14.340  -20.483 -7.841  1.00 37.35 ? 95  SER A CB  1 
ATOM   423  O OG  . SER A 1 57  ? 13.686  -21.628 -7.328  1.00 40.71 ? 95  SER A OG  1 
ATOM   424  N N   . LYS A 1 58  ? 14.978  -17.095 -6.749  1.00 37.28 ? 96  LYS A N   1 
ATOM   425  C CA  . LYS A 1 58  ? 15.524  -15.838 -7.222  1.00 37.37 ? 96  LYS A CA  1 
ATOM   426  C C   . LYS A 1 58  ? 16.281  -15.234 -6.050  1.00 37.14 ? 96  LYS A C   1 
ATOM   427  O O   . LYS A 1 58  ? 15.915  -15.462 -4.896  1.00 37.64 ? 96  LYS A O   1 
ATOM   428  C CB  . LYS A 1 58  ? 14.380  -14.948 -7.720  1.00 37.59 ? 96  LYS A CB  1 
ATOM   429  C CG  . LYS A 1 58  ? 13.711  -15.538 -8.968  1.00 38.13 ? 96  LYS A CG  1 
ATOM   430  C CD  . LYS A 1 58  ? 12.757  -14.592 -9.639  1.00 43.24 ? 96  LYS A CD  1 
ATOM   431  C CE  . LYS A 1 58  ? 12.066  -15.233 -10.843 1.00 44.54 ? 96  LYS A CE  1 
ATOM   432  N NZ  . LYS A 1 58  ? 10.810  -14.476 -11.222 1.00 46.74 ? 96  LYS A NZ  1 
ATOM   433  N N   . HIS A 1 59  ? 17.362  -14.519 -6.320  1.00 36.55 ? 97  HIS A N   1 
ATOM   434  C CA  . HIS A 1 59  ? 18.119  -13.895 -5.236  1.00 36.16 ? 97  HIS A CA  1 
ATOM   435  C C   . HIS A 1 59  ? 17.280  -12.815 -4.534  1.00 35.79 ? 97  HIS A C   1 
ATOM   436  O O   . HIS A 1 59  ? 16.786  -11.908 -5.186  1.00 35.76 ? 97  HIS A O   1 
ATOM   437  C CB  . HIS A 1 59  ? 19.418  -13.302 -5.762  1.00 36.25 ? 97  HIS A CB  1 
ATOM   438  C CG  . HIS A 1 59  ? 20.387  -12.968 -4.679  1.00 35.50 ? 97  HIS A CG  1 
ATOM   439  N ND1 . HIS A 1 59  ? 20.210  -11.898 -3.828  1.00 33.56 ? 97  HIS A ND1 1 
ATOM   440  C CD2 . HIS A 1 59  ? 21.528  -13.578 -4.288  1.00 35.24 ? 97  HIS A CD2 1 
ATOM   441  C CE1 . HIS A 1 59  ? 21.191  -11.869 -2.953  1.00 34.47 ? 97  HIS A CE1 1 
ATOM   442  N NE2 . HIS A 1 59  ? 22.014  -12.866 -3.222  1.00 36.81 ? 97  HIS A NE2 1 
ATOM   443  N N   . PRO A 1 60  ? 17.114  -12.901 -3.207  1.00 35.49 ? 98  PRO A N   1 
ATOM   444  C CA  . PRO A 1 60  ? 16.144  -11.993 -2.595  1.00 36.06 ? 98  PRO A CA  1 
ATOM   445  C C   . PRO A 1 60  ? 16.623  -10.551 -2.522  1.00 37.27 ? 98  PRO A C   1 
ATOM   446  O O   . PRO A 1 60  ? 15.931  -9.709  -1.964  1.00 36.98 ? 98  PRO A O   1 
ATOM   447  C CB  . PRO A 1 60  ? 15.986  -12.552 -1.188  1.00 35.81 ? 98  PRO A CB  1 
ATOM   448  C CG  . PRO A 1 60  ? 17.326  -13.164 -0.902  1.00 35.63 ? 98  PRO A CG  1 
ATOM   449  C CD  . PRO A 1 60  ? 17.761  -13.768 -2.210  1.00 35.65 ? 98  PRO A CD  1 
ATOM   450  N N   . CYS A 1 61  ? 17.812  -10.275 -3.050  1.00 38.48 ? 99  CYS A N   1 
ATOM   451  C CA  . CYS A 1 61  ? 18.233  -8.896  -3.256  1.00 40.19 ? 99  CYS A CA  1 
ATOM   452  C C   . CYS A 1 61  ? 18.228  -8.494  -4.744  1.00 40.70 ? 99  CYS A C   1 
ATOM   453  O O   . CYS A 1 61  ? 18.733  -7.425  -5.099  1.00 41.45 ? 99  CYS A O   1 
ATOM   454  C CB  . CYS A 1 61  ? 19.608  -8.626  -2.591  1.00 40.88 ? 99  CYS A CB  1 
ATOM   455  S SG  . CYS A 1 61  ? 19.525  -8.499  -0.768  1.00 42.29 ? 99  CYS A SG  1 
ATOM   456  N N   . ASP A 1 62  ? 17.669  -9.339  -5.606  1.00 40.67 ? 100 ASP A N   1 
ATOM   457  C CA  . ASP A 1 62  ? 17.619  -9.034  -7.034  1.00 41.65 ? 100 ASP A CA  1 
ATOM   458  C C   . ASP A 1 62  ? 16.218  -9.157  -7.611  1.00 41.40 ? 100 ASP A C   1 
ATOM   459  O O   . ASP A 1 62  ? 16.054  -9.646  -8.721  1.00 41.44 ? 100 ASP A O   1 
ATOM   460  C CB  . ASP A 1 62  ? 18.577  -9.936  -7.834  1.00 42.58 ? 100 ASP A CB  1 
ATOM   461  C CG  . ASP A 1 62  ? 18.892  -9.375  -9.241  1.00 45.02 ? 100 ASP A CG  1 
ATOM   462  O OD1 . ASP A 1 62  ? 19.530  -10.088 -10.054 1.00 49.17 ? 100 ASP A OD1 1 
ATOM   463  O OD2 . ASP A 1 62  ? 18.499  -8.221  -9.534  1.00 49.25 ? 100 ASP A OD2 1 
ATOM   464  N N   . ILE A 1 63  ? 15.219  -8.713  -6.856  1.00 41.07 ? 101 ILE A N   1 
ATOM   465  C CA  . ILE A 1 63  ? 13.823  -8.811  -7.279  1.00 40.98 ? 101 ILE A CA  1 
ATOM   466  C C   . ILE A 1 63  ? 13.471  -7.584  -8.128  1.00 41.75 ? 101 ILE A C   1 
ATOM   467  O O   . ILE A 1 63  ? 13.861  -6.464  -7.772  1.00 41.70 ? 101 ILE A O   1 
ATOM   468  C CB  . ILE A 1 63  ? 12.889  -8.915  -6.039  1.00 40.52 ? 101 ILE A CB  1 
ATOM   469  C CG1 . ILE A 1 63  ? 13.318  -10.074 -5.121  1.00 39.18 ? 101 ILE A CG1 1 
ATOM   470  C CG2 . ILE A 1 63  ? 11.412  -9.043  -6.450  1.00 40.48 ? 101 ILE A CG2 1 
ATOM   471  C CD1 . ILE A 1 63  ? 13.378  -11.436 -5.813  1.00 38.91 ? 101 ILE A CD1 1 
ATOM   472  N N   . THR A 1 64  ? 12.738  -7.783  -9.233  1.00 42.32 ? 102 THR A N   1 
ATOM   473  C CA  . THR A 1 64  ? 12.287  -6.653  -10.079 1.00 43.42 ? 102 THR A CA  1 
ATOM   474  C C   . THR A 1 64  ? 10.767  -6.613  -10.221 1.00 44.18 ? 102 THR A C   1 
ATOM   475  O O   . THR A 1 64  ? 10.086  -7.597  -9.941  1.00 44.32 ? 102 THR A O   1 
ATOM   476  C CB  . THR A 1 64  ? 12.888  -6.692  -11.490 1.00 43.51 ? 102 THR A CB  1 
ATOM   477  O OG1 . THR A 1 64  ? 12.209  -7.693  -12.263 1.00 44.46 ? 102 THR A OG1 1 
ATOM   478  C CG2 . THR A 1 64  ? 14.401  -7.008  -11.463 1.00 42.87 ? 102 THR A CG2 1 
ATOM   479  N N   . GLU A 1 65  ? 10.235  -5.484  -10.681 1.00 45.11 ? 103 GLU A N   1 
ATOM   480  C CA  . GLU A 1 65  ? 8.782   -5.349  -10.858 1.00 46.11 ? 103 GLU A CA  1 
ATOM   481  C C   . GLU A 1 65  ? 8.288   -6.359  -11.870 1.00 45.37 ? 103 GLU A C   1 
ATOM   482  O O   . GLU A 1 65  ? 7.168   -6.842  -11.747 1.00 45.19 ? 103 GLU A O   1 
ATOM   483  C CB  . GLU A 1 65  ? 8.375   -3.936  -11.269 1.00 46.26 ? 103 GLU A CB  1 
ATOM   484  C CG  . GLU A 1 65  ? 8.992   -2.883  -10.393 1.00 51.37 ? 103 GLU A CG  1 
ATOM   485  C CD  . GLU A 1 65  ? 8.085   -1.693  -10.131 1.00 58.18 ? 103 GLU A CD  1 
ATOM   486  O OE1 . GLU A 1 65  ? 7.054   -1.551  -10.839 1.00 60.06 ? 103 GLU A OE1 1 
ATOM   487  O OE2 . GLU A 1 65  ? 8.406   -0.894  -9.212  1.00 60.18 ? 103 GLU A OE2 1 
ATOM   488  N N   . GLU A 1 66  ? 9.131   -6.689  -12.849 1.00 44.68 ? 104 GLU A N   1 
ATOM   489  C CA  . GLU A 1 66  ? 8.790   -7.685  -13.852 1.00 44.58 ? 104 GLU A CA  1 
ATOM   490  C C   . GLU A 1 66  ? 8.457   -9.002  -13.171 1.00 43.34 ? 104 GLU A C   1 
ATOM   491  O O   . GLU A 1 66  ? 7.592   -9.750  -13.649 1.00 43.76 ? 104 GLU A O   1 
ATOM   492  C CB  . GLU A 1 66  ? 9.945   -7.931  -14.837 1.00 45.42 ? 104 GLU A CB  1 
ATOM   493  C CG  . GLU A 1 66  ? 10.193  -6.830  -15.878 1.00 50.47 ? 104 GLU A CG  1 
ATOM   494  C CD  . GLU A 1 66  ? 11.246  -5.784  -15.447 1.00 56.23 ? 104 GLU A CD  1 
ATOM   495  O OE1 . GLU A 1 66  ? 10.877  -4.837  -14.697 1.00 57.45 ? 104 GLU A OE1 1 
ATOM   496  O OE2 . GLU A 1 66  ? 12.433  -5.908  -15.881 1.00 57.77 ? 104 GLU A OE2 1 
ATOM   497  N N   . ASP A 1 67  ? 9.149   -9.285  -12.065 1.00 41.45 ? 105 ASP A N   1 
ATOM   498  C CA  . ASP A 1 67  ? 9.023   -10.557 -11.375 1.00 40.67 ? 105 ASP A CA  1 
ATOM   499  C C   . ASP A 1 67  ? 7.589   -10.732 -10.957 1.00 40.05 ? 105 ASP A C   1 
ATOM   500  O O   . ASP A 1 67  ? 7.097   -11.839 -10.896 1.00 40.22 ? 105 ASP A O   1 
ATOM   501  C CB  . ASP A 1 67  ? 9.931   -10.617 -10.152 1.00 39.80 ? 105 ASP A CB  1 
ATOM   502  C CG  . ASP A 1 67  ? 11.375  -10.941 -10.519 1.00 41.73 ? 105 ASP A CG  1 
ATOM   503  O OD1 . ASP A 1 67  ? 11.586  -11.797 -11.406 1.00 41.43 ? 105 ASP A OD1 1 
ATOM   504  O OD2 . ASP A 1 67  ? 12.295  -10.348 -9.917  1.00 41.54 ? 105 ASP A OD2 1 
ATOM   505  N N   . TYR A 1 68  ? 6.915   -9.618  -10.716 1.00 39.73 ? 106 TYR A N   1 
ATOM   506  C CA  . TYR A 1 68  ? 5.572   -9.651  -10.165 1.00 39.04 ? 106 TYR A CA  1 
ATOM   507  C C   . TYR A 1 68  ? 4.487   -9.410  -11.191 1.00 39.76 ? 106 TYR A C   1 
ATOM   508  O O   . TYR A 1 68  ? 3.328   -9.337  -10.809 1.00 39.99 ? 106 TYR A O   1 
ATOM   509  C CB  . TYR A 1 68  ? 5.433   -8.607  -9.054  1.00 38.73 ? 106 TYR A CB  1 
ATOM   510  C CG  . TYR A 1 68  ? 6.017   -9.012  -7.713  1.00 37.26 ? 106 TYR A CG  1 
ATOM   511  C CD1 . TYR A 1 68  ? 7.163   -8.383  -7.203  1.00 34.90 ? 106 TYR A CD1 1 
ATOM   512  C CD2 . TYR A 1 68  ? 5.400   -9.995  -6.941  1.00 34.26 ? 106 TYR A CD2 1 
ATOM   513  C CE1 . TYR A 1 68  ? 7.705   -8.761  -5.977  1.00 36.98 ? 106 TYR A CE1 1 
ATOM   514  C CE2 . TYR A 1 68  ? 5.924   -10.381 -5.726  1.00 37.26 ? 106 TYR A CE2 1 
ATOM   515  C CZ  . TYR A 1 68  ? 7.077   -9.762  -5.241  1.00 38.24 ? 106 TYR A CZ  1 
ATOM   516  O OH  . TYR A 1 68  ? 7.556   -10.152 -4.015  1.00 37.65 ? 106 TYR A OH  1 
ATOM   517  N N   . GLN A 1 69  ? 4.850   -9.248  -12.469 1.00 41.01 ? 107 GLN A N   1 
ATOM   518  C CA  . GLN A 1 69  ? 3.869   -8.934  -13.530 1.00 42.39 ? 107 GLN A CA  1 
ATOM   519  C C   . GLN A 1 69  ? 2.814   -10.015 -13.793 1.00 42.15 ? 107 GLN A C   1 
ATOM   520  O O   . GLN A 1 69  ? 1.643   -9.673  -13.978 1.00 42.61 ? 107 GLN A O   1 
ATOM   521  C CB  . GLN A 1 69  ? 4.530   -8.493  -14.837 1.00 43.21 ? 107 GLN A CB  1 
ATOM   522  C CG  . GLN A 1 69  ? 5.150   -7.099  -14.786 1.00 47.70 ? 107 GLN A CG  1 
ATOM   523  C CD  . GLN A 1 69  ? 4.262   -6.087  -14.067 1.00 55.66 ? 107 GLN A CD  1 
ATOM   524  O OE1 . GLN A 1 69  ? 3.191   -5.697  -14.583 1.00 59.23 ? 107 GLN A OE1 1 
ATOM   525  N NE2 . GLN A 1 69  ? 4.690   -5.664  -12.853 1.00 55.87 ? 107 GLN A NE2 1 
ATOM   526  N N   . PRO A 1 70  ? 3.215   -11.303 -13.808 1.00 41.12 ? 108 PRO A N   1 
ATOM   527  C CA  . PRO A 1 70  ? 2.252   -12.397 -13.841 1.00 40.70 ? 108 PRO A CA  1 
ATOM   528  C C   . PRO A 1 70  ? 1.235   -12.324 -12.692 1.00 40.71 ? 108 PRO A C   1 
ATOM   529  O O   . PRO A 1 70  ? 0.053   -12.540 -12.919 1.00 40.43 ? 108 PRO A O   1 
ATOM   530  C CB  . PRO A 1 70  ? 3.141   -13.641 -13.718 1.00 40.40 ? 108 PRO A CB  1 
ATOM   531  C CG  . PRO A 1 70  ? 4.426   -13.212 -14.351 1.00 39.72 ? 108 PRO A CG  1 
ATOM   532  C CD  . PRO A 1 70  ? 4.597   -11.814 -13.839 1.00 41.70 ? 108 PRO A CD  1 
ATOM   533  N N   . LEU A 1 71  ? 1.681   -11.995 -11.481 1.00 40.37 ? 109 LEU A N   1 
ATOM   534  C CA  . LEU A 1 71  ? 0.746   -11.805 -10.370 1.00 40.41 ? 109 LEU A CA  1 
ATOM   535  C C   . LEU A 1 71  ? -0.159  -10.606 -10.589 1.00 40.46 ? 109 LEU A C   1 
ATOM   536  O O   . LEU A 1 71  ? -1.363  -10.684 -10.349 1.00 41.58 ? 109 LEU A O   1 
ATOM   537  C CB  . LEU A 1 71  ? 1.479   -11.665 -9.052  1.00 39.87 ? 109 LEU A CB  1 
ATOM   538  C CG  . LEU A 1 71  ? 0.649   -11.490 -7.773  1.00 39.64 ? 109 LEU A CG  1 
ATOM   539  C CD1 . LEU A 1 71  ? -0.330  -12.636 -7.533  1.00 39.30 ? 109 LEU A CD1 1 
ATOM   540  C CD2 . LEU A 1 71  ? 1.616   -11.341 -6.595  1.00 38.83 ? 109 LEU A CD2 1 
ATOM   541  N N   . MET A 1 72  ? 0.414   -9.508  -11.051 1.00 40.71 ? 110 MET A N   1 
ATOM   542  C CA  . MET A 1 72  ? -0.342  -8.301  -11.324 1.00 41.69 ? 110 MET A CA  1 
ATOM   543  C C   . MET A 1 72  ? -1.436  -8.558  -12.343 1.00 42.03 ? 110 MET A C   1 
ATOM   544  O O   . MET A 1 72  ? -2.515  -7.990  -12.243 1.00 41.14 ? 110 MET A O   1 
ATOM   545  C CB  . MET A 1 72  ? 0.567   -7.227  -11.904 1.00 42.30 ? 110 MET A CB  1 
ATOM   546  C CG  . MET A 1 72  ? 1.703   -6.752  -11.031 1.00 45.14 ? 110 MET A CG  1 
ATOM   547  S SD  . MET A 1 72  ? 0.959   -5.889  -9.680  1.00 50.41 ? 110 MET A SD  1 
ATOM   548  C CE  . MET A 1 72  ? 1.107   -7.128  -8.393  1.00 49.63 ? 110 MET A CE  1 
ATOM   549  N N   . LYS A 1 73  ? -1.154  -9.411  -13.329 1.00 42.66 ? 111 LYS A N   1 
ATOM   550  C CA  . LYS A 1 73  ? -2.137  -9.713  -14.365 1.00 43.53 ? 111 LYS A CA  1 
ATOM   551  C C   . LYS A 1 73  ? -3.314  -10.424 -13.749 1.00 43.83 ? 111 LYS A C   1 
ATOM   552  O O   . LYS A 1 73  ? -4.464  -10.012 -13.929 1.00 43.95 ? 111 LYS A O   1 
ATOM   553  C CB  . LYS A 1 73  ? -1.531  -10.575 -15.469 1.00 44.44 ? 111 LYS A CB  1 
ATOM   554  C CG  . LYS A 1 73  ? -0.692  -9.778  -16.458 1.00 47.20 ? 111 LYS A CG  1 
ATOM   555  C CD  . LYS A 1 73  ? 0.000   -10.703 -17.445 1.00 51.79 ? 111 LYS A CD  1 
ATOM   556  C CE  . LYS A 1 73  ? 1.450   -10.269 -17.695 1.00 53.86 ? 111 LYS A CE  1 
ATOM   557  N NZ  . LYS A 1 73  ? 2.302   -11.467 -18.034 1.00 53.19 ? 111 LYS A NZ  1 
ATOM   558  N N   . LEU A 1 74  ? -3.024  -11.482 -12.999 1.00 44.18 ? 112 LEU A N   1 
ATOM   559  C CA  . LEU A 1 74  ? -4.070  -12.279 -12.377 1.00 44.86 ? 112 LEU A CA  1 
ATOM   560  C C   . LEU A 1 74  ? -4.869  -11.483 -11.347 1.00 45.41 ? 112 LEU A C   1 
ATOM   561  O O   . LEU A 1 74  ? -6.035  -11.785 -11.096 1.00 45.59 ? 112 LEU A O   1 
ATOM   562  C CB  . LEU A 1 74  ? -3.493  -13.563 -11.768 1.00 44.69 ? 112 LEU A CB  1 
ATOM   563  C CG  . LEU A 1 74  ? -2.803  -14.548 -12.726 1.00 44.84 ? 112 LEU A CG  1 
ATOM   564  C CD1 . LEU A 1 74  ? -2.261  -15.754 -11.985 1.00 43.66 ? 112 LEU A CD1 1 
ATOM   565  C CD2 . LEU A 1 74  ? -3.728  -14.972 -13.886 1.00 44.52 ? 112 LEU A CD2 1 
ATOM   566  N N   . GLY A 1 75  ? -4.240  -10.459 -10.776 1.00 46.00 ? 113 GLY A N   1 
ATOM   567  C CA  . GLY A 1 75  ? -4.881  -9.613  -9.765  1.00 46.88 ? 113 GLY A CA  1 
ATOM   568  C C   . GLY A 1 75  ? -5.480  -8.323  -10.291 1.00 47.47 ? 113 GLY A C   1 
ATOM   569  O O   . GLY A 1 75  ? -5.836  -7.439  -9.513  1.00 47.21 ? 113 GLY A O   1 
ATOM   570  N N   . THR A 1 76  ? -5.567  -8.209  -11.613 1.00 48.71 ? 114 THR A N   1 
ATOM   571  C CA  . THR A 1 76  ? -6.241  -7.096  -12.289 1.00 50.39 ? 114 THR A CA  1 
ATOM   572  C C   . THR A 1 76  ? -7.610  -6.860  -11.644 1.00 50.11 ? 114 THR A C   1 
ATOM   573  O O   . THR A 1 76  ? -8.428  -7.769  -11.577 1.00 50.09 ? 114 THR A O   1 
ATOM   574  C CB  . THR A 1 76  ? -6.409  -7.409  -13.815 1.00 51.06 ? 114 THR A CB  1 
ATOM   575  O OG1 . THR A 1 76  ? -5.138  -7.285  -14.474 1.00 53.02 ? 114 THR A OG1 1 
ATOM   576  C CG2 . THR A 1 76  ? -7.429  -6.480  -14.495 1.00 52.22 ? 114 THR A CG2 1 
ATOM   577  N N   . GLN A 1 77  ? -7.836  -5.639  -11.162 1.00 50.28 ? 115 GLN A N   1 
ATOM   578  C CA  . GLN A 1 77  ? -9.048  -5.288  -10.421 1.00 50.05 ? 115 GLN A CA  1 
ATOM   579  C C   . GLN A 1 77  ? -9.435  -3.824  -10.655 1.00 50.27 ? 115 GLN A C   1 
ATOM   580  O O   . GLN A 1 77  ? -8.616  -2.922  -10.454 1.00 50.04 ? 115 GLN A O   1 
ATOM   581  C CB  . GLN A 1 77  ? -8.806  -5.498  -8.919  1.00 49.59 ? 115 GLN A CB  1 
ATOM   582  C CG  . GLN A 1 77  ? -10.074 -5.564  -8.132  1.00 49.49 ? 115 GLN A CG  1 
ATOM   583  C CD  . GLN A 1 77  ? -9.852  -5.813  -6.672  1.00 49.81 ? 115 GLN A CD  1 
ATOM   584  O OE1 . GLN A 1 77  ? -10.752 -5.599  -5.849  1.00 51.02 ? 115 GLN A OE1 1 
ATOM   585  N NE2 . GLN A 1 77  ? -8.667  -6.268  -6.330  1.00 43.65 ? 115 GLN A NE2 1 
ATOM   586  N N   . THR A 1 78  ? -10.679 -3.598  -11.065 1.00 50.72 ? 116 THR A N   1 
ATOM   587  C CA  . THR A 1 78  ? -11.226 -2.239  -11.195 1.00 51.51 ? 116 THR A CA  1 
ATOM   588  C C   . THR A 1 78  ? -11.716 -1.745  -9.844  1.00 51.12 ? 116 THR A C   1 
ATOM   589  O O   . THR A 1 78  ? -12.585 -2.377  -9.226  1.00 52.16 ? 116 THR A O   1 
ATOM   590  C CB  . THR A 1 78  ? -12.423 -2.146  -12.162 1.00 51.23 ? 116 THR A CB  1 
ATOM   591  O OG1 . THR A 1 78  ? -12.292 -3.114  -13.206 1.00 52.33 ? 116 THR A OG1 1 
ATOM   592  C CG2 . THR A 1 78  ? -12.462 -0.769  -12.783 1.00 52.50 ? 116 THR A CG2 1 
ATOM   593  N N   . VAL A 1 79  ? -11.161 -0.615  -9.410  1.00 50.13 ? 117 VAL A N   1 
ATOM   594  C CA  . VAL A 1 79  ? -11.543 0.049   -8.156  1.00 48.57 ? 117 VAL A CA  1 
ATOM   595  C C   . VAL A 1 79  ? -12.118 1.444   -8.467  1.00 46.40 ? 117 VAL A C   1 
ATOM   596  O O   . VAL A 1 79  ? -11.616 2.135   -9.363  1.00 45.12 ? 117 VAL A O   1 
ATOM   597  C CB  . VAL A 1 79  ? -10.351 0.154   -7.161  1.00 49.41 ? 117 VAL A CB  1 
ATOM   598  C CG1 . VAL A 1 79  ? -9.575  -1.167  -7.112  1.00 49.70 ? 117 VAL A CG1 1 
ATOM   599  C CG2 . VAL A 1 79  ? -9.387  1.312   -7.525  1.00 51.45 ? 117 VAL A CG2 1 
ATOM   600  N N   . PRO A 1 80  ? -13.180 1.845   -7.749  1.00 44.08 ? 118 PRO A N   1 
ATOM   601  C CA  . PRO A 1 80  ? -13.777 3.167   -7.972  1.00 42.63 ? 118 PRO A CA  1 
ATOM   602  C C   . PRO A 1 80  ? -12.712 4.254   -7.832  1.00 40.78 ? 118 PRO A C   1 
ATOM   603  O O   . PRO A 1 80  ? -12.250 4.504   -6.737  1.00 40.27 ? 118 PRO A O   1 
ATOM   604  C CB  . PRO A 1 80  ? -14.831 3.251   -6.866  1.00 42.15 ? 118 PRO A CB  1 
ATOM   605  C CG  . PRO A 1 80  ? -15.241 1.830   -6.651  1.00 43.29 ? 118 PRO A CG  1 
ATOM   606  C CD  . PRO A 1 80  ? -13.908 1.093   -6.714  1.00 44.17 ? 118 PRO A CD  1 
ATOM   607  N N   . CYS A 1 81  ? -12.324 4.872   -8.943  1.00 39.21 ? 119 CYS A N   1 
ATOM   608  C CA  . CYS A 1 81  ? -11.103 5.700   -9.007  1.00 39.45 ? 119 CYS A CA  1 
ATOM   609  C C   . CYS A 1 81  ? -11.224 6.987   -8.204  1.00 37.61 ? 119 CYS A C   1 
ATOM   610  O O   . CYS A 1 81  ? -10.217 7.517   -7.745  1.00 36.83 ? 119 CYS A O   1 
ATOM   611  C CB  . CYS A 1 81  ? -10.772 6.080   -10.456 1.00 40.10 ? 119 CYS A CB  1 
ATOM   612  S SG  . CYS A 1 81  ? -12.023 7.108   -11.306 1.00 47.65 ? 119 CYS A SG  1 
ATOM   613  N N   . ASN A 1 82  ? -12.457 7.465   -8.015  1.00 35.69 ? 120 ASN A N   1 
ATOM   614  C CA  . ASN A 1 82  ? -12.706 8.654   -7.202  1.00 35.33 ? 120 ASN A CA  1 
ATOM   615  C C   . ASN A 1 82  ? -12.848 8.363   -5.690  1.00 35.11 ? 120 ASN A C   1 
ATOM   616  O O   . ASN A 1 82  ? -13.154 9.265   -4.937  1.00 34.62 ? 120 ASN A O   1 
ATOM   617  C CB  . ASN A 1 82  ? -13.946 9.401   -7.703  1.00 34.32 ? 120 ASN A CB  1 
ATOM   618  C CG  . ASN A 1 82  ? -15.217 8.572   -7.613  1.00 35.01 ? 120 ASN A CG  1 
ATOM   619  O OD1 . ASN A 1 82  ? -15.235 7.380   -7.913  1.00 35.40 ? 120 ASN A OD1 1 
ATOM   620  N ND2 . ASN A 1 82  ? -16.300 9.224   -7.252  1.00 34.52 ? 120 ASN A ND2 1 
ATOM   621  N N   . LYS A 1 83  ? -12.637 7.118   -5.267  1.00 34.56 ? 121 LYS A N   1 
ATOM   622  C CA  . LYS A 1 83  ? -12.885 6.719   -3.879  1.00 35.68 ? 121 LYS A CA  1 
ATOM   623  C C   . LYS A 1 83  ? -11.642 6.139   -3.195  1.00 36.97 ? 121 LYS A C   1 
ATOM   624  O O   . LYS A 1 83  ? -11.733 5.367   -2.224  1.00 36.73 ? 121 LYS A O   1 
ATOM   625  C CB  . LYS A 1 83  ? -14.058 5.749   -3.825  1.00 36.22 ? 121 LYS A CB  1 
ATOM   626  C CG  . LYS A 1 83  ? -15.408 6.446   -4.181  1.00 36.07 ? 121 LYS A CG  1 
ATOM   627  C CD  . LYS A 1 83  ? -16.591 5.558   -4.050  1.00 35.96 ? 121 LYS A CD  1 
ATOM   628  C CE  . LYS A 1 83  ? -17.833 6.226   -4.646  1.00 37.55 ? 121 LYS A CE  1 
ATOM   629  N NZ  . LYS A 1 83  ? -18.251 7.553   -4.021  1.00 35.34 ? 121 LYS A NZ  1 
ATOM   630  N N   . ILE A 1 84  ? -10.480 6.537   -3.703  1.00 37.79 ? 122 ILE A N   1 
ATOM   631  C CA  . ILE A 1 84  ? -9.238  6.002   -3.226  1.00 40.33 ? 122 ILE A CA  1 
ATOM   632  C C   . ILE A 1 84  ? -8.708  6.716   -1.970  1.00 40.27 ? 122 ILE A C   1 
ATOM   633  O O   . ILE A 1 84  ? -8.658  7.955   -1.915  1.00 41.28 ? 122 ILE A O   1 
ATOM   634  C CB  . ILE A 1 84  ? -8.222  5.890   -4.378  1.00 40.78 ? 122 ILE A CB  1 
ATOM   635  C CG1 . ILE A 1 84  ? -8.634  4.653   -5.232  1.00 41.77 ? 122 ILE A CG1 1 
ATOM   636  C CG2 . ILE A 1 84  ? -6.726  5.839   -3.820  1.00 40.04 ? 122 ILE A CG2 1 
ATOM   637  C CD1 . ILE A 1 84  ? -7.945  4.527   -6.610  1.00 42.57 ? 122 ILE A CD1 1 
ATOM   638  N N   . LEU A 1 85  ? -8.380  5.904   -0.959  1.00 39.35 ? 123 LEU A N   1 
ATOM   639  C CA  . LEU A 1 85  ? -7.724  6.360   0.261   1.00 37.74 ? 123 LEU A CA  1 
ATOM   640  C C   . LEU A 1 85  ? -6.320  5.773   0.362   1.00 38.89 ? 123 LEU A C   1 
ATOM   641  O O   . LEU A 1 85  ? -6.129  4.537   0.541   1.00 37.65 ? 123 LEU A O   1 
ATOM   642  C CB  . LEU A 1 85  ? -8.547  5.968   1.495   1.00 37.29 ? 123 LEU A CB  1 
ATOM   643  C CG  . LEU A 1 85  ? -7.911  6.396   2.854   1.00 35.93 ? 123 LEU A CG  1 
ATOM   644  C CD1 . LEU A 1 85  ? -7.737  7.932   2.940   1.00 37.70 ? 123 LEU A CD1 1 
ATOM   645  C CD2 . LEU A 1 85  ? -8.691  5.897   4.032   1.00 37.14 ? 123 LEU A CD2 1 
ATOM   646  N N   . LEU A 1 86  ? -5.343  6.663   0.237   1.00 39.28 ? 124 LEU A N   1 
ATOM   647  C CA  . LEU A 1 86  ? -3.941  6.340   0.511   1.00 39.25 ? 124 LEU A CA  1 
ATOM   648  C C   . LEU A 1 86  ? -3.656  6.581   2.001   1.00 39.61 ? 124 LEU A C   1 
ATOM   649  O O   . LEU A 1 86  ? -4.448  7.220   2.696   1.00 39.56 ? 124 LEU A O   1 
ATOM   650  C CB  . LEU A 1 86  ? -3.048  7.218   -0.350  1.00 38.02 ? 124 LEU A CB  1 
ATOM   651  C CG  . LEU A 1 86  ? -3.352  7.262   -1.846  1.00 40.03 ? 124 LEU A CG  1 
ATOM   652  C CD1 . LEU A 1 86  ? -2.407  8.207   -2.528  1.00 38.18 ? 124 LEU A CD1 1 
ATOM   653  C CD2 . LEU A 1 86  ? -3.195  5.830   -2.401  1.00 40.28 ? 124 LEU A CD2 1 
ATOM   654  N N   . TRP A 1 87  ? -2.539  6.069   2.498   1.00 39.75 ? 125 TRP A N   1 
ATOM   655  C CA  . TRP A 1 87  ? -2.126  6.381   3.873   1.00 40.94 ? 125 TRP A CA  1 
ATOM   656  C C   . TRP A 1 87  ? -0.637  6.216   4.039   1.00 41.67 ? 125 TRP A C   1 
ATOM   657  O O   . TRP A 1 87  ? -0.007  5.608   3.219   1.00 41.17 ? 125 TRP A O   1 
ATOM   658  C CB  . TRP A 1 87  ? -2.879  5.534   4.911   1.00 41.37 ? 125 TRP A CB  1 
ATOM   659  C CG  . TRP A 1 87  ? -2.733  4.049   4.684   1.00 42.38 ? 125 TRP A CG  1 
ATOM   660  C CD1 . TRP A 1 87  ? -3.579  3.240   3.994   1.00 43.68 ? 125 TRP A CD1 1 
ATOM   661  C CD2 . TRP A 1 87  ? -1.674  3.213   5.157   1.00 43.80 ? 125 TRP A CD2 1 
ATOM   662  N NE1 . TRP A 1 87  ? -3.122  1.942   4.013   1.00 44.78 ? 125 TRP A NE1 1 
ATOM   663  C CE2 . TRP A 1 87  ? -1.952  1.898   4.720   1.00 44.03 ? 125 TRP A CE2 1 
ATOM   664  C CE3 . TRP A 1 87  ? -0.522  3.443   5.933   1.00 44.49 ? 125 TRP A CE3 1 
ATOM   665  C CZ2 . TRP A 1 87  ? -1.118  0.806   5.026   1.00 43.85 ? 125 TRP A CZ2 1 
ATOM   666  C CZ3 . TRP A 1 87  ? 0.310   2.348   6.248   1.00 44.74 ? 125 TRP A CZ3 1 
ATOM   667  C CH2 . TRP A 1 87  ? 0.013   1.054   5.767   1.00 44.36 ? 125 TRP A CH2 1 
ATOM   668  N N   . SER A 1 88  ? -0.098  6.753   5.128   1.00 42.97 ? 126 SER A N   1 
ATOM   669  C CA  . SER A 1 88  ? 1.301   6.621   5.434   1.00 45.44 ? 126 SER A CA  1 
ATOM   670  C C   . SER A 1 88  ? 1.414   6.458   6.950   1.00 45.77 ? 126 SER A C   1 
ATOM   671  O O   . SER A 1 88  ? 0.901   7.294   7.710   1.00 43.58 ? 126 SER A O   1 
ATOM   672  C CB  . SER A 1 88  ? 2.041   7.868   4.970   1.00 46.51 ? 126 SER A CB  1 
ATOM   673  O OG  . SER A 1 88  ? 3.448   7.640   4.855   1.00 51.93 ? 126 SER A OG  1 
ATOM   674  N N   . ARG A 1 89  ? 2.024   5.350   7.375   1.00 47.68 ? 127 ARG A N   1 
ATOM   675  C CA  . ARG A 1 89  ? 2.248   5.053   8.801   1.00 50.55 ? 127 ARG A CA  1 
ATOM   676  C C   . ARG A 1 89  ? 0.984   4.800   9.637   1.00 51.38 ? 127 ARG A C   1 
ATOM   677  O O   . ARG A 1 89  ? 1.016   3.996   10.554  1.00 53.53 ? 127 ARG A O   1 
ATOM   678  C CB  . ARG A 1 89  ? 3.134   6.133   9.470   1.00 50.80 ? 127 ARG A CB  1 
ATOM   679  C CG  . ARG A 1 89  ? 4.628   5.986   9.177   1.00 53.44 ? 127 ARG A CG  1 
ATOM   680  C CD  . ARG A 1 89  ? 5.023   6.525   7.789   1.00 58.19 ? 127 ARG A CD  1 
ATOM   681  N NE  . ARG A 1 89  ? 6.006   5.674   7.098   1.00 62.72 ? 127 ARG A NE  1 
ATOM   682  C CZ  . ARG A 1 89  ? 7.278   6.003   6.837   1.00 64.94 ? 127 ARG A CZ  1 
ATOM   683  N NH1 . ARG A 1 89  ? 7.771   7.186   7.204   1.00 64.42 ? 127 ARG A NH1 1 
ATOM   684  N NH2 . ARG A 1 89  ? 8.066   5.133   6.195   1.00 66.12 ? 127 ARG A NH2 1 
ATOM   685  N N   . ILE A 1 90  ? -0.120  5.455   9.318   1.00 52.30 ? 128 ILE A N   1 
ATOM   686  C CA  . ILE A 1 90  ? -1.312  5.442   10.169  1.00 53.21 ? 128 ILE A CA  1 
ATOM   687  C C   . ILE A 1 90  ? -2.366  4.390   9.689   1.00 53.25 ? 128 ILE A C   1 
ATOM   688  O O   . ILE A 1 90  ? -3.559  4.699   9.435   1.00 53.65 ? 128 ILE A O   1 
ATOM   689  C CB  . ILE A 1 90  ? -1.855  6.923   10.335  1.00 53.31 ? 128 ILE A CB  1 
ATOM   690  C CG1 . ILE A 1 90  ? -2.972  7.014   11.365  1.00 53.88 ? 128 ILE A CG1 1 
ATOM   691  C CG2 . ILE A 1 90  ? -2.257  7.524   9.025   1.00 54.04 ? 128 ILE A CG2 1 
ATOM   692  C CD1 . ILE A 1 90  ? -2.443  7.086   12.785  1.00 56.55 ? 128 ILE A CD1 1 
ATOM   693  N N   . LYS A 1 91  ? -1.885  3.146   9.593   1.00 52.22 ? 129 LYS A N   1 
ATOM   694  C CA  . LYS A 1 91  ? -2.606  1.978   9.064   1.00 51.69 ? 129 LYS A CA  1 
ATOM   695  C C   . LYS A 1 91  ? -4.002  1.702   9.647   1.00 50.42 ? 129 LYS A C   1 
ATOM   696  O O   . LYS A 1 91  ? -4.988  1.566   8.903   1.00 49.91 ? 129 LYS A O   1 
ATOM   697  C CB  . LYS A 1 91  ? -1.727  0.743   9.311   1.00 53.25 ? 129 LYS A CB  1 
ATOM   698  C CG  . LYS A 1 91  ? -2.189  -0.567  8.690   1.00 55.36 ? 129 LYS A CG  1 
ATOM   699  C CD  . LYS A 1 91  ? -0.969  -1.514  8.636   1.00 59.60 ? 129 LYS A CD  1 
ATOM   700  C CE  . LYS A 1 91  ? -1.261  -2.837  7.946   1.00 59.73 ? 129 LYS A CE  1 
ATOM   701  N NZ  . LYS A 1 91  ? -1.725  -3.829  8.947   1.00 62.19 ? 129 LYS A NZ  1 
ATOM   702  N N   . ASP A 1 92  ? -4.078  1.582   10.972  1.00 48.61 ? 130 ASP A N   1 
ATOM   703  C CA  . ASP A 1 92  ? -5.296  1.094   11.615  1.00 47.12 ? 130 ASP A CA  1 
ATOM   704  C C   . ASP A 1 92  ? -6.544  1.964   11.442  1.00 45.28 ? 130 ASP A C   1 
ATOM   705  O O   . ASP A 1 92  ? -7.614  1.436   11.167  1.00 44.76 ? 130 ASP A O   1 
ATOM   706  C CB  . ASP A 1 92  ? -5.036  0.760   13.078  1.00 48.05 ? 130 ASP A CB  1 
ATOM   707  C CG  . ASP A 1 92  ? -4.366  -0.608  13.250  1.00 51.31 ? 130 ASP A CG  1 
ATOM   708  O OD1 . ASP A 1 92  ? -3.956  -1.220  12.223  1.00 55.78 ? 130 ASP A OD1 1 
ATOM   709  O OD2 . ASP A 1 92  ? -4.249  -1.079  14.405  1.00 54.20 ? 130 ASP A OD2 1 
ATOM   710  N N   . LEU A 1 93  ? -6.419  3.278   11.612  1.00 43.35 ? 131 LEU A N   1 
ATOM   711  C CA  . LEU A 1 93  ? -7.550  4.198   11.374  1.00 42.04 ? 131 LEU A CA  1 
ATOM   712  C C   . LEU A 1 93  ? -7.993  4.130   9.900   1.00 40.67 ? 131 LEU A C   1 
ATOM   713  O O   . LEU A 1 93  ? -9.192  4.157   9.598   1.00 40.33 ? 131 LEU A O   1 
ATOM   714  C CB  . LEU A 1 93  ? -7.151  5.643   11.648  1.00 41.93 ? 131 LEU A CB  1 
ATOM   715  C CG  . LEU A 1 93  ? -8.149  6.677   12.175  1.00 44.55 ? 131 LEU A CG  1 
ATOM   716  C CD1 . LEU A 1 93  ? -7.871  8.006   11.559  1.00 44.31 ? 131 LEU A CD1 1 
ATOM   717  C CD2 . LEU A 1 93  ? -9.604  6.302   11.986  1.00 47.67 ? 131 LEU A CD2 1 
ATOM   718  N N   . ALA A 1 94  ? -7.027  4.053   8.998   1.00 39.16 ? 132 ALA A N   1 
ATOM   719  C CA  . ALA A 1 94  ? -7.347  3.945   7.559   1.00 39.89 ? 132 ALA A CA  1 
ATOM   720  C C   . ALA A 1 94  ? -8.303  2.766   7.340   1.00 39.51 ? 132 ALA A C   1 
ATOM   721  O O   . ALA A 1 94  ? -9.396  2.943   6.813   1.00 39.23 ? 132 ALA A O   1 
ATOM   722  C CB  . ALA A 1 94  ? -6.073  3.864   6.688   1.00 39.42 ? 132 ALA A CB  1 
ATOM   723  N N   . HIS A 1 95  ? -7.953  1.592   7.855   1.00 39.76 ? 133 HIS A N   1 
ATOM   724  C CA  . HIS A 1 95  ? -8.795  0.410   7.680   1.00 39.71 ? 133 HIS A CA  1 
ATOM   725  C C   . HIS A 1 95  ? -10.075 0.439   8.490   1.00 38.89 ? 133 HIS A C   1 
ATOM   726  O O   . HIS A 1 95  ? -11.117 0.059   8.000   1.00 39.68 ? 133 HIS A O   1 
ATOM   727  C CB  . HIS A 1 95  ? -8.006  -0.871  7.977   1.00 40.93 ? 133 HIS A CB  1 
ATOM   728  C CG  . HIS A 1 95  ? -6.821  -1.065  7.080   1.00 43.82 ? 133 HIS A CG  1 
ATOM   729  N ND1 . HIS A 1 95  ? -5.889  -2.060  7.279   1.00 47.28 ? 133 HIS A ND1 1 
ATOM   730  C CD2 . HIS A 1 95  ? -6.417  -0.381  5.980   1.00 45.87 ? 133 HIS A CD2 1 
ATOM   731  C CE1 . HIS A 1 95  ? -4.961  -1.979  6.338   1.00 50.61 ? 133 HIS A CE1 1 
ATOM   732  N NE2 . HIS A 1 95  ? -5.255  -0.961  5.543   1.00 47.83 ? 133 HIS A NE2 1 
ATOM   733  N N   . GLN A 1 96  ? -10.021 0.886   9.730   1.00 38.30 ? 134 GLN A N   1 
ATOM   734  C CA  . GLN A 1 96  ? -11.245 1.013   10.502  1.00 38.38 ? 134 GLN A CA  1 
ATOM   735  C C   . GLN A 1 96  ? -12.218 1.960   9.824   1.00 37.80 ? 134 GLN A C   1 
ATOM   736  O O   . GLN A 1 96  ? -13.411 1.700   9.803   1.00 37.09 ? 134 GLN A O   1 
ATOM   737  C CB  . GLN A 1 96  ? -10.951 1.524   11.907  1.00 38.69 ? 134 GLN A CB  1 
ATOM   738  C CG  . GLN A 1 96  ? -10.015 0.643   12.698  1.00 40.65 ? 134 GLN A CG  1 
ATOM   739  C CD  . GLN A 1 96  ? -9.867  1.140   14.101  1.00 44.77 ? 134 GLN A CD  1 
ATOM   740  O OE1 . GLN A 1 96  ? -10.686 0.835   14.958  1.00 48.09 ? 134 GLN A OE1 1 
ATOM   741  N NE2 . GLN A 1 96  ? -8.829  1.920   14.348  1.00 46.37 ? 134 GLN A NE2 1 
ATOM   742  N N   . PHE A 1 97  ? -11.702 3.075   9.317   1.00 38.08 ? 135 PHE A N   1 
ATOM   743  C CA  . PHE A 1 97  ? -12.487 4.013   8.519   1.00 38.76 ? 135 PHE A CA  1 
ATOM   744  C C   . PHE A 1 97  ? -13.193 3.357   7.307   1.00 38.58 ? 135 PHE A C   1 
ATOM   745  O O   . PHE A 1 97  ? -14.411 3.471   7.183   1.00 38.18 ? 135 PHE A O   1 
ATOM   746  C CB  . PHE A 1 97  ? -11.615 5.162   8.008   1.00 38.73 ? 135 PHE A CB  1 
ATOM   747  C CG  . PHE A 1 97  ? -12.343 6.093   7.065   1.00 38.49 ? 135 PHE A CG  1 
ATOM   748  C CD1 . PHE A 1 97  ? -11.948 6.217   5.747   1.00 41.21 ? 135 PHE A CD1 1 
ATOM   749  C CD2 . PHE A 1 97  ? -13.445 6.805   7.493   1.00 39.71 ? 135 PHE A CD2 1 
ATOM   750  C CE1 . PHE A 1 97  ? -12.631 7.087   4.870   1.00 40.16 ? 135 PHE A CE1 1 
ATOM   751  C CE2 . PHE A 1 97  ? -14.132 7.679   6.619   1.00 41.70 ? 135 PHE A CE2 1 
ATOM   752  C CZ  . PHE A 1 97  ? -13.730 7.799   5.316   1.00 36.59 ? 135 PHE A CZ  1 
ATOM   753  N N   . THR A 1 98  ? -12.428 2.693   6.428   1.00 39.62 ? 136 THR A N   1 
ATOM   754  C CA  . THR A 1 98  ? -13.025 2.035   5.260   1.00 40.58 ? 136 THR A CA  1 
ATOM   755  C C   . THR A 1 98  ? -13.980 0.885   5.615   1.00 41.63 ? 136 THR A C   1 
ATOM   756  O O   . THR A 1 98  ? -14.901 0.620   4.864   1.00 42.51 ? 136 THR A O   1 
ATOM   757  C CB  . THR A 1 98  ? -12.012 1.594   4.193   1.00 40.47 ? 136 THR A CB  1 
ATOM   758  O OG1 . THR A 1 98  ? -11.134 0.580   4.711   1.00 39.77 ? 136 THR A OG1 1 
ATOM   759  C CG2 . THR A 1 98  ? -11.216 2.759   3.681   1.00 38.92 ? 136 THR A CG2 1 
ATOM   760  N N   . GLN A 1 99  ? -13.805 0.252   6.779   1.00 43.06 ? 137 GLN A N   1 
ATOM   761  C CA  . GLN A 1 99  ? -14.687 -0.833  7.227   1.00 43.24 ? 137 GLN A CA  1 
ATOM   762  C C   . GLN A 1 99  ? -16.108 -0.345  7.546   1.00 43.83 ? 137 GLN A C   1 
ATOM   763  O O   . GLN A 1 99  ? -17.066 -1.133  7.491   1.00 43.35 ? 137 GLN A O   1 
ATOM   764  C CB  . GLN A 1 99  ? -14.109 -1.548  8.453   1.00 44.05 ? 137 GLN A CB  1 
ATOM   765  C CG  . GLN A 1 99  ? -12.796 -2.307  8.253   1.00 46.93 ? 137 GLN A CG  1 
ATOM   766  C CD  . GLN A 1 99  ? -12.929 -3.575  7.425   1.00 52.02 ? 137 GLN A CD  1 
ATOM   767  O OE1 . GLN A 1 99  ? -12.301 -3.703  6.372   1.00 54.81 ? 137 GLN A OE1 1 
ATOM   768  N NE2 . GLN A 1 99  ? -13.723 -4.534  7.906   1.00 53.97 ? 137 GLN A NE2 1 
ATOM   769  N N   . VAL A 1 100 ? -16.219 0.931   7.926   1.00 44.12 ? 138 VAL A N   1 
ATOM   770  C CA  . VAL A 1 100 ? -17.503 1.613   8.108   1.00 45.48 ? 138 VAL A CA  1 
ATOM   771  C C   . VAL A 1 100 ? -17.857 2.307   6.787   1.00 46.71 ? 138 VAL A C   1 
ATOM   772  O O   . VAL A 1 100 ? -18.923 2.055   6.209   1.00 46.04 ? 138 VAL A O   1 
ATOM   773  C CB  . VAL A 1 100 ? -17.460 2.722   9.198   1.00 44.96 ? 138 VAL A CB  1 
ATOM   774  C CG1 . VAL A 1 100 ? -18.875 3.202   9.503   1.00 45.96 ? 138 VAL A CG1 1 
ATOM   775  C CG2 . VAL A 1 100 ? -16.775 2.241   10.464  1.00 45.21 ? 138 VAL A CG2 1 
ATOM   776  N N   . GLN A 1 101 ? -16.948 3.184   6.321   1.00 48.30 ? 139 GLN A N   1 
ATOM   777  C CA  . GLN A 1 101 ? -17.100 3.850   5.061   1.00 49.17 ? 139 GLN A CA  1 
ATOM   778  C C   . GLN A 1 101 ? -16.713 2.866   3.975   1.00 51.08 ? 139 GLN A C   1 
ATOM   779  O O   . GLN A 1 101 ? -15.696 3.075   3.263   1.00 50.59 ? 139 GLN A O   1 
ATOM   780  C CB  . GLN A 1 101 ? -16.202 5.070   4.980   1.00 50.39 ? 139 GLN A CB  1 
ATOM   781  C CG  . GLN A 1 101 ? -16.599 6.062   3.836   1.00 50.67 ? 139 GLN A CG  1 
ATOM   782  C CD  . GLN A 1 101 ? -17.946 6.643   4.121   1.00 51.64 ? 139 GLN A CD  1 
ATOM   783  O OE1 . GLN A 1 101 ? -18.236 6.974   5.267   1.00 55.12 ? 139 GLN A OE1 1 
ATOM   784  N NE2 . GLN A 1 101 ? -18.802 6.729   3.109   1.00 52.49 ? 139 GLN A NE2 1 
ATOM   785  N N   . ARG A 1 102 ? -17.500 1.788   3.853   1.00 51.74 ? 140 ARG A N   1 
ATOM   786  C CA  . ARG A 1 102 ? -17.178 0.724   2.915   1.00 53.75 ? 140 ARG A CA  1 
ATOM   787  C C   . ARG A 1 102 ? -17.179 1.248   1.490   1.00 54.33 ? 140 ARG A C   1 
ATOM   788  O O   . ARG A 1 102 ? -17.135 0.466   0.532   1.00 54.94 ? 140 ARG A O   1 
ATOM   789  C CB  . ARG A 1 102 ? -18.125 -0.470  3.045   1.00 54.82 ? 140 ARG A CB  1 
ATOM   790  C CG  . ARG A 1 102 ? -17.827 -1.548  1.993   1.00 56.77 ? 140 ARG A CG  1 
ATOM   791  C CD  . ARG A 1 102 ? -19.062 -2.298  1.501   1.00 60.23 ? 140 ARG A CD  1 
ATOM   792  N NE  . ARG A 1 102 ? -20.358 -1.584  1.538   1.00 62.19 ? 140 ARG A NE  1 
ATOM   793  C CZ  . ARG A 1 102 ? -21.014 -1.101  0.478   1.00 62.11 ? 140 ARG A CZ  1 
ATOM   794  N NH1 . ARG A 1 102 ? -20.502 -1.176  -0.747  1.00 61.83 ? 140 ARG A NH1 1 
ATOM   795  N NH2 . ARG A 1 102 ? -22.186 -0.515  0.655   1.00 62.14 ? 140 ARG A NH2 1 
ATOM   796  N N   . ASP A 1 103 ? -17.227 2.578   1.391   1.00 54.22 ? 141 ASP A N   1 
ATOM   797  C CA  . ASP A 1 103 ? -17.158 3.316   0.174   1.00 54.43 ? 141 ASP A CA  1 
ATOM   798  C C   . ASP A 1 103 ? -15.656 3.521   -0.243  1.00 54.87 ? 141 ASP A C   1 
ATOM   799  O O   . ASP A 1 103 ? -15.254 2.996   -1.318  1.00 55.24 ? 141 ASP A O   1 
ATOM   800  C CB  . ASP A 1 103 ? -17.861 4.659   0.413   1.00 56.17 ? 141 ASP A CB  1 
ATOM   801  C CG  . ASP A 1 103 ? -18.718 5.095   -0.762  1.00 60.64 ? 141 ASP A CG  1 
ATOM   802  O OD1 . ASP A 1 103 ? -18.477 6.225   -1.294  1.00 63.74 ? 141 ASP A OD1 1 
ATOM   803  O OD2 . ASP A 1 103 ? -19.644 4.314   -1.141  1.00 65.17 ? 141 ASP A OD2 1 
ATOM   804  N N   . MET A 1 104 ? -14.843 4.259   0.571   1.00 52.70 ? 142 MET A N   1 
ATOM   805  C CA  . MET A 1 104 ? -13.427 4.495   0.231   1.00 50.70 ? 142 MET A CA  1 
ATOM   806  C C   . MET A 1 104 ? -12.675 3.158   0.268   1.00 48.51 ? 142 MET A C   1 
ATOM   807  O O   . MET A 1 104 ? -13.051 2.243   1.004   1.00 47.20 ? 142 MET A O   1 
ATOM   808  C CB  . MET A 1 104 ? -12.721 5.599   1.087   1.00 50.83 ? 142 MET A CB  1 
ATOM   809  C CG  . MET A 1 104 ? -13.022 7.137   0.756   1.00 50.96 ? 142 MET A CG  1 
ATOM   810  S SD  . MET A 1 104 ? -11.762 8.373   1.342   1.00 52.28 ? 142 MET A SD  1 
ATOM   811  C CE  . MET A 1 104 ? -12.789 9.809   1.723   1.00 52.24 ? 142 MET A CE  1 
ATOM   812  N N   . PHE A 1 105 ? -11.617 3.062   -0.539  1.00 45.82 ? 143 PHE A N   1 
ATOM   813  C CA  . PHE A 1 105 ? -10.834 1.851   -0.708  1.00 44.98 ? 143 PHE A CA  1 
ATOM   814  C C   . PHE A 1 105 ? -9.374  2.186   -0.400  1.00 43.22 ? 143 PHE A C   1 
ATOM   815  O O   . PHE A 1 105 ? -8.852  3.130   -0.959  1.00 40.95 ? 143 PHE A O   1 
ATOM   816  C CB  . PHE A 1 105 ? -10.918 1.386   -2.175  1.00 46.59 ? 143 PHE A CB  1 
ATOM   817  C CG  . PHE A 1 105 ? -12.058 0.460   -2.454  1.00 49.39 ? 143 PHE A CG  1 
ATOM   818  C CD1 . PHE A 1 105 ? -11.815 -0.856  -2.876  1.00 52.39 ? 143 PHE A CD1 1 
ATOM   819  C CD2 . PHE A 1 105 ? -13.366 0.885   -2.274  1.00 53.82 ? 143 PHE A CD2 1 
ATOM   820  C CE1 . PHE A 1 105 ? -12.877 -1.739  -3.129  1.00 54.48 ? 143 PHE A CE1 1 
ATOM   821  C CE2 . PHE A 1 105 ? -14.462 0.017   -2.500  1.00 55.66 ? 143 PHE A CE2 1 
ATOM   822  C CZ  . PHE A 1 105 ? -14.206 -1.305  -2.939  1.00 54.51 ? 143 PHE A CZ  1 
ATOM   823  N N   . THR A 1 106 ? -8.733  1.430   0.488   1.00 41.26 ? 144 THR A N   1 
ATOM   824  C CA  . THR A 1 106 ? -7.277  1.477   0.606   1.00 40.03 ? 144 THR A CA  1 
ATOM   825  C C   . THR A 1 106 ? -6.718  0.361   -0.296  1.00 39.70 ? 144 THR A C   1 
ATOM   826  O O   . THR A 1 106 ? -7.466  -0.482  -0.827  1.00 38.12 ? 144 THR A O   1 
ATOM   827  C CB  . THR A 1 106 ? -6.795  1.215   2.058   1.00 40.68 ? 144 THR A CB  1 
ATOM   828  O OG1 . THR A 1 106 ? -7.198  -0.103  2.478   1.00 40.42 ? 144 THR A OG1 1 
ATOM   829  C CG2 . THR A 1 106 ? -7.357  2.268   3.029   1.00 40.94 ? 144 THR A CG2 1 
ATOM   830  N N   . LEU A 1 107 ? -5.408  0.375   -0.469  1.00 39.17 ? 145 LEU A N   1 
ATOM   831  C CA  . LEU A 1 107 ? -4.727  -0.691  -1.187  1.00 40.06 ? 145 LEU A CA  1 
ATOM   832  C C   . LEU A 1 107 ? -5.046  -2.088  -0.589  1.00 39.68 ? 145 LEU A C   1 
ATOM   833  O O   . LEU A 1 107 ? -5.186  -3.074  -1.316  1.00 40.22 ? 145 LEU A O   1 
ATOM   834  C CB  . LEU A 1 107 ? -3.217  -0.378  -1.219  1.00 40.28 ? 145 LEU A CB  1 
ATOM   835  C CG  . LEU A 1 107 ? -2.305  -1.293  -2.046  1.00 41.25 ? 145 LEU A CG  1 
ATOM   836  C CD1 . LEU A 1 107 ? -2.808  -1.379  -3.471  1.00 40.78 ? 145 LEU A CD1 1 
ATOM   837  C CD2 . LEU A 1 107 ? -0.906  -0.788  -2.017  1.00 39.01 ? 145 LEU A CD2 1 
ATOM   838  N N   . GLU A 1 108 ? -5.253  -2.153  0.723   1.00 40.42 ? 146 GLU A N   1 
ATOM   839  C CA  . GLU A 1 108 ? -5.495  -3.442  1.390   1.00 42.06 ? 146 GLU A CA  1 
ATOM   840  C C   . GLU A 1 108 ? -6.930  -3.928  1.221   1.00 42.13 ? 146 GLU A C   1 
ATOM   841  O O   . GLU A 1 108 ? -7.254  -5.063  1.550   1.00 43.01 ? 146 GLU A O   1 
ATOM   842  C CB  . GLU A 1 108 ? -5.039  -3.418  2.852   1.00 41.67 ? 146 GLU A CB  1 
ATOM   843  C CG  . GLU A 1 108 ? -3.520  -3.147  3.002   1.00 42.54 ? 146 GLU A CG  1 
ATOM   844  C CD  . GLU A 1 108 ? -3.132  -1.692  2.705   1.00 47.01 ? 146 GLU A CD  1 
ATOM   845  O OE1 . GLU A 1 108 ? -3.976  -0.782  2.871   1.00 47.61 ? 146 GLU A OE1 1 
ATOM   846  O OE2 . GLU A 1 108 ? -1.980  -1.449  2.306   1.00 45.83 ? 146 GLU A OE2 1 
ATOM   847  N N   . ASP A 1 109 ? -7.760  -3.090  0.625   1.00 42.48 ? 147 ASP A N   1 
ATOM   848  C CA  . ASP A 1 109 ? -9.108  -3.486  0.268   1.00 42.58 ? 147 ASP A CA  1 
ATOM   849  C C   . ASP A 1 109 ? -9.127  -4.114  -1.128  1.00 41.56 ? 147 ASP A C   1 
ATOM   850  O O   . ASP A 1 109 ? -10.190 -4.609  -1.550  1.00 42.29 ? 147 ASP A O   1 
ATOM   851  C CB  . ASP A 1 109 ? -10.108 -2.298  0.382   1.00 43.44 ? 147 ASP A CB  1 
ATOM   852  C CG  . ASP A 1 109 ? -10.296 -1.822  1.844   1.00 47.60 ? 147 ASP A CG  1 
ATOM   853  O OD1 . ASP A 1 109 ? -10.084 -0.621  2.158   1.00 49.66 ? 147 ASP A OD1 1 
ATOM   854  O OD2 . ASP A 1 109 ? -10.600 -2.672  2.704   1.00 48.20 ? 147 ASP A OD2 1 
ATOM   855  N N   . THR A 1 110 ? -7.989  -4.113  -1.840  1.00 39.80 ? 148 THR A N   1 
ATOM   856  C CA  . THR A 1 110 ? -7.888  -4.830  -3.146  1.00 38.89 ? 148 THR A CA  1 
ATOM   857  C C   . THR A 1 110 ? -7.409  -6.280  -2.918  1.00 38.73 ? 148 THR A C   1 
ATOM   858  O O   . THR A 1 110 ? -6.825  -6.552  -1.885  1.00 38.83 ? 148 THR A O   1 
ATOM   859  C CB  . THR A 1 110 ? -6.918  -4.171  -4.161  1.00 38.93 ? 148 THR A CB  1 
ATOM   860  O OG1 . THR A 1 110 ? -5.558  -4.240  -3.685  1.00 37.22 ? 148 THR A OG1 1 
ATOM   861  C CG2 . THR A 1 110 ? -7.319  -2.705  -4.459  1.00 39.02 ? 148 THR A CG2 1 
ATOM   862  N N   . LEU A 1 111 ? -7.642  -7.187  -3.870  1.00 37.57 ? 149 LEU A N   1 
ATOM   863  C CA  . LEU A 1 111 ? -7.163  -8.555  -3.738  1.00 37.65 ? 149 LEU A CA  1 
ATOM   864  C C   . LEU A 1 111 ? -5.680  -8.579  -3.392  1.00 36.98 ? 149 LEU A C   1 
ATOM   865  O O   . LEU A 1 111 ? -5.285  -9.162  -2.389  1.00 38.00 ? 149 LEU A O   1 
ATOM   866  C CB  . LEU A 1 111 ? -7.426  -9.401  -5.007  1.00 36.53 ? 149 LEU A CB  1 
ATOM   867  C CG  . LEU A 1 111 ? -6.822  -10.822 -4.998  1.00 37.07 ? 149 LEU A CG  1 
ATOM   868  C CD1 . LEU A 1 111 ? -7.391  -11.721 -3.846  1.00 34.80 ? 149 LEU A CD1 1 
ATOM   869  C CD2 . LEU A 1 111 ? -7.026  -11.505 -6.347  1.00 38.81 ? 149 LEU A CD2 1 
ATOM   870  N N   . LEU A 1 112 ? -4.873  -7.932  -4.211  1.00 37.21 ? 150 LEU A N   1 
ATOM   871  C CA  . LEU A 1 112 ? -3.415  -7.988  -4.032  1.00 37.53 ? 150 LEU A CA  1 
ATOM   872  C C   . LEU A 1 112 ? -2.909  -7.433  -2.689  1.00 38.00 ? 150 LEU A C   1 
ATOM   873  O O   . LEU A 1 112 ? -2.101  -8.088  -2.024  1.00 38.74 ? 150 LEU A O   1 
ATOM   874  C CB  . LEU A 1 112 ? -2.694  -7.378  -5.253  1.00 37.33 ? 150 LEU A CB  1 
ATOM   875  C CG  . LEU A 1 112 ? -2.898  -8.237  -6.525  1.00 39.63 ? 150 LEU A CG  1 
ATOM   876  C CD1 . LEU A 1 112 ? -2.187  -7.687  -7.753  1.00 38.49 ? 150 LEU A CD1 1 
ATOM   877  C CD2 . LEU A 1 112 ? -2.463  -9.688  -6.267  1.00 36.34 ? 150 LEU A CD2 1 
ATOM   878  N N   . GLY A 1 113 ? -3.383  -6.254  -2.272  1.00 37.28 ? 151 GLY A N   1 
ATOM   879  C CA  . GLY A 1 113 ? -3.031  -5.734  -0.944  1.00 37.58 ? 151 GLY A CA  1 
ATOM   880  C C   . GLY A 1 113 ? -3.526  -6.593  0.212   1.00 37.78 ? 151 GLY A C   1 
ATOM   881  O O   . GLY A 1 113 ? -2.818  -6.800  1.200   1.00 38.89 ? 151 GLY A O   1 
ATOM   882  N N   . TYR A 1 114 ? -4.753  -7.085  0.100   1.00 37.55 ? 152 TYR A N   1 
ATOM   883  C CA  . TYR A 1 114 ? -5.309  -8.008  1.071   1.00 37.98 ? 152 TYR A CA  1 
ATOM   884  C C   . TYR A 1 114 ? -4.472  -9.290  1.224   1.00 38.00 ? 152 TYR A C   1 
ATOM   885  O O   . TYR A 1 114 ? -4.229  -9.749  2.354   1.00 37.65 ? 152 TYR A O   1 
ATOM   886  C CB  . TYR A 1 114 ? -6.733  -8.362  0.671   1.00 39.03 ? 152 TYR A CB  1 
ATOM   887  C CG  . TYR A 1 114 ? -7.480  -9.252  1.649   1.00 40.48 ? 152 TYR A CG  1 
ATOM   888  C CD1 . TYR A 1 114 ? -7.549  -10.628 1.452   1.00 40.07 ? 152 TYR A CD1 1 
ATOM   889  C CD2 . TYR A 1 114 ? -8.161  -8.705  2.738   1.00 42.66 ? 152 TYR A CD2 1 
ATOM   890  C CE1 . TYR A 1 114 ? -8.265  -11.458 2.336   1.00 40.39 ? 152 TYR A CE1 1 
ATOM   891  C CE2 . TYR A 1 114 ? -8.880  -9.517  3.623   1.00 41.44 ? 152 TYR A CE2 1 
ATOM   892  C CZ  . TYR A 1 114 ? -8.912  -10.892 3.417   1.00 42.29 ? 152 TYR A CZ  1 
ATOM   893  O OH  . TYR A 1 114 ? -9.637  -11.688 4.279   1.00 43.24 ? 152 TYR A OH  1 
ATOM   894  N N   . LEU A 1 115 ? -4.029  -9.866  0.102   1.00 38.40 ? 153 LEU A N   1 
ATOM   895  C CA  . LEU A 1 115 ? -3.174  -11.056 0.155   1.00 38.11 ? 153 LEU A CA  1 
ATOM   896  C C   . LEU A 1 115 ? -1.895  -10.805 0.948   1.00 38.56 ? 153 LEU A C   1 
ATOM   897  O O   . LEU A 1 115 ? -1.499  -11.668 1.734   1.00 38.81 ? 153 LEU A O   1 
ATOM   898  C CB  . LEU A 1 115 ? -2.778  -11.544 -1.242  1.00 38.48 ? 153 LEU A CB  1 
ATOM   899  C CG  . LEU A 1 115 ? -3.835  -12.086 -2.197  1.00 37.56 ? 153 LEU A CG  1 
ATOM   900  C CD1 . LEU A 1 115 ? -3.156  -12.580 -3.448  1.00 38.62 ? 153 LEU A CD1 1 
ATOM   901  C CD2 . LEU A 1 115 ? -4.654  -13.180 -1.552  1.00 36.63 ? 153 LEU A CD2 1 
ATOM   902  N N   . ALA A 1 116 ? -1.256  -9.641  0.761   1.00 38.10 ? 154 ALA A N   1 
ATOM   903  C CA  . ALA A 1 116 ? 0.082   -9.418  1.317   1.00 37.36 ? 154 ALA A CA  1 
ATOM   904  C C   . ALA A 1 116 ? 0.125   -8.677  2.641   1.00 38.21 ? 154 ALA A C   1 
ATOM   905  O O   . ALA A 1 116 ? 1.154   -8.676  3.302   1.00 37.29 ? 154 ALA A O   1 
ATOM   906  C CB  . ALA A 1 116 ? 0.952   -8.735  0.311   1.00 37.12 ? 154 ALA A CB  1 
ATOM   907  N N   . ASP A 1 117 ? -0.985  -8.045  3.035   1.00 39.60 ? 155 ASP A N   1 
ATOM   908  C CA  . ASP A 1 117 ? -1.020  -7.193  4.245   1.00 40.84 ? 155 ASP A CA  1 
ATOM   909  C C   . ASP A 1 117 ? -0.376  -7.834  5.489   1.00 40.22 ? 155 ASP A C   1 
ATOM   910  O O   . ASP A 1 117 ? -0.793  -8.884  5.933   1.00 40.44 ? 155 ASP A O   1 
ATOM   911  C CB  . ASP A 1 117 ? -2.479  -6.768  4.520   1.00 41.81 ? 155 ASP A CB  1 
ATOM   912  C CG  . ASP A 1 117 ? -2.601  -5.583  5.491   1.00 45.63 ? 155 ASP A CG  1 
ATOM   913  O OD1 . ASP A 1 117 ? -3.715  -5.410  6.059   1.00 50.27 ? 155 ASP A OD1 1 
ATOM   914  O OD2 . ASP A 1 117 ? -1.607  -4.843  5.696   1.00 47.45 ? 155 ASP A OD2 1 
ATOM   915  N N   . ASP A 1 118 ? 0.637   -7.180  6.055   1.00 40.89 ? 156 ASP A N   1 
ATOM   916  C CA  . ASP A 1 118 ? 1.379   -7.661  7.238   1.00 41.49 ? 156 ASP A CA  1 
ATOM   917  C C   . ASP A 1 118 ? 2.128   -8.966  7.056   1.00 41.01 ? 156 ASP A C   1 
ATOM   918  O O   . ASP A 1 118 ? 2.418   -9.630  8.034   1.00 42.05 ? 156 ASP A O   1 
ATOM   919  C CB  . ASP A 1 118 ? 0.480   -7.823  8.476   1.00 42.79 ? 156 ASP A CB  1 
ATOM   920  C CG  . ASP A 1 118 ? -0.135  -6.516  8.931   1.00 47.68 ? 156 ASP A CG  1 
ATOM   921  O OD1 . ASP A 1 118 ? 0.540   -5.457  8.858   1.00 52.17 ? 156 ASP A OD1 1 
ATOM   922  O OD2 . ASP A 1 118 ? -1.317  -6.552  9.360   1.00 54.04 ? 156 ASP A OD2 1 
ATOM   923  N N   . LEU A 1 119 ? 2.415   -9.375  5.833   1.00 40.02 ? 157 LEU A N   1 
ATOM   924  C CA  . LEU A 1 119 ? 3.152   -10.639 5.663   1.00 38.94 ? 157 LEU A CA  1 
ATOM   925  C C   . LEU A 1 119 ? 4.547   -10.326 5.199   1.00 38.04 ? 157 LEU A C   1 
ATOM   926  O O   . LEU A 1 119 ? 4.798   -9.230  4.661   1.00 36.85 ? 157 LEU A O   1 
ATOM   927  C CB  . LEU A 1 119 ? 2.457   -11.579 4.678   1.00 38.18 ? 157 LEU A CB  1 
ATOM   928  C CG  . LEU A 1 119 ? 1.069   -12.092 5.044   1.00 38.14 ? 157 LEU A CG  1 
ATOM   929  C CD1 . LEU A 1 119 ? 0.572   -13.007 3.960   1.00 35.20 ? 157 LEU A CD1 1 
ATOM   930  C CD2 . LEU A 1 119 ? 1.047   -12.812 6.371   1.00 38.25 ? 157 LEU A CD2 1 
ATOM   931  N N   . THR A 1 120 ? 5.443   -11.273 5.436   1.00 37.34 ? 158 THR A N   1 
ATOM   932  C CA  . THR A 1 120 ? 6.846   -11.178 5.034   1.00 37.94 ? 158 THR A CA  1 
ATOM   933  C C   . THR A 1 120 ? 7.163   -12.457 4.289   1.00 37.09 ? 158 THR A C   1 
ATOM   934  O O   . THR A 1 120 ? 6.653   -13.520 4.637   1.00 36.99 ? 158 THR A O   1 
ATOM   935  C CB  . THR A 1 120 ? 7.830   -11.026 6.266   1.00 38.93 ? 158 THR A CB  1 
ATOM   936  O OG1 . THR A 1 120 ? 7.465   -9.860  7.015   1.00 40.78 ? 158 THR A OG1 1 
ATOM   937  C CG2 . THR A 1 120 ? 9.277   -10.849 5.799   1.00 38.64 ? 158 THR A CG2 1 
ATOM   938  N N   . TRP A 1 121 ? 7.986   -12.345 3.248   1.00 36.76 ? 159 TRP A N   1 
ATOM   939  C CA  . TRP A 1 121 ? 8.368   -13.513 2.448   1.00 36.22 ? 159 TRP A CA  1 
ATOM   940  C C   . TRP A 1 121 ? 9.628   -13.252 1.658   1.00 36.30 ? 159 TRP A C   1 
ATOM   941  O O   . TRP A 1 121 ? 9.898   -12.107 1.247   1.00 35.78 ? 159 TRP A O   1 
ATOM   942  C CB  . TRP A 1 121 ? 7.251   -13.891 1.476   1.00 35.37 ? 159 TRP A CB  1 
ATOM   943  C CG  . TRP A 1 121 ? 6.953   -12.811 0.465   1.00 34.95 ? 159 TRP A CG  1 
ATOM   944  C CD1 . TRP A 1 121 ? 7.460   -12.711 -0.794  1.00 34.63 ? 159 TRP A CD1 1 
ATOM   945  C CD2 . TRP A 1 121 ? 6.059   -11.691 0.630   1.00 36.31 ? 159 TRP A CD2 1 
ATOM   946  N NE1 . TRP A 1 121 ? 6.956   -11.589 -1.426  1.00 35.34 ? 159 TRP A NE1 1 
ATOM   947  C CE2 . TRP A 1 121 ? 6.092   -10.951 -0.572  1.00 35.51 ? 159 TRP A CE2 1 
ATOM   948  C CE3 . TRP A 1 121 ? 5.243   -11.233 1.682   1.00 36.43 ? 159 TRP A CE3 1 
ATOM   949  C CZ2 . TRP A 1 121 ? 5.336   -9.783  -0.754  1.00 35.40 ? 159 TRP A CZ2 1 
ATOM   950  C CZ3 . TRP A 1 121 ? 4.491   -10.035 1.487   1.00 34.15 ? 159 TRP A CZ3 1 
ATOM   951  C CH2 . TRP A 1 121 ? 4.539   -9.358  0.283   1.00 33.15 ? 159 TRP A CH2 1 
ATOM   952  N N   . CYS A 1 122 ? 10.395  -14.321 1.458   1.00 37.27 ? 160 CYS A N   1 
ATOM   953  C CA  . CYS A 1 122 ? 11.542  -14.321 0.549   1.00 37.96 ? 160 CYS A CA  1 
ATOM   954  C C   . CYS A 1 122 ? 12.001  -15.752 0.258   1.00 37.60 ? 160 CYS A C   1 
ATOM   955  O O   . CYS A 1 122 ? 11.667  -16.665 0.998   1.00 36.32 ? 160 CYS A O   1 
ATOM   956  C CB  . CYS A 1 122 ? 12.711  -13.465 1.106   1.00 39.34 ? 160 CYS A CB  1 
ATOM   957  S SG  . CYS A 1 122 ? 13.499  -14.037 2.654   1.00 43.37 ? 160 CYS A SG  1 
ATOM   958  N N   . GLY A 1 123 ? 12.756  -15.933 -0.828  1.00 37.74 ? 161 GLY A N   1 
