data_2HD1
# 
_entry.id   2HD1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HD1         
RCSB  RCSB038212   
WWPDB D_1000038212 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2006-06-27 
_pdbx_database_PDB_obs_spr.pdb_id           2HD1 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1TBM 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1TBM 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HD1 
_pdbx_database_status.recvd_initial_deposition_date   2006-06-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Huai, Q.'     1 
'Wang, H.'     2 
'Zhang, W.'    3 
'Colman, R.W.' 4 
'Robinson, H.' 5 
'Ke, H.'       6 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of phosphodiesterase 9 shows orientation variation of inhibitor IBMX binding' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            101 
_citation.page_first                9624 
_citation.page_last                 9629 
_citation.year                      2004 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15210993 
_citation.pdbx_database_id_DOI      10.1073/pnas.0401120101 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Huai, Q.'     1 
primary 'Wang, H.'     2 
primary 'Zhang, W.'    3 
primary 'Colman, R.W.' 4 
primary 'Robinson, H.' 5 
primary 'Ke, H.'       6 
# 
_cell.entry_id           2HD1 
_cell.length_a           103.513 
_cell.length_b           103.513 
_cell.length_c           269.727 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HD1 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Phosphodiesterase 9A'      38546.570 2   ? ? 'catalytic domain (residues 181-506)' ? 
2 non-polymer syn 'ZINC ION'                  65.409    2   ? ? ?                                     ? 
3 non-polymer syn 'MAGNESIUM ION'             24.305    2   ? ? ?                                     ? 
4 non-polymer syn 3-ISOBUTYL-1-METHYLXANTHINE 222.244   2   ? ? ?                                     ? 
5 water       nat water                       18.015    195 ? ? ?                                     ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCV
AQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNI
FSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCL
LEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAM
KELQKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCV
AQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNI
FSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCL
LEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAM
KELQKK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   THR n 
1 3   TYR n 
1 4   PRO n 
1 5   LYS n 
1 6   TYR n 
1 7   LEU n 
1 8   LEU n 
1 9   SER n 
1 10  PRO n 
1 11  GLU n 
1 12  THR n 
1 13  ILE n 
1 14  GLU n 
1 15  ALA n 
1 16  LEU n 
1 17  ARG n 
1 18  LYS n 
1 19  PRO n 
1 20  THR n 
1 21  PHE n 
1 22  ASP n 
1 23  VAL n 
1 24  TRP n 
1 25  LEU n 
1 26  TRP n 
1 27  GLU n 
1 28  PRO n 
1 29  ASN n 
1 30  GLU n 
1 31  MET n 
1 32  LEU n 
1 33  SER n 
1 34  CYS n 
1 35  LEU n 
1 36  GLU n 
1 37  HIS n 
1 38  MET n 
1 39  TYR n 
1 40  HIS n 
1 41  ASP n 
1 42  LEU n 
1 43  GLY n 
1 44  LEU n 
1 45  VAL n 
1 46  ARG n 
1 47  ASP n 
1 48  PHE n 
1 49  SER n 
1 50  ILE n 
1 51  ASN n 
1 52  PRO n 
1 53  VAL n 
1 54  THR n 
1 55  LEU n 
1 56  ARG n 
1 57  ARG n 
1 58  TRP n 
1 59  LEU n 
1 60  PHE n 
1 61  CYS n 
1 62  VAL n 
1 63  HIS n 
1 64  ASP n 
1 65  ASN n 
1 66  TYR n 
1 67  ARG n 
1 68  ASN n 
1 69  ASN n 
1 70  PRO n 
1 71  PHE n 
1 72  HIS n 
1 73  ASN n 
1 74  PHE n 
1 75  ARG n 
1 76  HIS n 
1 77  CYS n 
1 78  PHE n 
1 79  CYS n 
1 80  VAL n 
1 81  ALA n 
1 82  GLN n 
1 83  MET n 
1 84  MET n 
1 85  TYR n 
1 86  SER n 
1 87  MET n 
1 88  VAL n 
1 89  TRP n 
1 90  LEU n 
1 91  CYS n 
1 92  SER n 
1 93  LEU n 
1 94  GLN n 
1 95  GLU n 
1 96  LYS n 
1 97  PHE n 
1 98  SER n 
1 99  GLN n 
1 100 THR n 
1 101 ASP n 
1 102 ILE n 
1 103 LEU n 
1 104 ILE n 
1 105 LEU n 
1 106 MET n 
1 107 THR n 
1 108 ALA n 
1 109 ALA n 
1 110 ILE n 
1 111 CYS n 
1 112 HIS n 
1 113 ASP n 
1 114 LEU n 
1 115 ASP n 
1 116 HIS n 
1 117 PRO n 
1 118 GLY n 
1 119 TYR n 
1 120 ASN n 
1 121 ASN n 
1 122 THR n 
1 123 TYR n 
1 124 GLN n 
1 125 ILE n 
1 126 ASN n 
1 127 ALA n 
1 128 ARG n 
1 129 THR n 
1 130 GLU n 
1 131 LEU n 
1 132 ALA n 
1 133 VAL n 
1 134 ARG n 
1 135 TYR n 
1 136 ASN n 
1 137 ASP n 
1 138 ILE n 
1 139 SER n 
1 140 PRO n 
1 141 LEU n 
1 142 GLU n 
1 143 ASN n 
1 144 HIS n 
1 145 HIS n 
1 146 CYS n 
1 147 ALA n 
1 148 VAL n 
1 149 ALA n 
1 150 PHE n 
1 151 GLN n 
1 152 ILE n 
1 153 LEU n 
1 154 ALA n 
1 155 GLU n 
1 156 PRO n 
1 157 GLU n 
1 158 CYS n 
1 159 ASN n 
1 160 ILE n 
1 161 PHE n 
1 162 SER n 
1 163 ASN n 
1 164 ILE n 
1 165 PRO n 
1 166 PRO n 
1 167 ASP n 
1 168 GLY n 
1 169 PHE n 
1 170 LYS n 
1 171 GLN n 
1 172 ILE n 
1 173 ARG n 
1 174 GLN n 
1 175 GLY n 
1 176 MET n 
1 177 ILE n 
1 178 THR n 
1 179 LEU n 
1 180 ILE n 
1 181 LEU n 
1 182 ALA n 
1 183 THR n 
1 184 ASP n 
1 185 MET n 
1 186 ALA n 
1 187 ARG n 
1 188 HIS n 
1 189 ALA n 
1 190 GLU n 
1 191 ILE n 
1 192 MET n 
1 193 ASP n 
1 194 SER n 
1 195 PHE n 
1 196 LYS n 
1 197 GLU n 
1 198 LYS n 
1 199 MET n 
1 200 GLU n 
1 201 ASN n 
1 202 PHE n 
1 203 ASP n 
1 204 TYR n 
1 205 SER n 
1 206 ASN n 
1 207 GLU n 
1 208 GLU n 
1 209 HIS n 
1 210 MET n 
1 211 THR n 
1 212 LEU n 
1 213 LEU n 
1 214 LYS n 
1 215 MET n 
1 216 ILE n 
1 217 LEU n 
1 218 ILE n 
1 219 LYS n 
1 220 CYS n 
1 221 CYS n 
1 222 ASP n 
1 223 ILE n 
1 224 SER n 
1 225 ASN n 
1 226 GLU n 
1 227 VAL n 
1 228 ARG n 
1 229 PRO n 
1 230 MET n 
1 231 GLU n 
1 232 VAL n 
1 233 ALA n 
1 234 GLU n 
1 235 PRO n 
1 236 TRP n 
1 237 VAL n 
1 238 ASP n 
1 239 CYS n 
1 240 LEU n 
1 241 LEU n 
1 242 GLU n 
1 243 GLU n 
1 244 TYR n 
1 245 PHE n 
1 246 MET n 
1 247 GLN n 
1 248 SER n 
1 249 ASP n 
1 250 ARG n 
1 251 GLU n 
1 252 LYS n 
1 253 SER n 
1 254 GLU n 
1 255 GLY n 
1 256 LEU n 
1 257 PRO n 
1 258 VAL n 
1 259 ALA n 
1 260 PRO n 
1 261 PHE n 
1 262 MET n 
1 263 ASP n 
1 264 ARG n 
1 265 ASP n 
1 266 LYS n 
1 267 VAL n 
1 268 THR n 
1 269 LYS n 
1 270 ALA n 
1 271 THR n 
1 272 ALA n 
1 273 GLN n 
1 274 ILE n 
1 275 GLY n 
1 276 PHE n 
1 277 ILE n 
1 278 LYS n 
1 279 PHE n 
1 280 VAL n 
1 281 LEU n 
1 282 ILE n 
1 283 PRO n 
1 284 MET n 
1 285 PHE n 
1 286 GLU n 
1 287 THR n 
1 288 VAL n 
1 289 THR n 
1 290 LYS n 
1 291 LEU n 
1 292 PHE n 
1 293 PRO n 
1 294 MET n 
1 295 VAL n 
1 296 GLU n 
1 297 GLU n 
1 298 ILE n 
1 299 MET n 
1 300 LEU n 
1 301 GLN n 
1 302 PRO n 
1 303 LEU n 
1 304 TRP n 
1 305 GLU n 
1 306 SER n 
1 307 ARG n 
1 308 ASP n 
1 309 ARG n 
1 310 TYR n 
1 311 GLU n 
1 312 GLU n 
1 313 LEU n 
1 314 LYS n 
1 315 ARG n 
1 316 ILE n 
1 317 ASP n 
1 318 ASP n 
1 319 ALA n 
1 320 MET n 
1 321 LYS n 
1 322 GLU n 
1 323 LEU n 
1 324 GLN n 
1 325 LYS n 
1 326 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PDE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q53Y40_HUMAN 
_struct_ref.pdbx_db_accession          Q53Y40 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCV
AQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNI
FSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCL
LEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAM
KELQKK
;
_struct_ref.pdbx_align_begin           181 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2HD1 A 1 ? 326 ? Q53Y40 181 ? 506 ? 181 506 
2 1 2HD1 B 1 ? 326 ? Q53Y40 181 ? 506 ? 181 506 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                       ? 'H2 O'           18.015  
IBM non-polymer         . 3-ISOBUTYL-1-METHYLXANTHINE ? 'C10 H14 N4 O2'  222.244 
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION'             ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'                  ? 'Zn 2'           65.409  
# 
_exptl.entry_id          2HD1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.68 
_exptl_crystal.density_percent_sol   73.74 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
;The protein drops contain 3 microl PDE9A2-IBMX complex and 1 microl well buffer of 0.1 M HEPES, 2.2 M Na formate, and 5% xylitol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     2HD1 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.23 
_reflns.d_resolution_low             30 
_reflns.number_all                   ? 
_reflns.number_obs                   70925 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.072 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        27.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.23 
_reflns_shell.d_res_low              ? 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           0.489 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.0 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2HD1 
_refine.ls_d_res_high                            2.23 
_refine.ls_d_res_low                             30 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     67397 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.215 
_refine.ls_R_factor_R_free                       0.231 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      PDE4 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.B_iso_mean                               35.8 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5390 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         36 
_refine_hist.number_atoms_solvent             195 
_refine_hist.number_atoms_total               5621 
_refine_hist.d_res_high                       2.23 
_refine_hist.d_res_low                        30 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.20  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2HD1 
_struct.title                     'Crystal structure of PDE9 in complex with IBMX' 
_struct.pdbx_descriptor           'Phosphodiesterase 9A' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HD1 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'cGMP, PDE9, IBMX, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 9   ? LEU A 16  ? SER A 189 LEU A 196 1 ? 8  
HELX_P HELX_P2  2  GLU A 27  ? LEU A 42  ? GLU A 207 LEU A 222 1 ? 16 
HELX_P HELX_P3  3  GLY A 43  ? PHE A 48  ? GLY A 223 PHE A 228 1 ? 6  
HELX_P HELX_P4  4  ASN A 51  ? ASN A 65  ? ASN A 231 ASN A 245 1 ? 15 
HELX_P HELX_P5  5  ASN A 73  ? CYS A 91  ? ASN A 253 CYS A 271 1 ? 19 
HELX_P HELX_P6  6  SER A 92  ? PHE A 97  ? SER A 272 PHE A 277 1 ? 6  
HELX_P HELX_P7  7  SER A 98  ? HIS A 112 ? SER A 278 HIS A 292 1 ? 15 
HELX_P HELX_P8  8  ASN A 120 ? ALA A 127 ? ASN A 300 ALA A 307 1 ? 8  
HELX_P HELX_P9  9  THR A 129 ? TYR A 135 ? THR A 309 TYR A 315 1 ? 7  
HELX_P HELX_P10 10 SER A 139 ? ALA A 154 ? SER A 319 ALA A 334 1 ? 16 
HELX_P HELX_P11 11 GLU A 155 ? ASN A 159 ? GLU A 335 ASN A 339 5 ? 5  
HELX_P HELX_P12 12 PRO A 165 ? ALA A 182 ? PRO A 345 ALA A 362 1 ? 18 
HELX_P HELX_P13 13 THR A 183 ? ALA A 186 ? THR A 363 ALA A 366 5 ? 4  
HELX_P HELX_P14 14 ARG A 187 ? MET A 199 ? ARG A 367 MET A 379 1 ? 13 
HELX_P HELX_P15 15 GLU A 200 ? PHE A 202 ? GLU A 380 PHE A 382 5 ? 3  
HELX_P HELX_P16 16 ASN A 206 ? ILE A 223 ? ASN A 386 ILE A 403 1 ? 18 
HELX_P HELX_P17 17 SER A 224 ? ARG A 228 ? SER A 404 ARG A 408 5 ? 5  
HELX_P HELX_P18 18 PRO A 229 ? GLU A 254 ? PRO A 409 GLU A 434 1 ? 26 
HELX_P HELX_P19 19 ALA A 259 ? ASP A 263 ? ALA A 439 ASP A 443 5 ? 5  
HELX_P HELX_P20 20 THR A 268 ? VAL A 280 ? THR A 448 VAL A 460 1 ? 13 
HELX_P HELX_P21 21 VAL A 280 ? PHE A 292 ? VAL A 460 PHE A 472 1 ? 13 
HELX_P HELX_P22 22 MET A 294 ? LYS A 321 ? MET A 474 LYS A 501 1 ? 28 
HELX_P HELX_P23 23 SER B 9   ? LEU B 16  ? SER B 189 LEU B 196 1 ? 8  
HELX_P HELX_P24 24 GLU B 27  ? LEU B 42  ? GLU B 207 LEU B 222 1 ? 16 
HELX_P HELX_P25 25 GLY B 43  ? PHE B 48  ? GLY B 223 PHE B 228 1 ? 6  
HELX_P HELX_P26 26 ASN B 51  ? ASN B 65  ? ASN B 231 ASN B 245 1 ? 15 
HELX_P HELX_P27 27 ASN B 73  ? CYS B 91  ? ASN B 253 CYS B 271 1 ? 19 
HELX_P HELX_P28 28 SER B 92  ? PHE B 97  ? SER B 272 PHE B 277 1 ? 6  
HELX_P HELX_P29 29 SER B 98  ? HIS B 112 ? SER B 278 HIS B 292 1 ? 15 
HELX_P HELX_P30 30 ASN B 120 ? ALA B 127 ? ASN B 300 ALA B 307 1 ? 8  
HELX_P HELX_P31 31 THR B 129 ? TYR B 135 ? THR B 309 TYR B 315 1 ? 7  
HELX_P HELX_P32 32 SER B 139 ? ALA B 154 ? SER B 319 ALA B 334 1 ? 16 
HELX_P HELX_P33 33 GLU B 155 ? ASN B 159 ? GLU B 335 ASN B 339 5 ? 5  
HELX_P HELX_P34 34 PRO B 165 ? ALA B 182 ? PRO B 345 ALA B 362 1 ? 18 
HELX_P HELX_P35 35 THR B 183 ? ALA B 186 ? THR B 363 ALA B 366 5 ? 4  
HELX_P HELX_P36 36 ARG B 187 ? GLU B 200 ? ARG B 367 GLU B 380 1 ? 14 
HELX_P HELX_P37 37 ASN B 206 ? ILE B 223 ? ASN B 386 ILE B 403 1 ? 18 
HELX_P HELX_P38 38 SER B 224 ? ARG B 228 ? SER B 404 ARG B 408 5 ? 5  
HELX_P HELX_P39 39 PRO B 229 ? GLY B 255 ? PRO B 409 GLY B 435 1 ? 27 
HELX_P HELX_P40 40 ALA B 259 ? ASP B 263 ? ALA B 439 ASP B 443 5 ? 5  
HELX_P HELX_P41 41 THR B 268 ? VAL B 280 ? THR B 448 VAL B 460 1 ? 13 
HELX_P HELX_P42 42 VAL B 280 ? PHE B 292 ? VAL B 460 PHE B 472 1 ? 13 
HELX_P HELX_P43 43 MET B 294 ? MET B 299 ? MET B 474 MET B 479 1 ? 6  
HELX_P HELX_P44 44 MET B 299 ? LEU B 323 ? MET B 479 LEU B 503 1 ? 25 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 76  NE2 ? ? A ZN 101 A HIS 256 1_555 ? ? ? ? ? ? ? 2.127 ? 
metalc2  metalc ? ? C ZN . ZN ? ? ? 1_555 A ASP 222 OD1 ? ? A ZN 101 A ASP 402 1_555 ? ? ? ? ? ? ? 2.060 ? 
metalc3  metalc ? ? C ZN . ZN ? ? ? 1_555 I HOH .   O   ? ? A ZN 101 A HOH 507 1_555 ? ? ? ? ? ? ? 2.637 ? 
metalc4  metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 112 NE2 ? ? A ZN 101 A HIS 292 1_555 ? ? ? ? ? ? ? 2.107 ? 
metalc5  metalc ? ? C ZN . ZN ? ? ? 1_555 A ASP 113 OD2 ? ? A ZN 101 A ASP 293 1_555 ? ? ? ? ? ? ? 2.063 ? 
metalc6  metalc ? ? D MG . MG ? ? ? 1_555 I HOH .   O   ? ? A MG 102 A HOH 509 1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc7  metalc ? ? D MG . MG ? ? ? 1_555 A ASP 113 OD1 ? ? A MG 102 A ASP 293 1_555 ? ? ? ? ? ? ? 2.126 ? 
metalc8  metalc ? ? D MG . MG ? ? ? 1_555 I HOH .   O   ? ? A MG 102 A HOH 510 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc9  metalc ? ? D MG . MG ? ? ? 1_555 I HOH .   O   ? ? A MG 102 A HOH 511 1_555 ? ? ? ? ? ? ? 2.204 ? 
metalc10 metalc ? ? D MG . MG ? ? ? 1_555 I HOH .   O   ? ? A MG 102 A HOH 508 1_555 ? ? ? ? ? ? ? 2.280 ? 
metalc11 metalc ? ? F ZN . ZN ? ? ? 1_555 B ASP 222 OD1 ? ? B ZN 101 B ASP 402 1_555 ? ? ? ? ? ? ? 2.055 ? 
metalc12 metalc ? ? F ZN . ZN ? ? ? 1_555 B ASP 113 OD2 ? ? B ZN 101 B ASP 293 1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc13 metalc ? ? F ZN . ZN ? ? ? 1_555 B HIS 112 NE2 ? ? B ZN 101 B HIS 292 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc14 metalc ? ? F ZN . ZN ? ? ? 1_555 B HIS 76  NE2 ? ? B ZN 101 B HIS 256 1_555 ? ? ? ? ? ? ? 2.123 ? 
metalc15 metalc ? ? G MG . MG ? ? ? 1_555 J HOH .   O   ? ? B MG 102 B HOH 508 1_555 ? ? ? ? ? ? ? 2.199 ? 
metalc16 metalc ? ? G MG . MG ? ? ? 1_555 J HOH .   O   ? ? B MG 102 B HOH 511 1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc17 metalc ? ? G MG . MG ? ? ? 1_555 J HOH .   O   ? ? B MG 102 B HOH 509 1_555 ? ? ? ? ? ? ? 2.284 ? 
metalc18 metalc ? ? G MG . MG ? ? ? 1_555 J HOH .   O   ? ? B MG 102 B HOH 510 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc19 metalc ? ? G MG . MG ? ? ? 1_555 B ASP 113 OD1 ? ? B MG 102 B ASP 293 1_555 ? ? ? ? ? ? ? 2.097 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE ZN A 101' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 102' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN B 101' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG B 102' 
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE IBM A 1'  
AC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE IBM B 1'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 MG  D .   ? MG  A 102 . ? 1_555 ? 