ATOM   959  C CA  . GLY A 1 123 ? 13.334  -17.234 -1.172  1.00 37.82 ? 161 GLY A CA  1 
ATOM   960  C C   . GLY A 1 123 ? 14.858  -17.160 -1.137  1.00 38.96 ? 161 GLY A C   1 
ATOM   961  O O   . GLY A 1 123 ? 15.438  -16.363 -0.386  1.00 38.58 ? 161 GLY A O   1 
ATOM   962  N N   . GLU A 1 124 ? 15.497  -17.992 -1.959  1.00 39.99 ? 162 GLU A N   1 
ATOM   963  C CA  . GLU A 1 124 ? 16.952  -18.132 -2.018  1.00 41.20 ? 162 GLU A CA  1 
ATOM   964  C C   . GLU A 1 124 ? 17.316  -18.367 -3.464  1.00 41.39 ? 162 GLU A C   1 
ATOM   965  O O   . GLU A 1 124 ? 16.543  -18.973 -4.201  1.00 41.10 ? 162 GLU A O   1 
ATOM   966  C CB  . GLU A 1 124 ? 17.411  -19.331 -1.187  1.00 40.39 ? 162 GLU A CB  1 
ATOM   967  C CG  . GLU A 1 124 ? 16.757  -19.376 0.175   1.00 42.67 ? 162 GLU A CG  1 
ATOM   968  C CD  . GLU A 1 124 ? 17.289  -20.434 1.120   1.00 44.25 ? 162 GLU A CD  1 
ATOM   969  O OE1 . GLU A 1 124 ? 16.632  -20.600 2.173   1.00 50.34 ? 162 GLU A OE1 1 
ATOM   970  O OE2 . GLU A 1 124 ? 18.323  -21.094 0.842   1.00 47.15 ? 162 GLU A OE2 1 
ATOM   971  N N   . PHE A 1 125 ? 18.484  -17.891 -3.884  1.00 41.85 ? 163 PHE A N   1 
ATOM   972  C CA  . PHE A 1 125 ? 18.902  -18.098 -5.263  1.00 43.17 ? 163 PHE A CA  1 
ATOM   973  C C   . PHE A 1 125 ? 19.142  -19.597 -5.519  1.00 44.02 ? 163 PHE A C   1 
ATOM   974  O O   . PHE A 1 125 ? 18.716  -20.163 -6.530  1.00 44.51 ? 163 PHE A O   1 
ATOM   975  C CB  . PHE A 1 125 ? 20.161  -17.271 -5.557  1.00 42.92 ? 163 PHE A CB  1 
ATOM   976  C CG  . PHE A 1 125 ? 20.699  -17.423 -6.968  1.00 42.96 ? 163 PHE A CG  1 
ATOM   977  C CD1 . PHE A 1 125 ? 19.961  -16.982 -8.067  1.00 43.96 ? 163 PHE A CD1 1 
ATOM   978  C CD2 . PHE A 1 125 ? 21.960  -17.975 -7.190  1.00 44.63 ? 163 PHE A CD2 1 
ATOM   979  C CE1 . PHE A 1 125 ? 20.465  -17.096 -9.368  1.00 43.86 ? 163 PHE A CE1 1 
ATOM   980  C CE2 . PHE A 1 125 ? 22.487  -18.093 -8.493  1.00 44.86 ? 163 PHE A CE2 1 
ATOM   981  C CZ  . PHE A 1 125 ? 21.733  -17.649 -9.583  1.00 44.34 ? 163 PHE A CZ  1 
ATOM   982  N N   . ASP A 1 126 ? 19.773  -20.244 -4.554  1.00 44.76 ? 164 ASP A N   1 
ATOM   983  C CA  . ASP A 1 126 ? 20.332  -21.573 -4.753  1.00 46.30 ? 164 ASP A CA  1 
ATOM   984  C C   . ASP A 1 126 ? 19.283  -22.712 -4.639  1.00 45.94 ? 164 ASP A C   1 
ATOM   985  O O   . ASP A 1 126 ? 19.595  -23.880 -4.868  1.00 46.04 ? 164 ASP A O   1 
ATOM   986  C CB  . ASP A 1 126 ? 21.563  -21.769 -3.816  1.00 46.84 ? 164 ASP A CB  1 
ATOM   987  C CG  . ASP A 1 126 ? 21.838  -20.530 -2.898  1.00 50.17 ? 164 ASP A CG  1 
ATOM   988  O OD1 . ASP A 1 126 ? 22.881  -19.847 -3.093  1.00 52.67 ? 164 ASP A OD1 1 
ATOM   989  O OD2 . ASP A 1 126 ? 21.001  -20.222 -2.000  1.00 52.38 ? 164 ASP A OD2 1 
ATOM   990  N N   . THR A 1 127 ? 18.039  -22.356 -4.323  1.00 45.75 ? 165 THR A N   1 
ATOM   991  C CA  . THR A 1 127 ? 17.003  -23.353 -4.016  1.00 45.26 ? 165 THR A CA  1 
ATOM   992  C C   . THR A 1 127 ? 15.598  -22.863 -4.285  1.00 44.23 ? 165 THR A C   1 
ATOM   993  O O   . THR A 1 127 ? 15.368  -21.664 -4.473  1.00 44.56 ? 165 THR A O   1 
ATOM   994  C CB  . THR A 1 127 ? 17.061  -23.770 -2.532  1.00 45.72 ? 165 THR A CB  1 
ATOM   995  O OG1 . THR A 1 127 ? 16.239  -24.930 -2.325  1.00 48.52 ? 165 THR A OG1 1 
ATOM   996  C CG2 . THR A 1 127 ? 16.567  -22.640 -1.638  1.00 44.28 ? 165 THR A CG2 1 
ATOM   997  N N   . SER A 1 128 ? 14.648  -23.787 -4.283  1.00 42.77 ? 166 SER A N   1 
ATOM   998  C CA  . SER A 1 128 ? 13.244  -23.402 -4.340  1.00 42.34 ? 166 SER A CA  1 
ATOM   999  C C   . SER A 1 128 ? 12.622  -23.334 -2.930  1.00 41.71 ? 166 SER A C   1 
ATOM   1000 O O   . SER A 1 128 ? 11.406  -23.435 -2.777  1.00 41.34 ? 166 SER A O   1 
ATOM   1001 C CB  . SER A 1 128 ? 12.454  -24.360 -5.237  1.00 42.03 ? 166 SER A CB  1 
ATOM   1002 O OG  . SER A 1 128 ? 12.409  -25.651 -4.656  1.00 41.60 ? 166 SER A OG  1 
ATOM   1003 N N   . LYS A 1 129 ? 13.463  -23.196 -1.903  1.00 41.09 ? 167 LYS A N   1 
ATOM   1004 C CA  . LYS A 1 129 ? 12.977  -23.095 -0.526  1.00 40.54 ? 167 LYS A CA  1 
ATOM   1005 C C   . LYS A 1 129 ? 12.479  -21.689 -0.241  1.00 39.22 ? 167 LYS A C   1 
ATOM   1006 O O   . LYS A 1 129 ? 13.059  -20.717 -0.733  1.00 39.01 ? 167 LYS A O   1 
ATOM   1007 C CB  . LYS A 1 129 ? 14.075  -23.434 0.483   1.00 40.71 ? 167 LYS A CB  1 
ATOM   1008 C CG  . LYS A 1 129 ? 14.181  -24.919 0.824   1.00 42.91 ? 167 LYS A CG  1 
ATOM   1009 C CD  . LYS A 1 129 ? 14.962  -25.127 2.122   1.00 44.82 ? 167 LYS A CD  1 
ATOM   1010 C CE  . LYS A 1 129 ? 16.429  -25.451 1.870   1.00 47.51 ? 167 LYS A CE  1 
ATOM   1011 N NZ  . LYS A 1 129 ? 16.640  -26.868 1.443   1.00 45.77 ? 167 LYS A NZ  1 
ATOM   1012 N N   . ILE A 1 130 ? 11.386  -21.610 0.524   1.00 38.68 ? 168 ILE A N   1 
ATOM   1013 C CA  . ILE A 1 130 ? 10.990  -20.383 1.224   1.00 38.13 ? 168 ILE A CA  1 
ATOM   1014 C C   . ILE A 1 130 ? 11.937  -20.251 2.430   1.00 39.03 ? 168 ILE A C   1 
ATOM   1015 O O   . ILE A 1 130 ? 12.313  -21.252 3.041   1.00 39.27 ? 168 ILE A O   1 
ATOM   1016 C CB  . ILE A 1 130 ? 9.509   -20.404 1.675   1.00 37.97 ? 168 ILE A CB  1 
ATOM   1017 C CG1 . ILE A 1 130 ? 8.576   -20.213 0.476   1.00 36.58 ? 168 ILE A CG1 1 
ATOM   1018 C CG2 . ILE A 1 130 ? 9.259   -19.301 2.677   1.00 36.65 ? 168 ILE A CG2 1 
ATOM   1019 C CD1 . ILE A 1 130 ? 7.064   -20.296 0.789   1.00 37.23 ? 168 ILE A CD1 1 
ATOM   1020 N N   . ASN A 1 131 ? 12.360  -19.022 2.726   1.00 39.23 ? 169 ASN A N   1 
ATOM   1021 C CA  . ASN A 1 131 ? 13.258  -18.747 3.842   1.00 39.63 ? 169 ASN A CA  1 
ATOM   1022 C C   . ASN A 1 131 ? 12.458  -18.229 5.043   1.00 39.68 ? 169 ASN A C   1 
ATOM   1023 O O   . ASN A 1 131 ? 12.031  -17.080 5.074   1.00 39.88 ? 169 ASN A O   1 
ATOM   1024 C CB  . ASN A 1 131 ? 14.369  -17.767 3.406   1.00 39.06 ? 169 ASN A CB  1 
ATOM   1025 C CG  . ASN A 1 131 ? 15.502  -17.634 4.435   1.00 41.18 ? 169 ASN A CG  1 
ATOM   1026 O OD1 . ASN A 1 131 ? 15.372  -18.038 5.591   1.00 41.99 ? 169 ASN A OD1 1 
ATOM   1027 N ND2 . ASN A 1 131 ? 16.618  -17.032 4.012   1.00 41.19 ? 169 ASN A ND2 1 
ATOM   1028 N N   . TYR A 1 132 ? 12.250  -19.101 6.022   1.00 40.55 ? 170 TYR A N   1 
ATOM   1029 C CA  . TYR A 1 132 ? 11.500  -18.761 7.233   1.00 41.42 ? 170 TYR A CA  1 
ATOM   1030 C C   . TYR A 1 132 ? 12.393  -18.239 8.341   1.00 41.78 ? 170 TYR A C   1 
ATOM   1031 O O   . TYR A 1 132 ? 11.915  -17.920 9.426   1.00 42.32 ? 170 TYR A O   1 
ATOM   1032 C CB  . TYR A 1 132 ? 10.739  -19.987 7.749   1.00 41.33 ? 170 TYR A CB  1 
ATOM   1033 C CG  . TYR A 1 132 ? 9.620   -20.403 6.860   1.00 41.33 ? 170 TYR A CG  1 
ATOM   1034 C CD1 . TYR A 1 132 ? 9.770   -21.483 5.989   1.00 41.69 ? 170 TYR A CD1 1 
ATOM   1035 C CD2 . TYR A 1 132 ? 8.400   -19.708 6.869   1.00 41.35 ? 170 TYR A CD2 1 
ATOM   1036 C CE1 . TYR A 1 132 ? 8.723   -21.876 5.148   1.00 42.11 ? 170 TYR A CE1 1 
ATOM   1037 C CE2 . TYR A 1 132 ? 7.351   -20.082 6.037   1.00 41.32 ? 170 TYR A CE2 1 
ATOM   1038 C CZ  . TYR A 1 132 ? 7.520   -21.167 5.183   1.00 42.90 ? 170 TYR A CZ  1 
ATOM   1039 O OH  . TYR A 1 132 ? 6.499   -21.551 4.358   1.00 42.87 ? 170 TYR A OH  1 
ATOM   1040 N N   . GLN A 1 133 ? 13.687  -18.156 8.075   1.00 42.32 ? 171 GLN A N   1 
ATOM   1041 C CA  . GLN A 1 133 ? 14.653  -17.823 9.113   1.00 42.77 ? 171 GLN A CA  1 
ATOM   1042 C C   . GLN A 1 133 ? 15.009  -16.339 9.089   1.00 42.28 ? 171 GLN A C   1 
ATOM   1043 O O   . GLN A 1 133 ? 15.130  -15.718 10.147  1.00 42.25 ? 171 GLN A O   1 
ATOM   1044 C CB  . GLN A 1 133 ? 15.904  -18.693 8.987   1.00 42.99 ? 171 GLN A CB  1 
ATOM   1045 C CG  . GLN A 1 133 ? 15.712  -20.198 9.305   1.00 46.56 ? 171 GLN A CG  1 
ATOM   1046 C CD  . GLN A 1 133 ? 15.459  -20.490 10.797  1.00 50.16 ? 171 GLN A CD  1 
ATOM   1047 O OE1 . GLN A 1 133 ? 14.344  -20.292 11.309  1.00 51.95 ? 171 GLN A OE1 1 
ATOM   1048 N NE2 . GLN A 1 133 ? 16.493  -20.975 11.493  1.00 51.02 ? 171 GLN A NE2 1 
ATOM   1049 N N   . SER A 1 134 ? 15.184  -15.778 7.893   1.00 41.38 ? 172 SER A N   1 
ATOM   1050 C CA  . SER A 1 134 ? 15.388  -14.333 7.749   1.00 41.73 ? 172 SER A CA  1 
ATOM   1051 C C   . SER A 1 134 ? 15.163  -13.866 6.322   1.00 41.77 ? 172 SER A C   1 
ATOM   1052 O O   . SER A 1 134 ? 15.243  -14.662 5.382   1.00 41.97 ? 172 SER A O   1 
ATOM   1053 C CB  . SER A 1 134 ? 16.790  -13.912 8.201   1.00 41.26 ? 172 SER A CB  1 
ATOM   1054 O OG  . SER A 1 134 ? 17.755  -14.397 7.293   1.00 41.27 ? 172 SER A OG  1 
ATOM   1055 N N   . CYS A 1 135 ? 14.912  -12.567 6.185   1.00 42.38 ? 173 CYS A N   1 
ATOM   1056 C CA  . CYS A 1 135 ? 14.680  -11.896 4.900   1.00 43.07 ? 173 CYS A CA  1 
ATOM   1057 C C   . CYS A 1 135 ? 15.384  -10.528 4.875   1.00 43.41 ? 173 CYS A C   1 
ATOM   1058 O O   . CYS A 1 135 ? 15.562  -9.910  5.917   1.00 43.06 ? 173 CYS A O   1 
ATOM   1059 C CB  . CYS A 1 135 ? 13.165  -11.712 4.642   1.00 43.38 ? 173 CYS A CB  1 
ATOM   1060 S SG  . CYS A 1 135 ? 12.286  -13.251 4.156   1.00 43.52 ? 173 CYS A SG  1 
ATOM   1061 N N   . PRO A 1 136 ? 15.776  -10.048 3.685   1.00 43.92 ? 174 PRO A N   1 
ATOM   1062 C CA  . PRO A 1 136 ? 16.487  -8.780  3.631   1.00 44.80 ? 174 PRO A CA  1 
ATOM   1063 C C   . PRO A 1 136 ? 15.752  -7.608  4.302   1.00 45.41 ? 174 PRO A C   1 
ATOM   1064 O O   . PRO A 1 136 ? 14.573  -7.412  4.069   1.00 45.75 ? 174 PRO A O   1 
ATOM   1065 C CB  . PRO A 1 136 ? 16.619  -8.539  2.128   1.00 44.90 ? 174 PRO A CB  1 
ATOM   1066 C CG  . PRO A 1 136 ? 16.651  -9.922  1.538   1.00 43.62 ? 174 PRO A CG  1 
ATOM   1067 C CD  . PRO A 1 136 ? 15.616  -10.634 2.341   1.00 44.10 ? 174 PRO A CD  1 
ATOM   1068 N N   . ASP A 1 137 ? 16.439  -6.852  5.147   1.00 46.39 ? 175 ASP A N   1 
ATOM   1069 C CA  . ASP A 1 137 ? 15.888  -5.590  5.626   1.00 47.74 ? 175 ASP A CA  1 
ATOM   1070 C C   . ASP A 1 137 ? 16.115  -4.552  4.530   1.00 48.39 ? 175 ASP A C   1 
ATOM   1071 O O   . ASP A 1 137 ? 17.204  -4.466  3.957   1.00 48.21 ? 175 ASP A O   1 
ATOM   1072 C CB  . ASP A 1 137 ? 16.552  -5.162  6.942   1.00 48.30 ? 175 ASP A CB  1 
ATOM   1073 C CG  . ASP A 1 137 ? 15.891  -3.939  7.562   1.00 49.77 ? 175 ASP A CG  1 
ATOM   1074 O OD1 . ASP A 1 137 ? 16.565  -2.908  7.739   1.00 49.86 ? 175 ASP A OD1 1 
ATOM   1075 O OD2 . ASP A 1 137 ? 14.678  -4.000  7.843   1.00 54.13 ? 175 ASP A OD2 1 
ATOM   1076 N N   . TRP A 1 138 ? 15.087  -3.776  4.226   1.00 49.52 ? 176 TRP A N   1 
ATOM   1077 C CA  . TRP A 1 138 ? 15.161  -2.760  3.181   1.00 51.05 ? 176 TRP A CA  1 
ATOM   1078 C C   . TRP A 1 138 ? 16.367  -1.844  3.398   1.00 51.14 ? 176 TRP A C   1 
ATOM   1079 O O   . TRP A 1 138 ? 17.039  -1.437  2.447   1.00 50.59 ? 176 TRP A O   1 
ATOM   1080 C CB  . TRP A 1 138 ? 13.850  -1.958  3.163   1.00 52.88 ? 176 TRP A CB  1 
ATOM   1081 C CG  . TRP A 1 138 ? 13.830  -0.781  2.235   1.00 55.75 ? 176 TRP A CG  1 
ATOM   1082 C CD1 . TRP A 1 138 ? 13.533  -0.787  0.892   1.00 57.42 ? 176 TRP A CD1 1 
ATOM   1083 C CD2 . TRP A 1 138 ? 14.090  0.595   2.583   1.00 57.03 ? 176 TRP A CD2 1 
ATOM   1084 N NE1 . TRP A 1 138 ? 13.607  0.500   0.380   1.00 58.72 ? 176 TRP A NE1 1 
ATOM   1085 C CE2 . TRP A 1 138 ? 13.948  1.363   1.393   1.00 58.50 ? 176 TRP A CE2 1 
ATOM   1086 C CE3 . TRP A 1 138 ? 14.426  1.248   3.778   1.00 56.54 ? 176 TRP A CE3 1 
ATOM   1087 C CZ2 . TRP A 1 138 ? 14.139  2.758   1.368   1.00 57.53 ? 176 TRP A CZ2 1 
ATOM   1088 C CZ3 . TRP A 1 138 ? 14.619  2.636   3.755   1.00 57.24 ? 176 TRP A CZ3 1 
ATOM   1089 C CH2 . TRP A 1 138 ? 14.476  3.373   2.554   1.00 57.11 ? 176 TRP A CH2 1 
ATOM   1090 N N   . ARG A 1 139 ? 16.649  -1.555  4.662   1.00 51.36 ? 177 ARG A N   1 
ATOM   1091 C CA  . ARG A 1 139 ? 17.618  -0.540  5.016   1.00 52.05 ? 177 ARG A CA  1 
ATOM   1092 C C   . ARG A 1 139 ? 19.019  -1.126  5.142   1.00 51.81 ? 177 ARG A C   1 
ATOM   1093 O O   . ARG A 1 139 ? 19.964  -0.629  4.515   1.00 52.35 ? 177 ARG A O   1 
ATOM   1094 C CB  . ARG A 1 139 ? 17.184  0.145   6.309   1.00 52.38 ? 177 ARG A CB  1 
ATOM   1095 C CG  . ARG A 1 139 ? 17.455  1.610   6.352   1.00 52.72 ? 177 ARG A CG  1 
ATOM   1096 C CD  . ARG A 1 139 ? 17.623  2.061   7.788   1.00 55.00 ? 177 ARG A CD  1 
ATOM   1097 N NE  . ARG A 1 139 ? 18.177  3.416   7.858   1.00 56.44 ? 177 ARG A NE  1 
ATOM   1098 C CZ  . ARG A 1 139 ? 18.810  3.928   8.910   1.00 54.73 ? 177 ARG A CZ  1 
ATOM   1099 N NH1 . ARG A 1 139 ? 18.991  3.216   10.016  1.00 56.19 ? 177 ARG A NH1 1 
ATOM   1100 N NH2 . ARG A 1 139 ? 19.272  5.163   8.846   1.00 55.59 ? 177 ARG A NH2 1 
ATOM   1101 N N   . LYS A 1 140 ? 19.158  -2.185  5.937   1.00 51.54 ? 178 LYS A N   1 
ATOM   1102 C CA  . LYS A 1 140 ? 20.482  -2.766  6.199   1.00 51.43 ? 178 LYS A CA  1 
ATOM   1103 C C   . LYS A 1 140 ? 20.988  -3.659  5.063   1.00 50.30 ? 178 LYS A C   1 
ATOM   1104 O O   . LYS A 1 140 ? 22.203  -3.731  4.826   1.00 50.04 ? 178 LYS A O   1 
ATOM   1105 C CB  . LYS A 1 140 ? 20.511  -3.553  7.521   1.00 51.89 ? 178 LYS A CB  1 
ATOM   1106 C CG  . LYS A 1 140 ? 19.531  -3.049  8.583   1.00 54.75 ? 178 LYS A CG  1 
ATOM   1107 C CD  . LYS A 1 140 ? 19.917  -3.560  9.966   1.00 59.20 ? 178 LYS A CD  1 
ATOM   1108 C CE  . LYS A 1 140 ? 19.270  -2.732  11.090  1.00 60.66 ? 178 LYS A CE  1 
ATOM   1109 N NZ  . LYS A 1 140 ? 19.865  -3.085  12.428  1.00 61.99 ? 178 LYS A NZ  1 
ATOM   1110 N N   . ASP A 1 141 ? 20.065  -4.322  4.366   1.00 48.50 ? 179 ASP A N   1 
ATOM   1111 C CA  . ASP A 1 141 ? 20.439  -5.377  3.423   1.00 47.61 ? 179 ASP A CA  1 
ATOM   1112 C C   . ASP A 1 141 ? 20.365  -4.938  1.958   1.00 46.67 ? 179 ASP A C   1 
ATOM   1113 O O   . ASP A 1 141 ? 21.387  -4.881  1.285   1.00 45.99 ? 179 ASP A O   1 
ATOM   1114 C CB  . ASP A 1 141 ? 19.627  -6.665  3.672   1.00 47.35 ? 179 ASP A CB  1 
ATOM   1115 C CG  . ASP A 1 141 ? 19.942  -7.319  5.021   1.00 48.02 ? 179 ASP A CG  1 
ATOM   1116 O OD1 . ASP A 1 141 ? 21.115  -7.334  5.442   1.00 50.37 ? 179 ASP A OD1 1 
ATOM   1117 O OD2 . ASP A 1 141 ? 19.020  -7.822  5.682   1.00 47.71 ? 179 ASP A OD2 1 
ATOM   1118 N N   . CYS A 1 142 ? 19.160  -4.637  1.476   1.00 45.99 ? 180 CYS A N   1 
ATOM   1119 C CA  . CYS A 1 142 ? 18.928  -4.242  0.082   1.00 46.12 ? 180 CYS A CA  1 
ATOM   1120 C C   . CYS A 1 142 ? 17.495  -3.810  -0.041  1.00 45.86 ? 180 CYS A C   1 
ATOM   1121 O O   . CYS A 1 142 ? 16.636  -4.269  0.724   1.00 46.35 ? 180 CYS A O   1 
ATOM   1122 C CB  . CYS A 1 142 ? 19.181  -5.405  -0.883  1.00 45.81 ? 180 CYS A CB  1 
ATOM   1123 S SG  . CYS A 1 142 ? 18.231  -6.941  -0.495  1.00 49.36 ? 180 CYS A SG  1 
ATOM   1124 N N   . SER A 1 143 ? 17.214  -2.939  -1.003  1.00 45.61 ? 181 SER A N   1 
ATOM   1125 C CA  . SER A 1 143 ? 15.851  -2.477  -1.209  1.00 45.09 ? 181 SER A CA  1 
ATOM   1126 C C   . SER A 1 143 ? 15.146  -3.249  -2.316  1.00 44.26 ? 181 SER A C   1 
ATOM   1127 O O   . SER A 1 143 ? 13.938  -3.175  -2.426  1.00 43.88 ? 181 SER A O   1 
ATOM   1128 C CB  . SER A 1 143 ? 15.827  -0.971  -1.499  1.00 45.62 ? 181 SER A CB  1 
ATOM   1129 O OG  . SER A 1 143 ? 16.669  -0.676  -2.597  1.00 47.98 ? 181 SER A OG  1 
ATOM   1130 N N   . ASN A 1 144 ? 15.889  -3.999  -3.129  1.00 43.58 ? 182 ASN A N   1 
ATOM   1131 C CA  . ASN A 1 144 ? 15.271  -4.828  -4.179  1.00 43.23 ? 182 ASN A CA  1 
ATOM   1132 C C   . ASN A 1 144 ? 14.849  -6.206  -3.617  1.00 41.74 ? 182 ASN A C   1 
ATOM   1133 O O   . ASN A 1 144 ? 15.167  -7.220  -4.211  1.00 41.30 ? 182 ASN A O   1 
ATOM   1134 C CB  . ASN A 1 144 ? 16.259  -5.056  -5.351  1.00 44.59 ? 182 ASN A CB  1 
ATOM   1135 C CG  . ASN A 1 144 ? 16.206  -3.973  -6.440  1.00 49.12 ? 182 ASN A CG  1 
ATOM   1136 O OD1 . ASN A 1 144 ? 15.678  -2.864  -6.254  1.00 53.25 ? 182 ASN A OD1 1 
ATOM   1137 N ND2 . ASN A 1 144 ? 16.792  -4.301  -7.599  1.00 54.10 ? 182 ASN A ND2 1 
ATOM   1138 N N   . ASN A 1 145 ? 14.179  -6.240  -2.466  1.00 39.89 ? 183 ASN A N   1 
ATOM   1139 C CA  . ASN A 1 145 ? 13.772  -7.492  -1.846  1.00 39.77 ? 183 ASN A CA  1 
ATOM   1140 C C   . ASN A 1 145 ? 12.298  -7.829  -2.176  1.00 38.98 ? 183 ASN A C   1 
ATOM   1141 O O   . ASN A 1 145 ? 11.567  -6.946  -2.610  1.00 38.64 ? 183 ASN A O   1 
ATOM   1142 C CB  . ASN A 1 145 ? 14.046  -7.448  -0.336  1.00 39.16 ? 183 ASN A CB  1 
ATOM   1143 C CG  . ASN A 1 145 ? 13.240  -6.372  0.385   1.00 40.66 ? 183 ASN A CG  1 
ATOM   1144 O OD1 . ASN A 1 145 ? 13.796  -5.349  0.775   1.00 43.38 ? 183 ASN A OD1 1 
ATOM   1145 N ND2 . ASN A 1 145 ? 11.946  -6.612  0.600   1.00 37.08 ? 183 ASN A ND2 1 
ATOM   1146 N N   . PRO A 1 146 ? 11.869  -9.102  -2.003  1.00 39.13 ? 184 PRO A N   1 
ATOM   1147 C CA  . PRO A 1 146 ? 10.495  -9.477  -2.415  1.00 38.29 ? 184 PRO A CA  1 
ATOM   1148 C C   . PRO A 1 146 ? 9.392   -8.598  -1.816  1.00 38.90 ? 184 PRO A C   1 
ATOM   1149 O O   . PRO A 1 146 ? 8.459   -8.235  -2.530  1.00 38.11 ? 184 PRO A O   1 
ATOM   1150 C CB  . PRO A 1 146 ? 10.363  -10.931 -1.958  1.00 38.34 ? 184 PRO A CB  1 
ATOM   1151 C CG  . PRO A 1 146 ? 11.812  -11.452 -1.960  1.00 37.30 ? 184 PRO A CG  1 
ATOM   1152 C CD  . PRO A 1 146 ? 12.617  -10.268 -1.471  1.00 38.59 ? 184 PRO A CD  1 
ATOM   1153 N N   . VAL A 1 147 ? 9.502   -8.228  -0.544  1.00 39.26 ? 185 VAL A N   1 
ATOM   1154 C CA  . VAL A 1 147 ? 8.420   -7.454  0.089   1.00 39.86 ? 185 VAL A CA  1 
ATOM   1155 C C   . VAL A 1 147 ? 8.392   -5.998  -0.411  1.00 40.36 ? 185 VAL A C   1 
ATOM   1156 O O   . VAL A 1 147 ? 7.347   -5.509  -0.821  1.00 40.99 ? 185 VAL A O   1 
ATOM   1157 C CB  . VAL A 1 147 ? 8.464   -7.553  1.649   1.00 40.54 ? 185 VAL A CB  1 
ATOM   1158 C CG1 . VAL A 1 147 ? 7.494   -6.552  2.327   1.00 37.78 ? 185 VAL A CG1 1 
ATOM   1159 C CG2 . VAL A 1 147 ? 8.172   -9.002  2.091   1.00 38.27 ? 185 VAL A CG2 1 
ATOM   1160 N N   . SER A 1 148 ? 9.543   -5.336  -0.425  1.00 39.89 ? 186 SER A N   1 
ATOM   1161 C CA  . SER A 1 148 ? 9.592   -3.948  -0.803  1.00 39.85 ? 186 SER A CA  1 
ATOM   1162 C C   . SER A 1 148 ? 9.224   -3.766  -2.258  1.00 39.40 ? 186 SER A C   1 
ATOM   1163 O O   . SER A 1 148 ? 8.572   -2.797  -2.590  1.00 38.40 ? 186 SER A O   1 
ATOM   1164 C CB  . SER A 1 148 ? 10.995  -3.375  -0.567  1.00 40.08 ? 186 SER A CB  1 
ATOM   1165 O OG  . SER A 1 148 ? 11.323  -3.471  0.802   1.00 40.39 ? 186 SER A OG  1 
ATOM   1166 N N   . VAL A 1 149 ? 9.665   -4.686  -3.119  1.00 37.95 ? 187 VAL A N   1 
ATOM   1167 C CA  . VAL A 1 149 ? 9.406   -4.568  -4.562  1.00 37.94 ? 187 VAL A CA  1 
ATOM   1168 C C   . VAL A 1 149 ? 7.903   -4.832  -4.873  1.00 37.31 ? 187 VAL A C   1 
ATOM   1169 O O   . VAL A 1 149 ? 7.289   -4.180  -5.754  1.00 37.15 ? 187 VAL A O   1 
ATOM   1170 C CB  . VAL A 1 149 ? 10.314  -5.515  -5.398  1.00 37.94 ? 187 VAL A CB  1 
ATOM   1171 C CG1 . VAL A 1 149 ? 9.910   -5.483  -6.876  1.00 38.28 ? 187 VAL A CG1 1 
ATOM   1172 C CG2 . VAL A 1 149 ? 11.788  -5.080  -5.285  1.00 36.83 ? 187 VAL A CG2 1 
ATOM   1173 N N   . PHE A 1 150 ? 7.326   -5.774  -4.142  1.00 36.48 ? 188 PHE A N   1 
ATOM   1174 C CA  . PHE A 1 150 ? 5.896   -6.005  -4.241  1.00 36.60 ? 188 PHE A CA  1 
ATOM   1175 C C   . PHE A 1 150 ? 5.149   -4.727  -3.919  1.00 37.06 ? 188 PHE A C   1 
ATOM   1176 O O   . PHE A 1 150 ? 4.317   -4.287  -4.693  1.00 37.62 ? 188 PHE A O   1 
ATOM   1177 C CB  . PHE A 1 150 ? 5.449   -7.118  -3.315  1.00 36.51 ? 188 PHE A CB  1 
ATOM   1178 C CG  . PHE A 1 150 ? 3.972   -7.258  -3.235  1.00 38.18 ? 188 PHE A CG  1 
ATOM   1179 C CD1 . PHE A 1 150 ? 3.295   -8.128  -4.092  1.00 38.39 ? 188 PHE A CD1 1 
ATOM   1180 C CD2 . PHE A 1 150 ? 3.243   -6.551  -2.294  1.00 36.58 ? 188 PHE A CD2 1 
ATOM   1181 C CE1 . PHE A 1 150 ? 1.908   -8.265  -4.025  1.00 37.46 ? 188 PHE A CE1 1 
ATOM   1182 C CE2 . PHE A 1 150 ? 1.851   -6.671  -2.231  1.00 37.94 ? 188 PHE A CE2 1 
ATOM   1183 C CZ  . PHE A 1 150 ? 1.197   -7.528  -3.103  1.00 36.98 ? 188 PHE A CZ  1 
ATOM   1184 N N   . TRP A 1 151 ? 5.425   -4.107  -2.784  1.00 37.73 ? 189 TRP A N   1 
ATOM   1185 C CA  . TRP A 1 151 ? 4.584   -2.963  -2.377  1.00 38.05 ? 189 TRP A CA  1 
ATOM   1186 C C   . TRP A 1 151 ? 4.739   -1.763  -3.303  1.00 39.30 ? 189 TRP A C   1 
ATOM   1187 O O   . TRP A 1 151 ? 3.768   -1.034  -3.579  1.00 39.01 ? 189 TRP A O   1 
ATOM   1188 C CB  . TRP A 1 151 ? 4.811   -2.619  -0.919  1.00 36.93 ? 189 TRP A CB  1 
ATOM   1189 C CG  . TRP A 1 151 ? 4.154   -3.627  0.009   1.00 38.62 ? 189 TRP A CG  1 
ATOM   1190 C CD1 . TRP A 1 151 ? 4.786   -4.514  0.854   1.00 37.67 ? 189 TRP A CD1 1 
ATOM   1191 C CD2 . TRP A 1 151 ? 2.748   -3.852  0.182   1.00 36.15 ? 189 TRP A CD2 1 
ATOM   1192 N NE1 . TRP A 1 151 ? 3.866   -5.239  1.545   1.00 37.69 ? 189 TRP A NE1 1 
ATOM   1193 C CE2 . TRP A 1 151 ? 2.608   -4.876  1.136   1.00 36.68 ? 189 TRP A CE2 1 
ATOM   1194 C CE3 . TRP A 1 151 ? 1.602   -3.312  -0.405  1.00 35.78 ? 189 TRP A CE3 1 
ATOM   1195 C CZ2 . TRP A 1 151 ? 1.371   -5.340  1.550   1.00 36.90 ? 189 TRP A CZ2 1 
ATOM   1196 C CZ3 . TRP A 1 151 ? 0.373   -3.773  0.005   1.00 35.92 ? 189 TRP A CZ3 1 
ATOM   1197 C CH2 . TRP A 1 151 ? 0.266   -4.774  0.972   1.00 36.44 ? 189 TRP A CH2 1 
ATOM   1198 N N   . LYS A 1 152 ? 5.953   -1.586  -3.816  1.00 39.02 ? 190 LYS A N   1 
ATOM   1199 C CA  . LYS A 1 152 ? 6.231   -0.549  -4.794  1.00 40.69 ? 190 LYS A CA  1 
ATOM   1200 C C   . LYS A 1 152 ? 5.412   -0.738  -6.090  1.00 41.27 ? 190 LYS A C   1 
ATOM   1201 O O   . LYS A 1 152 ? 4.807   0.219   -6.591  1.00 41.77 ? 190 LYS A O   1 
ATOM   1202 C CB  . LYS A 1 152 ? 7.742   -0.482  -5.092  1.00 40.57 ? 190 LYS A CB  1 
ATOM   1203 C CG  . LYS A 1 152 ? 8.091   0.580   -6.104  1.00 43.46 ? 190 LYS A CG  1 
ATOM   1204 C CD  . LYS A 1 152 ? 9.558   0.923   -6.109  1.00 44.25 ? 190 LYS A CD  1 
ATOM   1205 C CE  . LYS A 1 152 ? 9.726   2.333   -6.699  1.00 48.17 ? 190 LYS A CE  1 
ATOM   1206 N NZ  . LYS A 1 152 ? 11.135  2.696   -6.974  1.00 51.12 ? 190 LYS A NZ  1 
ATOM   1207 N N   . THR A 1 153 ? 5.419   -1.960  -6.624  1.00 40.80 ? 191 THR A N   1 
ATOM   1208 C CA  . THR A 1 153 ? 4.709   -2.306  -7.834  1.00 41.17 ? 191 THR A CA  1 
ATOM   1209 C C   . THR A 1 153 ? 3.208   -2.132  -7.650  1.00 40.73 ? 191 THR A C   1 
ATOM   1210 O O   . THR A 1 153 ? 2.565   -1.507  -8.486  1.00 41.33 ? 191 THR A O   1 
ATOM   1211 C CB  . THR A 1 153 ? 4.940   -3.771  -8.217  1.00 41.67 ? 191 THR A CB  1 
ATOM   1212 O OG1 . THR A 1 153 ? 6.341   -4.045  -8.201  1.00 45.83 ? 191 THR A OG1 1 
ATOM   1213 C CG2 . THR A 1 153 ? 4.424   -4.033  -9.589  1.00 42.57 ? 191 THR A CG2 1 
ATOM   1214 N N   . VAL A 1 154 ? 2.642   -2.692  -6.590  1.00 39.08 ? 192 VAL A N   1 
ATOM   1215 C CA  . VAL A 1 154 ? 1.206   -2.554  -6.391  1.00 39.99 ? 192 VAL A CA  1 
ATOM   1216 C C   . VAL A 1 154 ? 0.774   -1.116  -5.995  1.00 40.60 ? 192 VAL A C   1 
ATOM   1217 O O   . VAL A 1 154 ? -0.277  -0.661  -6.443  1.00 41.30 ? 192 VAL A O   1 
ATOM   1218 C CB  . VAL A 1 154 ? 0.594   -3.660  -5.432  1.00 40.09 ? 192 VAL A CB  1 
ATOM   1219 C CG1 . VAL A 1 154 ? 0.895   -5.076  -5.973  1.00 41.54 ? 192 VAL A CG1 1 
ATOM   1220 C CG2 . VAL A 1 154 ? 1.133   -3.550  -4.033  1.00 40.61 ? 192 VAL A CG2 1 
ATOM   1221 N N   . SER A 1 155 ? 1.579   -0.387  -5.212  1.00 40.84 ? 193 SER A N   1 
ATOM   1222 C CA  . SER A 1 155 ? 1.206   0.969   -4.809  1.00 40.54 ? 193 SER A CA  1 
ATOM   1223 C C   . SER A 1 155 ? 1.231   1.883   -6.026  1.00 41.09 ? 193 SER A C   1 
ATOM   1224 O O   . SER A 1 155 ? 0.400   2.759   -6.172  1.00 40.34 ? 193 SER A O   1 
ATOM   1225 C CB  . SER A 1 155 ? 2.180   1.516   -3.781  1.00 41.33 ? 193 SER A CB  1 
ATOM   1226 O OG  . SER A 1 155 ? 2.112   0.798   -2.553  1.00 46.10 ? 193 SER A OG  1 
ATOM   1227 N N   . ARG A 1 156 ? 2.200   1.688   -6.906  1.00 41.39 ? 194 ARG A N   1 
ATOM   1228 C CA  . ARG A 1 156 ? 2.242   2.455   -8.138  1.00 42.59 ? 194 ARG A CA  1 
ATOM   1229 C C   . ARG A 1 156 ? 0.998   2.274   -9.016  1.00 43.07 ? 194 ARG A C   1 
ATOM   1230 O O   . ARG A 1 156 ? 0.393   3.260   -9.448  1.00 43.93 ? 194 ARG A O   1 
ATOM   1231 C CB  . ARG A 1 156 ? 3.488   2.163   -8.986  1.00 42.39 ? 194 ARG A CB  1 
ATOM   1232 C CG  . ARG A 1 156 ? 3.394   2.967   -10.285 1.00 46.42 ? 194 ARG A CG  1 
ATOM   1233 C CD  . ARG A 1 156 ? 4.695   3.170   -11.001 1.00 52.33 ? 194 ARG A CD  1 
ATOM   1234 N NE  . ARG A 1 156 ? 5.293   1.902   -11.338 1.00 57.56 ? 194 ARG A NE  1 
ATOM   1235 C CZ  . ARG A 1 156 ? 6.273   1.338   -10.648 1.00 59.97 ? 194 ARG A CZ  1 
ATOM   1236 N NH1 . ARG A 1 156 ? 6.796   1.924   -9.577  1.00 61.79 ? 194 ARG A NH1 1 
ATOM   1237 N NH2 . ARG A 1 156 ? 6.749   0.181   -11.057 1.00 63.45 ? 194 ARG A NH2 1 
ATOM   1238 N N   . ARG A 1 157 ? 0.639   1.040   -9.318  1.00 41.67 ? 195 ARG A N   1 
ATOM   1239 C CA  . ARG A 1 157 ? -0.553  0.804   -10.092 1.00 42.93 ? 195 ARG A CA  1 
ATOM   1240 C C   . ARG A 1 157 ? -1.839  1.375   -9.422  1.00 41.20 ? 195 ARG A C   1 
ATOM   1241 O O   . ARG A 1 157 ? -2.664  1.941   -10.085 1.00 41.09 ? 195 ARG A O   1 
ATOM   1242 C CB  . ARG A 1 157 ? -0.693  -0.681  -10.413 1.00 42.71 ? 195 ARG A CB  1 
ATOM   1243 C CG  . ARG A 1 157 ? -1.841  -0.963  -11.417 1.00 47.02 ? 195 ARG A CG  1 
ATOM   1244 C CD  . ARG A 1 157 ? -1.822  -2.383  -12.035 1.00 48.18 ? 195 ARG A CD  1 
ATOM   1245 N NE  . ARG A 1 157 ? -2.386  -3.429  -11.161 1.00 54.98 ? 195 ARG A NE  1 
ATOM   1246 C CZ  . ARG A 1 157 ? -2.628  -4.684  -11.557 1.00 56.89 ? 195 ARG A CZ  1 
ATOM   1247 N NH1 . ARG A 1 157 ? -2.367  -5.047  -12.814 1.00 58.67 ? 195 ARG A NH1 1 
ATOM   1248 N NH2 . ARG A 1 157 ? -3.134  -5.577  -10.701 1.00 56.05 ? 195 ARG A NH2 1 
ATOM   1249 N N   . PHE A 1 158 ? -1.990  1.194   -8.125  1.00 40.86 ? 196 PHE A N   1 
ATOM   1250 C CA  . PHE A 1 158 ? -3.108  1.761   -7.358  1.00 41.58 ? 196 PHE A CA  1 
ATOM   1251 C C   . PHE A 1 158 ? -3.142  3.301   -7.444  1.00 41.75 ? 196 PHE A C   1 
ATOM   1252 O O   . PHE A 1 158 ? -4.195  3.887   -7.705  1.00 42.73 ? 196 PHE A O   1 
ATOM   1253 C CB  . PHE A 1 158 ? -2.971  1.326   -5.910  1.00 40.47 ? 196 PHE A CB  1 
ATOM   1254 C CG  . PHE A 1 158 ? -4.203  1.544   -5.082  1.00 42.45 ? 196 PHE A CG  1 
ATOM   1255 C CD1 . PHE A 1 158 ? -5.413  0.878   -5.397  1.00 39.17 ? 196 PHE A CD1 1 
ATOM   1256 C CD2 . PHE A 1 158 ? -4.156  2.376   -3.949  1.00 41.25 ? 196 PHE A CD2 1 
ATOM   1257 C CE1 . PHE A 1 158 ? -6.558  1.048   -4.590  1.00 42.03 ? 196 PHE A CE1 1 
ATOM   1258 C CE2 . PHE A 1 158 ? -5.289  2.544   -3.147  1.00 41.25 ? 196 PHE A CE2 1 
ATOM   1259 C CZ  . PHE A 1 158 ? -6.496  1.882   -3.466  1.00 38.75 ? 196 PHE A CZ  1 
ATOM   1260 N N   . ALA A 1 159 ? -1.998  3.956   -7.252  1.00 41.00 ? 197 ALA A N   1 
ATOM   1261 C CA  . ALA A 1 159 ? -1.907  5.415   -7.464  1.00 40.67 ? 197 ALA A CA  1 
ATOM   1262 C C   . ALA A 1 159 ? -2.283  5.851   -8.889  1.00 40.04 ? 197 ALA A C   1 
ATOM   1263 O O   . ALA A 1 159 ? -2.951  6.854   -9.053  1.00 38.85 ? 197 ALA A O   1 
ATOM   1264 C CB  . ALA A 1 159 ? -0.527  5.972   -7.080  1.00 40.88 ? 197 ALA A CB  1 
ATOM   1265 N N   . GLU A 1 160 ? -1.901  5.076   -9.888  1.00 39.06 ? 198 GLU A N   1 
ATOM   1266 C CA  . GLU A 1 160 ? -2.222  5.386   -11.278 1.00 40.85 ? 198 GLU A CA  1 
ATOM   1267 C C   . GLU A 1 160 ? -3.698  5.207   -11.619 1.00 40.65 ? 198 GLU A C   1 
ATOM   1268 O O   . GLU A 1 160 ? -4.159  5.707   -12.642 1.00 39.68 ? 198 GLU A O   1 
ATOM   1269 C CB  . GLU A 1 160 ? -1.427  4.488   -12.211 1.00 41.02 ? 198 GLU A CB  1 
ATOM   1270 C CG  . GLU A 1 160 ? 0.054   4.820   -12.248 1.00 43.47 ? 198 GLU A CG  1 
ATOM   1271 C CD  . GLU A 1 160 ? 0.871   3.825   -13.068 1.00 43.97 ? 198 GLU A CD  1 
ATOM   1272 O OE1 . GLU A 1 160 ? 0.549   2.614   -13.103 1.00 48.15 ? 198 GLU A OE1 1 
ATOM   1273 O OE2 . GLU A 1 160 ? 1.870   4.269   -13.668 1.00 50.75 ? 198 GLU A OE2 1 
ATOM   1274 N N   . ALA A 1 161 ? -4.441  4.489   -10.792 1.00 40.59 ? 199 ALA A N   1 
ATOM   1275 C CA  . ALA A 1 161 ? -5.866  4.250   -11.137 1.00 42.11 ? 199 ALA A CA  1 
ATOM   1276 C C   . ALA A 1 161 ? -6.746  5.373   -10.564 1.00 42.15 ? 199 ALA A C   1 
ATOM   1277 O O   . ALA A 1 161 ? -7.906  5.491   -10.928 1.00 42.89 ? 199 ALA A O   1 
ATOM   1278 C CB  . ALA A 1 161 ? -6.340  2.882   -10.627 1.00 41.52 ? 199 ALA A CB  1 
ATOM   1279 N N   . ALA A 1 162 ? -6.192  6.204   -9.690  1.00 41.36 ? 200 ALA A N   1 
ATOM   1280 C CA  . ALA A 1 162 ? -6.989  7.241   -9.016  1.00 41.05 ? 200 ALA A CA  1 
ATOM   1281 C C   . ALA A 1 162 ? -7.403  8.431   -9.916  1.00 40.63 ? 200 ALA A C   1 
ATOM   1282 O O   . ALA A 1 162 ? -6.713  8.809   -10.870 1.00 39.59 ? 200 ALA A O   1 
ATOM   1283 C CB  . ALA A 1 162 ? -6.251  7.730   -7.780  1.00 40.61 ? 200 ALA A CB  1 
ATOM   1284 N N   . CYS A 1 163 ? -8.532  9.035   -9.581  1.00 40.09 ? 201 CYS A N   1 
ATOM   1285 C CA  . CYS A 1 163 ? -9.043  10.152  -10.327 1.00 40.40 ? 201 CYS A CA  1 
ATOM   1286 C C   . CYS A 1 163 ? -9.768  11.016  -9.324  1.00 40.25 ? 201 CYS A C   1 
ATOM   1287 O O   . CYS A 1 163 ? -10.027 10.582  -8.171  1.00 40.27 ? 201 CYS A O   1 
ATOM   1288 C CB  . CYS A 1 163 ? -10.006 9.647   -11.446 1.00 40.92 ? 201 CYS A CB  1 
ATOM   1289 S SG  . CYS A 1 163 ? -11.630 9.091   -10.742 1.00 46.42 ? 201 CYS A SG  1 
ATOM   1290 N N   . ASP A 1 164 ? -10.097 12.231  -9.759  1.00 39.05 ? 202 ASP A N   1 
ATOM   1291 C CA  . ASP A 1 164 ? -10.912 13.173  -9.004  1.00 38.79 ? 202 ASP A CA  1 
ATOM   1292 C C   . ASP A 1 164 ? -10.263 13.671  -7.702  1.00 37.87 ? 202 ASP A C   1 
ATOM   1293 O O   . ASP A 1 164 ? -9.204  14.249  -7.740  1.00 38.56 ? 202 ASP A O   1 
ATOM   1294 C CB  . ASP A 1 164 ? -12.336 12.613  -8.811  1.00 37.87 ? 202 ASP A CB  1 
ATOM   1295 C CG  . ASP A 1 164 ? -13.019 12.307  -10.143 1.00 40.36 ? 202 ASP A CG  1 
ATOM   1296 O OD1 . ASP A 1 164 ? -12.587 12.841  -11.205 1.00 37.46 ? 202 ASP A OD1 1 
ATOM   1297 O OD2 . ASP A 1 164 ? -14.010 11.548  -10.138 1.00 40.63 ? 202 ASP A OD2 1 
ATOM   1298 N N   . VAL A 1 165 ? -10.921 13.474  -6.570  1.00 37.47 ? 203 VAL A N   1 
ATOM   1299 C CA  . VAL A 1 165 ? -10.320 13.751  -5.262  1.00 37.82 ? 203 VAL A CA  1 
ATOM   1300 C C   . VAL A 1 165 ? -9.758  12.461  -4.720  1.00 38.24 ? 203 VAL A C   1 
ATOM   1301 O O   . VAL A 1 165 ? -10.463 11.480  -4.593  1.00 38.03 ? 203 VAL A O   1 
ATOM   1302 C CB  . VAL A 1 165 ? -11.295 14.447  -4.256  1.00 38.82 ? 203 VAL A CB  1 
ATOM   1303 C CG1 . VAL A 1 165 ? -10.538 14.852  -2.981  1.00 36.52 ? 203 VAL A CG1 1 
ATOM   1304 C CG2 . VAL A 1 165 ? -11.908 15.751  -4.887  1.00 37.58 ? 203 VAL A CG2 1 
ATOM   1305 N N   . VAL A 1 166 ? -8.465  12.463  -4.438  1.00 37.89 ? 204 VAL A N   1 
ATOM   1306 C CA  . VAL A 1 166 ? -7.802  11.362  -3.776  1.00 38.25 ? 204 VAL A CA  1 
ATOM   1307 C C   . VAL A 1 166 ? -7.461  11.853  -2.368  1.00 38.65 ? 204 VAL A C   1 
ATOM   1308 O O   . VAL A 1 166 ? -7.133  13.017  -2.170  1.00 39.39 ? 204 VAL A O   1 
ATOM   1309 C CB  . VAL A 1 166 ? -6.517  10.990  -4.532  1.00 38.18 ? 204 VAL A CB  1 
ATOM   1310 C CG1 . VAL A 1 166 ? -5.850  9.805   -3.921  1.00 39.07 ? 204 VAL A CG1 1 
ATOM   1311 C CG2 . VAL A 1 166 ? -6.827  10.695  -5.975  1.00 39.90 ? 204 VAL A CG2 1 
ATOM   1312 N N   . HIS A 1 167 ? -7.621  10.984  -1.385  1.00 38.92 ? 205 HIS A N   1 
ATOM   1313 C CA  . HIS A 1 167 ? -7.415  11.337  0.026   1.00 39.19 ? 205 HIS A CA  1 
ATOM   1314 C C   . HIS A 1 167 ? -6.212  10.565  0.540   1.00 39.03 ? 205 HIS A C   1 
ATOM   1315 O O   . HIS A 1 167 ? -5.936  9.425   0.093   1.00 37.87 ? 205 HIS A O   1 
ATOM   1316 C CB  . HIS A 1 167 ? -8.634  10.989  0.889   1.00 39.34 ? 205 HIS A CB  1 
ATOM   1317 C CG  . HIS A 1 167 ? -9.821  11.870  0.642   1.00 41.57 ? 205 HIS A CG  1 
ATOM   1318 N ND1 . HIS A 1 167 ? -10.706 11.647  -0.389  1.00 40.26 ? 205 HIS A ND1 1 
ATOM   1319 C CD2 . HIS A 1 167 ? -10.260 12.983  1.282   1.00 42.61 ? 205 HIS A CD2 1 
ATOM   1320 C CE1 . HIS A 1 167 ? -11.639 12.583  -0.377  1.00 42.92 ? 205 HIS A CE1 1 
ATOM   1321 N NE2 . HIS A 1 167 ? -11.390 13.406  0.624   1.00 42.46 ? 205 HIS A NE2 1 
ATOM   1322 N N   . VAL A 1 168 ? -5.505  11.175  1.489   1.00 39.18 ? 206 VAL A N   1 
ATOM   1323 C CA  . VAL A 1 168 ? -4.412  10.483  2.183   1.00 38.30 ? 206 VAL A CA  1 
ATOM   1324 C C   . VAL A 1 168 ? -4.473  10.773  3.678   1.00 38.54 ? 206 VAL A C   1 
ATOM   1325 O O   . VAL A 1 168 ? -4.692  11.908  4.089   1.00 38.58 ? 206 VAL A O   1 
ATOM   1326 C CB  . VAL A 1 168 ? -3.041  10.812  1.557   1.00 38.56 ? 206 VAL A CB  1 
ATOM   1327 C CG1 . VAL A 1 168 ? -2.828  12.299  1.519   1.00 36.88 ? 206 VAL A CG1 1 
ATOM   1328 C CG2 . VAL A 1 168 ? -1.871  10.044  2.280   1.00 36.43 ? 206 VAL A CG2 1 
ATOM   1329 N N   . MET A 1 169 ? -4.393  9.721   4.474   1.00 38.06 ? 207 MET A N   1 
ATOM   1330 C CA  . MET A 1 169 ? -4.293  9.846   5.912   1.00 38.68 ? 207 MET A CA  1 
ATOM   1331 C C   . MET A 1 169 ? -2.846  9.832   6.281   1.00 38.30 ? 207 MET A C   1 
ATOM   1332 O O   . MET A 1 169 ? -2.142  8.915   5.885   1.00 38.17 ? 207 MET A O   1 
ATOM   1333 C CB  . MET A 1 169 ? -4.938  8.665   6.595   1.00 39.13 ? 207 MET A CB  1 
ATOM   1334 C CG  . MET A 1 169 ? -6.392  8.859   6.808   1.00 40.41 ? 207 MET A CG  1 
ATOM   1335 S SD  . MET A 1 169 ? -7.020  7.607   7.894   1.00 41.99 ? 207 MET A SD  1 
ATOM   1336 C CE  . MET A 1 169 ? -8.766  7.931   7.575   1.00 40.22 ? 207 MET A CE  1 
ATOM   1337 N N   . LEU A 1 170 ? -2.411  10.840  7.036   1.00 38.01 ? 208 LEU A N   1 
ATOM   1338 C CA  . LEU A 1 170 ? -1.041  10.916  7.541   1.00 37.80 ? 208 LEU A CA  1 
ATOM   1339 C C   . LEU A 1 170 ? -1.016  10.931  9.061   1.00 38.70 ? 208 LEU A C   1 
ATOM   1340 O O   . LEU A 1 170 ? -1.931  11.458  9.716   1.00 37.78 ? 208 LEU A O   1 
ATOM   1341 C CB  . LEU A 1 170 ? -0.321  12.159  7.017   1.00 36.53 ? 208 LEU A CB  1 
ATOM   1342 C CG  . LEU A 1 170 ? -0.377  12.360  5.510   1.00 36.12 ? 208 LEU A CG  1 
ATOM   1343 C CD1 . LEU A 1 170 ? 0.021   13.767  5.142   1.00 36.82 ? 208 LEU A CD1 1 
ATOM   1344 C CD2 . LEU A 1 170 ? 0.487   11.335  4.812   1.00 36.36 ? 208 LEU A CD2 1 
ATOM   1345 N N   . ASP A 1 171 ? 0.050   10.353  9.606   1.00 40.06 ? 209 ASP A N   1 
ATOM   1346 C CA  . ASP A 1 171 ? 0.248   10.279  11.056  1.00 42.04 ? 209 ASP A CA  1 
ATOM   1347 C C   . ASP A 1 171 ? 0.881   11.551  11.578  1.00 42.09 ? 209 ASP A C   1 
ATOM   1348 O O   . ASP A 1 171 ? 2.097   11.720  11.509  1.00 42.37 ? 209 ASP A O   1 
ATOM   1349 C CB  . ASP A 1 171 ? 1.171   9.107   11.352  1.00 42.36 ? 209 ASP A CB  1 
ATOM   1350 C CG  . ASP A 1 171 ? 1.455   8.936   12.799  1.00 43.13 ? 209 ASP A CG  1 
ATOM   1351 O OD1 . ASP A 1 171 ? 0.845   9.634   13.668  1.00 44.54 ? 209 ASP A OD1 1 
ATOM   1352 O OD2 . ASP A 1 171 ? 2.309   8.067   13.065  1.00 45.11 ? 209 ASP A OD2 1 
ATOM   1353 N N   . GLY A 1 172 ? 0.050   12.423  12.126  1.00 42.52 ? 210 GLY A N   1 
ATOM   1354 C CA  . GLY A 1 172 ? 0.492   13.705  12.612  1.00 43.30 ? 210 GLY A CA  1 
ATOM   1355 C C   . GLY A 1 172 ? 1.286   13.700  13.899  1.00 44.27 ? 210 GLY A C   1 
ATOM   1356 O O   . GLY A 1 172 ? 1.612   14.759  14.414  1.00 43.37 ? 210 GLY A O   1 
ATOM   1357 N N   . SER A 1 173 ? 1.620   12.521  14.417  1.00 45.59 ? 211 SER A N   1 
ATOM   1358 C CA  . SER A 1 173 ? 2.473   12.439  15.619  1.00 47.01 ? 211 SER A CA  1 
ATOM   1359 C C   . SER A 1 173 ? 3.930   12.070  15.274  1.00 48.66 ? 211 SER A C   1 
ATOM   1360 O O   . SER A 1 173 ? 4.777   11.961  16.125  1.00 48.76 ? 211 SER A O   1 
ATOM   1361 C CB  . SER A 1 173 ? 1.878   11.453  16.613  1.00 46.45 ? 211 SER A CB  1 
ATOM   1362 O OG  . SER A 1 173 ? 1.753   10.186  16.031  1.00 44.81 ? 211 SER A OG  1 
ATOM   1363 N N   . ARG A 1 174 ? 4.192   11.862  13.997  1.00 51.33 ? 212 ARG A N   1 
ATOM   1364 C CA  . ARG A 1 174 ? 5.528   11.641  13.466  1.00 53.69 ? 212 ARG A CA  1 
ATOM   1365 C C   . ARG A 1 174 ? 6.183   13.008  13.404  1.00 53.47 ? 212 ARG A C   1 
ATOM   1366 O O   . ARG A 1 174 ? 5.487   14.015  13.272  1.00 53.68 ? 212 ARG A O   1 
ATOM   1367 C CB  . ARG A 1 174 ? 5.381   11.085  12.033  1.00 54.64 ? 212 ARG A CB  1 
ATOM   1368 C CG  . ARG A 1 174 ? 6.570   10.314  11.472  1.00 59.83 ? 212 ARG A CG  1 
ATOM   1369 C CD  . ARG A 1 174 ? 6.618   8.877   12.008  1.00 67.24 ? 212 ARG A CD  1 
ATOM   1370 N NE  . ARG A 1 174 ? 7.287   7.939   11.090  1.00 71.65 ? 212 ARG A NE  1 
ATOM   1371 C CZ  . ARG A 1 174 ? 8.064   6.924   11.488  1.00 73.22 ? 212 ARG A CZ  1 
ATOM   1372 N NH1 . ARG A 1 174 ? 8.302   6.719   12.784  1.00 73.25 ? 212 ARG A NH1 1 
ATOM   1373 N NH2 . ARG A 1 174 ? 8.624   6.121   10.590  1.00 73.73 ? 212 ARG A NH2 1 
ATOM   1374 N N   . SER A 1 175 ? 7.511   13.056  13.480  1.00 53.40 ? 213 SER A N   1 
ATOM   1375 C CA  . SER A 1 175 ? 8.242   14.316  13.246  1.00 53.12 ? 213 SER A CA  1 
ATOM   1376 C C   . SER A 1 175 ? 8.236   14.678  11.758  1.00 52.14 ? 213 SER A C   1 
ATOM   1377 O O   . SER A 1 175 ? 8.447   15.838  11.393  1.00 52.40 ? 213 SER A O   1 
ATOM   1378 C CB  . SER A 1 175 ? 9.685   14.232  13.769  1.00 53.71 ? 213 SER A CB  1 
ATOM   1379 O OG  . SER A 1 175 ? 10.306  13.023  13.340  1.00 56.98 ? 213 SER A OG  1 
ATOM   1380 N N   . LYS A 1 176 ? 8.000   13.672  10.915  1.00 50.37 ? 214 LYS A N   1 
ATOM   1381 C CA  . LYS A 1 176 ? 7.838   13.862  9.485   1.00 48.68 ? 214 LYS A CA  1 
ATOM   1382 C C   . LYS A 1 176 ? 6.416   13.449  9.093   1.00 47.04 ? 214 LYS A C   1 
ATOM   1383 O O   . LYS A 1 176 ? 6.194   12.358  8.553   1.00 46.04 ? 214 LYS A O   1 
ATOM   1384 C CB  . LYS A 1 176 ? 8.863   13.029  8.720   1.00 48.95 ? 214 LYS A CB  1 
ATOM   1385 C CG  . LYS A 1 176 ? 10.232  13.662  8.527   1.00 49.13 ? 214 LYS A CG  1 
ATOM   1386 C CD  . LYS A 1 176 ? 11.090  12.753  7.615   1.00 50.22 ? 214 LYS A CD  1 
ATOM   1387 C CE  . LYS A 1 176 ? 12.581  13.140  7.619   1.00 53.35 ? 214 LYS A CE  1 
ATOM   1388 N NZ  . LYS A 1 176 ? 12.885  14.545  7.184   1.00 54.98 ? 214 LYS A NZ  1 
ATOM   1389 N N   . ILE A 1 177 ? 5.450   14.325  9.361   1.00 45.72 ? 215 ILE A N   1 
ATOM   1390 C CA  . ILE A 1 177 ? 4.029   14.033  9.062   1.00 44.54 ? 215 ILE A CA  1 
ATOM   1391 C C   . ILE A 1 177 ? 3.912   13.603  7.599   1.00 43.92 ? 215 ILE A C   1 
ATOM   1392 O O   . ILE A 1 177 ? 3.281   12.587  7.293   1.00 44.59 ? 215 ILE A O   1 
ATOM   1393 C CB  . ILE A 1 177 ? 3.084   15.225  9.381   1.00 44.18 ? 215 ILE A CB  1 
ATOM   1394 C CG1 . ILE A 1 177 ? 3.168   15.610  10.877  1.00 43.16 ? 215 ILE A CG1 1 
ATOM   1395 C CG2 . ILE A 1 177 ? 1.666   14.886  8.937   1.00 43.56 ? 215 ILE A CG2 1 
ATOM   1396 C CD1 . ILE A 1 177 ? 2.341   16.810  11.254  1.00 43.07 ? 215 ILE A CD1 1 
ATOM   1397 N N   . PHE A 1 178 ? 4.548   14.369  6.711   1.00 43.41 ? 216 PHE A N   1 
ATOM   1398 C CA  . PHE A 1 178 ? 4.811   13.894  5.363   1.00 43.13 ? 216 PHE A CA  1 
ATOM   1399 C C   . PHE A 1 178 ? 6.289   13.542  5.219   1.00 43.20 ? 216 PHE A C   1 
ATOM   1400 O O   . PHE A 1 178 ? 7.152   14.373  5.474   1.00 42.33 ? 216 PHE A O   1 
ATOM   1401 C CB  . PHE A 1 178 ? 4.388   14.915  4.292   1.00 42.58 ? 216 PHE A CB  1 
ATOM   1402 C CG  . PHE A 1 178 ? 4.939   14.607  2.928   1.00 41.06 ? 216 PHE A CG  1 
ATOM   1403 C CD1 . PHE A 1 178 ? 4.469   13.508  2.194   1.00 39.92 ? 216 PHE A CD1 1 
ATOM   1404 C CD2 . PHE A 1 178 ? 5.949   15.397  2.383   1.00 40.05 ? 216 PHE A CD2 1 
ATOM   1405 C CE1 . PHE A 1 178 ? 5.009   13.204  0.911   1.00 39.33 ? 216 PHE A CE1 1 
ATOM   1406 C CE2 . PHE A 1 178 ? 6.481   15.111  1.117   1.00 40.71 ? 216 PHE A CE2 1 
ATOM   1407 C CZ  . PHE A 1 178 ? 6.021   14.014  0.390   1.00 39.01 ? 216 PHE A CZ  1 
ATOM   1408 N N   . ASP A 1 179 ? 6.544   12.315  4.757   1.00 44.36 ? 217 ASP A N   1 
ATOM   1409 C CA  . ASP A 1 179 ? 7.886   11.754  4.641   1.00 45.48 ? 217 ASP A CA  1 
ATOM   1410 C C   . ASP A 1 179 ? 8.149   11.336  3.194   1.00 45.93 ? 217 ASP A C   1 
ATOM   1411 O O   . ASP A 1 179 ? 7.553   10.396  2.681   1.00 45.68 ? 217 ASP A O   1 
ATOM   1412 C CB  . ASP A 1 179 ? 8.046   10.535  5.568   1.00 45.74 ? 217 ASP A CB  1 
ATOM   1413 C CG  . ASP A 1 179 ? 9.468   9.949   5.550   1.00 48.67 ? 217 ASP A CG  1 
ATOM   1414 O OD1 . ASP A 1 179 ? 10.375  10.517  4.884   1.00 49.34 ? 217 ASP A OD1 1 
ATOM   1415 O OD2 . ASP A 1 179 ? 9.691   8.928   6.229   1.00 50.57 ? 217 ASP A OD2 1 
ATOM   1416 N N   . LYS A 1 180 ? 9.049   12.064  2.556   1.00 46.61 ? 218 LYS A N   1 
ATOM   1417 C CA  . LYS A 1 180 ? 9.458   11.821  1.188   1.00 47.56 ? 218 LYS A CA  1 
ATOM   1418 C C   . LYS A 1 180 ? 9.917   10.391  0.929   1.00 47.26 ? 218 LYS A C   1 
ATOM   1419 O O   . LYS A 1 180 ? 9.877   9.921   -0.209  1.00 46.96 ? 218 LYS A O   1 
ATOM   1420 C CB  . LYS A 1 180 ? 10.555  12.827  0.829   1.00 47.81 ? 218 LYS A CB  1 
ATOM   1421 C CG  . LYS A 1 180 ? 9.980   14.276  0.696   1.00 49.20 ? 218 LYS A CG  1 
ATOM   1422 C CD  . LYS A 1 180 ? 10.995  15.332  0.204   1.00 49.85 ? 218 LYS A CD  1 
ATOM   1423 C CE  . LYS A 1 180 ? 12.160  15.512  1.170   1.00 52.57 ? 218 LYS A CE  1 
ATOM   1424 N NZ  . LYS A 1 180 ? 13.182  16.442  0.602   1.00 53.42 ? 218 LYS A NZ  1 
ATOM   1425 N N   . ASP A 1 181 ? 10.326  9.694   1.991   1.00 47.68 ? 219 ASP A N   1 
ATOM   1426 C CA  . ASP A 1 181 ? 10.852  8.327   1.903   1.00 48.36 ? 219 ASP A CA  1 
ATOM   1427 C C   . ASP A 1 181 ? 9.867   7.192   2.126   1.00 47.75 ? 219 ASP A C   1 
ATOM   1428 O O   . ASP A 1 181 ? 10.231  6.031   1.972   1.00 48.61 ? 219 ASP A O   1 
ATOM   1429 C CB  . ASP A 1 181 ? 12.061  8.169   2.826   1.00 49.01 ? 219 ASP A CB  1 
ATOM   1430 C CG  . ASP A 1 181 ? 13.284  8.839   2.252   1.00 53.32 ? 219 ASP A CG  1 
ATOM   1431 O OD1 . ASP A 1 181 ? 13.472  8.702   1.012   1.00 58.14 ? 219 ASP A OD1 1 
ATOM   1432 O OD2 . ASP A 1 181 ? 14.032  9.522   3.000   1.00 56.28 ? 219 ASP A OD2 1 
ATOM   1433 N N   . SER A 1 182 ? 8.630   7.514   2.483   1.00 46.72 ? 220 SER A N   1 
ATOM   1434 C CA  . SER A 1 182 ? 7.578   6.524   2.609   1.00 44.98 ? 220 SER A CA  1 
ATOM   1435 C C   . SER A 1 182 ? 7.115   6.079   1.221   1.00 45.29 ? 220 SER A C   1 
ATOM   1436 O O   . SER A 1 182 ? 7.402   6.743   0.234   1.00 45.40 ? 220 SER A O   1 
ATOM   1437 C CB  . SER A 1 182 ? 6.399   7.128   3.374   1.00 44.55 ? 220 SER A CB  1 
ATOM   1438 O OG  . SER A 1 182 ? 5.872   8.283   2.719   1.00 41.77 ? 220 SER A OG  1 
ATOM   1439 N N   . THR A 1 183 ? 6.396   4.964   1.142   1.00 45.13 ? 221 THR A N   1 
ATOM   1440 C CA  . THR A 1 183 ? 5.785   4.540   -0.127  1.00 45.64 ? 221 THR A CA  1 
ATOM   1441 C C   . THR A 1 183 ? 4.922   5.685   -0.657  1.00 44.83 ? 221 THR A C   1 
ATOM   1442 O O   . THR A 1 183 ? 5.018   6.053   -1.832  1.00 43.57 ? 221 THR A O   1 
ATOM   1443 C CB  . THR A 1 183 ? 4.984   3.214   0.015   1.00 46.48 ? 221 THR A CB  1 
ATOM   1444 O OG1 . THR A 1 183 ? 5.886   2.175   0.392   1.00 49.26 ? 221 THR A OG1 1 
ATOM   1445 C CG2 . THR A 1 183 ? 4.329   2.796   -1.283  1.00 46.06 ? 221 THR A CG2 1 
ATOM   1446 N N   . PHE A 1 184 ? 4.120   6.297   0.216   1.00 43.95 ? 222 PHE A N   1 
ATOM   1447 C CA  . PHE A 1 184 ? 3.294   7.422   -0.233  1.00 42.29 ? 222 PHE A CA  1 
ATOM   1448 C C   . PHE A 1 184 ? 4.118   8.530   -0.882  1.00 42.03 ? 222 PHE A C   1 
ATOM   1449 O O   . PHE A 1 184 ? 3.787   8.988   -1.961  1.00 41.19 ? 222 PHE A O   1 
ATOM   1450 C CB  . PHE A 1 184 ? 2.472   8.011   0.899   1.00 41.91 ? 222 PHE A CB  1 
ATOM   1451 C CG  . PHE A 1 184 ? 1.785   9.283   0.509   1.00 40.93 ? 222 PHE A CG  1 
ATOM   1452 C CD1 . PHE A 1 184 ? 0.792   9.267   -0.480  1.00 39.95 ? 222 PHE A CD1 1 
ATOM   1453 C CD2 . PHE A 1 184 ? 2.126   10.493  1.116   1.00 40.70 ? 222 PHE A CD2 1 
ATOM   1454 C CE1 . PHE A 1 184 ? 0.150   10.431  -0.875  1.00 38.99 ? 222 PHE A CE1 1 
ATOM   1455 C CE2 . PHE A 1 184 ? 1.497   11.689  0.735   1.00 39.17 ? 222 PHE A CE2 1 
ATOM   1456 C CZ  . PHE A 1 184 ? 0.512   11.670  -0.260  1.00 42.30 ? 222 PHE A CZ  1 
ATOM   1457 N N   . GLY A 1 185 ? 5.189   8.960   -0.207  1.00 41.14 ? 223 GLY A N   1 
ATOM   1458 C CA  . GLY A 1 185 ? 5.993   10.049  -0.673  1.00 41.88 ? 223 GLY A CA  1 
ATOM   1459 C C   . GLY A 1 185 ? 6.867   9.744   -1.869  1.00 43.21 ? 223 GLY A C   1 
ATOM   1460 O O   . GLY A 1 185 ? 7.134   10.643  -2.665  1.00 43.00 ? 223 GLY A O   1 
ATOM   1461 N N   . SER A 1 186 ? 7.340   8.504   -2.004  1.00 43.32 ? 224 SER A N   1 
ATOM   1462 C CA  . SER A 1 186 ? 8.279   8.193   -3.093  1.00 44.36 ? 224 SER A CA  1 
ATOM   1463 C C   . SER A 1 186 ? 7.599   7.582   -4.314  1.00 45.25 ? 224 SER A C   1 
ATOM   1464 O O   . SER A 1 186 ? 8.117   7.712   -5.419  1.00 46.32 ? 224 SER A O   1 
ATOM   1465 C CB  . SER A 1 186 ? 9.418   7.281   -2.610  1.00 44.62 ? 224 SER A CB  1 
ATOM   1466 O OG  . SER A 1 186 ? 8.896   6.014   -2.232  1.00 46.13 ? 224 SER A OG  1 
ATOM   1467 N N   . VAL A 1 187 ? 6.477   6.888   -4.092  1.00 44.38 ? 225 VAL A N   1 
ATOM   1468 C CA  . VAL A 1 187 ? 5.746   6.179   -5.120  1.00 44.56 ? 225 VAL A CA  1 
ATOM   1469 C C   . VAL A 1 187 ? 4.353   6.793   -5.371  1.00 44.36 ? 225 VAL A C   1 
ATOM   1470 O O   . VAL A 1 187 ? 4.008   7.064   -6.517  1.00 44.16 ? 225 VAL A O   1 
ATOM   1471 C CB  . VAL A 1 187 ? 5.519   4.651   -4.805  1.00 44.79 ? 225 VAL A CB  1 
ATOM   1472 C CG1 . VAL A 1 187 ? 4.789   4.021   -5.950  1.00 44.72 ? 225 VAL A CG1 1 
ATOM   1473 C CG2 . VAL A 1 187 ? 6.822   3.899   -4.582  1.00 46.12 ? 225 VAL A CG2 1 
ATOM   1474 N N   . GLY A 1 188 ? 3.548   6.964   -4.327  1.00 42.08 ? 226 GLY A N   1 
ATOM   1475 C CA  . GLY A 1 188 ? 2.170   7.391   -4.513  1.00 42.36 ? 226 GLY A CA  1 
ATOM   1476 C C   . GLY A 1 188 ? 2.061   8.814   -5.093  1.00 42.56 ? 226 GLY A C   1 
ATOM   1477 O O   . GLY A 1 188 ? 1.396   9.034   -6.115  1.00 42.80 ? 226 GLY A O   1 
ATOM   1478 N N   . VAL A 1 189 ? 2.750   9.762   -4.466  1.00 40.52 ? 227 VAL A N   1 
ATOM   1479 C CA  . VAL A 1 189 ? 2.727   11.161  -4.897  1.00 40.57 ? 227 VAL A CA  1 
ATOM   1480 C C   . VAL A 1 189 ? 3.154   11.347  -6.357  1.00 40.04 ? 227 VAL A C   1 
ATOM   1481 O O   . VAL A 1 189 ? 2.648   12.235  -7.073  1.00 40.34 ? 227 VAL A O   1 
ATOM   1482 C CB  . VAL A 1 189 ? 3.598   12.015  -3.956  1.00 41.12 ? 227 VAL A CB  1 
ATOM   1483 C CG1 . VAL A 1 189 ? 4.036   13.303  -4.622  1.00 41.98 ? 227 VAL A CG1 1 
ATOM   1484 C CG2 . VAL A 1 189 ? 2.823   12.325  -2.718  1.00 41.32 ? 227 VAL A CG2 1 
ATOM   1485 N N   . HIS A 1 190 ? 4.114   10.552  -6.789  1.00 37.90 ? 228 HIS A N   1 
ATOM   1486 C CA  . HIS A 1 190 ? 4.680   10.738  -8.116  1.00 37.74 ? 228 HIS A CA  1 
ATOM   1487 C C   . HIS A 1 190 ? 3.959   9.940   -9.182  1.00 38.01 ? 228 HIS A C   1 
ATOM   1488 O O   . HIS A 1 190 ? 4.270   10.062  -10.384 1.00 38.36 ? 228 HIS A O   1 
ATOM   1489 C CB  . HIS A 1 190 ? 6.202   10.500  -8.064  1.00 36.63 ? 228 HIS A CB  1 
ATOM   1490 C CG  . HIS A 1 190 ? 6.878   11.483  -7.172  1.00 38.54 ? 228 HIS A CG  1 
ATOM   1491 N ND1 . HIS A 1 190 ? 6.934   12.833  -7.469  1.00 35.82 ? 228 HIS A ND1 1 
ATOM   1492 C CD2 . HIS A 1 190 ? 7.398   11.348  -5.928  1.00 39.18 ? 228 HIS A CD2 1 
ATOM   1493 C CE1 . HIS A 1 190 ? 7.516   13.473  -6.469  1.00 39.86 ? 228 HIS A CE1 1 
ATOM   1494 N NE2 . HIS A 1 190 ? 7.801   12.596  -5.517  1.00 40.16 ? 228 HIS A NE2 1 
ATOM   1495 N N   . ASN A 1 191 ? 2.973   9.140   -8.771  1.00 38.09 ? 229 ASN A N   1 