2  AC1 6 HIS A 76  ? HIS A 256 . ? 1_555 ? 
3  AC1 6 HIS A 112 ? HIS A 292 . ? 1_555 ? 
4  AC1 6 ASP A 113 ? ASP A 293 . ? 1_555 ? 
5  AC1 6 ASP A 222 ? ASP A 402 . ? 1_555 ? 
6  AC1 6 HOH I .   ? HOH A 507 . ? 1_555 ? 
7  AC2 6 ZN  C .   ? ZN  A 101 . ? 1_555 ? 
8  AC2 6 ASP A 113 ? ASP A 293 . ? 1_555 ? 
9  AC2 6 HOH I .   ? HOH A 508 . ? 1_555 ? 
10 AC2 6 HOH I .   ? HOH A 509 . ? 1_555 ? 
11 AC2 6 HOH I .   ? HOH A 510 . ? 1_555 ? 
12 AC2 6 HOH I .   ? HOH A 511 . ? 1_555 ? 
13 AC3 5 MG  G .   ? MG  B 102 . ? 1_555 ? 
14 AC3 5 HIS B 76  ? HIS B 256 . ? 1_555 ? 
15 AC3 5 HIS B 112 ? HIS B 292 . ? 1_555 ? 
16 AC3 5 ASP B 113 ? ASP B 293 . ? 1_555 ? 
17 AC3 5 ASP B 222 ? ASP B 402 . ? 1_555 ? 
18 AC4 6 ZN  F .   ? ZN  B 101 . ? 1_555 ? 
19 AC4 6 ASP B 113 ? ASP B 293 . ? 1_555 ? 
20 AC4 6 HOH J .   ? HOH B 508 . ? 1_555 ? 
21 AC4 6 HOH J .   ? HOH B 509 . ? 1_555 ? 
22 AC4 6 HOH J .   ? HOH B 510 . ? 1_555 ? 
23 AC4 6 HOH J .   ? HOH B 511 . ? 1_555 ? 
24 AC5 5 ILE A 223 ? ILE A 403 . ? 1_555 ? 
25 AC5 5 LEU A 240 ? LEU A 420 . ? 1_555 ? 
26 AC5 5 TYR A 244 ? TYR A 424 . ? 1_555 ? 
27 AC5 5 GLN A 273 ? GLN A 453 . ? 1_555 ? 
28 AC5 5 PHE A 276 ? PHE A 456 . ? 1_555 ? 
29 AC6 7 ALA A 319 ? ALA A 499 . ? 5_645 ? 
30 AC6 7 LEU B 240 ? LEU B 420 . ? 1_555 ? 
31 AC6 7 TYR B 244 ? TYR B 424 . ? 1_555 ? 
32 AC6 7 PHE B 261 ? PHE B 441 . ? 1_555 ? 
33 AC6 7 ALA B 272 ? ALA B 452 . ? 1_555 ? 
34 AC6 7 GLN B 273 ? GLN B 453 . ? 1_555 ? 
35 AC6 7 PHE B 276 ? PHE B 456 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2HD1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HD1 
_atom_sites.fract_transf_matrix[1][1]   0.009661 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009661 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003707 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 1   ? 102.469 51.032  75.851  1.00 78.52  ? 181 PRO A N   1 
ATOM   2    C  CA  . PRO A 1 1   ? 102.165 52.474  76.061  1.00 78.54  ? 181 PRO A CA  1 
ATOM   3    C  C   . PRO A 1 1   ? 101.058 52.980  75.122  1.00 78.55  ? 181 PRO A C   1 
ATOM   4    O  O   . PRO A 1 1   ? 99.931  52.479  75.145  1.00 78.46  ? 181 PRO A O   1 
ATOM   5    C  CB  . PRO A 1 1   ? 103.470 53.228  75.829  1.00 78.62  ? 181 PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 1   ? 104.224 52.259  74.896  1.00 77.84  ? 181 PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 1   ? 103.874 50.867  75.428  1.00 77.82  ? 181 PRO A CD  1 
ATOM   8    N  N   . THR A 1 2   ? 101.388 53.991  74.319  1.00 78.06  ? 182 THR A N   1 
ATOM   9    C  CA  . THR A 1 2   ? 100.466 54.566  73.339  1.00 76.94  ? 182 THR A CA  1 
ATOM   10   C  C   . THR A 1 2   ? 101.105 54.285  71.982  1.00 75.89  ? 182 THR A C   1 
ATOM   11   O  O   . THR A 1 2   ? 101.966 55.035  71.515  1.00 75.85  ? 182 THR A O   1 
ATOM   12   C  CB  . THR A 1 2   ? 100.309 56.092  73.524  1.00 77.48  ? 182 THR A CB  1 
ATOM   13   O  OG1 . THR A 1 2   ? 99.728  56.365  74.807  1.00 77.85  ? 182 THR A OG1 1 
ATOM   14   C  CG2 . THR A 1 2   ? 99.415  56.670  72.436  1.00 77.43  ? 182 THR A CG2 1 
ATOM   15   N  N   . TYR A 1 3   ? 100.675 53.192  71.361  1.00 74.17  ? 183 TYR A N   1 
ATOM   16   C  CA  . TYR A 1 3   ? 101.219 52.748  70.083  1.00 72.78  ? 183 TYR A CA  1 
ATOM   17   C  C   . TYR A 1 3   ? 100.870 53.610  68.869  1.00 72.10  ? 183 TYR A C   1 
ATOM   18   O  O   . TYR A 1 3   ? 99.957  54.436  68.922  1.00 72.52  ? 183 TYR A O   1 
ATOM   19   C  CB  . TYR A 1 3   ? 100.780 51.302  69.826  1.00 71.69  ? 183 TYR A CB  1 
ATOM   20   C  CG  . TYR A 1 3   ? 100.945 50.397  71.029  1.00 70.36  ? 183 TYR A CG  1 
ATOM   21   C  CD1 . TYR A 1 3   ? 99.978  50.356  72.032  1.00 69.50  ? 183 TYR A CD1 1 
ATOM   22   C  CD2 . TYR A 1 3   ? 102.086 49.614  71.184  1.00 69.69  ? 183 TYR A CD2 1 
ATOM   23   C  CE1 . TYR A 1 3   ? 100.145 49.561  73.157  1.00 69.24  ? 183 TYR A CE1 1 
ATOM   24   C  CE2 . TYR A 1 3   ? 102.264 48.817  72.305  1.00 68.85  ? 183 TYR A CE2 1 
ATOM   25   C  CZ  . TYR A 1 3   ? 101.291 48.797  73.288  1.00 68.68  ? 183 TYR A CZ  1 
ATOM   26   O  OH  . TYR A 1 3   ? 101.472 48.021  74.406  1.00 68.70  ? 183 TYR A OH  1 
ATOM   27   N  N   . PRO A 1 4   ? 101.615 53.434  67.760  1.00 71.05  ? 184 PRO A N   1 
ATOM   28   C  CA  . PRO A 1 4   ? 101.411 54.171  66.508  1.00 70.22  ? 184 PRO A CA  1 
ATOM   29   C  C   . PRO A 1 4   ? 100.276 53.588  65.658  1.00 69.26  ? 184 PRO A C   1 
ATOM   30   O  O   . PRO A 1 4   ? 99.977  52.392  65.731  1.00 69.13  ? 184 PRO A O   1 
ATOM   31   C  CB  . PRO A 1 4   ? 102.770 54.061  65.823  1.00 70.67  ? 184 PRO A CB  1 
ATOM   32   C  CG  . PRO A 1 4   ? 103.233 52.710  66.241  1.00 70.71  ? 184 PRO A CG  1 
ATOM   33   C  CD  . PRO A 1 4   ? 102.890 52.692  67.716  1.00 70.94  ? 184 PRO A CD  1 
ATOM   34   N  N   . LYS A 1 5   ? 99.663  54.446  64.846  1.00 67.87  ? 185 LYS A N   1 
ATOM   35   C  CA  . LYS A 1 5   ? 98.542  54.075  63.984  1.00 65.92  ? 185 LYS A CA  1 
ATOM   36   C  C   . LYS A 1 5   ? 98.632  52.730  63.255  1.00 64.09  ? 185 LYS A C   1 
ATOM   37   O  O   . LYS A 1 5   ? 97.697  51.927  63.321  1.00 63.07  ? 185 LYS A O   1 
ATOM   38   C  CB  . LYS A 1 5   ? 98.300  55.177  62.950  1.00 67.10  ? 185 LYS A CB  1 
ATOM   39   C  CG  . LYS A 1 5   ? 97.928  56.528  63.538  1.00 68.05  ? 185 LYS A CG  1 
ATOM   40   C  CD  . LYS A 1 5   ? 97.791  57.564  62.430  1.00 69.63  ? 185 LYS A CD  1 
ATOM   41   C  CE  . LYS A 1 5   ? 97.497  58.948  62.985  1.00 70.41  ? 185 LYS A CE  1 
ATOM   42   N  NZ  . LYS A 1 5   ? 97.486  59.976  61.905  1.00 71.20  ? 185 LYS A NZ  1 
ATOM   43   N  N   . TYR A 1 6   ? 99.741  52.488  62.558  1.00 61.83  ? 186 TYR A N   1 
ATOM   44   C  CA  . TYR A 1 6   ? 99.900  51.247  61.799  1.00 59.58  ? 186 TYR A CA  1 
ATOM   45   C  C   . TYR A 1 6   ? 99.865  49.979  62.641  1.00 56.54  ? 186 TYR A C   1 
ATOM   46   O  O   . TYR A 1 6   ? 99.816  48.871  62.107  1.00 56.02  ? 186 TYR A O   1 
ATOM   47   C  CB  . TYR A 1 6   ? 101.174 51.297  60.945  1.00 62.21  ? 186 TYR A CB  1 
ATOM   48   C  CG  . TYR A 1 6   ? 102.438 51.634  61.696  1.00 64.91  ? 186 TYR A CG  1 
ATOM   49   C  CD1 . TYR A 1 6   ? 103.262 50.629  62.202  1.00 65.78  ? 186 TYR A CD1 1 
ATOM   50   C  CD2 . TYR A 1 6   ? 102.818 52.964  61.895  1.00 65.71  ? 186 TYR A CD2 1 
ATOM   51   C  CE1 . TYR A 1 6   ? 104.436 50.939  62.890  1.00 67.33  ? 186 TYR A CE1 1 
ATOM   52   C  CE2 . TYR A 1 6   ? 103.987 53.285  62.582  1.00 67.34  ? 186 TYR A CE2 1 
ATOM   53   C  CZ  . TYR A 1 6   ? 104.792 52.270  63.076  1.00 67.78  ? 186 TYR A CZ  1 
ATOM   54   O  OH  . TYR A 1 6   ? 105.947 52.581  63.759  1.00 68.88  ? 186 TYR A OH  1 
ATOM   55   N  N   . LEU A 1 7   ? 99.899  50.137  63.957  1.00 52.60  ? 187 LEU A N   1 
ATOM   56   C  CA  . LEU A 1 7   ? 99.806  48.985  64.839  1.00 49.24  ? 187 LEU A CA  1 
ATOM   57   C  C   . LEU A 1 7   ? 98.347  48.953  65.266  1.00 46.91  ? 187 LEU A C   1 
ATOM   58   O  O   . LEU A 1 7   ? 97.921  49.703  66.140  1.00 47.03  ? 187 LEU A O   1 
ATOM   59   C  CB  . LEU A 1 7   ? 100.726 49.137  66.055  1.00 48.28  ? 187 LEU A CB  1 
ATOM   60   C  CG  . LEU A 1 7   ? 102.229 49.128  65.756  1.00 47.49  ? 187 LEU A CG  1 
ATOM   61   C  CD1 . LEU A 1 7   ? 103.007 49.088  67.055  1.00 46.58  ? 187 LEU A CD1 1 
ATOM   62   C  CD2 . LEU A 1 7   ? 102.580 47.922  64.898  1.00 47.27  ? 187 LEU A CD2 1 
ATOM   63   N  N   . LEU A 1 8   ? 97.577  48.097  64.615  1.00 44.98  ? 188 LEU A N   1 
ATOM   64   C  CA  . LEU A 1 8   ? 96.161  47.981  64.905  1.00 42.66  ? 188 LEU A CA  1 
ATOM   65   C  C   . LEU A 1 8   ? 95.945  47.578  66.354  1.00 41.86  ? 188 LEU A C   1 
ATOM   66   O  O   . LEU A 1 8   ? 96.678  46.749  66.887  1.00 41.72  ? 188 LEU A O   1 
ATOM   67   C  CB  . LEU A 1 8   ? 95.528  46.947  63.975  1.00 41.74  ? 188 LEU A CB  1 
ATOM   68   C  CG  . LEU A 1 8   ? 95.847  47.121  62.486  1.00 41.16  ? 188 LEU A CG  1 
ATOM   69   C  CD1 . LEU A 1 8   ? 95.169  46.015  61.700  1.00 40.28  ? 188 LEU A CD1 1 
ATOM   70   C  CD2 . LEU A 1 8   ? 95.385  48.491  62.000  1.00 40.56  ? 188 LEU A CD2 1 
ATOM   71   N  N   . SER A 1 9   ? 94.945  48.178  66.990  1.00 40.34  ? 189 SER A N   1 
ATOM   72   C  CA  . SER A 1 9   ? 94.623  47.868  68.375  1.00 39.38  ? 189 SER A CA  1 
ATOM   73   C  C   . SER A 1 9   ? 93.718  46.645  68.383  1.00 38.78  ? 189 SER A C   1 
ATOM   74   O  O   . SER A 1 9   ? 93.105  46.313  67.370  1.00 39.00  ? 189 SER A O   1 
ATOM   75   C  CB  . SER A 1 9   ? 93.881  49.040  69.015  1.00 38.74  ? 189 SER A CB  1 
ATOM   76   O  OG  . SER A 1 9   ? 92.596  49.191  68.432  1.00 38.09  ? 189 SER A OG  1 
ATOM   77   N  N   . PRO A 1 10  ? 93.629  45.947  69.522  1.00 38.36  ? 190 PRO A N   1 
ATOM   78   C  CA  . PRO A 1 10  ? 92.760  44.766  69.563  1.00 37.74  ? 190 PRO A CA  1 
ATOM   79   C  C   . PRO A 1 10  ? 91.285  45.075  69.276  1.00 37.92  ? 190 PRO A C   1 
ATOM   80   O  O   . PRO A 1 10  ? 90.534  44.196  68.843  1.00 37.61  ? 190 PRO A O   1 
ATOM   81   C  CB  . PRO A 1 10  ? 92.998  44.194  70.967  1.00 37.29  ? 190 PRO A CB  1 
ATOM   82   C  CG  . PRO A 1 10  ? 93.630  45.338  71.735  1.00 38.93  ? 190 PRO A CG  1 
ATOM   83   C  CD  . PRO A 1 10  ? 94.479  46.028  70.721  1.00 38.06  ? 190 PRO A CD  1 
ATOM   84   N  N   . GLU A 1 11  ? 90.873  46.319  69.513  1.00 38.46  ? 191 GLU A N   1 
ATOM   85   C  CA  . GLU A 1 11  ? 89.490  46.739  69.251  1.00 39.03  ? 191 GLU A CA  1 
ATOM   86   C  C   . GLU A 1 11  ? 89.250  46.796  67.736  1.00 37.49  ? 191 GLU A C   1 
ATOM   87   O  O   . GLU A 1 11  ? 88.210  46.359  67.240  1.00 36.00  ? 191 GLU A O   1 
ATOM   88   C  CB  . GLU A 1 11  ? 89.208  48.128  69.847  1.00 41.41  ? 191 GLU A CB  1 
ATOM   89   C  CG  . GLU A 1 11  ? 89.100  48.192  71.371  1.00 45.49  ? 191 GLU A CG  1 
ATOM   90   C  CD  . GLU A 1 11  ? 90.406  47.867  72.081  1.00 47.47  ? 191 GLU A CD  1 
ATOM   91   O  OE1 . GLU A 1 11  ? 91.438  48.499  71.761  1.00 47.50  ? 191 GLU A OE1 1 
ATOM   92   O  OE2 . GLU A 1 11  ? 90.394  46.982  72.967  1.00 49.30  ? 191 GLU A OE2 1 
ATOM   93   N  N   . THR A 1 12  ? 90.222  47.346  67.014  1.00 36.66  ? 192 THR A N   1 
ATOM   94   C  CA  . THR A 1 12  ? 90.143  47.464  65.563  1.00 36.15  ? 192 THR A CA  1 
ATOM   95   C  C   . THR A 1 12  ? 90.130  46.081  64.905  1.00 36.13  ? 192 THR A C   1 
ATOM   96   O  O   . THR A 1 12  ? 89.304  45.803  64.037  1.00 34.94  ? 192 THR A O   1 
ATOM   97   C  CB  . THR A 1 12  ? 91.336  48.272  65.020  1.00 35.96  ? 192 THR A CB  1 
ATOM   98   O  OG1 . THR A 1 12  ? 91.320  49.589  65.591  1.00 34.81  ? 192 THR A OG1 1 
ATOM   99   C  CG2 . THR A 1 12  ? 91.266  48.370  63.501  1.00 35.71  ? 192 THR A CG2 1 
ATOM   100  N  N   . ILE A 1 13  ? 91.051  45.223  65.333  1.00 36.32  ? 193 ILE A N   1 
ATOM   101  C  CA  . ILE A 1 13  ? 91.158  43.868  64.804  1.00 37.39  ? 193 ILE A CA  1 
ATOM   102  C  C   . ILE A 1 13  ? 89.835  43.134  64.993  1.00 37.78  ? 193 ILE A C   1 
ATOM   103  O  O   . ILE A 1 13  ? 89.390  42.381  64.127  1.00 37.47  ? 193 ILE A O   1 
ATOM   104  C  CB  . ILE A 1 13  ? 92.289  43.105  65.522  1.00 38.17  ? 193 ILE A CB  1 
ATOM   105  C  CG1 . ILE A 1 13  ? 93.640  43.678  65.091  1.00 38.34  ? 193 ILE A CG1 1 
ATOM   106  C  CG2 . ILE A 1 13  ? 92.197  41.622  65.235  1.00 38.78  ? 193 ILE A CG2 1 
ATOM   107  C  CD1 . ILE A 1 13  ? 94.821  43.024  65.771  1.00 40.16  ? 193 ILE A CD1 1 
ATOM   108  N  N   . GLU A 1 14  ? 89.204  43.375  66.133  1.00 37.80  ? 194 GLU A N   1 
ATOM   109  C  CA  . GLU A 1 14  ? 87.924  42.763  66.453  1.00 37.89  ? 194 GLU A CA  1 
ATOM   110  C  C   . GLU A 1 14  ? 86.825  43.331  65.543  1.00 36.38  ? 194 GLU A C   1 
ATOM   111  O  O   . GLU A 1 14  ? 86.027  42.592  64.965  1.00 35.54  ? 194 GLU A O   1 
ATOM   112  C  CB  . GLU A 1 14  ? 87.591  43.050  67.921  1.00 40.64  ? 194 GLU A CB  1 
ATOM   113  C  CG  . GLU A 1 14  ? 86.377  42.329  68.468  1.00 45.97  ? 194 GLU A CG  1 
ATOM   114  C  CD  . GLU A 1 14  ? 86.491  40.823  68.331  1.00 49.30  ? 194 GLU A CD  1 
ATOM   115  O  OE1 . GLU A 1 14  ? 87.621  40.295  68.475  1.00 50.34  ? 194 GLU A OE1 1 
ATOM   116  O  OE2 . GLU A 1 14  ? 85.450  40.169  68.088  1.00 50.58  ? 194 GLU A OE2 1 
ATOM   117  N  N   . ALA A 1 15  ? 86.802  44.653  65.413  1.00 34.52  ? 195 ALA A N   1 
ATOM   118  C  CA  . ALA A 1 15  ? 85.800  45.330  64.601  1.00 33.42  ? 195 ALA A CA  1 
ATOM   119  C  C   . ALA A 1 15  ? 85.925  45.010  63.116  1.00 32.36  ? 195 ALA A C   1 
ATOM   120  O  O   . ALA A 1 15  ? 84.932  44.978  62.389  1.00 32.80  ? 195 ALA A O   1 
ATOM   121  C  CB  . ALA A 1 15  ? 85.899  46.833  64.818  1.00 33.85  ? 195 ALA A CB  1 
ATOM   122  N  N   . LEU A 1 16  ? 87.153  44.769  62.676  1.00 31.18  ? 196 LEU A N   1 
ATOM   123  C  CA  . LEU A 1 16  ? 87.440  44.469  61.283  1.00 31.40  ? 196 LEU A CA  1 
ATOM   124  C  C   . LEU A 1 16  ? 86.656  43.273  60.729  1.00 32.37  ? 196 LEU A C   1 
ATOM   125  O  O   . LEU A 1 16  ? 86.525  43.115  59.512  1.00 32.18  ? 196 LEU A O   1 
ATOM   126  C  CB  . LEU A 1 16  ? 88.943  44.227  61.134  1.00 31.02  ? 196 LEU A CB  1 
ATOM   127  C  CG  . LEU A 1 16  ? 89.558  44.222  59.733  1.00 31.09  ? 196 LEU A CG  1 
ATOM   128  C  CD1 . LEU A 1 16  ? 89.283  45.549  59.034  1.00 29.67  ? 196 LEU A CD1 1 
ATOM   129  C  CD2 . LEU A 1 16  ? 91.057  43.979  59.855  1.00 30.21  ? 196 LEU A CD2 1 
ATOM   130  N  N   . ARG A 1 17  ? 86.122  42.446  61.624  1.00 32.48  ? 197 ARG A N   1 
ATOM   131  C  CA  . ARG A 1 17  ? 85.373  41.255  61.234  1.00 33.40  ? 197 ARG A CA  1 
ATOM   132  C  C   . ARG A 1 17  ? 83.900  41.469  60.932  1.00 33.16  ? 197 ARG A C   1 
ATOM   133  O  O   . ARG A 1 17  ? 83.226  40.561  60.447  1.00 31.92  ? 197 ARG A O   1 
ATOM   134  C  CB  . ARG A 1 17  ? 85.462  40.204  62.331  1.00 35.38  ? 197 ARG A CB  1 
ATOM   135  C  CG  . ARG A 1 17  ? 86.844  39.710  62.598  1.00 39.30  ? 197 ARG A CG  1 
ATOM   136  C  CD  . ARG A 1 17  ? 86.791  38.466  63.448  1.00 43.22  ? 197 ARG A CD  1 
ATOM   137  N  NE  . ARG A 1 17  ? 88.119  37.894  63.587  1.00 47.17  ? 197 ARG A NE  1 
ATOM   138  C  CZ  . ARG A 1 17  ? 88.355  36.595  63.687  1.00 49.70  ? 197 ARG A CZ  1 
ATOM   139  N  NH1 . ARG A 1 17  ? 87.342  35.735  63.662  1.00 50.13  ? 197 ARG A NH1 1 
ATOM   140  N  NH2 . ARG A 1 17  ? 89.603  36.157  63.807  1.00 51.81  ? 197 ARG A NH2 1 
ATOM   141  N  N   . LYS A 1 18  ? 83.394  42.657  61.232  1.00 32.71  ? 198 LYS A N   1 
ATOM   142  C  CA  . LYS A 1 18  ? 81.986  42.935  61.016  1.00 33.39  ? 198 LYS A CA  1 
ATOM   143  C  C   . LYS A 1 18  ? 81.763  43.952  59.909  1.00 31.79  ? 198 LYS A C   1 
ATOM   144  O  O   . LYS A 1 18  ? 82.583  44.839  59.692  1.00 30.47  ? 198 LYS A O   1 
ATOM   145  C  CB  . LYS A 1 18  ? 81.355  43.426  62.325  1.00 35.32  ? 198 LYS A CB  1 
ATOM   146  C  CG  . LYS A 1 18  ? 81.548  42.457  63.479  1.00 39.29  ? 198 LYS A CG  1 
ATOM   147  C  CD  . LYS A 1 18  ? 81.023  43.011  64.798  1.00 42.63  ? 198 LYS A CD  1 
ATOM   148  C  CE  . LYS A 1 18  ? 81.345  42.054  65.948  1.00 45.54  ? 198 LYS A CE  1 
ATOM   149  N  NZ  . LYS A 1 18  ? 80.752  42.480  67.255  1.00 47.70  ? 198 LYS A NZ  1 
ATOM   150  N  N   . PRO A 1 19  ? 80.640  43.825  59.190  1.00 30.83  ? 199 PRO A N   1 
ATOM   151  C  CA  . PRO A 1 19  ? 80.293  44.731  58.096  1.00 30.66  ? 199 PRO A CA  1 
ATOM   152  C  C   . PRO A 1 19  ? 80.039  46.164  58.566  1.00 30.16  ? 199 PRO A C   1 
ATOM   153  O  O   . PRO A 1 19  ? 79.857  47.066  57.750  1.00 30.28  ? 199 PRO A O   1 
ATOM   154  C  CB  . PRO A 1 19  ? 79.058  44.069  57.486  1.00 31.05  ? 199 PRO A CB  1 
ATOM   155  C  CG  . PRO A 1 19  ? 78.430  43.384  58.667  1.00 31.52  ? 199 PRO A CG  1 
ATOM   156  C  CD  . PRO A 1 19  ? 79.622  42.773  59.344  1.00 31.01  ? 199 PRO A CD  1 
ATOM   157  N  N   . THR A 1 20  ? 80.042  46.370  59.882  1.00 29.67  ? 200 THR A N   1 
ATOM   158  C  CA  . THR A 1 20  ? 79.823  47.695  60.462  1.00 29.11  ? 200 THR A CA  1 
ATOM   159  C  C   . THR A 1 20  ? 81.122  48.505  60.567  1.00 28.81  ? 200 THR A C   1 
ATOM   160  O  O   . THR A 1 20  ? 81.108  49.666  60.979  1.00 28.05  ? 200 THR A O   1 
ATOM   161  C  CB  . THR A 1 20  ? 79.208  47.595  61.884  1.00 29.74  ? 200 THR A CB  1 
ATOM   162  O  OG1 . THR A 1 20  ? 80.047  46.779  62.713  1.00 30.63  ? 200 THR A OG1 1 
ATOM   163  C  CG2 . THR A 1 20  ? 77.811  46.985  61.834  1.00 29.70  ? 200 THR A CG2 1 
ATOM   164  N  N   . PHE A 1 21  ? 82.243  47.890  60.203  1.00 28.07  ? 201 PHE A N   1 
ATOM   165  C  CA  . PHE A 1 21  ? 83.541  48.556  60.278  1.00 28.15  ? 201 PHE A CA  1 