ATOM   1496 C CA  . ASN A 1 191 ? 2.260   8.310   -9.759  1.00 40.18 ? 229 ASN A CA  1 
ATOM   1497 C C   . ASN A 1 191 ? 0.794   8.665   -9.908  1.00 39.56 ? 229 ASN A C   1 
ATOM   1498 O O   . ASN A 1 191 ? 0.128   8.062   -10.720 1.00 38.72 ? 229 ASN A O   1 
ATOM   1499 C CB  . ASN A 1 191 ? 2.484   6.825   -9.509  1.00 40.17 ? 229 ASN A CB  1 
ATOM   1500 C CG  . ASN A 1 191 ? 3.868   6.390   -9.954  1.00 43.75 ? 229 ASN A CG  1 
ATOM   1501 O OD1 . ASN A 1 191 ? 4.112   6.124   -11.146 1.00 45.75 ? 229 ASN A OD1 1 
ATOM   1502 N ND2 . ASN A 1 191 ? 4.797   6.351   -9.010  1.00 40.67 ? 229 ASN A ND2 1 
ATOM   1503 N N   . LEU A 1 192 ? 0.322   9.657   -9.139  1.00 39.02 ? 230 LEU A N   1 
ATOM   1504 C CA  . LEU A 1 192 ? -1.010  10.218  -9.352  1.00 39.37 ? 230 LEU A CA  1 
ATOM   1505 C C   . LEU A 1 192 ? -0.970  10.857  -10.705 1.00 39.36 ? 230 LEU A C   1 
ATOM   1506 O O   . LEU A 1 192 ? 0.057   11.422  -11.076 1.00 40.84 ? 230 LEU A O   1 
ATOM   1507 C CB  . LEU A 1 192 ? -1.318  11.278  -8.314  1.00 40.28 ? 230 LEU A CB  1 
ATOM   1508 C CG  . LEU A 1 192 ? -1.523  10.781  -6.862  1.00 39.86 ? 230 LEU A CG  1 
ATOM   1509 C CD1 . LEU A 1 192 ? -1.769  11.948  -5.929  1.00 45.72 ? 230 LEU A CD1 1 
ATOM   1510 C CD2 . LEU A 1 192 ? -2.710  9.796   -6.799  1.00 43.40 ? 230 LEU A CD2 1 
ATOM   1511 N N   . GLN A 1 193 ? -2.053  10.772  -11.458 1.00 38.73 ? 231 GLN A N   1 
ATOM   1512 C CA  . GLN A 1 193 ? -2.000  11.211  -12.862 1.00 39.13 ? 231 GLN A CA  1 
ATOM   1513 C C   . GLN A 1 193 ? -2.669  12.557  -12.970 1.00 38.49 ? 231 GLN A C   1 
ATOM   1514 O O   . GLN A 1 193 ? -3.887  12.650  -12.811 1.00 38.00 ? 231 GLN A O   1 
ATOM   1515 C CB  . GLN A 1 193 ? -2.698  10.217  -13.764 1.00 40.07 ? 231 GLN A CB  1 
ATOM   1516 C CG  . GLN A 1 193 ? -2.163  8.780   -13.598 1.00 45.81 ? 231 GLN A CG  1 
ATOM   1517 C CD  . GLN A 1 193 ? -0.833  8.558   -14.293 1.00 52.94 ? 231 GLN A CD  1 
ATOM   1518 O OE1 . GLN A 1 193 ? -0.767  8.560   -15.533 1.00 55.95 ? 231 GLN A OE1 1 
ATOM   1519 N NE2 . GLN A 1 193 ? 0.252   8.342   -13.490 1.00 52.96 ? 231 GLN A NE2 1 
ATOM   1520 N N   . PRO A 1 194 ? -1.888  13.607  -13.252 1.00 38.47 ? 232 PRO A N   1 
ATOM   1521 C CA  . PRO A 1 194 ? -2.463  14.953  -13.260 1.00 38.64 ? 232 PRO A CA  1 
ATOM   1522 C C   . PRO A 1 194 ? -3.598  15.145  -14.258 1.00 38.89 ? 232 PRO A C   1 
ATOM   1523 O O   . PRO A 1 194 ? -4.405  16.059  -14.073 1.00 39.83 ? 232 PRO A O   1 
ATOM   1524 C CB  . PRO A 1 194 ? -1.279  15.849  -13.636 1.00 38.62 ? 232 PRO A CB  1 
ATOM   1525 C CG  . PRO A 1 194 ? -0.060  15.074  -13.184 1.00 39.58 ? 232 PRO A CG  1 
ATOM   1526 C CD  . PRO A 1 194 ? -0.440  13.632  -13.564 1.00 39.21 ? 232 PRO A CD  1 
ATOM   1527 N N   . GLU A 1 195 ? -3.659  14.334  -15.310 1.00 38.07 ? 233 GLU A N   1 
ATOM   1528 C CA  . GLU A 1 195 ? -4.775  14.433  -16.270 1.00 39.15 ? 233 GLU A CA  1 
ATOM   1529 C C   . GLU A 1 195 ? -6.144  14.074  -15.638 1.00 38.90 ? 233 GLU A C   1 
ATOM   1530 O O   . GLU A 1 195 ? -7.185  14.520  -16.117 1.00 39.50 ? 233 GLU A O   1 
ATOM   1531 C CB  . GLU A 1 195 ? -4.528  13.507  -17.450 1.00 39.19 ? 233 GLU A CB  1 
ATOM   1532 C CG  . GLU A 1 195 ? -3.253  13.831  -18.252 1.00 44.05 ? 233 GLU A CG  1 
ATOM   1533 C CD  . GLU A 1 195 ? -1.921  13.313  -17.601 1.00 48.26 ? 233 GLU A CD  1 
ATOM   1534 O OE1 . GLU A 1 195 ? -1.900  12.745  -16.468 1.00 47.14 ? 233 GLU A OE1 1 
ATOM   1535 O OE2 . GLU A 1 195 ? -0.872  13.503  -18.268 1.00 51.66 ? 233 GLU A OE2 1 
ATOM   1536 N N   . LYS A 1 196 ? -6.110  13.273  -14.574 1.00 38.48 ? 234 LYS A N   1 
ATOM   1537 C CA  . LYS A 1 196 ? -7.294  12.642  -13.929 1.00 38.90 ? 234 LYS A CA  1 
ATOM   1538 C C   . LYS A 1 196 ? -7.571  13.154  -12.518 1.00 38.15 ? 234 LYS A C   1 
ATOM   1539 O O   . LYS A 1 196 ? -8.722  13.291  -12.076 1.00 38.06 ? 234 LYS A O   1 
ATOM   1540 C CB  . LYS A 1 196 ? -6.998  11.154  -13.755 1.00 39.38 ? 234 LYS A CB  1 
ATOM   1541 C CG  . LYS A 1 196 ? -7.286  10.282  -14.904 1.00 41.88 ? 234 LYS A CG  1 
ATOM   1542 C CD  . LYS A 1 196 ? -6.339  9.123   -14.911 1.00 44.81 ? 234 LYS A CD  1 
ATOM   1543 C CE  . LYS A 1 196 ? -6.564  8.164   -13.757 1.00 49.13 ? 234 LYS A CE  1 
ATOM   1544 N NZ  . LYS A 1 196 ? -6.161  6.793   -14.182 1.00 49.30 ? 234 LYS A NZ  1 
ATOM   1545 N N   . VAL A 1 197 ? -6.497  13.386  -11.776 1.00 36.96 ? 235 VAL A N   1 
ATOM   1546 C CA  . VAL A 1 197 ? -6.607  13.748  -10.358 1.00 36.99 ? 235 VAL A CA  1 
ATOM   1547 C C   . VAL A 1 197 ? -6.725  15.262  -10.209 1.00 37.52 ? 235 VAL A C   1 
ATOM   1548 O O   . VAL A 1 197 ? -5.842  16.012  -10.634 1.00 36.26 ? 235 VAL A O   1 
ATOM   1549 C CB  . VAL A 1 197 ? -5.407  13.221  -9.592  1.00 37.44 ? 235 VAL A CB  1 
ATOM   1550 C CG1 . VAL A 1 197 ? -5.469  13.647  -8.108  1.00 36.91 ? 235 VAL A CG1 1 
ATOM   1551 C CG2 . VAL A 1 197 ? -5.358  11.663  -9.745  1.00 38.12 ? 235 VAL A CG2 1 
ATOM   1552 N N   . GLN A 1 198 ? -7.846  15.687  -9.648  1.00 37.49 ? 236 GLN A N   1 
ATOM   1553 C CA  . GLN A 1 198 ? -8.172  17.093  -9.480  1.00 39.67 ? 236 GLN A CA  1 
ATOM   1554 C C   . GLN A 1 198 ? -7.440  17.603  -8.241  1.00 38.63 ? 236 GLN A C   1 
ATOM   1555 O O   . GLN A 1 198 ? -6.716  18.595  -8.312  1.00 38.88 ? 236 GLN A O   1 
ATOM   1556 C CB  . GLN A 1 198 ? -9.707  17.238  -9.397  1.00 39.35 ? 236 GLN A CB  1 
ATOM   1557 C CG  . GLN A 1 198 ? -10.293 18.264  -8.444  1.00 46.90 ? 236 GLN A CG  1 
ATOM   1558 C CD  . GLN A 1 198 ? -10.535 19.571  -9.097  1.00 51.30 ? 236 GLN A CD  1 
ATOM   1559 O OE1 . GLN A 1 198 ? -9.659  20.094  -9.789  1.00 56.87 ? 236 GLN A OE1 1 
ATOM   1560 N NE2 . GLN A 1 198 ? -11.725 20.124  -8.902  1.00 47.60 ? 236 GLN A NE2 1 
ATOM   1561 N N   . THR A 1 199 ? -7.571  16.870  -7.139  1.00 38.05 ? 237 THR A N   1 
ATOM   1562 C CA  . THR A 1 199 ? -7.108  17.280  -5.835  1.00 38.41 ? 237 THR A CA  1 
ATOM   1563 C C   . THR A 1 199 ? -6.550  16.107  -5.022  1.00 37.95 ? 237 THR A C   1 
ATOM   1564 O O   . THR A 1 199 ? -7.108  15.034  -5.030  1.00 36.57 ? 237 THR A O   1 
ATOM   1565 C CB  . THR A 1 199 ? -8.297  17.877  -5.032  1.00 39.26 ? 237 THR A CB  1 
ATOM   1566 O OG1 . THR A 1 199 ? -8.879  18.931  -5.781  1.00 41.61 ? 237 THR A OG1 1 
ATOM   1567 C CG2 . THR A 1 199 ? -7.896  18.401  -3.667  1.00 38.74 ? 237 THR A CG2 1 
ATOM   1568 N N   . LEU A 1 200 ? -5.452  16.350  -4.306  1.00 38.27 ? 238 LEU A N   1 
ATOM   1569 C CA  . LEU A 1 200 ? -5.072  15.504  -3.201  1.00 38.63 ? 238 LEU A CA  1 
ATOM   1570 C C   . LEU A 1 200 ? -5.441  16.149  -1.881  1.00 40.51 ? 238 LEU A C   1 
ATOM   1571 O O   . LEU A 1 200 ? -4.984  17.239  -1.548  1.00 39.56 ? 238 LEU A O   1 
ATOM   1572 C CB  . LEU A 1 200 ? -3.582  15.192  -3.208  1.00 39.06 ? 238 LEU A CB  1 
ATOM   1573 C CG  . LEU A 1 200 ? -3.118  14.300  -2.020  1.00 40.10 ? 238 LEU A CG  1 
ATOM   1574 C CD1 . LEU A 1 200 ? -3.547  12.826  -2.207  1.00 40.68 ? 238 LEU A CD1 1 
ATOM   1575 C CD2 . LEU A 1 200 ? -1.660  14.388  -1.788  1.00 44.06 ? 238 LEU A CD2 1 
ATOM   1576 N N   . GLU A 1 201 ? -6.253  15.446  -1.105  1.00 40.98 ? 239 GLU A N   1 
ATOM   1577 C CA  . GLU A 1 201 ? -6.640  15.963  0.156   1.00 40.91 ? 239 GLU A CA  1 
ATOM   1578 C C   . GLU A 1 201 ? -6.014  15.131  1.274   1.00 40.18 ? 239 GLU A C   1 
ATOM   1579 O O   . GLU A 1 201 ? -6.276  13.914  1.375   1.00 38.86 ? 239 GLU A O   1 
ATOM   1580 C CB  . GLU A 1 201 ? -8.149  16.019  0.284   1.00 40.43 ? 239 GLU A CB  1 
ATOM   1581 C CG  . GLU A 1 201 ? -8.536  16.583  1.652   1.00 43.91 ? 239 GLU A CG  1 
ATOM   1582 C CD  . GLU A 1 201 ? -9.973  17.022  1.717   1.00 47.91 ? 239 GLU A CD  1 
ATOM   1583 O OE1 . GLU A 1 201 ? -10.775 16.393  2.457   1.00 46.82 ? 239 GLU A OE1 1 
ATOM   1584 O OE2 . GLU A 1 201 ? -10.282 18.011  1.016   1.00 53.72 ? 239 GLU A OE2 1 
ATOM   1585 N N   . ALA A 1 202 ? -5.187  15.805  2.079   1.00 38.80 ? 240 ALA A N   1 
ATOM   1586 C CA  . ALA A 1 202 ? -4.509  15.186  3.209   1.00 39.34 ? 240 ALA A CA  1 
ATOM   1587 C C   . ALA A 1 202 ? -5.336  15.342  4.489   1.00 39.23 ? 240 ALA A C   1 
ATOM   1588 O O   . ALA A 1 202 ? -5.839  16.417  4.778   1.00 38.23 ? 240 ALA A O   1 
ATOM   1589 C CB  . ALA A 1 202 ? -3.084  15.770  3.389   1.00 38.28 ? 240 ALA A CB  1 
ATOM   1590 N N   . TRP A 1 203 ? -5.506  14.239  5.221   1.00 39.54 ? 241 TRP A N   1 
ATOM   1591 C CA  . TRP A 1 203 ? -6.075  14.279  6.559   1.00 39.35 ? 241 TRP A CA  1 
ATOM   1592 C C   . TRP A 1 203 ? -4.971  13.977  7.558   1.00 39.25 ? 241 TRP A C   1 
ATOM   1593 O O   . TRP A 1 203 ? -4.454  12.847  7.631   1.00 38.90 ? 241 TRP A O   1 
ATOM   1594 C CB  . TRP A 1 203 ? -7.186  13.247  6.741   1.00 40.05 ? 241 TRP A CB  1 
ATOM   1595 C CG  . TRP A 1 203 ? -8.384  13.429  5.858   1.00 40.83 ? 241 TRP A CG  1 
ATOM   1596 C CD1 . TRP A 1 203 ? -8.761  14.559  5.173   1.00 41.31 ? 241 TRP A CD1 1 
ATOM   1597 C CD2 . TRP A 1 203 ? -9.389  12.453  5.606   1.00 42.08 ? 241 TRP A CD2 1 
ATOM   1598 N NE1 . TRP A 1 203 ? -9.949  14.336  4.508   1.00 39.54 ? 241 TRP A NE1 1 
ATOM   1599 C CE2 . TRP A 1 203 ? -10.349 13.045  4.753   1.00 41.92 ? 241 TRP A CE2 1 
ATOM   1600 C CE3 . TRP A 1 203 ? -9.573  11.123  6.017   1.00 42.19 ? 241 TRP A CE3 1 
ATOM   1601 C CZ2 . TRP A 1 203 ? -11.485 12.340  4.295   1.00 41.95 ? 241 TRP A CZ2 1 
ATOM   1602 C CZ3 . TRP A 1 203 ? -10.707 10.445  5.591   1.00 41.76 ? 241 TRP A CZ3 1 
ATOM   1603 C CH2 . TRP A 1 203 ? -11.647 11.057  4.725   1.00 41.06 ? 241 TRP A CH2 1 
ATOM   1604 N N   . VAL A 1 204 ? -4.644  14.985  8.350   1.00 38.62 ? 242 VAL A N   1 
ATOM   1605 C CA  . VAL A 1 204 ? -3.552  14.878  9.302   1.00 38.42 ? 242 VAL A CA  1 
ATOM   1606 C C   . VAL A 1 204 ? -4.115  14.407  10.632  1.00 38.68 ? 242 VAL A C   1 
ATOM   1607 O O   . VAL A 1 204 ? -4.835  15.152  11.329  1.00 37.86 ? 242 VAL A O   1 
ATOM   1608 C CB  . VAL A 1 204 ? -2.761  16.194  9.419   1.00 38.00 ? 242 VAL A CB  1 
ATOM   1609 C CG1 . VAL A 1 204 ? -1.598  16.030  10.392  1.00 37.33 ? 242 VAL A CG1 1 
ATOM   1610 C CG2 . VAL A 1 204 ? -2.254  16.608  8.023   1.00 38.05 ? 242 VAL A CG2 1 
ATOM   1611 N N   . ILE A 1 205 ? -3.791  13.154  10.949  1.00 38.19 ? 243 ILE A N   1 
ATOM   1612 C CA  . ILE A 1 205 ? -4.370  12.475  12.095  1.00 40.39 ? 243 ILE A CA  1 
ATOM   1613 C C   . ILE A 1 205 ? -3.605  12.825  13.376  1.00 40.90 ? 243 ILE A C   1 
ATOM   1614 O O   . ILE A 1 205 ? -2.452  12.445  13.541  1.00 41.80 ? 243 ILE A O   1 
ATOM   1615 C CB  . ILE A 1 205 ? -4.371  10.956  11.865  1.00 39.82 ? 243 ILE A CB  1 
ATOM   1616 C CG1 . ILE A 1 205 ? -5.062  10.610  10.534  1.00 40.29 ? 243 ILE A CG1 1 
ATOM   1617 C CG2 . ILE A 1 205 ? -5.020  10.235  13.053  1.00 41.15 ? 243 ILE A CG2 1 
ATOM   1618 C CD1 . ILE A 1 205 ? -6.449  11.162  10.381  1.00 39.30 ? 243 ILE A CD1 1 
ATOM   1619 N N   . HIS A 1 206 ? -4.232  13.549  14.279  1.00 42.48 ? 244 HIS A N   1 
ATOM   1620 C CA  . HIS A 1 206 ? -3.550  13.929  15.543  1.00 44.21 ? 244 HIS A CA  1 
ATOM   1621 C C   . HIS A 1 206 ? -3.325  12.775  16.519  1.00 46.10 ? 244 HIS A C   1 
ATOM   1622 O O   . HIS A 1 206 ? -4.165  11.875  16.641  1.00 46.30 ? 244 HIS A O   1 
ATOM   1623 C CB  . HIS A 1 206 ? -4.306  15.048  16.243  1.00 43.52 ? 244 HIS A CB  1 
ATOM   1624 C CG  . HIS A 1 206 ? -4.135  16.389  15.606  1.00 43.11 ? 244 HIS A CG  1 
ATOM   1625 N ND1 . HIS A 1 206 ? -4.381  16.620  14.270  1.00 42.75 ? 244 HIS A ND1 1 
ATOM   1626 C CD2 . HIS A 1 206 ? -3.771  17.583  16.130  1.00 42.24 ? 244 HIS A CD2 1 
ATOM   1627 C CE1 . HIS A 1 206 ? -4.163  17.890  13.994  1.00 40.86 ? 244 HIS A CE1 1 
ATOM   1628 N NE2 . HIS A 1 206 ? -3.793  18.496  15.104  1.00 44.16 ? 244 HIS A NE2 1 
ATOM   1629 N N   . GLY A 1 207 ? -2.197  12.824  17.234  1.00 48.24 ? 245 GLY A N   1 
ATOM   1630 C CA  . GLY A 1 207 ? -1.781  11.744  18.133  1.00 50.23 ? 245 GLY A CA  1 
ATOM   1631 C C   . GLY A 1 207 ? -2.466  11.815  19.480  1.00 52.19 ? 245 GLY A C   1 
ATOM   1632 O O   . GLY A 1 207 ? -1.862  11.512  20.532  1.00 52.62 ? 245 GLY A O   1 
ATOM   1633 N N   . GLY A 1 208 ? -3.740  12.199  19.463  1.00 53.31 ? 246 GLY A N   1 
ATOM   1634 C CA  . GLY A 1 208 ? -4.438  12.495  20.701  1.00 54.82 ? 246 GLY A CA  1 
ATOM   1635 C C   . GLY A 1 208 ? -3.882  13.816  21.186  1.00 55.65 ? 246 GLY A C   1 
ATOM   1636 O O   . GLY A 1 208 ? -3.750  14.771  20.399  1.00 55.95 ? 246 GLY A O   1 
ATOM   1637 N N   . ARG A 1 209 ? -3.516  13.862  22.458  1.00 55.64 ? 247 ARG A N   1 
ATOM   1638 C CA  . ARG A 1 209 ? -3.075  15.101  23.062  1.00 56.27 ? 247 ARG A CA  1 
ATOM   1639 C C   . ARG A 1 209 ? -4.315  15.854  23.495  1.00 56.43 ? 247 ARG A C   1 
ATOM   1640 O O   . ARG A 1 209 ? -4.737  15.741  24.642  1.00 56.75 ? 247 ARG A O   1 
ATOM   1641 N N   . GLU A 1 210 ? -4.917  16.589  22.565  1.00 56.50 ? 248 GLU A N   1 
ATOM   1642 C CA  . GLU A 1 210 ? -6.085  17.405  22.869  1.00 56.52 ? 248 GLU A CA  1 
ATOM   1643 C C   . GLU A 1 210 ? -5.772  18.895  22.825  1.00 56.63 ? 248 GLU A C   1 
ATOM   1644 O O   . GLU A 1 210 ? -4.761  19.341  23.378  1.00 56.79 ? 248 GLU A O   1 
ATOM   1645 N N   . ASP A 1 211 ? -6.640  19.657  22.151  1.00 56.61 ? 249 ASP A N   1 
ATOM   1646 C CA  . ASP A 1 211 ? -6.547  21.131  22.049  1.00 55.94 ? 249 ASP A CA  1 
ATOM   1647 C C   . ASP A 1 211 ? -5.423  21.689  21.165  1.00 55.29 ? 249 ASP A C   1 
ATOM   1648 O O   . ASP A 1 211 ? -4.958  22.818  21.389  1.00 55.30 ? 249 ASP A O   1 
ATOM   1649 N N   . SER A 1 212 ? -5.003  20.944  20.140  1.00 53.74 ? 250 SER A N   1 
ATOM   1650 C CA  . SER A 1 212 ? -3.651  21.164  19.621  1.00 52.53 ? 250 SER A CA  1 
ATOM   1651 C C   . SER A 1 212 ? -3.464  21.978  18.318  1.00 51.91 ? 250 SER A C   1 
ATOM   1652 O O   . SER A 1 212 ? -4.385  22.647  17.833  1.00 52.37 ? 250 SER A O   1 
ATOM   1653 C CB  . SER A 1 212 ? -2.847  19.850  19.628  1.00 52.59 ? 250 SER A CB  1 
ATOM   1654 O OG  . SER A 1 212 ? -3.313  18.943  18.668  1.00 50.45 ? 250 SER A OG  1 
ATOM   1655 N N   . ARG A 1 213 ? -2.238  21.909  17.796  1.00 50.41 ? 251 ARG A N   1 
ATOM   1656 C CA  . ARG A 1 213 ? -1.725  22.734  16.697  1.00 48.66 ? 251 ARG A CA  1 
ATOM   1657 C C   . ARG A 1 213 ? -2.476  22.517  15.388  1.00 47.67 ? 251 ARG A C   1 
ATOM   1658 O O   . ARG A 1 213 ? -3.085  21.474  15.195  1.00 47.52 ? 251 ARG A O   1 
ATOM   1659 C CB  . ARG A 1 213 ? -0.232  22.412  16.498  1.00 48.90 ? 251 ARG A CB  1 
ATOM   1660 C CG  . ARG A 1 213 ? 0.579   22.338  17.822  1.00 47.46 ? 251 ARG A CG  1 
ATOM   1661 C CD  . ARG A 1 213 ? 1.737   21.304  17.788  1.00 48.01 ? 251 ARG A CD  1 
ATOM   1662 N NE  . ARG A 1 213 ? 1.362   19.901  17.486  1.00 47.76 ? 251 ARG A NE  1 
ATOM   1663 C CZ  . ARG A 1 213 ? 0.487   19.162  18.176  1.00 47.10 ? 251 ARG A CZ  1 
ATOM   1664 N NH1 . ARG A 1 213 ? -0.156  19.668  19.215  1.00 51.88 ? 251 ARG A NH1 1 
ATOM   1665 N NH2 . ARG A 1 213 ? 0.240   17.910  17.834  1.00 47.42 ? 251 ARG A NH2 1 
ATOM   1666 N N   . ASP A 1 214 ? -2.453  23.512  14.502  1.00 46.34 ? 252 ASP A N   1 
ATOM   1667 C CA  . ASP A 1 214 ? -2.880  23.310  13.113  1.00 45.66 ? 252 ASP A CA  1 
ATOM   1668 C C   . ASP A 1 214 ? -1.720  22.669  12.332  1.00 44.77 ? 252 ASP A C   1 
ATOM   1669 O O   . ASP A 1 214 ? -0.824  23.366  11.838  1.00 45.13 ? 252 ASP A O   1 
ATOM   1670 C CB  . ASP A 1 214 ? -3.324  24.626  12.465  1.00 45.08 ? 252 ASP A CB  1 
ATOM   1671 C CG  . ASP A 1 214 ? -3.823  24.443  11.034  1.00 46.69 ? 252 ASP A CG  1 
ATOM   1672 O OD1 . ASP A 1 214 ? -3.945  23.291  10.532  1.00 46.64 ? 252 ASP A OD1 1 
ATOM   1673 O OD2 . ASP A 1 214 ? -4.100  25.466  10.389  1.00 47.76 ? 252 ASP A OD2 1 
ATOM   1674 N N   . LEU A 1 215 ? -1.741  21.344  12.218  1.00 43.80 ? 253 LEU A N   1 
ATOM   1675 C CA  . LEU A 1 215 ? -0.624  20.602  11.640  1.00 42.44 ? 253 LEU A CA  1 
ATOM   1676 C C   . LEU A 1 215 ? -0.585  20.649  10.104  1.00 42.89 ? 253 LEU A C   1 
ATOM   1677 O O   . LEU A 1 215 ? 0.373   20.206  9.479   1.00 42.36 ? 253 LEU A O   1 
ATOM   1678 C CB  . LEU A 1 215 ? -0.618  19.158  12.156  1.00 41.97 ? 253 LEU A CB  1 
ATOM   1679 C CG  . LEU A 1 215 ? -0.405  18.892  13.647  1.00 41.56 ? 253 LEU A CG  1 
ATOM   1680 C CD1 . LEU A 1 215 ? -0.532  17.401  13.926  1.00 41.79 ? 253 LEU A CD1 1 
ATOM   1681 C CD2 . LEU A 1 215 ? 0.952   19.406  14.122  1.00 41.27 ? 253 LEU A CD2 1 
ATOM   1682 N N   . CYS A 1 216 ? -1.632  21.189  9.510   1.00 43.35 ? 254 CYS A N   1 
ATOM   1683 C CA  . CYS A 1 216 ? -1.615  21.525  8.110   1.00 44.15 ? 254 CYS A CA  1 
ATOM   1684 C C   . CYS A 1 216 ? -0.608  22.643  7.786   1.00 44.27 ? 254 CYS A C   1 
ATOM   1685 O O   . CYS A 1 216 ? -0.327  22.872  6.602   1.00 44.85 ? 254 CYS A O   1 
ATOM   1686 C CB  . CYS A 1 216 ? -3.020  21.892  7.655   1.00 44.02 ? 254 CYS A CB  1 
ATOM   1687 S SG  . CYS A 1 216 ? -4.100  20.419  7.543   1.00 49.77 ? 254 CYS A SG  1 
ATOM   1688 N N   . GLN A 1 217 ? -0.058  23.317  8.815   1.00 43.25 ? 255 GLN A N   1 
ATOM   1689 C CA  . GLN A 1 217 ? 1.006   24.335  8.637   1.00 43.02 ? 255 GLN A CA  1 
ATOM   1690 C C   . GLN A 1 217 ? 2.417   23.784  8.845   1.00 42.72 ? 255 GLN A C   1 
ATOM   1691 O O   . GLN A 1 217 ? 3.416   24.490  8.682   1.00 42.92 ? 255 GLN A O   1 
ATOM   1692 C CB  . GLN A 1 217 ? 0.810   25.539  9.575   1.00 42.95 ? 255 GLN A CB  1 
ATOM   1693 C CG  . GLN A 1 217 ? -0.579  26.167  9.567   1.00 44.19 ? 255 GLN A CG  1 
ATOM   1694 C CD  . GLN A 1 217 ? -1.102  26.489  8.175   1.00 45.93 ? 255 GLN A CD  1 
ATOM   1695 O OE1 . GLN A 1 217 ? -0.345  26.865  7.274   1.00 47.12 ? 255 GLN A OE1 1 
ATOM   1696 N NE2 . GLN A 1 217 ? -2.409  26.336  7.994   1.00 46.26 ? 255 GLN A NE2 1 
ATOM   1697 N N   . ASP A 1 218 ? 2.488   22.519  9.222   1.00 42.98 ? 256 ASP A N   1 
ATOM   1698 C CA  . ASP A 1 218 ? 3.742   21.836  9.433   1.00 43.04 ? 256 ASP A CA  1 
ATOM   1699 C C   . ASP A 1 218 ? 4.612   21.910  8.178   1.00 42.99 ? 256 ASP A C   1 
ATOM   1700 O O   . ASP A 1 218 ? 4.092   21.768  7.068   1.00 44.52 ? 256 ASP A O   1 
ATOM   1701 C CB  . ASP A 1 218 ? 3.457   20.388  9.822   1.00 43.18 ? 256 ASP A CB  1 
ATOM   1702 C CG  . ASP A 1 218 ? 4.717   19.572  9.980   1.00 44.63 ? 256 ASP A CG  1 
ATOM   1703 O OD1 . ASP A 1 218 ? 5.133   18.926  8.984   1.00 45.72 ? 256 ASP A OD1 1 
ATOM   1704 O OD2 . ASP A 1 218 ? 5.310   19.606  11.079  1.00 46.08 ? 256 ASP A OD2 1 
ATOM   1705 N N   . PRO A 1 219 ? 5.930   22.144  8.343   1.00 42.70 ? 257 PRO A N   1 
ATOM   1706 C CA  . PRO A 1 219 ? 6.846   22.288  7.209   1.00 41.93 ? 257 PRO A CA  1 
ATOM   1707 C C   . PRO A 1 219 ? 6.753   21.204  6.174   1.00 41.10 ? 257 PRO A C   1 
ATOM   1708 O O   . PRO A 1 219 ? 6.843   21.523  4.986   1.00 40.40 ? 257 PRO A O   1 
ATOM   1709 C CB  . PRO A 1 219 ? 8.230   22.279  7.868   1.00 41.71 ? 257 PRO A CB  1 
ATOM   1710 C CG  . PRO A 1 219 ? 7.983   22.894  9.189   1.00 42.31 ? 257 PRO A CG  1 
ATOM   1711 C CD  . PRO A 1 219 ? 6.639   22.364  9.623   1.00 42.65 ? 257 PRO A CD  1 
ATOM   1712 N N   . THR A 1 220 ? 6.564   19.948  6.603   1.00 40.59 ? 258 THR A N   1 
ATOM   1713 C CA  . THR A 1 220 ? 6.569   18.827  5.674   1.00 39.32 ? 258 THR A CA  1 
ATOM   1714 C C   . THR A 1 220 ? 5.265   18.786  4.880   1.00 40.42 ? 258 THR A C   1 
ATOM   1715 O O   . THR A 1 220 ? 5.225   18.242  3.774   1.00 39.59 ? 258 THR A O   1 
ATOM   1716 C CB  . THR A 1 220 ? 6.815   17.453  6.325   1.00 39.56 ? 258 THR A CB  1 
ATOM   1717 O OG1 . THR A 1 220 ? 5.666   17.051  7.085   1.00 37.73 ? 258 THR A OG1 1 
ATOM   1718 C CG2 . THR A 1 220 ? 8.085   17.449  7.183   1.00 37.37 ? 258 THR A CG2 1 
ATOM   1719 N N   . ILE A 1 221 ? 4.216   19.373  5.443   1.00 40.86 ? 259 ILE A N   1 
ATOM   1720 C CA  . ILE A 1 221 ? 2.944   19.511  4.746   1.00 41.45 ? 259 ILE A CA  1 
ATOM   1721 C C   . ILE A 1 221 ? 3.032   20.599  3.688   1.00 42.06 ? 259 ILE A C   1 
ATOM   1722 O O   . ILE A 1 221 ? 2.442   20.472  2.607   1.00 42.44 ? 259 ILE A O   1 
ATOM   1723 C CB  . ILE A 1 221 ? 1.760   19.801  5.707   1.00 40.55 ? 259 ILE A CB  1 
ATOM   1724 C CG1 . ILE A 1 221 ? 1.571   18.623  6.676   1.00 40.06 ? 259 ILE A CG1 1 
ATOM   1725 C CG2 . ILE A 1 221 ? 0.471   20.061  4.895   1.00 40.45 ? 259 ILE A CG2 1 
ATOM   1726 C CD1 . ILE A 1 221 ? 1.168   17.269  5.972   1.00 40.87 ? 259 ILE A CD1 1 
ATOM   1727 N N   . LYS A 1 222 ? 3.752   21.669  3.995   1.00 42.56 ? 260 LYS A N   1 
ATOM   1728 C CA  . LYS A 1 222 ? 4.014   22.686  2.993   1.00 43.63 ? 260 LYS A CA  1 
ATOM   1729 C C   . LYS A 1 222 ? 4.848   22.095  1.826   1.00 43.65 ? 260 LYS A C   1 
ATOM   1730 O O   . LYS A 1 222 ? 4.673   22.466  0.658   1.00 43.15 ? 260 LYS A O   1 
ATOM   1731 C CB  . LYS A 1 222 ? 4.703   23.899  3.625   1.00 44.11 ? 260 LYS A CB  1 
ATOM   1732 C CG  . LYS A 1 222 ? 3.931   24.557  4.777   1.00 46.40 ? 260 LYS A CG  1 
ATOM   1733 C CD  . LYS A 1 222 ? 2.762   25.404  4.286   1.00 51.49 ? 260 LYS A CD  1 
ATOM   1734 C CE  . LYS A 1 222 ? 1.437   24.612  4.257   1.00 55.51 ? 260 LYS A CE  1 
ATOM   1735 N NZ  . LYS A 1 222 ? 0.235   25.530  4.249   1.00 57.35 ? 260 LYS A NZ  1 
ATOM   1736 N N   . GLU A 1 223 ? 5.745   21.175  2.166   1.00 42.98 ? 261 GLU A N   1 
ATOM   1737 C CA  . GLU A 1 223 ? 6.537   20.466  1.193   1.00 43.39 ? 261 GLU A CA  1 
ATOM   1738 C C   . GLU A 1 223 ? 5.615   19.639  0.293   1.00 41.30 ? 261 GLU A C   1 
ATOM   1739 O O   . GLU A 1 223 ? 5.655   19.742  -0.938  1.00 40.60 ? 261 GLU A O   1 
ATOM   1740 C CB  . GLU A 1 223 ? 7.485   19.570  1.959   1.00 43.34 ? 261 GLU A CB  1 
ATOM   1741 C CG  . GLU A 1 223 ? 8.669   19.027  1.233   1.00 46.74 ? 261 GLU A CG  1 
ATOM   1742 C CD  . GLU A 1 223 ? 9.531   18.172  2.191   1.00 48.21 ? 261 GLU A CD  1 
ATOM   1743 O OE1 . GLU A 1 223 ? 10.595  18.657  2.643   1.00 53.37 ? 261 GLU A OE1 1 
ATOM   1744 O OE2 . GLU A 1 223 ? 9.114   17.030  2.530   1.00 53.75 ? 261 GLU A OE2 1 
ATOM   1745 N N   . LEU A 1 224 ? 4.758   18.837  0.907   1.00 39.55 ? 262 LEU A N   1 
ATOM   1746 C CA  . LEU A 1 224 ? 3.829   18.033  0.158   1.00 38.35 ? 262 LEU A CA  1 
ATOM   1747 C C   . LEU A 1 224 ? 2.997   18.939  -0.749  1.00 37.60 ? 262 LEU A C   1 
ATOM   1748 O O   . LEU A 1 224 ? 2.722   18.603  -1.892  1.00 36.26 ? 262 LEU A O   1 
ATOM   1749 C CB  . LEU A 1 224 ? 2.928   17.217  1.094   1.00 37.02 ? 262 LEU A CB  1 
ATOM   1750 C CG  . LEU A 1 224 ? 1.809   16.396  0.448   1.00 37.73 ? 262 LEU A CG  1 
ATOM   1751 C CD1 . LEU A 1 224 ? 2.381   15.397  -0.594  1.00 35.44 ? 262 LEU A CD1 1 
ATOM   1752 C CD2 . LEU A 1 224 ? 0.972   15.678  1.509   1.00 36.20 ? 262 LEU A CD2 1 
ATOM   1753 N N   . GLU A 1 225 ? 2.573   20.075  -0.216  1.00 36.71 ? 263 GLU A N   1 
ATOM   1754 C CA  . GLU A 1 225 ? 1.700   20.948  -0.969  1.00 37.19 ? 263 GLU A CA  1 
ATOM   1755 C C   . GLU A 1 225 ? 2.419   21.460  -2.214  1.00 36.76 ? 263 GLU A C   1 
ATOM   1756 O O   . GLU A 1 225 ? 1.843   21.556  -3.309  1.00 36.94 ? 263 GLU A O   1 
ATOM   1757 C CB  . GLU A 1 225 ? 1.246   22.097  -0.066  1.00 37.33 ? 263 GLU A CB  1 
ATOM   1758 C CG  . GLU A 1 225 ? 0.593   23.229  -0.791  1.00 38.85 ? 263 GLU A CG  1 
ATOM   1759 C CD  . GLU A 1 225 ? 0.242   24.358  0.135   1.00 44.49 ? 263 GLU A CD  1 
ATOM   1760 O OE1 . GLU A 1 225 ? 1.175   24.962  0.731   1.00 46.28 ? 263 GLU A OE1 1 
ATOM   1761 O OE2 . GLU A 1 225 ? -0.969  24.641  0.261   1.00 45.88 ? 263 GLU A OE2 1 
ATOM   1762 N N   . SER A 1 226 ? 3.687   21.777  -2.044  1.00 35.86 ? 264 SER A N   1 
ATOM   1763 C CA  . SER A 1 226 ? 4.483   22.319  -3.118  1.00 36.76 ? 264 SER A CA  1 
ATOM   1764 C C   . SER A 1 226 ? 4.713   21.290  -4.222  1.00 36.60 ? 264 SER A C   1 
ATOM   1765 O O   . SER A 1 226 ? 4.589   21.611  -5.410  1.00 36.55 ? 264 SER A O   1 
ATOM   1766 C CB  . SER A 1 226 ? 5.822   22.810  -2.568  1.00 37.13 ? 264 SER A CB  1 
ATOM   1767 O OG  . SER A 1 226 ? 6.747   22.996  -3.625  1.00 40.72 ? 264 SER A OG  1 
ATOM   1768 N N   . ILE A 1 227 ? 5.041   20.062  -3.837  1.00 36.30 ? 265 ILE A N   1 
ATOM   1769 C CA  . ILE A 1 227 ? 5.289   18.996  -4.794  1.00 36.34 ? 265 ILE A CA  1 
ATOM   1770 C C   . ILE A 1 227 ? 4.011   18.726  -5.592  1.00 36.48 ? 265 ILE A C   1 
ATOM   1771 O O   . ILE A 1 227 ? 4.032   18.659  -6.839  1.00 34.64 ? 265 ILE A O   1 
ATOM   1772 C CB  . ILE A 1 227 ? 5.710   17.692  -4.064  1.00 37.34 ? 265 ILE A CB  1 
ATOM   1773 C CG1 . ILE A 1 227 ? 7.087   17.870  -3.383  1.00 37.03 ? 265 ILE A CG1 1 
ATOM   1774 C CG2 . ILE A 1 227 ? 5.678   16.457  -5.045  1.00 35.94 ? 265 ILE A CG2 1 
ATOM   1775 C CD1 . ILE A 1 227 ? 7.456   16.689  -2.443  1.00 37.42 ? 265 ILE A CD1 1 
ATOM   1776 N N   . ILE A 1 228 ? 2.898   18.612  -4.876  1.00 35.89 ? 266 ILE A N   1 
ATOM   1777 C CA  . ILE A 1 228 ? 1.622   18.295  -5.523  1.00 37.77 ? 266 ILE A CA  1 
ATOM   1778 C C   . ILE A 1 228 ? 1.198   19.422  -6.466  1.00 37.70 ? 266 ILE A C   1 
ATOM   1779 O O   . ILE A 1 228 ? 0.843   19.145  -7.617  1.00 37.84 ? 266 ILE A O   1 
ATOM   1780 C CB  . ILE A 1 228 ? 0.507   17.888  -4.482  1.00 37.92 ? 266 ILE A CB  1 
ATOM   1781 C CG1 . ILE A 1 228 ? 0.767   16.474  -3.930  1.00 39.62 ? 266 ILE A CG1 1 
ATOM   1782 C CG2 . ILE A 1 228 ? -0.899  17.816  -5.114  1.00 39.28 ? 266 ILE A CG2 1 
ATOM   1783 C CD1 . ILE A 1 228 ? 0.607   15.323  -4.975  1.00 41.35 ? 266 ILE A CD1 1 
ATOM   1784 N N   . SER A 1 229 ? 1.330   20.685  -6.028  1.00 38.39 ? 267 SER A N   1 
ATOM   1785 C CA  . SER A 1 229 ? 0.904   21.839  -6.822  1.00 38.68 ? 267 SER A CA  1 
ATOM   1786 C C   . SER A 1 229 ? 1.726   21.953  -8.087  1.00 39.22 ? 267 SER A C   1 
ATOM   1787 O O   . SER A 1 229 ? 1.213   22.336  -9.155  1.00 37.68 ? 267 SER A O   1 
ATOM   1788 C CB  . SER A 1 229 ? 1.053   23.145  -6.030  1.00 39.74 ? 267 SER A CB  1 
ATOM   1789 O OG  . SER A 1 229 ? 0.341   23.033  -4.810  1.00 44.23 ? 267 SER A OG  1 
ATOM   1790 N N   . LYS A 1 230 ? 3.011   21.631  -7.978  1.00 39.25 ? 268 LYS A N   1 
ATOM   1791 C CA  . LYS A 1 230 ? 3.857   21.707  -9.154  1.00 40.46 ? 268 LYS A CA  1 
ATOM   1792 C C   . LYS A 1 230 ? 3.626   20.548  -10.145 1.00 39.83 ? 268 LYS A C   1 
ATOM   1793 O O   . LYS A 1 230 ? 4.111   20.587  -11.259 1.00 40.34 ? 268 LYS A O   1 
ATOM   1794 C CB  . LYS A 1 230 ? 5.337   21.940  -8.785  1.00 40.93 ? 268 LYS A CB  1 
ATOM   1795 C CG  . LYS A 1 230 ? 6.268   21.010  -9.507  1.00 45.61 ? 268 LYS A CG  1 
ATOM   1796 C CD  . LYS A 1 230 ? 6.509   21.352  -11.065 1.00 50.36 ? 268 LYS A CD  1 
ATOM   1797 C CE  . LYS A 1 230 ? 6.995   20.101  -11.827 1.00 46.00 ? 268 LYS A CE  1 
ATOM   1798 N NZ  . LYS A 1 230 ? 6.728   20.056  -13.289 1.00 50.61 ? 268 LYS A NZ  1 
ATOM   1799 N N   . ARG A 1 231 ? 2.884   19.522  -9.746  1.00 39.69 ? 269 ARG A N   1 
ATOM   1800 C CA  . ARG A 1 231 ? 2.427   18.520  -10.679 1.00 39.04 ? 269 ARG A CA  1 
ATOM   1801 C C   . ARG A 1 231 ? 1.095   18.959  -11.354 1.00 39.54 ? 269 ARG A C   1 
ATOM   1802 O O   . ARG A 1 231 ? 0.546   18.216  -12.161 1.00 38.51 ? 269 ARG A O   1 
ATOM   1803 C CB  . ARG A 1 231 ? 2.248   17.168  -9.962  1.00 39.11 ? 269 ARG A CB  1 
ATOM   1804 C CG  . ARG A 1 231 ? 3.531   16.633  -9.307  1.00 38.94 ? 269 ARG A CG  1 
ATOM   1805 C CD  . ARG A 1 231 ? 3.503   15.105  -9.169  1.00 39.10 ? 269 ARG A CD  1 
ATOM   1806 N NE  . ARG A 1 231 ? 3.458   14.519  -10.507 1.00 40.70 ? 269 ARG A NE  1 
ATOM   1807 C CZ  . ARG A 1 231 ? 2.698   13.484  -10.812 1.00 36.66 ? 269 ARG A CZ  1 
ATOM   1808 N NH1 . ARG A 1 231 ? 1.969   12.937  -9.860  1.00 37.35 ? 269 ARG A NH1 1 
ATOM   1809 N NH2 . ARG A 1 231 ? 2.670   13.027  -12.046 1.00 38.98 ? 269 ARG A NH2 1 
ATOM   1810 N N   . ASN A 1 232 ? 0.571   20.143  -11.008 1.00 39.48 ? 270 ASN A N   1 
ATOM   1811 C CA  . ASN A 1 232 ? -0.710  20.627  -11.540 1.00 40.09 ? 270 ASN A CA  1 
ATOM   1812 C C   . ASN A 1 232 ? -1.898  19.895  -10.918 1.00 39.64 ? 270 ASN A C   1 
ATOM   1813 O O   . ASN A 1 232 ? -2.875  19.588  -11.598 1.00 40.25 ? 270 ASN A O   1 
ATOM   1814 C CB  . ASN A 1 232 ? -0.778  20.517  -13.089 1.00 41.01 ? 270 ASN A CB  1 
ATOM   1815 C CG  . ASN A 1 232 ? 0.123   21.521  -13.813 1.00 46.09 ? 270 ASN A CG  1 
ATOM   1816 O OD1 . ASN A 1 232 ? 0.793   21.185  -14.814 1.00 50.03 ? 270 ASN A OD1 1 
ATOM   1817 N ND2 . ASN A 1 232 ? 0.118   22.765  -13.346 1.00 50.32 ? 270 ASN A ND2 1 
ATOM   1818 N N   . ILE A 1 233 ? -1.810  19.605  -9.620  1.00 38.42 ? 271 ILE A N   1 
ATOM   1819 C CA  . ILE A 1 233 ? -2.891  18.968  -8.865  1.00 37.73 ? 271 ILE A CA  1 
ATOM   1820 C C   . ILE A 1 233 ? -3.133  19.877  -7.657  1.00 38.47 ? 271 ILE A C   1 
ATOM   1821 O O   . ILE A 1 233 ? -2.176  20.439  -7.090  1.00 39.08 ? 271 ILE A O   1 
ATOM   1822 C CB  . ILE A 1 233 ? -2.483  17.517  -8.404  1.00 37.22 ? 271 ILE A CB  1 
ATOM   1823 C CG1 . ILE A 1 233 ? -2.299  16.613  -9.619  1.00 37.11 ? 271 ILE A CG1 1 
ATOM   1824 C CG2 . ILE A 1 233 ? -3.525  16.911  -7.453  1.00 35.33 ? 271 ILE A CG2 1 
ATOM   1825 C CD1 . ILE A 1 233 ? -1.642  15.248  -9.352  1.00 35.04 ? 271 ILE A CD1 1 
ATOM   1826 N N   . GLN A 1 234 ? -4.392  20.088  -7.293  1.00 39.00 ? 272 GLN A N   1 
ATOM   1827 C CA  . GLN A 1 234 ? -4.701  20.981  -6.167  1.00 39.95 ? 272 GLN A CA  1 
ATOM   1828 C C   . GLN A 1 234 ? -4.414  20.266  -4.855  1.00 39.98 ? 272 GLN A C   1 
ATOM   1829 O O   . GLN A 1 234 ? -4.561  19.031  -4.761  1.00 40.11 ? 272 GLN A O   1 
ATOM   1830 C CB  . GLN A 1 234 ? -6.161  21.448  -6.209  1.00 39.40 ? 272 GLN A CB  1 
ATOM   1831 C CG  . GLN A 1 234 ? -6.439  22.295  -7.436  1.00 45.76 ? 272 GLN A CG  1 
ATOM   1832 C CD  . GLN A 1 234 ? -7.869  22.821  -7.484  1.00 55.28 ? 272 GLN A CD  1 
ATOM   1833 O OE1 . GLN A 1 234 ? -8.638  22.461  -8.387  1.00 59.58 ? 272 GLN A OE1 1 
ATOM   1834 N NE2 . GLN A 1 234 ? -8.239  23.678  -6.508  1.00 57.57 ? 272 GLN A NE2 1 
ATOM   1835 N N   . PHE A 1 235 ? -4.023  21.032  -3.848  1.00 39.46 ? 273 PHE A N   1 
ATOM   1836 C CA  . PHE A 1 235 ? -3.776  20.447  -2.554  1.00 39.82 ? 273 PHE A CA  1 
ATOM   1837 C C   . PHE A 1 235 ? -4.755  20.978  -1.545  1.00 40.53 ? 273 PHE A C   1 
ATOM   1838 O O   . PHE A 1 235 ? -5.047  22.188  -1.511  1.00 41.26 ? 273 PHE A O   1 
ATOM   1839 C CB  . PHE A 1 235 ? -2.341  20.690  -2.072  1.00 39.83 ? 273 PHE A CB  1 
ATOM   1840 C CG  . PHE A 1 235 ? -2.039  20.018  -0.746  1.00 39.29 ? 273 PHE A CG  1 
ATOM   1841 C CD1 . PHE A 1 235 ? -1.907  18.634  -0.674  1.00 40.08 ? 273 PHE A CD1 1 
ATOM   1842 C CD2 . PHE A 1 235 ? -1.913  20.771  0.412   1.00 39.97 ? 273 PHE A CD2 1 
ATOM   1843 C CE1 . PHE A 1 235 ? -1.646  17.991  0.556   1.00 41.99 ? 273 PHE A CE1 1 
ATOM   1844 C CE2 . PHE A 1 235 ? -1.640  20.151  1.653   1.00 41.09 ? 273 PHE A CE2 1 
ATOM   1845 C CZ  . PHE A 1 235 ? -1.502  18.765  1.719   1.00 40.52 ? 273 PHE A CZ  1 
ATOM   1846 N N   . SER A 1 236 ? -5.249  20.084  -0.707  1.00 40.68 ? 274 SER A N   1 
ATOM   1847 C CA  . SER A 1 236 ? -6.126  20.465  0.379   1.00 42.52 ? 274 SER A CA  1 
ATOM   1848 C C   . SER A 1 236 ? -5.660  19.732  1.633   1.00 42.36 ? 274 SER A C   1 
ATOM   1849 O O   . SER A 1 236 ? -5.142  18.632  1.552   1.00 41.54 ? 274 SER A O   1 
ATOM   1850 C CB  . SER A 1 236 ? -7.548  20.018  0.026   1.00 42.78 ? 274 SER A CB  1 
ATOM   1851 O OG  . SER A 1 236 ? -8.452  20.390  1.043   1.00 47.83 ? 274 SER A OG  1 
ATOM   1852 N N   . CYS A 1 237 ? -5.854  20.327  2.791   1.00 43.61 ? 275 CYS A N   1 
ATOM   1853 C CA  . CYS A 1 237 ? -5.459  19.667  4.029   1.00 44.15 ? 275 CYS A CA  1 
ATOM   1854 C C   . CYS A 1 237 ? -6.519  19.877  5.120   1.00 43.86 ? 275 CYS A C   1 
ATOM   1855 O O   . CYS A 1 237 ? -7.170  20.927  5.163   1.00 42.55 ? 275 CYS A O   1 
ATOM   1856 C CB  . CYS A 1 237 ? -4.082  20.184  4.468   1.00 44.49 ? 275 CYS A CB  1 
ATOM   1857 S SG  . CYS A 1 237 ? -3.409  19.309  5.879   1.00 47.75 ? 275 CYS A SG  1 
ATOM   1858 N N   . LYS A 1 238 ? -6.732  18.849  5.956   1.00 44.13 ? 276 LYS A N   1 
ATOM   1859 C CA  . LYS A 1 238 ? -7.612  18.948  7.145   1.00 44.14 ? 276 LYS A CA  1 
ATOM   1860 C C   . LYS A 1 238 ? -6.967  18.259  8.330   1.00 43.17 ? 276 LYS A C   1 
ATOM   1861 O O   . LYS A 1 238 ? -6.386  17.174  8.187   1.00 42.66 ? 276 LYS A O   1 
ATOM   1862 C CB  . LYS A 1 238 ? -8.961  18.258  6.915   1.00 45.15 ? 276 LYS A CB  1 
ATOM   1863 C CG  . LYS A 1 238 ? -9.629  18.528  5.589   1.00 49.03 ? 276 LYS A CG  1 
ATOM   1864 C CD  . LYS A 1 238 ? -10.309 19.888  5.564   1.00 56.28 ? 276 LYS A CD  1 
ATOM   1865 C CE  . LYS A 1 238 ? -10.969 20.160  4.220   1.00 61.10 ? 276 LYS A CE  1 
ATOM   1866 N NZ  . LYS A 1 238 ? -12.230 19.367  4.078   1.00 64.06 ? 276 LYS A NZ  1 
ATOM   1867 N N   . ASN A 1 239 ? -7.077  18.884  9.495   1.00 41.52 ? 277 ASN A N   1 
ATOM   1868 C CA  . ASN A 1 239 ? -6.672  18.261  10.741  1.00 40.71 ? 277 ASN A CA  1 
ATOM   1869 C C   . ASN A 1 239 ? -7.750  17.300  11.174  1.00 39.99 ? 277 ASN A C   1 
ATOM   1870 O O   . ASN A 1 239 ? -8.935  17.616  11.063  1.00 40.86 ? 277 ASN A O   1 
ATOM   1871 C CB  . ASN A 1 239 ? -6.528  19.316  11.845  1.00 40.21 ? 277 ASN A CB  1 
ATOM   1872 C CG  . ASN A 1 239 ? -5.347  20.241  11.625  1.00 41.26 ? 277 ASN A CG  1 
ATOM   1873 O OD1 . ASN A 1 239 ? -4.196  19.853  11.837  1.00 40.69 ? 277 ASN A OD1 1 
ATOM   1874 N ND2 . ASN A 1 239 ? -5.628  21.481  11.226  1.00 39.86 ? 277 ASN A ND2 1 
ATOM   1875 N N   . ILE A 1 240 ? -7.370  16.137  11.675  1.00 38.62 ? 278 ILE A N   1 
ATOM   1876 C CA  . ILE A 1 240 ? -8.340  15.328  12.398  1.00 38.67 ? 278 ILE A CA  1 
ATOM   1877 C C   . ILE A 1 240 ? -7.842  15.273  13.822  1.00 38.97 ? 278 ILE A C   1 
ATOM   1878 O O   . ILE A 1 240 ? -6.972  14.484  14.144  1.00 38.95 ? 278 ILE A O   1 
ATOM   1879 C CB  . ILE A 1 240 ? -8.566  13.914  11.783  1.00 38.05 ? 278 ILE A CB  1 
ATOM   1880 C CG1 . ILE A 1 240 ? -9.180  14.038  10.364  1.00 36.85 ? 278 ILE A CG1 1 
ATOM   1881 C CG2 . ILE A 1 240 ? -9.421  13.037  12.714  1.00 36.19 ? 278 ILE A CG2 1 
ATOM   1882 C CD1 . ILE A 1 240 ? -9.765  12.743  9.849   1.00 39.79 ? 278 ILE A CD1 1 
ATOM   1883 N N   . TYR A 1 241 ? -8.374  16.157  14.645  1.00 40.21 ? 279 TYR A N   1 
ATOM   1884 C CA  . TYR A 1 241 ? -7.917  16.300  16.033  1.00 41.69 ? 279 TYR A CA  1 
ATOM   1885 C C   . TYR A 1 241 ? -8.224  15.095  16.914  1.00 42.13 ? 279 TYR A C   1 
ATOM   1886 O O   . TYR A 1 241 ? -7.388  14.680  17.733  1.00 42.94 ? 279 TYR A O   1 
ATOM   1887 C CB  . TYR A 1 241 ? -8.523  17.547  16.676  1.00 42.53 ? 279 TYR A CB  1 
ATOM   1888 C CG  . TYR A 1 241 ? -8.153  18.827  15.979  1.00 43.83 ? 279 TYR A CG  1 
ATOM   1889 C CD1 . TYR A 1 241 ? -6.891  19.412  16.161  1.00 45.00 ? 279 TYR A CD1 1 
ATOM   1890 C CD2 . TYR A 1 241 ? -9.061  19.456  15.128  1.00 44.92 ? 279 TYR A CD2 1 
ATOM   1891 C CE1 . TYR A 1 241 ? -6.540  20.600  15.496  1.00 45.88 ? 279 TYR A CE1 1 
ATOM   1892 C CE2 . TYR A 1 241 ? -8.728  20.641  14.458  1.00 46.16 ? 279 TYR A CE2 1 
ATOM   1893 C CZ  . TYR A 1 241 ? -7.468  21.206  14.650  1.00 45.46 ? 279 TYR A CZ  1 
ATOM   1894 O OH  . TYR A 1 241 ? -7.164  22.376  13.997  1.00 46.39 ? 279 TYR A OH  1 
ATOM   1895 N N   . ARG A 1 242 ? -9.433  14.557  16.780  1.00 42.08 ? 280 ARG A N   1 
ATOM   1896 C CA  . ARG A 1 242 ? -9.889  13.461  17.647  1.00 41.48 ? 280 ARG A CA  1 
ATOM   1897 C C   . ARG A 1 242 ? -10.335 12.290  16.789  1.00 40.29 ? 280 ARG A C   1 
ATOM   1898 O O   . ARG A 1 242 ? -11.521 12.197  16.456  1.00 39.99 ? 280 ARG A O   1 
ATOM   1899 N N   . PRO A 1 243 ? -9.390  11.401  16.420  1.00 39.49 ? 281 PRO A N   1 
ATOM   1900 C CA  . PRO A 1 243 ? -9.724  10.258  15.547  1.00 39.65 ? 281 PRO A CA  1 
ATOM   1901 C C   . PRO A 1 243 ? -10.766 9.296   16.155  1.00 39.08 ? 281 PRO A C   1 
ATOM   1902 O O   . PRO A 1 243 ? -11.477 8.615   15.404  1.00 38.23 ? 281 PRO A O   1 
ATOM   1903 C CB  . PRO A 1 243 ? -8.368  9.568   15.282  1.00 38.94 ? 281 PRO A CB  1 
ATOM   1904 C CG  . PRO A 1 243 ? -7.415  10.150  16.272  1.00 39.97 ? 281 PRO A CG  1 
ATOM   1905 C CD  . PRO A 1 243 ? -7.959  11.447  16.773  1.00 39.55 ? 281 PRO A CD  1 
ATOM   1906 N N   . ASP A 1 244 ? -10.851 9.265   17.487  1.00 38.55 ? 282 ASP A N   1 
ATOM   1907 C CA  . ASP A 1 244 ? -11.888 8.514   18.188  1.00 38.69 ? 282 ASP A CA  1 
ATOM   1908 C C   . ASP A 1 244 ? -13.268 9.116   17.919  1.00 38.46 ? 282 ASP A C   1 
ATOM   1909 O O   . ASP A 1 244 ? -14.234 8.383   17.718  1.00 38.78 ? 282 ASP A O   1 
ATOM   1910 C CB  . ASP A 1 244 ? -11.607 8.449   19.709  1.00 38.90 ? 282 ASP A CB  1 
ATOM   1911 C CG  . ASP A 1 244 ? -11.496 9.833   20.344  1.00 39.19 ? 282 ASP A CG  1 
ATOM   1912 O OD1 . ASP A 1 244 ? -10.422 10.514  20.171  1.00 41.01 ? 282 ASP A OD1 1 
ATOM   1913 O OD2 . ASP A 1 244 ? -12.513 10.266  20.984  1.00 41.69 ? 282 ASP A OD2 1 
ATOM   1914 N N   . LYS A 1 245 ? -13.367 10.438  17.928  1.00 38.50 ? 283 LYS A N   1 
ATOM   1915 C CA  . LYS A 1 245 ? -14.621 11.099  17.581  1.00 40.08 ? 283 LYS A CA  1 
ATOM   1916 C C   . LYS A 1 245 ? -14.903 11.032  16.058  1.00 39.75 ? 283 LYS A C   1 
ATOM   1917 O O   . LYS A 1 245 ? -16.058 10.895  15.641  1.00 40.19 ? 283 LYS A O   1 
ATOM   1918 C CB  . LYS A 1 245 ? -14.625 12.556  18.062  1.00 39.85 ? 283 LYS A CB  1 
ATOM   1919 C CG  . LYS A 1 245 ? -15.993 13.242  17.918  1.00 42.42 ? 283 LYS A CG  1 
ATOM   1920 C CD  . LYS A 1 245 ? -16.070 14.605  18.622  1.00 42.57 ? 283 LYS A CD  1 
ATOM   1921 C CE  . LYS A 1 245 ? -15.270 15.672  17.856  1.00 47.78 ? 283 LYS A CE  1 
ATOM   1922 N NZ  . LYS A 1 245 ? -15.270 16.954  18.626  1.00 49.48 ? 283 LYS A NZ  1 
ATOM   1923 N N   . PHE A 1 246 ? -13.859 11.122  15.243  1.00 39.17 ? 284 PHE A N   1 
ATOM   1924 C CA  . PHE A 1 246 ? -14.015 11.005  13.792  1.00 39.18 ? 284 PHE A CA  1 
ATOM   1925 C C   . PHE A 1 246 ? -14.714 9.694   13.402  1.00 39.47 ? 284 PHE A C   1 
ATOM   1926 O O   . PHE A 1 246 ? -15.750 9.724   12.739  1.00 39.28 ? 284 PHE A O   1 
ATOM   1927 C CB  . PHE A 1 246 ? -12.660 11.089  13.098  1.00 38.89 ? 284 PHE A CB  1 
ATOM   1928 C CG  . PHE A 1 246 ? -12.713 10.776  11.633  1.00 39.59 ? 284 PHE A CG  1 
ATOM   1929 C CD1 . PHE A 1 246 ? -13.365 11.631  10.756  1.00 40.34 ? 284 PHE A CD1 1 
ATOM   1930 C CD2 . PHE A 1 246 ? -12.112 9.617   11.128  1.00 37.98 ? 284 PHE A CD2 1 
ATOM   1931 C CE1 . PHE A 1 246 ? -13.397 11.349  9.363   1.00 41.36 ? 284 PHE A CE1 1 
ATOM   1932 C CE2 . PHE A 1 246 ? -12.154 9.321   9.747   1.00 38.71 ? 284 PHE A CE2 1 
ATOM   1933 C CZ  . PHE A 1 246 ? -12.796 10.191  8.869   1.00 38.06 ? 284 PHE A CZ  1 
ATOM   1934 N N   . LEU A 1 247 ? -14.146 8.559   13.821  1.00 39.24 ? 285 LEU A N   1 
ATOM   1935 C CA  . LEU A 1 247 ? -14.753 7.262   13.568  1.00 40.08 ? 285 LEU A CA  1 
ATOM   1936 C C   . LEU A 1 247 ? -16.178 7.208   14.087  1.00 40.52 ? 285 LEU A C   1 
ATOM   1937 O O   . LEU A 1 247 ? -17.029 6.613   13.453  1.00 41.01 ? 285 LEU A O   1 
ATOM   1938 C CB  . LEU A 1 247 ? -13.980 6.140   14.249  1.00 39.77 ? 285 LEU A CB  1 
ATOM   1939 C CG  . LEU A 1 247 ? -12.999 5.218   13.562  1.00 41.00 ? 285 LEU A CG  1 
ATOM   1940 C CD1 . LEU A 1 247 ? -12.905 3.986   14.441  1.00 41.66 ? 285 LEU A CD1 1 
ATOM   1941 C CD2 . LEU A 1 247 ? -13.433 4.853   12.124  1.00 41.84 ? 285 LEU A CD2 1 
ATOM   1942 N N   . GLN A 1 248 ? -16.434 7.798   15.257  1.00 40.97 ? 286 GLN A N   1 
ATOM   1943 C CA  . GLN A 1 248 ? -17.763 7.774   15.819  1.00 41.86 ? 286 GLN A CA  1 
ATOM   1944 C C   . GLN A 1 248 ? -18.747 8.540   14.952  1.00 42.36 ? 286 GLN A C   1 
ATOM   1945 O O   . GLN A 1 248 ? -19.864 8.103   14.746  1.00 42.45 ? 286 GLN A O   1 
ATOM   1946 C CB  . GLN A 1 248 ? -17.762 8.329   17.240  1.00 41.74 ? 286 GLN A CB  1 
ATOM   1947 C CG  . GLN A 1 248 ? -19.119 8.235   17.935  1.00 42.99 ? 286 GLN A CG  1 
ATOM   1948 C CD  . GLN A 1 248 ? -19.791 6.865   17.761  1.00 43.59 ? 286 GLN A CD  1 
ATOM   1949 O OE1 . GLN A 1 248 ? -21.044 6.803   17.669  1.00 44.87 ? 286 GLN A OE1 1 
ATOM   1950 N NE2 . GLN A 1 248 ? -18.976 5.768   17.730  1.00 42.78 ? 286 GLN A NE2 1 
ATOM   1951 N N   . CYS A 1 249 ? -18.331 9.690   14.456  1.00 43.51 ? 287 CYS A N   1 
ATOM   1952 C CA  . CYS A 1 249 ? -19.132 10.441  13.493  1.00 45.17 ? 287 CYS A CA  1 
ATOM   1953 C C   . CYS A 1 249 ? -19.347 9.701   12.162  1.00 44.99 ? 287 CYS A C   1 
ATOM   1954 O O   . CYS A 1 249 ? -20.426 9.765   11.600  1.00 45.36 ? 287 CYS A O   1 
ATOM   1955 C CB  . CYS A 1 249 ? -18.516 11.821  13.257  1.00 45.74 ? 287 CYS A CB  1 
ATOM   1956 S SG  . CYS A 1 249 ? -18.590 12.818  14.739  1.00 49.14 ? 287 CYS A SG  1 
ATOM   1957 N N   . VAL A 1 250 ? -18.338 8.995   11.672  1.00 45.55 ? 288 VAL A N   1 
ATOM   1958 C CA  . VAL A 1 250 ? -18.505 8.172   10.471  1.00 45.71 ? 288 VAL A CA  1 
ATOM   1959 C C   . VAL A 1 250 ? -19.577 7.087   10.707  1.00 46.49 ? 288 VAL A C   1 
ATOM   1960 O O   . VAL A 1 250 ? -20.413 6.838   9.849   1.00 46.76 ? 288 VAL A O   1 
ATOM   1961 C CB  . VAL A 1 250 ? -17.158 7.560   9.973   1.00 45.98 ? 288 VAL A CB  1 
ATOM   1962 C CG1 . VAL A 1 250 ? -17.361 6.693   8.737   1.00 45.52 ? 288 VAL A CG1 1 
ATOM   1963 C CG2 . VAL A 1 250 ? -16.136 8.652   9.653   1.00 44.37 ? 288 VAL A CG2 1 
ATOM   1964 N N   . LYS A 1 251 ? -19.579 6.458   11.878  1.00 47.09 ? 289 LYS A N   1 
ATOM   1965 C CA  . LYS A 1 251 ? -20.524 5.372   12.135  1.00 47.48 ? 289 LYS A CA  1 
ATOM   1966 C C   . LYS A 1 251 ? -21.923 5.916   12.381  1.00 48.34 ? 289 LYS A C   1 
ATOM   1967 O O   . LYS A 1 251 ? -22.911 5.253   12.103  1.00 48.62 ? 289 LYS A O   1 
ATOM   1968 C CB  . LYS A 1 251 ? -20.083 4.521   13.324  1.00 47.61 ? 289 LYS A CB  1 
ATOM   1969 C CG  . LYS A 1 251 ? -18.799 3.751   13.112  1.00 45.96 ? 289 LYS A CG  1 
ATOM   1970 C CD  . LYS A 1 251 ? -18.350 3.091   14.404  1.00 46.97 ? 289 LYS A CD  1 
ATOM   1971 C CE  . LYS A 1 251 ? -16.914 2.647   14.278  1.00 48.15 ? 289 LYS A CE  1 
ATOM   1972 N NZ  . LYS A 1 251 ? -16.474 1.750   15.366  1.00 47.38 ? 289 LYS A NZ  1 
ATOM   1973 N N   . ASN A 1 252 ? -21.991 7.134   12.901  1.00 49.37 ? 290 ASN A N   1 
ATOM   1974 C CA  . ASN A 1 252 ? -23.245 7.744   13.304  1.00 50.20 ? 290 ASN A CA  1 
ATOM   1975 C C   . ASN A 1 252 ? -23.240 9.214   12.890  1.00 51.22 ? 290 ASN A C   1 
ATOM   1976 O O   . ASN A 1 252 ? -23.135 10.095  13.748  1.00 50.93 ? 290 ASN A O   1 
ATOM   1977 C CB  . ASN A 1 252 ? -23.415 7.608   14.805  1.00 50.35 ? 290 ASN A CB  1 
ATOM   1978 N N   . PRO A 1 253 ? -23.310 9.467   11.575  1.00 52.01 ? 291 PRO A N   1 
ATOM   1979 C CA  . PRO A 1 253 ? -23.368 10.828  11.025  1.00 53.59 ? 291 PRO A CA  1 
ATOM   1980 C C   . PRO A 1 253 ? -24.406 11.657  11.765  1.00 54.92 ? 291 PRO A C   1 
ATOM   1981 O O   . PRO A 1 253 ? -25.557 11.229  11.941  1.00 55.11 ? 291 PRO A O   1 
ATOM   1982 N N   . GLU A 1 254 ? -24.004 12.834  12.235  1.00 55.80 ? 292 GLU A N   1 
ATOM   1983 C CA  . GLU A 1 254 ? -24.906 13.680  13.032  1.00 57.30 ? 292 GLU A CA  1 
ATOM   1984 C C   . GLU A 1 254 ? -25.303 13.058  14.366  1.00 57.79 ? 292 GLU A C   1 
ATOM   1985 O O   . GLU A 1 254 ? -24.973 11.909  14.669  1.00 57.75 ? 292 GLU A O   1 
ATOM   1986 N N   . ASP A 1 255 ? -26.018 13.821  15.173  1.00 58.61 ? 293 ASP A N   1 
ATOM   1987 C CA  . ASP A 1 255 ? -26.384 13.342  16.498  1.00 59.63 ? 293 ASP A CA  1 
ATOM   1988 C C   . ASP A 1 255 ? -25.246 13.565  17.479  1.00 60.20 ? 293 ASP A C   1 
ATOM   1989 O O   . ASP A 1 255 ? -24.188 12.909  17.389  1.00 59.96 ? 293 ASP A O   1 
ATOM   1990 N N   . SER A 1 256 ? -25.484 14.487  18.422  1.00 60.60 ? 294 SER A N   1 
ATOM   1991 C CA  . SER A 1 256 ? -24.451 14.958  19.344  1.00 60.58 ? 294 SER A CA  1 
ATOM   1992 C C   . SER A 1 256 ? -23.500 15.968  18.712  1.00 60.31 ? 294 SER A C   1 
ATOM   1993 O O   . SER A 1 256 ? -23.930 16.969  18.109  1.00 60.09 ? 294 SER A O   1 
ATOM   1994 N N   . SER A 1 257 ? -22.200 15.689  18.838  1.00 60.18 ? 295 SER A N   1 
ATOM   1995 C CA  . SER A 1 257 ? -21.167 16.666  18.503  1.00 59.97 ? 295 SER A CA  1 
ATOM   1996 C C   . SER A 1 257 ? -20.451 16.464  17.188  1.00 59.80 ? 295 SER A C   1 
ATOM   1997 O O   . SER A 1 257 ? -19.286 16.843  17.049  1.00 60.17 ? 295 SER A O   1 
ATOM   1998 N N   . CYS A 1 258 ? -21.136 15.875  16.214  1.00 59.34 ? 296 CYS A N   1 
ATOM   1999 C CA  . CYS A 1 258 ? -20.560 15.735  14.887  1.00 58.51 ? 296 CYS A CA  1 
ATOM   2000 C C   . CYS A 1 258 ? -20.877 16.945  14.027  1.00 58.70 ? 296 CYS A C   1 
ATOM   2001 O O   . CYS A 1 258 ? -20.363 17.051  12.911  1.00 58.84 ? 296 CYS A O   1 
ATOM   2002 C CB  . CYS A 1 258 ? -21.045 14.454  14.204  1.00 58.27 ? 296 CYS A CB  1 
ATOM   2003 S SG  . CYS A 1 258 ? -20.581 12.939  15.086  1.00 56.07 ? 296 CYS A SG  1 
ATOM   2004 N N   . ARG B 1 7   ? 26.725  16.638  4.498   1.00 49.90 ? 45  ARG B N   1 
ATOM   2005 C CA  . ARG B 1 7   ? 25.798  15.537  4.881   1.00 49.23 ? 45  ARG B CA  1 
ATOM   2006 C C   . ARG B 1 7   ? 26.141  14.219  4.154   1.00 48.34 ? 45  ARG B C   1 
ATOM   2007 O O   . ARG B 1 7   ? 26.610  14.201  2.997   1.00 47.60 ? 45  ARG B O   1 
ATOM   2008 C CB  . ARG B 1 7   ? 24.345  15.958  4.671   1.00 49.27 ? 45  ARG B CB  1 
ATOM   2009 C CG  . ARG B 1 7   ? 23.344  14.987  5.198   1.00 51.41 ? 45  ARG B CG  1 
ATOM   2010 C CD  . ARG B 1 7   ? 22.279  15.687  5.985   1.00 54.82 ? 45  ARG B CD  1 
ATOM   2011 N NE  . ARG B 1 7   ? 21.534  14.733  6.803   1.00 59.01 ? 45  ARG B NE  1 
ATOM   2012 C CZ  . ARG B 1 7   ? 20.367  14.185  6.459   1.00 61.47 ? 45  ARG B CZ  1 
ATOM   2013 N NH1 . ARG B 1 7   ? 19.782  14.498  5.305   1.00 63.04 ? 45  ARG B NH1 1 
ATOM   2014 N NH2 . ARG B 1 7   ? 19.772  13.328  7.277   1.00 62.71 ? 45  ARG B NH2 1 
ATOM   2015 N N   . TRP B 1 8   ? 25.905  13.133  4.885   1.00 47.06 ? 46  TRP B N   1 
ATOM   2016 C CA  . TRP B 1 8   ? 26.267  11.775  4.521   1.00 45.97 ? 46  TRP B CA  1 
ATOM   2017 C C   . TRP B 1 8   ? 25.236  11.095  3.621   1.00 45.53 ? 46  TRP B C   1 
ATOM   2018 O O   . TRP B 1 8   ? 25.446  9.959   3.187   1.00 45.13 ? 46  TRP B O   1 
ATOM   2019 C CB  . TRP B 1 8   ? 26.391  10.958  5.797   1.00 45.46 ? 46  TRP B CB  1 
ATOM   2020 C CG  . TRP B 1 8   ? 25.115  10.925  6.582   1.00 45.05 ? 46  TRP B CG  1 
ATOM   2021 C CD1 . TRP B 1 8   ? 24.091  10.045  6.434   1.00 45.14 ? 46  TRP B CD1 1 
ATOM   2022 C CD2 . TRP B 1 8   ? 24.720  11.832  7.619   1.00 45.22 ? 46  TRP B CD2 1 
ATOM   2023 N NE1 . TRP B 1 8   ? 23.080  10.335  7.321   1.00 44.72 ? 46  TRP B NE1 1 
ATOM   2024 C CE2 . TRP B 1 8   ? 23.438  11.430  8.059   1.00 45.32 ? 46  TRP B CE2 1 
ATOM   2025 C CE3 . TRP B 1 8   ? 25.323  12.949  8.217   1.00 45.21 ? 46  TRP B CE3 1 
ATOM   2026 C CZ2 . TRP B 1 8   ? 22.748  12.095  9.086   1.00 46.16 ? 46  TRP B CZ2 1 
ATOM   2027 C CZ3 . TRP B 1 8   ? 24.642  13.610  9.238   1.00 45.95 ? 46  TRP B CZ3 1 
ATOM   2028 C CH2 . TRP B 1 8   ? 23.362  13.179  9.662   1.00 45.83 ? 46  TRP B CH2 1 
ATOM   2029 N N   . ARG B 1 9   ? 24.113  11.766  3.384   1.00 45.36 ? 47  ARG B N   1 
ATOM   2030 C CA  . ARG B 1 9   ? 23.006  11.180  2.620   1.00 45.77 ? 47  ARG B CA  1 
ATOM   2031 C C   . ARG B 1 9   ? 22.907  11.669  1.168   1.00 44.30 ? 47  ARG B C   1 
ATOM   2032 O O   . ARG B 1 9   ? 23.176  12.826  0.866   1.00 44.52 ? 47  ARG B O   1 