ATOM   166  C  C   . PHE A 1 21  ? 83.536  49.896  59.544  1.00 28.60  ? 201 PHE A C   1 
ATOM   167  O  O   . PHE A 1 21  ? 83.161  49.982  58.371  1.00 28.35  ? 201 PHE A O   1 
ATOM   168  C  CB  . PHE A 1 21  ? 84.621  47.648  59.688  1.00 27.52  ? 201 PHE A CB  1 
ATOM   169  C  CG  . PHE A 1 21  ? 86.032  48.094  59.983  1.00 26.82  ? 201 PHE A CG  1 
ATOM   170  C  CD1 . PHE A 1 21  ? 86.590  47.898  61.243  1.00 26.50  ? 201 PHE A CD1 1 
ATOM   171  C  CD2 . PHE A 1 21  ? 86.812  48.677  58.988  1.00 25.91  ? 201 PHE A CD2 1 
ATOM   172  C  CE1 . PHE A 1 21  ? 87.910  48.274  61.508  1.00 26.20  ? 201 PHE A CE1 1 
ATOM   173  C  CE2 . PHE A 1 21  ? 88.131  49.056  59.239  1.00 26.30  ? 201 PHE A CE2 1 
ATOM   174  C  CZ  . PHE A 1 21  ? 88.681  48.852  60.504  1.00 26.13  ? 201 PHE A CZ  1 
ATOM   175  N  N   . ASP A 1 22  ? 83.949  50.944  60.242  1.00 30.02  ? 202 ASP A N   1 
ATOM   176  C  CA  . ASP A 1 22  ? 83.997  52.277  59.654  1.00 30.43  ? 202 ASP A CA  1 
ATOM   177  C  C   . ASP A 1 22  ? 85.220  52.355  58.750  1.00 30.53  ? 202 ASP A C   1 
ATOM   178  O  O   . ASP A 1 22  ? 86.347  52.551  59.219  1.00 30.36  ? 202 ASP A O   1 
ATOM   179  C  CB  . ASP A 1 22  ? 84.086  53.329  60.757  1.00 31.54  ? 202 ASP A CB  1 
ATOM   180  C  CG  . ASP A 1 22  ? 83.954  54.749  60.225  1.00 33.56  ? 202 ASP A CG  1 
ATOM   181  O  OD1 . ASP A 1 22  ? 83.916  55.680  61.057  1.00 34.76  ? 202 ASP A OD1 1 
ATOM   182  O  OD2 . ASP A 1 22  ? 83.888  54.935  58.987  1.00 32.42  ? 202 ASP A OD2 1 
ATOM   183  N  N   . VAL A 1 23  ? 84.989  52.201  57.452  1.00 29.58  ? 203 VAL A N   1 
ATOM   184  C  CA  . VAL A 1 23  ? 86.072  52.217  56.478  1.00 30.22  ? 203 VAL A CA  1 
ATOM   185  C  C   . VAL A 1 23  ? 86.687  53.592  56.250  1.00 31.27  ? 203 VAL A C   1 
ATOM   186  O  O   . VAL A 1 23  ? 87.766  53.703  55.662  1.00 30.88  ? 203 VAL A O   1 
ATOM   187  C  CB  . VAL A 1 23  ? 85.591  51.661  55.119  1.00 29.26  ? 203 VAL A CB  1 
ATOM   188  C  CG1 . VAL A 1 23  ? 85.108  50.227  55.292  1.00 28.05  ? 203 VAL A CG1 1 
ATOM   189  C  CG2 . VAL A 1 23  ? 84.474  52.534  54.562  1.00 28.87  ? 203 VAL A CG2 1 
ATOM   190  N  N   . TRP A 1 24  ? 86.011  54.634  56.724  1.00 32.21  ? 204 TRP A N   1 
ATOM   191  C  CA  . TRP A 1 24  ? 86.487  56.002  56.538  1.00 33.09  ? 204 TRP A CA  1 
ATOM   192  C  C   . TRP A 1 24  ? 87.486  56.486  57.576  1.00 34.60  ? 204 TRP A C   1 
ATOM   193  O  O   . TRP A 1 24  ? 88.157  57.494  57.360  1.00 34.87  ? 204 TRP A O   1 
ATOM   194  C  CB  . TRP A 1 24  ? 85.307  56.976  56.522  1.00 31.80  ? 204 TRP A CB  1 
ATOM   195  C  CG  . TRP A 1 24  ? 84.396  56.801  55.351  1.00 31.47  ? 204 TRP A CG  1 
ATOM   196  C  CD1 . TRP A 1 24  ? 83.147  56.247  55.355  1.00 30.47  ? 204 TRP A CD1 1 
ATOM   197  C  CD2 . TRP A 1 24  ? 84.661  57.189  53.997  1.00 30.26  ? 204 TRP A CD2 1 
ATOM   198  N  NE1 . TRP A 1 24  ? 82.616  56.269  54.088  1.00 30.79  ? 204 TRP A NE1 1 
ATOM   199  C  CE2 . TRP A 1 24  ? 83.525  56.841  53.235  1.00 30.40  ? 204 TRP A CE2 1 
ATOM   200  C  CE3 . TRP A 1 24  ? 85.750  57.797  53.355  1.00 29.90  ? 204 TRP A CE3 1 
ATOM   201  C  CZ2 . TRP A 1 24  ? 83.442  57.087  51.856  1.00 30.60  ? 204 TRP A CZ2 1 
ATOM   202  C  CZ3 . TRP A 1 24  ? 85.670  58.042  51.984  1.00 29.19  ? 204 TRP A CZ3 1 
ATOM   203  C  CH2 . TRP A 1 24  ? 84.521  57.685  51.251  1.00 29.91  ? 204 TRP A CH2 1 
ATOM   204  N  N   . LEU A 1 25  ? 87.594  55.776  58.692  1.00 36.09  ? 205 LEU A N   1 
ATOM   205  C  CA  . LEU A 1 25  ? 88.491  56.197  59.763  1.00 37.90  ? 205 LEU A CA  1 
ATOM   206  C  C   . LEU A 1 25  ? 89.970  56.051  59.503  1.00 38.56  ? 205 LEU A C   1 
ATOM   207  O  O   . LEU A 1 25  ? 90.773  56.780  60.084  1.00 38.55  ? 205 LEU A O   1 
ATOM   208  C  CB  . LEU A 1 25  ? 88.185  55.435  61.052  1.00 39.87  ? 205 LEU A CB  1 
ATOM   209  C  CG  . LEU A 1 25  ? 86.870  55.685  61.787  1.00 43.76  ? 205 LEU A CG  1 
ATOM   210  C  CD1 . LEU A 1 25  ? 86.825  54.790  63.031  1.00 45.00  ? 205 LEU A CD1 1 
ATOM   211  C  CD2 . LEU A 1 25  ? 86.761  57.161  62.176  1.00 44.68  ? 205 LEU A CD2 1 
ATOM   212  N  N   . TRP A 1 26  ? 90.343  55.129  58.627  1.00 38.60  ? 206 TRP A N   1 
ATOM   213  C  CA  . TRP A 1 26  ? 91.756  54.875  58.416  1.00 38.42  ? 206 TRP A CA  1 
ATOM   214  C  C   . TRP A 1 26  ? 92.438  55.423  57.182  1.00 38.72  ? 206 TRP A C   1 
ATOM   215  O  O   . TRP A 1 26  ? 91.829  55.595  56.125  1.00 38.37  ? 206 TRP A O   1 
ATOM   216  C  CB  . TRP A 1 26  ? 91.986  53.370  58.510  1.00 39.37  ? 206 TRP A CB  1 
ATOM   217  C  CG  . TRP A 1 26  ? 91.054  52.747  59.495  1.00 40.95  ? 206 TRP A CG  1 
ATOM   218  C  CD1 . TRP A 1 26  ? 89.768  52.332  59.262  1.00 41.82  ? 206 TRP A CD1 1 
ATOM   219  C  CD2 . TRP A 1 26  ? 91.279  52.579  60.899  1.00 41.57  ? 206 TRP A CD2 1 
ATOM   220  N  NE1 . TRP A 1 26  ? 89.181  51.923  60.436  1.00 41.61  ? 206 TRP A NE1 1 
ATOM   221  C  CE2 . TRP A 1 26  ? 90.085  52.063  61.456  1.00 42.44  ? 206 TRP A CE2 1 
ATOM   222  C  CE3 . TRP A 1 26  ? 92.371  52.819  61.740  1.00 41.87  ? 206 TRP A CE3 1 
ATOM   223  C  CZ2 . TRP A 1 26  ? 89.955  51.784  62.821  1.00 43.07  ? 206 TRP A CZ2 1 
ATOM   224  C  CZ3 . TRP A 1 26  ? 92.243  52.543  63.095  1.00 43.31  ? 206 TRP A CZ3 1 
ATOM   225  C  CH2 . TRP A 1 26  ? 91.042  52.029  63.622  1.00 44.03  ? 206 TRP A CH2 1 
ATOM   226  N  N   . GLU A 1 27  ? 93.726  55.703  57.352  1.00 38.98  ? 207 GLU A N   1 
ATOM   227  C  CA  . GLU A 1 27  ? 94.571  56.201  56.282  1.00 40.52  ? 207 GLU A CA  1 
ATOM   228  C  C   . GLU A 1 27  ? 95.069  54.953  55.566  1.00 39.63  ? 207 GLU A C   1 
ATOM   229  O  O   . GLU A 1 27  ? 94.992  53.854  56.111  1.00 38.86  ? 207 GLU A O   1 
ATOM   230  C  CB  . GLU A 1 27  ? 95.741  56.992  56.866  1.00 43.05  ? 207 GLU A CB  1 
ATOM   231  C  CG  . GLU A 1 27  ? 95.308  58.258  57.592  1.00 48.43  ? 207 GLU A CG  1 
ATOM   232  C  CD  . GLU A 1 27  ? 96.469  58.992  58.238  1.00 51.90  ? 207 GLU A CD  1 
ATOM   233  O  OE1 . GLU A 1 27  ? 97.426  59.355  57.516  1.00 54.05  ? 207 GLU A OE1 1 
ATOM   234  O  OE2 . GLU A 1 27  ? 96.425  59.212  59.470  1.00 54.01  ? 207 GLU A OE2 1 
ATOM   235  N  N   . PRO A 1 28  ? 95.585  55.099  54.339  1.00 39.47  ? 208 PRO A N   1 
ATOM   236  C  CA  . PRO A 1 28  ? 96.076  53.936  53.592  1.00 39.50  ? 208 PRO A CA  1 
ATOM   237  C  C   . PRO A 1 28  ? 96.989  52.982  54.361  1.00 39.37  ? 208 PRO A C   1 
ATOM   238  O  O   . PRO A 1 28  ? 96.795  51.765  54.325  1.00 37.83  ? 208 PRO A O   1 
ATOM   239  C  CB  . PRO A 1 28  ? 96.754  54.564  52.368  1.00 39.46  ? 208 PRO A CB  1 
ATOM   240  C  CG  . PRO A 1 28  ? 97.019  55.990  52.784  1.00 40.40  ? 208 PRO A CG  1 
ATOM   241  C  CD  . PRO A 1 28  ? 95.802  56.339  53.577  1.00 39.62  ? 208 PRO A CD  1 
ATOM   242  N  N   . ASN A 1 29  ? 97.974  53.529  55.067  1.00 39.92  ? 209 ASN A N   1 
ATOM   243  C  CA  . ASN A 1 29  ? 98.894  52.696  55.826  1.00 39.86  ? 209 ASN A CA  1 
ATOM   244  C  C   . ASN A 1 29  ? 98.163  51.794  56.817  1.00 38.12  ? 209 ASN A C   1 
ATOM   245  O  O   . ASN A 1 29  ? 98.510  50.621  56.965  1.00 36.71  ? 209 ASN A O   1 
ATOM   246  C  CB  . ASN A 1 29  ? 99.918  53.573  56.550  1.00 43.55  ? 209 ASN A CB  1 
ATOM   247  C  CG  . ASN A 1 29  ? 100.854 54.283  55.581  1.00 48.22  ? 209 ASN A CG  1 
ATOM   248  O  OD1 . ASN A 1 29  ? 101.634 53.641  54.862  1.00 49.20  ? 209 ASN A OD1 1 
ATOM   249  N  ND2 . ASN A 1 29  ? 100.774 55.615  55.544  1.00 50.76  ? 209 ASN A ND2 1 
ATOM   250  N  N   . GLU A 1 30  ? 97.149  52.337  57.481  1.00 36.08  ? 210 GLU A N   1 
ATOM   251  C  CA  . GLU A 1 30  ? 96.377  51.564  58.450  1.00 35.48  ? 210 GLU A CA  1 
ATOM   252  C  C   . GLU A 1 30  ? 95.509  50.534  57.729  1.00 33.97  ? 210 GLU A C   1 
ATOM   253  O  O   . GLU A 1 30  ? 95.280  49.437  58.241  1.00 32.74  ? 210 GLU A O   1 
ATOM   254  C  CB  . GLU A 1 30  ? 95.488  52.483  59.286  1.00 37.76  ? 210 GLU A CB  1 
ATOM   255  C  CG  . GLU A 1 30  ? 96.228  53.636  59.944  1.00 42.94  ? 210 GLU A CG  1 
ATOM   256  C  CD  . GLU A 1 30  ? 95.274  54.645  60.559  1.00 45.77  ? 210 GLU A CD  1 
ATOM   257  O  OE1 . GLU A 1 30  ? 94.699  54.359  61.635  1.00 48.16  ? 210 GLU A OE1 1 
ATOM   258  O  OE2 . GLU A 1 30  ? 95.084  55.720  59.954  1.00 47.43  ? 210 GLU A OE2 1 
ATOM   259  N  N   . MET A 1 31  ? 95.011  50.892  56.548  1.00 31.41  ? 211 MET A N   1 
ATOM   260  C  CA  . MET A 1 31  ? 94.194  49.964  55.782  1.00 30.13  ? 211 MET A CA  1 
ATOM   261  C  C   . MET A 1 31  ? 95.064  48.818  55.286  1.00 28.84  ? 211 MET A C   1 
ATOM   262  O  O   . MET A 1 31  ? 94.610  47.682  55.223  1.00 28.79  ? 211 MET A O   1 
ATOM   263  C  CB  . MET A 1 31  ? 93.514  50.665  54.602  1.00 30.21  ? 211 MET A CB  1 
ATOM   264  C  CG  . MET A 1 31  ? 92.293  51.476  55.009  1.00 29.45  ? 211 MET A CG  1 
ATOM   265  S  SD  . MET A 1 31  ? 91.369  52.128  53.605  1.00 31.43  ? 211 MET A SD  1 
ATOM   266  C  CE  . MET A 1 31  ? 92.463  53.513  53.114  1.00 26.48  ? 211 MET A CE  1 
ATOM   267  N  N   . LEU A 1 32  ? 96.315  49.113  54.942  1.00 27.67  ? 212 LEU A N   1 
ATOM   268  C  CA  . LEU A 1 32  ? 97.220  48.071  54.481  1.00 26.76  ? 212 LEU A CA  1 
ATOM   269  C  C   . LEU A 1 32  ? 97.446  47.064  55.606  1.00 27.76  ? 212 LEU A C   1 
ATOM   270  O  O   . LEU A 1 32  ? 97.438  45.855  55.372  1.00 28.52  ? 212 LEU A O   1 
ATOM   271  C  CB  . LEU A 1 32  ? 98.542  48.682  54.024  1.00 26.36  ? 212 LEU A CB  1 
ATOM   272  C  CG  . LEU A 1 32  ? 98.438  49.446  52.696  1.00 27.11  ? 212 LEU A CG  1 
ATOM   273  C  CD1 . LEU A 1 32  ? 99.720  50.218  52.427  1.00 26.02  ? 212 LEU A CD1 1 
ATOM   274  C  CD2 . LEU A 1 32  ? 98.161  48.462  51.570  1.00 25.61  ? 212 LEU A CD2 1 
ATOM   275  N  N   . SER A 1 33  ? 97.636  47.565  56.828  1.00 27.07  ? 213 SER A N   1 
ATOM   276  C  CA  . SER A 1 33  ? 97.831  46.705  57.988  1.00 25.79  ? 213 SER A CA  1 
ATOM   277  C  C   . SER A 1 33  ? 96.609  45.816  58.194  1.00 25.14  ? 213 SER A C   1 
ATOM   278  O  O   . SER A 1 33  ? 96.740  44.649  58.578  1.00 23.43  ? 213 SER A O   1 
ATOM   279  C  CB  . SER A 1 33  ? 98.072  47.544  59.250  1.00 26.44  ? 213 SER A CB  1 
ATOM   280  O  OG  . SER A 1 33  ? 99.369  48.126  59.234  1.00 29.03  ? 213 SER A OG  1 
ATOM   281  N  N   . CYS A 1 34  ? 95.425  46.373  57.944  1.00 24.03  ? 214 CYS A N   1 
ATOM   282  C  CA  . CYS A 1 34  ? 94.187  45.621  58.090  1.00 24.86  ? 214 CYS A CA  1 
ATOM   283  C  C   . CYS A 1 34  ? 94.155  44.469  57.082  1.00 24.80  ? 214 CYS A C   1 
ATOM   284  O  O   . CYS A 1 34  ? 93.821  43.334  57.436  1.00 25.04  ? 214 CYS A O   1 
ATOM   285  C  CB  . CYS A 1 34  ? 92.968  46.528  57.881  1.00 25.27  ? 214 CYS A CB  1 
ATOM   286  S  SG  . CYS A 1 34  ? 92.598  47.642  59.272  1.00 26.49  ? 214 CYS A SG  1 
ATOM   287  N  N   . LEU A 1 35  ? 94.510  44.759  55.833  1.00 24.20  ? 215 LEU A N   1 
ATOM   288  C  CA  . LEU A 1 35  ? 94.520  43.732  54.799  1.00 25.19  ? 215 LEU A CA  1 
ATOM   289  C  C   . LEU A 1 35  ? 95.528  42.648  55.172  1.00 26.44  ? 215 LEU A C   1 
ATOM   290  O  O   . LEU A 1 35  ? 95.239  41.457  55.049  1.00 27.30  ? 215 LEU A O   1 
ATOM   291  C  CB  . LEU A 1 35  ? 94.874  44.344  53.442  1.00 22.78  ? 215 LEU A CB  1 
ATOM   292  C  CG  . LEU A 1 35  ? 93.806  45.286  52.884  1.00 23.34  ? 215 LEU A CG  1 
ATOM   293  C  CD1 . LEU A 1 35  ? 94.281  45.868  51.575  1.00 21.39  ? 215 LEU A CD1 1 
ATOM   294  C  CD2 . LEU A 1 35  ? 92.483  44.532  52.696  1.00 21.25  ? 215 LEU A CD2 1 
ATOM   295  N  N   . GLU A 1 36  ? 96.705  43.073  55.631  1.00 26.72  ? 216 GLU A N   1 
ATOM   296  C  CA  . GLU A 1 36  ? 97.759  42.155  56.049  1.00 27.40  ? 216 GLU A CA  1 
ATOM   297  C  C   . GLU A 1 36  ? 97.244  41.222  57.144  1.00 27.82  ? 216 GLU A C   1 
ATOM   298  O  O   . GLU A 1 36  ? 97.444  40.011  57.083  1.00 28.02  ? 216 GLU A O   1 
ATOM   299  C  CB  . GLU A 1 36  ? 98.964  42.937  56.575  1.00 26.79  ? 216 GLU A CB  1 
ATOM   300  C  CG  . GLU A 1 36  ? 100.081 42.056  57.117  1.00 29.12  ? 216 GLU A CG  1 
ATOM   301  C  CD  . GLU A 1 36  ? 101.204 42.864  57.750  1.00 30.13  ? 216 GLU A CD  1 
ATOM   302  O  OE1 . GLU A 1 36  ? 102.199 42.258  58.204  1.00 29.92  ? 216 GLU A OE1 1 
ATOM   303  O  OE2 . GLU A 1 36  ? 101.090 44.107  57.791  1.00 30.42  ? 216 GLU A OE2 1 
ATOM   304  N  N   . HIS A 1 37  ? 96.588  41.793  58.149  1.00 27.09  ? 217 HIS A N   1 
ATOM   305  C  CA  . HIS A 1 37  ? 96.048  40.995  59.243  1.00 27.82  ? 217 HIS A CA  1 
ATOM   306  C  C   . HIS A 1 37  ? 95.037  39.967  58.735  1.00 27.60  ? 217 HIS A C   1 
ATOM   307  O  O   . HIS A 1 37  ? 94.936  38.868  59.275  1.00 27.77  ? 217 HIS A O   1 
ATOM   308  C  CB  . HIS A 1 37  ? 95.372  41.887  60.288  1.00 28.36  ? 217 HIS A CB  1 
ATOM   309  C  CG  . HIS A 1 37  ? 94.543  41.122  61.273  1.00 30.46  ? 217 HIS A CG  1 
ATOM   310  N  ND1 . HIS A 1 37  ? 95.095  40.305  62.237  1.00 30.77  ? 217 HIS A ND1 1 
ATOM   311  C  CD2 . HIS A 1 37  ? 93.199  41.008  61.407  1.00 30.81  ? 217 HIS A CD2 1 
ATOM   312  C  CE1 . HIS A 1 37  ? 94.128  39.722  62.922  1.00 31.90  ? 217 HIS A CE1 1 
ATOM   313  N  NE2 . HIS A 1 37  ? 92.968  40.131  62.439  1.00 31.78  ? 217 HIS A NE2 1 
ATOM   314  N  N   . MET A 1 38  ? 94.284  40.328  57.702  1.00 26.76  ? 218 MET A N   1 
ATOM   315  C  CA  . MET A 1 38  ? 93.303  39.413  57.141  1.00 25.95  ? 218 MET A CA  1 
ATOM   316  C  C   . MET A 1 38  ? 93.964  38.144  56.623  1.00 25.90  ? 218 MET A C   1 
ATOM   317  O  O   . MET A 1 38  ? 93.489  37.041  56.887  1.00 25.35  ? 218 MET A O   1 
ATOM   318  C  CB  . MET A 1 38  ? 92.534  40.092  56.014  1.00 25.87  ? 218 MET A CB  1 
ATOM   319  C  CG  . MET A 1 38  ? 91.472  41.061  56.493  1.00 25.52  ? 218 MET A CG  1 
ATOM   320  S  SD  . MET A 1 38  ? 90.717  41.939  55.119  1.00 25.13  ? 218 MET A SD  1 
ATOM   321  C  CE  . MET A 1 38  ? 90.229  43.488  55.964  1.00 25.60  ? 218 MET A CE  1 
ATOM   322  N  N   . TYR A 1 39  ? 95.065  38.297  55.893  1.00 25.11  ? 219 TYR A N   1 
ATOM   323  C  CA  . TYR A 1 39  ? 95.766  37.143  55.352  1.00 25.17  ? 219 TYR A CA  1 
ATOM   324  C  C   . TYR A 1 39  ? 96.316  36.219  56.431  1.00 26.20  ? 219 TYR A C   1 
ATOM   325  O  O   . TYR A 1 39  ? 96.262  34.994  56.288  1.00 27.03  ? 219 TYR A O   1 
ATOM   326  C  CB  . TYR A 1 39  ? 96.877  37.588  54.393  1.00 23.67  ? 219 TYR A CB  1 
ATOM   327  C  CG  . TYR A 1 39  ? 96.353  37.811  52.991  1.00 23.63  ? 219 TYR A CG  1 
ATOM   328  C  CD1 . TYR A 1 39  ? 95.417  38.811  52.725  1.00 23.01  ? 219 TYR A CD1 1 
ATOM   329  C  CD2 . TYR A 1 39  ? 96.726  36.969  51.946  1.00 23.78  ? 219 TYR A CD2 1 
ATOM   330  C  CE1 . TYR A 1 39  ? 94.859  38.957  51.461  1.00 23.91  ? 219 TYR A CE1 1 
ATOM   331  C  CE2 . TYR A 1 39  ? 96.176  37.108  50.671  1.00 23.71  ? 219 TYR A CE2 1 
ATOM   332  C  CZ  . TYR A 1 39  ? 95.243  38.101  50.439  1.00 24.31  ? 219 TYR A CZ  1 
ATOM   333  O  OH  . TYR A 1 39  ? 94.687  38.231  49.190  1.00 23.97  ? 219 TYR A OH  1 
ATOM   334  N  N   . HIS A 1 40  ? 96.843  36.790  57.510  1.00 25.92  ? 220 HIS A N   1 
ATOM   335  C  CA  . HIS A 1 40  ? 97.361  35.964  58.598  1.00 25.38  ? 220 HIS A CA  1 
ATOM   336  C  C   . HIS A 1 40  ? 96.205  35.288  59.321  1.00 25.23  ? 220 HIS A C   1 
ATOM   337  O  O   . HIS A 1 40  ? 96.213  34.080  59.534  1.00 24.57  ? 220 HIS A O   1 
ATOM   338  C  CB  . HIS A 1 40  ? 98.149  36.813  59.600  1.00 24.99  ? 220 HIS A CB  1 
ATOM   339  C  CG  . HIS A 1 40  ? 99.520  37.190  59.131  1.00 24.60  ? 220 HIS A CG  1 
ATOM   340  N  ND1 . HIS A 1 40  ? 100.564 36.291  59.086  1.00 24.25  ? 220 HIS A ND1 1 
ATOM   341  C  CD2 . HIS A 1 40  ? 100.015 38.367  58.677  1.00 23.62  ? 220 HIS A CD2 1 
ATOM   342  C  CE1 . HIS A 1 40  ? 101.644 36.899  58.626  1.00 25.78  ? 220 HIS A CE1 1 
ATOM   343  N  NE2 . HIS A 1 40  ? 101.337 38.157  58.371  1.00 24.36  ? 220 HIS A NE2 1 
ATOM   344  N  N   . ASP A 1 41  ? 95.201  36.079  59.674  1.00 26.03  ? 221 ASP A N   1 
ATOM   345  C  CA  . ASP A 1 41  ? 94.037  35.591  60.404  1.00 27.69  ? 221 ASP A CA  1 
ATOM   346  C  C   . ASP A 1 41  ? 93.243  34.482  59.698  1.00 28.58  ? 221 ASP A C   1 
ATOM   347  O  O   . ASP A 1 41  ? 92.726  33.572  60.355  1.00 28.69  ? 221 ASP A O   1 
ATOM   348  C  CB  . ASP A 1 41  ? 93.109  36.764  60.718  1.00 28.66  ? 221 ASP A CB  1 
ATOM   349  C  CG  . ASP A 1 41  ? 92.047  36.407  61.732  1.00 30.44  ? 221 ASP A CG  1 
ATOM   350  O  OD1 . ASP A 1 41  ? 90.871  36.775  61.520  1.00 29.96  ? 221 ASP A OD1 1 
ATOM   351  O  OD2 . ASP A 1 41  ? 92.396  35.760  62.746  1.00 32.01  ? 221 ASP A OD2 1 
ATOM   352  N  N   . LEU A 1 42  ? 93.136  34.568  58.371  1.00 27.94  ? 222 LEU A N   1 
ATOM   353  C  CA  . LEU A 1 42  ? 92.412  33.570  57.582  1.00 26.92  ? 222 LEU A CA  1 
ATOM   354  C  C   . LEU A 1 42  ? 93.249  32.305  57.379  1.00 26.60  ? 222 LEU A C   1 
ATOM   355  O  O   . LEU A 1 42  ? 92.773  31.316  56.812  1.00 25.52  ? 222 LEU A O   1 
ATOM   356  C  CB  . LEU A 1 42  ? 92.016  34.158  56.216  1.00 26.08  ? 222 LEU A CB  1 
ATOM   357  C  CG  . LEU A 1 42  ? 90.898  35.205  56.260  1.00 25.57  ? 222 LEU A CG  1 
ATOM   358  C  CD1 . LEU A 1 42  ? 90.757  35.887  54.899  1.00 24.91  ? 222 LEU A CD1 1 
ATOM   359  C  CD2 . LEU A 1 42  ? 89.591  34.530  56.685  1.00 24.87  ? 222 LEU A CD2 1 
ATOM   360  N  N   . GLY A 1 43  ? 94.497  32.350  57.844  1.00 26.49  ? 223 GLY A N   1 
ATOM   361  C  CA  . GLY A 1 43  ? 95.394  31.214  57.725  1.00 26.43  ? 223 GLY A CA  1 
ATOM   362  C  C   . GLY A 1 43  ? 95.991  31.031  56.344  1.00 27.26  ? 223 GLY A C   1 
ATOM   363  O  O   . GLY A 1 43  ? 96.493  29.951  56.018  1.00 28.14  ? 223 GLY A O   1 
ATOM   364  N  N   . LEU A 1 44  ? 95.949  32.084  55.532  1.00 26.85  ? 224 LEU A N   1 
ATOM   365  C  CA  . LEU A 1 44  ? 96.488  32.022  54.174  1.00 27.14  ? 224 LEU A CA  1 
ATOM   366  C  C   . LEU A 1 44  ? 98.011  32.088  54.163  1.00 26.87  ? 224 LEU A C   1 
ATOM   367  O  O   . LEU A 1 44  ? 98.656  31.416  53.366  1.00 26.61  ? 224 LEU A O   1 
ATOM   368  C  CB  . LEU A 1 44  ? 95.915  33.160  53.319  1.00 26.99  ? 224 LEU A CB  1 
ATOM   369  C  CG  . LEU A 1 44  ? 94.386  33.225  53.253  1.00 27.14  ? 224 LEU A CG  1 
ATOM   370  C  CD1 . LEU A 1 44  ? 93.942  34.432  52.432  1.00 25.09  ? 224 LEU A CD1 1 
ATOM   371  C  CD2 . LEU A 1 44  ? 93.847  31.930  52.664  1.00 25.82  ? 224 LEU A CD2 1 
ATOM   372  N  N   . VAL A 1 45  ? 98.584  32.911  55.035  1.00 27.95  ? 225 VAL A N   1 
ATOM   373  C  CA  . VAL A 1 45  ? 100.038 33.027  55.118  1.00 28.51  ? 225 VAL A CA  1 
ATOM   374  C  C   . VAL A 1 45  ? 100.583 31.654  55.487  1.00 29.74  ? 225 VAL A C   1 
ATOM   375  O  O   . VAL A 1 45  ? 101.543 31.160  54.897  1.00 29.90  ? 225 VAL A O   1 
ATOM   376  C  CB  . VAL A 1 45  ? 100.455 34.029  56.215  1.00 28.81  ? 225 VAL A CB  1 
ATOM   377  C  CG1 . VAL A 1 45  ? 101.960 33.995  56.414  1.00 28.04  ? 225 VAL A CG1 1 
ATOM   378  C  CG2 . VAL A 1 45  ? 99.990  35.425  55.840  1.00 28.31  ? 225 VAL A CG2 1 
ATOM   379  N  N   . ARG A 1 46  ? 99.935  31.042  56.466  1.00 30.91  ? 226 ARG A N   1 
ATOM   380  C  CA  . ARG A 1 46  ? 100.310 29.730  56.955  1.00 32.57  ? 226 ARG A CA  1 
ATOM   381  C  C   . ARG A 1 46  ? 100.160 28.631  55.895  1.00 31.61  ? 226 ARG A C   1 
ATOM   382  O  O   . ARG A 1 46  ? 101.126 27.956  55.556  1.00 30.66  ? 226 ARG A O   1 
ATOM   383  C  CB  . ARG A 1 46  ? 99.454  29.404  58.179  1.00 35.48  ? 226 ARG A CB  1 
ATOM   384  C  CG  . ARG A 1 46  ? 99.703  28.057  58.820  1.00 41.05  ? 226 ARG A CG  1 
ATOM   385  C  CD  . ARG A 1 46  ? 98.566  27.745  59.779  1.00 45.39  ? 226 ARG A CD  1 
ATOM   386  N  NE  . ARG A 1 46  ? 97.293  27.679  59.057  1.00 49.72  ? 226 ARG A NE  1 
ATOM   387  C  CZ  . ARG A 1 46  ? 96.095  27.724  59.633  1.00 50.59  ? 226 ARG A CZ  1 
ATOM   388  N  NH1 . ARG A 1 46  ? 95.994  27.837  60.951  1.00 53.17  ? 226 ARG A NH1 1 
ATOM   389  N  NH2 . ARG A 1 46  ? 94.996  27.667  58.890  1.00 51.00  ? 226 ARG A NH2 1 
ATOM   390  N  N   . ASP A 1 47  ? 98.955  28.468  55.360  1.00 30.37  ? 227 ASP A N   1 
ATOM   391  C  CA  . ASP A 1 47  ? 98.705  27.419  54.380  1.00 29.56  ? 227 ASP A CA  1 
ATOM   392  C  C   . ASP A 1 47  ? 99.322  27.587  52.990  1.00 29.47  ? 227 ASP A C   1 
ATOM   393  O  O   . ASP A 1 47  ? 99.393  26.625  52.223  1.00 29.84  ? 227 ASP A O   1 
ATOM   394  C  CB  . ASP A 1 47  ? 97.201  27.185  54.252  1.00 30.37  ? 227 ASP A CB  1 
ATOM   395  C  CG  . ASP A 1 47  ? 96.565  26.810  55.570  1.00 31.70  ? 227 ASP A CG  1 
ATOM   396  O  OD1 . ASP A 1 47  ? 97.259  26.181  56.395  1.00 32.94  ? 227 ASP A OD1 1 
ATOM   397  O  OD2 . ASP A 1 47  ? 95.377  27.129  55.783  1.00 32.93  ? 227 ASP A OD2 1 
ATOM   398  N  N   . PHE A 1 48  ? 99.775  28.788  52.657  1.00 27.74  ? 228 PHE A N   1 
ATOM   399  C  CA  . PHE A 1 48  ? 100.383 28.996  51.352  1.00 27.69  ? 228 PHE A CA  1 
ATOM   400  C  C   . PHE A 1 48  ? 101.830 29.469  51.452  1.00 27.42  ? 228 PHE A C   1 
ATOM   401  O  O   . PHE A 1 48  ? 102.427 29.896  50.467  1.00 27.03  ? 228 PHE A O   1 
ATOM   402  C  CB  . PHE A 1 48  ? 99.517  29.962  50.537  1.00 27.09  ? 228 PHE A CB  1 
ATOM   403  C  CG  . PHE A 1 48  ? 98.159  29.393  50.197  1.00 27.04  ? 228 PHE A CG  1 
ATOM   404  C  CD1 . PHE A 1 48  ? 98.032  28.380  49.247  1.00 26.03  ? 228 PHE A CD1 1 
ATOM   405  C  CD2 . PHE A 1 48  ? 97.023  29.804  50.885  1.00 27.05  ? 228 PHE A CD2 1 
ATOM   406  C  CE1 . PHE A 1 48  ? 96.795  27.783  48.995  1.00 25.61  ? 228 PHE A CE1 1 
ATOM   407  C  CE2 . PHE A 1 48  ? 95.778  29.212  50.640  1.00 25.72  ? 228 PHE A CE2 1 
ATOM   408  C  CZ  . PHE A 1 48  ? 95.667  28.204  49.700  1.00 25.63  ? 228 PHE A CZ  1 
ATOM   409  N  N   . SER A 1 49  ? 102.393 29.350  52.654  1.00 28.05  ? 229 SER A N   1 
ATOM   410  C  CA  . SER A 1 49  ? 103.775 29.745  52.926  1.00 28.87  ? 229 SER A CA  1 
ATOM   411  C  C   . SER A 1 49  ? 104.099 31.119  52.356  1.00 28.43  ? 229 SER A C   1 
ATOM   412  O  O   . SER A 1 49  ? 105.146 31.317  51.746  1.00 28.07  ? 229 SER A O   1 
ATOM   413  C  CB  . SER A 1 49  ? 104.754 28.718  52.343  1.00 29.64  ? 229 SER A CB  1 
ATOM   414  O  OG  . SER A 1 49  ? 104.460 27.409  52.795  1.00 31.77  ? 229 SER A OG  1 
ATOM   415  N  N   . ILE A 1 50  ? 103.197 32.068  52.551  1.00 28.80  ? 230 ILE A N   1 
ATOM   416  C  CA  . ILE A 1 50  ? 103.430 33.408  52.042  1.00 29.44  ? 230 ILE A CA  1 
ATOM   417  C  C   . ILE A 1 50  ? 104.484 34.095  52.896  1.00 30.40  ? 230 ILE A C   1 
ATOM   418  O  O   . ILE A 1 50  ? 104.347 34.166  54.118  1.00 30.73  ? 230 ILE A O   1 
ATOM   419  C  CB  . ILE A 1 50  ? 102.163 34.273  52.099  1.00 28.49  ? 230 ILE A CB  1 
ATOM   420  C  CG1 . ILE A 1 50  ? 101.007 33.572  51.384  1.00 29.49  ? 230 ILE A CG1 1 
ATOM   421  C  CG2 . ILE A 1 50  ? 102.441 35.618  51.463  1.00 27.26  ? 230 ILE A CG2 1 
ATOM   422  C  CD1 . ILE A 1 50  ? 99.690  34.334  51.469  1.00 29.20  ? 230 ILE A CD1 1 
ATOM   423  N  N   . ASN A 1 51  ? 105.536 34.586  52.256  1.00 31.26  ? 231 ASN A N   1 
ATOM   424  C  CA  . ASN A 1 51  ? 106.582 35.301  52.971  1.00 32.59  ? 231 ASN A CA  1 
ATOM   425  C  C   . ASN A 1 51  ? 105.885 36.528  53.565  1.00 32.27  ? 231 ASN A C   1 
ATOM   426  O  O   . ASN A 1 51  ? 105.349 37.358  52.828  1.00 32.40  ? 231 ASN A O   1 
ATOM   427  C  CB  . ASN A 1 51  ? 107.671 35.737  51.992  1.00 35.13  ? 231 ASN A CB  1 
ATOM   428  C  CG  . ASN A 1 51  ? 108.807 36.464  52.672  1.00 38.38  ? 231 ASN A CG  1 
ATOM   429  O  OD1 . ASN A 1 51  ? 108.588 37.323  53.535  1.00 40.12  ? 231 ASN A OD1 1 
ATOM   430  N  ND2 . ASN A 1 51  ? 110.036 36.135  52.281  1.00 40.54  ? 231 ASN A ND2 1 
ATOM   431  N  N   . PRO A 1 52  ? 105.874 36.659  54.903  1.00 31.88  ? 232 PRO A N   1 
ATOM   432  C  CA  . PRO A 1 52  ? 105.207 37.817  55.507  1.00 32.01  ? 232 PRO A CA  1 
ATOM   433  C  C   . PRO A 1 52  ? 105.678 39.194  55.045  1.00 31.29  ? 232 PRO A C   1 
ATOM   434  O  O   . PRO A 1 52  ? 104.914 40.155  55.095  1.00 31.31  ? 232 PRO A O   1 
ATOM   435  C  CB  . PRO A 1 52  ? 105.385 37.586  57.017  1.00 32.03  ? 232 PRO A CB  1 
ATOM   436  C  CG  . PRO A 1 52  ? 106.554 36.664  57.110  1.00 33.38  ? 232 PRO A CG  1 
ATOM   437  C  CD  . PRO A 1 52  ? 106.376 35.742  55.937  1.00 32.24  ? 232 PRO A CD  1 
ATOM   438  N  N   . VAL A 1 53  ? 106.921 39.297  54.589  1.00 30.28  ? 233 VAL A N   1 
ATOM   439  C  CA  . VAL A 1 53  ? 107.424 40.581  54.118  1.00 29.64  ? 233 VAL A CA  1 
ATOM   440  C  C   . VAL A 1 53  ? 106.939 40.797  52.692  1.00 28.54  ? 233 VAL A C   1 
ATOM   441  O  O   . VAL A 1 53  ? 106.570 41.907  52.313  1.00 27.80  ? 233 VAL A O   1 
ATOM   442  C  CB  . VAL A 1 53  ? 108.964 40.640  54.147  1.00 30.34  ? 233 VAL A CB  1 
ATOM   443  C  CG1 . VAL A 1 53  ? 109.442 41.998  53.640  1.00 30.30  ? 233 VAL A CG1 1 
ATOM   444  C  CG2 . VAL A 1 53  ? 109.461 40.402  55.569  1.00 31.93  ? 233 VAL A CG2 1 
ATOM   445  N  N   . THR A 1 54  ? 106.935 39.726  51.902  1.00 27.60  ? 234 THR A N   1 
ATOM   446  C  CA  . THR A 1 54  ? 106.470 39.824  50.532  1.00 26.45  ? 234 THR A CA  1 
ATOM   447  C  C   . THR A 1 54  ? 104.998 40.244  50.563  1.00 26.31  ? 234 THR A C   1 
ATOM   448  O  O   . THR A 1 54  ? 104.556 41.015  49.719  1.00 25.99  ? 234 THR A O   1 
ATOM   449  C  CB  . THR A 1 54  ? 106.610 38.480  49.794  1.00 26.97  ? 234 THR A CB  1 
ATOM   450  O  OG1 . THR A 1 54  ? 107.989 38.093  49.769  1.00 27.01  ? 234 THR A OG1 1 
ATOM   451  C  CG2 . THR A 1 54  ? 106.100 38.604  48.354  1.00 26.01  ? 234 THR A CG2 1 
ATOM   452  N  N   . LEU A 1 55  ? 104.251 39.746  51.547  1.00 26.18  ? 235 LEU A N   1 
ATOM   453  C  CA  . LEU A 1 55  ? 102.839 40.089  51.688  1.00 26.52  ? 235 LEU A CA  1 
ATOM   454  C  C   . LEU A 1 55  ? 102.681 41.600  51.813  1.00 28.10  ? 235 LEU A C   1 
ATOM   455  O  O   . LEU A 1 55  ? 101.758 42.189  51.243  1.00 28.39  ? 235 LEU A O   1 
ATOM   456  C  CB  . LEU A 1 55  ? 102.244 39.414  52.923  1.00 25.56  ? 235 LEU A CB  1 
ATOM   457  C  CG  . LEU A 1 55  ? 100.808 39.807  53.280  1.00 25.36  ? 235 LEU A CG  1 
ATOM   458  C  CD1 . LEU A 1 55  ? 99.869  39.460  52.130  1.00 24.75  ? 235 LEU A CD1 1 
ATOM   459  C  CD2 . LEU A 1 55  ? 100.382 39.084  54.549  1.00 25.32  ? 235 LEU A CD2 1 
ATOM   460  N  N   . ARG A 1 56  ? 103.584 42.225  52.563  1.00 29.31  ? 236 ARG A N   1 
ATOM   461  C  CA  . ARG A 1 56  ? 103.546 43.675  52.748  1.00 30.03  ? 236 ARG A CA  1 
ATOM   462  C  C   . ARG A 1 56  ? 103.952 44.417  51.491  1.00 29.04  ? 236 ARG A C   1 
ATOM   463  O  O   . ARG A 1 56  ? 103.320 45.402  51.113  1.00 29.26  ? 236 ARG A O   1 
ATOM   464  C  CB  . ARG A 1 56  ? 104.481 44.109  53.867  1.00 31.84  ? 236 ARG A CB  1 
ATOM   465  C  CG  . ARG A 1 56  ? 104.026 43.753  55.242  1.00 34.66  ? 236 ARG A CG  1 
ATOM   466  C  CD  . ARG A 1 56  ? 104.866 44.522  56.236  1.00 36.38  ? 236 ARG A CD  1 
ATOM   467  N  NE  . ARG A 1 56  ? 104.555 44.129  57.592  1.00 38.54  ? 236 ARG A NE  1 
ATOM   468  C  CZ  . ARG A 1 56  ? 105.392 44.263  58.609  1.00 40.60  ? 236 ARG A CZ  1 
ATOM   469  N  NH1 . ARG A 1 56  ? 106.595 44.791  58.410  1.00 39.27  ? 236 ARG A NH1 1 
ATOM   470  N  NH2 . ARG A 1 56  ? 105.027 43.847  59.816  1.00 40.38  ? 236 ARG A NH2 1 
ATOM   471  N  N   . ARG A 1 57  ? 105.028 43.964  50.857  1.00 28.17  ? 237 ARG A N   1 
ATOM   472  C  CA  . ARG A 1 57  ? 105.475 44.621  49.641  1.00 28.91  ? 237 ARG A CA  1 
ATOM   473  C  C   . ARG A 1 57  ? 104.383 44.533  48.583  1.00 28.12  ? 237 ARG A C   1 
ATOM   474  O  O   . ARG A 1 57  ? 104.118 45.508  47.880  1.00 28.23  ? 237 ARG A O   1 
ATOM   475  C  CB  . ARG A 1 57  ? 106.776 43.992  49.126  1.00 29.94  ? 237 ARG A CB  1 
ATOM   476  C  CG  . ARG A 1 57  ? 108.015 44.453  49.877  1.00 33.14  ? 237 ARG A CG  1 
ATOM   477  C  CD  . ARG A 1 57  ? 109.301 44.030  49.178  1.00 35.63  ? 237 ARG A CD  1 
ATOM   478  N  NE  . ARG A 1 57  ? 109.444 42.580  49.165  1.00 39.26  ? 237 ARG A NE  1 
ATOM   479  C  CZ  . ARG A 1 57  ? 110.287 41.898  49.931  1.00 40.99  ? 237 ARG A CZ  1 
ATOM   480  N  NH1 . ARG A 1 57  ? 111.083 42.526  50.778  1.00 40.54  ? 237 ARG A NH1 1 
ATOM   481  N  NH2 . ARG A 1 57  ? 110.318 40.575  49.855  1.00 43.92  ? 237 ARG A NH2 1 
ATOM   482  N  N   . TRP A 1 58  ? 103.737 43.371  48.490  1.00 26.08  ? 238 TRP A N   1 
ATOM   483  C  CA  . TRP A 1 58  ? 102.668 43.160  47.516  1.00 26.11  ? 238 TRP A CA  1 
ATOM   484  C  C   . TRP A 1 58  ? 101.498 44.119  47.744  1.00 26.09  ? 238 TRP A C   1 
ATOM   485  O  O   . TRP A 1 58  ? 101.028 44.769  46.808  1.00 25.74  ? 238 TRP A O   1 
ATOM   486  C  CB  . TRP A 1 58  ? 102.168 41.711  47.582  1.00 25.19  ? 238 TRP A CB  1 
ATOM   487  C  CG  . TRP A 1 58  ? 100.945 41.450  46.748  1.00 24.19  ? 238 TRP A CG  1 
ATOM   488  C  CD1 . TRP A 1 58  ? 100.861 41.443  45.382  1.00 23.58  ? 238 TRP A CD1 1 
ATOM   489  C  CD2 . TRP A 1 58  ? 99.623  41.191  47.231  1.00 22.62  ? 238 TRP A CD2 1 
ATOM   490  N  NE1 . TRP A 1 58  ? 99.567  41.201  44.988  1.00 22.13  ? 238 TRP A NE1 1 
ATOM   491  C  CE2 . TRP A 1 58  ? 98.786  41.045  46.104  1.00 22.64  ? 238 TRP A CE2 1 
ATOM   492  C  CE3 . TRP A 1 58  ? 99.062  41.073  48.508  1.00 22.44  ? 238 TRP A CE3 1 
ATOM   493  C  CZ2 . TRP A 1 58  ? 97.419  40.782  46.217  1.00 21.48  ? 238 TRP A CZ2 1 
ATOM   494  C  CZ3 . TRP A 1 58  ? 97.703  40.810  48.620  1.00 21.28  ? 238 TRP A CZ3 1 
ATOM   495  C  CH2 . TRP A 1 58  ? 96.899  40.669  47.480  1.00 21.43  ? 238 TRP A CH2 1 
ATOM   496  N  N   . LEU A 1 59  ? 101.029 44.200  48.987  1.00 26.20  ? 239 LEU A N   1 
ATOM   497  C  CA  . LEU A 1 59  ? 99.917  45.089  49.317  1.00 27.57  ? 239 LEU A CA  1 
ATOM   498  C  C   . LEU A 1 59  ? 100.280 46.540  49.004  1.00 27.68  ? 239 LEU A C   1 
ATOM   499  O  O   . LEU A 1 59  ? 99.458  47.308  48.497  1.00 27.45  ? 239 LEU A O   1 
ATOM   500  C  CB  . LEU A 1 59  ? 99.548  44.952  50.799  1.00 27.06  ? 239 LEU A CB  1 
ATOM   501  C  CG  . LEU A 1 59  ? 98.845  43.649  51.195  1.00 27.35  ? 239 LEU A CG  1 
ATOM   502  C  CD1 . LEU A 1 59  ? 98.783  43.529  52.712  1.00 26.61  ? 239 LEU A CD1 1 
ATOM   503  C  CD2 . LEU A 1 59  ? 97.445  43.621  50.598  1.00 26.71  ? 239 LEU A CD2 1 
ATOM   504  N  N   . PHE A 1 60  ? 101.521 46.907  49.307  1.00 28.52  ? 240 PHE A N   1 
ATOM   505  C  CA  . PHE A 1 60  ? 102.011 48.258  49.048  1.00 29.25  ? 240 PHE A CA  1 
ATOM   506  C  C   . PHE A 1 60  ? 102.011 48.534  47.544  1.00 28.36  ? 240 PHE A C   1 
ATOM   507  O  O   . PHE A 1 60  ? 101.651 49.625  47.099  1.00 27.94  ? 240 PHE A O   1 
ATOM   508  C  CB  . PHE A 1 60  ? 103.433 48.413  49.592  1.00 31.14  ? 240 PHE A CB  1 
ATOM   509  C  CG  . PHE A 1 60  ? 103.984 49.805  49.463  1.00 33.83  ? 240 PHE A CG  1 
ATOM   510  C  CD1 . PHE A 1 60  ? 103.708 50.769  50.434  1.00 34.56  ? 240 PHE A CD1 1 
ATOM   511  C  CD2 . PHE A 1 60  ? 104.779 50.155  48.373  1.00 34.13  ? 240 PHE A CD2 1 
ATOM   512  C  CE1 . PHE A 1 60  ? 104.224 52.069  50.322  1.00 36.15  ? 240 PHE A CE1 1 
ATOM   513  C  CE2 . PHE A 1 60  ? 105.297 51.445  48.246  1.00 35.73  ? 240 PHE A CE2 1 
ATOM   514  C  CZ  . PHE A 1 60  ? 105.022 52.405  49.223  1.00 35.40  ? 240 PHE A CZ  1 
ATOM   515  N  N   . CYS A 1 61  ? 102.426 47.540  46.762  1.00 28.11  ? 241 CYS A N   1 
ATOM   516  C  CA  . CYS A 1 61  ? 102.465 47.685  45.311  1.00 27.62  ? 241 CYS A CA  1 
ATOM   517  C  C   . CYS A 1 61  ? 101.037 47.734  44.766  1.00 27.48  ? 241 CYS A C   1 
ATOM   518  O  O   . CYS A 1 61  ? 100.749 48.450  43.807  1.00 27.80  ? 241 CYS A O   1 
ATOM   519  C  CB  . CYS A 1 61  ? 103.224 46.523  44.672  1.00 28.20  ? 241 CYS A CB  1 
ATOM   520  S  SG  . CYS A 1 61  ? 103.412 46.681  42.868  1.00 32.21  ? 241 CYS A SG  1 
ATOM   521  N  N   . VAL A 1 62  ? 100.143 46.967  45.374  1.00 26.46  ? 242 VAL A N   1 
ATOM   522  C  CA  . VAL A 1 62  ? 98.757  46.967  44.945  1.00 26.87  ? 242 VAL A CA  1 
ATOM   523  C  C   . VAL A 1 62  ? 98.197  48.372  45.164  1.00 27.66  ? 242 VAL A C   1 
ATOM   524  O  O   . VAL A 1 62  ? 97.538  48.934  44.290  1.00 25.81  ? 242 VAL A O   1 
ATOM   525  C  CB  . VAL A 1 62  ? 97.928  45.952  45.756  1.00 26.06  ? 242 VAL A CB  1 
ATOM   526  C  CG1 . VAL A 1 62  ? 96.443  46.179  45.517  1.00 24.59  ? 242 VAL A CG1 1 
ATOM   527  C  CG2 . VAL A 1 62  ? 98.329  44.535  45.363  1.00 25.91  ? 242 VAL A CG2 1 
ATOM   528  N  N   . HIS A 1 63  ? 98.472  48.929  46.340  1.00 28.85  ? 243 HIS A N   1 
ATOM   529  C  CA  . HIS A 1 63  ? 98.011  50.265  46.691  1.00 30.78  ? 243 HIS A CA  1 
ATOM   530  C  C   . HIS A 1 63  ? 98.526  51.298  45.693  1.00 31.21  ? 243 HIS A C   1 
ATOM   531  O  O   . HIS A 1 63  ? 97.774  52.146  45.211  1.00 31.06  ? 243 HIS A O   1 
ATOM   532  C  CB  . HIS A 1 63  ? 98.473  50.627  48.110  1.00 32.88  ? 243 HIS A CB  1 
ATOM   533  C  CG  . HIS A 1 63  ? 98.442  52.096  48.397  1.00 34.68  ? 243 HIS A CG  1 
ATOM   534  N  ND1 . HIS A 1 63  ? 99.494  52.934  48.095  1.00 35.88  ? 243 HIS A ND1 1 
ATOM   535  C  CD2 . HIS A 1 63  ? 97.461  52.887  48.896  1.00 35.53  ? 243 HIS A CD2 1 