ATOM   2033 C CB  . ARG B 1 9   ? 21.675  11.420  3.335   1.00 46.16 ? 47  ARG B CB  1 
ATOM   2034 C CG  . ARG B 1 9   ? 21.287  10.302  4.239   1.00 50.91 ? 47  ARG B CG  1 
ATOM   2035 C CD  . ARG B 1 9   ? 19.813  9.973   4.091   1.00 57.72 ? 47  ARG B CD  1 
ATOM   2036 N NE  . ARG B 1 9   ? 19.631  8.525   4.004   1.00 63.01 ? 47  ARG B NE  1 
ATOM   2037 C CZ  . ARG B 1 9   ? 19.548  7.827   2.867   1.00 65.99 ? 47  ARG B CZ  1 
ATOM   2038 N NH1 . ARG B 1 9   ? 19.608  8.426   1.669   1.00 67.39 ? 47  ARG B NH1 1 
ATOM   2039 N NH2 . ARG B 1 9   ? 19.393  6.507   2.933   1.00 67.70 ? 47  ARG B NH2 1 
ATOM   2040 N N   . GLN B 1 10  ? 22.546  10.782  0.259   1.00 42.91 ? 48  GLN B N   1 
ATOM   2041 C CA  . GLN B 1 10  ? 22.271  11.220  -1.092  1.00 43.03 ? 48  GLN B CA  1 
ATOM   2042 C C   . GLN B 1 10  ? 20.825  10.919  -1.388  1.00 42.06 ? 48  GLN B C   1 
ATOM   2043 O O   . GLN B 1 10  ? 20.301  9.924   -0.926  1.00 42.36 ? 48  GLN B O   1 
ATOM   2044 C CB  . GLN B 1 10  ? 23.190  10.546  -2.120  1.00 42.92 ? 48  GLN B CB  1 
ATOM   2045 C CG  . GLN B 1 10  ? 24.682  10.968  -2.026  1.00 43.59 ? 48  GLN B CG  1 
ATOM   2046 C CD  . GLN B 1 10  ? 25.540  10.320  -3.107  1.00 43.50 ? 48  GLN B CD  1 
ATOM   2047 O OE1 . GLN B 1 10  ? 25.028  9.602   -3.975  1.00 40.57 ? 48  GLN B OE1 1 
ATOM   2048 N NE2 . GLN B 1 10  ? 26.849  10.560  -3.053  1.00 44.21 ? 48  GLN B NE2 1 
ATOM   2049 N N   . THR B 1 11  ? 20.200  11.772  -2.176  1.00 42.25 ? 49  THR B N   1 
ATOM   2050 C CA  . THR B 1 11  ? 18.763  11.696  -2.415  1.00 42.92 ? 49  THR B CA  1 
ATOM   2051 C C   . THR B 1 11  ? 18.421  10.516  -3.329  1.00 41.52 ? 49  THR B C   1 
ATOM   2052 O O   . THR B 1 11  ? 17.432  9.867   -3.108  1.00 41.15 ? 49  THR B O   1 
ATOM   2053 C CB  . THR B 1 11  ? 18.256  13.040  -3.029  1.00 44.85 ? 49  THR B CB  1 
ATOM   2054 O OG1 . THR B 1 11  ? 18.854  14.150  -2.324  1.00 48.62 ? 49  THR B OG1 1 
ATOM   2055 C CG2 . THR B 1 11  ? 16.757  13.149  -2.957  1.00 45.26 ? 49  THR B CG2 1 
ATOM   2056 N N   . TRP B 1 12  ? 19.252  10.255  -4.353  1.00 39.52 ? 50  TRP B N   1 
ATOM   2057 C CA  . TRP B 1 12  ? 18.904  9.352   -5.465  1.00 38.05 ? 50  TRP B CA  1 
ATOM   2058 C C   . TRP B 1 12  ? 19.926  8.226   -5.628  1.00 38.03 ? 50  TRP B C   1 
ATOM   2059 O O   . TRP B 1 12  ? 21.026  8.331   -5.091  1.00 37.19 ? 50  TRP B O   1 
ATOM   2060 C CB  . TRP B 1 12  ? 18.789  10.142  -6.761  1.00 37.32 ? 50  TRP B CB  1 
ATOM   2061 C CG  . TRP B 1 12  ? 17.859  11.325  -6.645  1.00 36.34 ? 50  TRP B CG  1 
ATOM   2062 C CD1 . TRP B 1 12  ? 18.183  12.673  -6.759  1.00 37.36 ? 50  TRP B CD1 1 
ATOM   2063 C CD2 . TRP B 1 12  ? 16.455  11.277  -6.354  1.00 36.61 ? 50  TRP B CD2 1 
ATOM   2064 N NE1 . TRP B 1 12  ? 17.053  13.447  -6.555  1.00 35.07 ? 50  TRP B NE1 1 
ATOM   2065 C CE2 . TRP B 1 12  ? 15.984  12.618  -6.313  1.00 37.07 ? 50  TRP B CE2 1 
ATOM   2066 C CE3 . TRP B 1 12  ? 15.542  10.230  -6.121  1.00 37.37 ? 50  TRP B CE3 1 
ATOM   2067 C CZ2 . TRP B 1 12  ? 14.641  12.931  -6.061  1.00 36.91 ? 50  TRP B CZ2 1 
ATOM   2068 C CZ3 . TRP B 1 12  ? 14.193  10.549  -5.867  1.00 38.31 ? 50  TRP B CZ3 1 
ATOM   2069 C CH2 . TRP B 1 12  ? 13.761  11.894  -5.848  1.00 36.46 ? 50  TRP B CH2 1 
ATOM   2070 N N   . SER B 1 13  ? 19.547  7.168   -6.357  1.00 36.96 ? 51  SER B N   1 
ATOM   2071 C CA  . SER B 1 13  ? 20.416  5.985   -6.600  1.00 37.64 ? 51  SER B CA  1 
ATOM   2072 C C   . SER B 1 13  ? 21.353  6.153   -7.782  1.00 37.41 ? 51  SER B C   1 
ATOM   2073 O O   . SER B 1 13  ? 22.375  5.492   -7.842  1.00 37.33 ? 51  SER B O   1 
ATOM   2074 C CB  . SER B 1 13  ? 19.567  4.760   -6.891  1.00 36.66 ? 51  SER B CB  1 
ATOM   2075 O OG  . SER B 1 13  ? 18.669  4.519   -5.830  1.00 40.47 ? 51  SER B OG  1 
ATOM   2076 N N   . GLY B 1 14  ? 20.978  7.018   -8.716  1.00 37.31 ? 52  GLY B N   1 
ATOM   2077 C CA  . GLY B 1 14  ? 21.670  7.168   -10.000 1.00 38.91 ? 52  GLY B CA  1 
ATOM   2078 C C   . GLY B 1 14  ? 22.790  8.194   -9.900  1.00 38.89 ? 52  GLY B C   1 
ATOM   2079 O O   . GLY B 1 14  ? 22.832  8.970   -8.930  1.00 39.46 ? 52  GLY B O   1 
ATOM   2080 N N   . PRO B 1 15  ? 23.735  8.188   -10.863 1.00 38.80 ? 53  PRO B N   1 
ATOM   2081 C CA  . PRO B 1 15  ? 24.833  9.177   -10.862 1.00 37.80 ? 53  PRO B CA  1 
ATOM   2082 C C   . PRO B 1 15  ? 24.268  10.576  -10.930 1.00 37.47 ? 53  PRO B C   1 
ATOM   2083 O O   . PRO B 1 15  ? 23.175  10.772  -11.491 1.00 37.90 ? 53  PRO B O   1 
ATOM   2084 C CB  . PRO B 1 15  ? 25.603  8.829   -12.153 1.00 38.01 ? 53  PRO B CB  1 
ATOM   2085 C CG  . PRO B 1 15  ? 25.413  7.309   -12.252 1.00 38.91 ? 53  PRO B CG  1 
ATOM   2086 C CD  . PRO B 1 15  ? 23.894  7.248   -11.990 1.00 39.42 ? 53  PRO B CD  1 
ATOM   2087 N N   . GLY B 1 16  ? 24.974  11.544  -10.339 1.00 36.22 ? 54  GLY B N   1 
ATOM   2088 C CA  . GLY B 1 16  ? 24.529  12.951  -10.384 1.00 34.96 ? 54  GLY B CA  1 
ATOM   2089 C C   . GLY B 1 16  ? 24.773  13.647  -11.719 1.00 35.66 ? 54  GLY B C   1 
ATOM   2090 O O   . GLY B 1 16  ? 25.259  13.017  -12.693 1.00 34.99 ? 54  GLY B O   1 
ATOM   2091 N N   . THR B 1 17  ? 24.431  14.946  -11.790 1.00 34.71 ? 55  THR B N   1 
ATOM   2092 C CA  . THR B 1 17  ? 24.716  15.748  -12.979 1.00 34.16 ? 55  THR B CA  1 
ATOM   2093 C C   . THR B 1 17  ? 26.215  15.762  -13.318 1.00 34.13 ? 55  THR B C   1 
ATOM   2094 O O   . THR B 1 17  ? 27.073  15.956  -12.438 1.00 35.58 ? 55  THR B O   1 
ATOM   2095 C CB  . THR B 1 17  ? 24.226  17.171  -12.771 1.00 34.28 ? 55  THR B CB  1 
ATOM   2096 O OG1 . THR B 1 17  ? 22.853  17.116  -12.389 1.00 35.39 ? 55  THR B OG1 1 
ATOM   2097 C CG2 . THR B 1 17  ? 24.385  18.004  -14.032 1.00 33.98 ? 55  THR B CG2 1 
ATOM   2098 N N   . THR B 1 18  ? 26.544  15.537  -14.591 1.00 35.15 ? 56  THR B N   1 
ATOM   2099 C CA  . THR B 1 18  ? 27.927  15.600  -15.085 1.00 35.04 ? 56  THR B CA  1 
ATOM   2100 C C   . THR B 1 18  ? 28.588  16.901  -14.685 1.00 35.93 ? 56  THR B C   1 
ATOM   2101 O O   . THR B 1 18  ? 27.952  17.950  -14.735 1.00 36.94 ? 56  THR B O   1 
ATOM   2102 C CB  . THR B 1 18  ? 27.902  15.537  -16.645 1.00 34.99 ? 56  THR B CB  1 
ATOM   2103 O OG1 . THR B 1 18  ? 27.036  14.457  -17.008 1.00 36.80 ? 56  THR B OG1 1 
ATOM   2104 C CG2 . THR B 1 18  ? 29.264  15.387  -17.206 1.00 34.15 ? 56  THR B CG2 1 
ATOM   2105 N N   . LYS B 1 19  ? 29.840  16.852  -14.253 1.00 35.85 ? 57  LYS B N   1 
ATOM   2106 C CA  . LYS B 1 19  ? 30.474  18.075  -13.756 1.00 36.72 ? 57  LYS B CA  1 
ATOM   2107 C C   . LYS B 1 19  ? 30.515  19.094  -14.895 1.00 37.80 ? 57  LYS B C   1 
ATOM   2108 O O   . LYS B 1 19  ? 30.697  18.712  -16.045 1.00 38.25 ? 57  LYS B O   1 
ATOM   2109 C CB  . LYS B 1 19  ? 31.877  17.802  -13.186 1.00 36.58 ? 57  LYS B CB  1 
ATOM   2110 C CG  . LYS B 1 19  ? 32.956  17.500  -14.169 1.00 36.07 ? 57  LYS B CG  1 
ATOM   2111 C CD  . LYS B 1 19  ? 34.314  17.200  -13.482 1.00 36.13 ? 57  LYS B CD  1 
ATOM   2112 C CE  . LYS B 1 19  ? 35.079  18.431  -12.998 1.00 35.82 ? 57  LYS B CE  1 
ATOM   2113 N NZ  . LYS B 1 19  ? 36.444  18.100  -12.506 1.00 32.69 ? 57  LYS B NZ  1 
ATOM   2114 N N   . ARG B 1 20  ? 30.303  20.372  -14.577 1.00 38.90 ? 58  ARG B N   1 
ATOM   2115 C CA  . ARG B 1 20  ? 30.400  21.477  -15.544 1.00 39.13 ? 58  ARG B CA  1 
ATOM   2116 C C   . ARG B 1 20  ? 29.355  21.360  -16.660 1.00 39.25 ? 58  ARG B C   1 
ATOM   2117 O O   . ARG B 1 20  ? 29.565  21.807  -17.784 1.00 39.24 ? 58  ARG B O   1 
ATOM   2118 C CB  . ARG B 1 20  ? 31.836  21.635  -16.069 1.00 39.16 ? 58  ARG B CB  1 
ATOM   2119 C CG  . ARG B 1 20  ? 32.815  21.946  -14.903 1.00 41.67 ? 58  ARG B CG  1 
ATOM   2120 C CD  . ARG B 1 20  ? 34.276  22.147  -15.330 1.00 42.83 ? 58  ARG B CD  1 
ATOM   2121 N NE  . ARG B 1 20  ? 34.347  23.004  -16.512 1.00 52.73 ? 58  ARG B NE  1 
ATOM   2122 C CZ  . ARG B 1 20  ? 34.261  24.333  -16.478 1.00 55.82 ? 58  ARG B CZ  1 
ATOM   2123 N NH1 . ARG B 1 20  ? 34.145  24.968  -15.307 1.00 58.86 ? 58  ARG B NH1 1 
ATOM   2124 N NH2 . ARG B 1 20  ? 34.303  25.026  -17.608 1.00 56.57 ? 58  ARG B NH2 1 
ATOM   2125 N N   . PHE B 1 21  ? 28.218  20.774  -16.304 1.00 39.75 ? 59  PHE B N   1 
ATOM   2126 C CA  . PHE B 1 21  ? 27.103  20.527  -17.224 1.00 39.79 ? 59  PHE B CA  1 
ATOM   2127 C C   . PHE B 1 21  ? 26.719  21.819  -17.954 1.00 39.99 ? 59  PHE B C   1 
ATOM   2128 O O   . PHE B 1 21  ? 26.668  21.814  -19.175 1.00 40.17 ? 59  PHE B O   1 
ATOM   2129 C CB  . PHE B 1 21  ? 25.904  19.909  -16.479 1.00 39.27 ? 59  PHE B CB  1 
ATOM   2130 C CG  . PHE B 1 21  ? 24.719  19.609  -17.355 1.00 39.31 ? 59  PHE B CG  1 
ATOM   2131 C CD1 . PHE B 1 21  ? 24.776  18.593  -18.328 1.00 37.62 ? 59  PHE B CD1 1 
ATOM   2132 C CD2 . PHE B 1 21  ? 23.543  20.357  -17.230 1.00 39.26 ? 59  PHE B CD2 1 
ATOM   2133 C CE1 . PHE B 1 21  ? 23.655  18.307  -19.151 1.00 37.53 ? 59  PHE B CE1 1 
ATOM   2134 C CE2 . PHE B 1 21  ? 22.409  20.080  -18.045 1.00 39.04 ? 59  PHE B CE2 1 
ATOM   2135 C CZ  . PHE B 1 21  ? 22.487  19.038  -19.023 1.00 38.83 ? 59  PHE B CZ  1 
ATOM   2136 N N   . PRO B 1 22  ? 26.498  22.944  -17.223 1.00 40.42 ? 60  PRO B N   1 
ATOM   2137 C CA  . PRO B 1 22  ? 26.144  24.187  -17.963 1.00 39.67 ? 60  PRO B CA  1 
ATOM   2138 C C   . PRO B 1 22  ? 27.183  24.608  -18.989 1.00 39.71 ? 60  PRO B C   1 
ATOM   2139 O O   . PRO B 1 22  ? 26.855  24.817  -20.158 1.00 39.84 ? 60  PRO B O   1 
ATOM   2140 C CB  . PRO B 1 22  ? 26.037  25.250  -16.846 1.00 38.66 ? 60  PRO B CB  1 
ATOM   2141 C CG  . PRO B 1 22  ? 25.680  24.459  -15.617 1.00 39.01 ? 60  PRO B CG  1 
ATOM   2142 C CD  . PRO B 1 22  ? 26.521  23.186  -15.767 1.00 39.77 ? 60  PRO B CD  1 
ATOM   2143 N N   . GLU B 1 23  ? 28.436  24.706  -18.585 1.00 39.53 ? 61  GLU B N   1 
ATOM   2144 C CA  . GLU B 1 23  ? 29.497  25.046  -19.537 1.00 40.13 ? 61  GLU B CA  1 
ATOM   2145 C C   . GLU B 1 23  ? 29.629  24.044  -20.677 1.00 39.40 ? 61  GLU B C   1 
ATOM   2146 O O   . GLU B 1 23  ? 29.891  24.414  -21.802 1.00 37.47 ? 61  GLU B O   1 
ATOM   2147 C CB  . GLU B 1 23  ? 30.843  25.235  -18.832 1.00 40.73 ? 61  GLU B CB  1 
ATOM   2148 C CG  . GLU B 1 23  ? 30.783  26.269  -17.720 1.00 45.49 ? 61  GLU B CG  1 
ATOM   2149 C CD  . GLU B 1 23  ? 30.630  25.653  -16.312 1.00 51.10 ? 61  GLU B CD  1 
ATOM   2150 O OE1 . GLU B 1 23  ? 29.657  24.898  -16.001 1.00 53.32 ? 61  GLU B OE1 1 
ATOM   2151 O OE2 . GLU B 1 23  ? 31.532  25.927  -15.503 1.00 54.34 ? 61  GLU B OE2 1 
ATOM   2152 N N   . THR B 1 24  ? 29.412  22.772  -20.380 1.00 39.50 ? 62  THR B N   1 
ATOM   2153 C CA  . THR B 1 24  ? 29.513  21.724  -21.385 1.00 40.23 ? 62  THR B CA  1 
ATOM   2154 C C   . THR B 1 24  ? 28.414  21.858  -22.456 1.00 40.03 ? 62  THR B C   1 
ATOM   2155 O O   . THR B 1 24  ? 28.699  21.775  -23.647 1.00 39.61 ? 62  THR B O   1 
ATOM   2156 C CB  . THR B 1 24  ? 29.476  20.314  -20.700 1.00 41.33 ? 62  THR B CB  1 
ATOM   2157 O OG1 . THR B 1 24  ? 30.599  20.208  -19.823 1.00 42.34 ? 62  THR B OG1 1 
ATOM   2158 C CG2 . THR B 1 24  ? 29.572  19.194  -21.724 1.00 41.47 ? 62  THR B CG2 1 
ATOM   2159 N N   . VAL B 1 25  ? 27.163  22.050  -22.024 1.00 39.88 ? 63  VAL B N   1 
ATOM   2160 C CA  . VAL B 1 25  ? 26.026  22.127  -22.959 1.00 39.84 ? 63  VAL B CA  1 
ATOM   2161 C C   . VAL B 1 25  ? 26.212  23.345  -23.867 1.00 40.71 ? 63  VAL B C   1 
ATOM   2162 O O   . VAL B 1 25  ? 26.041  23.266  -25.084 1.00 39.73 ? 63  VAL B O   1 
ATOM   2163 C CB  . VAL B 1 25  ? 24.668  22.152  -22.223 1.00 39.55 ? 63  VAL B CB  1 
ATOM   2164 C CG1 . VAL B 1 25  ? 23.521  22.505  -23.175 1.00 38.96 ? 63  VAL B CG1 1 
ATOM   2165 C CG2 . VAL B 1 25  ? 24.399  20.816  -21.599 1.00 40.95 ? 63  VAL B CG2 1 
ATOM   2166 N N   . LEU B 1 26  ? 26.572  24.472  -23.259 1.00 40.99 ? 64  LEU B N   1 
ATOM   2167 C CA  . LEU B 1 26  ? 26.816  25.696  -24.016 1.00 41.47 ? 64  LEU B CA  1 
ATOM   2168 C C   . LEU B 1 26  ? 27.984  25.562  -25.011 1.00 41.08 ? 64  LEU B C   1 
ATOM   2169 O O   . LEU B 1 26  ? 27.863  25.982  -26.155 1.00 40.33 ? 64  LEU B O   1 
ATOM   2170 C CB  . LEU B 1 26  ? 27.041  26.854  -23.061 1.00 42.13 ? 64  LEU B CB  1 
ATOM   2171 C CG  . LEU B 1 26  ? 27.021  28.197  -23.768 1.00 46.00 ? 64  LEU B CG  1 
ATOM   2172 C CD1 . LEU B 1 26  ? 25.633  28.434  -24.398 1.00 46.99 ? 64  LEU B CD1 1 
ATOM   2173 C CD2 . LEU B 1 26  ? 27.392  29.284  -22.742 1.00 48.38 ? 64  LEU B CD2 1 
ATOM   2174 N N   . ALA B 1 27  ? 29.093  24.952  -24.581 1.00 40.97 ? 65  ALA B N   1 
ATOM   2175 C CA  . ALA B 1 27  ? 30.240  24.702  -25.475 1.00 41.78 ? 65  ALA B CA  1 
ATOM   2176 C C   . ALA B 1 27  ? 29.877  23.781  -26.641 1.00 41.15 ? 65  ALA B C   1 
ATOM   2177 O O   . ALA B 1 27  ? 30.411  23.925  -27.740 1.00 40.46 ? 65  ALA B O   1 
ATOM   2178 C CB  . ALA B 1 27  ? 31.408  24.110  -24.691 1.00 41.80 ? 65  ALA B CB  1 
ATOM   2179 N N   . ARG B 1 28  ? 28.973  22.833  -26.392 1.00 40.96 ? 66  ARG B N   1 
ATOM   2180 C CA  . ARG B 1 28  ? 28.563  21.855  -27.426 1.00 40.59 ? 66  ARG B CA  1 
ATOM   2181 C C   . ARG B 1 28  ? 27.695  22.525  -28.455 1.00 40.54 ? 66  ARG B C   1 
ATOM   2182 O O   . ARG B 1 28  ? 27.772  22.227  -29.653 1.00 39.98 ? 66  ARG B O   1 
ATOM   2183 C CB  . ARG B 1 28  ? 27.794  20.675  -26.821 1.00 39.84 ? 66  ARG B CB  1 
ATOM   2184 C CG  . ARG B 1 28  ? 28.696  19.699  -26.034 1.00 41.15 ? 66  ARG B CG  1 
ATOM   2185 C CD  . ARG B 1 28  ? 27.942  18.491  -25.479 1.00 39.44 ? 66  ARG B CD  1 
ATOM   2186 N NE  . ARG B 1 28  ? 28.866  17.446  -24.990 1.00 40.49 ? 66  ARG B NE  1 
ATOM   2187 C CZ  . ARG B 1 28  ? 28.489  16.186  -24.754 1.00 39.33 ? 66  ARG B CZ  1 
ATOM   2188 N NH1 . ARG B 1 28  ? 27.216  15.839  -24.938 1.00 35.84 ? 66  ARG B NH1 1 
ATOM   2189 N NH2 . ARG B 1 28  ? 29.359  15.284  -24.287 1.00 36.83 ? 66  ARG B NH2 1 
ATOM   2190 N N   . CYS B 1 29  ? 26.837  23.403  -27.952 1.00 40.82 ? 67  CYS B N   1 
ATOM   2191 C CA  . CYS B 1 29  ? 25.973  24.206  -28.790 1.00 41.18 ? 67  CYS B CA  1 
ATOM   2192 C C   . CYS B 1 29  ? 26.828  25.065  -29.707 1.00 40.73 ? 67  CYS B C   1 
ATOM   2193 O O   . CYS B 1 29  ? 26.644  25.063  -30.931 1.00 40.42 ? 67  CYS B O   1 
ATOM   2194 C CB  . CYS B 1 29  ? 25.041  25.065  -27.930 1.00 41.62 ? 67  CYS B CB  1 
ATOM   2195 S SG  . CYS B 1 29  ? 23.812  25.873  -28.924 1.00 43.32 ? 67  CYS B SG  1 
ATOM   2196 N N   . VAL B 1 30  ? 27.790  25.776  -29.114 1.00 41.30 ? 68  VAL B N   1 
ATOM   2197 C CA  . VAL B 1 30  ? 28.737  26.592  -29.885 1.00 41.28 ? 68  VAL B CA  1 
ATOM   2198 C C   . VAL B 1 30  ? 29.470  25.766  -30.948 1.00 41.64 ? 68  VAL B C   1 
ATOM   2199 O O   . VAL B 1 30  ? 29.497  26.164  -32.108 1.00 40.68 ? 68  VAL B O   1 
ATOM   2200 C CB  . VAL B 1 30  ? 29.725  27.393  -28.986 1.00 41.06 ? 68  VAL B CB  1 
ATOM   2201 C CG1 . VAL B 1 30  ? 30.753  28.125  -29.835 1.00 41.78 ? 68  VAL B CG1 1 
ATOM   2202 C CG2 . VAL B 1 30  ? 28.969  28.428  -28.166 1.00 43.27 ? 68  VAL B CG2 1 
ATOM   2203 N N   . LYS B 1 31  ? 30.027  24.614  -30.573 1.00 41.50 ? 69  LYS B N   1 
ATOM   2204 C CA  . LYS B 1 31  ? 30.735  23.775  -31.544 1.00 42.59 ? 69  LYS B CA  1 
ATOM   2205 C C   . LYS B 1 31  ? 29.828  23.216  -32.648 1.00 41.97 ? 69  LYS B C   1 
ATOM   2206 O O   . LYS B 1 31  ? 30.204  23.226  -33.814 1.00 42.07 ? 69  LYS B O   1 
ATOM   2207 C CB  . LYS B 1 31  ? 31.491  22.622  -30.869 1.00 43.75 ? 69  LYS B CB  1 
ATOM   2208 C CG  . LYS B 1 31  ? 32.568  22.057  -31.790 1.00 47.29 ? 69  LYS B CG  1 
ATOM   2209 C CD  . LYS B 1 31  ? 32.942  20.621  -31.455 1.00 51.31 ? 69  LYS B CD  1 
ATOM   2210 C CE  . LYS B 1 31  ? 34.192  20.185  -32.275 1.00 52.21 ? 69  LYS B CE  1 
ATOM   2211 N NZ  . LYS B 1 31  ? 34.979  19.106  -31.559 1.00 56.14 ? 69  LYS B NZ  1 
ATOM   2212 N N   . TYR B 1 32  ? 28.650  22.714  -32.276 1.00 41.76 ? 70  TYR B N   1 
ATOM   2213 C CA  . TYR B 1 32  ? 27.699  22.172  -33.237 1.00 41.22 ? 70  TYR B CA  1 
ATOM   2214 C C   . TYR B 1 32  ? 27.345  23.174  -34.330 1.00 41.72 ? 70  TYR B C   1 
ATOM   2215 O O   . TYR B 1 32  ? 27.322  22.822  -35.526 1.00 42.16 ? 70  TYR B O   1 
ATOM   2216 C CB  . TYR B 1 32  ? 26.411  21.724  -32.561 1.00 40.85 ? 70  TYR B CB  1 
ATOM   2217 C CG  . TYR B 1 32  ? 25.532  20.933  -33.489 1.00 40.08 ? 70  TYR B CG  1 
ATOM   2218 C CD1 . TYR B 1 32  ? 25.629  19.539  -33.552 1.00 40.94 ? 70  TYR B CD1 1 
ATOM   2219 C CD2 . TYR B 1 32  ? 24.633  21.573  -34.347 1.00 39.98 ? 70  TYR B CD2 1 
ATOM   2220 C CE1 . TYR B 1 32  ? 24.822  18.793  -34.435 1.00 38.50 ? 70  TYR B CE1 1 
ATOM   2221 C CE2 . TYR B 1 32  ? 23.833  20.856  -35.205 1.00 38.64 ? 70  TYR B CE2 1 
ATOM   2222 C CZ  . TYR B 1 32  ? 23.924  19.465  -35.255 1.00 39.85 ? 70  TYR B CZ  1 
ATOM   2223 O OH  . TYR B 1 32  ? 23.137  18.748  -36.143 1.00 38.77 ? 70  TYR B OH  1 
ATOM   2224 N N   . THR B 1 33  ? 27.053  24.414  -33.931 1.00 41.71 ? 71  THR B N   1 
ATOM   2225 C CA  . THR B 1 33  ? 26.649  25.434  -34.898 1.00 42.19 ? 71  THR B CA  1 
ATOM   2226 C C   . THR B 1 33  ? 27.838  25.864  -35.744 1.00 43.16 ? 71  THR B C   1 
ATOM   2227 O O   . THR B 1 33  ? 27.677  26.223  -36.900 1.00 41.78 ? 71  THR B O   1 
ATOM   2228 C CB  . THR B 1 33  ? 25.931  26.620  -34.236 1.00 42.07 ? 71  THR B CB  1 
ATOM   2229 O OG1 . THR B 1 33  ? 26.794  27.233  -33.279 1.00 43.02 ? 71  THR B OG1 1 
ATOM   2230 C CG2 . THR B 1 33  ? 24.665  26.141  -33.537 1.00 41.35 ? 71  THR B CG2 1 
ATOM   2231 N N   . GLU B 1 34  ? 29.031  25.799  -35.161 1.00 44.55 ? 72  GLU B N   1 
ATOM   2232 C CA  . GLU B 1 34  ? 30.264  25.991  -35.927 1.00 46.84 ? 72  GLU B CA  1 
ATOM   2233 C C   . GLU B 1 34  ? 30.419  24.917  -37.000 1.00 46.48 ? 72  GLU B C   1 
ATOM   2234 O O   . GLU B 1 34  ? 30.612  25.247  -38.163 1.00 46.41 ? 72  GLU B O   1 
ATOM   2235 C CB  . GLU B 1 34  ? 31.493  26.051  -35.013 1.00 46.76 ? 72  GLU B CB  1 
ATOM   2236 C CG  . GLU B 1 34  ? 31.747  27.454  -34.481 1.00 50.06 ? 72  GLU B CG  1 
ATOM   2237 C CD  . GLU B 1 34  ? 32.724  27.498  -33.312 1.00 50.51 ? 72  GLU B CD  1 
ATOM   2238 O OE1 . GLU B 1 34  ? 33.064  26.406  -32.788 1.00 55.16 ? 72  GLU B OE1 1 
ATOM   2239 O OE2 . GLU B 1 34  ? 33.134  28.623  -32.909 1.00 52.27 ? 72  GLU B OE2 1 
ATOM   2240 N N   . ILE B 1 35  ? 30.297  23.652  -36.607 1.00 46.69 ? 73  ILE B N   1 
ATOM   2241 C CA  . ILE B 1 35  ? 30.376  22.514  -37.529 1.00 47.46 ? 73  ILE B CA  1 
ATOM   2242 C C   . ILE B 1 35  ? 29.207  22.452  -38.532 1.00 47.80 ? 73  ILE B C   1 
ATOM   2243 O O   . ILE B 1 35  ? 29.403  22.095  -39.697 1.00 48.48 ? 73  ILE B O   1 
ATOM   2244 C CB  . ILE B 1 35  ? 30.472  21.165  -36.765 1.00 47.61 ? 73  ILE B CB  1 
ATOM   2245 C CG1 . ILE B 1 35  ? 31.823  21.030  -36.055 1.00 46.99 ? 73  ILE B CG1 1 
ATOM   2246 C CG2 . ILE B 1 35  ? 30.298  19.986  -37.717 1.00 47.74 ? 73  ILE B CG2 1 
ATOM   2247 C CD1 . ILE B 1 35  ? 31.817  19.925  -34.981 1.00 48.45 ? 73  ILE B CD1 1 
ATOM   2248 N N   . HIS B 1 36  ? 28.001  22.788  -38.092 1.00 47.71 ? 74  HIS B N   1 
ATOM   2249 C CA  . HIS B 1 36  ? 26.843  22.780  -38.971 1.00 47.76 ? 74  HIS B CA  1 
ATOM   2250 C C   . HIS B 1 36  ? 26.318  24.196  -39.205 1.00 47.38 ? 74  HIS B C   1 
ATOM   2251 O O   . HIS B 1 36  ? 25.567  24.715  -38.378 1.00 47.52 ? 74  HIS B O   1 
ATOM   2252 C CB  . HIS B 1 36  ? 25.734  21.915  -38.393 1.00 48.08 ? 74  HIS B CB  1 
ATOM   2253 C CG  . HIS B 1 36  ? 26.126  20.490  -38.179 1.00 51.23 ? 74  HIS B CG  1 
ATOM   2254 N ND1 . HIS B 1 36  ? 26.893  20.083  -37.105 1.00 54.66 ? 74  HIS B ND1 1 
ATOM   2255 C CD2 . HIS B 1 36  ? 25.818  19.367  -38.869 1.00 52.81 ? 74  HIS B CD2 1 
ATOM   2256 C CE1 . HIS B 1 36  ? 27.055  18.770  -37.155 1.00 55.81 ? 74  HIS B CE1 1 
ATOM   2257 N NE2 . HIS B 1 36  ? 26.406  18.311  -38.210 1.00 55.37 ? 74  HIS B NE2 1 
ATOM   2258 N N   . PRO B 1 37  ? 26.695  24.816  -40.346 1.00 46.89 ? 75  PRO B N   1 
ATOM   2259 C CA  . PRO B 1 37  ? 26.293  26.183  -40.708 1.00 46.75 ? 75  PRO B CA  1 
ATOM   2260 C C   . PRO B 1 37  ? 24.775  26.398  -40.809 1.00 46.60 ? 75  PRO B C   1 
ATOM   2261 O O   . PRO B 1 37  ? 24.291  27.512  -40.565 1.00 46.78 ? 75  PRO B O   1 
ATOM   2262 C CB  . PRO B 1 37  ? 26.939  26.389  -42.088 1.00 46.78 ? 75  PRO B CB  1 
ATOM   2263 C CG  . PRO B 1 37  ? 28.037  25.397  -42.149 1.00 46.75 ? 75  PRO B CG  1 
ATOM   2264 C CD  . PRO B 1 37  ? 27.562  24.212  -41.370 1.00 46.52 ? 75  PRO B CD  1 
ATOM   2265 N N   . GLU B 1 38  ? 24.037  25.349  -41.167 1.00 46.14 ? 76  GLU B N   1 
ATOM   2266 C CA  . GLU B 1 38  ? 22.583  25.448  -41.312 1.00 46.07 ? 76  GLU B CA  1 
ATOM   2267 C C   . GLU B 1 38  ? 21.835  25.630  -39.974 1.00 45.97 ? 76  GLU B C   1 
ATOM   2268 O O   . GLU B 1 38  ? 20.662  26.000  -39.954 1.00 46.14 ? 76  GLU B O   1 
ATOM   2269 C CB  . GLU B 1 38  ? 22.028  24.273  -42.143 1.00 46.37 ? 76  GLU B CB  1 
ATOM   2270 C CG  . GLU B 1 38  ? 21.893  22.924  -41.431 1.00 46.40 ? 76  GLU B CG  1 
ATOM   2271 C CD  . GLU B 1 38  ? 23.212  22.180  -41.218 1.00 48.54 ? 76  GLU B CD  1 
ATOM   2272 O OE1 . GLU B 1 38  ? 24.287  22.683  -41.632 1.00 48.49 ? 76  GLU B OE1 1 
ATOM   2273 O OE2 . GLU B 1 38  ? 23.161  21.078  -40.610 1.00 49.59 ? 76  GLU B OE2 1 
ATOM   2274 N N   . MET B 1 39  ? 22.524  25.397  -38.861 1.00 45.46 ? 77  MET B N   1 
ATOM   2275 C CA  . MET B 1 39  ? 21.935  25.593  -37.537 1.00 45.26 ? 77  MET B CA  1 
ATOM   2276 C C   . MET B 1 39  ? 22.380  26.886  -36.829 1.00 45.45 ? 77  MET B C   1 
ATOM   2277 O O   . MET B 1 39  ? 22.170  27.044  -35.616 1.00 44.68 ? 77  MET B O   1 
ATOM   2278 C CB  . MET B 1 39  ? 22.237  24.382  -36.654 1.00 44.88 ? 77  MET B CB  1 
ATOM   2279 C CG  . MET B 1 39  ? 21.483  23.142  -37.035 1.00 45.50 ? 77  MET B CG  1 
ATOM   2280 S SD  . MET B 1 39  ? 19.707  23.376  -36.990 1.00 48.31 ? 77  MET B SD  1 
ATOM   2281 C CE  . MET B 1 39  ? 19.328  23.277  -35.255 1.00 44.22 ? 77  MET B CE  1 
ATOM   2282 N N   . ARG B 1 40  ? 22.976  27.817  -37.577 1.00 45.92 ? 78  ARG B N   1 
ATOM   2283 C CA  . ARG B 1 40  ? 23.531  29.048  -36.974 1.00 46.35 ? 78  ARG B CA  1 
ATOM   2284 C C   . ARG B 1 40  ? 22.469  30.108  -36.619 1.00 46.90 ? 78  ARG B C   1 
ATOM   2285 O O   . ARG B 1 40  ? 22.776  31.148  -36.018 1.00 47.60 ? 78  ARG B O   1 
ATOM   2286 C CB  . ARG B 1 40  ? 24.649  29.626  -37.850 1.00 45.98 ? 78  ARG B CB  1 
ATOM   2287 C CG  . ARG B 1 40  ? 25.932  28.818  -37.753 1.00 44.70 ? 78  ARG B CG  1 
ATOM   2288 C CD  . ARG B 1 40  ? 27.071  29.446  -38.555 1.00 44.73 ? 78  ARG B CD  1 
ATOM   2289 N NE  . ARG B 1 40  ? 28.293  28.620  -38.564 1.00 41.09 ? 78  ARG B NE  1 
ATOM   2290 C CZ  . ARG B 1 40  ? 29.217  28.679  -39.521 1.00 39.12 ? 78  ARG B CZ  1 
ATOM   2291 N NH1 . ARG B 1 40  ? 29.044  29.507  -40.549 1.00 34.74 ? 78  ARG B NH1 1 
ATOM   2292 N NH2 . ARG B 1 40  ? 30.298  27.904  -39.462 1.00 36.98 ? 78  ARG B NH2 1 
ATOM   2293 N N   . HIS B 1 41  ? 21.225  29.820  -36.989 1.00 47.06 ? 79  HIS B N   1 
ATOM   2294 C CA  . HIS B 1 41  ? 20.069  30.613  -36.601 1.00 47.16 ? 79  HIS B CA  1 
ATOM   2295 C C   . HIS B 1 41  ? 19.722  30.383  -35.120 1.00 47.12 ? 79  HIS B C   1 
ATOM   2296 O O   . HIS B 1 41  ? 18.778  30.961  -34.593 1.00 47.56 ? 79  HIS B O   1 
ATOM   2297 C CB  . HIS B 1 41  ? 18.877  30.236  -37.490 1.00 47.52 ? 79  HIS B CB  1 
ATOM   2298 C CG  . HIS B 1 41  ? 18.488  28.785  -37.408 1.00 48.27 ? 79  HIS B CG  1 
ATOM   2299 N ND1 . HIS B 1 41  ? 18.987  27.826  -38.266 1.00 49.05 ? 79  HIS B ND1 1 
ATOM   2300 C CD2 . HIS B 1 41  ? 17.644  28.134  -36.568 1.00 48.56 ? 79  HIS B CD2 1 
ATOM   2301 C CE1 . HIS B 1 41  ? 18.463  26.650  -37.963 1.00 49.76 ? 79  HIS B CE1 1 
ATOM   2302 N NE2 . HIS B 1 41  ? 17.652  26.808  -36.930 1.00 49.40 ? 79  HIS B NE2 1 
ATOM   2303 N N   . VAL B 1 42  ? 20.482  29.528  -34.456 1.00 46.78 ? 80  VAL B N   1 
ATOM   2304 C CA  . VAL B 1 42  ? 20.229  29.183  -33.062 1.00 47.01 ? 80  VAL B CA  1 
ATOM   2305 C C   . VAL B 1 42  ? 20.974  30.146  -32.127 1.00 46.56 ? 80  VAL B C   1 
ATOM   2306 O O   . VAL B 1 42  ? 22.127  30.479  -32.384 1.00 46.68 ? 80  VAL B O   1 
ATOM   2307 C CB  . VAL B 1 42  ? 20.675  27.736  -32.805 1.00 46.58 ? 80  VAL B CB  1 
ATOM   2308 C CG1 . VAL B 1 42  ? 20.960  27.514  -31.373 1.00 47.87 ? 80  VAL B CG1 1 
ATOM   2309 C CG2 . VAL B 1 42  ? 19.618  26.787  -33.278 1.00 48.62 ? 80  VAL B CG2 1 
ATOM   2310 N N   . ASP B 1 43  ? 20.329  30.611  -31.062 1.00 46.21 ? 81  ASP B N   1 
ATOM   2311 C CA  . ASP B 1 43  ? 21.076  31.314  -30.035 1.00 46.24 ? 81  ASP B CA  1 
ATOM   2312 C C   . ASP B 1 43  ? 21.433  30.337  -28.923 1.00 46.23 ? 81  ASP B C   1 
ATOM   2313 O O   . ASP B 1 43  ? 20.553  29.839  -28.213 1.00 45.67 ? 81  ASP B O   1 
ATOM   2314 C CB  . ASP B 1 43  ? 20.284  32.466  -29.447 1.00 46.75 ? 81  ASP B CB  1 
ATOM   2315 C CG  . ASP B 1 43  ? 21.047  33.180  -28.327 1.00 48.48 ? 81  ASP B CG  1 
ATOM   2316 O OD1 . ASP B 1 43  ? 22.133  33.729  -28.597 1.00 52.28 ? 81  ASP B OD1 1 
ATOM   2317 O OD2 . ASP B 1 43  ? 20.573  33.197  -27.174 1.00 49.57 ? 81  ASP B OD2 1 
ATOM   2318 N N   . CYS B 1 44  ? 22.719  30.074  -28.751 1.00 45.83 ? 82  CYS B N   1 
ATOM   2319 C CA  . CYS B 1 44  ? 23.113  29.054  -27.802 1.00 46.46 ? 82  CYS B CA  1 
ATOM   2320 C C   . CYS B 1 44  ? 22.750  29.383  -26.349 1.00 45.80 ? 82  CYS B C   1 
ATOM   2321 O O   . CYS B 1 44  ? 22.350  28.491  -25.604 1.00 45.35 ? 82  CYS B O   1 
ATOM   2322 C CB  . CYS B 1 44  ? 24.575  28.663  -27.996 1.00 46.71 ? 82  CYS B CB  1 
ATOM   2323 S SG  . CYS B 1 44  ? 24.738  27.634  -29.506 1.00 50.72 ? 82  CYS B SG  1 
ATOM   2324 N N   . GLN B 1 45  ? 22.826  30.658  -25.963 1.00 45.18 ? 83  GLN B N   1 
ATOM   2325 C CA  . GLN B 1 45  ? 22.412  31.050  -24.598 1.00 44.92 ? 83  GLN B CA  1 
ATOM   2326 C C   . GLN B 1 45  ? 20.922  30.706  -24.396 1.00 44.00 ? 83  GLN B C   1 
ATOM   2327 O O   . GLN B 1 45  ? 20.543  30.143  -23.376 1.00 44.39 ? 83  GLN B O   1 
ATOM   2328 C CB  . GLN B 1 45  ? 22.722  32.540  -24.311 1.00 44.92 ? 83  GLN B CB  1 
ATOM   2329 C CG  . GLN B 1 45  ? 22.516  32.988  -22.831 1.00 45.75 ? 83  GLN B CG  1 
ATOM   2330 C CD  . GLN B 1 45  ? 23.287  32.147  -21.810 1.00 48.24 ? 83  GLN B CD  1 
ATOM   2331 O OE1 . GLN B 1 45  ? 22.714  31.645  -20.826 1.00 47.43 ? 83  GLN B OE1 1 
ATOM   2332 N NE2 . GLN B 1 45  ? 24.589  31.984  -22.039 1.00 49.26 ? 83  GLN B NE2 1 
ATOM   2333 N N   . SER B 1 46  ? 20.103  30.997  -25.407 1.00 42.74 ? 84  SER B N   1 
ATOM   2334 C CA  . SER B 1 46  ? 18.667  30.759  -25.343 1.00 42.04 ? 84  SER B CA  1 
ATOM   2335 C C   . SER B 1 46  ? 18.362  29.284  -25.289 1.00 41.66 ? 84  SER B C   1 
ATOM   2336 O O   . SER B 1 46  ? 17.470  28.866  -24.556 1.00 41.97 ? 84  SER B O   1 
ATOM   2337 C CB  . SER B 1 46  ? 17.961  31.372  -26.547 1.00 41.76 ? 84  SER B CB  1 
ATOM   2338 O OG  . SER B 1 46  ? 18.250  32.750  -26.634 1.00 43.87 ? 84  SER B OG  1 
ATOM   2339 N N   . VAL B 1 47  ? 19.095  28.502  -26.085 1.00 40.47 ? 85  VAL B N   1 
ATOM   2340 C CA  . VAL B 1 47  ? 19.033  27.043  -26.032 1.00 39.29 ? 85  VAL B CA  1 
ATOM   2341 C C   . VAL B 1 47  ? 19.345  26.550  -24.618 1.00 39.40 ? 85  VAL B C   1 
ATOM   2342 O O   . VAL B 1 47  ? 18.564  25.786  -24.055 1.00 38.96 ? 85  VAL B O   1 
ATOM   2343 C CB  . VAL B 1 47  ? 20.001  26.404  -27.072 1.00 39.30 ? 85  VAL B CB  1 
ATOM   2344 C CG1 . VAL B 1 47  ? 20.213  24.947  -26.814 1.00 38.51 ? 85  VAL B CG1 1 
ATOM   2345 C CG2 . VAL B 1 47  ? 19.500  26.637  -28.505 1.00 37.80 ? 85  VAL B CG2 1 
ATOM   2346 N N   . TRP B 1 48  ? 20.462  27.000  -24.024 1.00 39.49 ? 86  TRP B N   1 
ATOM   2347 C CA  . TRP B 1 48  ? 20.773  26.561  -22.653 1.00 38.89 ? 86  TRP B CA  1 
ATOM   2348 C C   . TRP B 1 48  ? 19.656  26.957  -21.670 1.00 39.10 ? 86  TRP B C   1 
ATOM   2349 O O   . TRP B 1 48  ? 19.260  26.161  -20.808 1.00 39.06 ? 86  TRP B O   1 
ATOM   2350 C CB  . TRP B 1 48  ? 22.163  27.025  -22.184 1.00 39.26 ? 86  TRP B CB  1 
ATOM   2351 C CG  . TRP B 1 48  ? 22.311  26.957  -20.706 1.00 38.08 ? 86  TRP B CG  1 
ATOM   2352 C CD1 . TRP B 1 48  ? 22.412  28.010  -19.843 1.00 38.22 ? 86  TRP B CD1 1 
ATOM   2353 C CD2 . TRP B 1 48  ? 22.315  25.776  -19.897 1.00 39.13 ? 86  TRP B CD2 1 
ATOM   2354 N NE1 . TRP B 1 48  ? 22.495  27.563  -18.546 1.00 39.91 ? 86  TRP B NE1 1 
ATOM   2355 C CE2 . TRP B 1 48  ? 22.433  26.194  -18.548 1.00 38.91 ? 86  TRP B CE2 1 
ATOM   2356 C CE3 . TRP B 1 48  ? 22.222  24.409  -20.175 1.00 38.41 ? 86  TRP B CE3 1 
ATOM   2357 C CZ2 . TRP B 1 48  ? 22.463  25.295  -17.492 1.00 38.84 ? 86  TRP B CZ2 1 
ATOM   2358 C CZ3 . TRP B 1 48  ? 22.262  23.508  -19.119 1.00 39.03 ? 86  TRP B CZ3 1 
ATOM   2359 C CH2 . TRP B 1 48  ? 22.380  23.953  -17.795 1.00 39.56 ? 86  TRP B CH2 1 
ATOM   2360 N N   . ASP B 1 49  ? 19.130  28.167  -21.841 1.00 39.14 ? 87  ASP B N   1 
ATOM   2361 C CA  . ASP B 1 49  ? 18.085  28.682  -20.989 1.00 40.01 ? 87  ASP B CA  1 
ATOM   2362 C C   . ASP B 1 49  ? 16.816  27.829  -21.063 1.00 40.07 ? 87  ASP B C   1 
ATOM   2363 O O   . ASP B 1 49  ? 16.162  27.579  -20.038 1.00 39.33 ? 87  ASP B O   1 
ATOM   2364 C CB  . ASP B 1 49  ? 17.782  30.142  -21.350 1.00 40.16 ? 87  ASP B CB  1 
ATOM   2365 C CG  . ASP B 1 49  ? 18.805  31.113  -20.778 1.00 41.81 ? 87  ASP B CG  1 
ATOM   2366 O OD1 . ASP B 1 49  ? 19.647  30.711  -19.938 1.00 44.45 ? 87  ASP B OD1 1 
ATOM   2367 O OD2 . ASP B 1 49  ? 18.751  32.303  -21.148 1.00 43.86 ? 87  ASP B OD2 1 
ATOM   2368 N N   . ALA B 1 50  ? 16.486  27.369  -22.272 1.00 40.66 ? 88  ALA B N   1 
ATOM   2369 C CA  . ALA B 1 50  ? 15.325  26.491  -22.451 1.00 40.92 ? 88  ALA B CA  1 
ATOM   2370 C C   . ALA B 1 50  ? 15.527  25.122  -21.842 1.00 40.98 ? 88  ALA B C   1 
ATOM   2371 O O   . ALA B 1 50  ? 14.601  24.541  -21.281 1.00 41.51 ? 88  ALA B O   1 
ATOM   2372 C CB  . ALA B 1 50  ? 14.953  26.366  -23.938 1.00 41.34 ? 88  ALA B CB  1 
ATOM   2373 N N   . PHE B 1 51  ? 16.740  24.610  -21.940 1.00 40.54 ? 89  PHE B N   1 
ATOM   2374 C CA  . PHE B 1 51  ? 17.108  23.299  -21.415 1.00 40.81 ? 89  PHE B CA  1 
ATOM   2375 C C   . PHE B 1 51  ? 16.992  23.300  -19.874 1.00 41.68 ? 89  PHE B C   1 
ATOM   2376 O O   . PHE B 1 51  ? 16.304  22.442  -19.279 1.00 40.40 ? 89  PHE B O   1 
ATOM   2377 C CB  . PHE B 1 51  ? 18.552  23.007  -21.865 1.00 40.90 ? 89  PHE B CB  1 
ATOM   2378 C CG  . PHE B 1 51  ? 18.930  21.568  -21.872 1.00 42.11 ? 89  PHE B CG  1 
ATOM   2379 C CD1 . PHE B 1 51  ? 18.382  20.671  -20.983 1.00 42.33 ? 89  PHE B CD1 1 
ATOM   2380 C CD2 . PHE B 1 51  ? 19.890  21.121  -22.747 1.00 42.67 ? 89  PHE B CD2 1 
ATOM   2381 C CE1 . PHE B 1 51  ? 18.763  19.311  -20.999 1.00 42.38 ? 89  PHE B CE1 1 
ATOM   2382 C CE2 . PHE B 1 51  ? 20.253  19.783  -22.769 1.00 46.00 ? 89  PHE B CE2 1 
ATOM   2383 C CZ  . PHE B 1 51  ? 19.705  18.891  -21.872 1.00 42.96 ? 89  PHE B CZ  1 
ATOM   2384 N N   . LYS B 1 52  ? 17.655  24.280  -19.260 1.00 42.08 ? 90  LYS B N   1 
ATOM   2385 C CA  . LYS B 1 52  ? 17.658  24.527  -17.798 1.00 43.50 ? 90  LYS B CA  1 
ATOM   2386 C C   . LYS B 1 52  ? 16.211  24.695  -17.265 1.00 42.76 ? 90  LYS B C   1 
ATOM   2387 O O   . LYS B 1 52  ? 15.833  24.083  -16.269 1.00 42.72 ? 90  LYS B O   1 
ATOM   2388 C CB  . LYS B 1 52  ? 18.501  25.794  -17.553 1.00 43.98 ? 90  LYS B CB  1 
ATOM   2389 C CG  . LYS B 1 52  ? 18.805  26.154  -16.154 1.00 48.90 ? 90  LYS B CG  1 
ATOM   2390 C CD  . LYS B 1 52  ? 19.914  27.206  -16.115 1.00 53.14 ? 90  LYS B CD  1 
ATOM   2391 C CE  . LYS B 1 52  ? 19.434  28.645  -16.341 1.00 56.48 ? 90  LYS B CE  1 
ATOM   2392 N NZ  . LYS B 1 52  ? 19.227  29.357  -15.030 1.00 57.80 ? 90  LYS B NZ  1 
ATOM   2393 N N   . GLY B 1 53  ? 15.397  25.479  -17.964 1.00 42.49 ? 91  GLY B N   1 
ATOM   2394 C CA  . GLY B 1 53  ? 13.974  25.633  -17.629 1.00 42.55 ? 91  GLY B CA  1 
ATOM   2395 C C   . GLY B 1 53  ? 13.119  24.361  -17.673 1.00 42.07 ? 91  GLY B C   1 
ATOM   2396 O O   . GLY B 1 53  ? 12.039  24.298  -17.093 1.00 42.19 ? 91  GLY B O   1 
ATOM   2397 N N   . ALA B 1 54  ? 13.582  23.342  -18.372 1.00 41.41 ? 92  ALA B N   1 
ATOM   2398 C CA  . ALA B 1 54  ? 12.860  22.070  -18.409 1.00 40.04 ? 92  ALA B CA  1 
ATOM   2399 C C   . ALA B 1 54  ? 12.907  21.331  -17.073 1.00 39.49 ? 92  ALA B C   1 
ATOM   2400 O O   . ALA B 1 54  ? 11.952  20.639  -16.725 1.00 38.72 ? 92  ALA B O   1 
ATOM   2401 C CB  . ALA B 1 54  ? 13.389  21.172  -19.563 1.00 40.74 ? 92  ALA B CB  1 
ATOM   2402 N N   . PHE B 1 55  ? 14.000  21.486  -16.317 1.00 38.66 ? 93  PHE B N   1 
ATOM   2403 C CA  . PHE B 1 55  ? 14.185  20.715  -15.099 1.00 38.50 ? 93  PHE B CA  1 
ATOM   2404 C C   . PHE B 1 55  ? 14.553  21.446  -13.796 1.00 38.97 ? 93  PHE B C   1 
ATOM   2405 O O   . PHE B 1 55  ? 14.370  20.883  -12.709 1.00 39.02 ? 93  PHE B O   1 
ATOM   2406 C CB  . PHE B 1 55  ? 15.197  19.610  -15.337 1.00 36.85 ? 93  PHE B CB  1 
ATOM   2407 C CG  . PHE B 1 55  ? 16.604  20.082  -15.503 1.00 36.71 ? 93  PHE B CG  1 
ATOM   2408 C CD1 . PHE B 1 55  ? 17.496  20.056  -14.424 1.00 37.79 ? 93  PHE B CD1 1 
ATOM   2409 C CD2 . PHE B 1 55  ? 17.075  20.498  -16.756 1.00 39.01 ? 93  PHE B CD2 1 
ATOM   2410 C CE1 . PHE B 1 55  ? 18.808  20.472  -14.576 1.00 37.91 ? 93  PHE B CE1 1 
ATOM   2411 C CE2 . PHE B 1 55  ? 18.385  20.891  -16.923 1.00 38.95 ? 93  PHE B CE2 1 
ATOM   2412 C CZ  . PHE B 1 55  ? 19.259  20.885  -15.842 1.00 38.76 ? 93  PHE B CZ  1 
ATOM   2413 N N   . ILE B 1 56  ? 15.079  22.662  -13.906 1.00 39.37 ? 94  ILE B N   1 
ATOM   2414 C CA  . ILE B 1 56  ? 15.498  23.426  -12.739 1.00 41.00 ? 94  ILE B CA  1 
ATOM   2415 C C   . ILE B 1 56  ? 14.291  23.726  -11.861 1.00 39.95 ? 94  ILE B C   1 
ATOM   2416 O O   . ILE B 1 56  ? 13.240  24.065  -12.373 1.00 40.47 ? 94  ILE B O   1 
ATOM   2417 C CB  . ILE B 1 56  ? 16.269  24.708  -13.161 1.00 41.24 ? 94  ILE B CB  1 
ATOM   2418 C CG1 . ILE B 1 56  ? 17.686  24.315  -13.574 1.00 44.12 ? 94  ILE B CG1 1 
ATOM   2419 C CG2 . ILE B 1 56  ? 16.388  25.756  -12.025 1.00 43.46 ? 94  ILE B CG2 1 
ATOM   2420 C CD1 . ILE B 1 56  ? 18.426  23.568  -12.493 1.00 44.18 ? 94  ILE B CD1 1 
ATOM   2421 N N   . SER B 1 57  ? 14.438  23.527  -10.556 1.00 40.04 ? 95  SER B N   1 
ATOM   2422 C CA  . SER B 1 57  ? 13.360  23.791  -9.601  1.00 41.16 ? 95  SER B CA  1 
ATOM   2423 C C   . SER B 1 57  ? 12.155  22.850  -9.758  1.00 40.50 ? 95  SER B C   1 
ATOM   2424 O O   . SER B 1 57  ? 11.083  23.134  -9.233  1.00 41.38 ? 95  SER B O   1 
ATOM   2425 C CB  . SER B 1 57  ? 12.888  25.266  -9.674  1.00 41.36 ? 95  SER B CB  1 
ATOM   2426 O OG  . SER B 1 57  ? 14.005  26.139  -9.578  1.00 43.73 ? 95  SER B OG  1 
ATOM   2427 N N   . LYS B 1 58  ? 12.326  21.753  -10.477 1.00 38.33 ? 96  LYS B N   1 
ATOM   2428 C CA  . LYS B 1 58  ? 11.268  20.773  -10.612 1.00 38.04 ? 96  LYS B CA  1 
ATOM   2429 C C   . LYS B 1 58  ? 11.668  19.519  -9.873  1.00 36.32 ? 96  LYS B C   1 
ATOM   2430 O O   . LYS B 1 58  ? 12.838  19.189  -9.842  1.00 34.88 ? 96  LYS B O   1 
ATOM   2431 C CB  . LYS B 1 58  ? 10.987  20.501  -12.093 1.00 37.64 ? 96  LYS B CB  1 
ATOM   2432 C CG  . LYS B 1 58  ? 10.382  21.751  -12.753 1.00 38.31 ? 96  LYS B CG  1 
ATOM   2433 C CD  . LYS B 1 58  ? 10.245  21.666  -14.276 1.00 39.97 ? 96  LYS B CD  1 
ATOM   2434 C CE  . LYS B 1 58  ? 9.556   22.932  -14.775 1.00 43.22 ? 96  LYS B CE  1 
ATOM   2435 N NZ  . LYS B 1 58  ? 9.478   22.875  -16.242 1.00 50.31 ? 96  LYS B NZ  1 
ATOM   2436 N N   . HIS B 1 59  ? 10.710  18.854  -9.232  1.00 35.74 ? 97  HIS B N   1 
ATOM   2437 C CA  . HIS B 1 59  ? 11.018  17.565  -8.579  1.00 35.81 ? 97  HIS B CA  1 
ATOM   2438 C C   . HIS B 1 59  ? 11.474  16.619  -9.688  1.00 35.39 ? 97  HIS B C   1 
ATOM   2439 O O   . HIS B 1 59  ? 10.793  16.483  -10.698 1.00 36.98 ? 97  HIS B O   1 
ATOM   2440 C CB  . HIS B 1 59  ? 9.811   16.980  -7.849  1.00 35.57 ? 97  HIS B CB  1 
ATOM   2441 C CG  . HIS B 1 59  ? 10.151  15.785  -7.004  1.00 35.39 ? 97  HIS B CG  1 
ATOM   2442 N ND1 . HIS B 1 59  ? 10.509  14.566  -7.548  1.00 34.26 ? 97  HIS B ND1 1 
ATOM   2443 C CD2 . HIS B 1 59  ? 10.255  15.643  -5.659  1.00 36.11 ? 97  HIS B CD2 1 
ATOM   2444 C CE1 . HIS B 1 59  ? 10.807  13.721  -6.571  1.00 36.55 ? 97  HIS B CE1 1 
ATOM   2445 N NE2 . HIS B 1 59  ? 10.641  14.343  -5.415  1.00 35.03 ? 97  HIS B NE2 1 
ATOM   2446 N N   . PRO B 1 60  ? 12.656  16.025  -9.558  1.00 35.69 ? 98  PRO B N   1 
ATOM   2447 C CA  . PRO B 1 60  ? 13.129  15.269  -10.734 1.00 35.47 ? 98  PRO B CA  1 
ATOM   2448 C C   . PRO B 1 60  ? 12.408  13.904  -10.967 1.00 36.31 ? 98  PRO B C   1 
ATOM   2449 O O   . PRO B 1 60  ? 12.830  13.105  -11.817 1.00 37.24 ? 98  PRO B O   1 
ATOM   2450 C CB  . PRO B 1 60  ? 14.623  15.115  -10.439 1.00 34.81 ? 98  PRO B CB  1 
ATOM   2451 C CG  . PRO B 1 60  ? 14.682  14.981  -9.010  1.00 35.81 ? 98  PRO B CG  1 
ATOM   2452 C CD  . PRO B 1 60  ? 13.658  16.015  -8.482  1.00 34.78 ? 98  PRO B CD  1 
ATOM   2453 N N   . CYS B 1 61  ? 11.347  13.607  -10.226 1.00 35.66 ? 99  CYS B N   1 
ATOM   2454 C CA  . CYS B 1 61  ? 10.504  12.479  -10.603 1.00 36.64 ? 99  CYS B CA  1 
ATOM   2455 C C   . CYS B 1 61  ? 9.200   12.925  -11.322 1.00 36.51 ? 99  CYS B C   1 
ATOM   2456 O O   . CYS B 1 61  ? 8.337   12.105  -11.643 1.00 35.15 ? 99  CYS B O   1 
ATOM   2457 C CB  . CYS B 1 61  ? 10.159  11.624  -9.370  1.00 37.32 ? 99  CYS B CB  1 
ATOM   2458 S SG  . CYS B 1 61  ? 11.575  10.703  -8.747  1.00 40.21 ? 99  CYS B SG  1 
ATOM   2459 N N   . ASP B 1 62  ? 9.057   14.235  -11.555 1.00 36.44 ? 100 ASP B N   1 
ATOM   2460 C CA  . ASP B 1 62  ? 7.792   14.777  -12.027 1.00 36.25 ? 100 ASP B CA  1 
ATOM   2461 C C   . ASP B 1 62  ? 7.952   15.500  -13.373 1.00 36.58 ? 100 ASP B C   1 
ATOM   2462 O O   . ASP B 1 62  ? 7.137   16.359  -13.730 1.00 36.82 ? 100 ASP B O   1 
ATOM   2463 C CB  . ASP B 1 62  ? 7.239   15.742  -10.991 1.00 35.47 ? 100 ASP B CB  1 
ATOM   2464 C CG  . ASP B 1 62  ? 6.745   15.035  -9.753  1.00 37.71 ? 100 ASP B CG  1 
ATOM   2465 O OD1 . ASP B 1 62  ? 6.303   13.870  -9.881  1.00 37.62 ? 100 ASP B OD1 1 
ATOM   2466 O OD2 . ASP B 1 62  ? 6.757   15.654  -8.657  1.00 38.16 ? 100 ASP B OD2 1 
ATOM   2467 N N   . ILE B 1 63  ? 8.993   15.145  -14.103 1.00 36.33 ? 101 ILE B N   1 
ATOM   2468 C CA  . ILE B 1 63  ? 9.305   15.814  -15.375 1.00 36.72 ? 101 ILE B CA  1 
ATOM   2469 C C   . ILE B 1 63  ? 8.348   15.322  -16.444 1.00 37.26 ? 101 ILE B C   1 
ATOM   2470 O O   . ILE B 1 63  ? 7.931   14.153  -16.415 1.00 35.88 ? 101 ILE B O   1 
ATOM   2471 C CB  . ILE B 1 63  ? 10.766  15.596  -15.760 1.00 37.16 ? 101 ILE B CB  1 
ATOM   2472 C CG1 . ILE B 1 63  ? 11.666  15.969  -14.553 1.00 37.84 ? 101 ILE B CG1 1 
ATOM   2473 C CG2 . ILE B 1 63  ? 11.103  16.427  -16.989 1.00 37.91 ? 101 ILE B CG2 1 
ATOM   2474 C CD1 . ILE B 1 63  ? 11.575  17.474  -14.116 1.00 38.49 ? 101 ILE B CD1 1 
ATOM   2475 N N   . THR B 1 64  ? 7.915   16.232  -17.327 1.00 37.91 ? 102 THR B N   1 
ATOM   2476 C CA  . THR B 1 64  ? 6.954   15.862  -18.378 1.00 39.52 ? 102 THR B CA  1 
ATOM   2477 C C   . THR B 1 64  ? 7.515   16.212  -19.746 1.00 39.69 ? 102 THR B C   1 
ATOM   2478 O O   . THR B 1 64  ? 8.445   17.020  -19.867 1.00 38.90 ? 102 THR B O   1 
ATOM   2479 C CB  . THR B 1 64  ? 5.615   16.589  -18.268 1.00 39.19 ? 102 THR B CB  1 
ATOM   2480 O OG1 . THR B 1 64  ? 5.859   17.985  -18.468 1.00 40.92 ? 102 THR B OG1 1 
ATOM   2481 C CG2 . THR B 1 64  ? 4.913   16.323  -16.897 1.00 38.27 ? 102 THR B CG2 1 
ATOM   2482 N N   . GLU B 1 65  ? 6.948   15.598  -20.779 1.00 40.16 ? 103 GLU B N   1 
ATOM   2483 C CA  . GLU B 1 65  ? 7.383   15.921  -22.135 1.00 42.34 ? 103 GLU B CA  1 
ATOM   2484 C C   . GLU B 1 65  ? 7.138   17.402  -22.416 1.00 41.46 ? 103 GLU B C   1 
ATOM   2485 O O   . GLU B 1 65  ? 7.931   18.034  -23.101 1.00 41.38 ? 103 GLU B O   1 
ATOM   2486 C CB  . GLU B 1 65  ? 6.702   15.028  -23.171 1.00 41.86 ? 103 GLU B CB  1 
ATOM   2487 C CG  . GLU B 1 65  ? 7.456   13.688  -23.327 1.00 44.96 ? 103 GLU B CG  1 
ATOM   2488 C CD  . GLU B 1 65  ? 6.925   12.789  -24.461 1.00 46.35 ? 103 GLU B CD  1 
ATOM   2489 O OE1 . GLU B 1 65  ? 6.857   13.242  -25.630 1.00 49.64 ? 103 GLU B OE1 1 
ATOM   2490 O OE2 . GLU B 1 65  ? 6.584   11.620  -24.163 1.00 52.83 ? 103 GLU B OE2 1 
ATOM   2491 N N   . GLU B 1 66  ? 6.072   17.949  -21.831 1.00 40.79 ? 104 GLU B N   1 
ATOM   2492 C CA  . GLU B 1 66  ? 5.695   19.343  -22.028 1.00 41.59 ? 104 GLU B CA  1 
ATOM   2493 C C   . GLU B 1 66  ? 6.773   20.266  -21.439 1.00 41.00 ? 104 GLU B C   1 
ATOM   2494 O O   . GLU B 1 66  ? 6.989   21.360  -21.966 1.00 41.38 ? 104 GLU B O   1 
ATOM   2495 C CB  . GLU B 1 66  ? 4.300   19.628  -21.446 1.00 41.88 ? 104 GLU B CB  1 
ATOM   2496 C CG  . GLU B 1 66  ? 3.082   18.937  -22.189 1.00 46.89 ? 104 GLU B CG  1 
ATOM   2497 C CD  . GLU B 1 66  ? 3.100   17.363  -22.264 1.00 52.25 ? 104 GLU B CD  1 
ATOM   2498 O OE1 . GLU B 1 66  ? 3.737   16.682  -21.406 1.00 47.34 ? 104 GLU B OE1 1 
ATOM   2499 O OE2 . GLU B 1 66  ? 2.431   16.819  -23.198 1.00 54.97 ? 104 GLU B OE2 1 
ATOM   2500 N N   . ASP B 1 67  ? 7.470   19.817  -20.384 1.00 39.51 ? 105 ASP B N   1 
ATOM   2501 C CA  . ASP B 1 67  ? 8.580   20.586  -19.827 1.00 39.43 ? 105 ASP B CA  1 
ATOM   2502 C C   . ASP B 1 67  ? 9.681   20.833  -20.887 1.00 39.80 ? 105 ASP B C   1 
ATOM   2503 O O   . ASP B 1 67  ? 10.408  21.820  -20.806 1.00 40.33 ? 105 ASP B O   1 
ATOM   2504 C CB  . ASP B 1 67  ? 9.205   19.883  -18.608 1.00 38.25 ? 105 ASP B CB  1 
ATOM   2505 C CG  . ASP B 1 67  ? 8.294   19.916  -17.364 1.00 38.81 ? 105 ASP B CG  1 
ATOM   2506 O OD1 . ASP B 1 67  ? 7.529   20.882  -17.152 1.00 40.05 ? 105 ASP B OD1 1 
ATOM   2507 O OD2 . ASP B 1 67  ? 8.347   18.954  -16.602 1.00 38.05 ? 105 ASP B OD2 1 
ATOM   2508 N N   . TYR B 1 68  ? 9.795   19.946  -21.876 1.00 39.36 ? 106 TYR B N   1 
ATOM   2509 C CA  . TYR B 1 68  ? 10.880  20.068  -22.836 1.00 38.93 ? 106 TYR B CA  1 
ATOM   2510 C C   . TYR B 1 68  ? 10.506  20.783  -24.131 1.00 40.18 ? 106 TYR B C   1 
ATOM   2511 O O   . TYR B 1 68  ? 11.366  20.964  -25.011 1.00 40.95 ? 106 TYR B O   1 
ATOM   2512 C CB  . TYR B 1 68  ? 11.512  18.708  -23.126 1.00 38.25 ? 106 TYR B CB  1 
ATOM   2513 C CG  . TYR B 1 68  ? 12.520  18.287  -22.071 1.00 36.80 ? 106 TYR B CG  1 
ATOM   2514 C CD1 . TYR B 1 68  ? 12.215  17.270  -21.155 1.00 37.83 ? 106 TYR B CD1 1 
ATOM   2515 C CD2 . TYR B 1 68  ? 13.778  18.887  -22.004 1.00 35.22 ? 106 TYR B CD2 1 
ATOM   2516 C CE1 . TYR B 1 68  ? 13.141  16.874  -20.164 1.00 37.57 ? 106 TYR B CE1 1 
ATOM   2517 C CE2 . TYR B 1 68  ? 14.720  18.502  -21.024 1.00 38.31 ? 106 TYR B CE2 1 
ATOM   2518 C CZ  . TYR B 1 68  ? 14.390  17.500  -20.104 1.00 38.27 ? 106 TYR B CZ  1 
ATOM   2519 O OH  . TYR B 1 68  ? 15.301  17.097  -19.140 1.00 36.55 ? 106 TYR B OH  1 
ATOM   2520 N N   . GLN B 1 69  ? 9.248   21.182  -24.246 1.00 40.49 ? 107 GLN B N   1 
ATOM   2521 C CA  . GLN B 1 69  ? 8.737   21.749  -25.485 1.00 42.50 ? 107 GLN B CA  1 
ATOM   2522 C C   . GLN B 1 69  ? 9.437   23.036  -25.919 1.00 42.37 ? 107 GLN B C   1 
ATOM   2523 O O   . GLN B 1 69  ? 9.797   23.136  -27.083 1.00 42.55 ? 107 GLN B O   1 
ATOM   2524 C CB  . GLN B 1 69  ? 7.222   21.938  -25.440 1.00 43.21 ? 107 GLN B CB  1 
ATOM   2525 C CG  . GLN B 1 69  ? 6.438   20.695  -25.874 1.00 49.06 ? 107 GLN B CG  1 
ATOM   2526 C CD  . GLN B 1 69  ? 7.062   19.952  -27.064 1.00 52.51 ? 107 GLN B CD  1 
ATOM   2527 O OE1 . GLN B 1 69  ? 7.093   20.468  -28.184 1.00 54.01 ? 107 GLN B OE1 1 
ATOM   2528 N NE2 . GLN B 1 69  ? 7.553   18.733  -26.814 1.00 53.47 ? 107 GLN B NE2 1 
ATOM   2529 N N   . PRO B 1 70  ? 9.648   24.010  -24.993 1.00 42.12 ? 108 PRO B N   1 
ATOM   2530 C CA  . PRO B 1 70  ? 10.424  25.211  -25.370 1.00 41.80 ? 108 PRO B CA  1 
ATOM   2531 C C   . PRO B 1 70  ? 11.824  24.866  -25.959 1.00 41.10 ? 108 PRO B C   1 
ATOM   2532 O O   . PRO B 1 70  ? 12.233  25.455  -26.959 1.00 39.74 ? 108 PRO B O   1 
ATOM   2533 C CB  . PRO B 1 70  ? 10.572  25.976  -24.048 1.00 42.10 ? 108 PRO B CB  1 
ATOM   2534 C CG  . PRO B 1 70  ? 9.447   25.476  -23.168 1.00 43.06 ? 108 PRO B CG  1 
ATOM   2535 C CD  . PRO B 1 70  ? 9.205   24.049  -23.583 1.00 42.70 ? 108 PRO B CD  1 
ATOM   2536 N N   . LEU B 1 71  ? 12.534  23.919  -25.349 1.00 39.92 ? 109 LEU B N   1 
ATOM   2537 C CA  . LEU B 1 71  ? 13.774  23.399  -25.929 1.00 40.83 ? 109 LEU B CA  1 
ATOM   2538 C C   . LEU B 1 71  ? 13.575  22.729  -27.318 1.00 41.28 ? 109 LEU B C   1 
ATOM   2539 O O   . LEU B 1 71  ? 14.348  22.986  -28.257 1.00 40.69 ? 109 LEU B O   1 
ATOM   2540 C CB  . LEU B 1 71  ? 14.451  22.424  -24.971 1.00 40.43 ? 109 LEU B CB  1 
ATOM   2541 C CG  . LEU B 1 71  ? 15.782  21.803  -25.434 1.00 41.79 ? 109 LEU B CG  1 
ATOM   2542 C CD1 . LEU B 1 71  ? 16.888  22.875  -25.711 1.00 41.36 ? 109 LEU B CD1 1 
ATOM   2543 C CD2 . LEU B 1 71  ? 16.260  20.724  -24.420 1.00 40.41 ? 109 LEU B CD2 1 
ATOM   2544 N N   . MET B 1 72  ? 12.552  21.887  -27.435 1.00 41.37 ? 110 MET B N   1 
ATOM   2545 C CA  . MET B 1 72  ? 12.242  21.241  -28.698 1.00 42.57 ? 110 MET B CA  1 
ATOM   2546 C C   . MET B 1 72  ? 12.031  22.281  -29.806 1.00 42.94 ? 110 MET B C   1 
ATOM   2547 O O   . MET B 1 72  ? 12.568  22.122  -30.902 1.00 43.55 ? 110 MET B O   1 
ATOM   2548 C CB  . MET B 1 72  ? 11.002  20.348  -28.591 1.00 43.28 ? 110 MET B CB  1 
ATOM   2549 C CG  . MET B 1 72  ? 11.138  19.101  -27.713 1.00 44.62 ? 110 MET B CG  1 
ATOM   2550 S SD  . MET B 1 72  ? 12.519  18.046  -28.137 1.00 50.51 ? 110 MET B SD  1 
ATOM   2551 C CE  . MET B 1 72  ? 13.478  18.129  -26.618 1.00 50.31 ? 110 MET B CE  1 
ATOM   2552 N N   . LYS B 1 73  ? 11.255  23.326  -29.534 1.00 42.48 ? 111 LYS B N   1 
ATOM   2553 C CA  . LYS B 1 73  ? 11.030  24.383  -30.519 1.00 43.24 ? 111 LYS B CA  1 
ATOM   2554 C C   . LYS B 1 73  ? 12.336  25.026  -30.986 1.00 42.69 ? 111 LYS B C   1 
ATOM   2555 O O   . LYS B 1 73  ? 12.574  25.177  -32.177 1.00 42.80 ? 111 LYS B O   1 
ATOM   2556 C CB  . LYS B 1 73  ? 10.111  25.460  -29.963 1.00 43.87 ? 111 LYS B CB  1 
ATOM   2557 C CG  . LYS B 1 73  ? 8.651   25.105  -29.970 1.00 46.88 ? 111 LYS B CG  1 
ATOM   2558 C CD  . LYS B 1 73  ? 7.802   26.359  -29.741 1.00 51.22 ? 111 LYS B CD  1 
ATOM   2559 C CE  . LYS B 1 73  ? 6.364   26.007  -29.282 1.00 53.35 ? 111 LYS B CE  1 
ATOM   2560 N NZ  . LYS B 1 73  ? 6.376   25.015  -28.137 1.00 52.91 ? 111 LYS B NZ  1 
ATOM   2561 N N   . LEU B 1 74  ? 13.191  25.390  -30.036 1.00 42.48 ? 112 LEU B N   1 
ATOM   2562 C CA  . LEU B 1 74  ? 14.450  26.053  -30.358 1.00 42.17 ? 112 LEU B CA  1 
ATOM   2563 C C   . LEU B 1 74  ? 15.425  25.121  -31.075 1.00 41.96 ? 112 LEU B C   1 
ATOM   2564 O O   . LEU B 1 74  ? 16.214  25.576  -31.897 1.00 41.78 ? 112 LEU B O   1 
ATOM   2565 C CB  . LEU B 1 74  ? 15.094  26.636  -29.098 1.00 41.62 ? 112 LEU B CB  1 
ATOM   2566 C CG  . LEU B 1 74  ? 14.442  27.864  -28.442 1.00 41.87 ? 112 LEU B CG  1 
ATOM   2567 C CD1 . LEU B 1 74  ? 15.174  28.168  -27.138 1.00 41.37 ? 112 LEU B CD1 1 
ATOM   2568 C CD2 . LEU B 1 74  ? 14.449  29.083  -29.353 1.00 40.38 ? 112 LEU B CD2 1 
ATOM   2569 N N   . GLY B 1 75  ? 15.357  23.828  -30.768 1.00 41.81 ? 113 GLY B N   1 