ATOM   536  C  CE1 . HIS A 1 63  ? 99.163  54.178  48.393  1.00 36.03  ? 243 HIS A CE1 1 
ATOM   537  N  NE2 . HIS A 1 63  ? 97.934  54.177  48.880  1.00 36.38  ? 243 HIS A NE2 1 
ATOM   538  N  N   . ASP A 1 64  ? 99.810  51.219  45.379  1.00 31.82  ? 244 ASP A N   1 
ATOM   539  C  CA  . ASP A 1 64  ? 100.411 52.155  44.440  1.00 32.46  ? 244 ASP A CA  1 
ATOM   540  C  C   . ASP A 1 64  ? 99.754  52.096  43.055  1.00 32.34  ? 244 ASP A C   1 
ATOM   541  O  O   . ASP A 1 64  ? 99.765  53.078  42.311  1.00 32.18  ? 244 ASP A O   1 
ATOM   542  C  CB  . ASP A 1 64  ? 101.903 51.867  44.312  1.00 33.71  ? 244 ASP A CB  1 
ATOM   543  C  CG  . ASP A 1 64  ? 102.599 52.836  43.386  1.00 35.86  ? 244 ASP A CG  1 
ATOM   544  O  OD1 . ASP A 1 64  ? 102.589 54.049  43.686  1.00 37.02  ? 244 ASP A OD1 1 
ATOM   545  O  OD2 . ASP A 1 64  ? 103.151 52.387  42.357  1.00 37.26  ? 244 ASP A OD2 1 
ATOM   546  N  N   . ASN A 1 65  ? 99.165  50.953  42.714  1.00 31.79  ? 245 ASN A N   1 
ATOM   547  C  CA  . ASN A 1 65  ? 98.538  50.811  41.407  1.00 30.43  ? 245 ASN A CA  1 
ATOM   548  C  C   . ASN A 1 65  ? 97.051  51.119  41.341  1.00 29.95  ? 245 ASN A C   1 
ATOM   549  O  O   . ASN A 1 65  ? 96.402  50.876  40.328  1.00 29.86  ? 245 ASN A O   1 
ATOM   550  C  CB  . ASN A 1 65  ? 98.840  49.428  40.847  1.00 30.38  ? 245 ASN A CB  1 
ATOM   551  C  CG  . ASN A 1 65  ? 100.235 49.352  40.265  1.00 30.69  ? 245 ASN A CG  1 
ATOM   552  O  OD1 . ASN A 1 65  ? 100.478 49.822  39.156  1.00 33.00  ? 245 ASN A OD1 1 
ATOM   553  N  ND2 . ASN A 1 65  ? 101.166 48.789  41.021  1.00 29.83  ? 245 ASN A ND2 1 
ATOM   554  N  N   . TYR A 1 66  ? 96.507  51.643  42.430  1.00 29.54  ? 246 TYR A N   1 
ATOM   555  C  CA  . TYR A 1 66  ? 95.112  52.048  42.432  1.00 30.57  ? 246 TYR A CA  1 
ATOM   556  C  C   . TYR A 1 66  ? 95.185  53.548  42.178  1.00 31.63  ? 246 TYR A C   1 
ATOM   557  O  O   . TYR A 1 66  ? 96.079  54.214  42.690  1.00 31.64  ? 246 TYR A O   1 
ATOM   558  C  CB  . TYR A 1 66  ? 94.443  51.760  43.785  1.00 29.03  ? 246 TYR A CB  1 
ATOM   559  C  CG  . TYR A 1 66  ? 93.646  50.476  43.791  1.00 27.32  ? 246 TYR A CG  1 
ATOM   560  C  CD1 . TYR A 1 66  ? 94.262  49.250  44.051  1.00 26.30  ? 246 TYR A CD1 1 
ATOM   561  C  CD2 . TYR A 1 66  ? 92.296  50.477  43.442  1.00 26.08  ? 246 TYR A CD2 1 
ATOM   562  C  CE1 . TYR A 1 66  ? 93.556  48.057  43.954  1.00 25.88  ? 246 TYR A CE1 1 
ATOM   563  C  CE2 . TYR A 1 66  ? 91.578  49.290  43.341  1.00 26.41  ? 246 TYR A CE2 1 
ATOM   564  C  CZ  . TYR A 1 66  ? 92.217  48.080  43.592  1.00 26.09  ? 246 TYR A CZ  1 
ATOM   565  O  OH  . TYR A 1 66  ? 91.529  46.900  43.428  1.00 25.50  ? 246 TYR A OH  1 
ATOM   566  N  N   . ARG A 1 67  ? 94.279  54.084  41.370  1.00 33.95  ? 247 ARG A N   1 
ATOM   567  C  CA  . ARG A 1 67  ? 94.309  55.518  41.090  1.00 35.73  ? 247 ARG A CA  1 
ATOM   568  C  C   . ARG A 1 67  ? 93.454  56.301  42.077  1.00 36.49  ? 247 ARG A C   1 
ATOM   569  O  O   . ARG A 1 67  ? 92.575  55.745  42.736  1.00 36.72  ? 247 ARG A O   1 
ATOM   570  C  CB  . ARG A 1 67  ? 93.832  55.803  39.666  1.00 36.85  ? 247 ARG A CB  1 
ATOM   571  C  CG  . ARG A 1 67  ? 94.684  55.184  38.578  1.00 38.84  ? 247 ARG A CG  1 
ATOM   572  C  CD  . ARG A 1 67  ? 94.376  55.842  37.242  1.00 41.83  ? 247 ARG A CD  1 
ATOM   573  N  NE  . ARG A 1 67  ? 94.680  54.965  36.118  1.00 45.08  ? 247 ARG A NE  1 
ATOM   574  C  CZ  . ARG A 1 67  ? 94.527  55.305  34.842  1.00 46.99  ? 247 ARG A CZ  1 
ATOM   575  N  NH1 . ARG A 1 67  ? 94.075  56.512  34.525  1.00 47.41  ? 247 ARG A NH1 1 
ATOM   576  N  NH2 . ARG A 1 67  ? 94.814  54.435  33.880  1.00 47.79  ? 247 ARG A NH2 1 
ATOM   577  N  N   . ASN A 1 68  ? 93.712  57.598  42.172  1.00 37.41  ? 248 ASN A N   1 
ATOM   578  C  CA  . ASN A 1 68  ? 92.966  58.444  43.091  1.00 37.90  ? 248 ASN A CA  1 
ATOM   579  C  C   . ASN A 1 68  ? 91.672  58.963  42.500  1.00 36.13  ? 248 ASN A C   1 
ATOM   580  O  O   . ASN A 1 68  ? 91.466  60.171  42.393  1.00 36.48  ? 248 ASN A O   1 
ATOM   581  C  CB  . ASN A 1 68  ? 93.834  59.613  43.553  1.00 41.22  ? 248 ASN A CB  1 
ATOM   582  C  CG  . ASN A 1 68  ? 95.021  59.153  44.376  1.00 45.29  ? 248 ASN A CG  1 
ATOM   583  O  OD1 . ASN A 1 68  ? 94.867  58.369  45.317  1.00 47.82  ? 248 ASN A OD1 1 
ATOM   584  N  ND2 . ASN A 1 68  ? 96.212  59.638  44.032  1.00 47.18  ? 248 ASN A ND2 1 
ATOM   585  N  N   . ASN A 1 69  ? 90.805  58.038  42.110  1.00 33.73  ? 249 ASN A N   1 
ATOM   586  C  CA  . ASN A 1 69  ? 89.515  58.398  41.553  1.00 31.34  ? 249 ASN A CA  1 
ATOM   587  C  C   . ASN A 1 69  ? 88.610  58.719  42.725  1.00 29.91  ? 249 ASN A C   1 
ATOM   588  O  O   . ASN A 1 69  ? 88.918  58.382  43.865  1.00 28.73  ? 249 ASN A O   1 
ATOM   589  C  CB  . ASN A 1 69  ? 88.923  57.231  40.763  1.00 31.85  ? 249 ASN A CB  1 
ATOM   590  C  CG  . ASN A 1 69  ? 89.729  56.896  39.527  1.00 32.46  ? 249 ASN A CG  1 
ATOM   591  O  OD1 . ASN A 1 69  ? 89.986  57.760  38.691  1.00 32.98  ? 249 ASN A OD1 1 
ATOM   592  N  ND2 . ASN A 1 69  ? 90.128  55.633  39.399  1.00 32.01  ? 249 ASN A ND2 1 
ATOM   593  N  N   . PRO A 1 70  ? 87.489  59.399  42.468  1.00 29.57  ? 250 PRO A N   1 
ATOM   594  C  CA  . PRO A 1 70  ? 86.644  59.678  43.628  1.00 29.68  ? 250 PRO A CA  1 
ATOM   595  C  C   . PRO A 1 70  ? 85.978  58.429  44.216  1.00 30.12  ? 250 PRO A C   1 
ATOM   596  O  O   . PRO A 1 70  ? 85.732  58.378  45.420  1.00 31.11  ? 250 PRO A O   1 
ATOM   597  C  CB  . PRO A 1 70  ? 85.643  60.712  43.100  1.00 29.24  ? 250 PRO A CB  1 
ATOM   598  C  CG  . PRO A 1 70  ? 85.712  60.591  41.615  1.00 30.52  ? 250 PRO A CG  1 
ATOM   599  C  CD  . PRO A 1 70  ? 87.145  60.270  41.333  1.00 29.22  ? 250 PRO A CD  1 
ATOM   600  N  N   . PHE A 1 71  ? 85.712  57.421  43.381  1.00 28.39  ? 251 PHE A N   1 
ATOM   601  C  CA  . PHE A 1 71  ? 85.075  56.186  43.850  1.00 27.33  ? 251 PHE A CA  1 
ATOM   602  C  C   . PHE A 1 71  ? 85.956  54.939  43.677  1.00 27.52  ? 251 PHE A C   1 
ATOM   603  O  O   . PHE A 1 71  ? 86.257  54.241  44.650  1.00 26.96  ? 251 PHE A O   1 
ATOM   604  C  CB  . PHE A 1 71  ? 83.743  55.952  43.124  1.00 26.13  ? 251 PHE A CB  1 
ATOM   605  C  CG  . PHE A 1 71  ? 82.944  54.787  43.667  1.00 26.43  ? 251 PHE A CG  1 
ATOM   606  C  CD1 . PHE A 1 71  ? 81.933  54.990  44.603  1.00 25.90  ? 251 PHE A CD1 1 
ATOM   607  C  CD2 . PHE A 1 71  ? 83.203  53.482  43.240  1.00 27.14  ? 251 PHE A CD2 1 
ATOM   608  C  CE1 . PHE A 1 71  ? 81.186  53.912  45.106  1.00 25.93  ? 251 PHE A CE1 1 
ATOM   609  C  CE2 . PHE A 1 71  ? 82.462  52.394  43.740  1.00 25.82  ? 251 PHE A CE2 1 
ATOM   610  C  CZ  . PHE A 1 71  ? 81.453  52.613  44.674  1.00 25.21  ? 251 PHE A CZ  1 
ATOM   611  N  N   . HIS A 1 72  ? 86.364  54.657  42.440  1.00 26.93  ? 252 HIS A N   1 
ATOM   612  C  CA  . HIS A 1 72  ? 87.187  53.480  42.174  1.00 26.03  ? 252 HIS A CA  1 
ATOM   613  C  C   . HIS A 1 72  ? 88.644  53.693  42.539  1.00 26.24  ? 252 HIS A C   1 
ATOM   614  O  O   . HIS A 1 72  ? 89.525  53.812  41.683  1.00 24.23  ? 252 HIS A O   1 
ATOM   615  C  CB  . HIS A 1 72  ? 87.031  53.043  40.715  1.00 25.29  ? 252 HIS A CB  1 
ATOM   616  C  CG  . HIS A 1 72  ? 85.647  52.574  40.390  1.00 25.50  ? 252 HIS A CG  1 
ATOM   617  N  ND1 . HIS A 1 72  ? 84.683  53.405  39.861  1.00 24.56  ? 252 HIS A ND1 1 
ATOM   618  C  CD2 . HIS A 1 72  ? 85.035  51.387  40.615  1.00 24.64  ? 252 HIS A CD2 1 
ATOM   619  C  CE1 . HIS A 1 72  ? 83.537  52.754  39.779  1.00 23.43  ? 252 HIS A CE1 1 
ATOM   620  N  NE2 . HIS A 1 72  ? 83.722  51.527  40.232  1.00 24.51  ? 252 HIS A NE2 1 
ATOM   621  N  N   . ASN A 1 73  ? 88.873  53.720  43.845  1.00 26.98  ? 253 ASN A N   1 
ATOM   622  C  CA  . ASN A 1 73  ? 90.193  53.937  44.405  1.00 28.33  ? 253 ASN A CA  1 
ATOM   623  C  C   . ASN A 1 73  ? 90.546  52.837  45.398  1.00 28.05  ? 253 ASN A C   1 
ATOM   624  O  O   . ASN A 1 73  ? 89.794  51.883  45.593  1.00 28.43  ? 253 ASN A O   1 
ATOM   625  C  CB  . ASN A 1 73  ? 90.222  55.296  45.110  1.00 28.75  ? 253 ASN A CB  1 
ATOM   626  C  CG  . ASN A 1 73  ? 89.009  55.507  46.007  1.00 30.88  ? 253 ASN A CG  1 
ATOM   627  O  OD1 . ASN A 1 73  ? 88.560  54.579  46.688  1.00 31.32  ? 253 ASN A OD1 1 
ATOM   628  N  ND2 . ASN A 1 73  ? 88.481  56.728  46.023  1.00 29.92  ? 253 ASN A ND2 1 
ATOM   629  N  N   . PHE A 1 74  ? 91.699  52.986  46.035  1.00 27.90  ? 254 PHE A N   1 
ATOM   630  C  CA  . PHE A 1 74  ? 92.158  52.013  47.009  1.00 27.40  ? 254 PHE A CA  1 
ATOM   631  C  C   . PHE A 1 74  ? 91.184  51.782  48.169  1.00 26.97  ? 254 PHE A C   1 
ATOM   632  O  O   . PHE A 1 74  ? 91.028  50.651  48.637  1.00 26.80  ? 254 PHE A O   1 
ATOM   633  C  CB  . PHE A 1 74  ? 93.516  52.428  47.577  1.00 27.48  ? 254 PHE A CB  1 
ATOM   634  C  CG  . PHE A 1 74  ? 94.048  51.465  48.594  1.00 28.20  ? 254 PHE A CG  1 
ATOM   635  C  CD1 . PHE A 1 74  ? 94.548  50.229  48.200  1.00 28.10  ? 254 PHE A CD1 1 
ATOM   636  C  CD2 . PHE A 1 74  ? 93.966  51.754  49.953  1.00 28.44  ? 254 PHE A CD2 1 
ATOM   637  C  CE1 . PHE A 1 74  ? 94.955  49.291  49.144  1.00 28.89  ? 254 PHE A CE1 1 
ATOM   638  C  CE2 . PHE A 1 74  ? 94.371  50.822  50.903  1.00 28.12  ? 254 PHE A CE2 1 
ATOM   639  C  CZ  . PHE A 1 74  ? 94.863  49.588  50.497  1.00 28.58  ? 254 PHE A CZ  1 
ATOM   640  N  N   . ARG A 1 75  ? 90.533  52.836  48.647  1.00 26.55  ? 255 ARG A N   1 
ATOM   641  C  CA  . ARG A 1 75  ? 89.604  52.655  49.758  1.00 27.16  ? 255 ARG A CA  1 
ATOM   642  C  C   . ARG A 1 75  ? 88.436  51.767  49.325  1.00 26.35  ? 255 ARG A C   1 
ATOM   643  O  O   . ARG A 1 75  ? 87.895  51.020  50.139  1.00 26.77  ? 255 ARG A O   1 
ATOM   644  C  CB  . ARG A 1 75  ? 89.092  54.004  50.285  1.00 26.65  ? 255 ARG A CB  1 
ATOM   645  C  CG  . ARG A 1 75  ? 88.411  53.910  51.665  1.00 26.54  ? 255 ARG A CG  1 
ATOM   646  C  CD  . ARG A 1 75  ? 87.957  55.288  52.169  1.00 25.81  ? 255 ARG A CD  1 
ATOM   647  N  NE  . ARG A 1 75  ? 89.085  56.200  52.339  1.00 25.42  ? 255 ARG A NE  1 
ATOM   648  C  CZ  . ARG A 1 75  ? 89.823  56.293  53.444  1.00 26.03  ? 255 ARG A CZ  1 
ATOM   649  N  NH1 . ARG A 1 75  ? 89.557  55.534  54.502  1.00 24.34  ? 255 ARG A NH1 1 
ATOM   650  N  NH2 . ARG A 1 75  ? 90.839  57.141  53.486  1.00 25.74  ? 255 ARG A NH2 1 
ATOM   651  N  N   . HIS A 1 76  ? 88.050  51.839  48.050  1.00 25.90  ? 256 HIS A N   1 
ATOM   652  C  CA  . HIS A 1 76  ? 86.962  50.994  47.551  1.00 25.29  ? 256 HIS A CA  1 
ATOM   653  C  C   . HIS A 1 76  ? 87.425  49.544  47.601  1.00 24.49  ? 256 HIS A C   1 
ATOM   654  O  O   . HIS A 1 76  ? 86.680  48.661  48.011  1.00 24.63  ? 256 HIS A O   1 
ATOM   655  C  CB  . HIS A 1 76  ? 86.584  51.346  46.108  1.00 24.58  ? 256 HIS A CB  1 
ATOM   656  C  CG  . HIS A 1 76  ? 85.745  50.300  45.423  1.00 26.47  ? 256 HIS A CG  1 
ATOM   657  N  ND1 . HIS A 1 76  ? 84.482  49.947  45.853  1.00 26.56  ? 256 HIS A ND1 1 
ATOM   658  C  CD2 . HIS A 1 76  ? 85.987  49.541  44.323  1.00 26.63  ? 256 HIS A CD2 1 
ATOM   659  C  CE1 . HIS A 1 76  ? 83.984  49.023  45.048  1.00 26.06  ? 256 HIS A CE1 1 
ATOM   660  N  NE2 . HIS A 1 76  ? 84.876  48.758  44.109  1.00 28.96  ? 256 HIS A NE2 1 
ATOM   661  N  N   . CYS A 1 77  ? 88.664  49.299  47.192  1.00 24.56  ? 257 CYS A N   1 
ATOM   662  C  CA  . CYS A 1 77  ? 89.176  47.935  47.199  1.00 25.81  ? 257 CYS A CA  1 
ATOM   663  C  C   . CYS A 1 77  ? 89.277  47.417  48.634  1.00 26.42  ? 257 CYS A C   1 
ATOM   664  O  O   . CYS A 1 77  ? 89.084  46.226  48.887  1.00 27.52  ? 257 CYS A O   1 
ATOM   665  C  CB  . CYS A 1 77  ? 90.525  47.868  46.459  1.00 26.02  ? 257 CYS A CB  1 
ATOM   666  S  SG  . CYS A 1 77  ? 92.011  47.535  47.422  1.00 23.68  ? 257 CYS A SG  1 
ATOM   667  N  N   . PHE A 1 78  ? 89.554  48.309  49.581  1.00 26.75  ? 258 PHE A N   1 
ATOM   668  C  CA  . PHE A 1 78  ? 89.633  47.898  50.978  1.00 25.54  ? 258 PHE A CA  1 
ATOM   669  C  C   . PHE A 1 78  ? 88.227  47.497  51.440  1.00 24.98  ? 258 PHE A C   1 
ATOM   670  O  O   . PHE A 1 78  ? 88.060  46.528  52.174  1.00 25.30  ? 258 PHE A O   1 
ATOM   671  C  CB  . PHE A 1 78  ? 90.185  49.034  51.853  1.00 25.02  ? 258 PHE A CB  1 
ATOM   672  C  CG  . PHE A 1 78  ? 90.106  48.751  53.330  1.00 25.40  ? 258 PHE A CG  1 
ATOM   673  C  CD1 . PHE A 1 78  ? 89.128  49.357  54.119  1.00 26.06  ? 258 PHE A CD1 1 
ATOM   674  C  CD2 . PHE A 1 78  ? 90.984  47.849  53.930  1.00 24.50  ? 258 PHE A CD2 1 
ATOM   675  C  CE1 . PHE A 1 78  ? 89.024  49.069  55.487  1.00 25.34  ? 258 PHE A CE1 1 
ATOM   676  C  CE2 . PHE A 1 78  ? 90.888  47.551  55.296  1.00 25.70  ? 258 PHE A CE2 1 
ATOM   677  C  CZ  . PHE A 1 78  ? 89.907  48.162  56.076  1.00 24.09  ? 258 PHE A CZ  1 
ATOM   678  N  N   . CYS A 1 79  ? 87.221  48.235  50.984  1.00 24.52  ? 259 CYS A N   1 
ATOM   679  C  CA  . CYS A 1 79  ? 85.828  47.951  51.328  1.00 24.81  ? 259 CYS A CA  1 
ATOM   680  C  C   . CYS A 1 79  ? 85.371  46.591  50.807  1.00 24.80  ? 259 CYS A C   1 
ATOM   681  O  O   . CYS A 1 79  ? 84.678  45.842  51.506  1.00 24.71  ? 259 CYS A O   1 
ATOM   682  C  CB  . CYS A 1 79  ? 84.902  49.016  50.738  1.00 25.48  ? 259 CYS A CB  1 
ATOM   683  S  SG  . CYS A 1 79  ? 84.982  50.627  51.540  1.00 26.28  ? 259 CYS A SG  1 
ATOM   684  N  N   . VAL A 1 80  ? 85.734  46.293  49.562  1.00 23.53  ? 260 VAL A N   1 
ATOM   685  C  CA  . VAL A 1 80  ? 85.361  45.034  48.943  1.00 22.31  ? 260 VAL A CA  1 
ATOM   686  C  C   . VAL A 1 80  ? 86.043  43.885  49.696  1.00 22.66  ? 260 VAL A C   1 
ATOM   687  O  O   . VAL A 1 80  ? 85.396  42.909  50.056  1.00 22.17  ? 260 VAL A O   1 
ATOM   688  C  CB  . VAL A 1 80  ? 85.762  45.017  47.455  1.00 21.12  ? 260 VAL A CB  1 
ATOM   689  C  CG1 . VAL A 1 80  ? 85.317  43.710  46.801  1.00 19.59  ? 260 VAL A CG1 1 
ATOM   690  C  CG2 . VAL A 1 80  ? 85.117  46.203  46.746  1.00 20.49  ? 260 VAL A CG2 1 
ATOM   691  N  N   . ALA A 1 81  ? 87.340  44.023  49.955  1.00 21.79  ? 261 ALA A N   1 
ATOM   692  C  CA  . ALA A 1 81  ? 88.092  43.001  50.674  1.00 22.32  ? 261 ALA A CA  1 
ATOM   693  C  C   . ALA A 1 81  ? 87.593  42.833  52.118  1.00 23.05  ? 261 ALA A C   1 
ATOM   694  O  O   . ALA A 1 81  ? 87.436  41.716  52.611  1.00 22.97  ? 261 ALA A O   1 
ATOM   695  C  CB  . ALA A 1 81  ? 89.584  43.352  50.669  1.00 21.16  ? 261 ALA A CB  1 
ATOM   696  N  N   . GLN A 1 82  ? 87.338  43.947  52.793  1.00 23.79  ? 262 GLN A N   1 
ATOM   697  C  CA  . GLN A 1 82  ? 86.864  43.907  54.173  1.00 23.45  ? 262 GLN A CA  1 
ATOM   698  C  C   . GLN A 1 82  ? 85.457  43.304  54.294  1.00 23.45  ? 262 GLN A C   1 
ATOM   699  O  O   . GLN A 1 82  ? 85.128  42.673  55.300  1.00 22.15  ? 262 GLN A O   1 
ATOM   700  C  CB  . GLN A 1 82  ? 86.905  45.317  54.768  1.00 22.63  ? 262 GLN A CB  1 
ATOM   701  C  CG  . GLN A 1 82  ? 86.686  45.388  56.269  1.00 23.45  ? 262 GLN A CG  1 
ATOM   702  C  CD  . GLN A 1 82  ? 85.218  45.418  56.653  1.00 24.81  ? 262 GLN A CD  1 
ATOM   703  O  OE1 . GLN A 1 82  ? 84.390  46.021  55.959  1.00 26.13  ? 262 GLN A OE1 1 
ATOM   704  N  NE2 . GLN A 1 82  ? 84.887  44.788  57.775  1.00 24.76  ? 262 GLN A NE2 1 
ATOM   705  N  N   . MET A 1 83  ? 84.624  43.495  53.279  1.00 23.10  ? 263 MET A N   1 
ATOM   706  C  CA  . MET A 1 83  ? 83.275  42.928  53.313  1.00 24.01  ? 263 MET A CA  1 
ATOM   707  C  C   . MET A 1 83  ? 83.377  41.422  53.031  1.00 24.69  ? 263 MET A C   1 
ATOM   708  O  O   . MET A 1 83  ? 82.597  40.621  53.563  1.00 23.45  ? 263 MET A O   1 
ATOM   709  C  CB  . MET A 1 83  ? 82.381  43.599  52.267  1.00 24.02  ? 263 MET A CB  1 
ATOM   710  C  CG  . MET A 1 83  ? 80.936  43.123  52.281  1.00 25.75  ? 263 MET A CG  1 
ATOM   711  S  SD  . MET A 1 83  ? 80.114  43.476  53.856  1.00 28.92  ? 263 MET A SD  1 
ATOM   712  C  CE  . MET A 1 83  ? 79.991  45.302  53.788  1.00 28.49  ? 263 MET A CE  1 
ATOM   713  N  N   . MET A 1 84  ? 84.344  41.045  52.195  1.00 24.69  ? 264 MET A N   1 
ATOM   714  C  CA  . MET A 1 84  ? 84.560  39.634  51.867  1.00 26.75  ? 264 MET A CA  1 
ATOM   715  C  C   . MET A 1 84  ? 84.997  38.939  53.152  1.00 26.99  ? 264 MET A C   1 
ATOM   716  O  O   . MET A 1 84  ? 84.509  37.860  53.498  1.00 27.58  ? 264 MET A O   1 
ATOM   717  C  CB  . MET A 1 84  ? 85.651  39.490  50.802  1.00 25.83  ? 264 MET A CB  1 
ATOM   718  C  CG  . MET A 1 84  ? 85.950  38.050  50.382  1.00 24.68  ? 264 MET A CG  1 
ATOM   719  S  SD  . MET A 1 84  ? 84.560  37.213  49.576  1.00 27.33  ? 264 MET A SD  1 
ATOM   720  C  CE  . MET A 1 84  ? 84.572  37.982  47.951  1.00 24.94  ? 264 MET A CE  1 
ATOM   721  N  N   . TYR A 1 85  ? 85.925  39.585  53.849  1.00 26.94  ? 265 TYR A N   1 
ATOM   722  C  CA  . TYR A 1 85  ? 86.456  39.104  55.114  1.00 26.70  ? 265 TYR A CA  1 
ATOM   723  C  C   . TYR A 1 85  ? 85.304  38.939  56.106  1.00 27.16  ? 265 TYR A C   1 
ATOM   724  O  O   . TYR A 1 85  ? 85.256  37.965  56.860  1.00 27.62  ? 265 TYR A O   1 
ATOM   725  C  CB  . TYR A 1 85  ? 87.473  40.121  55.646  1.00 26.34  ? 265 TYR A CB  1 
ATOM   726  C  CG  . TYR A 1 85  ? 88.110  39.777  56.973  1.00 26.31  ? 265 TYR A CG  1 
ATOM   727  C  CD1 . TYR A 1 85  ? 88.891  38.630  57.119  1.00 25.59  ? 265 TYR A CD1 1 
ATOM   728  C  CD2 . TYR A 1 85  ? 87.990  40.638  58.065  1.00 25.86  ? 265 TYR A CD2 1 
ATOM   729  C  CE1 . TYR A 1 85  ? 89.542  38.355  58.312  1.00 25.01  ? 265 TYR A CE1 1 
ATOM   730  C  CE2 . TYR A 1 85  ? 88.635  40.371  59.262  1.00 26.25  ? 265 TYR A CE2 1 
ATOM   731  C  CZ  . TYR A 1 85  ? 89.413  39.230  59.378  1.00 25.83  ? 265 TYR A CZ  1 
ATOM   732  O  OH  . TYR A 1 85  ? 90.077  38.975  60.554  1.00 25.91  ? 265 TYR A OH  1 
ATOM   733  N  N   . SER A 1 86  ? 84.376  39.891  56.090  1.00 26.55  ? 266 SER A N   1 
ATOM   734  C  CA  . SER A 1 86  ? 83.219  39.860  56.979  1.00 28.29  ? 266 SER A CA  1 
ATOM   735  C  C   . SER A 1 86  ? 82.302  38.697  56.643  1.00 28.50  ? 266 SER A C   1 
ATOM   736  O  O   . SER A 1 86  ? 81.787  38.024  57.531  1.00 29.94  ? 266 SER A O   1 
ATOM   737  C  CB  . SER A 1 86  ? 82.415  41.160  56.869  1.00 27.15  ? 266 SER A CB  1 
ATOM   738  O  OG  . SER A 1 86  ? 83.179  42.272  57.295  1.00 29.62  ? 266 SER A OG  1 
ATOM   739  N  N   . MET A 1 87  ? 82.093  38.476  55.352  1.00 29.50  ? 267 MET A N   1 
ATOM   740  C  CA  . MET A 1 87  ? 81.220  37.406  54.904  1.00 30.90  ? 267 MET A CA  1 
ATOM   741  C  C   . MET A 1 87  ? 81.783  36.031  55.201  1.00 30.73  ? 267 MET A C   1 
ATOM   742  O  O   . MET A 1 87  ? 81.028  35.086  55.420  1.00 31.31  ? 267 MET A O   1 
ATOM   743  C  CB  . MET A 1 87  ? 80.946  37.550  53.415  1.00 32.24  ? 267 MET A CB  1 
ATOM   744  C  CG  . MET A 1 87  ? 80.146  38.784  53.101  1.00 36.05  ? 267 MET A CG  1 
ATOM   745  S  SD  . MET A 1 87  ? 78.990  38.435  51.812  1.00 43.16  ? 267 MET A SD  1 
ATOM   746  C  CE  . MET A 1 87  ? 77.777  37.533  52.756  1.00 39.28  ? 267 MET A CE  1 
ATOM   747  N  N   . VAL A 1 88  ? 83.107  35.921  55.204  1.00 30.49  ? 268 VAL A N   1 
ATOM   748  C  CA  . VAL A 1 88  ? 83.761  34.659  55.505  1.00 30.29  ? 268 VAL A CA  1 
ATOM   749  C  C   . VAL A 1 88  ? 83.349  34.242  56.914  1.00 32.14  ? 268 VAL A C   1 
ATOM   750  O  O   . VAL A 1 88  ? 83.010  33.080  57.153  1.00 31.97  ? 268 VAL A O   1 
ATOM   751  C  CB  . VAL A 1 88  ? 85.304  34.791  55.432  1.00 27.98  ? 268 VAL A CB  1 
ATOM   752  C  CG1 . VAL A 1 88  ? 85.965  33.637  56.156  1.00 25.80  ? 268 VAL A CG1 1 
ATOM   753  C  CG2 . VAL A 1 88  ? 85.753  34.809  53.981  1.00 24.97  ? 268 VAL A CG2 1 
ATOM   754  N  N   . TRP A 1 89  ? 83.363  35.202  57.837  1.00 33.48  ? 269 TRP A N   1 
ATOM   755  C  CA  . TRP A 1 89  ? 82.991  34.948  59.229  1.00 35.01  ? 269 TRP A CA  1 
ATOM   756  C  C   . TRP A 1 89  ? 81.481  34.832  59.390  1.00 35.34  ? 269 TRP A C   1 
ATOM   757  O  O   . TRP A 1 89  ? 80.980  33.885  60.003  1.00 36.66  ? 269 TRP A O   1 
ATOM   758  C  CB  . TRP A 1 89  ? 83.519  36.068  60.130  1.00 35.43  ? 269 TRP A CB  1 
ATOM   759  C  CG  . TRP A 1 89  ? 85.013  36.176  60.100  1.00 37.74  ? 269 TRP A CG  1 
ATOM   760  C  CD1 . TRP A 1 89  ? 85.748  37.288  59.821  1.00 37.41  ? 269 TRP A CD1 1 
ATOM   761  C  CD2 . TRP A 1 89  ? 85.955  35.115  60.318  1.00 39.44  ? 269 TRP A CD2 1 
ATOM   762  N  NE1 . TRP A 1 89  ? 87.090  36.990  59.845  1.00 38.72  ? 269 TRP A NE1 1 
ATOM   763  C  CE2 . TRP A 1 89  ? 87.248  35.664  60.148  1.00 39.23  ? 269 TRP A CE2 1 
ATOM   764  C  CE3 . TRP A 1 89  ? 85.834  33.754  60.639  1.00 40.18  ? 269 TRP A CE3 1 
ATOM   765  C  CZ2 . TRP A 1 89  ? 88.414  34.901  60.288  1.00 40.68  ? 269 TRP A CZ2 1 
ATOM   766  C  CZ3 . TRP A 1 89  ? 86.994  32.991  60.780  1.00 41.32  ? 269 TRP A CZ3 1 
ATOM   767  C  CH2 . TRP A 1 89  ? 88.269  33.570  60.603  1.00 41.53  ? 269 TRP A CH2 1 
ATOM   768  N  N   . LEU A 1 90  ? 80.756  35.794  58.839  1.00 34.20  ? 270 LEU A N   1 
ATOM   769  C  CA  . LEU A 1 90  ? 79.309  35.777  58.936  1.00 34.06  ? 270 LEU A CA  1 
ATOM   770  C  C   . LEU A 1 90  ? 78.709  34.475  58.407  1.00 34.70  ? 270 LEU A C   1 
ATOM   771  O  O   . LEU A 1 90  ? 77.872  33.858  59.070  1.00 34.51  ? 270 LEU A O   1 
ATOM   772  C  CB  . LEU A 1 90  ? 78.715  36.955  58.165  1.00 34.24  ? 270 LEU A CB  1 
ATOM   773  C  CG  . LEU A 1 90  ? 77.192  36.917  57.988  1.00 34.22  ? 270 LEU A CG  1 
ATOM   774  C  CD1 . LEU A 1 90  ? 76.509  36.996  59.346  1.00 34.12  ? 270 LEU A CD1 1 
ATOM   775  C  CD2 . LEU A 1 90  ? 76.755  38.060  57.087  1.00 34.23  ? 270 LEU A CD2 1 
ATOM   776  N  N   . CYS A 1 91  ? 79.142  34.066  57.216  1.00 33.93  ? 271 CYS A N   1 
ATOM   777  C  CA  . CYS A 1 91  ? 78.629  32.862  56.577  1.00 34.78  ? 271 CYS A CA  1 
ATOM   778  C  C   . CYS A 1 91  ? 79.450  31.592  56.830  1.00 35.05  ? 271 CYS A C   1 
ATOM   779  O  O   . CYS A 1 91  ? 79.192  30.562  56.210  1.00 34.63  ? 271 CYS A O   1 
ATOM   780  C  CB  . CYS A 1 91  ? 78.520  33.086  55.065  1.00 35.15  ? 271 CYS A CB  1 
ATOM   781  S  SG  . CYS A 1 91  ? 77.618  34.583  54.558  1.00 36.99  ? 271 CYS A SG  1 
ATOM   782  N  N   . SER A 1 92  ? 80.427  31.659  57.730  1.00 34.86  ? 272 SER A N   1 
ATOM   783  C  CA  . SER A 1 92  ? 81.261  30.497  58.034  1.00 35.60  ? 272 SER A CA  1 
ATOM   784  C  C   . SER A 1 92  ? 81.739  29.827  56.744  1.00 35.54  ? 272 SER A C   1 
ATOM   785  O  O   . SER A 1 92  ? 81.625  28.606  56.573  1.00 35.04  ? 272 SER A O   1 
ATOM   786  C  CB  . SER A 1 92  ? 80.473  29.493  58.887  1.00 35.65  ? 272 SER A CB  1 
ATOM   787  O  OG  . SER A 1 92  ? 80.207  30.025  60.175  1.00 37.20  ? 272 SER A OG  1 
ATOM   788  N  N   . LEU A 1 93  ? 82.283  30.636  55.843  1.00 35.16  ? 273 LEU A N   1 
ATOM   789  C  CA  . LEU A 1 93  ? 82.759  30.144  54.562  1.00 35.27  ? 273 LEU A CA  1 
ATOM   790  C  C   . LEU A 1 93  ? 83.872  29.101  54.633  1.00 36.53  ? 273 LEU A C   1 
ATOM   791  O  O   . LEU A 1 93  ? 84.001  28.282  53.726  1.00 36.33  ? 273 LEU A O   1 
ATOM   792  C  CB  . LEU A 1 93  ? 83.214  31.316  53.692  1.00 33.66  ? 273 LEU A CB  1 
ATOM   793  C  CG  . LEU A 1 93  ? 82.114  32.313  53.324  1.00 33.33  ? 273 LEU A CG  1 
ATOM   794  C  CD1 . LEU A 1 93  ? 82.656  33.315  52.322  1.00 31.26  ? 273 LEU A CD1 1 
ATOM   795  C  CD2 . LEU A 1 93  ? 80.921  31.574  52.741  1.00 31.94  ? 273 LEU A CD2 1 
ATOM   796  N  N   . GLN A 1 94  ? 84.675  29.117  55.693  1.00 37.88  ? 274 GLN A N   1 
ATOM   797  C  CA  . GLN A 1 94  ? 85.764  28.150  55.790  1.00 40.57  ? 274 GLN A CA  1 
ATOM   798  C  C   . GLN A 1 94  ? 85.298  26.715  56.025  1.00 41.30  ? 274 GLN A C   1 
ATOM   799  O  O   . GLN A 1 94  ? 86.106  25.790  56.060  1.00 42.07  ? 274 GLN A O   1 
ATOM   800  C  CB  . GLN A 1 94  ? 86.778  28.595  56.851  1.00 40.72  ? 274 GLN A CB  1 
ATOM   801  C  CG  . GLN A 1 94  ? 87.498  29.872  56.422  1.00 42.78  ? 274 GLN A CG  1 
ATOM   802  C  CD  . GLN A 1 94  ? 88.607  30.306  57.360  1.00 43.60  ? 274 GLN A CD  1 
ATOM   803  O  OE1 . GLN A 1 94  ? 88.373  30.557  58.543  1.00 44.00  ? 274 GLN A OE1 1 
ATOM   804  N  NE2 . GLN A 1 94  ? 89.825  30.410  56.828  1.00 43.39  ? 274 GLN A NE2 1 
ATOM   805  N  N   . GLU A 1 95  ? 83.990  26.532  56.168  1.00 42.23  ? 275 GLU A N   1 
ATOM   806  C  CA  . GLU A 1 95  ? 83.423  25.203  56.350  1.00 43.01  ? 275 GLU A CA  1 
ATOM   807  C  C   . GLU A 1 95  ? 83.028  24.696  54.965  1.00 42.70  ? 275 GLU A C   1 
ATOM   808  O  O   . GLU A 1 95  ? 83.040  23.495  54.701  1.00 43.75  ? 275 GLU A O   1 
ATOM   809  C  CB  . GLU A 1 95  ? 82.160  25.248  57.216  1.00 43.97  ? 275 GLU A CB  1 
ATOM   810  C  CG  . GLU A 1 95  ? 82.313  25.902  58.570  1.00 46.73  ? 275 GLU A CG  1 
ATOM   811  C  CD  . GLU A 1 95  ? 81.009  25.881  59.355  1.00 49.23  ? 275 GLU A CD  1 
ATOM   812  O  OE1 . GLU A 1 95  ? 79.935  25.729  58.722  1.00 49.38  ? 275 GLU A OE1 1 
ATOM   813  O  OE2 . GLU A 1 95  ? 81.054  26.028  60.597  1.00 50.49  ? 275 GLU A OE2 1 
ATOM   814  N  N   . LYS A 1 96  ? 82.680  25.631  54.086  1.00 41.86  ? 276 LYS A N   1 
ATOM   815  C  CA  . LYS A 1 96  ? 82.237  25.308  52.735  1.00 40.77  ? 276 LYS A CA  1 
ATOM   816  C  C   . LYS A 1 96  ? 83.331  25.433  51.677  1.00 39.49  ? 276 LYS A C   1 
ATOM   817  O  O   . LYS A 1 96  ? 83.309  24.730  50.667  1.00 39.89  ? 276 LYS A O   1 
ATOM   818  C  CB  . LYS A 1 96  ? 81.078  26.233  52.340  1.00 43.09  ? 276 LYS A CB  1 
ATOM   819  C  CG  . LYS A 1 96  ? 80.038  26.491  53.433  1.00 44.37  ? 276 LYS A CG  1 
ATOM   820  C  CD  . LYS A 1 96  ? 79.079  25.322  53.607  1.00 46.98  ? 276 LYS A CD  1 
ATOM   821  C  CE  . LYS A 1 96  ? 77.995  25.656  54.633  1.00 48.54  ? 276 LYS A CE  1 
ATOM   822  N  NZ  . LYS A 1 96  ? 76.986  24.564  54.754  1.00 49.13  ? 276 LYS A NZ  1 
ATOM   823  N  N   . PHE A 1 97  ? 84.280  26.335  51.897  1.00 36.72  ? 277 PHE A N   1 
ATOM   824  C  CA  . PHE A 1 97  ? 85.338  26.558  50.922  1.00 34.90  ? 277 PHE A CA  1 
ATOM   825  C  C   . PHE A 1 97  ? 86.717  26.123  51.368  1.00 32.88  ? 277 PHE A C   1 
ATOM   826  O  O   . PHE A 1 97  ? 87.046  26.179  52.553  1.00 32.44  ? 277 PHE A O   1 
ATOM   827  C  CB  . PHE A 1 97  ? 85.403  28.044  50.550  1.00 34.77  ? 277 PHE A CB  1 
ATOM   828  C  CG  . PHE A 1 97  ? 84.251  28.513  49.715  1.00 35.81  ? 277 PHE A CG  1 
ATOM   829  C  CD1 . PHE A 1 97  ? 84.121  28.102  48.391  1.00 36.27  ? 277 PHE A CD1 1 
ATOM   830  C  CD2 . PHE A 1 97  ? 83.299  29.373  50.245  1.00 36.16  ? 277 PHE A CD2 1 
ATOM   831  C  CE1 . PHE A 1 97  ? 83.059  28.546  47.610  1.00 36.57  ? 277 PHE A CE1 1 
ATOM   832  C  CE2 . PHE A 1 97  ? 82.227  29.826  49.471  1.00 35.72  ? 277 PHE A CE2 1 
ATOM   833  C  CZ  . PHE A 1 97  ? 82.107  29.414  48.155  1.00 36.65  ? 277 PHE A CZ  1 
ATOM   834  N  N   . SER A 1 98  ? 87.522  25.704  50.399  1.00 30.93  ? 278 SER A N   1 
ATOM   835  C  CA  . SER A 1 98  ? 88.892  25.301  50.664  1.00 29.82  ? 278 SER A CA  1 
ATOM   836  C  C   . SER A 1 98  ? 89.682  26.585  50.903  1.00 29.58  ? 278 SER A C   1 
ATOM   837  O  O   . SER A 1 98  ? 89.189  27.691  50.638  1.00 28.33  ? 278 SER A O   1 
ATOM   838  C  CB  . SER A 1 98  ? 89.480  24.574  49.455  1.00 29.50  ? 278 SER A CB  1 
ATOM   839  O  OG  . SER A 1 98  ? 89.718  25.474  48.384  1.00 30.16  ? 278 SER A OG  1 
ATOM   840  N  N   . GLN A 1 99  ? 90.906  26.441  51.401  1.00 28.60  ? 279 GLN A N   1 
ATOM   841  C  CA  . GLN A 1 99  ? 91.746  27.594  51.657  1.00 27.27  ? 279 GLN A CA  1 
ATOM   842  C  C   . GLN A 1 99  ? 92.155  28.239  50.336  1.00 27.46  ? 279 GLN A C   1 
ATOM   843  O  O   . GLN A 1 99  ? 92.415  29.438  50.278  1.00 26.43  ? 279 GLN A O   1 
ATOM   844  C  CB  . GLN A 1 99  ? 92.975  27.178  52.462  1.00 28.37  ? 279 GLN A CB  1 
ATOM   845  C  CG  . GLN A 1 99  ? 92.691  26.944  53.952  1.00 28.01  ? 279 GLN A CG  1 
ATOM   846  C  CD  . GLN A 1 99  ? 92.251  28.219  54.665  1.00 27.80  ? 279 GLN A CD  1 
ATOM   847  O  OE1 . GLN A 1 99  ? 91.088  28.622  54.584  1.00 27.82  ? 279 GLN A OE1 1 
ATOM   848  N  NE2 . GLN A 1 99  ? 93.187  28.867  55.355  1.00 24.20  ? 279 GLN A NE2 1 
ATOM   849  N  N   . THR A 1 100 ? 92.205  27.442  49.274  1.00 26.99  ? 280 THR A N   1 
ATOM   850  C  CA  . THR A 1 100 ? 92.561  27.968  47.968  1.00 27.19  ? 280 THR A CA  1 
ATOM   851  C  C   . THR A 1 100 ? 91.432  28.882  47.500  1.00 26.55  ? 280 THR A C   1 
ATOM   852  O  O   . THR A 1 100 ? 91.680  29.952  46.953  1.00 25.40  ? 280 THR A O   1 
ATOM   853  C  CB  . THR A 1 100 ? 92.751  26.851  46.930  1.00 27.93  ? 280 THR A CB  1 
ATOM   854  O  OG1 . THR A 1 100 ? 93.744  25.929  47.393  1.00 28.63  ? 280 THR A OG1 1 
ATOM   855  C  CG2 . THR A 1 100 ? 93.208  27.445  45.597  1.00 28.35  ? 280 THR A CG2 1 
ATOM   856  N  N   . ASP A 1 101 ? 90.191  28.461  47.718  1.00 26.54  ? 281 ASP A N   1 
ATOM   857  C  CA  . ASP A 1 101 ? 89.056  29.280  47.315  1.00 26.91  ? 281 ASP A CA  1 
ATOM   858  C  C   . ASP A 1 101 ? 89.017  30.577  48.121  1.00 26.80  ? 281 ASP A C   1 
ATOM   859  O  O   . ASP A 1 101 ? 88.659  31.631  47.594  1.00 26.74  ? 281 ASP A O   1 
ATOM   860  C  CB  . ASP A 1 101 ? 87.735  28.523  47.484  1.00 27.00  ? 281 ASP A CB  1 
ATOM   861  C  CG  . ASP A 1 101 ? 87.476  27.537  46.349  1.00 29.63  ? 281 ASP A CG  1 
ATOM   862  O  OD1 . ASP A 1 101 ? 87.914  27.802  45.210  1.00 29.65  ? 281 ASP A OD1 1 
ATOM   863  O  OD2 . ASP A 1 101 ? 86.819  26.500  46.592  1.00 32.83  ? 281 ASP A OD2 1 
ATOM   864  N  N   . ILE A 1 102 ? 89.380  30.497  49.399  1.00 25.88  ? 282 ILE A N   1 
ATOM   865  C  CA  . ILE A 1 102 ? 89.392  31.679  50.247  1.00 25.21  ? 282 ILE A CA  1 
ATOM   866  C  C   . ILE A 1 102 ? 90.462  32.624  49.700  1.00 25.15  ? 282 ILE A C   1 
ATOM   867  O  O   . ILE A 1 102 ? 90.226  33.818  49.544  1.00 25.50  ? 282 ILE A O   1 
ATOM   868  C  CB  . ILE A 1 102 ? 89.709  31.319  51.722  1.00 25.07  ? 282 ILE A CB  1 
ATOM   869  C  CG1 . ILE A 1 102 ? 88.616  30.403  52.284  1.00 25.23  ? 282 ILE A CG1 1 
ATOM   870  C  CG2 . ILE A 1 102 ? 89.796  32.581  52.561  1.00 22.96  ? 282 ILE A CG2 1 
ATOM   871  C  CD1 . ILE A 1 102 ? 87.224  31.041  52.318  1.00 24.87  ? 282 ILE A CD1 1 
ATOM   872  N  N   . LEU A 1 103 ? 91.631  32.073  49.395  1.00 23.94  ? 283 LEU A N   1 
ATOM   873  C  CA  . LEU A 1 103 ? 92.729  32.856  48.846  1.00 23.33  ? 283 LEU A CA  1 
ATOM   874  C  C   . LEU A 1 103 ? 92.276  33.570  47.569  1.00 24.16  ? 283 LEU A C   1 
ATOM   875  O  O   . LEU A 1 103 ? 92.564  34.753  47.361  1.00 24.64  ? 283 LEU A O   1 
ATOM   876  C  CB  . LEU A 1 103 ? 93.906  31.936  48.524  1.00 21.67  ? 283 LEU A CB  1 
ATOM   877  C  CG  . LEU A 1 103 ? 95.125  32.624  47.909  1.00 22.67  ? 283 LEU A CG  1 
ATOM   878  C  CD1 . LEU A 1 103 ? 95.701  33.628  48.906  1.00 20.14  ? 283 LEU A CD1 1 
ATOM   879  C  CD2 . LEU A 1 103 ? 96.166  31.574  47.536  1.00 22.02  ? 283 LEU A CD2 1 
ATOM   880  N  N   . ILE A 1 104 ? 91.571  32.838  46.710  1.00 23.63  ? 284 ILE A N   1 
ATOM   881  C  CA  . ILE A 1 104 ? 91.074  33.385  45.455  1.00 22.81  ? 284 ILE A CA  1 
ATOM   882  C  C   . ILE A 1 104 ? 90.088  34.525  45.703  1.00 22.98  ? 284 ILE A C   1 
ATOM   883  O  O   . ILE A 1 104 ? 90.175  35.583  45.071  1.00 22.99  ? 284 ILE A O   1 
ATOM   884  C  CB  . ILE A 1 104 ? 90.389  32.279  44.607  1.00 22.73  ? 284 ILE A CB  1 
ATOM   885  C  CG1 . ILE A 1 104 ? 91.452  31.283  44.116  1.00 22.24  ? 284 ILE A CG1 1 
ATOM   886  C  CG2 . ILE A 1 104 ? 89.612  32.904  43.439  1.00 20.68  ? 284 ILE A CG2 1 
ATOM   887  C  CD1 . ILE A 1 104 ? 90.901  30.082  43.366  1.00 20.64  ? 284 ILE A CD1 1 
ATOM   888  N  N   . LEU A 1 105 ? 89.159  34.307  46.628  1.00 22.64  ? 285 LEU A N   1 
ATOM   889  C  CA  . LEU A 1 105 ? 88.157  35.312  46.952  1.00 22.73  ? 285 LEU A CA  1 
ATOM   890  C  C   . LEU A 1 105 ? 88.780  36.600  47.477  1.00 23.43  ? 285 LEU A C   1 
ATOM   891  O  O   . LEU A 1 105 ? 88.426  37.698  47.034  1.00 22.90  ? 285 LEU A O   1 
ATOM   892  C  CB  . LEU A 1 105 ? 87.172  34.761  47.984  1.00 21.65  ? 285 LEU A CB  1 
ATOM   893  C  CG  . LEU A 1 105 ? 86.183  33.734  47.425  1.00 23.04  ? 285 LEU A CG  1 
ATOM   894  C  CD1 . LEU A 1 105 ? 85.616  32.883  48.544  1.00 21.00  ? 285 LEU A CD1 1 
ATOM   895  C  CD2 . LEU A 1 105 ? 85.069  34.460  46.654  1.00 20.85  ? 285 LEU A CD2 1 
ATOM   896  N  N   . MET A 1 106 ? 89.712  36.464  48.415  1.00 23.15  ? 286 MET A N   1 
ATOM   897  C  CA  . MET A 1 106 ? 90.358  37.626  49.006  1.00 23.10  ? 286 MET A CA  1 
ATOM   898  C  C   . MET A 1 106 ? 91.282  38.360  48.041  1.00 23.49  ? 286 MET A C   1 
ATOM   899  O  O   . MET A 1 106 ? 91.219  39.586  47.936  1.00 24.22  ? 286 MET A O   1 
ATOM   900  C  CB  . MET A 1 106 ? 91.138  37.224  50.264  1.00 23.03  ? 286 MET A CB  1 
ATOM   901  C  CG  . MET A 1 106 ? 90.253  36.810  51.437  1.00 23.17  ? 286 MET A CG  1 
ATOM   902  S  SD  . MET A 1 106 ? 89.137  38.127  52.031  1.00 24.23  ? 286 MET A SD  1 
ATOM   903  C  CE  . MET A 1 106 ? 90.360  39.334  52.625  1.00 23.05  ? 286 MET A CE  1 
ATOM   904  N  N   . THR A 1 107 ? 92.131  37.625  47.331  1.00 21.45  ? 287 THR A N   1 
ATOM   905  C  CA  . THR A 1 107 ? 93.056  38.268  46.414  1.00 21.07  ? 287 THR A CA  1 