ATOM   2570 C CA  . GLY B 1 75  ? 16.222  22.830  -31.388 1.00 43.36 ? 113 GLY B CA  1 
ATOM   2571 C C   . GLY B 1 75  ? 15.645  22.177  -32.636 1.00 44.86 ? 113 GLY B C   1 
ATOM   2572 O O   . GLY B 1 75  ? 16.204  21.202  -33.124 1.00 45.84 ? 113 GLY B O   1 
ATOM   2573 N N   . THR B 1 76  ? 14.534  22.704  -33.151 1.00 45.14 ? 114 THR B N   1 
ATOM   2574 C CA  . THR B 1 76  ? 13.938  22.242  -34.416 1.00 46.11 ? 114 THR B CA  1 
ATOM   2575 C C   . THR B 1 76  ? 14.966  22.218  -35.558 1.00 45.40 ? 114 THR B C   1 
ATOM   2576 O O   . THR B 1 76  ? 15.718  23.174  -35.769 1.00 45.19 ? 114 THR B O   1 
ATOM   2577 C CB  . THR B 1 76  ? 12.692  23.090  -34.788 1.00 46.16 ? 114 THR B CB  1 
ATOM   2578 O OG1 . THR B 1 76  ? 11.641  22.780  -33.870 1.00 49.99 ? 114 THR B OG1 1 
ATOM   2579 C CG2 . THR B 1 76  ? 12.184  22.809  -36.192 1.00 46.64 ? 114 THR B CG2 1 
ATOM   2580 N N   . GLN B 1 77  ? 14.988  21.101  -36.273 1.00 45.33 ? 115 GLN B N   1 
ATOM   2581 C CA  . GLN B 1 77  ? 15.987  20.808  -37.285 1.00 44.63 ? 115 GLN B CA  1 
ATOM   2582 C C   . GLN B 1 77  ? 15.406  19.690  -38.098 1.00 44.99 ? 115 GLN B C   1 
ATOM   2583 O O   . GLN B 1 77  ? 15.024  18.672  -37.546 1.00 45.16 ? 115 GLN B O   1 
ATOM   2584 C CB  . GLN B 1 77  ? 17.238  20.279  -36.592 1.00 44.42 ? 115 GLN B CB  1 
ATOM   2585 C CG  . GLN B 1 77  ? 18.337  19.807  -37.514 1.00 41.88 ? 115 GLN B CG  1 
ATOM   2586 C CD  . GLN B 1 77  ? 19.621  19.515  -36.776 1.00 41.83 ? 115 GLN B CD  1 
ATOM   2587 O OE1 . GLN B 1 77  ? 20.655  19.281  -37.387 1.00 41.63 ? 115 GLN B OE1 1 
ATOM   2588 N NE2 . GLN B 1 77  ? 19.567  19.547  -35.453 1.00 38.81 ? 115 GLN B NE2 1 
ATOM   2589 N N   . THR B 1 78  ? 15.316  19.845  -39.403 1.00 45.52 ? 116 THR B N   1 
ATOM   2590 C CA  . THR B 1 78  ? 14.949  18.666  -40.158 1.00 46.35 ? 116 THR B CA  1 
ATOM   2591 C C   . THR B 1 78  ? 16.192  18.097  -40.840 1.00 45.97 ? 116 THR B C   1 
ATOM   2592 O O   . THR B 1 78  ? 17.048  18.830  -41.334 1.00 46.50 ? 116 THR B O   1 
ATOM   2593 C CB  . THR B 1 78  ? 13.700  18.842  -41.071 1.00 46.74 ? 116 THR B CB  1 
ATOM   2594 O OG1 . THR B 1 78  ? 13.842  20.003  -41.898 1.00 47.60 ? 116 THR B OG1 1 
ATOM   2595 C CG2 . THR B 1 78  ? 12.429  18.973  -40.218 1.00 47.72 ? 116 THR B CG2 1 
ATOM   2596 N N   . VAL B 1 79  ? 16.322  16.785  -40.757 1.00 45.33 ? 117 VAL B N   1 
ATOM   2597 C CA  . VAL B 1 79  ? 17.378  16.056  -41.427 1.00 44.52 ? 117 VAL B CA  1 
ATOM   2598 C C   . VAL B 1 79  ? 16.674  15.298  -42.547 1.00 43.30 ? 117 VAL B C   1 
ATOM   2599 O O   . VAL B 1 79  ? 15.461  15.121  -42.475 1.00 43.29 ? 117 VAL B O   1 
ATOM   2600 C CB  . VAL B 1 79  ? 18.086  15.095  -40.436 1.00 44.93 ? 117 VAL B CB  1 
ATOM   2601 C CG1 . VAL B 1 79  ? 18.552  15.861  -39.202 1.00 45.09 ? 117 VAL B CG1 1 
ATOM   2602 C CG2 . VAL B 1 79  ? 17.166  13.932  -40.037 1.00 46.01 ? 117 VAL B CG2 1 
ATOM   2603 N N   . PRO B 1 80  ? 17.403  14.859  -43.590 1.00 42.36 ? 118 PRO B N   1 
ATOM   2604 C CA  . PRO B 1 80  ? 16.666  14.164  -44.652 1.00 41.38 ? 118 PRO B CA  1 
ATOM   2605 C C   . PRO B 1 80  ? 16.055  12.886  -44.091 1.00 40.43 ? 118 PRO B C   1 
ATOM   2606 O O   . PRO B 1 80  ? 16.767  12.080  -43.495 1.00 40.51 ? 118 PRO B O   1 
ATOM   2607 C CB  . PRO B 1 80  ? 17.744  13.845  -45.691 1.00 41.47 ? 118 PRO B CB  1 
ATOM   2608 C CG  . PRO B 1 80  ? 18.916  14.722  -45.334 1.00 42.44 ? 118 PRO B CG  1 
ATOM   2609 C CD  . PRO B 1 80  ? 18.849  14.911  -43.859 1.00 42.51 ? 118 PRO B CD  1 
ATOM   2610 N N   . CYS B 1 81  ? 14.747  12.712  -44.253 1.00 39.56 ? 119 CYS B N   1 
ATOM   2611 C CA  . CYS B 1 81  ? 14.026  11.694  -43.479 1.00 38.52 ? 119 CYS B CA  1 
ATOM   2612 C C   . CYS B 1 81  ? 14.301  10.258  -43.878 1.00 37.16 ? 119 CYS B C   1 
ATOM   2613 O O   . CYS B 1 81  ? 14.016  9.337   -43.105 1.00 36.06 ? 119 CYS B O   1 
ATOM   2614 C CB  . CYS B 1 81  ? 12.525  11.960  -43.475 1.00 38.36 ? 119 CYS B CB  1 
ATOM   2615 S SG  . CYS B 1 81  ? 11.801  12.110  -45.065 1.00 41.68 ? 119 CYS B SG  1 
ATOM   2616 N N   . ASN B 1 82  ? 14.839  10.088  -45.086 1.00 35.60 ? 120 ASN B N   1 
ATOM   2617 C CA  . ASN B 1 82  ? 15.235  8.791   -45.611 1.00 34.93 ? 120 ASN B CA  1 
ATOM   2618 C C   . ASN B 1 82  ? 16.697  8.420   -45.303 1.00 34.55 ? 120 ASN B C   1 
ATOM   2619 O O   . ASN B 1 82  ? 17.223  7.461   -45.854 1.00 34.98 ? 120 ASN B O   1 
ATOM   2620 C CB  . ASN B 1 82  ? 14.976  8.729   -47.134 1.00 34.50 ? 120 ASN B CB  1 
ATOM   2621 C CG  . ASN B 1 82  ? 15.774  9.775   -47.923 1.00 34.59 ? 120 ASN B CG  1 
ATOM   2622 O OD1 . ASN B 1 82  ? 15.965  10.910  -47.468 1.00 33.85 ? 120 ASN B OD1 1 
ATOM   2623 N ND2 . ASN B 1 82  ? 16.231  9.396   -49.120 1.00 33.12 ? 120 ASN B ND2 1 
ATOM   2624 N N   . LYS B 1 83  ? 17.346  9.184   -44.428 1.00 34.34 ? 121 LYS B N   1 
ATOM   2625 C CA  . LYS B 1 83  ? 18.757  8.953   -44.074 1.00 33.58 ? 121 LYS B CA  1 
ATOM   2626 C C   . LYS B 1 83  ? 18.949  8.781   -42.565 1.00 33.79 ? 121 LYS B C   1 
ATOM   2627 O O   . LYS B 1 83  ? 19.973  9.153   -42.001 1.00 33.68 ? 121 LYS B O   1 
ATOM   2628 C CB  . LYS B 1 83  ? 19.607  10.112  -44.560 1.00 33.36 ? 121 LYS B CB  1 
ATOM   2629 C CG  . LYS B 1 83  ? 19.478  10.389  -46.048 1.00 32.71 ? 121 LYS B CG  1 
ATOM   2630 C CD  . LYS B 1 83  ? 20.191  9.356   -46.874 1.00 31.49 ? 121 LYS B CD  1 
ATOM   2631 C CE  . LYS B 1 83  ? 19.904  9.611   -48.319 1.00 34.71 ? 121 LYS B CE  1 
ATOM   2632 N NZ  . LYS B 1 83  ? 20.390  8.479   -49.106 1.00 35.01 ? 121 LYS B NZ  1 
ATOM   2633 N N   . ILE B 1 84  ? 17.950  8.203   -41.915 1.00 34.19 ? 122 ILE B N   1 
ATOM   2634 C CA  . ILE B 1 84  ? 17.932  8.123   -40.462 1.00 34.51 ? 122 ILE B CA  1 
ATOM   2635 C C   . ILE B 1 84  ? 18.379  6.757   -39.933 1.00 34.71 ? 122 ILE B C   1 
ATOM   2636 O O   . ILE B 1 84  ? 17.924  5.696   -40.417 1.00 34.67 ? 122 ILE B O   1 
ATOM   2637 C CB  . ILE B 1 84  ? 16.564  8.571   -39.918 1.00 34.48 ? 122 ILE B CB  1 
ATOM   2638 C CG1 . ILE B 1 84  ? 16.567  10.104  -39.845 1.00 36.24 ? 122 ILE B CG1 1 
ATOM   2639 C CG2 . ILE B 1 84  ? 16.322  8.022   -38.512 1.00 34.77 ? 122 ILE B CG2 1 
ATOM   2640 C CD1 . ILE B 1 84  ? 15.259  10.713  -40.015 1.00 38.96 ? 122 ILE B CD1 1 
ATOM   2641 N N   . LEU B 1 85  ? 19.320  6.812   -38.988 1.00 34.52 ? 123 LEU B N   1 
ATOM   2642 C CA  . LEU B 1 85  ? 19.841  5.653   -38.282 1.00 35.08 ? 123 LEU B CA  1 
ATOM   2643 C C   . LEU B 1 85  ? 19.421  5.695   -36.815 1.00 35.58 ? 123 LEU B C   1 
ATOM   2644 O O   . LEU B 1 85  ? 19.765  6.617   -36.062 1.00 36.53 ? 123 LEU B O   1 
ATOM   2645 C CB  . LEU B 1 85  ? 21.382  5.586   -38.347 1.00 35.13 ? 123 LEU B CB  1 
ATOM   2646 C CG  . LEU B 1 85  ? 22.089  4.292   -37.864 1.00 34.49 ? 123 LEU B CG  1 
ATOM   2647 C CD1 . LEU B 1 85  ? 21.565  3.039   -38.605 1.00 30.32 ? 123 LEU B CD1 1 
ATOM   2648 C CD2 . LEU B 1 85  ? 23.611  4.374   -38.050 1.00 34.44 ? 123 LEU B CD2 1 
ATOM   2649 N N   . LEU B 1 86  ? 18.658  4.694   -36.431 1.00 36.43 ? 124 LEU B N   1 
ATOM   2650 C CA  . LEU B 1 86  ? 18.319  4.470   -35.069 1.00 37.86 ? 124 LEU B CA  1 
ATOM   2651 C C   . LEU B 1 86  ? 19.318  3.479   -34.491 1.00 38.99 ? 124 LEU B C   1 
ATOM   2652 O O   . LEU B 1 86  ? 19.961  2.736   -35.210 1.00 38.88 ? 124 LEU B O   1 
ATOM   2653 C CB  . LEU B 1 86  ? 16.861  3.999   -34.948 1.00 37.74 ? 124 LEU B CB  1 
ATOM   2654 C CG  . LEU B 1 86  ? 15.747  4.975   -35.404 1.00 37.73 ? 124 LEU B CG  1 
ATOM   2655 C CD1 . LEU B 1 86  ? 14.344  4.517   -34.985 1.00 36.02 ? 124 LEU B CD1 1 
ATOM   2656 C CD2 . LEU B 1 86  ? 15.977  6.390   -34.917 1.00 36.48 ? 124 LEU B CD2 1 
ATOM   2657 N N   . TRP B 1 87  ? 19.503  3.513   -33.177 1.00 41.28 ? 125 TRP B N   1 
ATOM   2658 C CA  . TRP B 1 87  ? 20.359  2.500   -32.561 1.00 42.87 ? 125 TRP B CA  1 
ATOM   2659 C C   . TRP B 1 87  ? 19.816  2.145   -31.185 1.00 44.24 ? 125 TRP B C   1 
ATOM   2660 O O   . TRP B 1 87  ? 18.946  2.846   -30.651 1.00 43.10 ? 125 TRP B O   1 
ATOM   2661 C CB  . TRP B 1 87  ? 21.845  2.938   -32.550 1.00 42.78 ? 125 TRP B CB  1 
ATOM   2662 C CG  . TRP B 1 87  ? 22.105  4.168   -31.745 1.00 42.80 ? 125 TRP B CG  1 
ATOM   2663 C CD1 . TRP B 1 87  ? 22.197  5.451   -32.202 1.00 43.03 ? 125 TRP B CD1 1 
ATOM   2664 C CD2 . TRP B 1 87  ? 22.300  4.229   -30.323 1.00 43.41 ? 125 TRP B CD2 1 
ATOM   2665 N NE1 . TRP B 1 87  ? 22.436  6.316   -31.148 1.00 42.92 ? 125 TRP B NE1 1 
ATOM   2666 C CE2 . TRP B 1 87  ? 22.494  5.589   -29.985 1.00 43.74 ? 125 TRP B CE2 1 
ATOM   2667 C CE3 . TRP B 1 87  ? 22.317  3.262   -29.293 1.00 44.28 ? 125 TRP B CE3 1 
ATOM   2668 C CZ2 . TRP B 1 87  ? 22.708  6.005   -28.660 1.00 43.73 ? 125 TRP B CZ2 1 
ATOM   2669 C CZ3 . TRP B 1 87  ? 22.528  3.678   -27.978 1.00 43.29 ? 125 TRP B CZ3 1 
ATOM   2670 C CH2 . TRP B 1 87  ? 22.720  5.039   -27.680 1.00 43.62 ? 125 TRP B CH2 1 
ATOM   2671 N N   . SER B 1 88  ? 20.304  1.032   -30.644 1.00 46.68 ? 126 SER B N   1 
ATOM   2672 C CA  . SER B 1 88  ? 19.910  0.566   -29.321 1.00 49.90 ? 126 SER B CA  1 
ATOM   2673 C C   . SER B 1 88  ? 21.089  -0.150  -28.668 1.00 51.45 ? 126 SER B C   1 
ATOM   2674 O O   . SER B 1 88  ? 21.531  -1.185  -29.158 1.00 51.51 ? 126 SER B O   1 
ATOM   2675 C CB  . SER B 1 88  ? 18.711  -0.383  -29.435 1.00 50.12 ? 126 SER B CB  1 
ATOM   2676 O OG  . SER B 1 88  ? 17.929  -0.355  -28.253 1.00 52.46 ? 126 SER B OG  1 
ATOM   2677 N N   . ARG B 1 89  ? 21.598  0.424   -27.577 1.00 54.35 ? 127 ARG B N   1 
ATOM   2678 C CA  . ARG B 1 89  ? 22.728  -0.134  -26.807 1.00 56.75 ? 127 ARG B CA  1 
ATOM   2679 C C   . ARG B 1 89  ? 23.846  -0.644  -27.713 1.00 57.46 ? 127 ARG B C   1 
ATOM   2680 O O   . ARG B 1 89  ? 24.183  -1.830  -27.698 1.00 57.59 ? 127 ARG B O   1 
ATOM   2681 C CB  . ARG B 1 89  ? 22.241  -1.240  -25.847 1.00 57.62 ? 127 ARG B CB  1 
ATOM   2682 C CG  . ARG B 1 89  ? 21.536  -0.713  -24.569 1.00 60.88 ? 127 ARG B CG  1 
ATOM   2683 C CD  . ARG B 1 89  ? 20.253  -1.510  -24.265 1.00 66.05 ? 127 ARG B CD  1 
ATOM   2684 N NE  . ARG B 1 89  ? 19.862  -1.438  -22.852 1.00 70.14 ? 127 ARG B NE  1 
ATOM   2685 C CZ  . ARG B 1 89  ? 20.110  -2.387  -21.940 1.00 72.95 ? 127 ARG B CZ  1 
ATOM   2686 N NH1 . ARG B 1 89  ? 20.755  -3.509  -22.275 1.00 73.10 ? 127 ARG B NH1 1 
ATOM   2687 N NH2 . ARG B 1 89  ? 19.710  -2.219  -20.678 1.00 73.96 ? 127 ARG B NH2 1 
ATOM   2688 N N   . ILE B 1 90  ? 24.399  0.269   -28.505 1.00 58.50 ? 128 ILE B N   1 
ATOM   2689 C CA  . ILE B 1 90  ? 25.463  -0.013  -29.486 1.00 59.50 ? 128 ILE B CA  1 
ATOM   2690 C C   . ILE B 1 90  ? 25.976  1.349   -30.000 1.00 59.76 ? 128 ILE B C   1 
ATOM   2691 O O   . ILE B 1 90  ? 26.071  1.613   -31.210 1.00 60.30 ? 128 ILE B O   1 
ATOM   2692 C CB  . ILE B 1 90  ? 24.982  -0.958  -30.645 1.00 59.55 ? 128 ILE B CB  1 
ATOM   2693 C CG1 . ILE B 1 90  ? 26.107  -1.264  -31.648 1.00 59.68 ? 128 ILE B CG1 1 
ATOM   2694 C CG2 . ILE B 1 90  ? 23.766  -0.374  -31.367 1.00 60.11 ? 128 ILE B CG2 1 
ATOM   2695 C CD1 . ILE B 1 90  ? 26.861  -2.554  -31.407 1.00 60.40 ? 128 ILE B CD1 1 
ATOM   2696 N N   . LYS B 1 91  ? 26.319  2.189   -29.035 1.00 59.74 ? 129 LYS B N   1 
ATOM   2697 C CA  . LYS B 1 91  ? 26.645  3.591   -29.238 1.00 59.84 ? 129 LYS B CA  1 
ATOM   2698 C C   . LYS B 1 91  ? 27.756  3.822   -30.261 1.00 59.09 ? 129 LYS B C   1 
ATOM   2699 O O   . LYS B 1 91  ? 27.577  4.548   -31.249 1.00 59.01 ? 129 LYS B O   1 
ATOM   2700 C CB  . LYS B 1 91  ? 27.077  4.167   -27.890 1.00 60.15 ? 129 LYS B CB  1 
ATOM   2701 C CG  . LYS B 1 91  ? 26.636  5.590   -27.635 1.00 61.96 ? 129 LYS B CG  1 
ATOM   2702 C CD  . LYS B 1 91  ? 26.518  5.803   -26.127 1.00 63.89 ? 129 LYS B CD  1 
ATOM   2703 C CE  . LYS B 1 91  ? 25.841  7.114   -25.810 1.00 64.13 ? 129 LYS B CE  1 
ATOM   2704 N NZ  . LYS B 1 91  ? 26.664  8.197   -26.403 1.00 65.20 ? 129 LYS B NZ  1 
ATOM   2705 N N   . ASP B 1 92  ? 28.891  3.185   -30.004 1.00 57.99 ? 130 ASP B N   1 
ATOM   2706 C CA  . ASP B 1 92  ? 30.141  3.477   -30.688 1.00 57.39 ? 130 ASP B CA  1 
ATOM   2707 C C   . ASP B 1 92  ? 30.081  3.277   -32.198 1.00 56.15 ? 130 ASP B C   1 
ATOM   2708 O O   . ASP B 1 92  ? 30.566  4.127   -32.950 1.00 56.25 ? 130 ASP B O   1 
ATOM   2709 C CB  . ASP B 1 92  ? 31.286  2.645   -30.085 1.00 57.83 ? 130 ASP B CB  1 
ATOM   2710 C CG  . ASP B 1 92  ? 31.429  2.844   -28.562 1.00 60.00 ? 130 ASP B CG  1 
ATOM   2711 O OD1 . ASP B 1 92  ? 30.960  3.893   -28.029 1.00 60.81 ? 130 ASP B OD1 1 
ATOM   2712 O OD2 . ASP B 1 92  ? 32.021  1.939   -27.904 1.00 60.76 ? 130 ASP B OD2 1 
ATOM   2713 N N   . LEU B 1 93  ? 29.498  2.163   -32.642 1.00 54.29 ? 131 LEU B N   1 
ATOM   2714 C CA  . LEU B 1 93  ? 29.491  1.849   -34.069 1.00 52.80 ? 131 LEU B CA  1 
ATOM   2715 C C   . LEU B 1 93  ? 28.548  2.773   -34.834 1.00 51.39 ? 131 LEU B C   1 
ATOM   2716 O O   . LEU B 1 93  ? 28.887  3.256   -35.914 1.00 50.62 ? 131 LEU B O   1 
ATOM   2717 C CB  . LEU B 1 93  ? 29.139  0.379   -34.338 1.00 52.82 ? 131 LEU B CB  1 
ATOM   2718 C CG  . LEU B 1 93  ? 29.884  -0.310  -35.482 1.00 53.42 ? 131 LEU B CG  1 
ATOM   2719 C CD1 . LEU B 1 93  ? 28.941  -1.240  -36.247 1.00 53.91 ? 131 LEU B CD1 1 
ATOM   2720 C CD2 . LEU B 1 93  ? 30.546  0.659   -36.454 1.00 53.27 ? 131 LEU B CD2 1 
ATOM   2721 N N   . ALA B 1 94  ? 27.372  3.015   -34.273 1.00 49.96 ? 132 ALA B N   1 
ATOM   2722 C CA  . ALA B 1 94  ? 26.414  3.913   -34.902 1.00 49.39 ? 132 ALA B CA  1 
ATOM   2723 C C   . ALA B 1 94  ? 27.076  5.240   -35.279 1.00 48.80 ? 132 ALA B C   1 
ATOM   2724 O O   . ALA B 1 94  ? 26.969  5.697   -36.411 1.00 48.85 ? 132 ALA B O   1 
ATOM   2725 C CB  . ALA B 1 94  ? 25.201  4.145   -33.981 1.00 49.65 ? 132 ALA B CB  1 
ATOM   2726 N N   . HIS B 1 95  ? 27.784  5.828   -34.326 1.00 48.13 ? 133 HIS B N   1 
ATOM   2727 C CA  . HIS B 1 95  ? 28.379  7.141   -34.496 1.00 47.93 ? 133 HIS B CA  1 
ATOM   2728 C C   . HIS B 1 95  ? 29.611  7.096   -35.375 1.00 46.74 ? 133 HIS B C   1 
ATOM   2729 O O   . HIS B 1 95  ? 29.848  7.997   -36.173 1.00 45.51 ? 133 HIS B O   1 
ATOM   2730 C CB  . HIS B 1 95  ? 28.695  7.743   -33.129 1.00 48.68 ? 133 HIS B CB  1 
ATOM   2731 C CG  . HIS B 1 95  ? 27.493  7.861   -32.244 1.00 51.14 ? 133 HIS B CG  1 
ATOM   2732 N ND1 . HIS B 1 95  ? 27.581  7.912   -30.868 1.00 55.29 ? 133 HIS B ND1 1 
ATOM   2733 C CD2 . HIS B 1 95  ? 26.172  7.939   -32.542 1.00 52.11 ? 133 HIS B CD2 1 
ATOM   2734 C CE1 . HIS B 1 95  ? 26.368  8.029   -30.353 1.00 54.70 ? 133 HIS B CE1 1 
ATOM   2735 N NE2 . HIS B 1 95  ? 25.494  8.038   -31.349 1.00 55.15 ? 133 HIS B NE2 1 
ATOM   2736 N N   . GLN B 1 96  ? 30.392  6.037   -35.225 1.00 46.60 ? 134 GLN B N   1 
ATOM   2737 C CA  . GLN B 1 96  ? 31.526  5.834   -36.091 1.00 46.63 ? 134 GLN B CA  1 
ATOM   2738 C C   . GLN B 1 96  ? 31.011  5.763   -37.529 1.00 46.08 ? 134 GLN B C   1 
ATOM   2739 O O   . GLN B 1 96  ? 31.624  6.324   -38.432 1.00 45.92 ? 134 GLN B O   1 
ATOM   2740 C CB  . GLN B 1 96  ? 32.288  4.568   -35.701 1.00 46.74 ? 134 GLN B CB  1 
ATOM   2741 C CG  . GLN B 1 96  ? 33.022  4.664   -34.361 1.00 48.68 ? 134 GLN B CG  1 
ATOM   2742 C CD  . GLN B 1 96  ? 33.538  3.308   -33.848 1.00 48.47 ? 134 GLN B CD  1 
ATOM   2743 O OE1 . GLN B 1 96  ? 34.059  2.491   -34.607 1.00 50.09 ? 134 GLN B OE1 1 
ATOM   2744 N NE2 . GLN B 1 96  ? 33.388  3.076   -32.542 1.00 51.05 ? 134 GLN B NE2 1 
ATOM   2745 N N   . PHE B 1 97  ? 29.863  5.105   -37.724 1.00 45.75 ? 135 PHE B N   1 
ATOM   2746 C CA  . PHE B 1 97  ? 29.283  4.903   -39.067 1.00 44.91 ? 135 PHE B CA  1 
ATOM   2747 C C   . PHE B 1 97  ? 28.903  6.250   -39.694 1.00 44.26 ? 135 PHE B C   1 
ATOM   2748 O O   . PHE B 1 97  ? 29.405  6.592   -40.760 1.00 44.13 ? 135 PHE B O   1 
ATOM   2749 C CB  . PHE B 1 97  ? 28.076  3.930   -39.042 1.00 44.87 ? 135 PHE B CB  1 
ATOM   2750 C CG  . PHE B 1 97  ? 27.365  3.808   -40.370 1.00 44.48 ? 135 PHE B CG  1 
ATOM   2751 C CD1 . PHE B 1 97  ? 26.321  4.668   -40.698 1.00 43.82 ? 135 PHE B CD1 1 
ATOM   2752 C CD2 . PHE B 1 97  ? 27.750  2.844   -41.296 1.00 44.47 ? 135 PHE B CD2 1 
ATOM   2753 C CE1 . PHE B 1 97  ? 25.677  4.577   -41.930 1.00 43.95 ? 135 PHE B CE1 1 
ATOM   2754 C CE2 . PHE B 1 97  ? 27.105  2.741   -42.532 1.00 44.71 ? 135 PHE B CE2 1 
ATOM   2755 C CZ  . PHE B 1 97  ? 26.061  3.612   -42.845 1.00 44.56 ? 135 PHE B CZ  1 
ATOM   2756 N N   . THR B 1 98  ? 28.038  7.018   -39.036 1.00 43.40 ? 136 THR B N   1 
ATOM   2757 C CA  . THR B 1 98  ? 27.681  8.341   -39.557 1.00 43.10 ? 136 THR B CA  1 
ATOM   2758 C C   . THR B 1 98  ? 28.824  9.388   -39.540 1.00 43.72 ? 136 THR B C   1 
ATOM   2759 O O   . THR B 1 98  ? 28.681  10.473  -40.104 1.00 43.54 ? 136 THR B O   1 
ATOM   2760 C CB  . THR B 1 98  ? 26.458  8.948   -38.851 1.00 43.31 ? 136 THR B CB  1 
ATOM   2761 O OG1 . THR B 1 98  ? 26.835  9.357   -37.538 1.00 41.37 ? 136 THR B OG1 1 
ATOM   2762 C CG2 . THR B 1 98  ? 25.278  7.967   -38.800 1.00 42.22 ? 136 THR B CG2 1 
ATOM   2763 N N   . GLN B 1 99  ? 29.948  9.084   -38.902 1.00 44.10 ? 137 GLN B N   1 
ATOM   2764 C CA  . GLN B 1 99  ? 31.110  9.940   -39.064 1.00 45.70 ? 137 GLN B CA  1 
ATOM   2765 C C   . GLN B 1 99  ? 31.660  9.754   -40.476 1.00 46.64 ? 137 GLN B C   1 
ATOM   2766 O O   . GLN B 1 99  ? 32.041  10.725  -41.137 1.00 46.91 ? 137 GLN B O   1 
ATOM   2767 C CB  . GLN B 1 99  ? 32.172  9.639   -38.007 1.00 45.88 ? 137 GLN B CB  1 
ATOM   2768 C CG  . GLN B 1 99  ? 31.938  10.372  -36.678 1.00 47.52 ? 137 GLN B CG  1 
ATOM   2769 C CD  . GLN B 1 99  ? 32.020  11.903  -36.809 1.00 50.74 ? 137 GLN B CD  1 
ATOM   2770 O OE1 . GLN B 1 99  ? 31.148  12.642  -36.329 1.00 51.59 ? 137 GLN B OE1 1 
ATOM   2771 N NE2 . GLN B 1 99  ? 33.074  12.377  -37.454 1.00 52.00 ? 137 GLN B NE2 1 
ATOM   2772 N N   . VAL B 1 100 ? 31.664  8.500   -40.927 1.00 47.43 ? 138 VAL B N   1 
ATOM   2773 C CA  . VAL B 1 100 ? 32.135  8.108   -42.260 1.00 48.44 ? 138 VAL B CA  1 
ATOM   2774 C C   . VAL B 1 100 ? 31.092  8.350   -43.358 1.00 49.41 ? 138 VAL B C   1 
ATOM   2775 O O   . VAL B 1 100 ? 31.409  8.908   -44.421 1.00 50.02 ? 138 VAL B O   1 
ATOM   2776 C CB  . VAL B 1 100 ? 32.530  6.603   -42.312 1.00 48.31 ? 138 VAL B CB  1 
ATOM   2777 C CG1 . VAL B 1 100 ? 33.076  6.251   -43.678 1.00 48.05 ? 138 VAL B CG1 1 
ATOM   2778 C CG2 . VAL B 1 100 ? 33.548  6.267   -41.249 1.00 48.38 ? 138 VAL B CG2 1 
ATOM   2779 N N   . GLN B 1 101 ? 29.867  7.880   -43.118 1.00 49.89 ? 139 GLN B N   1 
ATOM   2780 C CA  . GLN B 1 101 ? 28.793  7.971   -44.092 1.00 50.19 ? 139 GLN B CA  1 
ATOM   2781 C C   . GLN B 1 101 ? 28.063  9.226   -43.686 1.00 50.70 ? 139 GLN B C   1 
ATOM   2782 O O   . GLN B 1 101 ? 27.022  9.184   -43.013 1.00 50.56 ? 139 GLN B O   1 
ATOM   2783 C CB  . GLN B 1 101 ? 27.890  6.730   -44.018 1.00 50.20 ? 139 GLN B CB  1 
ATOM   2784 C CG  . GLN B 1 101 ? 26.864  6.579   -45.151 1.00 50.72 ? 139 GLN B CG  1 
ATOM   2785 C CD  . GLN B 1 101 ? 27.321  5.666   -46.276 1.00 51.87 ? 139 GLN B CD  1 
ATOM   2786 O OE1 . GLN B 1 101 ? 28.404  5.077   -46.235 1.00 51.39 ? 139 GLN B OE1 1 
ATOM   2787 N NE2 . GLN B 1 101 ? 26.488  5.541   -47.292 1.00 53.15 ? 139 GLN B NE2 1 
ATOM   2788 N N   . ARG B 1 102 ? 28.641  10.361  -44.056 1.00 51.21 ? 140 ARG B N   1 
ATOM   2789 C CA  . ARG B 1 102 ? 28.098  11.644  -43.635 1.00 52.06 ? 140 ARG B CA  1 
ATOM   2790 C C   . ARG B 1 102 ? 26.725  11.955  -44.252 1.00 51.91 ? 140 ARG B C   1 
ATOM   2791 O O   . ARG B 1 102 ? 26.132  12.988  -43.948 1.00 52.23 ? 140 ARG B O   1 
ATOM   2792 C CB  . ARG B 1 102 ? 29.132  12.770  -43.845 1.00 52.58 ? 140 ARG B CB  1 
ATOM   2793 C CG  . ARG B 1 102 ? 29.781  13.266  -42.530 1.00 54.49 ? 140 ARG B CG  1 
ATOM   2794 C CD  . ARG B 1 102 ? 28.846  14.269  -41.838 1.00 56.94 ? 140 ARG B CD  1 
ATOM   2795 N NE  . ARG B 1 102 ? 28.710  14.078  -40.385 1.00 59.89 ? 140 ARG B NE  1 
ATOM   2796 C CZ  . ARG B 1 102 ? 27.626  13.598  -39.767 1.00 60.62 ? 140 ARG B CZ  1 
ATOM   2797 N NH1 . ARG B 1 102 ? 26.538  13.238  -40.454 1.00 61.13 ? 140 ARG B NH1 1 
ATOM   2798 N NH2 . ARG B 1 102 ? 27.627  13.479  -38.446 1.00 61.46 ? 140 ARG B NH2 1 
ATOM   2799 N N   . ASP B 1 103 ? 26.227  11.042  -45.095 1.00 51.96 ? 141 ASP B N   1 
ATOM   2800 C CA  . ASP B 1 103 ? 24.844  11.074  -45.624 1.00 52.01 ? 141 ASP B CA  1 
ATOM   2801 C C   . ASP B 1 103 ? 23.769  10.551  -44.634 1.00 51.04 ? 141 ASP B C   1 
ATOM   2802 O O   . ASP B 1 103 ? 22.584  10.540  -44.950 1.00 51.49 ? 141 ASP B O   1 
ATOM   2803 C CB  . ASP B 1 103 ? 24.743  10.302  -46.953 1.00 52.58 ? 141 ASP B CB  1 
ATOM   2804 C CG  . ASP B 1 103 ? 24.595  11.229  -48.167 1.00 55.26 ? 141 ASP B CG  1 
ATOM   2805 O OD1 . ASP B 1 103 ? 24.261  10.743  -49.283 1.00 57.38 ? 141 ASP B OD1 1 
ATOM   2806 O OD2 . ASP B 1 103 ? 24.805  12.457  -48.001 1.00 58.74 ? 141 ASP B OD2 1 
ATOM   2807 N N   . MET B 1 104 ? 24.186  10.127  -43.448 1.00 49.25 ? 142 MET B N   1 
ATOM   2808 C CA  . MET B 1 104 ? 23.303  9.443   -42.513 1.00 47.70 ? 142 MET B CA  1 
ATOM   2809 C C   . MET B 1 104 ? 23.340  10.138  -41.154 1.00 45.96 ? 142 MET B C   1 
ATOM   2810 O O   . MET B 1 104 ? 24.344  10.762  -40.803 1.00 45.05 ? 142 MET B O   1 
ATOM   2811 C CB  . MET B 1 104 ? 23.717  7.973   -42.381 1.00 48.14 ? 142 MET B CB  1 
ATOM   2812 C CG  . MET B 1 104 ? 23.629  7.149   -43.695 1.00 50.71 ? 142 MET B CG  1 
ATOM   2813 S SD  . MET B 1 104 ? 22.007  6.423   -44.002 1.00 55.89 ? 142 MET B SD  1 
ATOM   2814 C CE  . MET B 1 104 ? 21.935  5.137   -42.748 1.00 55.30 ? 142 MET B CE  1 
ATOM   2815 N N   . PHE B 1 105 ? 22.235  10.012  -40.409 1.00 44.30 ? 143 PHE B N   1 
ATOM   2816 C CA  . PHE B 1 105 ? 21.977  10.750  -39.175 1.00 42.65 ? 143 PHE B CA  1 
ATOM   2817 C C   . PHE B 1 105 ? 21.441  9.870   -38.060 1.00 40.70 ? 143 PHE B C   1 
ATOM   2818 O O   . PHE B 1 105 ? 20.388  9.265   -38.200 1.00 39.82 ? 143 PHE B O   1 
ATOM   2819 C CB  . PHE B 1 105 ? 20.939  11.850  -39.428 1.00 43.82 ? 143 PHE B CB  1 
ATOM   2820 C CG  . PHE B 1 105 ? 21.517  13.108  -39.968 1.00 46.04 ? 143 PHE B CG  1 
ATOM   2821 C CD1 . PHE B 1 105 ? 21.824  14.159  -39.110 1.00 48.99 ? 143 PHE B CD1 1 
ATOM   2822 C CD2 . PHE B 1 105 ? 21.751  13.253  -41.327 1.00 47.61 ? 143 PHE B CD2 1 
ATOM   2823 C CE1 . PHE B 1 105 ? 22.369  15.343  -39.594 1.00 50.33 ? 143 PHE B CE1 1 
ATOM   2824 C CE2 . PHE B 1 105 ? 22.304  14.424  -41.831 1.00 49.34 ? 143 PHE B CE2 1 
ATOM   2825 C CZ  . PHE B 1 105 ? 22.607  15.479  -40.964 1.00 49.06 ? 143 PHE B CZ  1 
ATOM   2826 N N   . THR B 1 106 ? 22.170  9.801   -36.955 1.00 38.88 ? 144 THR B N   1 
ATOM   2827 C CA  . THR B 1 106 ? 21.607  9.290   -35.730 1.00 38.13 ? 144 THR B CA  1 
ATOM   2828 C C   . THR B 1 106 ? 21.061  10.513  -35.021 1.00 38.06 ? 144 THR B C   1 
ATOM   2829 O O   . THR B 1 106 ? 21.341  11.645  -35.399 1.00 37.78 ? 144 THR B O   1 
ATOM   2830 C CB  . THR B 1 106 ? 22.672  8.645   -34.804 1.00 38.29 ? 144 THR B CB  1 
ATOM   2831 O OG1 . THR B 1 106 ? 23.581  9.666   -34.355 1.00 37.07 ? 144 THR B OG1 1 
ATOM   2832 C CG2 . THR B 1 106 ? 23.449  7.531   -35.526 1.00 36.99 ? 144 THR B CG2 1 
ATOM   2833 N N   . LEU B 1 107 ? 20.333  10.272  -33.952 1.00 38.89 ? 145 LEU B N   1 
ATOM   2834 C CA  . LEU B 1 107 ? 19.822  11.317  -33.064 1.00 39.89 ? 145 LEU B CA  1 
ATOM   2835 C C   . LEU B 1 107 ? 20.934  12.225  -32.478 1.00 40.36 ? 145 LEU B C   1 
ATOM   2836 O O   . LEU B 1 107 ? 20.772  13.438  -32.361 1.00 39.85 ? 145 LEU B O   1 
ATOM   2837 C CB  . LEU B 1 107 ? 19.015  10.621  -31.954 1.00 39.63 ? 145 LEU B CB  1 
ATOM   2838 C CG  . LEU B 1 107 ? 18.116  11.447  -31.038 1.00 43.04 ? 145 LEU B CG  1 
ATOM   2839 C CD1 . LEU B 1 107 ? 17.316  12.452  -31.808 1.00 41.04 ? 145 LEU B CD1 1 
ATOM   2840 C CD2 . LEU B 1 107 ? 17.196  10.545  -30.179 1.00 44.68 ? 145 LEU B CD2 1 
ATOM   2841 N N   . GLU B 1 108 ? 22.075  11.625  -32.149 1.00 40.60 ? 146 GLU B N   1 
ATOM   2842 C CA  . GLU B 1 108 ? 23.229  12.366  -31.644 1.00 41.86 ? 146 GLU B CA  1 
ATOM   2843 C C   . GLU B 1 108 ? 23.960  13.254  -32.679 1.00 41.92 ? 146 GLU B C   1 
ATOM   2844 O O   . GLU B 1 108 ? 24.835  14.051  -32.317 1.00 42.25 ? 146 GLU B O   1 
ATOM   2845 C CB  . GLU B 1 108 ? 24.195  11.408  -30.952 1.00 41.85 ? 146 GLU B CB  1 
ATOM   2846 C CG  . GLU B 1 108 ? 23.559  10.653  -29.773 1.00 42.93 ? 146 GLU B CG  1 
ATOM   2847 C CD  . GLU B 1 108 ? 22.589  9.552   -30.219 1.00 44.75 ? 146 GLU B CD  1 
ATOM   2848 O OE1 . GLU B 1 108 ? 22.703  9.077   -31.372 1.00 41.51 ? 146 GLU B OE1 1 
ATOM   2849 O OE2 . GLU B 1 108 ? 21.728  9.141   -29.412 1.00 45.59 ? 146 GLU B OE2 1 
ATOM   2850 N N   . ASP B 1 109 ? 23.582  13.124  -33.948 1.00 41.76 ? 147 ASP B N   1 
ATOM   2851 C CA  . ASP B 1 109 ? 24.036  14.018  -35.021 1.00 41.69 ? 147 ASP B CA  1 
ATOM   2852 C C   . ASP B 1 109 ? 23.132  15.251  -35.209 1.00 41.32 ? 147 ASP B C   1 
ATOM   2853 O O   . ASP B 1 109 ? 23.481  16.154  -35.966 1.00 41.42 ? 147 ASP B O   1 
ATOM   2854 C CB  . ASP B 1 109 ? 24.117  13.258  -36.335 1.00 41.78 ? 147 ASP B CB  1 
ATOM   2855 C CG  . ASP B 1 109 ? 25.095  12.108  -36.286 1.00 44.15 ? 147 ASP B CG  1 
ATOM   2856 O OD1 . ASP B 1 109 ? 24.704  11.011  -36.723 1.00 46.37 ? 147 ASP B OD1 1 
ATOM   2857 O OD2 . ASP B 1 109 ? 26.260  12.282  -35.841 1.00 46.08 ? 147 ASP B OD2 1 
ATOM   2858 N N   . THR B 1 110 ? 21.968  15.267  -34.555 1.00 41.43 ? 148 THR B N   1 
ATOM   2859 C CA  . THR B 1 110 ? 21.123  16.464  -34.459 1.00 41.16 ? 148 THR B CA  1 
ATOM   2860 C C   . THR B 1 110 ? 21.619  17.337  -33.313 1.00 41.23 ? 148 THR B C   1 
ATOM   2861 O O   . THR B 1 110 ? 22.216  16.822  -32.361 1.00 41.36 ? 148 THR B O   1 
ATOM   2862 C CB  . THR B 1 110 ? 19.618  16.133  -34.193 1.00 41.70 ? 148 THR B CB  1 
ATOM   2863 O OG1 . THR B 1 110 ? 19.451  15.565  -32.881 1.00 39.44 ? 148 THR B OG1 1 
ATOM   2864 C CG2 . THR B 1 110 ? 19.045  15.201  -35.271 1.00 41.68 ? 148 THR B CG2 1 
ATOM   2865 N N   . LEU B 1 111 ? 21.358  18.642  -33.378 1.00 40.54 ? 149 LEU B N   1 
ATOM   2866 C CA  . LEU B 1 111 ? 21.780  19.550  -32.307 1.00 40.76 ? 149 LEU B CA  1 
ATOM   2867 C C   . LEU B 1 111 ? 21.374  19.060  -30.917 1.00 39.94 ? 149 LEU B C   1 
ATOM   2868 O O   . LEU B 1 111 ? 22.206  19.056  -29.998 1.00 40.78 ? 149 LEU B O   1 
ATOM   2869 C CB  . LEU B 1 111 ? 21.261  20.989  -32.528 1.00 40.86 ? 149 LEU B CB  1 
ATOM   2870 C CG  . LEU B 1 111 ? 21.487  21.962  -31.342 1.00 41.48 ? 149 LEU B CG  1 
ATOM   2871 C CD1 . LEU B 1 111 ? 22.996  22.208  -31.141 1.00 42.51 ? 149 LEU B CD1 1 
ATOM   2872 C CD2 . LEU B 1 111 ? 20.774  23.325  -31.553 1.00 40.75 ? 149 LEU B CD2 1 
ATOM   2873 N N   . LEU B 1 112 ? 20.113  18.667  -30.748 1.00 39.34 ? 150 LEU B N   1 
ATOM   2874 C CA  . LEU B 1 112 ? 19.606  18.318  -29.384 1.00 39.35 ? 150 LEU B CA  1 
ATOM   2875 C C   . LEU B 1 112 ? 20.193  17.026  -28.860 1.00 38.55 ? 150 LEU B C   1 
ATOM   2876 O O   . LEU B 1 112 ? 20.530  16.933  -27.674 1.00 39.40 ? 150 LEU B O   1 
ATOM   2877 C CB  . LEU B 1 112 ? 18.066  18.312  -29.290 1.00 39.33 ? 150 LEU B CB  1 
ATOM   2878 C CG  . LEU B 1 112 ? 17.336  19.665  -29.442 1.00 39.89 ? 150 LEU B CG  1 
ATOM   2879 C CD1 . LEU B 1 112 ? 15.861  19.479  -29.317 1.00 43.67 ? 150 LEU B CD1 1 
ATOM   2880 C CD2 . LEU B 1 112 ? 17.773  20.682  -28.397 1.00 43.75 ? 150 LEU B CD2 1 
ATOM   2881 N N   . GLY B 1 113 ? 20.363  16.033  -29.724 1.00 37.80 ? 151 GLY B N   1 
ATOM   2882 C CA  . GLY B 1 113 ? 21.029  14.804  -29.298 1.00 37.68 ? 151 GLY B CA  1 
ATOM   2883 C C   . GLY B 1 113 ? 22.502  15.027  -28.979 1.00 38.01 ? 151 GLY B C   1 
ATOM   2884 O O   . GLY B 1 113 ? 23.036  14.439  -28.039 1.00 37.88 ? 151 GLY B O   1 
ATOM   2885 N N   . TYR B 1 114 ? 23.159  15.851  -29.795 1.00 38.05 ? 152 TYR B N   1 
ATOM   2886 C CA  . TYR B 1 114 ? 24.562  16.229  -29.629 1.00 38.52 ? 152 TYR B CA  1 
ATOM   2887 C C   . TYR B 1 114 ? 24.817  16.937  -28.289 1.00 38.79 ? 152 TYR B C   1 
ATOM   2888 O O   . TYR B 1 114 ? 25.801  16.640  -27.612 1.00 37.62 ? 152 TYR B O   1 
ATOM   2889 C CB  . TYR B 1 114 ? 24.966  17.144  -30.781 1.00 38.82 ? 152 TYR B CB  1 
ATOM   2890 C CG  . TYR B 1 114 ? 26.436  17.511  -30.803 1.00 41.23 ? 152 TYR B CG  1 
ATOM   2891 C CD1 . TYR B 1 114 ? 26.923  18.602  -30.067 1.00 40.60 ? 152 TYR B CD1 1 
ATOM   2892 C CD2 . TYR B 1 114 ? 27.345  16.794  -31.611 1.00 44.03 ? 152 TYR B CD2 1 
ATOM   2893 C CE1 . TYR B 1 114 ? 28.288  18.951  -30.109 1.00 41.05 ? 152 TYR B CE1 1 
ATOM   2894 C CE2 . TYR B 1 114 ? 28.704  17.137  -31.655 1.00 43.37 ? 152 TYR B CE2 1 
ATOM   2895 C CZ  . TYR B 1 114 ? 29.161  18.204  -30.902 1.00 41.30 ? 152 TYR B CZ  1 
ATOM   2896 O OH  . TYR B 1 114 ? 30.489  18.528  -30.964 1.00 41.45 ? 152 TYR B OH  1 
ATOM   2897 N N   . LEU B 1 115 ? 23.926  17.876  -27.932 1.00 39.22 ? 153 LEU B N   1 
ATOM   2898 C CA  . LEU B 1 115 ? 23.971  18.591  -26.648 1.00 39.95 ? 153 LEU B CA  1 
ATOM   2899 C C   . LEU B 1 115 ? 23.987  17.606  -25.477 1.00 40.38 ? 153 LEU B C   1 
ATOM   2900 O O   . LEU B 1 115 ? 24.773  17.754  -24.540 1.00 40.30 ? 153 LEU B O   1 
ATOM   2901 C CB  . LEU B 1 115 ? 22.745  19.494  -26.471 1.00 39.30 ? 153 LEU B CB  1 
ATOM   2902 C CG  . LEU B 1 115 ? 22.703  20.743  -27.370 1.00 40.66 ? 153 LEU B CG  1 
ATOM   2903 C CD1 . LEU B 1 115 ? 21.603  21.694  -26.997 1.00 39.35 ? 153 LEU B CD1 1 
ATOM   2904 C CD2 . LEU B 1 115 ? 24.032  21.437  -27.438 1.00 38.15 ? 153 LEU B CD2 1 
ATOM   2905 N N   . ALA B 1 116 ? 23.151  16.578  -25.580 1.00 40.18 ? 154 ALA B N   1 
ATOM   2906 C CA  . ALA B 1 116 ? 22.796  15.731  -24.440 1.00 40.24 ? 154 ALA B CA  1 
ATOM   2907 C C   . ALA B 1 116 ? 23.547  14.429  -24.371 1.00 40.54 ? 154 ALA B C   1 
ATOM   2908 O O   . ALA B 1 116 ? 23.518  13.755  -23.322 1.00 41.11 ? 154 ALA B O   1 
ATOM   2909 C CB  . ALA B 1 116 ? 21.333  15.455  -24.477 1.00 38.73 ? 154 ALA B CB  1 
ATOM   2910 N N   . ASP B 1 117 ? 24.177  14.043  -25.489 1.00 40.33 ? 155 ASP B N   1 
ATOM   2911 C CA  . ASP B 1 117 ? 24.888  12.768  -25.591 1.00 40.20 ? 155 ASP B CA  1 
ATOM   2912 C C   . ASP B 1 117 ? 25.752  12.436  -24.373 1.00 40.25 ? 155 ASP B C   1 
ATOM   2913 O O   . ASP B 1 117 ? 26.722  13.129  -24.069 1.00 38.85 ? 155 ASP B O   1 
ATOM   2914 C CB  . ASP B 1 117 ? 25.763  12.774  -26.838 1.00 40.46 ? 155 ASP B CB  1 
ATOM   2915 C CG  . ASP B 1 117 ? 26.316  11.387  -27.177 1.00 43.76 ? 155 ASP B CG  1 
ATOM   2916 O OD1 . ASP B 1 117 ? 27.294  11.334  -27.952 1.00 49.60 ? 155 ASP B OD1 1 
ATOM   2917 O OD2 . ASP B 1 117 ? 25.791  10.351  -26.681 1.00 43.58 ? 155 ASP B OD2 1 
ATOM   2918 N N   . ASP B 1 118 ? 25.415  11.347  -23.709 1.00 40.97 ? 156 ASP B N   1 
ATOM   2919 C CA  . ASP B 1 118 ? 26.218  10.833  -22.587 1.00 42.46 ? 156 ASP B CA  1 
ATOM   2920 C C   . ASP B 1 118 ? 26.289  11.716  -21.344 1.00 41.41 ? 156 ASP B C   1 
ATOM   2921 O O   . ASP B 1 118 ? 27.163  11.507  -20.500 1.00 41.71 ? 156 ASP B O   1 
ATOM   2922 C CB  . ASP B 1 118 ? 27.651  10.535  -23.025 1.00 43.61 ? 156 ASP B CB  1 
ATOM   2923 C CG  . ASP B 1 118 ? 27.867  9.067   -23.324 1.00 51.22 ? 156 ASP B CG  1 
ATOM   2924 O OD1 . ASP B 1 118 ? 27.210  8.211   -22.644 1.00 57.03 ? 156 ASP B OD1 1 
ATOM   2925 O OD2 . ASP B 1 118 ? 28.695  8.771   -24.235 1.00 57.24 ? 156 ASP B OD2 1 
ATOM   2926 N N   . LEU B 1 119 ? 25.410  12.700  -21.231 1.00 39.31 ? 157 LEU B N   1 
ATOM   2927 C CA  . LEU B 1 119 ? 25.401  13.533  -20.039 1.00 39.79 ? 157 LEU B CA  1 
ATOM   2928 C C   . LEU B 1 119 ? 24.271  13.083  -19.104 1.00 38.64 ? 157 LEU B C   1 
ATOM   2929 O O   . LEU B 1 119 ? 23.293  12.483  -19.540 1.00 37.33 ? 157 LEU B O   1 
ATOM   2930 C CB  . LEU B 1 119 ? 25.232  15.025  -20.412 1.00 39.90 ? 157 LEU B CB  1 
ATOM   2931 C CG  . LEU B 1 119 ? 26.333  15.598  -21.331 1.00 38.69 ? 157 LEU B CG  1 
ATOM   2932 C CD1 . LEU B 1 119 ? 26.075  17.044  -21.681 1.00 35.31 ? 157 LEU B CD1 1 
ATOM   2933 C CD2 . LEU B 1 119 ? 27.720  15.436  -20.675 1.00 38.50 ? 157 LEU B CD2 1 
ATOM   2934 N N   . THR B 1 120 ? 24.436  13.376  -17.820 1.00 39.09 ? 158 THR B N   1 
ATOM   2935 C CA  . THR B 1 120 ? 23.375  13.213  -16.837 1.00 39.24 ? 158 THR B CA  1 
ATOM   2936 C C   . THR B 1 120 ? 23.055  14.572  -16.230 1.00 39.29 ? 158 THR B C   1 
ATOM   2937 O O   . THR B 1 120 ? 23.965  15.399  -16.044 1.00 40.31 ? 158 THR B O   1 
ATOM   2938 C CB  . THR B 1 120 ? 23.789  12.222  -15.761 1.00 40.15 ? 158 THR B CB  1 
ATOM   2939 O OG1 . THR B 1 120 ? 24.072  10.952  -16.396 1.00 41.49 ? 158 THR B OG1 1 
ATOM   2940 C CG2 . THR B 1 120 ? 22.642  12.035  -14.723 1.00 40.39 ? 158 THR B CG2 1 
ATOM   2941 N N   . TRP B 1 121 ? 21.774  14.820  -15.933 1.00 38.09 ? 159 TRP B N   1 
ATOM   2942 C CA  . TRP B 1 121 ? 21.381  16.055  -15.293 1.00 38.12 ? 159 TRP B CA  1 
ATOM   2943 C C   . TRP B 1 121 ? 20.084  15.902  -14.476 1.00 39.71 ? 159 TRP B C   1 
ATOM   2944 O O   . TRP B 1 121 ? 19.205  15.108  -14.826 1.00 38.83 ? 159 TRP B O   1 
ATOM   2945 C CB  . TRP B 1 121 ? 21.286  17.234  -16.300 1.00 37.90 ? 159 TRP B CB  1 
ATOM   2946 C CG  . TRP B 1 121 ? 20.170  17.059  -17.283 1.00 39.72 ? 159 TRP B CG  1 
ATOM   2947 C CD1 . TRP B 1 121 ? 18.891  17.493  -17.164 1.00 38.61 ? 159 TRP B CD1 1 
ATOM   2948 C CD2 . TRP B 1 121 ? 20.244  16.325  -18.509 1.00 40.11 ? 159 TRP B CD2 1 
ATOM   2949 N NE1 . TRP B 1 121 ? 18.139  17.074  -18.265 1.00 38.53 ? 159 TRP B NE1 1 
ATOM   2950 C CE2 . TRP B 1 121 ? 18.960  16.370  -19.107 1.00 38.49 ? 159 TRP B CE2 1 
ATOM   2951 C CE3 . TRP B 1 121 ? 21.293  15.648  -19.176 1.00 38.58 ? 159 TRP B CE3 1 
ATOM   2952 C CZ2 . TRP B 1 121 ? 18.678  15.749  -20.349 1.00 39.91 ? 159 TRP B CZ2 1 
ATOM   2953 C CZ3 . TRP B 1 121 ? 21.012  15.037  -20.410 1.00 38.14 ? 159 TRP B CZ3 1 
ATOM   2954 C CH2 . TRP B 1 121 ? 19.711  15.070  -20.963 1.00 39.24 ? 159 TRP B CH2 1 
ATOM   2955 N N   . CYS B 1 122 ? 19.976  16.684  -13.387 1.00 41.68 ? 160 CYS B N   1 
ATOM   2956 C CA  . CYS B 1 122 ? 18.723  16.859  -12.646 1.00 41.52 ? 160 CYS B CA  1 
ATOM   2957 C C   . CYS B 1 122 ? 18.817  18.088  -11.730 1.00 41.19 ? 160 CYS B C   1 
ATOM   2958 O O   . CYS B 1 122 ? 19.918  18.553  -11.405 1.00 41.04 ? 160 CYS B O   1 
ATOM   2959 C CB  . CYS B 1 122 ? 18.340  15.620  -11.819 1.00 41.85 ? 160 CYS B CB  1 
ATOM   2960 S SG  . CYS B 1 122 ? 19.477  15.156  -10.556 1.00 47.28 ? 160 CYS B SG  1 
ATOM   2961 N N   . GLY B 1 123 ? 17.652  18.593  -11.328 1.00 40.57 ? 161 GLY B N   1 
ATOM   2962 C CA  . GLY B 1 123 ? 17.571  19.652  -10.358 1.00 42.10 ? 161 GLY B CA  1 
ATOM   2963 C C   . GLY B 1 123 ? 16.972  19.161  -9.063  1.00 43.13 ? 161 GLY B C   1 
ATOM   2964 O O   . GLY B 1 123 ? 17.149  18.010  -8.673  1.00 43.37 ? 161 GLY B O   1 
ATOM   2965 N N   . GLU B 1 124 ? 16.200  20.026  -8.421  1.00 45.17 ? 162 GLU B N   1 
ATOM   2966 C CA  . GLU B 1 124 ? 15.646  19.764  -7.084  1.00 46.79 ? 162 GLU B CA  1 
ATOM   2967 C C   . GLU B 1 124 ? 14.439  20.611  -6.984  1.00 47.05 ? 162 GLU B C   1 
ATOM   2968 O O   . GLU B 1 124 ? 14.516  21.762  -7.402  1.00 47.44 ? 162 GLU B O   1 
ATOM   2969 C CB  . GLU B 1 124 ? 16.637  20.193  -6.032  1.00 47.85 ? 162 GLU B CB  1 
ATOM   2970 C CG  . GLU B 1 124 ? 18.009  19.576  -6.247  1.00 51.22 ? 162 GLU B CG  1 
ATOM   2971 C CD  . GLU B 1 124 ? 19.093  20.331  -5.526  1.00 58.46 ? 162 GLU B CD  1 
ATOM   2972 O OE1 . GLU B 1 124 ? 20.270  20.286  -5.988  1.00 60.64 ? 162 GLU B OE1 1 
ATOM   2973 O OE2 . GLU B 1 124 ? 18.764  20.985  -4.512  1.00 58.96 ? 162 GLU B OE2 1 
ATOM   2974 N N   . PHE B 1 125 ? 13.315  20.079  -6.485  1.00 46.88 ? 163 PHE B N   1 
ATOM   2975 C CA  . PHE B 1 125 ? 12.100  20.895  -6.520  1.00 48.40 ? 163 PHE B CA  1 
ATOM   2976 C C   . PHE B 1 125 ? 12.344  22.092  -5.592  1.00 48.76 ? 163 PHE B C   1 
ATOM   2977 O O   . PHE B 1 125 ? 11.967  23.212  -5.895  1.00 49.40 ? 163 PHE B O   1 
ATOM   2978 C CB  . PHE B 1 125 ? 10.795  20.114  -6.199  1.00 47.92 ? 163 PHE B CB  1 
ATOM   2979 C CG  . PHE B 1 125 ? 10.498  20.016  -4.757  1.00 48.51 ? 163 PHE B CG  1 
ATOM   2980 C CD1 . PHE B 1 125 ? 9.490   20.777  -4.199  1.00 48.24 ? 163 PHE B CD1 1 
ATOM   2981 C CD2 . PHE B 1 125 ? 11.257  19.188  -3.941  1.00 51.28 ? 163 PHE B CD2 1 
ATOM   2982 C CE1 . PHE B 1 125 ? 9.228   20.718  -2.842  1.00 50.48 ? 163 PHE B CE1 1 
ATOM   2983 C CE2 . PHE B 1 125 ? 11.003  19.111  -2.550  1.00 52.36 ? 163 PHE B CE2 1 
ATOM   2984 C CZ  . PHE B 1 125 ? 9.985   19.885  -2.006  1.00 50.19 ? 163 PHE B CZ  1 
ATOM   2985 N N   . ASP B 1 126 ? 13.042  21.825  -4.498  1.00 49.65 ? 164 ASP B N   1 
ATOM   2986 C CA  . ASP B 1 126 ? 13.375  22.795  -3.470  1.00 52.02 ? 164 ASP B CA  1 
ATOM   2987 C C   . ASP B 1 126 ? 13.834  24.208  -3.938  1.00 52.05 ? 164 ASP B C   1 
ATOM   2988 O O   . ASP B 1 126 ? 13.669  25.197  -3.209  1.00 52.86 ? 164 ASP B O   1 
ATOM   2989 C CB  . ASP B 1 126 ? 14.558  22.224  -2.686  1.00 52.42 ? 164 ASP B CB  1 
ATOM   2990 C CG  . ASP B 1 126 ? 14.246  20.925  -2.004  1.00 55.19 ? 164 ASP B CG  1 
ATOM   2991 O OD1 . ASP B 1 126 ? 13.507  20.955  -0.987  1.00 55.66 ? 164 ASP B OD1 1 
ATOM   2992 O OD2 . ASP B 1 126 ? 14.788  19.884  -2.463  1.00 58.80 ? 164 ASP B OD2 1 
ATOM   2993 N N   . THR B 1 127 ? 14.454  24.278  -5.116  1.00 51.22 ? 165 THR B N   1 
ATOM   2994 C CA  . THR B 1 127 ? 15.548  25.219  -5.317  1.00 50.89 ? 165 THR B CA  1 
ATOM   2995 C C   . THR B 1 127 ? 15.930  25.325  -6.771  1.00 49.54 ? 165 THR B C   1 
ATOM   2996 O O   . THR B 1 127 ? 15.479  24.535  -7.577  1.00 49.59 ? 165 THR B O   1 
ATOM   2997 C CB  . THR B 1 127 ? 16.809  24.749  -4.551  1.00 51.10 ? 165 THR B CB  1 
ATOM   2998 O OG1 . THR B 1 127 ? 17.781  25.783  -4.585  1.00 56.22 ? 165 THR B OG1 1 
ATOM   2999 C CG2 . THR B 1 127 ? 17.448  23.558  -5.207  1.00 50.41 ? 165 THR B CG2 1 
ATOM   3000 N N   . SER B 1 128 ? 16.779  26.292  -7.104  1.00 48.38 ? 166 SER B N   1 
ATOM   3001 C CA  . SER B 1 128 ? 17.234  26.451  -8.497  1.00 47.73 ? 166 SER B CA  1 
ATOM   3002 C C   . SER B 1 128 ? 18.578  25.751  -8.738  1.00 46.85 ? 166 SER B C   1 
ATOM   3003 O O   . SER B 1 128 ? 19.188  25.911  -9.785  1.00 47.15 ? 166 SER B O   1 
ATOM   3004 C CB  . SER B 1 128 ? 17.350  27.933  -8.850  1.00 47.65 ? 166 SER B CB  1 
ATOM   3005 O OG  . SER B 1 128 ? 18.179  28.556  -7.885  1.00 47.34 ? 166 SER B OG  1 
ATOM   3006 N N   . LYS B 1 129 ? 19.038  24.986  -7.764  1.00 45.75 ? 167 LYS B N   1 
ATOM   3007 C CA  . LYS B 1 129 ? 20.318  24.339  -7.885  1.00 45.81 ? 167 LYS B CA  1 
ATOM   3008 C C   . LYS B 1 129 ? 20.284  23.075  -8.760  1.00 44.75 ? 167 LYS B C   1 
ATOM   3009 O O   . LYS B 1 129 ? 19.307  22.320  -8.735  1.00 44.42 ? 167 LYS B O   1 
ATOM   3010 C CB  . LYS B 1 129 ? 20.909  24.039  -6.489  1.00 46.11 ? 167 LYS B CB  1 
ATOM   3011 C CG  . LYS B 1 129 ? 21.495  25.313  -5.818  1.00 49.65 ? 167 LYS B CG  1 
ATOM   3012 C CD  . LYS B 1 129 ? 22.791  25.060  -4.997  1.00 56.37 ? 167 LYS B CD  1 
ATOM   3013 C CE  . LYS B 1 129 ? 22.511  24.633  -3.533  1.00 59.45 ? 167 LYS B CE  1 
ATOM   3014 N NZ  . LYS B 1 129 ? 22.248  25.787  -2.587  1.00 60.27 ? 167 LYS B NZ  1 
ATOM   3015 N N   . ILE B 1 130 ? 21.361  22.867  -9.517  1.00 43.18 ? 168 ILE B N   1 
ATOM   3016 C CA  . ILE B 1 130 ? 21.616  21.587  -10.197 1.00 42.81 ? 168 ILE B CA  1 
ATOM   3017 C C   . ILE B 1 130 ? 22.136  20.589  -9.172  1.00 41.59 ? 168 ILE B C   1 
ATOM   3018 O O   . ILE B 1 130 ? 22.941  20.957  -8.329  1.00 41.24 ? 168 ILE B O   1 
ATOM   3019 C CB  . ILE B 1 130 ? 22.626  21.765  -11.356 1.00 42.74 ? 168 ILE B CB  1 
ATOM   3020 C CG1 . ILE B 1 130 ? 21.947  22.447  -12.533 1.00 42.89 ? 168 ILE B CG1 1 
ATOM   3021 C CG2 . ILE B 1 130 ? 23.257  20.445  -11.750 1.00 42.71 ? 168 ILE B CG2 1 
ATOM   3022 C CD1 . ILE B 1 130 ? 22.903  23.061  -13.517 1.00 45.59 ? 168 ILE B CD1 1 
ATOM   3023 N N   . ASN B 1 131 ? 21.660  19.341  -9.215  1.00 40.90 ? 169 ASN B N   1 
ATOM   3024 C CA  . ASN B 1 131 ? 22.115  18.319  -8.241  1.00 39.98 ? 169 ASN B CA  1 
ATOM   3025 C C   . ASN B 1 131 ? 23.304  17.566  -8.819  1.00 40.17 ? 169 ASN B C   1 
ATOM   3026 O O   . ASN B 1 131 ? 23.166  16.799  -9.770  1.00 40.40 ? 169 ASN B O   1 
ATOM   3027 C CB  . ASN B 1 131 ? 20.980  17.358  -7.916  1.00 39.18 ? 169 ASN B CB  1 
ATOM   3028 C CG  . ASN B 1 131 ? 21.315  16.396  -6.796  1.00 38.43 ? 169 ASN B CG  1 
ATOM   3029 O OD1 . ASN B 1 131 ? 22.471  16.136  -6.478  1.00 37.82 ? 169 ASN B OD1 1 
ATOM   3030 N ND2 . ASN B 1 131 ? 20.292  15.846  -6.209  1.00 36.32 ? 169 ASN B ND2 1 
ATOM   3031 N N   . TYR B 1 132 ? 24.490  17.820  -8.279  1.00 40.59 ? 170 TYR B N   1 
ATOM   3032 C CA  . TYR B 1 132 ? 25.681  17.224  -8.824  1.00 40.48 ? 170 TYR B CA  1 
ATOM   3033 C C   . TYR B 1 132 ? 26.051  15.931  -8.130  1.00 39.91 ? 170 TYR B C   1 
ATOM   3034 O O   . TYR B 1 132 ? 27.008  15.302  -8.501  1.00 39.66 ? 170 TYR B O   1 
ATOM   3035 C CB  . TYR B 1 132 ? 26.869  18.214  -8.784  1.00 40.71 ? 170 TYR B CB  1 
ATOM   3036 C CG  . TYR B 1 132 ? 26.760  19.344  -9.793  1.00 40.26 ? 170 TYR B CG  1 
ATOM   3037 C CD1 . TYR B 1 132 ? 26.320  20.604  -9.406  1.00 38.70 ? 170 TYR B CD1 1 
ATOM   3038 C CD2 . TYR B 1 132 ? 27.100  19.143  -11.134 1.00 40.04 ? 170 TYR B CD2 1 
ATOM   3039 C CE1 . TYR B 1 132 ? 26.237  21.653  -10.328 1.00 39.69 ? 170 TYR B CE1 1 
ATOM   3040 C CE2 . TYR B 1 132 ? 27.006  20.172  -12.077 1.00 40.70 ? 170 TYR B CE2 1 
ATOM   3041 C CZ  . TYR B 1 132 ? 26.561  21.423  -11.668 1.00 41.11 ? 170 TYR B CZ  1 
ATOM   3042 O OH  . TYR B 1 132 ? 26.459  22.433  -12.602 1.00 42.69 ? 170 TYR B OH  1 
ATOM   3043 N N   . GLN B 1 133 ? 25.281  15.533  -7.130  1.00 40.35 ? 171 GLN B N   1 
ATOM   3044 C CA  . GLN B 1 133 ? 25.624  14.362  -6.284  1.00 40.64 ? 171 GLN B CA  1 
ATOM   3045 C C   . GLN B 1 133 ? 24.930  13.061  -6.684  1.00 38.19 ? 171 GLN B C   1 
ATOM   3046 O O   . GLN B 1 133 ? 25.539  11.986  -6.664  1.00 36.67 ? 171 GLN B O   1 
ATOM   3047 C CB  . GLN B 1 133 ? 25.397  14.687  -4.790  1.00 40.74 ? 171 GLN B CB  1 
ATOM   3048 C CG  . GLN B 1 133 ? 26.283  15.871  -4.331  1.00 44.83 ? 171 GLN B CG  1 
ATOM   3049 C CD  . GLN B 1 133 ? 26.342  16.067  -2.799  1.00 47.45 ? 171 GLN B CD  1 
ATOM   3050 O OE1 . GLN B 1 133 ? 25.599  16.902  -2.254  1.00 57.03 ? 171 GLN B OE1 1 
ATOM   3051 N NE2 . GLN B 1 133 ? 27.219  15.299  -2.098  1.00 51.37 ? 171 GLN B NE2 1 
ATOM   3052 N N   . SER B 1 134 ? 23.639  13.151  -7.003  1.00 36.82 ? 172 SER B N   1 
ATOM   3053 C CA  . SER B 1 134 ? 22.918  12.013  -7.488  1.00 36.77 ? 172 SER B CA  1 
ATOM   3054 C C   . SER B 1 134 ? 21.673  12.467  -8.260  1.00 37.56 ? 172 SER B C   1 
ATOM   3055 O O   . SER B 1 134 ? 21.216  13.616  -8.108  1.00 36.48 ? 172 SER B O   1 
ATOM   3056 C CB  . SER B 1 134 ? 22.547  11.078  -6.322  1.00 36.76 ? 172 SER B CB  1 
ATOM   3057 O OG  . SER B 1 134 ? 21.565  11.696  -5.487  1.00 37.50 ? 172 SER B OG  1 
ATOM   3058 N N   . CYS B 1 135 ? 21.149  11.567  -9.095  1.00 38.15 ? 173 CYS B N   1 
ATOM   3059 C CA  . CYS B 1 135 ? 19.930  11.818  -9.887  1.00 38.57 ? 173 CYS B CA  1 
ATOM   3060 C C   . CYS B 1 135 ? 19.114  10.518  -9.929  1.00 38.91 ? 173 CYS B C   1 
ATOM   3061 O O   . CYS B 1 135 ? 19.672  9.421   -9.785  1.00 37.74 ? 173 CYS B O   1 
ATOM   3062 C CB  . CYS B 1 135 ? 20.259  12.297  -11.297 1.00 38.94 ? 173 CYS B CB  1 
ATOM   3063 S SG  . CYS B 1 135 ? 20.995  13.942  -11.434 1.00 43.16 ? 173 CYS B SG  1 
ATOM   3064 N N   . PRO B 1 136 ? 17.778  10.626  -10.092 1.00 39.59 ? 174 PRO B N   1 
ATOM   3065 C CA  . PRO B 1 136 ? 16.977  9.415   -10.026 1.00 40.06 ? 174 PRO B CA  1 
ATOM   3066 C C   . PRO B 1 136 ? 17.428  8.323   -11.020 1.00 40.38 ? 174 PRO B C   1 
ATOM   3067 O O   . PRO B 1 136 ? 17.749  8.603   -12.186 1.00 40.79 ? 174 PRO B O   1 
ATOM   3068 C CB  . PRO B 1 136 ? 15.554  9.904   -10.343 1.00 40.03 ? 174 PRO B CB  1 
ATOM   3069 C CG  . PRO B 1 136 ? 15.568  11.328  -9.922  1.00 38.77 ? 174 PRO B CG  1 
ATOM   3070 C CD  . PRO B 1 136 ? 16.951  11.828  -10.286 1.00 39.03 ? 174 PRO B CD  1 
ATOM   3071 N N   . ASP B 1 137 ? 17.516  7.102   -10.515 1.00 39.49 ? 175 ASP B N   1 
ATOM   3072 C CA  . ASP B 1 137 ? 17.777  5.958   -11.371 1.00 40.46 ? 175 ASP B CA  1 
ATOM   3073 C C   . ASP B 1 137 ? 16.449  5.524   -11.940 1.00 40.60 ? 175 ASP B C   1 
ATOM   3074 O O   . ASP B 1 137 ? 15.482  5.338   -11.223 1.00 39.88 ? 175 ASP B O   1 
ATOM   3075 C CB  . ASP B 1 137 ? 18.422  4.816   -10.602 1.00 39.53 ? 175 ASP B CB  1 
ATOM   3076 C CG  . ASP B 1 137 ? 18.635  3.602   -11.477 1.00 42.37 ? 175 ASP B CG  1 
ATOM   3077 O OD1 . ASP B 1 137 ? 17.790  2.697   -11.455 1.00 38.30 ? 175 ASP B OD1 1 
ATOM   3078 O OD2 . ASP B 1 137 ? 19.592  3.602   -12.263 1.00 44.83 ? 175 ASP B OD2 1 
ATOM   3079 N N   . TRP B 1 138 ? 16.417  5.406   -13.252 1.00 42.74 ? 176 TRP B N   1 
ATOM   3080 C CA  . TRP B 1 138 ? 15.238  5.012   -13.988 1.00 44.86 ? 176 TRP B CA  1 
ATOM   3081 C C   . TRP B 1 138 ? 14.441  3.879   -13.314 1.00 44.48 ? 176 TRP B C   1 
ATOM   3082 O O   . TRP B 1 138 ? 13.214  3.919   -13.252 1.00 45.27 ? 176 TRP B O   1 
ATOM   3083 C CB  . TRP B 1 138 ? 15.695  4.633   -15.403 1.00 48.02 ? 176 TRP B CB  1 
ATOM   3084 C CG  . TRP B 1 138 ? 14.830  3.655   -16.041 1.00 51.47 ? 176 TRP B CG  1 
ATOM   3085 C CD1 . TRP B 1 138 ? 14.932  2.280   -15.994 1.00 53.16 ? 176 TRP B CD1 1 
ATOM   3086 C CD2 . TRP B 1 138 ? 13.673  3.953   -16.796 1.00 53.71 ? 176 TRP B CD2 1 
ATOM   3087 N NE1 . TRP B 1 138 ? 13.890  1.710   -16.690 1.00 55.07 ? 176 TRP B NE1 1 
ATOM   3088 C CE2 . TRP B 1 138 ? 13.106  2.719   -17.199 1.00 55.01 ? 176 TRP B CE2 1 
ATOM   3089 C CE3 . TRP B 1 138 ? 13.059  5.150   -17.188 1.00 53.88 ? 176 TRP B CE3 1 
ATOM   3090 C CZ2 . TRP B 1 138 ? 11.954  2.655   -17.980 1.00 53.73 ? 176 TRP B CZ2 1 
ATOM   3091 C CZ3 . TRP B 1 138 ? 11.923  5.088   -17.959 1.00 53.48 ? 176 TRP B CZ3 1 
ATOM   3092 C CH2 . TRP B 1 138 ? 11.373  3.849   -18.342 1.00 53.43 ? 176 TRP B CH2 1 
ATOM   3093 N N   . ARG B 1 139 ? 15.132  2.877   -12.791 1.00 43.81 ? 177 ARG B N   1 
ATOM   3094 C CA  . ARG B 1 139 ? 14.483  1.698   -12.278 1.00 43.80 ? 177 ARG B CA  1 
ATOM   3095 C C   . ARG B 1 139 ? 14.277  1.715   -10.764 1.00 43.26 ? 177 ARG B C   1 
ATOM   3096 O O   . ARG B 1 139 ? 13.225  1.290   -10.271 1.00 43.27 ? 177 ARG B O   1 
ATOM   3097 C CB  . ARG B 1 139 ? 15.299  0.471   -12.656 1.00 44.30 ? 177 ARG B CB  1 
ATOM   3098 C CG  . ARG B 1 139 ? 14.525  -0.552  -13.408 1.00 48.21 ? 177 ARG B CG  1 
ATOM   3099 C CD  . ARG B 1 139 ? 15.477  -1.564  -14.045 1.00 55.40 ? 177 ARG B CD  1 
ATOM   3100 N NE  . ARG B 1 139 ? 15.414  -2.890  -13.419 1.00 58.11 ? 177 ARG B NE  1 
ATOM   3101 C CZ  . ARG B 1 139 ? 15.969  -3.216  -12.244 1.00 61.38 ? 177 ARG B CZ  1 
ATOM   3102 N NH1 . ARG B 1 139 ? 16.635  -2.307  -11.520 1.00 61.87 ? 177 ARG B NH1 1 
ATOM   3103 N NH2 . ARG B 1 139 ? 15.853  -4.464  -11.780 1.00 60.30 ? 177 ARG B NH2 1 
ATOM   3104 N N   . LYS B 1 140 ? 15.284  2.161   -10.018 1.00 41.70 ? 178 LYS B N   1 
ATOM   3105 C CA  . LYS B 1 140 ? 15.213  2.108   -8.566  1.00 41.06 ? 178 LYS B CA  1 
ATOM   3106 C C   . LYS B 1 140 ? 14.464  3.323   -8.017  1.00 39.37 ? 178 LYS B C   1 