ATOM   906  C  C   . THR A 1 107 ? 92.327  38.950  45.264  1.00 21.57  ? 287 THR A C   1 
ATOM   907  O  O   . THR A 1 107 ? 92.712  40.045  44.843  1.00 21.49  ? 287 THR A O   1 
ATOM   908  C  CB  . THR A 1 107 ? 94.085  37.264  45.874  1.00 21.41  ? 287 THR A CB  1 
ATOM   909  O  OG1 . THR A 1 107 ? 94.571  36.462  46.963  1.00 20.81  ? 287 THR A OG1 1 
ATOM   910  C  CG2 . THR A 1 107 ? 95.256  37.999  45.239  1.00 18.53  ? 287 THR A CG2 1 
ATOM   911  N  N   . ALA A 1 108 ? 91.268  38.323  44.763  1.00 21.12  ? 288 ALA A N   1 
ATOM   912  C  CA  . ALA A 1 108 ? 90.504  38.924  43.678  1.00 21.06  ? 288 ALA A CA  1 
ATOM   913  C  C   . ALA A 1 108 ? 89.822  40.196  44.183  1.00 21.27  ? 288 ALA A C   1 
ATOM   914  O  O   . ALA A 1 108 ? 89.769  41.205  43.476  1.00 19.98  ? 288 ALA A O   1 
ATOM   915  C  CB  . ALA A 1 108 ? 89.452  37.946  43.149  1.00 21.64  ? 288 ALA A CB  1 
ATOM   916  N  N   . ALA A 1 109 ? 89.301  40.153  45.407  1.00 20.56  ? 289 ALA A N   1 
ATOM   917  C  CA  . ALA A 1 109 ? 88.621  41.322  45.956  1.00 22.18  ? 289 ALA A CA  1 
ATOM   918  C  C   . ALA A 1 109 ? 89.579  42.506  46.063  1.00 22.99  ? 289 ALA A C   1 
ATOM   919  O  O   . ALA A 1 109 ? 89.223  43.638  45.737  1.00 23.86  ? 289 ALA A O   1 
ATOM   920  C  CB  . ALA A 1 109 ? 88.028  41.000  47.324  1.00 21.28  ? 289 ALA A CB  1 
ATOM   921  N  N   . ILE A 1 110 ? 90.797  42.242  46.517  1.00 22.92  ? 290 ILE A N   1 
ATOM   922  C  CA  . ILE A 1 110 ? 91.787  43.294  46.657  1.00 23.22  ? 290 ILE A CA  1 
ATOM   923  C  C   . ILE A 1 110 ? 92.214  43.830  45.297  1.00 23.93  ? 290 ILE A C   1 
ATOM   924  O  O   . ILE A 1 110 ? 92.393  45.040  45.123  1.00 24.47  ? 290 ILE A O   1 
ATOM   925  C  CB  . ILE A 1 110 ? 93.034  42.782  47.415  1.00 23.21  ? 290 ILE A CB  1 
ATOM   926  C  CG1 . ILE A 1 110 ? 92.702  42.628  48.907  1.00 23.60  ? 290 ILE A CG1 1 
ATOM   927  C  CG2 . ILE A 1 110 ? 94.206  43.726  47.207  1.00 21.41  ? 290 ILE A CG2 1 
ATOM   928  C  CD1 . ILE A 1 110 ? 93.825  42.015  49.733  1.00 23.51  ? 290 ILE A CD1 1 
ATOM   929  N  N   . CYS A 1 111 ? 92.351  42.928  44.331  1.00 22.78  ? 291 CYS A N   1 
ATOM   930  C  CA  . CYS A 1 111 ? 92.805  43.293  42.995  1.00 22.52  ? 291 CYS A CA  1 
ATOM   931  C  C   . CYS A 1 111 ? 91.751  43.660  41.959  1.00 22.40  ? 291 CYS A C   1 
ATOM   932  O  O   . CYS A 1 111 ? 92.110  44.070  40.854  1.00 22.72  ? 291 CYS A O   1 
ATOM   933  C  CB  . CYS A 1 111 ? 93.651  42.151  42.420  1.00 21.28  ? 291 CYS A CB  1 
ATOM   934  S  SG  . CYS A 1 111 ? 95.171  41.777  43.334  1.00 25.16  ? 291 CYS A SG  1 
ATOM   935  N  N   . HIS A 1 112 ? 90.470  43.549  42.306  1.00 22.03  ? 292 HIS A N   1 
ATOM   936  C  CA  . HIS A 1 112 ? 89.397  43.780  41.342  1.00 22.80  ? 292 HIS A CA  1 
ATOM   937  C  C   . HIS A 1 112 ? 89.235  45.108  40.598  1.00 23.30  ? 292 HIS A C   1 
ATOM   938  O  O   . HIS A 1 112 ? 88.598  45.128  39.561  1.00 24.01  ? 292 HIS A O   1 
ATOM   939  C  CB  . HIS A 1 112 ? 88.051  43.411  41.964  1.00 23.58  ? 292 HIS A CB  1 
ATOM   940  C  CG  . HIS A 1 112 ? 87.336  44.569  42.579  1.00 25.78  ? 292 HIS A CG  1 
ATOM   941  N  ND1 . HIS A 1 112 ? 87.660  45.069  43.821  1.00 26.47  ? 292 HIS A ND1 1 
ATOM   942  C  CD2 . HIS A 1 112 ? 86.351  45.361  42.095  1.00 27.08  ? 292 HIS A CD2 1 
ATOM   943  C  CE1 . HIS A 1 112 ? 86.905  46.123  44.076  1.00 28.99  ? 292 HIS A CE1 1 
ATOM   944  N  NE2 . HIS A 1 112 ? 86.101  46.324  43.043  1.00 31.39  ? 292 HIS A NE2 1 
ATOM   945  N  N   . ASP A 1 113 ? 89.775  46.217  41.096  1.00 24.64  ? 293 ASP A N   1 
ATOM   946  C  CA  . ASP A 1 113 ? 89.625  47.498  40.385  1.00 24.36  ? 293 ASP A CA  1 
ATOM   947  C  C   . ASP A 1 113 ? 90.964  48.165  40.114  1.00 24.57  ? 293 ASP A C   1 
ATOM   948  O  O   . ASP A 1 113 ? 91.034  49.387  39.963  1.00 25.73  ? 293 ASP A O   1 
ATOM   949  C  CB  . ASP A 1 113 ? 88.745  48.476  41.169  1.00 24.00  ? 293 ASP A CB  1 
ATOM   950  C  CG  . ASP A 1 113 ? 87.272  48.346  40.809  1.00 25.84  ? 293 ASP A CG  1 
ATOM   951  O  OD1 . ASP A 1 113 ? 86.960  48.020  39.627  1.00 26.76  ? 293 ASP A OD1 1 
ATOM   952  O  OD2 . ASP A 1 113 ? 86.405  48.552  41.689  1.00 29.94  ? 293 ASP A OD2 1 
ATOM   953  N  N   . LEU A 1 114 ? 92.030  47.375  40.060  1.00 23.91  ? 294 LEU A N   1 
ATOM   954  C  CA  . LEU A 1 114 ? 93.367  47.921  39.835  1.00 23.78  ? 294 LEU A CA  1 
ATOM   955  C  C   . LEU A 1 114 ? 93.491  48.847  38.631  1.00 24.80  ? 294 LEU A C   1 
ATOM   956  O  O   . LEU A 1 114 ? 93.040  48.530  37.522  1.00 24.00  ? 294 LEU A O   1 
ATOM   957  C  CB  . LEU A 1 114 ? 94.382  46.786  39.702  1.00 23.07  ? 294 LEU A CB  1 
ATOM   958  C  CG  . LEU A 1 114 ? 94.952  46.259  41.022  1.00 24.57  ? 294 LEU A CG  1 
ATOM   959  C  CD1 . LEU A 1 114 ? 95.593  44.895  40.792  1.00 24.53  ? 294 LEU A CD1 1 
ATOM   960  C  CD2 . LEU A 1 114 ? 95.970  47.260  41.587  1.00 22.79  ? 294 LEU A CD2 1 
ATOM   961  N  N   . ASP A 1 115 ? 94.115  49.996  38.868  1.00 24.40  ? 295 ASP A N   1 
ATOM   962  C  CA  . ASP A 1 115 ? 94.359  50.989  37.833  1.00 24.78  ? 295 ASP A CA  1 
ATOM   963  C  C   . ASP A 1 115 ? 93.104  51.383  37.060  1.00 24.70  ? 295 ASP A C   1 
ATOM   964  O  O   . ASP A 1 115 ? 93.130  51.504  35.841  1.00 24.48  ? 295 ASP A O   1 
ATOM   965  C  CB  . ASP A 1 115 ? 95.445  50.469  36.878  1.00 24.79  ? 295 ASP A CB  1 
ATOM   966  C  CG  . ASP A 1 115 ? 96.025  51.562  35.992  1.00 26.05  ? 295 ASP A CG  1 
ATOM   967  O  OD1 . ASP A 1 115 ? 96.237  52.688  36.490  1.00 25.78  ? 295 ASP A OD1 1 
ATOM   968  O  OD2 . ASP A 1 115 ? 96.288  51.292  34.803  1.00 25.78  ? 295 ASP A OD2 1 
ATOM   969  N  N   . HIS A 1 116 ? 92.006  51.569  37.780  1.00 24.99  ? 296 HIS A N   1 
ATOM   970  C  CA  . HIS A 1 116 ? 90.746  51.977  37.174  1.00 25.85  ? 296 HIS A CA  1 
ATOM   971  C  C   . HIS A 1 116 ? 90.944  53.425  36.694  1.00 27.75  ? 296 HIS A C   1 
ATOM   972  O  O   . HIS A 1 116 ? 91.473  54.264  37.424  1.00 27.85  ? 296 HIS A O   1 
ATOM   973  C  CB  . HIS A 1 116 ? 89.634  51.911  38.223  1.00 24.15  ? 296 HIS A CB  1 
ATOM   974  C  CG  . HIS A 1 116 ? 88.249  51.929  37.652  1.00 23.50  ? 296 HIS A CG  1 
ATOM   975  N  ND1 . HIS A 1 116 ? 87.711  53.035  37.030  1.00 23.99  ? 296 HIS A ND1 1 
ATOM   976  C  CD2 . HIS A 1 116 ? 87.282  50.981  37.634  1.00 23.88  ? 296 HIS A CD2 1 
ATOM   977  C  CE1 . HIS A 1 116 ? 86.472  52.769  36.655  1.00 23.29  ? 296 HIS A CE1 1 
ATOM   978  N  NE2 . HIS A 1 116 ? 86.186  51.527  37.010  1.00 24.34  ? 296 HIS A NE2 1 
ATOM   979  N  N   . PRO A 1 117 ? 90.528  53.733  35.458  1.00 28.83  ? 297 PRO A N   1 
ATOM   980  C  CA  . PRO A 1 117 ? 90.672  55.082  34.896  1.00 29.78  ? 297 PRO A CA  1 
ATOM   981  C  C   . PRO A 1 117 ? 89.679  56.121  35.424  1.00 31.11  ? 297 PRO A C   1 
ATOM   982  O  O   . PRO A 1 117 ? 89.964  57.319  35.421  1.00 32.21  ? 297 PRO A O   1 
ATOM   983  C  CB  . PRO A 1 117 ? 90.515  54.841  33.401  1.00 29.30  ? 297 PRO A CB  1 
ATOM   984  C  CG  . PRO A 1 117 ? 89.493  53.752  33.356  1.00 28.70  ? 297 PRO A CG  1 
ATOM   985  C  CD  . PRO A 1 117 ? 89.954  52.807  34.464  1.00 28.46  ? 297 PRO A CD  1 
ATOM   986  N  N   . GLY A 1 118 ? 88.517  55.667  35.882  1.00 31.42  ? 298 GLY A N   1 
ATOM   987  C  CA  . GLY A 1 118 ? 87.528  56.601  36.390  1.00 30.88  ? 298 GLY A CA  1 
ATOM   988  C  C   . GLY A 1 118 ? 86.391  56.766  35.404  1.00 31.04  ? 298 GLY A C   1 
ATOM   989  O  O   . GLY A 1 118 ? 85.485  57.578  35.614  1.00 32.19  ? 298 GLY A O   1 
ATOM   990  N  N   . TYR A 1 119 ? 86.453  55.998  34.319  1.00 29.34  ? 299 TYR A N   1 
ATOM   991  C  CA  . TYR A 1 119 ? 85.428  56.010  33.279  1.00 28.77  ? 299 TYR A CA  1 
ATOM   992  C  C   . TYR A 1 119 ? 85.109  54.548  32.968  1.00 28.50  ? 299 TYR A C   1 
ATOM   993  O  O   . TYR A 1 119 ? 86.017  53.755  32.715  1.00 29.25  ? 299 TYR A O   1 
ATOM   994  C  CB  . TYR A 1 119 ? 85.941  56.736  32.029  1.00 29.79  ? 299 TYR A CB  1 
ATOM   995  C  CG  . TYR A 1 119 ? 86.335  58.180  32.274  1.00 29.63  ? 299 TYR A CG  1 
ATOM   996  C  CD1 . TYR A 1 119 ? 87.565  58.502  32.853  1.00 30.82  ? 299 TYR A CD1 1 
ATOM   997  C  CD2 . TYR A 1 119 ? 85.459  59.223  31.965  1.00 31.03  ? 299 TYR A CD2 1 
ATOM   998  C  CE1 . TYR A 1 119 ? 87.914  59.828  33.127  1.00 30.94  ? 299 TYR A CE1 1 
ATOM   999  C  CE2 . TYR A 1 119 ? 85.797  60.556  32.233  1.00 31.43  ? 299 TYR A CE2 1 
ATOM   1000 C  CZ  . TYR A 1 119 ? 87.022  60.849  32.815  1.00 32.34  ? 299 TYR A CZ  1 
ATOM   1001 O  OH  . TYR A 1 119 ? 87.347  62.157  33.099  1.00 33.79  ? 299 TYR A OH  1 
ATOM   1002 N  N   . ASN A 1 120 ? 83.825  54.195  32.977  1.00 27.74  ? 300 ASN A N   1 
ATOM   1003 C  CA  . ASN A 1 120 ? 83.408  52.811  32.762  1.00 27.34  ? 300 ASN A CA  1 
ATOM   1004 C  C   . ASN A 1 120 ? 83.636  52.224  31.366  1.00 27.30  ? 300 ASN A C   1 
ATOM   1005 O  O   . ASN A 1 120 ? 84.194  52.885  30.484  1.00 27.57  ? 300 ASN A O   1 
ATOM   1006 C  CB  . ASN A 1 120 ? 81.939  52.645  33.189  1.00 26.83  ? 300 ASN A CB  1 
ATOM   1007 C  CG  . ASN A 1 120 ? 80.962  53.315  32.239  1.00 28.75  ? 300 ASN A CG  1 
ATOM   1008 O  OD1 . ASN A 1 120 ? 79.777  53.443  32.555  1.00 28.35  ? 300 ASN A OD1 1 
ATOM   1009 N  ND2 . ASN A 1 120 ? 81.442  53.726  31.067  1.00 28.18  ? 300 ASN A ND2 1 
ATOM   1010 N  N   . ASN A 1 121 ? 83.214  50.974  31.178  1.00 26.09  ? 301 ASN A N   1 
ATOM   1011 C  CA  . ASN A 1 121 ? 83.389  50.284  29.900  1.00 24.85  ? 301 ASN A CA  1 
ATOM   1012 C  C   . ASN A 1 121 ? 82.622  50.943  28.764  1.00 25.13  ? 301 ASN A C   1 
ATOM   1013 O  O   . ASN A 1 121 ? 83.095  50.975  27.627  1.00 24.33  ? 301 ASN A O   1 
ATOM   1014 C  CB  . ASN A 1 121 ? 82.965  48.811  30.008  1.00 23.67  ? 301 ASN A CB  1 
ATOM   1015 C  CG  . ASN A 1 121 ? 83.904  47.993  30.881  1.00 23.10  ? 301 ASN A CG  1 
ATOM   1016 O  OD1 . ASN A 1 121 ? 85.132  48.090  30.765  1.00 23.69  ? 301 ASN A OD1 1 
ATOM   1017 N  ND2 . ASN A 1 121 ? 83.329  47.174  31.754  1.00 21.53  ? 301 ASN A ND2 1 
ATOM   1018 N  N   . THR A 1 122 ? 81.434  51.454  29.063  1.00 25.63  ? 302 THR A N   1 
ATOM   1019 C  CA  . THR A 1 122 ? 80.643  52.117  28.040  1.00 25.91  ? 302 THR A CA  1 
ATOM   1020 C  C   . THR A 1 122 ? 81.455  53.292  27.498  1.00 26.48  ? 302 THR A C   1 
ATOM   1021 O  O   . THR A 1 122 ? 81.509  53.512  26.286  1.00 26.84  ? 302 THR A O   1 
ATOM   1022 C  CB  . THR A 1 122 ? 79.294  52.601  28.608  1.00 27.52  ? 302 THR A CB  1 
ATOM   1023 O  OG1 . THR A 1 122 ? 78.521  51.460  29.009  1.00 26.44  ? 302 THR A OG1 1 
ATOM   1024 C  CG2 . THR A 1 122 ? 78.510  53.393  27.551  1.00 26.91  ? 302 THR A CG2 1 
ATOM   1025 N  N   . TYR A 1 123 ? 82.115  54.035  28.379  1.00 26.06  ? 303 TYR A N   1 
ATOM   1026 C  CA  . TYR A 1 123 ? 82.922  55.143  27.896  1.00 26.51  ? 303 TYR A CA  1 
ATOM   1027 C  C   . TYR A 1 123 ? 84.113  54.631  27.082  1.00 27.08  ? 303 TYR A C   1 
ATOM   1028 O  O   . TYR A 1 123 ? 84.426  55.175  26.024  1.00 26.44  ? 303 TYR A O   1 
ATOM   1029 C  CB  . TYR A 1 123 ? 83.457  56.013  29.037  1.00 25.44  ? 303 TYR A CB  1 
ATOM   1030 C  CG  . TYR A 1 123 ? 84.338  57.115  28.495  1.00 25.62  ? 303 TYR A CG  1 
ATOM   1031 C  CD1 . TYR A 1 123 ? 83.780  58.219  27.850  1.00 26.04  ? 303 TYR A CD1 1 
ATOM   1032 C  CD2 . TYR A 1 123 ? 85.728  56.992  28.508  1.00 25.78  ? 303 TYR A CD2 1 
ATOM   1033 C  CE1 . TYR A 1 123 ? 84.585  59.170  27.216  1.00 27.41  ? 303 TYR A CE1 1 
ATOM   1034 C  CE2 . TYR A 1 123 ? 86.544  57.929  27.878  1.00 26.89  ? 303 TYR A CE2 1 
ATOM   1035 C  CZ  . TYR A 1 123 ? 85.965  59.017  27.230  1.00 28.24  ? 303 TYR A CZ  1 
ATOM   1036 O  OH  . TYR A 1 123 ? 86.761  59.933  26.574  1.00 28.89  ? 303 TYR A OH  1 
ATOM   1037 N  N   . GLN A 1 124 ? 84.790  53.600  27.589  1.00 27.11  ? 304 GLN A N   1 
ATOM   1038 C  CA  . GLN A 1 124 ? 85.944  53.030  26.892  1.00 27.20  ? 304 GLN A CA  1 
ATOM   1039 C  C   . GLN A 1 124 ? 85.556  52.620  25.470  1.00 27.25  ? 304 GLN A C   1 
ATOM   1040 O  O   . GLN A 1 124 ? 86.260  52.915  24.507  1.00 26.37  ? 304 GLN A O   1 
ATOM   1041 C  CB  . GLN A 1 124 ? 86.467  51.794  27.637  1.00 27.28  ? 304 GLN A CB  1 
ATOM   1042 C  CG  . GLN A 1 124 ? 86.783  52.031  29.110  1.00 26.26  ? 304 GLN A CG  1 
ATOM   1043 C  CD  . GLN A 1 124 ? 87.892  53.046  29.318  1.00 26.45  ? 304 GLN A CD  1 
ATOM   1044 O  OE1 . GLN A 1 124 ? 87.889  53.784  30.300  1.00 28.83  ? 304 GLN A OE1 1 
ATOM   1045 N  NE2 . GLN A 1 124 ? 88.854  53.077  28.402  1.00 24.89  ? 304 GLN A NE2 1 
ATOM   1046 N  N   . ILE A 1 125 ? 84.419  51.945  25.358  1.00 27.14  ? 305 ILE A N   1 
ATOM   1047 C  CA  . ILE A 1 125 ? 83.925  51.459  24.080  1.00 28.32  ? 305 ILE A CA  1 
ATOM   1048 C  C   . ILE A 1 125 ? 83.511  52.583  23.126  1.00 29.59  ? 305 ILE A C   1 
ATOM   1049 O  O   . ILE A 1 125 ? 84.028  52.676  22.009  1.00 30.24  ? 305 ILE A O   1 
ATOM   1050 C  CB  . ILE A 1 125 ? 82.742  50.481  24.307  1.00 27.23  ? 305 ILE A CB  1 
ATOM   1051 C  CG1 . ILE A 1 125 ? 83.251  49.227  25.032  1.00 27.50  ? 305 ILE A CG1 1 
ATOM   1052 C  CG2 . ILE A 1 125 ? 82.083  50.118  22.984  1.00 27.87  ? 305 ILE A CG2 1 
ATOM   1053 C  CD1 . ILE A 1 125 ? 82.161  48.244  25.440  1.00 24.86  ? 305 ILE A CD1 1 
ATOM   1054 N  N   . ASN A 1 126 ? 82.596  53.445  23.562  1.00 30.38  ? 306 ASN A N   1 
ATOM   1055 C  CA  . ASN A 1 126 ? 82.129  54.539  22.714  1.00 30.14  ? 306 ASN A CA  1 
ATOM   1056 C  C   . ASN A 1 126 ? 83.237  55.490  22.262  1.00 30.76  ? 306 ASN A C   1 
ATOM   1057 O  O   . ASN A 1 126 ? 83.220  55.966  21.122  1.00 31.33  ? 306 ASN A O   1 
ATOM   1058 C  CB  . ASN A 1 126 ? 81.016  55.321  23.419  1.00 30.62  ? 306 ASN A CB  1 
ATOM   1059 C  CG  . ASN A 1 126 ? 79.740  54.504  23.573  1.00 30.30  ? 306 ASN A CG  1 
ATOM   1060 O  OD1 . ASN A 1 126 ? 79.465  53.609  22.777  1.00 31.90  ? 306 ASN A OD1 1 
ATOM   1061 N  ND2 . ASN A 1 126 ? 78.950  54.820  24.590  1.00 31.38  ? 306 ASN A ND2 1 
ATOM   1062 N  N   . ALA A 1 127 ? 84.206  55.747  23.139  1.00 29.80  ? 307 ALA A N   1 
ATOM   1063 C  CA  . ALA A 1 127 ? 85.313  56.645  22.820  1.00 29.83  ? 307 ALA A CA  1 
ATOM   1064 C  C   . ALA A 1 127 ? 86.480  55.914  22.150  1.00 30.34  ? 307 ALA A C   1 
ATOM   1065 O  O   . ALA A 1 127 ? 87.519  56.521  21.847  1.00 29.66  ? 307 ALA A O   1 
ATOM   1066 C  CB  . ALA A 1 127 ? 85.799  57.350  24.089  1.00 28.77  ? 307 ALA A CB  1 
ATOM   1067 N  N   . ARG A 1 128 ? 86.304  54.614  21.923  1.00 29.75  ? 308 ARG A N   1 
ATOM   1068 C  CA  . ARG A 1 128 ? 87.330  53.791  21.285  1.00 29.01  ? 308 ARG A CA  1 
ATOM   1069 C  C   . ARG A 1 128 ? 88.698  54.028  21.896  1.00 28.88  ? 308 ARG A C   1 
ATOM   1070 O  O   . ARG A 1 128 ? 89.677  54.255  21.187  1.00 30.23  ? 308 ARG A O   1 
ATOM   1071 C  CB  . ARG A 1 128 ? 87.368  54.076  19.782  1.00 28.78  ? 308 ARG A CB  1 
ATOM   1072 C  CG  . ARG A 1 128 ? 85.993  53.963  19.136  1.00 30.78  ? 308 ARG A CG  1 
ATOM   1073 C  CD  . ARG A 1 128 ? 86.002  54.319  17.661  1.00 32.27  ? 308 ARG A CD  1 
ATOM   1074 N  NE  . ARG A 1 128 ? 84.636  54.473  17.159  1.00 34.73  ? 308 ARG A NE  1 
ATOM   1075 C  CZ  . ARG A 1 128 ? 84.319  54.731  15.892  1.00 35.30  ? 308 ARG A CZ  1 
ATOM   1076 N  NH1 . ARG A 1 128 ? 85.276  54.866  14.977  1.00 35.61  ? 308 ARG A NH1 1 
ATOM   1077 N  NH2 . ARG A 1 128 ? 83.043  54.848  15.537  1.00 34.19  ? 308 ARG A NH2 1 
ATOM   1078 N  N   . THR A 1 129 ? 88.761  53.977  23.220  1.00 29.33  ? 309 THR A N   1 
ATOM   1079 C  CA  . THR A 1 129 ? 90.017  54.177  23.938  1.00 29.83  ? 309 THR A CA  1 
ATOM   1080 C  C   . THR A 1 129 ? 90.998  53.043  23.661  1.00 30.55  ? 309 THR A C   1 
ATOM   1081 O  O   . THR A 1 129 ? 90.635  51.998  23.112  1.00 29.27  ? 309 THR A O   1 
ATOM   1082 C  CB  . THR A 1 129 ? 89.797  54.205  25.456  1.00 29.80  ? 309 THR A CB  1 
ATOM   1083 O  OG1 . THR A 1 129 ? 89.338  52.916  25.887  1.00 29.61  ? 309 THR A OG1 1 
ATOM   1084 C  CG2 . THR A 1 129 ? 88.769  55.263  25.829  1.00 29.38  ? 309 THR A CG2 1 
ATOM   1085 N  N   . GLU A 1 130 ? 92.244  53.249  24.063  1.00 31.71  ? 310 GLU A N   1 
ATOM   1086 C  CA  . GLU A 1 130 ? 93.258  52.235  23.869  1.00 33.44  ? 310 GLU A CA  1 
ATOM   1087 C  C   . GLU A 1 130 ? 92.878  50.933  24.569  1.00 32.28  ? 310 GLU A C   1 
ATOM   1088 O  O   . GLU A 1 130 ? 93.186  49.852  24.072  1.00 33.21  ? 310 GLU A O   1 
ATOM   1089 C  CB  . GLU A 1 130 ? 94.605  52.730  24.383  1.00 36.59  ? 310 GLU A CB  1 
ATOM   1090 C  CG  . GLU A 1 130 ? 95.346  53.588  23.375  1.00 43.50  ? 310 GLU A CG  1 