ATOM   3107 O O   . LYS B 1 140 ? 13.884  3.248   -6.941  1.00 38.34 ? 178 LYS B O   1 
ATOM   3108 C CB  . LYS B 1 140 ? 16.612  2.013   -7.929  1.00 41.25 ? 178 LYS B CB  1 
ATOM   3109 C CG  . LYS B 1 140 ? 17.503  0.898   -8.478  1.00 42.65 ? 178 LYS B CG  1 
ATOM   3110 C CD  . LYS B 1 140 ? 18.736  0.645   -7.593  1.00 43.78 ? 178 LYS B CD  1 
ATOM   3111 C CE  . LYS B 1 140 ? 19.912  0.014   -8.396  1.00 48.72 ? 178 LYS B CE  1 
ATOM   3112 N NZ  . LYS B 1 140 ? 20.549  0.982   -9.393  1.00 50.17 ? 178 LYS B NZ  1 
ATOM   3113 N N   . ASP B 1 141 ? 14.458  4.430   -8.759  1.00 38.02 ? 179 ASP B N   1 
ATOM   3114 C CA  . ASP B 1 141 ? 13.875  5.662   -8.228  1.00 37.68 ? 179 ASP B CA  1 
ATOM   3115 C C   . ASP B 1 141 ? 12.568  6.020   -8.914  1.00 37.63 ? 179 ASP B C   1 
ATOM   3116 O O   . ASP B 1 141 ? 11.523  5.868   -8.317  1.00 37.45 ? 179 ASP B O   1 
ATOM   3117 C CB  . ASP B 1 141 ? 14.860  6.825   -8.291  1.00 36.85 ? 179 ASP B CB  1 
ATOM   3118 C CG  . ASP B 1 141 ? 16.085  6.602   -7.414  1.00 38.01 ? 179 ASP B CG  1 
ATOM   3119 O OD1 . ASP B 1 141 ? 15.935  6.138   -6.273  1.00 40.10 ? 179 ASP B OD1 1 
ATOM   3120 O OD2 . ASP B 1 141 ? 17.197  6.897   -7.858  1.00 36.09 ? 179 ASP B OD2 1 
ATOM   3121 N N   . CYS B 1 142 ? 12.636  6.501   -10.155 1.00 38.12 ? 180 CYS B N   1 
ATOM   3122 C CA  . CYS B 1 142 ? 11.439  6.872   -10.906 1.00 39.33 ? 180 CYS B CA  1 
ATOM   3123 C C   . CYS B 1 142 ? 11.778  7.072   -12.382 1.00 37.96 ? 180 CYS B C   1 
ATOM   3124 O O   . CYS B 1 142 ? 12.903  7.448   -12.740 1.00 37.03 ? 180 CYS B O   1 
ATOM   3125 C CB  . CYS B 1 142 ? 10.862  8.157   -10.312 1.00 39.64 ? 180 CYS B CB  1 
ATOM   3126 S SG  . CYS B 1 142 ? 12.037  9.528   -10.401 1.00 47.22 ? 180 CYS B SG  1 
ATOM   3127 N N   . SER B 1 143 ? 10.812  6.815   -13.249 1.00 37.47 ? 181 SER B N   1 
ATOM   3128 C CA  . SER B 1 143 ? 11.106  6.861   -14.671 1.00 37.79 ? 181 SER B CA  1 
ATOM   3129 C C   . SER B 1 143 ? 10.902  8.244   -15.267 1.00 37.51 ? 181 SER B C   1 
ATOM   3130 O O   . SER B 1 143 ? 11.445  8.551   -16.322 1.00 37.16 ? 181 SER B O   1 
ATOM   3131 C CB  . SER B 1 143 ? 10.276  5.816   -15.403 1.00 38.85 ? 181 SER B CB  1 
ATOM   3132 O OG  . SER B 1 143 ? 8.904   6.042   -15.190 1.00 42.52 ? 181 SER B OG  1 
ATOM   3133 N N   . ASN B 1 144 ? 10.140  9.100   -14.597 1.00 37.79 ? 182 ASN B N   1 
ATOM   3134 C CA  . ASN B 1 144 ? 9.886   10.440  -15.137 1.00 37.66 ? 182 ASN B CA  1 
ATOM   3135 C C   . ASN B 1 144 ? 10.919  11.459  -14.698 1.00 38.21 ? 182 ASN B C   1 
ATOM   3136 O O   . ASN B 1 144 ? 10.571  12.514  -14.155 1.00 39.21 ? 182 ASN B O   1 
ATOM   3137 C CB  . ASN B 1 144 ? 8.479   10.905  -14.793 1.00 37.64 ? 182 ASN B CB  1 
ATOM   3138 C CG  . ASN B 1 144 ? 7.441   10.064  -15.456 1.00 38.80 ? 182 ASN B CG  1 
ATOM   3139 O OD1 . ASN B 1 144 ? 7.604   9.639   -16.611 1.00 40.01 ? 182 ASN B OD1 1 
ATOM   3140 N ND2 . ASN B 1 144 ? 6.367   9.803   -14.746 1.00 36.35 ? 182 ASN B ND2 1 
ATOM   3141 N N   . ASN B 1 145 ? 12.185  11.145  -14.962 1.00 37.06 ? 183 ASN B N   1 
ATOM   3142 C CA  . ASN B 1 145 ? 13.296  11.971  -14.568 1.00 38.19 ? 183 ASN B CA  1 
ATOM   3143 C C   . ASN B 1 145 ? 13.808  12.806  -15.759 1.00 37.66 ? 183 ASN B C   1 
ATOM   3144 O O   . ASN B 1 145 ? 13.479  12.494  -16.909 1.00 37.62 ? 183 ASN B O   1 
ATOM   3145 C CB  . ASN B 1 145 ? 14.395  11.108  -13.949 1.00 36.79 ? 183 ASN B CB  1 
ATOM   3146 C CG  . ASN B 1 145 ? 14.907  10.026  -14.901 1.00 38.71 ? 183 ASN B CG  1 
ATOM   3147 O OD1 . ASN B 1 145 ? 14.599  8.832   -14.741 1.00 41.60 ? 183 ASN B OD1 1 
ATOM   3148 N ND2 . ASN B 1 145 ? 15.655  10.425  -15.888 1.00 34.89 ? 183 ASN B ND2 1 
ATOM   3149 N N   . PRO B 1 146 ? 14.592  13.862  -15.486 1.00 38.21 ? 184 PRO B N   1 
ATOM   3150 C CA  . PRO B 1 146 ? 15.023  14.794  -16.523 1.00 38.03 ? 184 PRO B CA  1 
ATOM   3151 C C   . PRO B 1 146 ? 15.704  14.129  -17.751 1.00 38.90 ? 184 PRO B C   1 
ATOM   3152 O O   . PRO B 1 146 ? 15.369  14.431  -18.889 1.00 37.71 ? 184 PRO B O   1 
ATOM   3153 C CB  . PRO B 1 146 ? 15.962  15.737  -15.767 1.00 38.21 ? 184 PRO B CB  1 
ATOM   3154 C CG  . PRO B 1 146 ? 15.359  15.719  -14.333 1.00 38.73 ? 184 PRO B CG  1 
ATOM   3155 C CD  . PRO B 1 146 ? 15.073  14.277  -14.146 1.00 37.26 ? 184 PRO B CD  1 
ATOM   3156 N N   . VAL B 1 147 ? 16.602  13.202  -17.510 1.00 40.38 ? 185 VAL B N   1 
ATOM   3157 C CA  . VAL B 1 147 ? 17.286  12.506  -18.592 1.00 41.02 ? 185 VAL B CA  1 
ATOM   3158 C C   . VAL B 1 147 ? 16.343  11.603  -19.406 1.00 40.42 ? 185 VAL B C   1 
ATOM   3159 O O   . VAL B 1 147 ? 16.298  11.738  -20.595 1.00 40.62 ? 185 VAL B O   1 
ATOM   3160 C CB  . VAL B 1 147 ? 18.497  11.738  -18.060 1.00 41.32 ? 185 VAL B CB  1 
ATOM   3161 C CG1 . VAL B 1 147 ? 19.125  10.818  -19.158 1.00 41.42 ? 185 VAL B CG1 1 
ATOM   3162 C CG2 . VAL B 1 147 ? 19.513  12.722  -17.522 1.00 41.10 ? 185 VAL B CG2 1 
ATOM   3163 N N   . SER B 1 148 ? 15.626  10.687  -18.756 1.00 40.45 ? 186 SER B N   1 
ATOM   3164 C CA  . SER B 1 148 ? 14.706  9.759   -19.418 1.00 40.25 ? 186 SER B CA  1 
ATOM   3165 C C   . SER B 1 148 ? 13.688  10.499  -20.243 1.00 40.17 ? 186 SER B C   1 
ATOM   3166 O O   . SER B 1 148 ? 13.410  10.118  -21.385 1.00 40.74 ? 186 SER B O   1 
ATOM   3167 C CB  . SER B 1 148 ? 13.954  8.897   -18.419 1.00 39.21 ? 186 SER B CB  1 
ATOM   3168 O OG  . SER B 1 148 ? 14.824  8.006   -17.736 1.00 43.01 ? 186 SER B OG  1 
ATOM   3169 N N   . VAL B 1 149 ? 13.118  11.557  -19.659 1.00 39.46 ? 187 VAL B N   1 
ATOM   3170 C CA  . VAL B 1 149 ? 12.008  12.237  -20.282 1.00 38.65 ? 187 VAL B CA  1 
ATOM   3171 C C   . VAL B 1 149 ? 12.537  12.975  -21.486 1.00 38.21 ? 187 VAL B C   1 
ATOM   3172 O O   . VAL B 1 149 ? 11.871  13.032  -22.525 1.00 38.68 ? 187 VAL B O   1 
ATOM   3173 C CB  . VAL B 1 149 ? 11.230  13.118  -19.282 1.00 37.90 ? 187 VAL B CB  1 
ATOM   3174 C CG1 . VAL B 1 149 ? 10.222  14.025  -20.010 1.00 37.72 ? 187 VAL B CG1 1 
ATOM   3175 C CG2 . VAL B 1 149 ? 10.498  12.218  -18.292 1.00 35.69 ? 187 VAL B CG2 1 
ATOM   3176 N N   . PHE B 1 150 ? 13.758  13.490  -21.362 1.00 38.79 ? 188 PHE B N   1 
ATOM   3177 C CA  . PHE B 1 150 ? 14.399  14.161  -22.506 1.00 39.27 ? 188 PHE B CA  1 
ATOM   3178 C C   . PHE B 1 150 ? 14.522  13.240  -23.726 1.00 38.81 ? 188 PHE B C   1 
ATOM   3179 O O   . PHE B 1 150 ? 14.112  13.590  -24.829 1.00 39.52 ? 188 PHE B O   1 
ATOM   3180 C CB  . PHE B 1 150 ? 15.802  14.667  -22.137 1.00 39.23 ? 188 PHE B CB  1 
ATOM   3181 C CG  . PHE B 1 150 ? 16.561  15.182  -23.330 1.00 38.94 ? 188 PHE B CG  1 
ATOM   3182 C CD1 . PHE B 1 150 ? 16.345  16.473  -23.800 1.00 41.32 ? 188 PHE B CD1 1 
ATOM   3183 C CD2 . PHE B 1 150 ? 17.468  14.371  -23.992 1.00 40.81 ? 188 PHE B CD2 1 
ATOM   3184 C CE1 . PHE B 1 150 ? 17.040  16.959  -24.925 1.00 43.01 ? 188 PHE B CE1 1 
ATOM   3185 C CE2 . PHE B 1 150 ? 18.146  14.836  -25.116 1.00 40.04 ? 188 PHE B CE2 1 
ATOM   3186 C CZ  . PHE B 1 150 ? 17.921  16.144  -25.584 1.00 41.04 ? 188 PHE B CZ  1 
ATOM   3187 N N   . TRP B 1 151 ? 15.103  12.069  -23.501 1.00 38.87 ? 189 TRP B N   1 
ATOM   3188 C CA  . TRP B 1 151 ? 15.370  11.115  -24.561 1.00 39.03 ? 189 TRP B CA  1 
ATOM   3189 C C   . TRP B 1 151 ? 14.078  10.549  -25.158 1.00 39.74 ? 189 TRP B C   1 
ATOM   3190 O O   . TRP B 1 151 ? 13.993  10.376  -26.359 1.00 38.77 ? 189 TRP B O   1 
ATOM   3191 C CB  . TRP B 1 151 ? 16.327  10.009  -24.094 1.00 38.54 ? 189 TRP B CB  1 
ATOM   3192 C CG  . TRP B 1 151 ? 17.748  10.517  -23.980 1.00 38.96 ? 189 TRP B CG  1 
ATOM   3193 C CD1 . TRP B 1 151 ? 18.488  10.659  -22.829 1.00 39.96 ? 189 TRP B CD1 1 
ATOM   3194 C CD2 . TRP B 1 151 ? 18.590  10.996  -25.052 1.00 40.20 ? 189 TRP B CD2 1 
ATOM   3195 N NE1 . TRP B 1 151 ? 19.740  11.167  -23.121 1.00 39.50 ? 189 TRP B NE1 1 
ATOM   3196 C CE2 . TRP B 1 151 ? 19.819  11.407  -24.470 1.00 38.77 ? 189 TRP B CE2 1 
ATOM   3197 C CE3 . TRP B 1 151 ? 18.414  11.137  -26.442 1.00 39.46 ? 189 TRP B CE3 1 
ATOM   3198 C CZ2 . TRP B 1 151 ? 20.881  11.930  -25.228 1.00 39.85 ? 189 TRP B CZ2 1 
ATOM   3199 C CZ3 . TRP B 1 151 ? 19.482  11.681  -27.208 1.00 39.71 ? 189 TRP B CZ3 1 
ATOM   3200 C CH2 . TRP B 1 151 ? 20.699  12.052  -26.595 1.00 38.88 ? 189 TRP B CH2 1 
ATOM   3201 N N   . LYS B 1 152 ? 13.076  10.311  -24.302 1.00 40.17 ? 190 LYS B N   1 
ATOM   3202 C CA  . LYS B 1 152 ? 11.730  9.919   -24.715 1.00 41.69 ? 190 LYS B CA  1 
ATOM   3203 C C   . LYS B 1 152 ? 11.135  10.948  -25.694 1.00 42.09 ? 190 LYS B C   1 
ATOM   3204 O O   . LYS B 1 152 ? 10.643  10.575  -26.788 1.00 41.52 ? 190 LYS B O   1 
ATOM   3205 C CB  . LYS B 1 152 ? 10.857  9.705   -23.464 1.00 40.94 ? 190 LYS B CB  1 
ATOM   3206 C CG  . LYS B 1 152 ? 9.400   9.502   -23.737 1.00 44.81 ? 190 LYS B CG  1 
ATOM   3207 C CD  . LYS B 1 152 ? 8.638   9.173   -22.456 1.00 45.57 ? 190 LYS B CD  1 
ATOM   3208 C CE  . LYS B 1 152 ? 8.261   7.673   -22.387 1.00 51.96 ? 190 LYS B CE  1 
ATOM   3209 N NZ  . LYS B 1 152 ? 7.062   7.374   -21.480 1.00 52.95 ? 190 LYS B NZ  1 
ATOM   3210 N N   . THR B 1 153 ? 11.214  12.230  -25.326 1.00 42.06 ? 191 THR B N   1 
ATOM   3211 C CA  . THR B 1 153 ? 10.707  13.313  -26.154 1.00 43.51 ? 191 THR B CA  1 
ATOM   3212 C C   . THR B 1 153 ? 11.429  13.458  -27.497 1.00 42.93 ? 191 THR B C   1 
ATOM   3213 O O   . THR B 1 153 ? 10.769  13.524  -28.537 1.00 43.07 ? 191 THR B O   1 
ATOM   3214 C CB  . THR B 1 153 ? 10.766  14.704  -25.421 1.00 44.43 ? 191 THR B CB  1 
ATOM   3215 O OG1 . THR B 1 153 ? 10.234  14.583  -24.089 1.00 48.12 ? 191 THR B OG1 1 
ATOM   3216 C CG2 . THR B 1 153 ? 9.966   15.777  -26.213 1.00 45.36 ? 191 THR B CG2 1 
ATOM   3217 N N   . VAL B 1 154 ? 12.759  13.580  -27.491 1.00 42.69 ? 192 VAL B N   1 
ATOM   3218 C CA  . VAL B 1 154 ? 13.483  13.779  -28.764 1.00 42.58 ? 192 VAL B CA  1 
ATOM   3219 C C   . VAL B 1 154 ? 13.385  12.543  -29.650 1.00 42.10 ? 192 VAL B C   1 
ATOM   3220 O O   . VAL B 1 154 ? 13.207  12.669  -30.870 1.00 42.04 ? 192 VAL B O   1 
ATOM   3221 C CB  . VAL B 1 154 ? 14.981  14.186  -28.617 1.00 42.59 ? 192 VAL B CB  1 
ATOM   3222 C CG1 . VAL B 1 154 ? 15.131  15.517  -27.943 1.00 43.55 ? 192 VAL B CG1 1 
ATOM   3223 C CG2 . VAL B 1 154 ? 15.751  13.152  -27.866 1.00 43.64 ? 192 VAL B CG2 1 
ATOM   3224 N N   . SER B 1 155 ? 13.476  11.357  -29.041 1.00 41.80 ? 193 SER B N   1 
ATOM   3225 C CA  . SER B 1 155 ? 13.370  10.123  -29.814 1.00 42.26 ? 193 SER B CA  1 
ATOM   3226 C C   . SER B 1 155 ? 12.034  10.044  -30.529 1.00 42.17 ? 193 SER B C   1 
ATOM   3227 O O   . SER B 1 155 ? 11.981  9.654   -31.693 1.00 41.47 ? 193 SER B O   1 
ATOM   3228 C CB  . SER B 1 155 ? 13.514  8.907   -28.929 1.00 42.20 ? 193 SER B CB  1 
ATOM   3229 O OG  . SER B 1 155 ? 14.827  8.845   -28.460 1.00 45.27 ? 193 SER B OG  1 
ATOM   3230 N N   . ARG B 1 156 ? 10.968  10.449  -29.841 1.00 41.94 ? 194 ARG B N   1 
ATOM   3231 C CA  . ARG B 1 156 ? 9.630   10.438  -30.422 1.00 42.99 ? 194 ARG B CA  1 
ATOM   3232 C C   . ARG B 1 156 ? 9.583   11.306  -31.662 1.00 42.41 ? 194 ARG B C   1 
ATOM   3233 O O   . ARG B 1 156 ? 9.170   10.859  -32.732 1.00 42.32 ? 194 ARG B O   1 
ATOM   3234 C CB  . ARG B 1 156 ? 8.590   10.931  -29.416 1.00 42.51 ? 194 ARG B CB  1 
ATOM   3235 C CG  . ARG B 1 156 ? 7.193   10.382  -29.606 1.00 45.30 ? 194 ARG B CG  1 
ATOM   3236 C CD  . ARG B 1 156 ? 6.222   10.901  -28.518 1.00 46.77 ? 194 ARG B CD  1 
ATOM   3237 N NE  . ARG B 1 156 ? 5.658   12.167  -28.975 1.00 54.50 ? 194 ARG B NE  1 
ATOM   3238 C CZ  . ARG B 1 156 ? 6.249   13.359  -28.855 1.00 56.38 ? 194 ARG B CZ  1 
ATOM   3239 N NH1 . ARG B 1 156 ? 7.438   13.488  -28.275 1.00 57.26 ? 194 ARG B NH1 1 
ATOM   3240 N NH2 . ARG B 1 156 ? 5.641   14.439  -29.338 1.00 60.68 ? 194 ARG B NH2 1 
ATOM   3241 N N   . ARG B 1 157 ? 10.004  12.552  -31.521 1.00 42.42 ? 195 ARG B N   1 
ATOM   3242 C CA  . ARG B 1 157 ? 10.017  13.465  -32.647 1.00 43.02 ? 195 ARG B CA  1 
ATOM   3243 C C   . ARG B 1 157 ? 10.884  12.875  -33.782 1.00 41.53 ? 195 ARG B C   1 
ATOM   3244 O O   . ARG B 1 157 ? 10.492  12.885  -34.955 1.00 40.46 ? 195 ARG B O   1 
ATOM   3245 C CB  . ARG B 1 157 ? 10.530  14.844  -32.217 1.00 43.59 ? 195 ARG B CB  1 
ATOM   3246 C CG  . ARG B 1 157 ? 9.707   15.505  -31.110 1.00 49.98 ? 195 ARG B CG  1 
ATOM   3247 C CD  . ARG B 1 157 ? 10.068  16.989  -31.008 1.00 58.53 ? 195 ARG B CD  1 
ATOM   3248 N NE  . ARG B 1 157 ? 8.888   17.873  -30.984 1.00 63.08 ? 195 ARG B NE  1 
ATOM   3249 C CZ  . ARG B 1 157 ? 8.823   19.049  -31.618 1.00 65.69 ? 195 ARG B CZ  1 
ATOM   3250 N NH1 . ARG B 1 157 ? 9.854   19.481  -32.347 1.00 66.34 ? 195 ARG B NH1 1 
ATOM   3251 N NH2 . ARG B 1 157 ? 7.724   19.796  -31.532 1.00 65.84 ? 195 ARG B NH2 1 
ATOM   3252 N N   . PHE B 1 158 ? 12.047  12.348  -33.414 1.00 40.21 ? 196 PHE B N   1 
ATOM   3253 C CA  . PHE B 1 158 ? 12.988  11.842  -34.398 1.00 39.12 ? 196 PHE B CA  1 
ATOM   3254 C C   . PHE B 1 158 ? 12.384  10.680  -35.197 1.00 38.94 ? 196 PHE B C   1 
ATOM   3255 O O   . PHE B 1 158 ? 12.469  10.673  -36.402 1.00 39.42 ? 196 PHE B O   1 
ATOM   3256 C CB  . PHE B 1 158 ? 14.289  11.445  -33.715 1.00 38.11 ? 196 PHE B CB  1 
ATOM   3257 C CG  . PHE B 1 158 ? 15.463  11.259  -34.662 1.00 37.37 ? 196 PHE B CG  1 
ATOM   3258 C CD1 . PHE B 1 158 ? 15.919  12.308  -35.462 1.00 36.75 ? 196 PHE B CD1 1 
ATOM   3259 C CD2 . PHE B 1 158 ? 16.143  10.045  -34.696 1.00 34.90 ? 196 PHE B CD2 1 
ATOM   3260 C CE1 . PHE B 1 158 ? 17.031  12.141  -36.305 1.00 37.25 ? 196 PHE B CE1 1 
ATOM   3261 C CE2 . PHE B 1 158 ? 17.255  9.869   -35.508 1.00 35.13 ? 196 PHE B CE2 1 
ATOM   3262 C CZ  . PHE B 1 158 ? 17.706  10.916  -36.317 1.00 36.59 ? 196 PHE B CZ  1 
ATOM   3263 N N   . ALA B 1 159 ? 11.756  9.721   -34.517 1.00 39.35 ? 197 ALA B N   1 
ATOM   3264 C CA  . ALA B 1 159 ? 11.074  8.605   -35.167 1.00 39.45 ? 197 ALA B CA  1 
ATOM   3265 C C   . ALA B 1 159 ? 9.911   9.058   -36.078 1.00 40.20 ? 197 ALA B C   1 
ATOM   3266 O O   . ALA B 1 159 ? 9.740   8.524   -37.187 1.00 39.57 ? 197 ALA B O   1 
ATOM   3267 C CB  . ALA B 1 159 ? 10.607  7.596   -34.132 1.00 39.30 ? 197 ALA B CB  1 
ATOM   3268 N N   . GLU B 1 160 ? 9.139   10.049  -35.622 1.00 40.50 ? 198 GLU B N   1 
ATOM   3269 C CA  . GLU B 1 160 ? 7.970   10.554  -36.363 1.00 42.16 ? 198 GLU B CA  1 
ATOM   3270 C C   . GLU B 1 160 ? 8.330   11.212  -37.692 1.00 40.64 ? 198 GLU B C   1 
ATOM   3271 O O   . GLU B 1 160 ? 7.513   11.259  -38.596 1.00 40.81 ? 198 GLU B O   1 
ATOM   3272 C CB  . GLU B 1 160 ? 7.169   11.571  -35.530 1.00 42.07 ? 198 GLU B CB  1 
ATOM   3273 C CG  . GLU B 1 160 ? 6.607   11.060  -34.205 1.00 45.51 ? 198 GLU B CG  1 
ATOM   3274 C CD  . GLU B 1 160 ? 5.949   12.172  -33.355 1.00 46.13 ? 198 GLU B CD  1 
ATOM   3275 O OE1 . GLU B 1 160 ? 6.384   13.351  -33.457 1.00 49.94 ? 198 GLU B OE1 1 
ATOM   3276 O OE2 . GLU B 1 160 ? 4.992   11.856  -32.592 1.00 49.24 ? 198 GLU B OE2 1 
ATOM   3277 N N   . ALA B 1 161 ? 9.536   11.755  -37.785 1.00 40.00 ? 199 ALA B N   1 
ATOM   3278 C CA  . ALA B 1 161 ? 9.962   12.494  -38.962 1.00 39.71 ? 199 ALA B CA  1 
ATOM   3279 C C   . ALA B 1 161 ? 10.584  11.556  -39.986 1.00 39.28 ? 199 ALA B C   1 
ATOM   3280 O O   . ALA B 1 161 ? 10.719  11.923  -41.148 1.00 40.72 ? 199 ALA B O   1 
ATOM   3281 C CB  . ALA B 1 161 ? 10.958  13.569  -38.573 1.00 40.22 ? 199 ALA B CB  1 
ATOM   3282 N N   . ALA B 1 162 ? 10.943  10.351  -39.545 1.00 37.83 ? 200 ALA B N   1 
ATOM   3283 C CA  . ALA B 1 162 ? 11.588  9.346   -40.367 1.00 36.21 ? 200 ALA B CA  1 
ATOM   3284 C C   . ALA B 1 162 ? 10.697  8.923   -41.536 1.00 35.95 ? 200 ALA B C   1 
ATOM   3285 O O   . ALA B 1 162 ? 9.478   8.767   -41.387 1.00 35.99 ? 200 ALA B O   1 
ATOM   3286 C CB  . ALA B 1 162 ? 11.942  8.145   -39.529 1.00 35.33 ? 200 ALA B CB  1 
ATOM   3287 N N   . CYS B 1 163 ? 11.305  8.729   -42.697 1.00 35.31 ? 201 CYS B N   1 
ATOM   3288 C CA  . CYS B 1 163 ? 10.534  8.307   -43.866 1.00 35.61 ? 201 CYS B CA  1 
ATOM   3289 C C   . CYS B 1 163 ? 11.298  7.264   -44.678 1.00 35.02 ? 201 CYS B C   1 
ATOM   3290 O O   . CYS B 1 163 ? 12.513  7.100   -44.516 1.00 34.49 ? 201 CYS B O   1 
ATOM   3291 C CB  . CYS B 1 163 ? 10.125  9.516   -44.714 1.00 35.97 ? 201 CYS B CB  1 
ATOM   3292 S SG  . CYS B 1 163 ? 11.461  10.198  -45.736 1.00 39.03 ? 201 CYS B SG  1 
ATOM   3293 N N   . ASP B 1 164 ? 10.558  6.545   -45.516 1.00 34.85 ? 202 ASP B N   1 
ATOM   3294 C CA  . ASP B 1 164 ? 11.094  5.575   -46.472 1.00 35.01 ? 202 ASP B CA  1 
ATOM   3295 C C   . ASP B 1 164 ? 11.693  4.349   -45.805 1.00 34.62 ? 202 ASP B C   1 
ATOM   3296 O O   . ASP B 1 164 ? 10.977  3.593   -45.140 1.00 34.64 ? 202 ASP B O   1 
ATOM   3297 C CB  . ASP B 1 164 ? 12.094  6.240   -47.415 1.00 35.42 ? 202 ASP B CB  1 
ATOM   3298 C CG  . ASP B 1 164 ? 11.426  7.168   -48.414 1.00 37.36 ? 202 ASP B CG  1 
ATOM   3299 O OD1 . ASP B 1 164 ? 10.170  7.147   -48.515 1.00 39.96 ? 202 ASP B OD1 1 
ATOM   3300 O OD2 . ASP B 1 164 ? 12.160  7.920   -49.098 1.00 38.83 ? 202 ASP B OD2 1 
ATOM   3301 N N   . VAL B 1 165 ? 12.995  4.140   -45.997 1.00 33.91 ? 203 VAL B N   1 
ATOM   3302 C CA  . VAL B 1 165 ? 13.682  3.043   -45.338 1.00 33.60 ? 203 VAL B CA  1 
ATOM   3303 C C   . VAL B 1 165 ? 14.376  3.585   -44.080 1.00 33.82 ? 203 VAL B C   1 
ATOM   3304 O O   . VAL B 1 165 ? 15.140  4.554   -44.139 1.00 33.92 ? 203 VAL B O   1 
ATOM   3305 C CB  . VAL B 1 165 ? 14.640  2.278   -46.308 1.00 33.76 ? 203 VAL B CB  1 
ATOM   3306 C CG1 . VAL B 1 165 ? 15.246  1.062   -45.624 1.00 33.72 ? 203 VAL B CG1 1 
ATOM   3307 C CG2 . VAL B 1 165 ? 13.886  1.812   -47.580 1.00 33.19 ? 203 VAL B CG2 1 
ATOM   3308 N N   . VAL B 1 166 ? 14.040  3.003   -42.931 1.00 33.44 ? 204 VAL B N   1 
ATOM   3309 C CA  . VAL B 1 166 ? 14.684  3.349   -41.666 1.00 32.55 ? 204 VAL B CA  1 
ATOM   3310 C C   . VAL B 1 166 ? 15.569  2.171   -41.243 1.00 33.13 ? 204 VAL B C   1 
ATOM   3311 O O   . VAL B 1 166 ? 15.151  0.998   -41.287 1.00 32.60 ? 204 VAL B O   1 
ATOM   3312 C CB  . VAL B 1 166 ? 13.655  3.723   -40.537 1.00 32.57 ? 204 VAL B CB  1 
ATOM   3313 C CG1 . VAL B 1 166 ? 14.354  4.156   -39.276 1.00 28.66 ? 204 VAL B CG1 1 
ATOM   3314 C CG2 . VAL B 1 166 ? 12.751  4.838   -40.966 1.00 31.77 ? 204 VAL B CG2 1 
ATOM   3315 N N   . HIS B 1 167 ? 16.803  2.497   -40.866 1.00 33.77 ? 205 HIS B N   1 
ATOM   3316 C CA  . HIS B 1 167 ? 17.746  1.512   -40.343 1.00 33.87 ? 205 HIS B CA  1 
ATOM   3317 C C   . HIS B 1 167 ? 17.953  1.643   -38.858 1.00 34.18 ? 205 HIS B C   1 
ATOM   3318 O O   . HIS B 1 167 ? 17.980  2.744   -38.279 1.00 34.43 ? 205 HIS B O   1 
ATOM   3319 C CB  . HIS B 1 167 ? 19.102  1.617   -41.010 1.00 33.07 ? 205 HIS B CB  1 
ATOM   3320 C CG  . HIS B 1 167 ? 19.034  1.541   -42.487 1.00 31.20 ? 205 HIS B CG  1 
ATOM   3321 N ND1 . HIS B 1 167 ? 18.940  2.662   -43.277 1.00 30.67 ? 205 HIS B ND1 1 
ATOM   3322 C CD2 . HIS B 1 167 ? 19.020  0.480   -43.323 1.00 29.64 ? 205 HIS B CD2 1 
ATOM   3323 C CE1 . HIS B 1 167 ? 18.874  2.292   -44.545 1.00 28.59 ? 205 HIS B CE1 1 
ATOM   3324 N NE2 . HIS B 1 167 ? 18.927  0.974   -44.598 1.00 27.92 ? 205 HIS B NE2 1 
ATOM   3325 N N   . VAL B 1 168 ? 18.126  0.494   -38.238 1.00 35.46 ? 206 VAL B N   1 
ATOM   3326 C CA  . VAL B 1 168 ? 18.428  0.464   -36.827 1.00 37.22 ? 206 VAL B CA  1 
ATOM   3327 C C   . VAL B 1 168 ? 19.594  -0.499  -36.566 1.00 38.29 ? 206 VAL B C   1 
ATOM   3328 O O   . VAL B 1 168 ? 19.569  -1.656  -36.995 1.00 38.23 ? 206 VAL B O   1 
ATOM   3329 C CB  . VAL B 1 168 ? 17.155  0.181   -35.960 1.00 36.59 ? 206 VAL B CB  1 
ATOM   3330 C CG1 . VAL B 1 168 ? 16.473  -1.145  -36.354 1.00 37.35 ? 206 VAL B CG1 1 
ATOM   3331 C CG2 . VAL B 1 168 ? 17.496  0.230   -34.462 1.00 37.05 ? 206 VAL B CG2 1 
ATOM   3332 N N   . MET B 1 169 ? 20.628  0.022   -35.904 1.00 40.16 ? 207 MET B N   1 
ATOM   3333 C CA  . MET B 1 169 ? 21.697  -0.804  -35.327 1.00 42.10 ? 207 MET B CA  1 
ATOM   3334 C C   . MET B 1 169 ? 21.291  -1.398  -33.981 1.00 42.94 ? 207 MET B C   1 
ATOM   3335 O O   . MET B 1 169 ? 20.936  -0.683  -33.046 1.00 42.94 ? 207 MET B O   1 
ATOM   3336 C CB  . MET B 1 169 ? 22.992  -0.014  -35.155 1.00 41.54 ? 207 MET B CB  1 
ATOM   3337 C CG  . MET B 1 169 ? 23.894  -0.078  -36.337 1.00 42.90 ? 207 MET B CG  1 
ATOM   3338 S SD  . MET B 1 169 ? 25.421  0.822   -36.063 1.00 43.27 ? 207 MET B SD  1 
ATOM   3339 C CE  . MET B 1 169 ? 26.131  0.671   -37.695 1.00 40.17 ? 207 MET B CE  1 
ATOM   3340 N N   . LEU B 1 170 ? 21.355  -2.722  -33.916 1.00 45.02 ? 208 LEU B N   1 
ATOM   3341 C CA  . LEU B 1 170 ? 21.120  -3.470  -32.701 1.00 46.73 ? 208 LEU B CA  1 
ATOM   3342 C C   . LEU B 1 170 ? 22.418  -4.167  -32.278 1.00 48.31 ? 208 LEU B C   1 
ATOM   3343 O O   . LEU B 1 170 ? 23.231  -4.548  -33.123 1.00 48.33 ? 208 LEU B O   1 
ATOM   3344 C CB  . LEU B 1 170 ? 20.013  -4.491  -32.952 1.00 46.61 ? 208 LEU B CB  1 
ATOM   3345 C CG  . LEU B 1 170 ? 18.651  -3.851  -33.214 1.00 45.94 ? 208 LEU B CG  1 
ATOM   3346 C CD1 . LEU B 1 170 ? 17.658  -4.898  -33.641 1.00 45.66 ? 208 LEU B CD1 1 
ATOM   3347 C CD2 . LEU B 1 170 ? 18.169  -3.115  -31.981 1.00 46.18 ? 208 LEU B CD2 1 
ATOM   3348 N N   . ASP B 1 171 ? 22.609  -4.311  -30.969 1.00 50.26 ? 209 ASP B N   1 
ATOM   3349 C CA  . ASP B 1 171 ? 23.783  -5.003  -30.406 1.00 52.33 ? 209 ASP B CA  1 
ATOM   3350 C C   . ASP B 1 171 ? 23.597  -6.530  -30.341 1.00 53.57 ? 209 ASP B C   1 
ATOM   3351 O O   . ASP B 1 171 ? 22.902  -7.048  -29.454 1.00 53.58 ? 209 ASP B O   1 
ATOM   3352 C CB  . ASP B 1 171 ? 24.102  -4.428  -29.015 1.00 52.28 ? 209 ASP B CB  1 
ATOM   3353 C CG  . ASP B 1 171 ? 25.193  -5.196  -28.282 1.00 52.36 ? 209 ASP B CG  1 
ATOM   3354 O OD1 . ASP B 1 171 ? 25.995  -5.910  -28.931 1.00 50.99 ? 209 ASP B OD1 1 
ATOM   3355 O OD2 . ASP B 1 171 ? 25.229  -5.068  -27.035 1.00 53.19 ? 209 ASP B OD2 1 
ATOM   3356 N N   . GLY B 1 172 ? 24.241  -7.241  -31.264 1.00 55.11 ? 210 GLY B N   1 
ATOM   3357 C CA  . GLY B 1 172 ? 24.044  -8.683  -31.392 1.00 57.51 ? 210 GLY B CA  1 
ATOM   3358 C C   . GLY B 1 172 ? 24.823  -9.582  -30.441 1.00 59.24 ? 210 GLY B C   1 
ATOM   3359 O O   . GLY B 1 172 ? 24.837  -10.810 -30.611 1.00 59.15 ? 210 GLY B O   1 
ATOM   3360 N N   . SER B 1 173 ? 25.488  -8.973  -29.458 1.00 61.05 ? 211 SER B N   1 
ATOM   3361 C CA  . SER B 1 173 ? 26.136  -9.708  -28.360 1.00 62.76 ? 211 SER B CA  1 
ATOM   3362 C C   . SER B 1 173 ? 25.448  -9.382  -27.029 1.00 63.92 ? 211 SER B C   1 
ATOM   3363 O O   . SER B 1 173 ? 25.847  -8.474  -26.282 1.00 63.97 ? 211 SER B O   1 
ATOM   3364 C CB  . SER B 1 173 ? 27.649  -9.454  -28.316 1.00 62.69 ? 211 SER B CB  1 
ATOM   3365 O OG  . SER B 1 173 ? 28.332  -10.362 -29.171 1.00 63.10 ? 211 SER B OG  1 
ATOM   3366 N N   . ARG B 1 174 ? 24.390  -10.146 -26.778 1.00 65.30 ? 212 ARG B N   1 
ATOM   3367 C CA  . ARG B 1 174 ? 23.472  -9.979  -25.665 1.00 66.73 ? 212 ARG B CA  1 
ATOM   3368 C C   . ARG B 1 174 ? 22.247  -10.767 -26.092 1.00 67.32 ? 212 ARG B C   1 
ATOM   3369 O O   . ARG B 1 174 ? 21.603  -10.403 -27.081 1.00 67.61 ? 212 ARG B O   1 
ATOM   3370 C CB  . ARG B 1 174 ? 23.080  -8.512  -25.461 1.00 66.86 ? 212 ARG B CB  1 
ATOM   3371 C CG  . ARG B 1 174 ? 22.448  -8.249  -24.106 1.00 68.39 ? 212 ARG B CG  1 
ATOM   3372 C CD  . ARG B 1 174 ? 23.473  -7.664  -23.136 1.00 70.82 ? 212 ARG B CD  1 
ATOM   3373 N NE  . ARG B 1 174 ? 23.485  -6.179  -23.256 1.00 72.69 ? 212 ARG B NE  1 
ATOM   3374 C CZ  . ARG B 1 174 ? 24.280  -5.369  -22.550 1.00 73.02 ? 212 ARG B CZ  1 
ATOM   3375 N NH1 . ARG B 1 174 ? 25.164  -5.884  -21.655 1.00 72.60 ? 212 ARG B NH1 1 
ATOM   3376 N NH2 . ARG B 1 174 ? 24.188  -4.032  -22.749 1.00 72.28 ? 212 ARG B NH2 1 
ATOM   3377 N N   . SER B 1 175 ? 21.927  -11.846 -25.379 1.00 68.04 ? 213 SER B N   1 
ATOM   3378 C CA  . SER B 1 175 ? 20.688  -12.587 -25.658 1.00 68.57 ? 213 SER B CA  1 
ATOM   3379 C C   . SER B 1 175 ? 19.426  -11.784 -25.261 1.00 68.90 ? 213 SER B C   1 
ATOM   3380 O O   . SER B 1 175 ? 18.397  -12.362 -24.879 1.00 69.00 ? 213 SER B O   1 
ATOM   3381 C CB  . SER B 1 175 ? 20.714  -14.005 -25.055 1.00 68.58 ? 213 SER B CB  1 
ATOM   3382 O OG  . SER B 1 175 ? 21.553  -14.087 -23.915 1.00 68.77 ? 213 SER B OG  1 
ATOM   3383 N N   . LYS B 1 176 ? 19.544  -10.452 -25.352 1.00 69.06 ? 214 LYS B N   1 
ATOM   3384 C CA  . LYS B 1 176 ? 18.432  -9.506  -25.282 1.00 69.18 ? 214 LYS B CA  1 
ATOM   3385 C C   . LYS B 1 176 ? 18.535  -8.480  -26.428 1.00 69.29 ? 214 LYS B C   1 
ATOM   3386 O O   . LYS B 1 176 ? 18.489  -7.265  -26.191 1.00 69.22 ? 214 LYS B O   1 
ATOM   3387 C CB  . LYS B 1 176 ? 18.409  -8.796  -23.917 1.00 69.34 ? 214 LYS B CB  1 
ATOM   3388 C CG  . LYS B 1 176 ? 17.182  -9.095  -23.058 1.00 69.68 ? 214 LYS B CG  1 
ATOM   3389 C CD  . LYS B 1 176 ? 17.301  -10.431 -22.310 1.00 69.88 ? 214 LYS B CD  1 
ATOM   3390 C CE  . LYS B 1 176 ? 15.921  -11.128 -22.273 1.00 70.86 ? 214 LYS B CE  1 
ATOM   3391 N NZ  . LYS B 1 176 ? 16.033  -12.546 -21.447 1.00 70.56 ? 214 LYS B NZ  1 
ATOM   3392 N N   . ILE B 1 177 ? 18.658  -8.982  -27.663 1.00 69.29 ? 215 ILE B N   1 
ATOM   3393 C CA  . ILE B 1 177 ? 18.911  -8.161  -28.871 1.00 69.20 ? 215 ILE B CA  1 
ATOM   3394 C C   . ILE B 1 177 ? 17.906  -7.019  -29.079 1.00 69.25 ? 215 ILE B C   1 
ATOM   3395 O O   . ILE B 1 177 ? 18.304  -5.851  -29.141 1.00 69.37 ? 215 ILE B O   1 
ATOM   3396 C CB  . ILE B 1 177 ? 19.035  -9.021  -30.165 1.00 69.23 ? 215 ILE B CB  1 
ATOM   3397 C CG1 . ILE B 1 177 ? 20.325  -9.850  -30.138 1.00 69.06 ? 215 ILE B CG1 1 
ATOM   3398 C CG2 . ILE B 1 177 ? 19.007  -8.133  -31.403 1.00 69.31 ? 215 ILE B CG2 1 
ATOM   3399 C CD1 . ILE B 1 177 ? 20.504  -10.800 -31.322 1.00 69.18 ? 215 ILE B CD1 1 
ATOM   3400 N N   . PHE B 1 178 ? 16.621  -7.350  -29.197 1.00 69.21 ? 216 PHE B N   1 
ATOM   3401 C CA  . PHE B 1 178 ? 15.581  -6.318  -29.167 1.00 69.10 ? 216 PHE B CA  1 
ATOM   3402 C C   . PHE B 1 178 ? 14.920  -6.227  -27.792 1.00 68.97 ? 216 PHE B C   1 
ATOM   3403 O O   . PHE B 1 178 ? 14.260  -7.159  -27.340 1.00 69.19 ? 216 PHE B O   1 
ATOM   3404 C CB  . PHE B 1 178 ? 14.526  -6.500  -30.273 1.00 69.03 ? 216 PHE B CB  1 
ATOM   3405 C CG  . PHE B 1 178 ? 13.346  -5.565  -30.136 1.00 69.09 ? 216 PHE B CG  1 
ATOM   3406 C CD1 . PHE B 1 178 ? 13.515  -4.179  -30.261 1.00 69.29 ? 216 PHE B CD1 1 
ATOM   3407 C CD2 . PHE B 1 178 ? 12.074  -6.060  -29.851 1.00 68.90 ? 216 PHE B CD2 1 
ATOM   3408 C CE1 . PHE B 1 178 ? 12.436  -3.299  -30.112 1.00 68.79 ? 216 PHE B CE1 1 
ATOM   3409 C CE2 . PHE B 1 178 ? 10.985  -5.191  -29.708 1.00 69.30 ? 216 PHE B CE2 1 
ATOM   3410 C CZ  . PHE B 1 178 ? 11.170  -3.803  -29.836 1.00 69.25 ? 216 PHE B CZ  1 
ATOM   3411 N N   . ASP B 1 179 ? 15.099  -5.087  -27.143 1.00 68.78 ? 217 ASP B N   1 
ATOM   3412 C CA  . ASP B 1 179 ? 14.537  -4.857  -25.828 1.00 68.89 ? 217 ASP B CA  1 
ATOM   3413 C C   . ASP B 1 179 ? 13.326  -3.945  -25.935 1.00 68.85 ? 217 ASP B C   1 
ATOM   3414 O O   . ASP B 1 179 ? 13.451  -2.757  -26.254 1.00 68.77 ? 217 ASP B O   1 
ATOM   3415 C CB  . ASP B 1 179 ? 15.592  -4.243  -24.897 1.00 68.92 ? 217 ASP B CB  1 
ATOM   3416 C CG  . ASP B 1 179 ? 15.070  -3.999  -23.482 1.00 69.43 ? 217 ASP B CG  1 
ATOM   3417 O OD1 . ASP B 1 179 ? 14.087  -4.647  -23.070 1.00 69.67 ? 217 ASP B OD1 1 
ATOM   3418 O OD2 . ASP B 1 179 ? 15.657  -3.159  -22.769 1.00 69.59 ? 217 ASP B OD2 1 
ATOM   3419 N N   . LYS B 1 180 ? 12.157  -4.514  -25.656 1.00 68.78 ? 218 LYS B N   1 
ATOM   3420 C CA  . LYS B 1 180 ? 10.908  -3.765  -25.630 1.00 68.78 ? 218 LYS B CA  1 
ATOM   3421 C C   . LYS B 1 180 ? 10.962  -2.628  -24.606 1.00 68.60 ? 218 LYS B C   1 
ATOM   3422 O O   . LYS B 1 180 ? 10.181  -1.679  -24.681 1.00 68.91 ? 218 LYS B O   1 
ATOM   3423 C CB  . LYS B 1 180 ? 9.736   -4.698  -25.318 1.00 68.71 ? 218 LYS B CB  1 
ATOM   3424 C CG  . LYS B 1 180 ? 8.401   -4.224  -25.899 1.00 69.35 ? 218 LYS B CG  1 
ATOM   3425 C CD  . LYS B 1 180 ? 7.197   -4.572  -25.013 1.00 69.34 ? 218 LYS B CD  1 
ATOM   3426 C CE  . LYS B 1 180 ? 6.794   -6.039  -25.106 1.00 68.59 ? 218 LYS B CE  1 
ATOM   3427 N NZ  . LYS B 1 180 ? 7.627   -6.897  -24.223 1.00 68.67 ? 218 LYS B NZ  1 
ATOM   3428 N N   . ASP B 1 181 ? 11.893  -2.732  -23.658 1.00 68.48 ? 219 ASP B N   1 
ATOM   3429 C CA  . ASP B 1 181 ? 12.084  -1.722  -22.610 1.00 68.15 ? 219 ASP B CA  1 
ATOM   3430 C C   . ASP B 1 181 ? 12.868  -0.488  -23.066 1.00 67.48 ? 219 ASP B C   1 
ATOM   3431 O O   . ASP B 1 181 ? 12.785  0.573   -22.424 1.00 67.85 ? 219 ASP B O   1 
ATOM   3432 C CB  . ASP B 1 181 ? 12.789  -2.340  -21.383 1.00 68.57 ? 219 ASP B CB  1 
ATOM   3433 C CG  . ASP B 1 181 ? 11.812  -2.817  -20.308 1.00 69.33 ? 219 ASP B CG  1 
ATOM   3434 O OD1 . ASP B 1 181 ? 11.057  -1.972  -19.775 1.00 70.38 ? 219 ASP B OD1 1 
ATOM   3435 O OD2 . ASP B 1 181 ? 11.819  -4.028  -19.976 1.00 69.29 ? 219 ASP B OD2 1 
ATOM   3436 N N   . SER B 1 182 ? 13.640  -0.622  -24.149 1.00 66.28 ? 220 SER B N   1 
ATOM   3437 C CA  . SER B 1 182 ? 14.604  0.418   -24.551 1.00 64.73 ? 220 SER B CA  1 
ATOM   3438 C C   . SER B 1 182 ? 13.910  1.682   -25.053 1.00 63.96 ? 220 SER B C   1 
ATOM   3439 O O   . SER B 1 182 ? 12.688  1.689   -25.215 1.00 63.92 ? 220 SER B O   1 
ATOM   3440 C CB  . SER B 1 182 ? 15.553  -0.132  -25.615 1.00 64.58 ? 220 SER B CB  1 
ATOM   3441 O OG  . SER B 1 182 ? 14.845  -0.462  -26.793 1.00 64.06 ? 220 SER B OG  1 
ATOM   3442 N N   . THR B 1 183 ? 14.680  2.750   -25.286 1.00 62.98 ? 221 THR B N   1 
ATOM   3443 C CA  . THR B 1 183 ? 14.146  3.928   -25.982 1.00 62.23 ? 221 THR B CA  1 
ATOM   3444 C C   . THR B 1 183 ? 13.685  3.554   -27.407 1.00 60.95 ? 221 THR B C   1 
ATOM   3445 O O   . THR B 1 183 ? 12.634  4.020   -27.865 1.00 60.98 ? 221 THR B O   1 
ATOM   3446 C CB  . THR B 1 183 ? 15.135  5.137   -26.059 1.00 62.76 ? 221 THR B CB  1 
ATOM   3447 O OG1 . THR B 1 183 ? 15.944  5.220   -24.877 1.00 63.43 ? 221 THR B OG1 1 
ATOM   3448 C CG2 . THR B 1 183 ? 14.354  6.458   -26.224 1.00 63.62 ? 221 THR B CG2 1 
ATOM   3449 N N   . PHE B 1 184 ? 14.461  2.715   -28.095 1.00 59.02 ? 222 PHE B N   1 
ATOM   3450 C CA  . PHE B 1 184 ? 14.058  2.242   -29.408 1.00 57.55 ? 222 PHE B CA  1 
ATOM   3451 C C   . PHE B 1 184 ? 12.825  1.360   -29.326 1.00 56.81 ? 222 PHE B C   1 
ATOM   3452 O O   . PHE B 1 184 ? 11.881  1.545   -30.087 1.00 56.56 ? 222 PHE B O   1 
ATOM   3453 C CB  . PHE B 1 184 ? 15.183  1.496   -30.113 1.00 56.84 ? 222 PHE B CB  1 
ATOM   3454 C CG  . PHE B 1 184 ? 14.742  0.785   -31.363 1.00 55.77 ? 222 PHE B CG  1 
ATOM   3455 C CD1 . PHE B 1 184 ? 14.288  1.506   -32.471 1.00 54.98 ? 222 PHE B CD1 1 
ATOM   3456 C CD2 . PHE B 1 184 ? 14.781  -0.604  -31.437 1.00 53.92 ? 222 PHE B CD2 1 
ATOM   3457 C CE1 . PHE B 1 184 ? 13.871  0.849   -33.628 1.00 53.06 ? 222 PHE B CE1 1 
ATOM   3458 C CE2 . PHE B 1 184 ? 14.381  -1.263  -32.583 1.00 53.12 ? 222 PHE B CE2 1 
ATOM   3459 C CZ  . PHE B 1 184 ? 13.924  -0.535  -33.683 1.00 54.01 ? 222 PHE B CZ  1 
ATOM   3460 N N   . GLY B 1 185 ? 12.844  0.410   -28.398 1.00 56.34 ? 223 GLY B N   1 
ATOM   3461 C CA  . GLY B 1 185 ? 11.752  -0.534  -28.236 1.00 56.03 ? 223 GLY B CA  1 
ATOM   3462 C C   . GLY B 1 185 ? 10.434  0.071   -27.785 1.00 55.93 ? 223 GLY B C   1 
ATOM   3463 O O   . GLY B 1 185 ? 9.375   -0.437  -28.145 1.00 55.97 ? 223 GLY B O   1 
ATOM   3464 N N   . SER B 1 186 ? 10.487  1.146   -26.998 1.00 55.58 ? 224 SER B N   1 
ATOM   3465 C CA  . SER B 1 186 ? 9.272   1.711   -26.387 1.00 55.39 ? 224 SER B CA  1 
ATOM   3466 C C   . SER B 1 186 ? 8.840   3.100   -26.884 1.00 55.27 ? 224 SER B C   1 
ATOM   3467 O O   . SER B 1 186 ? 7.723   3.542   -26.588 1.00 55.70 ? 224 SER B O   1 
ATOM   3468 C CB  . SER B 1 186 ? 9.426   1.770   -24.872 1.00 55.60 ? 224 SER B CB  1 
ATOM   3469 O OG  . SER B 1 186 ? 10.152  2.930   -24.505 1.00 55.77 ? 224 SER B OG  1 
ATOM   3470 N N   . VAL B 1 187 ? 9.723   3.797   -27.595 1.00 54.62 ? 225 VAL B N   1 
ATOM   3471 C CA  . VAL B 1 187 ? 9.387   5.091   -28.196 1.00 54.36 ? 225 VAL B CA  1 
ATOM   3472 C C   . VAL B 1 187 ? 9.581   5.023   -29.719 1.00 53.68 ? 225 VAL B C   1 
ATOM   3473 O O   . VAL B 1 187 ? 8.663   5.340   -30.491 1.00 53.91 ? 225 VAL B O   1 
ATOM   3474 C CB  . VAL B 1 187 ? 10.220  6.274   -27.589 1.00 54.73 ? 225 VAL B CB  1 
ATOM   3475 C CG1 . VAL B 1 187 ? 9.615   7.601   -28.004 1.00 55.49 ? 225 VAL B CG1 1 
ATOM   3476 C CG2 . VAL B 1 187 ? 10.290  6.195   -26.048 1.00 55.28 ? 225 VAL B CG2 1 
ATOM   3477 N N   . GLY B 1 188 ? 10.768  4.575   -30.135 1.00 52.74 ? 226 GLY B N   1 
ATOM   3478 C CA  . GLY B 1 188 ? 11.143  4.476   -31.544 1.00 51.29 ? 226 GLY B CA  1 
ATOM   3479 C C   . GLY B 1 188 ? 10.221  3.648   -32.415 1.00 50.38 ? 226 GLY B C   1 
ATOM   3480 O O   . GLY B 1 188 ? 9.590   4.173   -33.321 1.00 50.02 ? 226 GLY B O   1 
ATOM   3481 N N   . VAL B 1 189 ? 10.128  2.356   -32.134 1.00 49.70 ? 227 VAL B N   1 
ATOM   3482 C CA  . VAL B 1 189 ? 9.313   1.475   -32.948 1.00 49.42 ? 227 VAL B CA  1 
ATOM   3483 C C   . VAL B 1 189 ? 7.873   1.956   -33.086 1.00 49.16 ? 227 VAL B C   1 
ATOM   3484 O O   . VAL B 1 189 ? 7.202   1.650   -34.088 1.00 49.02 ? 227 VAL B O   1 
ATOM   3485 C CB  . VAL B 1 189 ? 9.312   -0.003  -32.454 1.00 49.77 ? 227 VAL B CB  1 
ATOM   3486 C CG1 . VAL B 1 189 ? 10.694  -0.595  -32.510 1.00 50.04 ? 227 VAL B CG1 1 
ATOM   3487 C CG2 . VAL B 1 189 ? 8.735   -0.133  -31.058 1.00 49.94 ? 227 VAL B CG2 1 
ATOM   3488 N N   . HIS B 1 190 ? 7.407   2.709   -32.093 1.00 48.35 ? 228 HIS B N   1 
ATOM   3489 C CA  . HIS B 1 190 ? 5.992   3.033   -31.999 1.00 48.15 ? 228 HIS B CA  1 
ATOM   3490 C C   . HIS B 1 190 ? 5.632   4.336   -32.678 1.00 47.38 ? 228 HIS B C   1 
ATOM   3491 O O   . HIS B 1 190 ? 4.461   4.639   -32.899 1.00 47.50 ? 228 HIS B O   1 
ATOM   3492 C CB  . HIS B 1 190 ? 5.516   2.972   -30.544 1.00 48.52 ? 228 HIS B CB  1 
ATOM   3493 C CG  . HIS B 1 190 ? 5.423   1.571   -30.024 1.00 49.79 ? 228 HIS B CG  1 
ATOM   3494 N ND1 . HIS B 1 190 ? 6.212   1.101   -28.996 1.00 50.87 ? 228 HIS B ND1 1 
ATOM   3495 C CD2 . HIS B 1 190 ? 4.672   0.518   -30.434 1.00 51.06 ? 228 HIS B CD2 1 
ATOM   3496 C CE1 . HIS B 1 190 ? 5.929   -0.171  -28.775 1.00 51.69 ? 228 HIS B CE1 1 
ATOM   3497 N NE2 . HIS B 1 190 ? 4.999   -0.550  -29.635 1.00 51.42 ? 228 HIS B NE2 1 
ATOM   3498 N N   . ASN B 1 191 ? 6.646   5.092   -33.052 1.00 46.45 ? 229 ASN B N   1 
ATOM   3499 C CA  . ASN B 1 191 ? 6.395   6.358   -33.707 1.00 45.81 ? 229 ASN B CA  1 
ATOM   3500 C C   . ASN B 1 191 ? 6.868   6.386   -35.143 1.00 44.57 ? 229 ASN B C   1 
ATOM   3501 O O   . ASN B 1 191 ? 6.944   7.448   -35.769 1.00 44.82 ? 229 ASN B O   1 
ATOM   3502 C CB  . ASN B 1 191 ? 6.966   7.499   -32.875 1.00 45.43 ? 229 ASN B CB  1 
ATOM   3503 C CG  . ASN B 1 191 ? 6.041   7.878   -31.755 1.00 47.38 ? 229 ASN B CG  1 
ATOM   3504 O OD1 . ASN B 1 191 ? 4.921   8.338   -31.999 1.00 48.65 ? 229 ASN B OD1 1 
ATOM   3505 N ND2 . ASN B 1 191 ? 6.471   7.644   -30.518 1.00 48.49 ? 229 ASN B ND2 1 
ATOM   3506 N N   . LEU B 1 192 ? 7.183   5.210   -35.664 1.00 43.63 ? 230 LEU B N   1 
ATOM   3507 C CA  . LEU B 1 192 ? 7.442   5.080   -37.090 1.00 42.12 ? 230 LEU B CA  1 
ATOM   3508 C C   . LEU B 1 192 ? 6.106   5.055   -37.816 1.00 42.13 ? 230 LEU B C   1 
ATOM   3509 O O   . LEU B 1 192 ? 5.313   4.144   -37.625 1.00 42.13 ? 230 LEU B O   1 
ATOM   3510 C CB  . LEU B 1 192 ? 8.262   3.829   -37.370 1.00 41.75 ? 230 LEU B CB  1 
ATOM   3511 C CG  . LEU B 1 192 ? 9.679   3.810   -36.784 1.00 38.68 ? 230 LEU B CG  1 
ATOM   3512 C CD1 . LEU B 1 192 ? 10.295  2.434   -36.886 1.00 36.88 ? 230 LEU B CD1 1 
ATOM   3513 C CD2 . LEU B 1 192 ? 10.563  4.845   -37.451 1.00 35.81 ? 230 LEU B CD2 1 
ATOM   3514 N N   . GLN B 1 193 ? 5.854   6.077   -38.627 1.00 41.93 ? 231 GLN B N   1 
ATOM   3515 C CA  . GLN B 1 193 ? 4.572   6.228   -39.323 1.00 41.87 ? 231 GLN B CA  1 
ATOM   3516 C C   . GLN B 1 193 ? 4.583   5.529   -40.691 1.00 41.44 ? 231 GLN B C   1 
ATOM   3517 O O   . GLN B 1 193 ? 5.333   5.923   -41.580 1.00 41.09 ? 231 GLN B O   1 
ATOM   3518 C CB  . GLN B 1 193 ? 4.227   7.712   -39.498 1.00 42.20 ? 231 GLN B CB  1 
ATOM   3519 C CG  . GLN B 1 193 ? 4.468   8.604   -38.258 1.00 44.31 ? 231 GLN B CG  1 
ATOM   3520 C CD  . GLN B 1 193 ? 3.394   8.455   -37.190 1.00 47.90 ? 231 GLN B CD  1 
ATOM   3521 O OE1 . GLN B 1 193 ? 2.204   8.293   -37.495 1.00 50.19 ? 231 GLN B OE1 1 
ATOM   3522 N NE2 . GLN B 1 193 ? 3.809   8.529   -35.922 1.00 51.05 ? 231 GLN B NE2 1 
ATOM   3523 N N   . PRO B 1 194 ? 3.739   4.494   -40.865 1.00 41.34 ? 232 PRO B N   1 
ATOM   3524 C CA  . PRO B 1 194 ? 3.677   3.715   -42.103 1.00 40.94 ? 232 PRO B CA  1 
ATOM   3525 C C   . PRO B 1 194 ? 3.223   4.492   -43.354 1.00 41.22 ? 232 PRO B C   1 
ATOM   3526 O O   . PRO B 1 194 ? 3.256   3.945   -44.473 1.00 40.35 ? 232 PRO B O   1 
ATOM   3527 C CB  . PRO B 1 194 ? 2.674   2.602   -41.764 1.00 41.26 ? 232 PRO B CB  1 
ATOM   3528 C CG  . PRO B 1 194 ? 1.881   3.127   -40.637 1.00 40.64 ? 232 PRO B CG  1 
ATOM   3529 C CD  . PRO B 1 194 ? 2.795   3.989   -39.851 1.00 41.48 ? 232 PRO B CD  1 
ATOM   3530 N N   . GLU B 1 195 ? 2.799   5.744   -43.175 1.00 41.43 ? 233 GLU B N   1 
ATOM   3531 C CA  . GLU B 1 195 ? 2.436   6.601   -44.314 1.00 42.01 ? 233 GLU B CA  1 
ATOM   3532 C C   . GLU B 1 195 ? 3.713   7.226   -44.848 1.00 41.58 ? 233 GLU B C   1 
ATOM   3533 O O   . GLU B 1 195 ? 3.727   7.834   -45.928 1.00 41.59 ? 233 GLU B O   1 
ATOM   3534 C CB  . GLU B 1 195 ? 1.476   7.731   -43.912 1.00 42.57 ? 233 GLU B CB  1 
ATOM   3535 C CG  . GLU B 1 195 ? 0.296   7.336   -43.025 1.00 44.56 ? 233 GLU B CG  1 
ATOM   3536 C CD  . GLU B 1 195 ? 0.687   7.190   -41.566 1.00 46.52 ? 233 GLU B CD  1 
ATOM   3537 O OE1 . GLU B 1 195 ? 1.319   8.118   -41.014 1.00 47.52 ? 233 GLU B OE1 1 
ATOM   3538 O OE2 . GLU B 1 195 ? 0.352   6.144   -40.969 1.00 47.94 ? 233 GLU B OE2 1 
ATOM   3539 N N   . LYS B 1 196 ? 4.778   7.073   -44.067 1.00 40.88 ? 234 LYS B N   1 
ATOM   3540 C CA  . LYS B 1 196 ? 6.080   7.634   -44.382 1.00 40.46 ? 234 LYS B CA  1 
ATOM   3541 C C   . LYS B 1 196 ? 7.123   6.533   -44.507 1.00 39.24 ? 234 LYS B C   1 
ATOM   3542 O O   . LYS B 1 196 ? 8.026   6.637   -45.337 1.00 39.27 ? 234 LYS B O   1 
ATOM   3543 C CB  . LYS B 1 196 ? 6.515   8.617   -43.301 1.00 40.70 ? 234 LYS B CB  1 
ATOM   3544 C CG  . LYS B 1 196 ? 5.385   9.482   -42.753 1.00 43.07 ? 234 LYS B CG  1 
ATOM   3545 C CD  . LYS B 1 196 ? 5.841   10.302  -41.568 1.00 46.13 ? 234 LYS B CD  1 
ATOM   3546 C CE  . LYS B 1 196 ? 6.377   11.646  -42.027 1.00 48.71 ? 234 LYS B CE  1 
ATOM   3547 N NZ  . LYS B 1 196 ? 7.694   11.928  -41.407 1.00 49.34 ? 234 LYS B NZ  1 
ATOM   3548 N N   . VAL B 1 197 ? 6.985   5.479   -43.699 1.00 37.38 ? 235 VAL B N   1 
ATOM   3549 C CA  . VAL B 1 197 ? 8.001   4.441   -43.613 1.00 35.73 ? 235 VAL B CA  1 
ATOM   3550 C C   . VAL B 1 197 ? 7.541   3.163   -44.272 1.00 34.96 ? 235 VAL B C   1 
ATOM   3551 O O   . VAL B 1 197 ? 6.523   2.590   -43.883 1.00 34.39 ? 235 VAL B O   1 
ATOM   3552 C CB  . VAL B 1 197 ? 8.394   4.140   -42.150 1.00 36.09 ? 235 VAL B CB  1 
ATOM   3553 C CG1 . VAL B 1 197 ? 9.381   2.984   -42.087 1.00 36.06 ? 235 VAL B CG1 1 
ATOM   3554 C CG2 . VAL B 1 197 ? 8.966   5.381   -41.472 1.00 34.41 ? 235 VAL B CG2 1 
ATOM   3555 N N   . GLN B 1 198 ? 8.309   2.715   -45.264 1.00 33.97 ? 236 GLN B N   1 
ATOM   3556 C CA  . GLN B 1 198 ? 8.019   1.449   -45.947 1.00 33.39 ? 236 GLN B CA  1 
ATOM   3557 C C   . GLN B 1 198 ? 8.746   0.267   -45.297 1.00 32.22 ? 236 GLN B C   1 
ATOM   3558 O O   . GLN B 1 198 ? 8.171   -0.843  -45.183 1.00 31.31 ? 236 GLN B O   1 
ATOM   3559 C CB  . GLN B 1 198 ? 8.249   1.534   -47.479 1.00 33.46 ? 236 GLN B CB  1 
ATOM   3560 C CG  . GLN B 1 198 ? 9.703   1.563   -47.989 1.00 33.73 ? 236 GLN B CG  1 
ATOM   3561 C CD  . GLN B 1 198 ? 9.808   1.571   -49.526 1.00 35.15 ? 236 GLN B CD  1 
ATOM   3562 O OE1 . GLN B 1 198 ? 9.269   0.687   -50.233 1.00 35.48 ? 236 GLN B OE1 1 
ATOM   3563 N NE2 . GLN B 1 198 ? 10.523  2.572   -50.050 1.00 38.45 ? 236 GLN B NE2 1 
ATOM   3564 N N   . THR B 1 199 ? 9.980   0.499   -44.836 1.00 31.24 ? 237 THR B N   1 
ATOM   3565 C CA  . THR B 1 199 ? 10.839  -0.551  -44.292 1.00 30.81 ? 237 THR B CA  1 
ATOM   3566 C C   . THR B 1 199 ? 11.622  -0.095  -43.068 1.00 31.55 ? 237 THR B C   1 
ATOM   3567 O O   . THR B 1 199 ? 12.166  1.017   -43.029 1.00 30.53 ? 237 THR B O   1 
ATOM   3568 C CB  . THR B 1 199 ? 11.864  -1.022  -45.341 1.00 30.80 ? 237 THR B CB  1 
ATOM   3569 O OG1 . THR B 1 199 ? 11.217  -1.147  -46.615 1.00 30.02 ? 237 THR B OG1 1 
ATOM   3570 C CG2 . THR B 1 199 ? 12.480  -2.367  -44.955 1.00 30.31 ? 237 THR B CG2 1 
ATOM   3571 N N   . LEU B 1 200 ? 11.659  -0.970  -42.068 1.00 32.28 ? 238 LEU B N   1 
ATOM   3572 C CA  . LEU B 1 200 ? 12.647  -0.903  -41.008 1.00 33.18 ? 238 LEU B CA  1 
ATOM   3573 C C   . LEU B 1 200 ? 13.687  -2.004  -41.232 1.00 33.61 ? 238 LEU B C   1 
ATOM   3574 O O   . LEU B 1 200 ? 13.385  -3.192  -41.041 1.00 33.68 ? 238 LEU B O   1 
ATOM   3575 C CB  . LEU B 1 200 ? 12.002  -1.086  -39.648 1.00 32.90 ? 238 LEU B CB  1 
ATOM   3576 C CG  . LEU B 1 200 ? 13.013  -1.095  -38.508 1.00 33.72 ? 238 LEU B CG  1 
ATOM   3577 C CD1 . LEU B 1 200 ? 13.339  0.335   -38.085 1.00 32.64 ? 238 LEU B CD1 1 
ATOM   3578 C CD2 . LEU B 1 200 ? 12.439  -1.863  -37.338 1.00 35.32 ? 238 LEU B CD2 1 
ATOM   3579 N N   . GLU B 1 201 ? 14.903  -1.610  -41.642 1.00 34.15 ? 239 GLU B N   1 
ATOM   3580 C CA  . GLU B 1 201 ? 15.994  -2.564  -41.806 1.00 34.44 ? 239 GLU B CA  1 
ATOM   3581 C C   . GLU B 1 201 ? 16.818  -2.559  -40.531 1.00 35.21 ? 239 GLU B C   1 
ATOM   3582 O O   . GLU B 1 201 ? 17.337  -1.517  -40.113 1.00 34.84 ? 239 GLU B O   1 
ATOM   3583 C CB  . GLU B 1 201 ? 16.851  -2.251  -43.031 1.00 34.30 ? 239 GLU B CB  1 
ATOM   3584 C CG  . GLU B 1 201 ? 17.809  -3.371  -43.401 1.00 33.98 ? 239 GLU B CG  1 
ATOM   3585 C CD  . GLU B 1 201 ? 18.318  -3.251  -44.829 1.00 35.68 ? 239 GLU B CD  1 
ATOM   3586 O OE1 . GLU B 1 201 ? 19.104  -2.318  -45.114 1.00 36.51 ? 239 GLU B OE1 1 
ATOM   3587 O OE2 . GLU B 1 201 ? 17.936  -4.097  -45.672 1.00 36.54 ? 239 GLU B OE2 1 
ATOM   3588 N N   . ALA B 1 202 ? 16.884  -3.715  -39.880 1.00 35.98 ? 240 ALA B N   1 
ATOM   3589 C CA  . ALA B 1 202 ? 17.725  -3.851  -38.704 1.00 36.94 ? 240 ALA B CA  1 
ATOM   3590 C C   . ALA B 1 202 ? 19.075  -4.406  -39.144 1.00 37.28 ? 240 ALA B C   1 
ATOM   3591 O O   . ALA B 1 202 ? 19.147  -5.269  -40.008 1.00 36.92 ? 240 ALA B O   1 
ATOM   3592 C CB  . ALA B 1 202 ? 17.079  -4.741  -37.665 1.00 36.74 ? 240 ALA B CB  1 
ATOM   3593 N N   . TRP B 1 203 ? 20.135  -3.851  -38.559 1.00 38.23 ? 241 TRP B N   1 
ATOM   3594 C CA  . TRP B 1 203 ? 21.479  -4.387  -38.701 1.00 38.44 ? 241 TRP B CA  1 
ATOM   3595 C C   . TRP B 1 203 ? 21.893  -4.931  -37.345 1.00 39.65 ? 241 TRP B C   1 
ATOM   3596 O O   . TRP B 1 203 ? 21.922  -4.187  -36.360 1.00 39.97 ? 241 TRP B O   1 
ATOM   3597 C CB  . TRP B 1 203 ? 22.456  -3.310  -39.142 1.00 37.42 ? 241 TRP B CB  1 
ATOM   3598 C CG  . TRP B 1 203 ? 22.195  -2.720  -40.485 1.00 36.11 ? 241 TRP B CG  1 
ATOM   3599 C CD1 . TRP B 1 203 ? 21.450  -3.252  -41.488 1.00 36.15 ? 241 TRP B CD1 1 
ATOM   3600 C CD2 . TRP B 1 203 ? 22.729  -1.493  -40.989 1.00 35.57 ? 241 TRP B CD2 1 
ATOM   3601 N NE1 . TRP B 1 203 ? 21.464  -2.424  -42.582 1.00 35.74 ? 241 TRP B NE1 1 
ATOM   3602 C CE2 . TRP B 1 203 ? 22.244  -1.335  -42.301 1.00 35.45 ? 241 TRP B CE2 1 
ATOM   3603 C CE3 . TRP B 1 203 ? 23.564  -0.500  -40.448 1.00 35.76 ? 241 TRP B CE3 1 
ATOM   3604 C CZ2 . TRP B 1 203 ? 22.571  -0.231  -43.090 1.00 36.26 ? 241 TRP B CZ2 1 
ATOM   3605 C CZ3 . TRP B 1 203 ? 23.879  0.603   -41.221 1.00 35.71 ? 241 TRP B CZ3 1 
ATOM   3606 C CH2 . TRP B 1 203 ? 23.387  0.729   -42.531 1.00 36.48 ? 241 TRP B CH2 1 
ATOM   3607 N N   . VAL B 1 204 ? 22.181  -6.234  -37.296 1.00 41.30 ? 242 VAL B N   1 
ATOM   3608 C CA  . VAL B 1 204 ? 22.546  -6.901  -36.044 1.00 42.76 ? 242 VAL B CA  1 
ATOM   3609 C C   . VAL B 1 204 ? 24.047  -7.099  -36.011 1.00 43.92 ? 242 VAL B C   1 
ATOM   3610 O O   . VAL B 1 204 ? 24.624  -7.740  -36.893 1.00 44.69 ? 242 VAL B O   1 
ATOM   3611 C CB  . VAL B 1 204 ? 21.833  -8.255  -35.828 1.00 42.33 ? 242 VAL B CB  1 
ATOM   3612 C CG1 . VAL B 1 204 ? 21.408  -8.381  -34.378 1.00 42.15 ? 242 VAL B CG1 1 
ATOM   3613 C CG2 . VAL B 1 204 ? 20.631  -8.383  -36.725 1.00 42.52 ? 242 VAL B CG2 1 
ATOM   3614 N N   . ILE B 1 205 ? 24.671  -6.534  -34.985 1.00 45.63 ? 243 ILE B N   1 
ATOM   3615 C CA  . ILE B 1 205 ? 26.124  -6.467  -34.922 1.00 46.85 ? 243 ILE B CA  1 
ATOM   3616 C C   . ILE B 1 205 ? 26.737  -7.653  -34.157 1.00 47.67 ? 243 ILE B C   1 
ATOM   3617 O O   . ILE B 1 205 ? 26.528  -7.798  -32.945 1.00 47.87 ? 243 ILE B O   1 
ATOM   3618 C CB  . ILE B 1 205 ? 26.595  -5.107  -34.305 1.00 46.42 ? 243 ILE B CB  1 
ATOM   3619 C CG1 . ILE B 1 205 ? 25.739  -3.924  -34.804 1.00 46.23 ? 243 ILE B CG1 1 
ATOM   3620 C CG2 . ILE B 1 205 ? 28.092  -4.885  -34.570 1.00 46.76 ? 243 ILE B CG2 1 
ATOM   3621 C CD1 . ILE B 1 205 ? 25.778  -3.674  -36.309 1.00 44.56 ? 243 ILE B CD1 1 
ATOM   3622 N N   . HIS B 1 206 ? 27.503  -8.479  -34.868 1.00 48.87 ? 244 HIS B N   1 
ATOM   3623 C CA  . HIS B 1 206 ? 28.221  -9.601  -34.265 1.00 50.15 ? 244 HIS B CA  1 
ATOM   3624 C C   . HIS B 1 206 ? 29.268  -9.135  -33.242 1.00 50.93 ? 244 HIS B C   1 
ATOM   3625 O O   . HIS B 1 206 ? 29.354  -7.951  -32.914 1.00 50.93 ? 244 HIS B O   1 
ATOM   3626 C CB  . HIS B 1 206 ? 28.885  -10.451 -35.354 1.00 50.14 ? 244 HIS B CB  1 
ATOM   3627 C CG  . HIS B 1 206 ? 27.941  -11.362 -36.080 1.00 50.81 ? 244 HIS B CG  1 
ATOM   3628 N ND1 . HIS B 1 206 ? 26.762  -10.922 -36.645 1.00 51.23 ? 244 HIS B ND1 1 
ATOM   3629 C CD2 . HIS B 1 206 ? 28.019  -12.687 -36.357 1.00 51.49 ? 244 HIS B CD2 1 
ATOM   3630 C CE1 . HIS B 1 206 ? 26.147  -11.939 -37.222 1.00 51.24 ? 244 HIS B CE1 1 
ATOM   3631 N NE2 . HIS B 1 206 ? 26.889  -13.021 -37.064 1.00 51.66 ? 244 HIS B NE2 1 
ATOM   3632 N N   . GLY B 1 207 ? 30.062  -10.075 -32.737 1.00 52.13 ? 245 GLY B N   1 
ATOM   3633 C CA  . GLY B 1 207 ? 31.080  -9.754  -31.736 1.00 53.35 ? 245 GLY B CA  1 
ATOM   3634 C C   . GLY B 1 207 ? 32.498  -9.934  -32.241 1.00 54.00 ? 245 GLY B C   1 
ATOM   3635 O O   . GLY B 1 207 ? 33.131  -10.951 -31.953 1.00 54.13 ? 245 GLY B O   1 
ATOM   3636 N N   . GLY B 1 208 ? 32.992  -8.939  -32.985 1.00 54.59 ? 246 GLY B N   1 
ATOM   3637 C CA  . GLY B 1 208 ? 34.338  -8.972  -33.581 1.00 55.10 ? 246 GLY B CA  1 
ATOM   3638 C C   . GLY B 1 208 ? 34.484  -10.021 -34.669 1.00 55.41 ? 246 GLY B C   1 
ATOM   3639 O O   . GLY B 1 208 ? 33.849  -9.923  -35.720 1.00 55.57 ? 246 GLY B O   1 
ATOM   3640 N N   . ARG B 1 209 ? 35.339  -11.013 -34.416 1.00 55.52 ? 247 ARG B N   1 
ATOM   3641 C CA  . ARG B 1 209 ? 35.453  -12.199 -35.264 1.00 55.82 ? 247 ARG B CA  1 
ATOM   3642 C C   . ARG B 1 209 ? 34.665  -13.352 -34.663 1.00 55.97 ? 247 ARG B C   1 
ATOM   3643 O O   . ARG B 1 209 ? 34.012  -13.189 -33.626 1.00 56.12 ? 247 ARG B O   1 
ATOM   3644 N N   . GLU B 1 210 ? 34.722  -14.515 -35.310 1.00 55.96 ? 248 GLU B N   1 
ATOM   3645 C CA  . GLU B 1 210 ? 33.974  -15.698 -34.865 1.00 56.01 ? 248 GLU B CA  1 
ATOM   3646 C C   . GLU B 1 210 ? 32.529  -15.688 -35.341 1.00 55.95 ? 248 GLU B C   1 
ATOM   3647 O O   . GLU B 1 210 ? 31.669  -15.042 -34.731 1.00 56.08 ? 248 GLU B O   1 
ATOM   3648 N N   . ASP B 1 211 ? 32.264  -16.420 -36.425 1.00 55.93 ? 249 ASP B N   1 
ATOM   3649 C CA  . ASP B 1 211 ? 30.954  -16.411 -37.094 1.00 55.59 ? 249 ASP B CA  1 
ATOM   3650 C C   . ASP B 1 211 ? 29.854  -17.143 -36.348 1.00 55.26 ? 249 ASP B C   1 
ATOM   3651 O O   . ASP B 1 211 ? 29.531  -18.293 -36.666 1.00 55.19 ? 249 ASP B O   1 
ATOM   3652 N N   . SER B 1 212 ? 29.271  -16.461 -35.362 1.00 54.94 ? 250 SER B N   1 
ATOM   3653 C CA  . SER B 1 212 ? 28.239  -17.053 -34.507 1.00 54.42 ? 250 SER B CA  1 
ATOM   3654 C C   . SER B 1 212 ? 26.816  -16.837 -35.037 1.00 54.03 ? 250 SER B C   1 
ATOM   3655 O O   . SER B 1 212 ? 26.077  -15.999 -34.515 1.00 54.23 ? 250 SER B O   1 
ATOM   3656 C CB  . SER B 1 212 ? 28.382  -16.572 -33.048 1.00 54.30 ? 250 SER B CB  1 
ATOM   3657 O OG  . SER B 1 212 ? 28.676  -15.185 -32.976 1.00 53.98 ? 250 SER B OG  1 
ATOM   3658 N N   . ARG B 1 213 ? 26.462  -17.601 -36.078 1.00 53.28 ? 251 ARG B N   1 
ATOM   3659 C CA  . ARG B 1 213 ? 25.083  -17.745 -36.613 1.00 52.59 ? 251 ARG B CA  1 
ATOM   3660 C C   . ARG B 1 213 ? 24.280  -16.511 -37.064 1.00 52.47 ? 251 ARG B C   1 
ATOM   3661 O O   . ARG B 1 213 ? 24.228  -15.485 -36.361 1.00 52.65 ? 251 ARG B O   1 
ATOM   3662 C CB  . ARG B 1 213 ? 24.199  -18.622 -35.700 1.00 52.37 ? 251 ARG B CB  1 
ATOM   3663 C CG  . ARG B 1 213 ? 24.729  -18.891 -34.298 1.00 51.09 ? 251 ARG B CG  1 
ATOM   3664 C CD  . ARG B 1 213 ? 24.119  -18.001 -33.242 1.00 47.18 ? 251 ARG B CD  1 
ATOM   3665 N NE  . ARG B 1 213 ? 25.184  -17.489 -32.378 1.00 45.72 ? 251 ARG B NE  1 
ATOM   3666 C CZ  . ARG B 1 213 ? 24.969  -16.963 -31.163 1.00 45.75 ? 251 ARG B CZ  1 
ATOM   3667 N NH1 . ARG B 1 213 ? 23.732  -16.886 -30.651 1.00 45.43 ? 251 ARG B NH1 1 
ATOM   3668 N NH2 . ARG B 1 213 ? 26.003  -16.520 -30.461 1.00 45.70 ? 251 ARG B NH2 1 
ATOM   3669 N N   . ASP B 1 214 ? 23.642  -16.661 -38.243 1.00 52.24 ? 252 ASP B N   1 
ATOM   3670 C CA  . ASP B 1 214 ? 22.584  -15.762 -38.737 1.00 51.89 ? 252 ASP B CA  1 
ATOM   3671 C C   . ASP B 1 214 ? 21.746  -15.193 -37.593 1.00 51.71 ? 252 ASP B C   1 
ATOM   3672 O O   . ASP B 1 214 ? 20.762  -15.802 -37.158 1.00 51.43 ? 252 ASP B O   1 
ATOM   3673 C CB  . ASP B 1 214 ? 21.684  -16.539 -39.717 1.00 51.85 ? 252 ASP B CB  1 
ATOM   3674 C CG  . ASP B 1 214 ? 20.764  -15.643 -40.535 1.00 51.65 ? 252 ASP B CG  1 
ATOM   3675 O OD1 . ASP B 1 214 ? 19.918  -14.896 -39.957 1.00 51.57 ? 252 ASP B OD1 1 
ATOM   3676 O OD2 . ASP B 1 214 ? 20.872  -15.699 -41.785 1.00 50.89 ? 252 ASP B OD2 1 
ATOM   3677 N N   . LEU B 1 215 ? 22.144  -14.018 -37.112 1.00 51.59 ? 253 LEU B N   1 
ATOM   3678 C CA  . LEU B 1 215 ? 21.541  -13.444 -35.923 1.00 51.44 ? 253 LEU B CA  1 
ATOM   3679 C C   . LEU B 1 215 ? 20.139  -12.879 -36.166 1.00 51.45 ? 253 LEU B C   1 
ATOM   3680 O O   . LEU B 1 215 ? 19.445  -12.495 -35.221 1.00 51.47 ? 253 LEU B O   1 
ATOM   3681 C CB  . LEU B 1 215 ? 22.470  -12.391 -35.305 1.00 51.61 ? 253 LEU B CB  1 
ATOM   3682 C CG  . LEU B 1 215 ? 23.622  -12.915 -34.437 1.00 51.64 ? 253 LEU B CG  1 
ATOM   3683 C CD1 . LEU B 1 215 ? 24.552  -11.784 -34.018 1.00 51.37 ? 253 LEU B CD1 1 
ATOM   3684 C CD2 . LEU B 1 215 ? 23.108  -13.680 -33.210 1.00 51.61 ? 253 LEU B CD2 1 
ATOM   3685 N N   . CYS B 1 216 ? 19.709  -12.852 -37.425 1.00 51.30 ? 254 CYS B N   1 
ATOM   3686 C CA  . CYS B 1 216 ? 18.379  -12.340 -37.747 1.00 51.13 ? 254 CYS B CA  1 
ATOM   3687 C C   . CYS B 1 216 ? 17.246  -13.286 -37.363 1.00 51.33 ? 254 CYS B C   1 
ATOM   3688 O O   . CYS B 1 216 ? 16.091  -12.866 -37.302 1.00 51.50 ? 254 CYS B O   1 
ATOM   3689 C CB  . CYS B 1 216 ? 18.288  -11.952 -39.218 1.00 50.78 ? 254 CYS B CB  1 
ATOM   3690 S SG  . CYS B 1 216 ? 19.126  -10.398 -39.552 1.00 50.00 ? 254 CYS B SG  1 
ATOM   3691 N N   . GLN B 1 217 ? 17.581  -14.546 -37.082 1.00 51.28 ? 255 GLN B N   1 
ATOM   3692 C CA  . GLN B 1 217 ? 16.581  -15.547 -36.694 1.00 51.51 ? 255 GLN B CA  1 
ATOM   3693 C C   . GLN B 1 217 ? 16.417  -15.677 -35.173 1.00 51.71 ? 255 GLN B C   1 
ATOM   3694 O O   . GLN B 1 217 ? 15.863  -16.658 -34.673 1.00 51.81 ? 255 GLN B O   1 
ATOM   3695 C CB  . GLN B 1 217 ? 16.884  -16.908 -37.350 1.00 51.36 ? 255 GLN B CB  1 
ATOM   3696 C CG  . GLN B 1 217 ? 17.070  -16.849 -38.873 1.00 50.92 ? 255 GLN B CG  1 
ATOM   3697 C CD  . GLN B 1 217 ? 15.758  -16.844 -39.660 1.00 50.75 ? 255 GLN B CD  1 
ATOM   3698 O OE1 . GLN B 1 217 ? 15.696  -17.319 -40.806 1.00 51.27 ? 255 GLN B OE1 1 
ATOM   3699 N NE2 . GLN B 1 217 ? 14.700  -16.302 -39.056 1.00 49.95 ? 255 GLN B NE2 1 
ATOM   3700 N N   . ASP B 1 218 ? 16.901  -14.666 -34.459 1.00 52.05 ? 256 ASP B N   1 
ATOM   3701 C CA  . ASP B 1 218 ? 16.737  -14.532 -33.015 1.00 52.55 ? 256 ASP B CA  1 
ATOM   3702 C C   . ASP B 1 218 ? 15.269  -14.202 -32.689 1.00 52.83 ? 256 ASP B C   1 
ATOM   3703 O O   . ASP B 1 218 ? 14.636  -13.429 -33.414 1.00 52.95 ? 256 ASP B O   1 
ATOM   3704 C CB  . ASP B 1 218 ? 17.674  -13.416 -32.519 1.00 52.64 ? 256 ASP B CB  1 
ATOM   3705 C CG  . ASP B 1 218 ? 17.889  -13.427 -31.008 1.00 52.81 ? 256 ASP B CG  1 
ATOM   3706 O OD1 . ASP B 1 218 ? 16.961  -13.043 -30.262 1.00 53.43 ? 256 ASP B OD1 1 
ATOM   3707 O OD2 . ASP B 1 218 ? 19.011  -13.773 -30.565 1.00 52.29 ? 256 ASP B OD2 1 
ATOM   3708 N N   . PRO B 1 219 ? 14.716  -14.810 -31.616 1.00 53.03 ? 257 PRO B N   1 
ATOM   3709 C CA  . PRO B 1 219 ? 13.374  -14.536 -31.068 1.00 52.90 ? 257 PRO B CA  1 
ATOM   3710 C C   . PRO B 1 219 ? 13.012  -13.058 -30.907 1.00 52.64 ? 257 PRO B C   1 
ATOM   3711 O O   . PRO B 1 219 ? 11.952  -12.633 -31.366 1.00 52.60 ? 257 PRO B O   1 
ATOM   3712 C CB  . PRO B 1 219 ? 13.417  -15.203 -29.681 1.00 52.99 ? 257 PRO B CB  1 
ATOM   3713 C CG  . PRO B 1 219 ? 14.863  -15.621 -29.470 1.00 53.29 ? 257 PRO B CG  1 
ATOM   3714 C CD  . PRO B 1 219 ? 15.376  -15.879 -30.849 1.00 53.09 ? 257 PRO B CD  1 
ATOM   3715 N N   . THR B 1 220 ? 13.875  -12.294 -30.242 1.00 52.35 ? 258 THR B N   1 
ATOM   3716 C CA  . THR B 1 220 ? 13.640  -10.867 -30.013 1.00 52.14 ? 258 THR B CA  1 
ATOM   3717 C C   . THR B 1 220 ? 13.532  -10.080 -31.315 1.00 51.90 ? 258 THR B C   1 
ATOM   3718 O O   . THR B 1 220 ? 12.786  -9.101  -31.393 1.00 51.81 ? 258 THR B O   1 
ATOM   3719 C CB  . THR B 1 220 ? 14.712  -10.255 -29.102 1.00 52.09 ? 258 THR B CB  1 
ATOM   3720 O OG1 . THR B 1 220 ? 15.885  -11.079 -29.133 1.00 51.94 ? 258 THR B OG1 1 
ATOM   3721 C CG2 . THR B 1 220 ? 14.199  -10.189 -27.679 1.00 52.00 ? 258 THR B CG2 1 
ATOM   3722 N N   . ILE B 1 221 ? 14.275  -10.523 -32.328 1.00 51.75 ? 259 ILE B N   1 
ATOM   3723 C CA  . ILE B 1 221 ? 14.129  -10.023 -33.693 1.00 51.72 ? 259 ILE B CA  1 
ATOM   3724 C C   . ILE B 1 221 ? 12.779  -10.444 -34.288 1.00 51.76 ? 259 ILE B C   1 
ATOM   3725 O O   . ILE B 1 221 ? 12.071  -9.614  -34.858 1.00 51.80 ? 259 ILE B O   1 
ATOM   3726 C CB  . ILE B 1 221 ? 15.291  -10.505 -34.607 1.00 51.90 ? 259 ILE B CB  1 
ATOM   3727 C CG1 . ILE B 1 221 ? 16.630  -9.868  -34.188 1.00 51.74 ? 259 ILE B CG1 1 
ATOM   3728 C CG2 . ILE B 1 221 ? 14.964  -10.289 -36.104 1.00 52.10 ? 259 ILE B CG2 1 
ATOM   3729 C CD1 . ILE B 1 221 ? 16.842  -8.418  -34.628 1.00 52.11 ? 259 ILE B CD1 1 
ATOM   3730 N N   . LYS B 1 222 ? 12.424  -11.724 -34.148 1.00 51.56 ? 260 LYS B N   1 
ATOM   3731 C CA  . LYS B 1 222 ? 11.124  -12.225 -34.610 1.00 51.42 ? 260 LYS B CA  1 
ATOM   3732 C C   . LYS B 1 222 ? 9.973   -11.486 -33.938 1.00 51.52 ? 260 LYS B C   1 
ATOM   3733 O O   . LYS B 1 222 ? 8.894   -11.351 -34.512 1.00 51.55 ? 260 LYS B O   1 
ATOM   3734 C CB  . LYS B 1 222 ? 11.004  -13.725 -34.358 1.00 51.23 ? 260 LYS B CB  1 
ATOM   3735 C CG  . LYS B 1 222 ? 11.927  -14.576 -35.224 1.00 51.19 ? 260 LYS B CG  1 
ATOM   3736 C CD  . LYS B 1 222 ? 11.376  -14.806 -36.642 1.00 50.93 ? 260 LYS B CD  1 
ATOM   3737 C CE  . LYS B 1 222 ? 10.175  -15.759 -36.657 1.00 51.03 ? 260 LYS B CE  1 
ATOM   3738 N NZ  . LYS B 1 222 ? 10.510  -17.157 -36.240 1.00 51.59 ? 260 LYS B NZ  1 
ATOM   3739 N N   . GLU B 1 223 ? 10.226  -11.001 -32.722 1.00 51.65 ? 261 GLU B N   1 
ATOM   3740 C CA  . GLU B 1 223 ? 9.274   -10.191 -31.966 1.00 51.86 ? 261 GLU B CA  1 
ATOM   3741 C C   . GLU B 1 223 ? 9.163   -8.773  -32.530 1.00 51.98 ? 261 GLU B C   1 
ATOM   3742 O O   . GLU B 1 223 ? 8.074   -8.351  -32.919 1.00 52.38 ? 261 GLU B O   1 
ATOM   3743 C CB  . GLU B 1 223 ? 9.667   -10.142 -30.488 1.00 51.83 ? 261 GLU B CB  1 
ATOM   3744 C CG  . GLU B 1 223 ? 8.666   -9.418  -29.599 1.00 52.07 ? 261 GLU B CG  1 
ATOM   3745 C CD  . GLU B 1 223 ? 9.281   -8.965  -28.291 1.00 53.20 ? 261 GLU B CD  1 
ATOM   3746 O OE1 . GLU B 1 223 ? 10.321  -9.534  -27.889 1.00 53.92 ? 261 GLU B OE1 1 
ATOM   3747 O OE2 . GLU B 1 223 ? 8.729   -8.033  -27.666 1.00 53.51 ? 261 GLU B OE2 1 
ATOM   3748 N N   . LEU B 1 224 ? 10.280  -8.041  -32.556 1.00 51.87 ? 262 LEU B N   1 
ATOM   3749 C CA  . LEU B 1 224 ? 10.351  -6.745  -33.238 1.00 51.56 ? 262 LEU B CA  1 
ATOM   3750 C C   . LEU B 1 224 ? 9.733   -6.830  -34.644 1.00 51.60 ? 262 LEU B C   1 
ATOM   3751 O O   . LEU B 1 224 ? 8.958   -5.957  -35.036 1.00 51.72 ? 262 LEU B O   1 
ATOM   3752 C CB  . LEU B 1 224 ? 11.803  -6.238  -33.306 1.00 51.44 ? 262 LEU B CB  1 
ATOM   3753 C CG  . LEU B 1 224 ? 12.200  -5.169  -34.336 1.00 50.55 ? 262 LEU B CG  1 
ATOM   3754 C CD1 . LEU B 1 224 ? 11.560  -3.844  -34.018 1.00 50.09 ? 262 LEU B CD1 1 
ATOM   3755 C CD2 . LEU B 1 224 ? 13.704  -5.028  -34.422 1.00 49.19 ? 262 LEU B CD2 1 
ATOM   3756 N N   . GLU B 1 225 ? 10.077  -7.881  -35.385 1.00 51.50 ? 263 GLU B N   1 
ATOM   3757 C CA  . GLU B 1 225 ? 9.483   -8.141  -36.693 1.00 51.56 ? 263 GLU B CA  1 
ATOM   3758 C C   . GLU B 1 225 ? 7.961   -8.058  -36.643 1.00 51.64 ? 263 GLU B C   1 
ATOM   3759 O O   . GLU B 1 225 ? 7.361   -7.251  -37.349 1.00 51.84 ? 263 GLU B O   1 
ATOM   3760 C CB  . GLU B 1 225 ? 9.915   -9.510  -37.232 1.00 51.61 ? 263 GLU B CB  1 
ATOM   3761 C CG  . GLU B 1 225 ? 9.293   -9.882  -38.577 1.00 51.31 ? 263 GLU B CG  1 
ATOM   3762 C CD  . GLU B 1 225 ? 9.839   -11.181 -39.144 1.00 51.42 ? 263 GLU B CD  1 
ATOM   3763 O OE1 . GLU B 1 225 ? 9.980   -12.178 -38.378 1.00 51.74 ? 263 GLU B OE1 1 
ATOM   3764 O OE2 . GLU B 1 225 ? 10.129  -11.211 -40.368 1.00 50.66 ? 263 GLU B OE2 1 
ATOM   3765 N N   . SER B 1 226 ? 7.346   -8.873  -35.792 1.00 51.53 ? 264 SER B N   1 
ATOM   3766 C CA  . SER B 1 226 ? 5.887   -8.969  -35.748 1.00 51.68 ? 264 SER B CA  1 
ATOM   3767 C C   . SER B 1 226 ? 5.230   -7.673  -35.265 1.00 51.60 ? 264 SER B C   1 
ATOM   3768 O O   . SER B 1 226 ? 4.038   -7.456  -35.475 1.00 51.78 ? 264 SER B O   1 
ATOM   3769 C CB  . SER B 1 226 ? 5.445   -10.159 -34.890 1.00 51.52 ? 264 SER B CB  1 
ATOM   3770 O OG  . SER B 1 226 ? 4.219   -10.697 -35.366 1.00 52.02 ? 264 SER B OG  1 
ATOM   3771 N N   . ILE B 1 227 ? 6.019   -6.814  -34.633 1.00 51.45 ? 265 ILE B N   1 
ATOM   3772 C CA  . ILE B 1 227 ? 5.527   -5.539  -34.129 1.00 51.50 ? 265 ILE B CA  1 
ATOM   3773 C C   . ILE B 1 227 ? 5.369   -4.533  -35.265 1.00 51.48 ? 265 ILE B C   1 
ATOM   3774 O O   . ILE B 1 227 ? 4.252   -4.087  -35.533 1.00 51.97 ? 265 ILE B O   1 
ATOM   3775 C CB  . ILE B 1 227 ? 6.428   -4.987  -33.012 1.00 51.35 ? 265 ILE B CB  1 
ATOM   3776 C CG1 . ILE B 1 227 ? 6.251   -5.826  -31.744 1.00 51.29 ? 265 ILE B CG1 1 
ATOM   3777 C CG2 . ILE B 1 227 ? 6.130   -3.509  -32.749 1.00 51.66 ? 265 ILE B CG2 1 
ATOM   3778 C CD1 . ILE B 1 227 ? 7.414   -5.724  -30.761 1.00 52.49 ? 265 ILE B CD1 1 
ATOM   3779 N N   . ILE B 1 228 ? 6.473   -4.201  -35.942 1.00 51.07 ? 266 ILE B N   1 
ATOM   3780 C CA  . ILE B 1 228 ? 6.440   -3.258  -37.071 1.00 50.49 ? 266 ILE B CA  1 
ATOM   3781 C C   . ILE B 1 228 ? 5.599   -3.791  -38.238 1.00 50.09 ? 266 ILE B C   1 
ATOM   3782 O O   . ILE B 1 228 ? 5.058   -3.015  -39.023 1.00 50.10 ? 266 ILE B O   1 
ATOM   3783 C CB  . ILE B 1 228 ? 7.872   -2.801  -37.558 1.00 50.72 ? 266 ILE B CB  1 
ATOM   3784 C CG1 . ILE B 1 228 ? 8.724   -3.990  -38.002 1.00 50.92 ? 266 ILE B CG1 1 
ATOM   3785 C CG2 . ILE B 1 228 ? 8.605   -1.974  -36.500 1.00 49.87 ? 266 ILE B CG2 1 
ATOM   3786 C CD1 . ILE B 1 228 ? 8.711   -4.200  -39.478 1.00 51.68 ? 266 ILE B CD1 1 
ATOM   3787 N N   . SER B 1 229 ? 5.496   -5.116  -38.337 1.00 49.62 ? 267 SER B N   1 
ATOM   3788 C CA  . SER B 1 229 ? 4.588   -5.766  -39.283 1.00 49.00 ? 267 SER B CA  1 
ATOM   3789 C C   . SER B 1 229 ? 3.132   -5.425  -38.974 1.00 48.52 ? 267 SER B C   1 
ATOM   3790 O O   . SER B 1 229 ? 2.336   -5.208  -39.889 1.00 48.28 ? 267 SER B O   1 
ATOM   3791 C CB  . SER B 1 229 ? 4.788   -7.283  -39.274 1.00 49.14 ? 267 SER B CB  1 
ATOM   3792 O OG  . SER B 1 229 ? 6.120   -7.622  -39.626 1.00 49.29 ? 267 SER B OG  1 
ATOM   3793 N N   . LYS B 1 230 ? 2.800   -5.377  -37.683 1.00 48.03 ? 268 LYS B N   1 
ATOM   3794 C CA  . LYS B 1 230 ? 1.467   -4.973  -37.218 1.00 47.66 ? 268 LYS B CA  1 
ATOM   3795 C C   . LYS B 1 230 ? 1.182   -3.488  -37.473 1.00 47.26 ? 268 LYS B C   1 
ATOM   3796 O O   . LYS B 1 230 ? 0.030   -3.109  -37.687 1.00 47.50 ? 268 LYS B O   1 
ATOM   3797 C CB  . LYS B 1 230 ? 1.268   -5.314  -35.729 1.00 47.78 ? 268 LYS B CB  1 
ATOM   3798 C CG  . LYS B 1 230 ? 0.258   -6.433  -35.441 1.00 47.70 ? 268 LYS B CG  1 
ATOM   3799 C CD  . LYS B 1 230 ? 0.711   -7.806  -35.946 1.00 47.66 ? 268 LYS B CD  1 
ATOM   3800 C CE  . LYS B 1 230 ? -0.350  -8.884  -35.694 1.00 47.59 ? 268 LYS B CE  1 
ATOM   3801 N NZ  . LYS B 1 230 ? -1.597  -8.715  -36.515 1.00 46.64 ? 268 LYS B NZ  1 
ATOM   3802 N N   . ARG B 1 231 ? 2.224   -2.660  -37.460 1.00 46.21 ? 269 ARG B N   1 
ATOM   3803 C CA  . ARG B 1 231 ? 2.097   -1.243  -37.829 1.00 45.62 ? 269 ARG B CA  1 
ATOM   3804 C C   . ARG B 1 231 ? 2.084   -1.065  -39.350 1.00 44.27 ? 269 ARG B C   1 
ATOM   3805 O O   . ARG B 1 231 ? 2.089   0.073   -39.861 1.00 43.64 ? 269 ARG B O   1 
ATOM   3806 C CB  . ARG B 1 231 ? 3.216   -0.408  -37.190 1.00 45.28 ? 269 ARG B CB  1 
ATOM   3807 C CG  . ARG B 1 231 ? 3.282   -0.550  -35.677 1.00 46.36 ? 269 ARG B CG  1 
ATOM   3808 C CD  . ARG B 1 231 ? 4.205   0.463   -35.027 1.00 47.08 ? 269 ARG B CD  1 
ATOM   3809 N NE  . ARG B 1 231 ? 3.535   1.723   -34.692 1.00 50.70 ? 269 ARG B NE  1 
ATOM   3810 C CZ  . ARG B 1 231 ? 3.481   2.784   -35.493 1.00 52.08 ? 269 ARG B CZ  1 
ATOM   3811 N NH1 . ARG B 1 231 ? 4.036   2.741   -36.697 1.00 54.26 ? 269 ARG B NH1 1 
ATOM   3812 N NH2 . ARG B 1 231 ? 2.860   3.888   -35.101 1.00 52.68 ? 269 ARG B NH2 1 
ATOM   3813 N N   . ASN B 1 232 ? 2.063   -2.190  -40.069 1.00 43.71 ? 270 ASN B N   1 
ATOM   3814 C CA  . ASN B 1 232 ? 2.104   -2.242  -41.531 1.00 42.96 ? 270 ASN B CA  1 
ATOM   3815 C C   . ASN B 1 232 ? 3.358   -1.601  -42.121 1.00 42.32 ? 270 ASN B C   1 
ATOM   3816 O O   . ASN B 1 232 ? 3.288   -0.714  -42.984 1.00 42.47 ? 270 ASN B O   1 
ATOM   3817 C CB  . ASN B 1 232 ? 0.834   -1.674  -42.168 1.00 42.98 ? 270 ASN B CB  1 
ATOM   3818 C CG  . ASN B 1 232 ? 0.701   -2.059  -43.623 1.00 43.62 ? 270 ASN B CG  1 
ATOM   3819 O OD1 . ASN B 1 232 ? 0.239   -1.264  -44.439 1.00 44.78 ? 270 ASN B OD1 1 
ATOM   3820 N ND2 . ASN B 1 232 ? 1.121   -3.281  -43.960 1.00 43.87 ? 270 ASN B ND2 1 
ATOM   3821 N N   . ILE B 1 233 ? 4.512   -2.072  -41.630 1.00 41.25 ? 271 ILE B N   1 
ATOM   3822 C CA  . ILE B 1 233 ? 5.798   -1.645  -42.141 1.00 40.45 ? 271 ILE B CA  1 
ATOM   3823 C C   . ILE B 1 233 ? 6.569   -2.927  -42.432 1.00 40.16 ? 271 ILE B C   1 
ATOM   3824 O O   . ILE B 1 233 ? 6.609   -3.856  -41.565 1.00 39.91 ? 271 ILE B O   1 
ATOM   3825 C CB  . ILE B 1 233 ? 6.532   -0.758  -41.090 1.00 40.17 ? 271 ILE B CB  1 
ATOM   3826 C CG1 . ILE B 1 233 ? 5.837   0.604   -40.980 1.00 39.90 ? 271 ILE B CG1 1 
ATOM   3827 C CG2 . ILE B 1 233 ? 8.013   -0.568  -41.426 1.00 40.27 ? 271 ILE B CG2 1 
ATOM   3828 C CD1 . ILE B 1 233 ? 6.371   1.498   -39.872 1.00 37.62 ? 271 ILE B CD1 1 
ATOM   3829 N N   . GLN B 1 234 ? 7.139   -3.011  -43.644 1.00 40.24 ? 272 GLN B N   1 
ATOM   3830 C CA  . GLN B 1 234 ? 8.041   -4.121  -43.985 1.00 40.44 ? 272 GLN B CA  1 
ATOM   3831 C C   . GLN B 1 234 ? 9.257   -4.200  -43.044 1.00 40.68 ? 272 GLN B C   1 
ATOM   3832 O O   . GLN B 1 234 ? 9.804   -3.172  -42.612 1.00 40.19 ? 272 GLN B O   1 
ATOM   3833 C CB  . GLN B 1 234 ? 8.539   -4.002  -45.425 1.00 40.53 ? 272 GLN B CB  1 
ATOM   3834 C CG  . GLN B 1 234 ? 7.471   -3.961  -46.496 1.00 40.60 ? 272 GLN B CG  1 
ATOM   3835 C CD  . GLN B 1 234 ? 8.061   -3.694  -47.867 1.00 40.81 ? 272 GLN B CD  1 
ATOM   3836 O OE1 . GLN B 1 234 ? 8.436   -2.566  -48.191 1.00 41.83 ? 272 GLN B OE1 1 
ATOM   3837 N NE2 . GLN B 1 234 ? 8.154   -4.730  -48.675 1.00 40.99 ? 272 GLN B NE2 1 
ATOM   3838 N N   . PHE B 1 235 ? 9.667   -5.427  -42.727 1.00 40.83 ? 273 PHE B N   1 
ATOM   3839 C CA  . PHE B 1 235 ? 10.857  -5.656  -41.913 1.00 41.47 ? 273 PHE B CA  1 
ATOM   3840 C C   . PHE B 1 235 ? 11.963  -6.361  -42.687 1.00 41.49 ? 273 PHE B C   1 
ATOM   3841 O O   . PHE B 1 235 ? 11.779  -7.452  -43.194 1.00 41.82 ? 273 PHE B O   1 
ATOM   3842 C CB  . PHE B 1 235 ? 10.528  -6.443  -40.639 1.00 41.53 ? 273 PHE B CB  1 
ATOM   3843 C CG  . PHE B 1 235 ? 11.691  -6.569  -39.697 1.00 42.19 ? 273 PHE B CG  1 
ATOM   3844 C CD1 . PHE B 1 235 ? 12.001  -5.543  -38.817 1.00 42.30 ? 273 PHE B CD1 1 
ATOM   3845 C CD2 . PHE B 1 235 ? 12.492  -7.708  -39.706 1.00 42.93 ? 273 PHE B CD2 1 
ATOM   3846 C CE1 . PHE B 1 235 ? 13.081  -5.644  -37.952 1.00 42.65 ? 273 PHE B CE1 1 
ATOM   3847 C CE2 . PHE B 1 235 ? 13.578  -7.817  -38.839 1.00 43.15 ? 273 PHE B CE2 1 
ATOM   3848 C CZ  . PHE B 1 235 ? 13.872  -6.781  -37.965 1.00 42.24 ? 273 PHE B CZ  1 
ATOM   3849 N N   . SER B 1 236 ? 13.116  -5.718  -42.767 1.00 41.86 ? 274 SER B N   1 
ATOM   3850 C CA  . SER B 1 236 ? 14.298  -6.343  -43.319 1.00 41.92 ? 274 SER B CA  1 
ATOM   3851 C C   . SER B 1 236 ? 15.329  -6.450  -42.209 1.00 42.45 ? 274 SER B C   1 
ATOM   3852 O O   . SER B 1 236 ? 15.358  -5.630  -41.273 1.00 42.10 ? 274 SER B O   1 
ATOM   3853 C CB  . SER B 1 236 ? 14.835  -5.532  -44.497 1.00 41.80 ? 274 SER B CB  1 
ATOM   3854 O OG  . SER B 1 236 ? 16.107  -6.001  -44.912 1.00 41.79 ? 274 SER B OG  1 
ATOM   3855 N N   . CYS B 1 237 ? 16.164  -7.474  -42.307 1.00 43.23 ? 275 CYS B N   1 
ATOM   3856 C CA  . CYS B 1 237 ? 17.194  -7.710  -41.312 1.00 43.76 ? 275 CYS B CA  1 
ATOM   3857 C C   . CYS B 1 237 ? 18.507  -8.132  -41.972 1.00 43.97 ? 275 CYS B C   1 
ATOM   3858 O O   . CYS B 1 237 ? 18.504  -8.918  -42.919 1.00 43.66 ? 275 CYS B O   1 
ATOM   3859 C CB  . CYS B 1 237 ? 16.724  -8.760  -40.312 1.00 43.92 ? 275 CYS B CB  1 
ATOM   3860 S SG  . CYS B 1 237 ? 17.830  -8.958  -38.927 1.00 44.62 ? 275 CYS B SG  1 
ATOM   3861 N N   . LYS B 1 238 ? 19.621  -7.592  -41.469 1.00 44.23 ? 276 LYS B N   1 
ATOM   3862 C CA  . LYS B 1 238 ? 20.954  -7.894  -42.001 1.00 44.35 ? 276 LYS B CA  1 
ATOM   3863 C C   . LYS B 1 238 ? 21.966  -8.215  -40.890 1.00 44.42 ? 276 LYS B C   1 
ATOM   3864 O O   . LYS B 1 238 ? 21.830  -7.759  -39.752 1.00 44.52 ? 276 LYS B O   1 
ATOM   3865 C CB  . LYS B 1 238 ? 21.458  -6.750  -42.893 1.00 44.33 ? 276 LYS B CB  1 
ATOM   3866 C CG  . LYS B 1 238 ? 20.639  -6.506  -44.168 1.00 45.47 ? 276 LYS B CG  1 
ATOM   3867 C CD  . LYS B 1 238 ? 21.059  -7.423  -45.304 1.00 47.04 ? 276 LYS B CD  1 
ATOM   3868 C CE  . LYS B 1 238 ? 19.947  -7.655  -46.347 1.00 48.73 ? 276 LYS B CE  1 
ATOM   3869 N NZ  . LYS B 1 238 ? 19.736  -6.493  -47.254 1.00 49.11 ? 276 LYS B NZ  1 
ATOM   3870 N N   . ASN B 1 239 ? 22.969  -9.020  -41.238 1.00 44.73 ? 277 ASN B N   1 
ATOM   3871 C CA  . ASN B 1 239 ? 24.047  -9.403  -40.331 1.00 44.87 ? 277 ASN B CA  1 
ATOM   3872 C C   . ASN B 1 239 ? 25.333  -8.651  -40.673 1.00 45.13 ? 277 ASN B C   1 
ATOM   3873 O O   . ASN B 1 239 ? 25.935  -8.901  -41.726 1.00 44.93 ? 277 ASN B O   1 
ATOM   3874 C CB  . ASN B 1 239 ? 24.347  -10.909 -40.441 1.00 44.83 ? 277 ASN B CB  1 
ATOM   3875 C CG  . ASN B 1 239 ? 23.195  -11.796 -39.984 1.00 44.45 ? 277 ASN B CG  1 
ATOM   3876 O OD1 . ASN B 1 239 ? 22.880  -11.854 -38.722 1.00 43.80 ? 277 ASN B OD1 1 
ATOM   3877 N ND2 . ASN B 1 239 ? 22.613  -12.565 -40.950 1.00 42.53 ? 277 ASN B ND2 1 
ATOM   3878 N N   . ILE B 1 240 ? 25.752  -7.736  -39.802 1.00 45.47 ? 278 ILE B N   1 
ATOM   3879 C CA  . ILE B 1 240 ? 27.120  -7.210  -39.857 1.00 45.88 ? 278 ILE B CA  1 
ATOM   3880 C C   . ILE B 1 240 ? 28.044  -8.166  -39.088 1.00 46.05 ? 278 ILE B C   1 
ATOM   3881 O O   . ILE B 1 240 ? 28.055  -8.196  -37.841 1.00 45.76 ? 278 ILE B O   1 
ATOM   3882 C CB  . ILE B 1 240 ? 27.231  -5.733  -39.369 1.00 46.10 ? 278 ILE B CB  1 
ATOM   3883 C CG1 . ILE B 1 240 ? 26.838  -4.776  -40.491 1.00 46.51 ? 278 ILE B CG1 1 
ATOM   3884 C CG2 . ILE B 1 240 ? 28.647  -5.373  -38.942 1.00 46.16 ? 278 ILE B CG2 1 
ATOM   3885 C CD1 . ILE B 1 240 ? 25.436  -4.248  -40.377 1.00 47.51 ? 278 ILE B CD1 1 
ATOM   3886 N N   . TYR B 1 241 ? 28.788  -8.962  -39.861 1.00 46.25 ? 279 TYR B N   1 
ATOM   3887 C CA  . TYR B 1 241 ? 29.684  -9.977  -39.328 1.00 46.42 ? 279 TYR B CA  1 
ATOM   3888 C C   . TYR B 1 241 ? 30.974  -9.375  -38.777 1.00 46.47 ? 279 TYR B C   1 
ATOM   3889 O O   . TYR B 1 241 ? 31.151  -9.327  -37.554 1.00 46.57 ? 279 TYR B O   1 
ATOM   3890 C CB  . TYR B 1 241 ? 29.968  -11.041 -40.374 1.00 46.75 ? 279 TYR B CB  1 
ATOM   3891 C CG  . TYR B 1 241 ? 28.750  -11.847 -40.765 1.00 47.32 ? 279 TYR B CG  1 
ATOM   3892 C CD1 . TYR B 1 241 ? 28.236  -12.831 -39.918 1.00 47.39 ? 279 TYR B CD1 1 
ATOM   3893 C CD2 . TYR B 1 241 ? 28.118  -11.636 -41.989 1.00 47.79 ? 279 TYR B CD2 1 
ATOM   3894 C CE1 . TYR B 1 241 ? 27.118  -13.579 -40.276 1.00 47.22 ? 279 TYR B CE1 1 
ATOM   3895 C CE2 . TYR B 1 241 ? 27.004  -12.383 -42.359 1.00 48.01 ? 279 TYR B CE2 1 
ATOM   3896 C CZ  . TYR B 1 241 ? 26.512  -13.350 -41.498 1.00 47.68 ? 279 TYR B CZ  1 
ATOM   3897 O OH  . TYR B 1 241 ? 25.411  -14.086 -41.867 1.00 48.18 ? 279 TYR B OH  1 
ATOM   3898 N N   . ARG B 1 242 ? 31.883  -8.899  -39.653 1.00 46.13 ? 280 ARG B N   1 
ATOM   3899 C CA  . ARG B 1 242 ? 33.077  -8.147  -39.193 1.00 46.12 ? 280 ARG B CA  1 
ATOM   3900 C C   . ARG B 1 242 ? 32.758  -6.660  -38.990 1.00 45.92 ? 280 ARG B C   1 
ATOM   3901 O O   . ARG B 1 242 ? 32.718  -5.913  -39.968 1.00 45.31 ? 280 ARG B O   1 
ATOM   3902 N N   . PRO B 1 243 ? 32.520  -6.216  -37.728 1.00 46.24 ? 281 PRO B N   1 
ATOM   3903 C CA  . PRO B 1 243 ? 32.317  -4.772  -37.501 1.00 46.71 ? 281 PRO B CA  1 
ATOM   3904 C C   . PRO B 1 243 ? 33.523  -3.948  -37.966 1.00 47.17 ? 281 PRO B C   1 
ATOM   3905 O O   . PRO B 1 243 ? 33.350  -2.819  -38.448 1.00 47.11 ? 281 PRO B O   1 
ATOM   3906 C CB  . PRO B 1 243 ? 32.140  -4.663  -35.973 1.00 46.43 ? 281 PRO B CB  1 
ATOM   3907 C CG  . PRO B 1 243 ? 31.682  -6.013  -35.556 1.00 46.45 ? 281 PRO B CG  1 
ATOM   3908 C CD  . PRO B 1 243 ? 32.415  -6.975  -36.463 1.00 46.24 ? 281 PRO B CD  1 
ATOM   3909 N N   . ASP B 1 244 ? 34.715  -4.538  -37.829 1.00 47.59 ? 282 ASP B N   1 
ATOM   3910 C CA  . ASP B 1 244 ? 35.982  -3.973  -38.298 1.00 48.12 ? 282 ASP B CA  1 
ATOM   3911 C C   . ASP B 1 244 ? 36.004  -3.751  -39.815 1.00 48.11 ? 282 ASP B C   1 
ATOM   3912 O O   . ASP B 1 244 ? 36.259  -2.634  -40.285 1.00 48.21 ? 282 ASP B O   1 
ATOM   3913 C CB  . ASP B 1 244 ? 37.140  -4.912  -37.924 1.00 48.71 ? 282 ASP B CB  1 
ATOM   3914 C CG  . ASP B 1 244 ? 37.460  -4.909  -36.427 1.00 49.84 ? 282 ASP B CG  1 
ATOM   3915 O OD1 . ASP B 1 244 ? 36.644  -4.391  -35.626 1.00 50.10 ? 282 ASP B OD1 1 
ATOM   3916 O OD2 . ASP B 1 244 ? 38.547  -5.439  -36.067 1.00 51.44 ? 282 ASP B OD2 1 
ATOM   3917 N N   . LYS B 1 245 ? 35.759  -4.823  -40.569 1.00 47.71 ? 283 LYS B N   1 
ATOM   3918 C CA  . LYS B 1 245 ? 35.693  -4.752  -42.025 1.00 47.67 ? 283 LYS B CA  1 
ATOM   3919 C C   . LYS B 1 245 ? 34.523  -3.901  -42.508 1.00 47.51 ? 283 LYS B C   1 
ATOM   3920 O O   . LYS B 1 245 ? 34.646  -3.174  -43.496 1.00 47.54 ? 283 LYS B O   1 
ATOM   3921 C CB  . LYS B 1 245 ? 35.635  -6.152  -42.650 1.00 47.48 ? 283 LYS B CB  1 
ATOM   3922 C CG  . LYS B 1 245 ? 36.996  -6.632  -43.228 1.00 47.56 ? 283 LYS B CG  1 
ATOM   3923 C CD  . LYS B 1 245 ? 37.875  -7.371  -42.048 1.00 47.90 ? 283 LYS B CD  1 
ATOM   3924 C CE  . LYS B 1 245 ? 37.260  -8.894  -41.780 1.00 47.87 ? 283 LYS B CE  1 
ATOM   3925 N NZ  . LYS B 1 245 ? 36.995  -9.773  -43.198 1.00 45.98 ? 283 LYS B NZ  1 
ATOM   3926 N N   . PHE B 1 246 ? 33.389  -4.003  -41.819 1.00 47.37 ? 284 PHE B N   1 
ATOM   3927 C CA  . PHE B 1 246 ? 32.238  -3.164  -42.125 1.00 47.51 ? 284 PHE B CA  1 
ATOM   3928 C C   . PHE B 1 246 ? 32.697  -1.713  -42.242 1.00 47.99 ? 284 PHE B C   1 
ATOM   3929 O O   . PHE B 1 246 ? 32.563  -1.099  -43.307 1.00 47.86 ? 284 PHE B O   1 
ATOM   3930 C CB  . PHE B 1 246 ? 31.145  -3.319  -41.058 1.00 47.16 ? 284 PHE B CB  1 
ATOM   3931 C CG  . PHE B 1 246 ? 29.952  -2.433  -41.277 1.00 46.76 ? 284 PHE B CG  1 
ATOM   3932 C CD1 . PHE B 1 246 ? 29.129  -2.611  -42.380 1.00 45.24 ? 284 PHE B CD1 1 
ATOM   3933 C CD2 . PHE B 1 246 ? 29.651  -1.410  -40.375 1.00 46.83 ? 284 PHE B CD2 1 
ATOM   3934 C CE1 . PHE B 1 246 ? 28.026  -1.789  -42.590 1.00 45.65 ? 284 PHE B CE1 1 
ATOM   3935 C CE2 . PHE B 1 246 ? 28.544  -0.584  -40.580 1.00 46.41 ? 284 PHE B CE2 1 
ATOM   3936 C CZ  . PHE B 1 246 ? 27.732  -0.778  -41.692 1.00 44.83 ? 284 PHE B CZ  1 
ATOM   3937 N N   . LEU B 1 247 ? 33.291  -1.207  -41.160 1.00 48.63 ? 285 LEU B N   1 
ATOM   3938 C CA  . LEU B 1 247 ? 33.828  0.151   -41.092 1.00 49.79 ? 285 LEU B CA  1 
ATOM   3939 C C   . LEU B 1 247 ? 34.829  0.479   -42.181 1.00 50.15 ? 285 LEU B C   1 
ATOM   3940 O O   . LEU B 1 247 ? 34.832  1.597   -42.691 1.00 49.95 ? 285 LEU B O   1 
ATOM   3941 C CB  . LEU B 1 247 ? 34.478  0.404   -39.732 1.00 50.04 ? 285 LEU B CB  1 
ATOM   3942 C CG  . LEU B 1 247 ? 33.567  0.832   -38.596 1.00 51.42 ? 285 LEU B CG  1 
ATOM   3943 C CD1 . LEU B 1 247 ? 34.317  0.759   -37.262 1.00 52.63 ? 285 LEU B CD1 1 
ATOM   3944 C CD2 . LEU B 1 247 ? 33.009  2.238   -38.859 1.00 52.28 ? 285 LEU B CD2 1 
ATOM   3945 N N   . GLN B 1 248 ? 35.683  -0.493  -42.507 1.00 51.07 ? 286 GLN B N   1 
ATOM   3946 C CA  . GLN B 1 248 ? 36.618  -0.397  -43.616 1.00 51.96 ? 286 GLN B CA  1 
ATOM   3947 C C   . GLN B 1 248 ? 35.927  -0.078  -44.937 1.00 52.61 ? 286 GLN B C   1 
ATOM   3948 O O   . GLN B 1 248 ? 36.300  0.883   -45.613 1.00 52.62 ? 286 GLN B O   1 
ATOM   3949 C CB  . GLN B 1 248 ? 37.408  -1.708  -43.762 1.00 52.30 ? 286 GLN B CB  1 
ATOM   3950 C CG  . GLN B 1 248 ? 38.883  -1.646  -43.374 1.00 52.68 ? 286 GLN B CG  1 
ATOM   3951 C CD  . GLN B 1 248 ? 39.120  -0.982  -42.026 1.00 53.33 ? 286 GLN B CD  1 
ATOM   3952 O OE1 . GLN B 1 248 ? 38.978  0.244   -41.880 1.00 53.65 ? 286 GLN B OE1 1 
ATOM   3953 N NE2 . GLN B 1 248 ? 39.501  -1.788  -41.030 1.00 53.32 ? 286 GLN B NE2 1 
ATOM   3954 N N   . CYS B 1 249 ? 34.930  -0.892  -45.298 1.00 53.29 ? 287 CYS B N   1 
ATOM   3955 C CA  . CYS B 1 249 ? 34.228  -0.746  -46.575 1.00 54.12 ? 287 CYS B CA  1 
ATOM   3956 C C   . CYS B 1 249 ? 33.487  0.572   -46.673 1.00 54.18 ? 287 CYS B C   1 
ATOM   3957 O O   . CYS B 1 249 ? 33.499  1.205   -47.731 1.00 54.31 ? 287 CYS B O   1 
ATOM   3958 C CB  . CYS B 1 249 ? 33.266  -1.908  -46.827 1.00 54.37 ? 287 CYS B CB  1 
ATOM   3959 S SG  . CYS B 1 249 ? 34.086  -3.506  -46.887 1.00 56.72 ? 287 CYS B SG  1 
ATOM   3960 N N   . VAL B 1 250 ? 32.851  0.981   -45.574 1.00 54.27 ? 288 VAL B N   1 
ATOM   3961 C CA  . VAL B 1 250 ? 32.166  2.273   -45.526 1.00 54.53 ? 288 VAL B CA  1 
ATOM   3962 C C   . VAL B 1 250 ? 33.171  3.401   -45.761 1.00 55.18 ? 288 VAL B C   1 
ATOM   3963 O O   . VAL B 1 250 ? 32.902  4.334   -46.529 1.00 55.19 ? 288 VAL B O   1 
ATOM   3964 C CB  . VAL B 1 250 ? 31.428  2.527   -44.186 1.00 53.93 ? 288 VAL B CB  1 
ATOM   3965 C CG1 . VAL B 1 250 ? 30.490  3.681   -44.348 1.00 54.13 ? 288 VAL B CG1 1 
ATOM   3966 C CG2 . VAL B 1 250 ? 30.648  1.314   -43.737 1.00 53.02 ? 288 VAL B CG2 1 
ATOM   3967 N N   . LYS B 1 251 ? 34.328  3.290   -45.106 1.00 55.88 ? 289 LYS B N   1 
ATOM   3968 C CA  . LYS B 1 251 ? 35.395  4.278   -45.216 1.00 56.72 ? 289 LYS B CA  1 
ATOM   3969 C C   . LYS B 1 251 ? 35.998  4.314   -46.614 1.00 57.01 ? 289 LYS B C   1 
ATOM   3970 O O   . LYS B 1 251 ? 36.128  5.387   -47.197 1.00 57.18 ? 289 LYS B O   1 
ATOM   3971 C CB  . LYS B 1 251 ? 36.476  4.019   -44.169 1.00 56.87 ? 289 LYS B CB  1 
ATOM   3972 C CG  . LYS B 1 251 ? 37.065  5.282   -43.570 1.00 57.78 ? 289 LYS B CG  1 
ATOM   3973 C CD  . LYS B 1 251 ? 37.884  4.996   -42.300 1.00 59.63 ? 289 LYS B CD  1 
ATOM   3974 C CE  . LYS B 1 251 ? 37.027  4.912   -41.036 1.00 60.28 ? 289 LYS B CE  1 
ATOM   3975 N NZ  . LYS B 1 251 ? 36.411  3.565   -40.851 1.00 61.19 ? 289 LYS B NZ  1 
ATOM   3976 N N   . ASN B 1 252 ? 36.352  3.146   -47.150 1.00 57.53 ? 290 ASN B N   1 
ATOM   3977 C CA  . ASN B 1 252 ? 36.898  3.046   -48.498 1.00 57.85 ? 290 ASN B CA  1 
ATOM   3978 C C   . ASN B 1 252 ? 36.043  2.149   -49.395 1.00 58.18 ? 290 ASN B C   1 
ATOM   3979 O O   . ASN B 1 252 ? 36.066  0.920   -49.272 1.00 58.22 ? 290 ASN B O   1 
ATOM   3980 C CB  . ASN B 1 252 ? 38.349  2.557   -48.459 1.00 57.89 ? 290 ASN B CB  1 
ATOM   3981 N N   . PRO B 1 253 ? 35.272  2.775   -50.281 1.00 58.52 ? 291 PRO B N   1 
ATOM   3982 C CA  . PRO B 1 253 ? 34.620  2.050   -51.367 1.00 59.05 ? 291 PRO B CA  1 
ATOM   3983 C C   . PRO B 1 253 ? 35.686  1.437   -52.259 1.00 59.48 ? 291 PRO B C   1 
ATOM   3984 O O   . PRO B 1 253 ? 36.743  2.044   -52.467 1.00 59.72 ? 291 PRO B O   1 
ATOM   3985 N N   . GLU B 1 254 ? 35.416  0.236   -52.781 1.00 59.74 ? 292 GLU B N   1 
ATOM   3986 C CA  . GLU B 1 254 ? 36.402  -0.537  -53.553 1.00 59.73 ? 292 GLU B CA  1 
ATOM   3987 C C   . GLU B 1 254 ? 37.722  -0.651  -52.804 1.00 59.83 ? 292 GLU B C   1 
ATOM   3988 O O   . GLU B 1 254 ? 38.696  0.059   -53.131 1.00 59.86 ? 292 GLU B O   1 
ATOM   3989 N N   . ASP B 1 255 ? 37.749  -1.535  -51.781 1.00 59.92 ? 293 ASP B N   1 
ATOM   3990 C CA  . ASP B 1 255 ? 38.915  -1.663  -50.905 1.00 59.90 ? 293 ASP B CA  1 
ATOM   3991 C C   . ASP B 1 255 ? 38.652  -2.602  -49.742 1.00 59.93 ? 293 ASP B C   1 
ATOM   3992 O O   . ASP B 1 255 ? 38.334  -2.163  -48.629 1.00 59.91 ? 293 ASP B O   1 
ATOM   3993 N N   . SER B 1 256 ? 38.790  -3.900  -50.012 1.00 59.92 ? 294 SER B N   1 
ATOM   3994 C CA  . SER B 1 256 ? 38.526  -4.944  -49.025 1.00 59.86 ? 294 SER B CA  1 
ATOM   3995 C C   . SER B 1 256 ? 37.972  -6.201  -49.670 1.00 59.84 ? 294 SER B C   1 
ATOM   3996 O O   . SER B 1 256 ? 38.245  -6.477  -50.847 1.00 59.58 ? 294 SER B O   1 
ATOM   3997 N N   . SER B 1 257 ? 37.192  -6.963  -48.893 1.00 59.81 ? 295 SER B N   1 
ATOM   3998 C CA  . SER B 1 257 ? 36.576  -8.197  -49.388 1.00 59.70 ? 295 SER B CA  1 
ATOM   3999 C C   . SER B 1 257 ? 35.187  -7.953  -49.947 1.00 59.53 ? 295 SER B C   1 
ATOM   4000 O O   . SER B 1 257 ? 34.632  -8.802  -50.664 1.00 59.67 ? 295 SER B O   1 
ATOM   4001 N N   . CYS B 1 258 ? 34.650  -6.774  -49.625 1.00 59.18 ? 296 CYS B N   1 
ATOM   4002 C CA  . CYS B 1 258 ? 33.311  -6.346  -50.024 1.00 58.97 ? 296 CYS B CA  1 
ATOM   4003 C C   . CYS B 1 258 ? 33.214  -6.008  -51.529 1.00 59.17 ? 296 CYS B C   1 
ATOM   4004 O O   . CYS B 1 258 ? 32.943  -7.148  -52.316 1.00 59.09 ? 296 CYS B O   1 
ATOM   4005 C CB  . CYS B 1 258 ? 32.921  -5.113  -49.201 1.00 59.11 ? 296 CYS B CB  1 
ATOM   4006 S SG  . CYS B 1 258 ? 34.302  -3.952  -48.873 1.00 58.58 ? 296 CYS B SG  1 
HETATM 4007 O O3P . NMN C 2 .   ? 3.820   5.272   3.197   1.00 47.90 ? 301 NMN A O3P 1 
HETATM 4008 P P   . NMN C 2 .   ? 4.289   3.928   3.845   1.00 49.85 ? 301 NMN A P   1 
HETATM 4009 O O1P . NMN C 2 .   ? 3.872   3.769   5.299   1.00 49.40 ? 301 NMN A O1P 1 
HETATM 4010 O O2P . NMN C 2 .   ? 5.724   3.515   3.575   1.00 45.75 ? 301 NMN A O2P 1 
HETATM 4011 O O5R . NMN C 2 .   ? 3.301   2.855   3.113   1.00 53.30 ? 301 NMN A O5R 1 
HETATM 4012 C C5R . NMN C 2 .   ? 1.880   3.110   2.962   1.00 55.21 ? 301 NMN A C5R 1 
HETATM 4013 C C4R . NMN C 2 .   ? 1.306   2.944   1.533   1.00 57.30 ? 301 NMN A C4R 1 
HETATM 4014 O O4R . NMN C 2 .   ? 1.837   1.777   0.870   1.00 58.56 ? 301 NMN A O4R 1 
HETATM 4015 C C3R . NMN C 2 .   ? -0.196  2.698   1.577   1.00 57.68 ? 301 NMN A C3R 1 
HETATM 4016 O O3R . NMN C 2 .   ? -0.901  3.248   0.420   1.00 55.28 ? 301 NMN A O3R 1 
HETATM 4017 C C2R . NMN C 2 .   ? -0.238  1.177   1.734   1.00 57.94 ? 301 NMN A C2R 1 
HETATM 4018 O O2R . NMN C 2 .   ? -1.402  0.608   1.152   1.00 60.15 ? 301 NMN A O2R 1 
HETATM 4019 C C1R . NMN C 2 .   ? 1.036   0.612   1.108   1.00 59.46 ? 301 NMN A C1R 1 
HETATM 4020 N N1  . NMN C 2 .   ? 1.768   -0.309  2.002   1.00 60.50 ? 301 NMN A N1  1 
HETATM 4021 C C2  . NMN C 2 .   ? 1.157   -1.312  2.674   1.00 60.81 ? 301 NMN A C2  1 
HETATM 4022 C C3  . NMN C 2 .   ? 1.870   -2.173  3.529   1.00 60.63 ? 301 NMN A C3  1 
HETATM 4023 C C7  . NMN C 2 .   ? 1.187   -3.298  4.294   1.00 60.54 ? 301 NMN A C7  1 
HETATM 4024 O O7  . NMN C 2 .   ? 1.832   -4.261  4.771   1.00 59.07 ? 301 NMN A O7  1 
HETATM 4025 N N7  . NMN C 2 .   ? -0.143  -3.213  4.427   1.00 59.09 ? 301 NMN A N7  1 
HETATM 4026 C C4  . NMN C 2 .   ? 3.241   -1.967  3.667   1.00 61.04 ? 301 NMN A C4  1 
HETATM 4027 C C5  . NMN C 2 .   ? 3.859   -0.942  2.964   1.00 60.96 ? 301 NMN A C5  1 
HETATM 4028 C C6  . NMN C 2 .   ? 3.094   -0.134  2.132   1.00 60.99 ? 301 NMN A C6  1 
HETATM 4029 O O3P . NMN D 2 .   ? 17.607  1.869   -27.093 1.00 66.09 ? 302 NMN B O3P 1 
HETATM 4030 P P   . NMN D 2 .   ? 18.371  2.622   -26.004 1.00 66.52 ? 302 NMN B P   1 
HETATM 4031 O O1P . NMN D 2 .   ? 19.855  2.298   -25.881 1.00 64.61 ? 302 NMN B O1P 1 
HETATM 4032 O O2P . NMN D 2 .   ? 17.643  2.642   -24.681 1.00 66.76 ? 302 NMN B O2P 1 
HETATM 4033 O O5R . NMN D 2 .   ? 18.282  4.151   -26.547 1.00 64.56 ? 302 NMN B O5R 1 
HETATM 4034 C C5R . NMN D 2 .   ? 18.906  4.552   -27.779 1.00 60.27 ? 302 NMN B C5R 1 
HETATM 4035 C C4R . NMN D 2 .   ? 18.013  5.469   -28.633 1.00 58.08 ? 302 NMN B C4R 1 
HETATM 4036 O O4R . NMN D 2 .   ? 17.525  6.629   -27.916 1.00 55.51 ? 302 NMN B O4R 1 
HETATM 4037 C C3R . NMN D 2 .   ? 18.839  6.046   -29.773 1.00 56.39 ? 302 NMN B C3R 1 
HETATM 4038 O O3R . NMN D 2 .   ? 18.033  6.252   -30.962 1.00 56.27 ? 302 NMN B O3R 1 
HETATM 4039 C C2R . NMN D 2 .   ? 19.394  7.325   -29.140 1.00 54.19 ? 302 NMN B C2R 1 
HETATM 4040 O O2R . NMN D 2 .   ? 19.480  8.400   -30.079 1.00 53.47 ? 302 NMN B O2R 1 
HETATM 4041 C C1R . NMN D 2 .   ? 18.512  7.671   -27.923 1.00 51.90 ? 302 NMN B C1R 1 
HETATM 4042 N N1  . NMN D 2 .   ? 19.279  7.694   -26.641 1.00 50.41 ? 302 NMN B N1  1 
HETATM 4043 C C2  . NMN D 2 .   ? 20.493  8.290   -26.575 1.00 50.58 ? 302 NMN B C2  1 
HETATM 4044 C C3  . NMN D 2 .   ? 21.254  8.315   -25.395 1.00 49.27 ? 302 NMN B C3  1 
HETATM 4045 C C7  . NMN D 2 .   ? 22.589  9.015   -25.400 1.00 48.62 ? 302 NMN B C7  1 
HETATM 4046 O O7  . NMN D 2 .   ? 23.098  9.435   -24.348 1.00 46.41 ? 302 NMN B O7  1 
HETATM 4047 N N7  . NMN D 2 .   ? 23.149  9.224   -26.585 1.00 44.29 ? 302 NMN B N7  1 
HETATM 4048 C C4  . NMN D 2 .   ? 20.745  7.718   -24.240 1.00 50.56 ? 302 NMN B C4  1 
HETATM 4049 C C5  . NMN D 2 .   ? 19.495  7.106   -24.311 1.00 50.35 ? 302 NMN B C5  1 
HETATM 4050 C C6  . NMN D 2 .   ? 18.784  7.119   -25.520 1.00 49.96 ? 302 NMN B C6  1 
HETATM 4051 O O   . HOH E 3 .   ? -4.079  2.581   0.355   1.00 21.53 ? 302 HOH A O   1 
HETATM 4052 O O   . HOH E 3 .   ? -9.739  8.938   -5.527  1.00 21.81 ? 303 HOH A O   1 
HETATM 4053 O O   . HOH E 3 .   ? -3.992  8.770   -10.875 1.00 24.82 ? 304 HOH A O   1 
HETATM 4054 O O   . HOH E 3 .   ? -10.770 9.729   -2.317  1.00 23.82 ? 305 HOH A O   1 
HETATM 4055 O O   . HOH E 3 .   ? -6.012  -6.740  -6.721  1.00 33.67 ? 306 HOH A O   1 
HETATM 4056 O O   . HOH E 3 .   ? -13.420 12.223  -5.674  1.00 25.50 ? 307 HOH A O   1 
HETATM 4057 O O   . HOH E 3 .   ? 13.699  -14.453 -3.039  1.00 29.29 ? 308 HOH A O   1 
HETATM 4058 O O   . HOH E 3 .   ? -6.153  20.359  -10.409 1.00 32.26 ? 309 HOH A O   1 
HETATM 4059 O O   . HOH E 3 .   ? 4.328   10.325  4.566   1.00 31.22 ? 310 HOH A O   1 
HETATM 4060 O O   . HOH E 3 .   ? 4.395   -12.800 -10.604 1.00 41.68 ? 311 HOH A O   1 
HETATM 4061 O O   . HOH E 3 .   ? 20.254  -16.042 -1.620  1.00 34.68 ? 312 HOH A O   1 
HETATM 4062 O O   . HOH E 3 .   ? -10.860 14.193  -13.436 1.00 29.36 ? 313 HOH A O   1 
HETATM 4063 O O   . HOH E 3 .   ? 2.422   17.523  -14.236 1.00 29.25 ? 314 HOH A O   1 
HETATM 4064 O O   . HOH E 3 .   ? -0.272  4.155   -4.012  1.00 28.58 ? 315 HOH A O   1 
HETATM 4065 O O   . HOH E 3 .   ? 4.288   15.838  -12.980 1.00 27.34 ? 316 HOH A O   1 
HETATM 4066 O O   . HOH E 3 .   ? -12.961 15.554  1.066   1.00 40.05 ? 317 HOH A O   1 
HETATM 4067 O O   . HOH E 3 .   ? -5.294  -9.176  4.696   1.00 37.34 ? 318 HOH A O   1 
HETATM 4068 O O   . HOH E 3 .   ? 13.655  -19.876 -3.223  1.00 31.23 ? 319 HOH A O   1 
HETATM 4069 O O   . HOH E 3 .   ? -1.616  23.165  4.177   1.00 46.00 ? 320 HOH A O   1 
HETATM 4070 O O   . HOH E 3 .   ? -11.459 16.395  14.565  1.00 53.33 ? 321 HOH A O   1 
HETATM 4071 O O   . HOH E 3 .   ? -11.068 21.126  -11.761 1.00 35.70 ? 322 HOH A O   1 
HETATM 4072 O O   . HOH E 3 .   ? -5.157  -14.473 6.812   1.00 45.90 ? 323 HOH A O   1 
HETATM 4073 O O   . HOH E 3 .   ? 3.704   -7.036  3.621   1.00 38.76 ? 324 HOH A O   1 
HETATM 4074 O O   . HOH E 3 .   ? -8.713  -13.775 5.020   1.00 45.11 ? 325 HOH A O   1 
HETATM 4075 O O   . HOH E 3 .   ? 7.581   5.450   -9.395  1.00 40.14 ? 326 HOH A O   1 
HETATM 4076 O O   . HOH E 3 .   ? 19.115  -4.687  -3.899  1.00 58.47 ? 327 HOH A O   1 
HETATM 4077 O O   . HOH E 3 .   ? -11.132 11.785  -15.334 1.00 48.23 ? 328 HOH A O   1 
HETATM 4078 O O   . HOH E 3 .   ? 2.585   10.104  8.157   1.00 32.33 ? 329 HOH A O   1 
HETATM 4079 O O   . HOH E 3 .   ? 11.514  -9.745  1.460   1.00 40.19 ? 330 HOH A O   1 
HETATM 4080 O O   . HOH E 3 .   ? -13.745 4.190   -11.790 1.00 38.17 ? 331 HOH A O   1 
HETATM 4081 O O   . HOH E 3 .   ? -10.189 -19.447 2.733   1.00 44.46 ? 332 HOH A O   1 
HETATM 4082 O O   . HOH E 3 .   ? 8.209   13.228  -2.661  1.00 39.22 ? 333 HOH A O   1 
HETATM 4083 O O   . HOH E 3 .   ? -26.137 8.855   14.293  1.00 51.61 ? 334 HOH A O   1 
HETATM 4084 O O   . HOH E 3 .   ? 1.398   5.122   -2.237  1.00 41.33 ? 335 HOH A O   1 
HETATM 4085 O O   . HOH E 3 .   ? 8.400   23.384  4.042   1.00 36.40 ? 336 HOH A O   1 
HETATM 4086 O O   . HOH E 3 .   ? 3.937   19.563  -14.850 1.00 34.76 ? 337 HOH A O   1 
HETATM 4087 O O   . HOH E 3 .   ? 13.841  -21.650 6.106   1.00 42.53 ? 338 HOH A O   1 
HETATM 4088 O O   . HOH E 3 .   ? 19.062  -17.243 7.422   1.00 49.78 ? 339 HOH A O   1 
HETATM 4089 O O   . HOH E 3 .   ? -20.094 0.570   7.650   1.00 34.22 ? 340 HOH A O   1 
HETATM 4090 O O   . HOH E 3 .   ? 11.337  -5.571  3.107   1.00 43.61 ? 341 HOH A O   1 
HETATM 4091 O O   . HOH E 3 .   ? 6.399   22.617  -14.848 1.00 42.62 ? 342 HOH A O   1 
HETATM 4092 O O   . HOH E 3 .   ? 6.910   23.462  -12.233 1.00 35.05 ? 343 HOH A O   1 
HETATM 4093 O O   . HOH E 3 .   ? -5.291  24.199  15.732  1.00 59.42 ? 344 HOH A O   1 
HETATM 4094 O O   . HOH E 3 .   ? -6.544  23.240  2.696   1.00 37.15 ? 345 HOH A O   1 
HETATM 4095 O O   . HOH E 3 .   ? 17.421  -15.897 1.571   1.00 40.20 ? 346 HOH A O   1 
HETATM 4096 O O   . HOH E 3 .   ? -8.344  21.247  9.623   1.00 45.94 ? 347 HOH A O   1 
HETATM 4097 O O   . HOH E 3 .   ? -14.178 15.991  13.851  1.00 50.82 ? 348 HOH A O   1 
HETATM 4098 O O   . HOH E 3 .   ? -4.070  -4.450  -6.138  1.00 40.46 ? 349 HOH A O   1 
HETATM 4099 O O   . HOH E 3 .   ? 19.836  5.236   6.249   1.00 56.98 ? 350 HOH A O   1 
HETATM 4100 O O   . HOH E 3 .   ? -7.435  -13.953 -12.657 1.00 49.38 ? 351 HOH A O   1 
HETATM 4101 O O   . HOH E 3 .   ? 8.114   -13.071 10.037  1.00 41.83 ? 352 HOH A O   1 
HETATM 4102 O O   . HOH E 3 .   ? -0.421  -14.347 -14.963 1.00 52.18 ? 353 HOH A O   1 
HETATM 4103 O O   . HOH E 3 .   ? 3.552   24.955  -0.102  1.00 41.68 ? 354 HOH A O   1 
HETATM 4104 O O   . HOH E 3 .   ? -13.814 -0.296  1.373   1.00 47.72 ? 355 HOH A O   1 
HETATM 4105 O O   . HOH E 3 .   ? 15.038  -27.123 -3.904  1.00 53.50 ? 356 HOH A O   1 
HETATM 4106 O O   . HOH E 3 .   ? 11.437  4.236   -4.648  1.00 48.62 ? 357 HOH A O   1 
HETATM 4107 O O   . HOH E 3 .   ? 24.656  -3.510  5.426   1.00 42.72 ? 358 HOH A O   1 
HETATM 4108 O O   . HOH E 3 .   ? 21.728  -23.619 16.727  1.00 54.14 ? 359 HOH A O   1 
HETATM 4109 O O   . HOH E 3 .   ? -2.139  3.052   13.689  1.00 56.35 ? 360 HOH A O   1 
HETATM 4110 O O   . HOH E 3 .   ? 12.512  -4.165  5.426   1.00 45.29 ? 361 HOH A O   1 
HETATM 4111 O O   . HOH E 3 .   ? 11.983  -26.005 -1.821  1.00 51.84 ? 362 HOH A O   1 
HETATM 4112 O O   . HOH E 3 .   ? 11.992  -8.267  3.839   1.00 42.22 ? 363 HOH A O   1 
HETATM 4113 O O   . HOH E 3 .   ? -3.665  18.969  -15.144 1.00 51.31 ? 364 HOH A O   1 
HETATM 4114 O O   . HOH E 3 .   ? -3.570  1.526   -12.811 1.00 47.66 ? 365 HOH A O   1 
HETATM 4115 O O   . HOH E 3 .   ? 12.290  -3.155  -10.762 1.00 45.57 ? 366 HOH A O   1 
HETATM 4116 O O   . HOH E 3 .   ? 14.483  11.871  0.708   1.00 61.06 ? 367 HOH A O   1 
HETATM 4117 O O   . HOH E 3 .   ? -13.252 -3.553  -6.771  1.00 53.96 ? 368 HOH A O   1 
HETATM 4118 O O   . HOH E 3 .   ? -2.704  23.637  -4.469  1.00 48.60 ? 369 HOH A O   1 
HETATM 4119 O O   . HOH E 3 .   ? 12.046  -1.712  -3.711  1.00 39.49 ? 370 HOH A O   1 
HETATM 4120 O O   . HOH E 3 .   ? 14.936  -12.020 -9.510  1.00 55.75 ? 371 HOH A O   1 
HETATM 4121 O O   . HOH E 3 .   ? -23.932 15.861  15.364  1.00 77.25 ? 372 HOH A O   1 
HETATM 4122 O O   . HOH E 3 .   ? -20.437 3.608   5.380   1.00 40.75 ? 373 HOH A O   1 
HETATM 4123 O O   . HOH E 3 .   ? 0.915   -3.577  -13.630 1.00 51.49 ? 374 HOH A O   1 
HETATM 4124 O O   . HOH E 3 .   ? 6.679   16.962  10.162  1.00 47.36 ? 375 HOH A O   1 
HETATM 4125 O O   . HOH E 3 .   ? -14.358 -21.454 2.813   1.00 48.91 ? 376 HOH A O   1 
HETATM 4126 O O   . HOH E 3 .   ? -4.365  22.303  -10.264 1.00 40.72 ? 377 HOH A O   1 
HETATM 4127 O O   . HOH E 3 .   ? -12.799 -5.426  -10.565 1.00 53.27 ? 378 HOH A O   1 
HETATM 4128 O O   . HOH E 3 .   ? 3.764   -24.556 3.679   1.00 48.19 ? 379 HOH A O   1 
HETATM 4129 O O   . HOH E 3 .   ? 1.837   23.536  12.656  1.00 56.38 ? 380 HOH A O   1 
HETATM 4130 O O   . HOH E 3 .   ? -6.019  19.529  -16.487 1.00 49.57 ? 381 HOH A O   1 
HETATM 4131 O O   . HOH E 3 .   ? 7.753   -14.002 -12.351 1.00 48.88 ? 382 HOH A O   1 
HETATM 4132 O O   . HOH E 3 .   ? -2.605  24.613  -7.021  1.00 45.45 ? 383 HOH A O   1 
HETATM 4133 O O   . HOH E 3 .   ? -9.640  3.420   -11.429 1.00 49.84 ? 384 HOH A O   1 
HETATM 4134 O O   . HOH E 3 .   ? 4.963   16.554  14.047  1.00 53.61 ? 385 HOH A O   1 
HETATM 4135 O O   . HOH E 3 .   ? 17.945  -14.327 -9.091  1.00 52.12 ? 386 HOH A O   1 
HETATM 4136 O O   . HOH E 3 .   ? -8.514  21.535  -11.274 1.00 43.08 ? 387 HOH A O   1 
HETATM 4137 O O   . HOH E 3 .   ? -5.264  24.875  7.961   1.00 56.74 ? 388 HOH A O   1 
HETATM 4138 O O   . HOH E 3 .   ? 8.292   -0.712  -0.990  1.00 37.21 ? 389 HOH A O   1 
HETATM 4139 O O   . HOH E 3 .   ? -10.149 -4.371  -14.319 1.00 58.09 ? 390 HOH A O   1 
HETATM 4140 O O   . HOH E 3 .   ? 11.265  10.753  -2.510  1.00 51.00 ? 391 HOH A O   1 
HETATM 4141 O O   . HOH E 3 .   ? 2.260   7.129   -13.995 1.00 49.65 ? 392 HOH A O   1 
HETATM 4142 O O   . HOH E 3 .   ? 10.193  -27.201 -4.888  1.00 43.16 ? 393 HOH A O   1 
HETATM 4143 O O   . HOH E 3 .   ? -2.502  -2.139  -7.594  1.00 42.56 ? 394 HOH A O   1 
HETATM 4144 O O   . HOH E 3 .   ? 5.481   -15.611 -11.937 1.00 56.80 ? 395 HOH A O   1 
HETATM 4145 O O   . HOH E 3 .   ? 6.036   -2.347  -12.992 1.00 51.22 ? 396 HOH A O   1 
HETATM 4146 O O   . HOH E 3 .   ? 26.676  -3.314  3.685   1.00 47.40 ? 397 HOH A O   1 
HETATM 4147 O O   . HOH E 3 .   ? -4.789  -0.926  -8.489  1.00 37.14 ? 398 HOH A O   1 
HETATM 4148 O O   . HOH E 3 .   ? 2.250   10.556  -13.632 1.00 45.18 ? 399 HOH A O   1 
HETATM 4149 O O   . HOH E 3 .   ? -2.574  22.813  -12.805 1.00 53.47 ? 400 HOH A O   1 
HETATM 4150 O O   . HOH E 3 .   ? -0.420  15.309  16.897  1.00 47.77 ? 401 HOH A O   1 
HETATM 4151 O O   . HOH E 3 .   ? 3.419   25.788  -2.809  1.00 48.24 ? 402 HOH A O   1 
HETATM 4152 O O   . HOH E 3 .   ? 4.944   -11.998 9.545   1.00 57.45 ? 403 HOH A O   1 
HETATM 4153 O O   . HOH E 3 .   ? 1.850   -2.383  7.221   1.00 51.23 ? 404 HOH A O   1 
HETATM 4154 O O   . HOH E 3 .   ? -14.781 -0.465  -10.074 1.00 54.90 ? 405 HOH A O   1 
HETATM 4155 O O   . HOH E 3 .   ? 0.165   -25.974 -7.877  1.00 54.65 ? 406 HOH A O   1 
HETATM 4156 O O   . HOH E 3 .   ? -5.802  -3.079  -9.381  1.00 55.39 ? 407 HOH A O   1 
HETATM 4157 O O   . HOH E 3 .   ? 10.125  -23.993 1.828   1.00 51.88 ? 408 HOH A O   1 
HETATM 4158 O O   . HOH E 3 .   ? 12.218  0.338   -7.769  1.00 60.50 ? 409 HOH A O   1 
HETATM 4159 O O   . HOH E 3 .   ? -5.607  -3.807  -12.416 1.00 56.19 ? 410 HOH A O   1 
HETATM 4160 O O   . HOH E 3 .   ? -15.559 -2.191  -7.016  1.00 59.90 ? 411 HOH A O   1 
HETATM 4161 O O   . HOH E 3 .   ? 1.285   -13.701 -16.944 1.00 72.09 ? 412 HOH A O   1 
HETATM 4162 O O   . HOH E 3 .   ? -13.022 19.131  -5.302  1.00 44.51 ? 413 HOH A O   1 
HETATM 4163 O O   . HOH E 3 .   ? -17.469 -2.236  -1.816  1.00 57.42 ? 414 HOH A O   1 
HETATM 4164 O O   . HOH E 3 .   ? 2.745   2.222   8.974   1.00 61.12 ? 415 HOH A O   1 
HETATM 4165 O O   . HOH E 3 .   ? 7.451   -23.885 1.267   1.00 55.16 ? 416 HOH A O   1 
HETATM 4166 O O   . HOH E 3 .   ? -7.258  17.144  -17.360 1.00 44.62 ? 417 HOH A O   1 
HETATM 4167 O O   . HOH E 3 .   ? 1.119   16.552  -16.461 1.00 51.65 ? 418 HOH A O   1 
HETATM 4168 O O   . HOH E 3 .   ? -14.462 0.063   11.928  1.00 43.34 ? 419 HOH A O   1 
HETATM 4169 O O   . HOH E 3 .   ? 22.337  -22.182 18.803  1.00 59.73 ? 420 HOH A O   1 
HETATM 4170 O O   . HOH E 3 .   ? -1.176  15.753  -20.182 1.00 57.84 ? 421 HOH A O   1 
HETATM 4171 O O   . HOH E 3 .   ? -28.415 11.549  11.534  1.00 55.18 ? 422 HOH A O   1 
HETATM 4172 O O   . HOH E 3 .   ? 6.453   6.773   -12.719 1.00 42.18 ? 423 HOH A O   1 
HETATM 4173 O O   . HOH E 3 .   ? 3.066   -24.563 -3.756  1.00 56.59 ? 424 HOH A O   1 
HETATM 4174 O O   . HOH E 3 .   ? -14.195 5.507   17.851  1.00 39.14 ? 425 HOH A O   1 
HETATM 4175 O O   . HOH E 3 .   ? -1.377  18.200  -16.343 1.00 47.21 ? 426 HOH A O   1 
HETATM 4176 O O   . HOH E 3 .   ? 11.068  -24.781 3.801   1.00 60.29 ? 427 HOH A O   1 
HETATM 4177 O O   . HOH E 3 .   ? -19.802 2.143   3.519   1.00 56.61 ? 428 HOH A O   1 
HETATM 4178 O O   . HOH E 3 .   ? 9.543   -6.020  4.899   1.00 61.18 ? 429 HOH A O   1 
HETATM 4179 O O   . HOH E 3 .   ? 3.851   21.898  -13.805 1.00 53.60 ? 430 HOH A O   1 
HETATM 4180 O O   . HOH E 3 .   ? -5.914  -6.381  4.950   1.00 55.23 ? 431 HOH A O   1 
HETATM 4181 O O   . HOH E 3 .   ? -15.676 6.266   0.251   1.00 42.23 ? 432 HOH A O   1 
HETATM 4182 O O   . HOH E 3 .   ? 8.775   6.327   -7.645  1.00 39.92 ? 433 HOH A O   1 
HETATM 4183 O O   . HOH E 3 .   ? -10.072 -18.549 4.701   1.00 41.31 ? 434 HOH A O   1 
HETATM 4184 O O   . HOH E 3 .   ? -2.368  23.363  -8.878  1.00 52.00 ? 435 HOH A O   1 
HETATM 4185 O O   . HOH E 3 .   ? 9.407   -3.109  -15.875 1.00 61.44 ? 436 HOH A O   1 
HETATM 4186 O O   . HOH E 3 .   ? -7.307  -1.916  12.114  1.00 56.42 ? 437 HOH A O   1 
HETATM 4187 O O   . HOH E 3 .   ? 8.947   18.823  10.438  1.00 63.23 ? 438 HOH A O   1 
HETATM 4188 O O   . HOH E 3 .   ? 12.700  11.055  5.042   1.00 56.67 ? 439 HOH A O   1 
HETATM 4189 O O   . HOH E 3 .   ? -3.049  6.370   -15.329 1.00 53.06 ? 440 HOH A O   1 
HETATM 4190 O O   . HOH E 3 .   ? -13.172 5.863   -14.426 1.00 57.27 ? 441 HOH A O   1 
HETATM 4191 O O   . HOH E 3 .   ? 5.113   18.936  14.866  1.00 76.09 ? 442 HOH A O   1 
HETATM 4192 O O   . HOH E 3 .   ? 0.970   25.911  -3.738  1.00 50.29 ? 443 HOH A O   1 
HETATM 4193 O O   . HOH F 3 .   ? 16.708  22.646  -9.198  1.00 23.62 ? 303 HOH B O   1 
HETATM 4194 O O   . HOH F 3 .   ? 14.872  18.329  -11.729 1.00 20.00 ? 304 HOH B O   1 
HETATM 4195 O O   . HOH F 3 .   ? 31.777  18.182  -24.819 1.00 35.30 ? 305 HOH B O   1 
HETATM 4196 O O   . HOH F 3 .   ? 6.355   18.172  -8.087  1.00 26.14 ? 306 HOH B O   1 
HETATM 4197 O O   . HOH F 3 .   ? 17.814  12.626  -14.636 1.00 17.71 ? 307 HOH B O   1 
HETATM 4198 O O   . HOH F 3 .   ? 18.061  19.437  -33.186 1.00 29.76 ? 308 HOH B O   1 
HETATM 4199 O O   . HOH F 3 .   ? 27.748  12.040  -13.517 1.00 31.13 ? 309 HOH B O   1 
HETATM 4200 O O   . HOH F 3 .   ? 17.399  16.242  -6.813  1.00 27.89 ? 310 HOH B O   1 
HETATM 4201 O O   . HOH F 3 .   ? 18.547  6.113   -14.917 1.00 33.92 ? 311 HOH B O   1 
HETATM 4202 O O   . HOH F 3 .   ? 12.391  23.230  -22.404 1.00 25.08 ? 312 HOH B O   1 
HETATM 4203 O O   . HOH F 3 .   ? 18.903  10.180  -14.104 1.00 23.59 ? 313 HOH B O   1 
HETATM 4204 O O   . HOH F 3 .   ? 24.758  5.594   -8.929  1.00 30.23 ? 314 HOH B O   1 
HETATM 4205 O O   . HOH F 3 .   ? 29.210  16.027  -10.740 1.00 36.23 ? 315 HOH B O   1 
HETATM 4206 O O   . HOH F 3 .   ? 21.405  9.255   -13.011 1.00 32.50 ? 316 HOH B O   1 
HETATM 4207 O O   . HOH F 3 .   ? 19.487  7.621   -33.535 1.00 37.70 ? 317 HOH B O   1 
HETATM 4208 O O   . HOH F 3 .   ? 15.240  6.969   -42.903 1.00 33.97 ? 318 HOH B O   1 
HETATM 4209 O O   . HOH F 3 .   ? 22.156  11.568  -21.885 1.00 25.92 ? 319 HOH B O   1 
HETATM 4210 O O   . HOH F 3 .   ? 8.599   9.193   -12.006 1.00 36.42 ? 320 HOH B O   1 
HETATM 4211 O O   . HOH F 3 .   ? 12.169  25.485  -14.464 1.00 34.49 ? 321 HOH B O   1 
HETATM 4212 O O   . HOH F 3 .   ? 25.573  4.053   -10.675 1.00 37.65 ? 322 HOH B O   1 
HETATM 4213 O O   . HOH F 3 .   ? 12.034  25.705  -20.430 1.00 34.77 ? 323 HOH B O   1 
HETATM 4214 O O   . HOH F 3 .   ? 13.867  5.825   -49.528 1.00 46.24 ? 324 HOH B O   1 
HETATM 4215 O O   . HOH F 3 .   ? 23.628  24.821  -9.416  1.00 39.91 ? 325 HOH B O   1 
HETATM 4216 O O   . HOH F 3 .   ? 5.820   11.597  -12.071 1.00 32.85 ? 326 HOH B O   1 
HETATM 4217 O O   . HOH F 3 .   ? 5.364   13.178  -14.557 1.00 42.53 ? 327 HOH B O   1 
HETATM 4218 O O   . HOH F 3 .   ? 28.408  14.535  6.406   1.00 41.69 ? 328 HOH B O   1 
HETATM 4219 O O   . HOH F 3 .   ? 24.980  19.207  -5.600  1.00 37.63 ? 329 HOH B O   1 
HETATM 4220 O O   . HOH F 3 .   ? 16.290  25.370  -34.645 1.00 53.30 ? 330 HOH B O   1 
HETATM 4221 O O   . HOH F 3 .   ? 30.925  26.714  -22.308 1.00 30.92 ? 331 HOH B O   1 
HETATM 4222 O O   . HOH F 3 .   ? 22.063  13.840  -3.778  1.00 39.12 ? 332 HOH B O   1 
HETATM 4223 O O   . HOH F 3 .   ? 6.869   24.131  -21.055 1.00 55.52 ? 333 HOH B O   1 
HETATM 4224 O O   . HOH F 3 .   ? 24.528  22.540  -7.099  1.00 46.02 ? 334 HOH B O   1 
HETATM 4225 O O   . HOH F 3 .   ? 22.064  4.345   -12.262 1.00 47.45 ? 335 HOH B O   1 
HETATM 4226 O O   . HOH F 3 .   ? 26.328  10.450  -17.801 1.00 36.55 ? 336 HOH B O   1 
HETATM 4227 O O   . HOH F 3 .   ? 9.717   24.478  -19.641 1.00 39.17 ? 337 HOH B O   1 
HETATM 4228 O O   . HOH F 3 .   ? 32.088  17.109  -32.536 1.00 43.34 ? 338 HOH B O   1 
HETATM 4229 O O   . HOH F 3 .   ? 32.553  25.355  -28.003 1.00 37.67 ? 339 HOH B O   1 
HETATM 4230 O O   . HOH F 3 .   ? 28.125  15.422  -28.141 1.00 41.47 ? 340 HOH B O   1 
HETATM 4231 O O   . HOH F 3 .   ? 20.704  20.070  -40.107 1.00 42.31 ? 341 HOH B O   1 
HETATM 4232 O O   . HOH F 3 .   ? 3.685   20.025  -17.572 1.00 40.80 ? 342 HOH B O   1 
HETATM 4233 O O   . HOH F 3 .   ? 17.880  8.570   -16.211 1.00 40.23 ? 343 HOH B O   1 
HETATM 4234 O O   . HOH F 3 .   ? 32.165  20.711  -24.475 1.00 48.82 ? 344 HOH B O   1 
HETATM 4235 O O   . HOH F 3 .   ? 20.647  6.449   -13.383 1.00 50.24 ? 345 HOH B O   1 
HETATM 4236 O O   . HOH F 3 .   ? 22.998  8.745   -15.479 1.00 35.08 ? 346 HOH B O   1 
HETATM 4237 O O   . HOH F 3 .   ? 32.252  17.649  -18.360 1.00 45.58 ? 347 HOH B O   1 
HETATM 4238 O O   . HOH F 3 .   ? 28.483  10.485  -35.574 1.00 46.16 ? 348 HOH B O   1 
HETATM 4239 O O   . HOH F 3 .   ? 26.537  12.832  0.310   1.00 44.84 ? 349 HOH B O   1 
HETATM 4240 O O   . HOH F 3 .   ? 5.089   13.602  -20.162 1.00 39.93 ? 350 HOH B O   1 
HETATM 4241 O O   . HOH F 3 .   ? 30.558  10.536  -33.518 1.00 53.21 ? 351 HOH B O   1 
HETATM 4242 O O   . HOH F 3 .   ? 7.772   8.097   -39.167 1.00 39.62 ? 352 HOH B O   1 
HETATM 4243 O O   . HOH F 3 .   ? 10.611  8.439   -18.848 1.00 47.56 ? 353 HOH B O   1 
HETATM 4244 O O   . HOH F 3 .   ? 13.865  28.413  -11.070 1.00 40.46 ? 354 HOH B O   1 
HETATM 4245 O O   . HOH F 3 .   ? 6.916   12.257  -18.430 1.00 50.36 ? 355 HOH B O   1 
HETATM 4246 O O   . HOH F 3 .   ? 8.607   25.392  -16.785 1.00 50.10 ? 356 HOH B O   1 
HETATM 4247 O O   . HOH F 3 .   ? 29.294  23.507  -12.633 1.00 46.17 ? 357 HOH B O   1 
HETATM 4248 O O   . HOH F 3 .   ? 15.443  28.893  -17.728 1.00 40.56 ? 358 HOH B O   1 
HETATM 4249 O O   . HOH F 3 .   ? 13.992  7.459   -21.990 1.00 42.45 ? 359 HOH B O   1 
HETATM 4250 O O   . HOH F 3 .   ? 31.472  -15.580 -31.860 1.00 62.79 ? 360 HOH B O   1 
HETATM 4251 O O   . HOH F 3 .   ? 10.943  3.351   -10.821 1.00 50.69 ? 361 HOH B O   1 
HETATM 4252 O O   . HOH F 3 .   ? 15.126  11.069  -2.181  1.00 53.62 ? 362 HOH B O   1 
HETATM 4253 O O   . HOH F 3 .   ? 11.831  28.609  -21.761 1.00 52.97 ? 363 HOH B O   1 
HETATM 4254 O O   . HOH F 3 .   ? 28.143  12.034  -16.664 1.00 48.04 ? 364 HOH B O   1 
HETATM 4255 O O   . HOH F 3 .   ? 17.551  7.354   -20.808 1.00 41.54 ? 365 HOH B O   1 
HETATM 4256 O O   . HOH F 3 .   ? 11.264  28.153  -27.190 1.00 40.43 ? 366 HOH B O   1 
HETATM 4257 O O   . HOH F 3 .   ? 12.935  19.575  -32.159 1.00 46.45 ? 367 HOH B O   1 
HETATM 4258 O O   . HOH F 3 .   ? 30.596  16.082  -28.161 1.00 41.20 ? 368 HOH B O   1 
HETATM 4259 O O   . HOH F 3 .   ? 37.892  17.264  -32.609 1.00 64.25 ? 369 HOH B O   1 
HETATM 4260 O O   . HOH F 3 .   ? 3.980   8.415   -15.955 1.00 47.76 ? 370 HOH B O   1 
HETATM 4261 O O   . HOH F 3 .   ? 13.142  0.430   -5.068  1.00 60.01 ? 371 HOH B O   1 
HETATM 4262 O O   . HOH F 3 .   ? 25.201  31.246  -30.079 1.00 59.85 ? 372 HOH B O   1 
HETATM 4263 O O   . HOH F 3 .   ? 8.018   27.891  -26.238 1.00 57.75 ? 373 HOH B O   1 
HETATM 4264 O O   . HOH F 3 .   ? 30.150  -8.547  -42.800 1.00 51.86 ? 374 HOH B O   1 
HETATM 4265 O O   . HOH F 3 .   ? 14.081  -3.081  -16.082 1.00 54.45 ? 375 HOH B O   1 
HETATM 4266 O O   . HOH F 3 .   ? 8.406   5.680   -12.009 1.00 37.69 ? 376 HOH B O   1 
HETATM 4267 O O   . HOH F 3 .   ? 4.411   18.052  -25.498 1.00 64.79 ? 377 HOH B O   1 
HETATM 4268 O O   . HOH F 3 .   ? 33.906  21.222  -19.630 1.00 49.39 ? 378 HOH B O   1 
HETATM 4269 O O   . HOH F 3 .   ? 22.997  3.620   -6.272  1.00 46.60 ? 379 HOH B O   1 
HETATM 4270 O O   . HOH F 3 .   ? 3.572   21.088  -24.221 1.00 54.11 ? 380 HOH B O   1 
HETATM 4271 O O   . HOH F 3 .   ? 15.663  5.582   -47.247 1.00 55.91 ? 381 HOH B O   1 
HETATM 4272 O O   . HOH F 3 .   ? 31.507  19.217  -28.688 1.00 51.95 ? 382 HOH B O   1 
HETATM 4273 O O   . HOH F 3 .   ? 6.799   -5.090  -51.738 1.00 55.09 ? 383 HOH B O   1 
HETATM 4274 O O   . HOH F 3 .   ? 8.262   4.713   -48.021 1.00 55.34 ? 384 HOH B O   1 
HETATM 4275 O O   . HOH F 3 .   ? 14.330  16.987  -4.844  1.00 32.89 ? 385 HOH B O   1 
HETATM 4276 O O   . HOH F 3 .   ? 27.032  8.278   -15.775 1.00 52.93 ? 386 HOH B O   1 
HETATM 4277 O O   . HOH F 3 .   ? 14.233  5.573   -30.632 1.00 53.79 ? 387 HOH B O   1 
HETATM 4278 O O   . HOH F 3 .   ? 33.880  25.660  -30.435 1.00 49.64 ? 388 HOH B O   1 
HETATM 4279 O O   . HOH F 3 .   ? 1.817   7.368   -33.811 1.00 57.87 ? 389 HOH B O   1 
HETATM 4280 O O   . HOH F 3 .   ? 16.413  6.639   -49.750 1.00 50.58 ? 390 HOH B O   1 
HETATM 4281 O O   . HOH F 3 .   ? 27.479  13.633  -30.049 1.00 46.21 ? 391 HOH B O   1 
HETATM 4282 O O   . HOH F 3 .   ? 33.519  26.543  -21.529 1.00 48.59 ? 392 HOH B O   1 
HETATM 4283 O O   . HOH F 3 .   ? 25.485  24.850  -11.876 1.00 44.37 ? 393 HOH B O   1 
HETATM 4284 O O   . HOH F 3 .   ? 33.665  21.850  -22.369 1.00 49.56 ? 394 HOH B O   1 
HETATM 4285 O O   . HOH F 3 .   ? 23.192  26.667  -13.711 1.00 48.36 ? 395 HOH B O   1 
HETATM 4286 O O   . HOH F 3 .   ? 35.647  -6.953  -52.858 1.00 64.66 ? 396 HOH B O   1 
HETATM 4287 O O   . HOH F 3 .   ? 20.549  16.000  3.204   1.00 60.35 ? 397 HOH B O   1 
HETATM 4288 O O   . HOH F 3 .   ? 2.050   17.992  -19.021 1.00 52.14 ? 398 HOH B O   1 
HETATM 4289 O O   . HOH F 3 .   ? 29.142  13.526  -32.187 1.00 51.04 ? 399 HOH B O   1 
HETATM 4290 O O   . HOH F 3 .   ? 9.896   7.418   -51.310 1.00 52.68 ? 400 HOH B O   1 
HETATM 4291 O O   . HOH F 3 .   ? 10.253  -1.825  -52.022 1.00 48.98 ? 401 HOH B O   1 
HETATM 4292 O O   . HOH F 3 .   ? 20.835  29.295  -8.431  1.00 52.10 ? 402 HOH B O   1 
HETATM 4293 O O   . HOH F 3 .   ? 36.555  24.224  -30.889 1.00 59.70 ? 403 HOH B O   1 
HETATM 4294 O O   . HOH F 3 .   ? 32.211  21.265  -27.314 1.00 49.71 ? 404 HOH B O   1 
HETATM 4295 O O   . HOH F 3 .   ? 17.294  5.889   -3.881  1.00 47.24 ? 405 HOH B O   1 
HETATM 4296 O O   . HOH F 3 .   ? 22.782  18.301  -3.803  1.00 52.16 ? 406 HOH B O   1 
HETATM 4297 O O   . HOH F 3 .   ? 39.801  -8.669  -46.756 1.00 66.28 ? 407 HOH B O   1 
HETATM 4298 O O   . HOH F 3 .   ? 31.498  28.898  -16.000 1.00 52.81 ? 408 HOH B O   1 
HETATM 4299 O O   . HOH F 3 .   ? 8.158   19.857  -9.609  1.00 28.22 ? 409 HOH B O   1 
HETATM 4300 O O   . HOH F 3 .   ? 27.677  15.316  8.433   1.00 47.93 ? 410 HOH B O   1 
HETATM 4301 O O   . HOH F 3 .   ? 22.866  28.765  -15.933 1.00 49.32 ? 411 HOH B O   1 
HETATM 4302 O O   . HOH F 3 .   ? 13.217  27.313  -7.217  1.00 55.39 ? 412 HOH B O   1 
HETATM 4303 O O   . HOH F 3 .   ? 38.779  7.843   -43.123 1.00 67.84 ? 413 HOH B O   1 
HETATM 4304 O O   . HOH F 3 .   ? 15.922  28.160  -15.383 1.00 64.95 ? 414 HOH B O   1 
HETATM 4305 O O   . HOH F 3 .   ? 20.952  4.207   -23.809 1.00 63.14 ? 415 HOH B O   1 
HETATM 4306 O O   . HOH F 3 .   ? 2.704   -2.987  -33.195 1.00 56.77 ? 416 HOH B O   1 
HETATM 4307 O O   . HOH F 3 .   ? 4.795   0.729   -45.041 1.00 58.73 ? 417 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   39  ?   ?   ?   A . n 
A 1 2   ARG 2   40  ?   ?   ?   A . n 
A 1 3   GLU 3   41  ?   ?   ?   A . n 
A 1 4   ALA 4   42  ?   ?   ?   A . n 
A 1 5   GLU 5   43  ?   ?   ?   A . n 
A 1 6   ALA 6   44  ?   ?   ?   A . n 
A 1 7   ARG 7   45  45  ARG ARG A . n 
A 1 8   TRP 8   46  46  TRP TRP A . n 
A 1 9   ARG 9   47  47  ARG ARG A . n 
A 1 10  GLN 10  48  48  GLN GLN A . n 
A 1 11  THR 11  49  49  THR THR A . n 
A 1 12  TRP 12  50  50  TRP TRP A . n 
A 1 13  SER 13  51  51  SER SER A . n 
A 1 14  GLY 14  52  52  GLY GLY A . n 
A 1 15  PRO 15  53  53  PRO PRO A . n 
A 1 16  GLY 16  54  54  GLY GLY A . n 
A 1 17  THR 17  55  55  THR THR A . n 
A 1 18  THR 18  56  56  THR THR A . n 
A 1 19  LYS 19  57  57  LYS LYS A . n 
A 1 20  ARG 20  58  58  ARG ARG A . n 
A 1 21  PHE 21  59  59  PHE PHE A . n 
A 1 22  PRO 22  60  60  PRO PRO A . n 
A 1 23  GLU 23  61  61  GLU GLU A . n 
A 1 24  THR 24  62  62  THR THR A . n 
A 1 25  VAL 25  63  63  VAL VAL A . n 
A 1 26  LEU 26  64  64  LEU LEU A . n 
A 1 27  ALA 27  65  65  ALA ALA A . n 
A 1 28  ARG 28  66  66  ARG ARG A . n 
A 1 29  CYS 29  67  67  CYS CYS A . n 
A 1 30  VAL 30  68  68  VAL VAL A . n 
A 1 31  LYS 31  69  69  LYS LYS A . n 
A 1 32  TYR 32  70  70  TYR TYR A . n 
A 1 33  THR 33  71  71  THR THR A . n 
A 1 34  GLU 34  72  72  GLU GLU A . n 
A 1 35  ILE 35  73  73  ILE ILE A . n 
A 1 36  HIS 36  74  74  HIS HIS A . n 
A 1 37  PRO 37  75  75  PRO PRO A . n 
A 1 38  GLU 38  76  76  GLU GLU A . n 
A 1 39  MET 39  77  77  MET MET A . n 
A 1 40  ARG 40  78  78  ARG ARG A . n 
A 1 41  HIS 41  79  79  HIS HIS A . n 
A 1 42  VAL 42  80  80  VAL VAL A . n 
A 1 43  ASP 43  81  81  ASP ASP A . n 
A 1 44  CYS 44  82  82  CYS CYS A . n 
A 1 45  GLN 45  83  83  GLN GLN A . n 
A 1 46  SER 46  84  84  SER SER A . n 
A 1 47  VAL 47  85  85  VAL VAL A . n 
A 1 48  TRP 48  86  86  TRP TRP A . n 
A 1 49  ASP 49  87  87  ASP ASP A . n 
A 1 50  ALA 50  88  88  ALA ALA A . n 
A 1 51  PHE 51  89  89  PHE PHE A . n 
A 1 52  LYS 52  90  90  LYS LYS A . n 
A 1 53  GLY 53  91  91  GLY GLY A . n 
A 1 54  ALA 54  92  92  ALA ALA A . n 
A 1 55  PHE 55  93  93  PHE PHE A . n 
A 1 56  ILE 56  94  94  ILE ILE A . n 
A 1 57  SER 57  95  95  SER SER A . n 
A 1 58  LYS 58  96  96  LYS LYS A . n 
A 1 59  HIS 59  97  97  HIS HIS A . n 
A 1 60  PRO 60  98  98  PRO PRO A . n 
A 1 61  CYS 61  99  99  CYS CYS A . n 
A 1 62  ASP 62  100 100 ASP ASP A . n 
A 1 63  ILE 63  101 101 ILE ILE A . n 
A 1 64  THR 64  102 102 THR THR A . n 
A 1 65  GLU 65  103 103 GLU GLU A . n 
A 1 66  GLU 66  104 104 GLU GLU A . n 
A 1 67  ASP 67  105 105 ASP ASP A . n 
A 1 68  TYR 68  106 106 TYR TYR A . n 
A 1 69  GLN 69  107 107 GLN GLN A . n 
A 1 70  PRO 70  108 108 PRO PRO A . n 
A 1 71  LEU 71  109 109 LEU LEU A . n 
A 1 72  MET 72  110 110 MET MET A . n 
A 1 73  LYS 73  111 111 LYS LYS A . n 
A 1 74  LEU 74  112 112 LEU LEU A . n 
A 1 75  GLY 75  113 113 GLY GLY A . n 
A 1 76  THR 76  114 114 THR THR A . n 
A 1 77  GLN 77  115 115 GLN GLN A . n 
A 1 78  THR 78  116 116 THR THR A . n 
A 1 79  VAL 79  117 117 VAL VAL A . n 
A 1 80  PRO 80  118 118 PRO PRO A . n 
A 1 81  CYS 81  119 119 CYS CYS A . n 
A 1 82  ASN 82  120 120 ASN ASN A . n 
A 1 83  LYS 83  121 121 LYS LYS A . n 
A 1 84  ILE 84  122 122 ILE ILE A . n 
A 1 85  LEU 85  123 123 LEU LEU A . n 
A 1 86  LEU 86  124 124 LEU LEU A . n 
A 1 87  TRP 87  125 125 TRP TRP A . n 
A 1 88  SER 88  126 126 SER SER A . n 
A 1 89  ARG 89  127 127 ARG ARG A . n 
A 1 90  ILE 90  128 128 ILE ILE A . n 
A 1 91  LYS 91  129 129 LYS LYS A . n 
A 1 92  ASP 92  130 130 ASP ASP A . n 
A 1 93  LEU 93  131 131 LEU LEU A . n 
A 1 94  ALA 94  132 132 ALA ALA A . n 
A 1 95  HIS 95  133 133 HIS HIS A . n 
A 1 96  GLN 96  134 134 GLN GLN A . n 
A 1 97  PHE 97  135 135 PHE PHE A . n 
A 1 98  THR 98  136 136 THR THR A . n 
A 1 99  GLN 99  137 137 GLN GLN A . n 
A 1 100 VAL 100 138 138 VAL VAL A . n 
A 1 101 GLN 101 139 139 GLN GLN A . n 
A 1 102 ARG 102 140 140 ARG ARG A . n 
A 1 103 ASP 103 141 141 ASP ASP A . n 
A 1 104 MET 104 142 142 MET MET A . n 
A 1 105 PHE 105 143 143 PHE PHE A . n 
A 1 106 THR 106 144 144 THR THR A . n 
A 1 107 LEU 107 145 145 LEU LEU A . n 
A 1 108 GLU 108 146 146 GLU GLU A . n 
A 1 109 ASP 109 147 147 ASP ASP A . n 
A 1 110 THR 110 148 148 THR THR A . n 
A 1 111 LEU 111 149 149 LEU LEU A . n 
A 1 112 LEU 112 150 150 LEU LEU A . n 
A 1 113 GLY 113 151 151 GLY GLY A . n 
A 1 114 TYR 114 152 152 TYR TYR A . n 
A 1 115 LEU 115 153 153 LEU LEU A . n 
A 1 116 ALA 116 154 154 ALA ALA A . n 
A 1 117 ASP 117 155 155 ASP ASP A . n 
A 1 118 ASP 118 156 156 ASP ASP A . n 
A 1 119 LEU 119 157 157 LEU LEU A . n 
A 1 120 THR 120 158 158 THR THR A . n 
A 1 121 TRP 121 159 159 TRP TRP A . n 
A 1 122 CYS 122 160 160 CYS CYS A . n 
A 1 123 GLY 123 161 161 GLY GLY A . n 
A 1 124 GLU 124 162 162 GLU GLU A . n 
A 1 125 PHE 125 163 163 PHE PHE A . n 
A 1 126 ASP 126 164 164 ASP ASP A . n 
A 1 127 THR 127 165 165 THR THR A . n 
A 1 128 SER 128 166 166 SER SER A . n 
A 1 129 LYS 129 167 167 LYS LYS A . n 
A 1 130 ILE 130 168 168 ILE ILE A . n 
A 1 131 ASN 131 169 169 ASN ASN A . n 
A 1 132 TYR 132 170 170 TYR TYR A . n 
A 1 133 GLN 133 171 171 GLN GLN A . n 
A 1 134 SER 134 172 172 SER SER A . n 
A 1 135 CYS 135 173 173 CYS CYS A . n 
A 1 136 PRO 136 174 174 PRO PRO A . n 
A 1 137 ASP 137 175 175 ASP ASP A . n 
A 1 138 TRP 138 176 176 TRP TRP A . n 
A 1 139 ARG 139 177 177 ARG ARG A . n 
A 1 140 LYS 140 178 178 LYS LYS A . n 
A 1 141 ASP 141 179 179 ASP ASP A . n 
A 1 142 CYS 142 180 180 CYS CYS A . n 
A 1 143 SER 143 181 181 SER SER A . n 
A 1 144 ASN 144 182 182 ASN ASN A . n 
A 1 145 ASN 145 183 183 ASN ASN A . n 
A 1 146 PRO 146 184 184 PRO PRO A . n 
A 1 147 VAL 147 185 185 VAL VAL A . n 
A 1 148 SER 148 186 186 SER SER A . n 
A 1 149 VAL 149 187 187 VAL VAL A . n 
A 1 150 PHE 150 188 188 PHE PHE A . n 
A 1 151 TRP 151 189 189 TRP TRP A . n 
A 1 152 LYS 152 190 190 LYS LYS A . n 
A 1 153 THR 153 191 191 THR THR A . n 
A 1 154 VAL 154 192 192 VAL VAL A . n 
A 1 155 SER 155 193 193 SER SER A . n 
A 1 156 ARG 156 194 194 ARG ARG A . n 
A 1 157 ARG 157 195 195 ARG ARG A . n 
A 1 158 PHE 158 196 196 PHE PHE A . n 
A 1 159 ALA 159 197 197 ALA ALA A . n 
A 1 160 GLU 160 198 198 GLU GLU A . n 
A 1 161 ALA 161 199 199 ALA ALA A . n 
A 1 162 ALA 162 200 200 ALA ALA A . n 
A 1 163 CYS 163 201 201 CYS CYS A . n 
A 1 164 ASP 164 202 202 ASP ASP A . n 
A 1 165 VAL 165 203 203 VAL VAL A . n 
A 1 166 VAL 166 204 204 VAL VAL A . n 
A 1 167 HIS 167 205 205 HIS HIS A . n 
A 1 168 VAL 168 206 206 VAL VAL A . n 
A 1 169 MET 169 207 207 MET MET A . n 
A 1 170 LEU 170 208 208 LEU LEU A . n 
A 1 171 ASP 171 209 209 ASP ASP A . n 
A 1 172 GLY 172 210 210 GLY GLY A . n 
A 1 173 SER 173 211 211 SER SER A . n 
A 1 174 ARG 174 212 212 ARG ARG A . n 
A 1 175 SER 175 213 213 SER SER A . n 
A 1 176 LYS 176 214 214 LYS LYS A . n 
A 1 177 ILE 177 215 215 ILE ILE A . n 
A 1 178 PHE 178 216 216 PHE PHE A . n 
A 1 179 ASP 179 217 217 ASP ASP A . n 
A 1 180 LYS 180 218 218 LYS LYS A . n 
A 1 181 ASP 181 219 219 ASP ASP A . n 
A 1 182 SER 182 220 220 SER SER A . n 
A 1 183 THR 183 221 221 THR THR A . n 
A 1 184 PHE 184 222 222 PHE PHE A . n 
A 1 185 GLY 185 223 223 GLY GLY A . n 
A 1 186 SER 186 224 224 SER SER A . n 
A 1 187 VAL 187 225 225 VAL VAL A . n 
A 1 188 GLY 188 226 226 GLY GLY A . n 
A 1 189 VAL 189 227 227 VAL VAL A . n 
A 1 190 HIS 190 228 228 HIS HIS A . n 
A 1 191 ASN 191 229 229 ASN ASN A . n 
A 1 192 LEU 192 230 230 LEU LEU A . n 
A 1 193 GLN 193 231 231 GLN GLN A . n 
A 1 194 PRO 194 232 232 PRO PRO A . n 
A 1 195 GLU 195 233 233 GLU GLU A . n 
A 1 196 LYS 196 234 234 LYS LYS A . n 
A 1 197 VAL 197 235 235 VAL VAL A . n 
A 1 198 GLN 198 236 236 GLN GLN A . n 
A 1 199 THR 199 237 237 THR THR A . n 
A 1 200 LEU 200 238 238 LEU LEU A . n 
A 1 201 GLU 201 239 239 GLU GLU A . n 
A 1 202 ALA 202 240 240 ALA ALA A . n 
A 1 203 TRP 203 241 241 TRP TRP A . n 
A 1 204 VAL 204 242 242 VAL VAL A . n 
A 1 205 ILE 205 243 243 ILE ILE A . n 
A 1 206 HIS 206 244 244 HIS HIS A . n 
A 1 207 GLY 207 245 245 GLY GLY A . n 
A 1 208 GLY 208 246 246 GLY GLY A . n 
A 1 209 ARG 209 247 247 ARG GLY A . n 
A 1 210 GLU 210 248 248 GLU GLY A . n 
A 1 211 ASP 211 249 249 ASP GLY A . n 
A 1 212 SER 212 250 250 SER SER A . n 
A 1 213 ARG 213 251 251 ARG ARG A . n 
A 1 214 ASP 214 252 252 ASP ASP A . n 
A 1 215 LEU 215 253 253 LEU LEU A . n 
A 1 216 CYS 216 254 254 CYS CYS A . n 
A 1 217 GLN 217 255 255 GLN GLN A . n 
A 1 218 ASP 218 256 256 ASP ASP A . n 
A 1 219 PRO 219 257 257 PRO PRO A . n 
A 1 220 THR 220 258 258 THR THR A . n 
A 1 221 ILE 221 259 259 ILE ILE A . n 
A 1 222 LYS 222 260 260 LYS LYS A . n 
A 1 223 GLU 223 261 261 GLU GLU A . n 
A 1 224 LEU 224 262 262 LEU LEU A . n 
A 1 225 GLU 225 263 263 GLU GLU A . n 
A 1 226 SER 226 264 264 SER SER A . n 
A 1 227 ILE 227 265 265 ILE ILE A . n 
A 1 228 ILE 228 266 266 ILE ILE A . n 
A 1 229 SER 229 267 267 SER SER A . n 
A 1 230 LYS 230 268 268 LYS LYS A . n 
A 1 231 ARG 231 269 269 ARG ARG A . n 
A 1 232 ASN 232 270 270 ASN ASN A . n 
A 1 233 ILE 233 271 271 ILE ILE A . n 
A 1 234 GLN 234 272 272 GLN GLN A . n 
A 1 235 PHE 235 273 273 PHE PHE A . n 
A 1 236 SER 236 274 274 SER SER A . n 
A 1 237 CYS 237 275 275 CYS CYS A . n 
A 1 238 LYS 238 276 276 LYS LYS A . n 
A 1 239 ASN 239 277 277 ASN ASN A . n 
A 1 240 ILE 240 278 278 ILE ILE A . n 
A 1 241 TYR 241 279 279 TYR TYR A . n 
A 1 242 ARG 242 280 280 ARG GLY A . n 
A 1 243 PRO 243 281 281 PRO PRO A . n 
A 1 244 ASP 244 282 282 ASP ASP A . n 
A 1 245 LYS 245 283 283 LYS LYS A . n 
A 1 246 PHE 246 284 284 PHE PHE A . n 
A 1 247 LEU 247 285 285 LEU LEU A . n 
A 1 248 GLN 248 286 286 GLN GLN A . n 
A 1 249 CYS 249 287 287 CYS CYS A . n 
A 1 250 VAL 250 288 288 VAL VAL A . n 
A 1 251 LYS 251 289 289 LYS LYS A . n 
A 1 252 ASN 252 290 290 ASN ALA A . n 
A 1 253 PRO 253 291 291 PRO GLY A . n 
A 1 254 GLU 254 292 292 GLU GLY A . n 
A 1 255 ASP 255 293 293 ASP GLY A . n 
A 1 256 SER 256 294 294 SER GLY A . n 
A 1 257 SER 257 295 295 SER GLY A . n 
A 1 258 CYS 258 296 296 CYS CYS A . n 
A 1 259 THR 259 297 ?   ?   ?   A . n 
A 1 260 SER 260 298 ?   ?   ?   A . n 
A 1 261 GLU 261 299 ?   ?   ?   A . n 
A 1 262 ILE 262 300 ?   ?   ?   A . n 
B 1 1   LYS 1   39  ?   ?   ?   B . n 
B 1 2   ARG 2   40  ?   ?   ?   B . n 
B 1 3   GLU 3   41  ?   ?   ?   B . n 
B 1 4   ALA 4   42  ?   ?   ?   B . n 
B 1 5   GLU 5   43  ?   ?   ?   B . n 
B 1 6   ALA 6   44  ?   ?   ?   B . n 
B 1 7   ARG 7   45  45  ARG ARG B . n 
B 1 8   TRP 8   46  46  TRP TRP B . n 
B 1 9   ARG 9   47  47  ARG ARG B . n 
B 1 10  GLN 10  48  48  GLN GLN B . n 
B 1 11  THR 11  49  49  THR THR B . n 
B 1 12  TRP 12  50  50  TRP TRP B . n 
B 1 13  SER 13  51  51  SER SER B . n 
B 1 14  GLY 14  52  52  GLY GLY B . n 
B 1 15  PRO 15  53  53  PRO PRO B . n 
B 1 16  GLY 16  54  54  GLY GLY B . n 
B 1 17  THR 17  55  55  THR THR B . n 
B 1 18  THR 18  56  56  THR THR B . n 
B 1 19  LYS 19  57  57  LYS LYS B . n 
B 1 20  ARG 20  58  58  ARG ARG B . n 
B 1 21  PHE 21  59  59  PHE PHE B . n 
B 1 22  PRO 22  60  60  PRO PRO B . n 
B 1 23  GLU 23  61  61  GLU GLU B . n 
B 1 24  THR 24  62  62  THR THR B . n 
B 1 25  VAL 25  63  63  VAL VAL B . n 
B 1 26  LEU 26  64  64  LEU LEU B . n 
B 1 27  ALA 27  65  65  ALA ALA B . n 
B 1 28  ARG 28  66  66  ARG ARG B . n 
B 1 29  CYS 29  67  67  CYS CYS B . n 
B 1 30  VAL 30  68  68  VAL VAL B . n 
B 1 31  LYS 31  69  69  LYS LYS B . n 
B 1 32  TYR 32  70  70  TYR TYR B . n 
B 1 33  THR 33  71  71  THR THR B . n 
B 1 34  GLU 34  72  72  GLU GLU B . n 
B 1 35  ILE 35  73  73  ILE ILE B . n 
B 1 36  HIS 36  74  74  HIS HIS B . n 
B 1 37  PRO 37  75  75  PRO PRO B . n 
B 1 38  GLU 38  76  76  GLU GLU B . n 
B 1 39  MET 39  77  77  MET MET B . n 
B 1 40  ARG 40  78  78  ARG ARG B . n 
B 1 41  HIS 41  79  79  HIS HIS B . n 
B 1 42  VAL 42  80  80  VAL VAL B . n 
B 1 43  ASP 43  81  81  ASP ASP B . n 
B 1 44  CYS 44  82  82  CYS CYS B . n 
B 1 45  GLN 45  83  83  GLN GLN B . n 
B 1 46  SER 46  84  84  SER SER B . n 
B 1 47  VAL 47  85  85  VAL VAL B . n 
B 1 48  TRP 48  86  86  TRP TRP B . n 
B 1 49  ASP 49  87  87  ASP ASP B . n 
B 1 50  ALA 50  88  88  ALA ALA B . n 
B 1 51  PHE 51  89  89  PHE PHE B . n 
B 1 52  LYS 52  90  90  LYS LYS B . n 
B 1 53  GLY 53  91  91  GLY GLY B . n 
B 1 54  ALA 54  92  92  ALA ALA B . n 
B 1 55  PHE 55  93  93  PHE PHE B . n 
B 1 56  ILE 56  94  94  ILE ILE B . n 
B 1 57  SER 57  95  95  SER SER B . n 
B 1 58  LYS 58  96  96  LYS LYS B . n 
B 1 59  HIS 59  97  97  HIS HIS B . n 
B 1 60  PRO 60  98  98  PRO PRO B . n 
B 1 61  CYS 61  99  99  CYS CYS B . n 
B 1 62  ASP 62  100 100 ASP ASP B . n 
B 1 63  ILE 63  101 101 ILE ILE B . n 
B 1 64  THR 64  102 102 THR THR B . n 
B 1 65  GLU 65  103 103 GLU GLU B . n 
B 1 66  GLU 66  104 104 GLU GLU B . n 
B 1 67  ASP 67  105 105 ASP ASP B . n 
B 1 68  TYR 68  106 106 TYR TYR B . n 
B 1 69  GLN 69  107 107 GLN GLN B . n 
B 1 70  PRO 70  108 108 PRO PRO B . n 
B 1 71  LEU 71  109 109 LEU LEU B . n 
B 1 72  MET 72  110 110 MET MET B . n 
B 1 73  LYS 73  111 111 LYS LYS B . n 
B 1 74  LEU 74  112 112 LEU LEU B . n 
B 1 75  GLY 75  113 113 GLY GLY B . n 
B 1 76  THR 76  114 114 THR THR B . n 
B 1 77  GLN 77  115 115 GLN GLN B . n 
B 1 78  THR 78  116 116 THR THR B . n 
B 1 79  VAL 79  117 117 VAL VAL B . n 
B 1 80  PRO 80  118 118 PRO PRO B . n 
B 1 81  CYS 81  119 119 CYS CYS B . n 
B 1 82  ASN 82  120 120 ASN ASN B . n 
B 1 83  LYS 83  121 121 LYS LYS B . n 
B 1 84  ILE 84  122 122 ILE ILE B . n 
B 1 85  LEU 85  123 123 LEU LEU B . n 
B 1 86  LEU 86  124 124 LEU LEU B . n 
B 1 87  TRP 87  125 125 TRP TRP B . n 
B 1 88  SER 88  126 126 SER SER B . n 
B 1 89  ARG 89  127 127 ARG ARG B . n 
B 1 90  ILE 90  128 128 ILE ILE B . n 
B 1 91  LYS 91  129 129 LYS LYS B . n 
B 1 92  ASP 92  130 130 ASP ASP B . n 
B 1 93  LEU 93  131 131 LEU LEU B . n 
B 1 94  ALA 94  132 132 ALA ALA B . n 
B 1 95  HIS 95  133 133 HIS HIS B . n 
B 1 96  GLN 96  134 134 GLN GLN B . n 
B 1 97  PHE 97  135 135 PHE PHE B . n 
B 1 98  THR 98  136 136 THR THR B . n 
B 1 99  GLN 99  137 137 GLN GLN B . n 
B 1 100 VAL 100 138 138 VAL VAL B . n 
B 1 101 GLN 101 139 139 GLN GLN B . n 
B 1 102 ARG 102 140 140 ARG ARG B . n 
B 1 103 ASP 103 141 141 ASP ASP B . n 
B 1 104 MET 104 142 142 MET MET B . n 
B 1 105 PHE 105 143 143 PHE PHE B . n 
B 1 106 THR 106 144 144 THR THR B . n 
B 1 107 LEU 107 145 145 LEU LEU B . n 
B 1 108 GLU 108 146 146 GLU GLU B . n 
B 1 109 ASP 109 147 147 ASP ASP B . n 
B 1 110 THR 110 148 148 THR THR B . n 
B 1 111 LEU 111 149 149 LEU LEU B . n 
B 1 112 LEU 112 150 150 LEU LEU B . n 
B 1 113 GLY 113 151 151 GLY GLY B . n 
B 1 114 TYR 114 152 152 TYR TYR B . n 
B 1 115 LEU 115 153 153 LEU LEU B . n 
B 1 116 ALA 116 154 154 ALA ALA B . n 
B 1 117 ASP 117 155 155 ASP ASP B . n 
B 1 118 ASP 118 156 156 ASP ASP B . n 
B 1 119 LEU 119 157 157 LEU LEU B . n 
B 1 120 THR 120 158 158 THR THR B . n 
B 1 121 TRP 121 159 159 TRP TRP B . n 
B 1 122 CYS 122 160 160 CYS CYS B . n 
B 1 123 GLY 123 161 161 GLY GLY B . n 
B 1 124 GLU 124 162 162 GLU GLU B . n 
B 1 125 PHE 125 163 163 PHE PHE B . n 
B 1 126 ASP 126 164 164 ASP ASP B . n 
B 1 127 THR 127 165 165 THR THR B . n 
B 1 128 SER 128 166 166 SER SER B . n 
B 1 129 LYS 129 167 167 LYS LYS B . n 
B 1 130 ILE 130 168 168 ILE ILE B . n 
B 1 131 ASN 131 169 169 ASN ASN B . n 
B 1 132 TYR 132 170 170 TYR TYR B . n 
B 1 133 GLN 133 171 171 GLN GLN B . n 
B 1 134 SER 134 172 172 SER SER B . n 
B 1 135 CYS 135 173 173 CYS CYS B . n 
B 1 136 PRO 136 174 174 PRO PRO B . n 
B 1 137 ASP 137 175 175 ASP ASP B . n 
B 1 138 TRP 138 176 176 TRP TRP B . n 
B 1 139 ARG 139 177 177 ARG ARG B . n 
B 1 140 LYS 140 178 178 LYS LYS B . n 
B 1 141 ASP 141 179 179 ASP ASP B . n 
B 1 142 CYS 142 180 180 CYS CYS B . n 
B 1 143 SER 143 181 181 SER SER B . n 
B 1 144 ASN 144 182 182 ASN ASN B . n 
B 1 145 ASN 145 183 183 ASN ASN B . n 
B 1 146 PRO 146 184 184 PRO PRO B . n 
B 1 147 VAL 147 185 185 VAL VAL B . n 
B 1 148 SER 148 186 186 SER SER B . n 
B 1 149 VAL 149 187 187 VAL VAL B . n 
B 1 150 PHE 150 188 188 PHE PHE B . n 
B 1 151 TRP 151 189 189 TRP TRP B . n 
B 1 152 LYS 152 190 190 LYS LYS B . n 
B 1 153 THR 153 191 191 THR THR B . n 
B 1 154 VAL 154 192 192 VAL VAL B . n 
B 1 155 SER 155 193 193 SER SER B . n 
B 1 156 ARG 156 194 194 ARG ARG B . n 
B 1 157 ARG 157 195 195 ARG ARG B . n 
B 1 158 PHE 158 196 196 PHE PHE B . n 
B 1 159 ALA 159 197 197 ALA ALA B . n 
B 1 160 GLU 160 198 198 GLU GLU B . n 
B 1 161 ALA 161 199 199 ALA ALA B . n 
B 1 162 ALA 162 200 200 ALA ALA B . n 
B 1 163 CYS 163 201 201 CYS CYS B . n 
B 1 164 ASP 164 202 202 ASP ASP B . n 
B 1 165 VAL 165 203 203 VAL VAL B . n 
B 1 166 VAL 166 204 204 VAL VAL B . n 
B 1 167 HIS 167 205 205 HIS HIS B . n 
B 1 168 VAL 168 206 206 VAL VAL B . n 
B 1 169 MET 169 207 207 MET MET B . n 
B 1 170 LEU 170 208 208 LEU LEU B . n 
B 1 171 ASP 171 209 209 ASP ASP B . n 
B 1 172 GLY 172 210 210 GLY GLY B . n 
B 1 173 SER 173 211 211 SER SER B . n 
B 1 174 ARG 174 212 212 ARG ARG B . n 
B 1 175 SER 175 213 213 SER SER B . n 
B 1 176 LYS 176 214 214 LYS LYS B . n 
B 1 177 ILE 177 215 215 ILE ILE B . n 
B 1 178 PHE 178 216 216 PHE PHE B . n 
B 1 179 ASP 179 217 217 ASP ASP B . n 
B 1 180 LYS 180 218 218 LYS LYS B . n 
B 1 181 ASP 181 219 219 ASP ASP B . n 
B 1 182 SER 182 220 220 SER SER B . n 
B 1 183 THR 183 221 221 THR THR B . n 
B 1 184 PHE 184 222 222 PHE PHE B . n 
B 1 185 GLY 185 223 223 GLY GLY B . n 
B 1 186 SER 186 224 224 SER SER B . n 
B 1 187 VAL 187 225 225 VAL VAL B . n 
B 1 188 GLY 188 226 226 GLY GLY B . n 
B 1 189 VAL 189 227 227 VAL VAL B . n 
B 1 190 HIS 190 228 228 HIS HIS B . n 
B 1 191 ASN 191 229 229 ASN ASN B . n 
B 1 192 LEU 192 230 230 LEU LEU B . n 
B 1 193 GLN 193 231 231 GLN GLN B . n 
B 1 194 PRO 194 232 232 PRO PRO B . n 
B 1 195 GLU 195 233 233 GLU GLU B . n 
B 1 196 LYS 196 234 234 LYS LYS B . n 
B 1 197 VAL 197 235 235 VAL VAL B . n 
B 1 198 GLN 198 236 236 GLN GLN B . n 
B 1 199 THR 199 237 237 THR THR B . n 
B 1 200 LEU 200 238 238 LEU LEU B . n 
B 1 201 GLU 201 239 239 GLU GLU B . n 
B 1 202 ALA 202 240 240 ALA ALA B . n 
B 1 203 TRP 203 241 241 TRP TRP B . n 
B 1 204 VAL 204 242 242 VAL VAL B . n 
B 1 205 ILE 205 243 243 ILE ILE B . n 
B 1 206 HIS 206 244 244 HIS HIS B . n 
B 1 207 GLY 207 245 245 GLY GLY B . n 
B 1 208 GLY 208 246 246 GLY GLY B . n 
B 1 209 ARG 209 247 247 ARG GLY B . n 
B 1 210 GLU 210 248 248 GLU GLY B . n 
B 1 211 ASP 211 249 249 ASP GLY B . n 
B 1 212 SER 212 250 250 SER SER B . n 
B 1 213 ARG 213 251 251 ARG ARG B . n 
B 1 214 ASP 214 252 252 ASP ASP B . n 
B 1 215 LEU 215 253 253 LEU LEU B . n 
B 1 216 CYS 216 254 254 CYS CYS B . n 
B 1 217 GLN 217 255 255 GLN GLN B . n 
B 1 218 ASP 218 256 256 ASP ASP B . n 
B 1 219 PRO 219 257 257 PRO PRO B . n 
B 1 220 THR 220 258 258 THR THR B . n 
B 1 221 ILE 221 259 259 ILE ILE B . n 
B 1 222 LYS 222 260 260 LYS LYS B . n 
B 1 223 GLU 223 261 261 GLU GLU B . n 
B 1 224 LEU 224 262 262 LEU LEU B . n 
B 1 225 GLU 225 263 263 GLU GLU B . n 
B 1 226 SER 226 264 264 SER SER B . n 
B 1 227 ILE 227 265 265 ILE ILE B . n 
B 1 228 ILE 228 266 266 ILE ILE B . n 
B 1 229 SER 229 267 267 SER SER B . n 
B 1 230 LYS 230 268 268 LYS LYS B . n 
B 1 231 ARG 231 269 269 ARG ARG B . n 
B 1 232 ASN 232 270 270 ASN ASN B . n 
B 1 233 ILE 233 271 271 ILE ILE B . n 
B 1 234 GLN 234 272 272 GLN GLN B . n 
B 1 235 PHE 235 273 273 PHE PHE B . n 
B 1 236 SER 236 274 274 SER SER B . n 
B 1 237 CYS 237 275 275 CYS CYS B . n 
B 1 238 LYS 238 276 276 LYS LYS B . n 
B 1 239 ASN 239 277 277 ASN ASN B . n 
B 1 240 ILE 240 278 278 ILE ILE B . n 
B 1 241 TYR 241 279 279 TYR TYR B . n 
B 1 242 ARG 242 280 280 ARG GLY B . n 
B 1 243 PRO 243 281 281 PRO PRO B . n 
B 1 244 ASP 244 282 282 ASP ASP B . n 
B 1 245 LYS 245 283 283 LYS LYS B . n 
B 1 246 PHE 246 284 284 PHE PHE B . n 
B 1 247 LEU 247 285 285 LEU LEU B . n 
B 1 248 GLN 248 286 286 GLN GLN B . n 
B 1 249 CYS 249 287 287 CYS CYS B . n 
B 1 250 VAL 250 288 288 VAL VAL B . n 
B 1 251 LYS 251 289 289 LYS LYS B . n 
B 1 252 ASN 252 290 290 ASN ALA B . n 
B 1 253 PRO 253 291 291 PRO GLY B . n 
B 1 254 GLU 254 292 292 GLU GLY B . n 
B 1 255 ASP 255 293 293 ASP GLY B . n 
B 1 256 SER 256 294 294 SER GLY B . n 
B 1 257 SER 257 295 295 SER GLY B . n 
B 1 258 CYS 258 296 296 CYS CYS B . n 
B 1 259 THR 259 297 ?   ?   ?   B . n 
B 1 260 SER 260 298 ?   ?   ?   B . n 
B 1 261 GLU 261 299 ?   ?   ?   B . n 
B 1 262 ILE 262 300 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-08-22 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 0.0727  -0.2767 0.8041   -0.2126 -0.1738 -0.1876 -0.0126 -0.0035 0.0358  2.9548 5.1593 0.9069 -1.2275 -0.0206 -0.7529 
-0.0301 -0.1702 -0.4622 0.3510  0.0145 -0.1316 -0.0144 0.0348  0.0157  'X-RAY DIFFRACTION' 
2 ? refined 19.1572 8.6088  -28.5241 -0.1394 -0.1118 -0.1241 0.0107  -0.0276 -0.0550 3.3901 1.7298 6.0752 0.3226  -0.1448 0.6094  
-0.0163 0.6078  -0.5918 -0.2732 0.0329 0.0563  0.5778  -0.0709 -0.0166 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 45 A 7 A 296 A 258 ? 'X-RAY DIFFRACTION' ? 
2 2 B 45 B 7 B 296 B 258 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement        5.2.0019 ? 1 
ADSC     'data collection' .        ? 2 
HKL-2000 'data scaling'    .        ? 3 
MOLREP   phasing           .        ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 A GLU 103 ? ? NH2 A ARG 194 ? ? 1.77 
2 1 O   B LEU 230 ? ? NH1 B ARG 269 ? ? 2.11 
3 1 O   A HOH 332 ? ? O   A HOH 434 ? ? 2.17 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CE B LYS 214 ? ? NZ B LYS 214 ? ? 1.645 1.486 0.159 0.025 N 
2 1 CD B LYS 283 ? ? CE B LYS 283 ? ? 1.664 1.508 0.156 0.025 N 
3 1 CE B LYS 283 ? ? NZ B LYS 283 ? ? 1.689 1.486 0.203 0.025 N 
4 1 C  B CYS 296 ? ? O  B CYS 296 ? ? 1.412 1.229 0.183 0.019 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 118 ? ? -54.92  108.86  
2  1 ARG A 127 ? ? 66.35   -32.88  
3  1 ILE A 128 ? ? -97.50  55.61   
4  1 ARG A 140 ? ? -62.15  11.45   
5  1 ASP A 179 ? ? -103.64 -65.30  
6  1 ASN A 182 ? ? -85.91  47.17   
7  1 ASP A 202 ? ? 65.30   -122.48 
8  1 LYS A 214 ? ? -116.54 78.19   
9  1 ARG A 247 ? ? 83.93   -84.07  
10 1 GLU A 248 ? ? 110.01  133.12  
11 1 SER A 250 ? ? -101.83 -167.96 
12 1 ASN A 270 ? ? 74.05   38.43   
13 1 GLU A 292 ? ? 64.67   174.38  
14 1 ASP A 293 ? ? 82.73   111.45  
15 1 SER A 294 ? ? 78.18   -127.97 
16 1 ILE B 128 ? ? -170.27 52.14   
17 1 ASP B 179 ? ? -109.11 -73.83  
18 1 ASP B 202 ? ? 68.15   -117.52 
19 1 ARG B 212 ? ? 161.85  114.70  
20 1 SER B 213 ? ? -69.52  30.36   
21 1 VAL B 225 ? ? -120.98 -52.15  
22 1 HIS B 244 ? ? -63.03  -173.62 
23 1 GLU B 248 ? ? 82.69   98.90   
24 1 ARG B 251 ? ? 56.24   134.95  
25 1 ASP B 252 ? ? -32.68  92.86   
26 1 TYR B 279 ? ? -76.61  -72.29  
27 1 GLU B 292 ? ? 50.73   76.26   
28 1 ASP B 293 ? ? 173.55  82.15   
29 1 SER B 294 ? ? 146.89  -152.67 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    164 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   THR 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    165 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -143.72 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 247 ? CB  ? A ARG 209 CB  
2  1 Y 1 A ARG 247 ? CG  ? A ARG 209 CG  
3  1 Y 1 A ARG 247 ? CD  ? A ARG 209 CD  
4  1 Y 1 A ARG 247 ? NE  ? A ARG 209 NE  
5  1 Y 1 A ARG 247 ? CZ  ? A ARG 209 CZ  
6  1 Y 1 A ARG 247 ? NH1 ? A ARG 209 NH1 
7  1 Y 1 A ARG 247 ? NH2 ? A ARG 209 NH2 
8  1 Y 1 A GLU 248 ? CB  ? A GLU 210 CB  
9  1 Y 1 A GLU 248 ? CG  ? A GLU 210 CG  
10 1 Y 1 A GLU 248 ? CD  ? A GLU 210 CD  
11 1 Y 1 A GLU 248 ? OE1 ? A GLU 210 OE1 
12 1 Y 1 A GLU 248 ? OE2 ? A GLU 210 OE2 
13 1 Y 1 A ASP 249 ? CB  ? A ASP 211 CB  
14 1 Y 1 A ASP 249 ? CG  ? A ASP 211 CG  
15 1 Y 1 A ASP 249 ? OD1 ? A ASP 211 OD1 
16 1 Y 1 A ASP 249 ? OD2 ? A ASP 211 OD2 
17 1 Y 1 A ARG 280 ? CB  ? A ARG 242 CB  
18 1 Y 1 A ARG 280 ? CG  ? A ARG 242 CG  
19 1 Y 1 A ARG 280 ? CD  ? A ARG 242 CD  
20 1 Y 1 A ARG 280 ? NE  ? A ARG 242 NE  
21 1 Y 1 A ARG 280 ? CZ  ? A ARG 242 CZ  
22 1 Y 1 A ARG 280 ? NH1 ? A ARG 242 NH1 
23 1 Y 1 A ARG 280 ? NH2 ? A ARG 242 NH2 
24 1 Y 1 A ASN 290 ? CG  ? A ASN 252 CG  
25 1 Y 1 A ASN 290 ? OD1 ? A ASN 252 OD1 
26 1 Y 1 A ASN 290 ? ND2 ? A ASN 252 ND2 
27 1 Y 1 A PRO 291 ? CB  ? A PRO 253 CB  
28 1 Y 1 A PRO 291 ? CG  ? A PRO 253 CG  
29 1 Y 1 A PRO 291 ? CD  ? A PRO 253 CD  
30 1 Y 1 A GLU 292 ? CB  ? A GLU 254 CB  
31 1 Y 1 A GLU 292 ? CG  ? A GLU 254 CG  
32 1 Y 1 A GLU 292 ? CD  ? A GLU 254 CD  
33 1 Y 1 A GLU 292 ? OE1 ? A GLU 254 OE1 
34 1 Y 1 A GLU 292 ? OE2 ? A GLU 254 OE2 
35 1 Y 1 A ASP 293 ? CB  ? A ASP 255 CB  
36 1 Y 1 A ASP 293 ? CG  ? A ASP 255 CG  
37 1 Y 1 A ASP 293 ? OD1 ? A ASP 255 OD1 
38 1 Y 1 A ASP 293 ? OD2 ? A ASP 255 OD2 
39 1 Y 1 A SER 294 ? CB  ? A SER 256 CB  
40 1 Y 1 A SER 294 ? OG  ? A SER 256 OG  
41 1 Y 1 A SER 295 ? CB  ? A SER 257 CB  
42 1 Y 1 A SER 295 ? OG  ? A SER 257 OG  
43 1 Y 1 B ARG 247 ? CB  ? B ARG 209 CB  
44 1 Y 1 B ARG 247 ? CG  ? B ARG 209 CG  
45 1 Y 1 B ARG 247 ? CD  ? B ARG 209 CD  
46 1 Y 1 B ARG 247 ? NE  ? B ARG 209 NE  
47 1 Y 1 B ARG 247 ? CZ  ? B ARG 209 CZ  
48 1 Y 1 B ARG 247 ? NH1 ? B ARG 209 NH1 
49 1 Y 1 B ARG 247 ? NH2 ? B ARG 209 NH2 
50 1 Y 1 B GLU 248 ? CB  ? B GLU 210 CB  
51 1 Y 1 B GLU 248 ? CG  ? B GLU 210 CG  
52 1 Y 1 B GLU 248 ? CD  ? B GLU 210 CD  
53 1 Y 1 B GLU 248 ? OE1 ? B GLU 210 OE1 
54 1 Y 1 B GLU 248 ? OE2 ? B GLU 210 OE2 
55 1 Y 1 B ASP 249 ? CB  ? B ASP 211 CB  
56 1 Y 1 B ASP 249 ? CG  ? B ASP 211 CG  
57 1 Y 1 B ASP 249 ? OD1 ? B ASP 211 OD1 
58 1 Y 1 B ASP 249 ? OD2 ? B ASP 211 OD2 
59 1 Y 1 B ARG 280 ? CB  ? B ARG 242 CB  
60 1 Y 1 B ARG 280 ? CG  ? B ARG 242 CG  
61 1 Y 1 B ARG 280 ? CD  ? B ARG 242 CD  
62 1 Y 1 B ARG 280 ? NE  ? B ARG 242 NE  
63 1 Y 1 B ARG 280 ? CZ  ? B ARG 242 CZ  
64 1 Y 1 B ARG 280 ? NH1 ? B ARG 242 NH1 
65 1 Y 1 B ARG 280 ? NH2 ? B ARG 242 NH2 
66 1 Y 1 B ASN 290 ? CG  ? B ASN 252 CG  
67 1 Y 1 B ASN 290 ? OD1 ? B ASN 252 OD1 
68 1 Y 1 B ASN 290 ? ND2 ? B ASN 252 ND2 
69 1 Y 1 B PRO 291 ? CB  ? B PRO 253 CB  
70 1 Y 1 B PRO 291 ? CG  ? B PRO 253 CG  
71 1 Y 1 B PRO 291 ? CD  ? B PRO 253 CD  
72 1 Y 1 B GLU 292 ? CB  ? B GLU 254 CB  
73 1 Y 1 B GLU 292 ? CG  ? B GLU 254 CG  
74 1 Y 1 B GLU 292 ? CD  ? B GLU 254 CD  
75 1 Y 1 B GLU 292 ? OE1 ? B GLU 254 OE1 
76 1 Y 1 B GLU 292 ? OE2 ? B GLU 254 OE2 
77 1 Y 1 B ASP 293 ? CB  ? B ASP 255 CB  
78 1 Y 1 B ASP 293 ? CG  ? B ASP 255 CG  
79 1 Y 1 B ASP 293 ? OD1 ? B ASP 255 OD1 
80 1 Y 1 B ASP 293 ? OD2 ? B ASP 255 OD2 
81 1 Y 1 B SER 294 ? CB  ? B SER 256 CB  
82 1 Y 1 B SER 294 ? OG  ? B SER 256 OG  
83 1 Y 1 B SER 295 ? CB  ? B SER 257 CB  
84 1 Y 1 B SER 295 ? OG  ? B SER 257 OG  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LYS 39  ? A LYS 1   
2  1 Y 1 A ARG 40  ? A ARG 2   
3  1 Y 1 A GLU 41  ? A GLU 3   
4  1 Y 1 A ALA 42  ? A ALA 4   
5  1 Y 1 A GLU 43  ? A GLU 5   
6  1 Y 1 A ALA 44  ? A ALA 6   
7  1 Y 1 A THR 297 ? A THR 259 
8  1 Y 1 A SER 298 ? A SER 260 
9  1 Y 1 A GLU 299 ? A GLU 261 
10 1 Y 1 A ILE 300 ? A ILE 262 
11 1 Y 1 B LYS 39  ? B LYS 1   
12 1 Y 1 B ARG 40  ? B ARG 2   
13 1 Y 1 B GLU 41  ? B GLU 3   
14 1 Y 1 B ALA 42  ? B ALA 4   
15 1 Y 1 B GLU 43  ? B GLU 5   
16 1 Y 1 B ALA 44  ? B ALA 6   
17 1 Y 1 B THR 297 ? B THR 259 
18 1 Y 1 B SER 298 ? B SER 260 
19 1 Y 1 B GLU 299 ? B GLU 261 
20 1 Y 1 B ILE 300 ? B ILE 262 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'BETA-NICOTINAMIDE RIBOSE MONOPHOSPHATE' NMN 
3 water                                    HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NMN 1   301 301 NMN NMN A . 
D 2 NMN 1   302 301 NMN NMN B . 
E 3 HOH 1   302 2   HOH HOH A . 
E 3 HOH 2   303 3   HOH HOH A . 
E 3 HOH 3   304 4   HOH HOH A . 
E 3 HOH 4   305 8   HOH HOH A . 
E 3 HOH 5   306 10  HOH HOH A . 
E 3 HOH 6   307 12  HOH HOH A . 
E 3 HOH 7   308 15  HOH HOH A . 
E 3 HOH 8   309 17  HOH HOH A . 
E 3 HOH 9   310 19  HOH HOH A . 
E 3 HOH 10  311 21  HOH HOH A . 
E 3 HOH 11  312 22  HOH HOH A . 
E 3 HOH 12  313 23  HOH HOH A . 
E 3 HOH 13  314 24  HOH HOH A . 
E 3 HOH 14  315 27  HOH HOH A . 
E 3 HOH 15  316 29  HOH HOH A . 
E 3 HOH 16  317 30  HOH HOH A . 
E 3 HOH 17  318 32  HOH HOH A . 
E 3 HOH 18  319 33  HOH HOH A . 
E 3 HOH 19  320 36  HOH HOH A . 
E 3 HOH 20  321 39  HOH HOH A . 
E 3 HOH 21  322 45  HOH HOH A . 
E 3 HOH 22  323 47  HOH HOH A . 
E 3 HOH 23  324 48  HOH HOH A . 
E 3 HOH 24  325 50  HOH HOH A . 
E 3 HOH 25  326 51  HOH HOH A . 
E 3 HOH 26  327 54  HOH HOH A . 
E 3 HOH 27  328 55  HOH HOH A . 
E 3 HOH 28  329 57  HOH HOH A . 
E 3 HOH 29  330 58  HOH HOH A . 
E 3 HOH 30  331 59  HOH HOH A . 
E 3 HOH 31  332 60  HOH HOH A . 
E 3 HOH 32  333 61  HOH HOH A . 
E 3 HOH 33  334 64  HOH HOH A . 
E 3 HOH 34  335 65  HOH HOH A . 
E 3 HOH 35  336 66  HOH HOH A . 
E 3 HOH 36  337 67  HOH HOH A . 
E 3 HOH 37  338 68  HOH HOH A . 
E 3 HOH 38  339 69  HOH HOH A . 
E 3 HOH 39  340 70  HOH HOH A . 
E 3 HOH 40  341 71  HOH HOH A . 
E 3 HOH 41  342 72  HOH HOH A . 
E 3 HOH 42  343 78  HOH HOH A . 
E 3 HOH 43  344 79  HOH HOH A . 
E 3 HOH 44  345 84  HOH HOH A . 
E 3 HOH 45  346 85  HOH HOH A . 
E 3 HOH 46  347 86  HOH HOH A . 
E 3 HOH 47  348 87  HOH HOH A . 
E 3 HOH 48  349 88  HOH HOH A . 
E 3 HOH 49  350 90  HOH HOH A . 
E 3 HOH 50  351 91  HOH HOH A . 
E 3 HOH 51  352 92  HOH HOH A . 
E 3 HOH 52  353 93  HOH HOH A . 
E 3 HOH 53  354 99  HOH HOH A . 
E 3 HOH 54  355 100 HOH HOH A . 
E 3 HOH 55  356 103 HOH HOH A . 
E 3 HOH 56  357 106 HOH HOH A . 
E 3 HOH 57  358 107 HOH HOH A . 
E 3 HOH 58  359 108 HOH HOH A . 
E 3 HOH 59  360 109 HOH HOH A . 
E 3 HOH 60  361 112 HOH HOH A . 
E 3 HOH 61  362 113 HOH HOH A . 
E 3 HOH 62  363 114 HOH HOH A . 
E 3 HOH 63  364 115 HOH HOH A . 
E 3 HOH 64  365 116 HOH HOH A . 
E 3 HOH 65  366 119 HOH HOH A . 
E 3 HOH 66  367 120 HOH HOH A . 
E 3 HOH 67  368 121 HOH HOH A . 
E 3 HOH 68  369 125 HOH HOH A . 
E 3 HOH 69  370 128 HOH HOH A . 
E 3 HOH 70  371 129 HOH HOH A . 
E 3 HOH 71  372 134 HOH HOH A . 
E 3 HOH 72  373 135 HOH HOH A . 
E 3 HOH 73  374 136 HOH HOH A . 
E 3 HOH 74  375 137 HOH HOH A . 
E 3 HOH 75  376 138 HOH HOH A . 
E 3 HOH 76  377 141 HOH HOH A . 
E 3 HOH 77  378 142 HOH HOH A . 
E 3 HOH 78  379 143 HOH HOH A . 
E 3 HOH 79  380 144 HOH HOH A . 
E 3 HOH 80  381 145 HOH HOH A . 
E 3 HOH 81  382 146 HOH HOH A . 
E 3 HOH 82  383 147 HOH HOH A . 
E 3 HOH 83  384 154 HOH HOH A . 
E 3 HOH 84  385 155 HOH HOH A . 
E 3 HOH 85  386 156 HOH HOH A . 
E 3 HOH 86  387 158 HOH HOH A . 
E 3 HOH 87  388 159 HOH HOH A . 
E 3 HOH 88  389 160 HOH HOH A . 
E 3 HOH 89  390 163 HOH HOH A . 
E 3 HOH 90  391 168 HOH HOH A . 
E 3 HOH 91  392 169 HOH HOH A . 
E 3 HOH 92  393 171 HOH HOH A . 
E 3 HOH 93  394 173 HOH HOH A . 
E 3 HOH 94  395 175 HOH HOH A . 
E 3 HOH 95  396 176 HOH HOH A . 
E 3 HOH 96  397 177 HOH HOH A . 
E 3 HOH 97  398 178 HOH HOH A . 
E 3 HOH 98  399 179 HOH HOH A . 
E 3 HOH 99  400 181 HOH HOH A . 
E 3 HOH 100 401 183 HOH HOH A . 
E 3 HOH 101 402 184 HOH HOH A . 
E 3 HOH 102 403 186 HOH HOH A . 
E 3 HOH 103 404 189 HOH HOH A . 
E 3 HOH 104 405 190 HOH HOH A . 
E 3 HOH 105 406 192 HOH HOH A . 
E 3 HOH 106 407 194 HOH HOH A . 
E 3 HOH 107 408 195 HOH HOH A . 
E 3 HOH 108 409 196 HOH HOH A . 
E 3 HOH 109 410 197 HOH HOH A . 
E 3 HOH 110 411 199 HOH HOH A . 
E 3 HOH 111 412 200 HOH HOH A . 
E 3 HOH 112 413 203 HOH HOH A . 
E 3 HOH 113 414 204 HOH HOH A . 
E 3 HOH 114 415 208 HOH HOH A . 
E 3 HOH 115 416 209 HOH HOH A . 
E 3 HOH 116 417 210 HOH HOH A . 
E 3 HOH 117 418 211 HOH HOH A . 
E 3 HOH 118 419 213 HOH HOH A . 
E 3 HOH 119 420 214 HOH HOH A . 
E 3 HOH 120 421 218 HOH HOH A . 
E 3 HOH 121 422 220 HOH HOH A . 
E 3 HOH 122 423 221 HOH HOH A . 
E 3 HOH 123 424 222 HOH HOH A . 
E 3 HOH 124 425 224 HOH HOH A . 
E 3 HOH 125 426 225 HOH HOH A . 
E 3 HOH 126 427 230 HOH HOH A . 
E 3 HOH 127 428 231 HOH HOH A . 
E 3 HOH 128 429 239 HOH HOH A . 
E 3 HOH 129 430 242 HOH HOH A . 
E 3 HOH 130 431 248 HOH HOH A . 
E 3 HOH 131 432 250 HOH HOH A . 
E 3 HOH 132 433 251 HOH HOH A . 
E 3 HOH 133 434 253 HOH HOH A . 
E 3 HOH 134 435 255 HOH HOH A . 
E 3 HOH 135 436 258 HOH HOH A . 
E 3 HOH 136 437 260 HOH HOH A . 
E 3 HOH 137 438 261 HOH HOH A . 
E 3 HOH 138 439 262 HOH HOH A . 
E 3 HOH 139 440 263 HOH HOH A . 
E 3 HOH 140 441 266 HOH HOH A . 
E 3 HOH 141 442 270 HOH HOH A . 
E 3 HOH 142 443 271 HOH HOH A . 
F 3 HOH 1   303 1   HOH HOH B . 
F 3 HOH 2   304 5   HOH HOH B . 
F 3 HOH 3   305 6   HOH HOH B . 
F 3 HOH 4   306 7   HOH HOH B . 
F 3 HOH 5   307 9   HOH HOH B . 
F 3 HOH 6   308 11  HOH HOH B . 
F 3 HOH 7   309 13  HOH HOH B . 
F 3 HOH 8   310 14  HOH HOH B . 
F 3 HOH 9   311 16  HOH HOH B . 
F 3 HOH 10  312 18  HOH HOH B . 
F 3 HOH 11  313 20  HOH HOH B . 
F 3 HOH 12  314 25  HOH HOH B . 
F 3 HOH 13  315 26  HOH HOH B . 
F 3 HOH 14  316 28  HOH HOH B . 
F 3 HOH 15  317 31  HOH HOH B . 
F 3 HOH 16  318 34  HOH HOH B . 
F 3 HOH 17  319 35  HOH HOH B . 
F 3 HOH 18  320 37  HOH HOH B . 
F 3 HOH 19  321 38  HOH HOH B . 
F 3 HOH 20  322 40  HOH HOH B . 
F 3 HOH 21  323 41  HOH HOH B . 
F 3 HOH 22  324 42  HOH HOH B . 
F 3 HOH 23  325 43  HOH HOH B . 
F 3 HOH 24  326 44  HOH HOH B . 
F 3 HOH 25  327 46  HOH HOH B . 
F 3 HOH 26  328 49  HOH HOH B . 
F 3 HOH 27  329 52  HOH HOH B . 
F 3 HOH 28  330 53  HOH HOH B . 
F 3 HOH 29  331 56  HOH HOH B . 
F 3 HOH 30  332 63  HOH HOH B . 
F 3 HOH 31  333 73  HOH HOH B . 
F 3 HOH 32  334 75  HOH HOH B . 
F 3 HOH 33  335 76  HOH HOH B . 
F 3 HOH 34  336 80  HOH HOH B . 
F 3 HOH 35  337 81  HOH HOH B . 
F 3 HOH 36  338 82  HOH HOH B . 
F 3 HOH 37  339 83  HOH HOH B . 
F 3 HOH 38  340 89  HOH HOH B . 
F 3 HOH 39  341 94  HOH HOH B . 
F 3 HOH 40  342 95  HOH HOH B . 
F 3 HOH 41  343 96  HOH HOH B . 
F 3 HOH 42  344 98  HOH HOH B . 
F 3 HOH 43  345 101 HOH HOH B . 
F 3 HOH 44  346 102 HOH HOH B . 
F 3 HOH 45  347 104 HOH HOH B . 
F 3 HOH 46  348 105 HOH HOH B . 
F 3 HOH 47  349 110 HOH HOH B . 
F 3 HOH 48  350 111 HOH HOH B . 
F 3 HOH 49  351 117 HOH HOH B . 
F 3 HOH 50  352 123 HOH HOH B . 
F 3 HOH 51  353 126 HOH HOH B . 
F 3 HOH 52  354 127 HOH HOH B . 
F 3 HOH 53  355 130 HOH HOH B . 
F 3 HOH 54  356 131 HOH HOH B . 
F 3 HOH 55  357 132 HOH HOH B . 
F 3 HOH 56  358 133 HOH HOH B . 
F 3 HOH 57  359 139 HOH HOH B . 
F 3 HOH 58  360 140 HOH HOH B . 
F 3 HOH 59  361 148 HOH HOH B . 
F 3 HOH 60  362 149 HOH HOH B . 
F 3 HOH 61  363 150 HOH HOH B . 
F 3 HOH 62  364 151 HOH HOH B . 
F 3 HOH 63  365 152 HOH HOH B . 
F 3 HOH 64  366 157 HOH HOH B . 
F 3 HOH 65  367 161 HOH HOH B . 
F 3 HOH 66  368 162 HOH HOH B . 
F 3 HOH 67  369 164 HOH HOH B . 
F 3 HOH 68  370 165 HOH HOH B . 
F 3 HOH 69  371 166 HOH HOH B . 
F 3 HOH 70  372 167 HOH HOH B . 
F 3 HOH 71  373 170 HOH HOH B . 
F 3 HOH 72  374 172 HOH HOH B . 
F 3 HOH 73  375 174 HOH HOH B . 
F 3 HOH 74  376 180 HOH HOH B . 
F 3 HOH 75  377 182 HOH HOH B . 
F 3 HOH 76  378 185 HOH HOH B . 
F 3 HOH 77  379 187 HOH HOH B . 
F 3 HOH 78  380 188 HOH HOH B . 
F 3 HOH 79  381 191 HOH HOH B . 
F 3 HOH 80  382 193 HOH HOH B . 
F 3 HOH 81  383 198 HOH HOH B . 
F 3 HOH 82  384 201 HOH HOH B . 
F 3 HOH 83  385 202 HOH HOH B . 
F 3 HOH 84  386 205 HOH HOH B . 
F 3 HOH 85  387 206 HOH HOH B . 
F 3 HOH 86  388 215 HOH HOH B . 
F 3 HOH 87  389 216 HOH HOH B . 
F 3 HOH 88  390 217 HOH HOH B . 
F 3 HOH 89  391 219 HOH HOH B . 
F 3 HOH 90  392 223 HOH HOH B . 
F 3 HOH 91  393 227 HOH HOH B . 
F 3 HOH 92  394 228 HOH HOH B . 
F 3 HOH 93  395 232 HOH HOH B . 
F 3 HOH 94  396 233 HOH HOH B . 
F 3 HOH 95  397 234 HOH HOH B . 
F 3 HOH 96  398 235 HOH HOH B . 
F 3 HOH 97  399 236 HOH HOH B . 
F 3 HOH 98  400 237 HOH HOH B . 
F 3 HOH 99  401 238 HOH HOH B . 
F 3 HOH 100 402 240 HOH HOH B . 
F 3 HOH 101 403 241 HOH HOH B . 
F 3 HOH 102 404 243 HOH HOH B . 
F 3 HOH 103 405 244 HOH HOH B . 
F 3 HOH 104 406 245 HOH HOH B . 
F 3 HOH 105 407 246 HOH HOH B . 
F 3 HOH 106 408 247 HOH HOH B . 
F 3 HOH 107 409 249 HOH HOH B . 
F 3 HOH 108 410 252 HOH HOH B . 
F 3 HOH 109 411 254 HOH HOH B . 
F 3 HOH 110 412 256 HOH HOH B . 
F 3 HOH 111 413 257 HOH HOH B . 
F 3 HOH 112 414 264 HOH HOH B . 
F 3 HOH 113 415 265 HOH HOH B . 
F 3 HOH 114 416 267 HOH HOH B . 
F 3 HOH 115 417 269 HOH HOH B . 
#