ATOM   1091 C  CD  . GLU A 1 130 ? 96.774  53.879  23.797  1.00 46.99  ? 310 GLU A CD  1 
ATOM   1092 O  OE1 . GLU A 1 130 ? 97.538  54.405  22.954  1.00 48.95  ? 310 GLU A OE1 1 
ATOM   1093 O  OE2 . GLU A 1 130 ? 97.127  53.582  24.967  1.00 49.23  ? 310 GLU A OE2 1 
ATOM   1094 N  N   . LEU A 1 131 ? 92.208  51.038  25.712  1.00 30.04  ? 311 LEU A N   1 
ATOM   1095 C  CA  . LEU A 1 131 ? 91.791  49.854  26.454  1.00 29.18  ? 311 LEU A CA  1 
ATOM   1096 C  C   . LEU A 1 131 ? 90.727  49.077  25.698  1.00 28.10  ? 311 LEU A C   1 
ATOM   1097 O  O   . LEU A 1 131 ? 90.789  47.850  25.617  1.00 27.32  ? 311 LEU A O   1 
ATOM   1098 C  CB  . LEU A 1 131 ? 91.243  50.226  27.836  1.00 29.42  ? 311 LEU A CB  1 
ATOM   1099 C  CG  . LEU A 1 131 ? 92.238  50.440  28.975  1.00 31.06  ? 311 LEU A CG  1 
ATOM   1100 C  CD1 . LEU A 1 131 ? 91.477  50.688  30.274  1.00 31.08  ? 311 LEU A CD1 1 
ATOM   1101 C  CD2 . LEU A 1 131 ? 93.127  49.208  29.116  1.00 32.45  ? 311 LEU A CD2 1 
ATOM   1102 N  N   . ALA A 1 132 ? 89.744  49.789  25.155  1.00 26.30  ? 312 ALA A N   1 
ATOM   1103 C  CA  . ALA A 1 132 ? 88.677  49.142  24.408  1.00 25.91  ? 312 ALA A CA  1 
ATOM   1104 C  C   . ALA A 1 132 ? 89.240  48.460  23.160  1.00 25.55  ? 312 ALA A C   1 
ATOM   1105 O  O   . ALA A 1 132 ? 88.793  47.376  22.784  1.00 26.75  ? 312 ALA A O   1 
ATOM   1106 C  CB  . ALA A 1 132 ? 87.607  50.159  24.026  1.00 24.81  ? 312 ALA A CB  1 
ATOM   1107 N  N   . VAL A 1 133 ? 90.226  49.089  22.528  1.00 24.73  ? 313 VAL A N   1 
ATOM   1108 C  CA  . VAL A 1 133 ? 90.845  48.522  21.336  1.00 25.57  ? 313 VAL A CA  1 
ATOM   1109 C  C   . VAL A 1 133 ? 91.669  47.293  21.713  1.00 25.62  ? 313 VAL A C   1 
ATOM   1110 O  O   . VAL A 1 133 ? 91.645  46.287  21.010  1.00 25.43  ? 313 VAL A O   1 
ATOM   1111 C  CB  . VAL A 1 133 ? 91.765  49.552  20.628  1.00 26.52  ? 313 VAL A CB  1 
ATOM   1112 C  CG1 . VAL A 1 133 ? 92.568  48.875  19.527  1.00 24.48  ? 313 VAL A CG1 1 
ATOM   1113 C  CG2 . VAL A 1 133 ? 90.918  50.684  20.033  1.00 26.50  ? 313 VAL A CG2 1 
ATOM   1114 N  N   . ARG A 1 134 ? 92.381  47.372  22.831  1.00 25.12  ? 314 ARG A N   1 
ATOM   1115 C  CA  . ARG A 1 134 ? 93.205  46.260  23.284  1.00 25.26  ? 314 ARG A CA  1 
ATOM   1116 C  C   . ARG A 1 134 ? 92.388  45.022  23.613  1.00 24.51  ? 314 ARG A C   1 
ATOM   1117 O  O   . ARG A 1 134 ? 92.802  43.904  23.324  1.00 24.01  ? 314 ARG A O   1 
ATOM   1118 C  CB  . ARG A 1 134 ? 94.006  46.645  24.524  1.00 26.36  ? 314 ARG A CB  1 
ATOM   1119 C  CG  . ARG A 1 134 ? 94.759  45.463  25.141  1.00 28.30  ? 314 ARG A CG  1 
ATOM   1120 C  CD  . ARG A 1 134 ? 95.556  45.898  26.351  1.00 29.25  ? 314 ARG A CD  1 
ATOM   1121 N  NE  . ARG A 1 134 ? 96.451  46.988  26.003  1.00 30.75  ? 314 ARG A NE  1 
ATOM   1122 C  CZ  . ARG A 1 134 ? 96.878  47.908  26.860  1.00 33.02  ? 314 ARG A CZ  1 
ATOM   1123 N  NH1 . ARG A 1 134 ? 96.497  47.864  28.130  1.00 33.47  ? 314 ARG A NH1 1 
ATOM   1124 N  NH2 . ARG A 1 134 ? 97.658  48.896  26.438  1.00 33.32  ? 314 ARG A NH2 1 
ATOM   1125 N  N   . TYR A 1 135 ? 91.225  45.227  24.216  1.00 23.96  ? 315 TYR A N   1 
ATOM   1126 C  CA  . TYR A 1 135 ? 90.373  44.120  24.613  1.00 23.72  ? 315 TYR A CA  1 
ATOM   1127 C  C   . TYR A 1 135 ? 89.145  43.845  23.747  1.00 23.82  ? 315 TYR A C   1 
ATOM   1128 O  O   . TYR A 1 135 ? 88.257  43.085  24.140  1.00 23.38  ? 315 TYR A O   1 
ATOM   1129 C  CB  . TYR A 1 135 ? 89.972  44.311  26.077  1.00 23.97  ? 315 TYR A CB  1 
ATOM   1130 C  CG  . TYR A 1 135 ? 91.157  44.148  26.994  1.00 23.13  ? 315 TYR A CG  1 
ATOM   1131 C  CD1 . TYR A 1 135 ? 91.827  42.921  27.077  1.00 22.96  ? 315 TYR A CD1 1 
ATOM   1132 C  CD2 . TYR A 1 135 ? 91.636  45.216  27.755  1.00 22.50  ? 315 TYR A CD2 1 
ATOM   1133 C  CE1 . TYR A 1 135 ? 92.942  42.760  27.888  1.00 22.34  ? 315 TYR A CE1 1 
ATOM   1134 C  CE2 . TYR A 1 135 ? 92.758  45.063  28.581  1.00 23.30  ? 315 TYR A CE2 1 
ATOM   1135 C  CZ  . TYR A 1 135 ? 93.404  43.830  28.636  1.00 22.51  ? 315 TYR A CZ  1 
ATOM   1136 O  OH  . TYR A 1 135 ? 94.517  43.663  29.422  1.00 23.38  ? 315 TYR A OH  1 
ATOM   1137 N  N   . ASN A 1 136 ? 89.099  44.463  22.571  1.00 22.91  ? 316 ASN A N   1 
ATOM   1138 C  CA  . ASN A 1 136 ? 88.006  44.250  21.636  1.00 23.43  ? 316 ASN A CA  1 
ATOM   1139 C  C   . ASN A 1 136 ? 86.603  44.427  22.220  1.00 23.04  ? 316 ASN A C   1 
ATOM   1140 O  O   . ASN A 1 136 ? 85.702  43.643  21.929  1.00 23.64  ? 316 ASN A O   1 
ATOM   1141 C  CB  . ASN A 1 136 ? 88.153  42.857  21.022  1.00 24.16  ? 316 ASN A CB  1 
ATOM   1142 C  CG  . ASN A 1 136 ? 89.548  42.620  20.473  1.00 25.19  ? 316 ASN A CG  1 
ATOM   1143 O  OD1 . ASN A 1 136 ? 89.996  43.328  19.571  1.00 25.86  ? 316 ASN A OD1 1 
ATOM   1144 N  ND2 . ASN A 1 136 ? 90.249  41.632  21.025  1.00 24.62  ? 316 ASN A ND2 1 
ATOM   1145 N  N   . ASP A 1 137 ? 86.431  45.461  23.039  1.00 22.75  ? 317 ASP A N   1 
ATOM   1146 C  CA  . ASP A 1 137 ? 85.148  45.786  23.664  1.00 23.23  ? 317 ASP A CA  1 
ATOM   1147 C  C   . ASP A 1 137 ? 84.616  44.733  24.629  1.00 23.29  ? 317 ASP A C   1 
ATOM   1148 O  O   . ASP A 1 137 ? 83.441  44.771  25.006  1.00 24.16  ? 317 ASP A O   1 
ATOM   1149 C  CB  . ASP A 1 137 ? 84.075  46.094  22.595  1.00 22.89  ? 317 ASP A CB  1 
ATOM   1150 C  CG  . ASP A 1 137 ? 84.422  47.322  21.752  1.00 23.15  ? 317 ASP A CG  1 
ATOM   1151 O  OD1 . ASP A 1 137 ? 85.243  48.145  22.205  1.00 22.98  ? 317 ASP A OD1 1 
ATOM   1152 O  OD2 . ASP A 1 137 ? 83.877  47.472  20.643  1.00 23.58  ? 317 ASP A OD2 1 
ATOM   1153 N  N   . ILE A 1 138 ? 85.470  43.801  25.040  1.00 22.94  ? 318 ILE A N   1 
ATOM   1154 C  CA  . ILE A 1 138 ? 85.045  42.769  25.988  1.00 22.94  ? 318 ILE A CA  1 
ATOM   1155 C  C   . ILE A 1 138 ? 85.537  43.130  27.389  1.00 21.64  ? 318 ILE A C   1 
ATOM   1156 O  O   . ILE A 1 138 ? 86.729  43.038  27.664  1.00 21.21  ? 318 ILE A O   1 
ATOM   1157 C  CB  . ILE A 1 138 ? 85.605  41.386  25.597  1.00 24.30  ? 318 ILE A CB  1 
ATOM   1158 C  CG1 . ILE A 1 138 ? 85.083  40.987  24.213  1.00 24.45  ? 318 ILE A CG1 1 
ATOM   1159 C  CG2 . ILE A 1 138 ? 85.199  40.337  26.645  1.00 22.96  ? 318 ILE A CG2 1 
ATOM   1160 C  CD1 . ILE A 1 138 ? 85.748  39.748  23.644  1.00 26.81  ? 318 ILE A CD1 1 
ATOM   1161 N  N   . SER A 1 139 ? 84.616  43.544  28.263  1.00 21.71  ? 319 SER A N   1 
ATOM   1162 C  CA  . SER A 1 139 ? 84.955  43.931  29.638  1.00 21.98  ? 319 SER A CA  1 
ATOM   1163 C  C   . SER A 1 139 ? 86.386  44.457  29.690  1.00 23.56  ? 319 SER A C   1 
ATOM   1164 O  O   . SER A 1 139 ? 87.240  43.900  30.390  1.00 23.81  ? 319 SER A O   1 
ATOM   1165 C  CB  . SER A 1 139 ? 84.820  42.725  30.580  1.00 22.81  ? 319 SER A CB  1 
ATOM   1166 O  OG  . SER A 1 139 ? 83.488  42.230  30.609  1.00 22.07  ? 319 SER A OG  1 
ATOM   1167 N  N   . PRO A 1 140 ? 86.674  45.538  28.944  1.00 23.91  ? 320 PRO A N   1 
ATOM   1168 C  CA  . PRO A 1 140 ? 88.041  46.063  28.961  1.00 24.13  ? 320 PRO A CA  1 
ATOM   1169 C  C   . PRO A 1 140 ? 88.622  46.441  30.321  1.00 24.55  ? 320 PRO A C   1 
ATOM   1170 O  O   . PRO A 1 140 ? 89.788  46.146  30.598  1.00 23.57  ? 320 PRO A O   1 
ATOM   1171 C  CB  . PRO A 1 140 ? 87.990  47.230  27.965  1.00 25.27  ? 320 PRO A CB  1 
ATOM   1172 C  CG  . PRO A 1 140 ? 86.529  47.539  27.813  1.00 26.33  ? 320 PRO A CG  1 
ATOM   1173 C  CD  . PRO A 1 140 ? 85.855  46.216  27.924  1.00 24.10  ? 320 PRO A CD  1 
ATOM   1174 N  N   . LEU A 1 141 ? 87.824  47.084  31.169  1.00 25.00  ? 321 LEU A N   1 
ATOM   1175 C  CA  . LEU A 1 141 ? 88.309  47.472  32.490  1.00 24.23  ? 321 LEU A CA  1 
ATOM   1176 C  C   . LEU A 1 141 ? 88.667  46.250  33.325  1.00 23.28  ? 321 LEU A C   1 
ATOM   1177 O  O   . LEU A 1 141 ? 89.774  46.150  33.861  1.00 22.79  ? 321 LEU A O   1 
ATOM   1178 C  CB  . LEU A 1 141 ? 87.258  48.295  33.244  1.00 24.79  ? 321 LEU A CB  1 
ATOM   1179 C  CG  . LEU A 1 141 ? 86.934  49.718  32.774  1.00 26.34  ? 321 LEU A CG  1 
ATOM   1180 C  CD1 . LEU A 1 141 ? 85.901  50.320  33.714  1.00 26.79  ? 321 LEU A CD1 1 
ATOM   1181 C  CD2 . LEU A 1 141 ? 88.190  50.567  32.759  1.00 25.10  ? 321 LEU A CD2 1 
ATOM   1182 N  N   . GLU A 1 142 ? 87.731  45.317  33.439  1.00 22.07  ? 322 GLU A N   1 
ATOM   1183 C  CA  . GLU A 1 142 ? 87.985  44.127  34.244  1.00 21.72  ? 322 GLU A CA  1 
ATOM   1184 C  C   . GLU A 1 142 ? 89.173  43.328  33.712  1.00 20.78  ? 322 GLU A C   1 
ATOM   1185 O  O   . GLU A 1 142 ? 89.998  42.848  34.487  1.00 20.70  ? 322 GLU A O   1 
ATOM   1186 C  CB  . GLU A 1 142 ? 86.732  43.262  34.311  1.00 21.30  ? 322 GLU A CB  1 
ATOM   1187 C  CG  . GLU A 1 142 ? 85.574  43.891  35.081  1.00 22.16  ? 322 GLU A CG  1 
ATOM   1188 C  CD  . GLU A 1 142 ? 84.965  45.118  34.393  1.00 23.28  ? 322 GLU A CD  1 
ATOM   1189 O  OE1 . GLU A 1 142 ? 85.019  45.208  33.142  1.00 20.21  ? 322 GLU A OE1 1 
ATOM   1190 O  OE2 . GLU A 1 142 ? 84.406  45.980  35.113  1.00 23.13  ? 322 GLU A OE2 1 
ATOM   1191 N  N   . ASN A 1 143 ? 89.264  43.182  32.395  1.00 20.78  ? 323 ASN A N   1 
ATOM   1192 C  CA  . ASN A 1 143 ? 90.393  42.470  31.800  1.00 21.81  ? 323 ASN A CA  1 
ATOM   1193 C  C   . ASN A 1 143 ? 91.682  43.181  32.181  1.00 22.05  ? 323 ASN A C   1 
ATOM   1194 O  O   . ASN A 1 143 ? 92.695  42.540  32.480  1.00 23.35  ? 323 ASN A O   1 
ATOM   1195 C  CB  . ASN A 1 143 ? 90.272  42.423  30.273  1.00 20.63  ? 323 ASN A CB  1 
ATOM   1196 C  CG  . ASN A 1 143 ? 89.626  41.143  29.780  1.00 20.06  ? 323 ASN A CG  1 
ATOM   1197 O  OD1 . ASN A 1 143 ? 90.160  40.050  29.980  1.00 20.39  ? 323 ASN A OD1 1 
ATOM   1198 N  ND2 . ASN A 1 143 ? 88.470  41.270  29.134  1.00 18.18  ? 323 ASN A ND2 1 
ATOM   1199 N  N   . HIS A 1 144 ? 91.635  44.512  32.187  1.00 22.47  ? 324 HIS A N   1 
ATOM   1200 C  CA  . HIS A 1 144 ? 92.803  45.309  32.541  1.00 22.47  ? 324 HIS A CA  1 
ATOM   1201 C  C   . HIS A 1 144 ? 93.156  45.172  34.017  1.00 22.29  ? 324 HIS A C   1 
ATOM   1202 O  O   . HIS A 1 144 ? 94.326  44.991  34.358  1.00 24.03  ? 324 HIS A O   1 
ATOM   1203 C  CB  . HIS A 1 144 ? 92.577  46.786  32.210  1.00 21.21  ? 324 HIS A CB  1 
ATOM   1204 C  CG  . HIS A 1 144 ? 93.753  47.656  32.530  1.00 19.78  ? 324 HIS A CG  1 
ATOM   1205 N  ND1 . HIS A 1 144 ? 94.964  47.544  31.880  1.00 21.13  ? 324 HIS A ND1 1 
ATOM   1206 C  CD2 . HIS A 1 144 ? 93.907  48.649  33.438  1.00 20.75  ? 324 HIS A CD2 1 
ATOM   1207 C  CE1 . HIS A 1 144 ? 95.812  48.429  32.372  1.00 20.56  ? 324 HIS A CE1 1 
ATOM   1208 N  NE2 . HIS A 1 144 ? 95.195  49.113  33.320  1.00 20.54  ? 324 HIS A NE2 1 
ATOM   1209 N  N   . HIS A 1 145 ? 92.155  45.263  34.891  1.00 22.71  ? 325 HIS A N   1 
ATOM   1210 C  CA  . HIS A 1 145 ? 92.395  45.144  36.332  1.00 23.62  ? 325 HIS A CA  1 
ATOM   1211 C  C   . HIS A 1 145 ? 93.103  43.818  36.573  1.00 24.97  ? 325 HIS A C   1 
ATOM   1212 O  O   . HIS A 1 145 ? 94.088  43.731  37.309  1.00 25.89  ? 325 HIS A O   1 
ATOM   1213 C  CB  . HIS A 1 145 ? 91.084  45.116  37.137  1.00 21.89  ? 325 HIS A CB  1 
ATOM   1214 C  CG  . HIS A 1 145 ? 90.174  46.278  36.891  1.00 22.21  ? 325 HIS A CG  1 
ATOM   1215 N  ND1 . HIS A 1 145 ? 90.631  47.567  36.715  1.00 22.63  ? 325 HIS A ND1 1 
ATOM   1216 C  CD2 . HIS A 1 145 ? 88.821  46.348  36.852  1.00 22.80  ? 325 HIS A CD2 1 
ATOM   1217 C  CE1 . HIS A 1 145 ? 89.598  48.382  36.577  1.00 23.69  ? 325 HIS A CE1 1 
ATOM   1218 N  NE2 . HIS A 1 145 ? 88.489  47.667  36.658  1.00 23.42  ? 325 HIS A NE2 1 
ATOM   1219 N  N   . CYS A 1 146 ? 92.571  42.780  35.943  1.00 26.56  ? 326 CYS A N   1 
ATOM   1220 C  CA  . CYS A 1 146 ? 93.099  41.437  36.069  1.00 27.65  ? 326 CYS A CA  1 
ATOM   1221 C  C   . CYS A 1 146 ? 94.547  41.347  35.573  1.00 26.57  ? 326 CYS A C   1 
ATOM   1222 O  O   . CYS A 1 146 ? 95.410  40.780  36.244  1.00 25.73  ? 326 CYS A O   1 
ATOM   1223 C  CB  . CYS A 1 146 ? 92.196  40.478  35.294  1.00 30.21  ? 326 CYS A CB  1 
ATOM   1224 S  SG  . CYS A 1 146 ? 92.276  38.818  35.907  1.00 41.55  ? 326 CYS A SG  1 
ATOM   1225 N  N   . ALA A 1 147 ? 94.810  41.917  34.403  1.00 25.50  ? 327 ALA A N   1 
ATOM   1226 C  CA  . ALA A 1 147 ? 96.150  41.905  33.835  1.00 25.14  ? 327 ALA A CA  1 
ATOM   1227 C  C   . ALA A 1 147 ? 97.141  42.631  34.751  1.00 24.44  ? 327 ALA A C   1 
ATOM   1228 O  O   . ALA A 1 147 ? 98.259  42.168  34.961  1.00 24.77  ? 327 ALA A O   1 
ATOM   1229 C  CB  . ALA A 1 147 ? 96.138  42.561  32.449  1.00 24.02  ? 327 ALA A CB  1 
ATOM   1230 N  N   . VAL A 1 148 ? 96.744  43.780  35.284  1.00 23.92  ? 328 VAL A N   1 
ATOM   1231 C  CA  . VAL A 1 148 ? 97.640  44.515  36.170  1.00 23.84  ? 328 VAL A CA  1 
ATOM   1232 C  C   . VAL A 1 148 ? 97.903  43.668  37.412  1.00 23.69  ? 328 VAL A C   1 
ATOM   1233 O  O   . VAL A 1 148 ? 99.021  43.620  37.924  1.00 23.65  ? 328 VAL A O   1 
ATOM   1234 C  CB  . VAL A 1 148 ? 97.041  45.889  36.593  1.00 23.11  ? 328 VAL A CB  1 
ATOM   1235 C  CG1 . VAL A 1 148 ? 97.911  46.528  37.675  1.00 22.38  ? 328 VAL A CG1 1 
ATOM   1236 C  CG2 . VAL A 1 148 ? 96.980  46.823  35.386  1.00 22.87  ? 328 VAL A CG2 1 
ATOM   1237 N  N   . ALA A 1 149 ? 96.869  42.983  37.881  1.00 23.02  ? 329 ALA A N   1 
ATOM   1238 C  CA  . ALA A 1 149 ? 97.004  42.140  39.055  1.00 22.72  ? 329 ALA A CA  1 
ATOM   1239 C  C   . ALA A 1 149 ? 98.136  41.128  38.879  1.00 23.47  ? 329 ALA A C   1 
ATOM   1240 O  O   . ALA A 1 149 ? 98.952  40.923  39.791  1.00 24.47  ? 329 ALA A O   1 
ATOM   1241 C  CB  . ALA A 1 149 ? 95.695  41.423  39.329  1.00 21.14  ? 329 ALA A CB  1 
ATOM   1242 N  N   . PHE A 1 150 ? 98.214  40.504  37.707  1.00 21.99  ? 330 PHE A N   1 
ATOM   1243 C  CA  . PHE A 1 150 ? 99.257  39.513  37.502  1.00 23.14  ? 330 PHE A CA  1 
ATOM   1244 C  C   . PHE A 1 150 ? 100.598 40.066  37.072  1.00 23.76  ? 330 PHE A C   1 
ATOM   1245 O  O   . PHE A 1 150 ? 101.609 39.383  37.190  1.00 24.79  ? 330 PHE A O   1 
ATOM   1246 C  CB  . PHE A 1 150 ? 98.756  38.404  36.568  1.00 20.69  ? 330 PHE A CB  1 
ATOM   1247 C  CG  . PHE A 1 150 ? 97.777  37.488  37.239  1.00 20.54  ? 330 PHE A CG  1 
ATOM   1248 C  CD1 . PHE A 1 150 ? 98.225  36.468  38.076  1.00 20.78  ? 330 PHE A CD1 1 
ATOM   1249 C  CD2 . PHE A 1 150 ? 96.405  37.713  37.137  1.00 20.59  ? 330 PHE A CD2 1 
ATOM   1250 C  CE1 . PHE A 1 150 ? 97.324  35.685  38.812  1.00 19.22  ? 330 PHE A CE1 1 
ATOM   1251 C  CE2 . PHE A 1 150 ? 95.494  36.937  37.869  1.00 19.19  ? 330 PHE A CE2 1 
ATOM   1252 C  CZ  . PHE A 1 150 ? 95.959  35.921  38.709  1.00 19.72  ? 330 PHE A CZ  1 
ATOM   1253 N  N   . GLN A 1 151 ? 100.626 41.300  36.587  1.00 24.69  ? 331 GLN A N   1 
ATOM   1254 C  CA  . GLN A 1 151 ? 101.909 41.895  36.232  1.00 27.04  ? 331 GLN A CA  1 
ATOM   1255 C  C   . GLN A 1 151 ? 102.567 42.202  37.576  1.00 26.51  ? 331 GLN A C   1 
ATOM   1256 O  O   . GLN A 1 151 ? 103.784 42.077  37.737  1.00 26.98  ? 331 GLN A O   1 
ATOM   1257 C  CB  . GLN A 1 151 ? 101.712 43.170  35.403  1.00 27.89  ? 331 GLN A CB  1 
ATOM   1258 C  CG  . GLN A 1 151 ? 100.927 42.902  34.114  1.00 30.42  ? 331 GLN A CG  1 
ATOM   1259 C  CD  . GLN A 1 151 ? 100.597 44.155  33.318  1.00 32.03  ? 331 GLN A CD  1 
ATOM   1260 O  OE1 . GLN A 1 151 ? 100.397 45.237  33.875  1.00 30.89  ? 331 GLN A OE1 1 
ATOM   1261 N  NE2 . GLN A 1 151 ? 100.512 44.002  32.002  1.00 34.24  ? 331 GLN A NE2 1 
ATOM   1262 N  N   . ILE A 1 152 ? 101.742 42.573  38.551  1.00 26.04  ? 332 ILE A N   1 
ATOM   1263 C  CA  . ILE A 1 152 ? 102.238 42.876  39.886  1.00 25.88  ? 332 ILE A CA  1 
ATOM   1264 C  C   . ILE A 1 152 ? 102.787 41.601  40.525  1.00 25.65  ? 332 ILE A C   1 
ATOM   1265 O  O   . ILE A 1 152 ? 103.907 41.584  41.027  1.00 24.67  ? 332 ILE A O   1 
ATOM   1266 C  CB  . ILE A 1 152 ? 101.119 43.460  40.782  1.00 25.68  ? 332 ILE A CB  1 
ATOM   1267 C  CG1 . ILE A 1 152 ? 100.817 44.902  40.357  1.00 25.32  ? 332 ILE A CG1 1 
ATOM   1268 C  CG2 . ILE A 1 152 ? 101.526 43.384  42.251  1.00 24.52  ? 332 ILE A CG2 1 
ATOM   1269 C  CD1 . ILE A 1 152 ? 99.708  45.573  41.157  1.00 24.28  ? 332 ILE A CD1 1 
ATOM   1270 N  N   . LEU A 1 153 ? 101.997 40.535  40.501  1.00 26.28  ? 333 LEU A N   1 
ATOM   1271 C  CA  . LEU A 1 153 ? 102.424 39.260  41.074  1.00 27.82  ? 333 LEU A CA  1 
ATOM   1272 C  C   . LEU A 1 153 ? 103.630 38.678  40.336  1.00 29.31  ? 333 LEU A C   1 
ATOM   1273 O  O   . LEU A 1 153 ? 104.333 37.822  40.872  1.00 29.42  ? 333 LEU A O   1 
ATOM   1274 C  CB  . LEU A 1 153 ? 101.271 38.256  41.050  1.00 26.13  ? 333 LEU A CB  1 
ATOM   1275 C  CG  . LEU A 1 153 ? 100.118 38.534  42.020  1.00 26.93  ? 333 LEU A CG  1 
ATOM   1276 C  CD1 . LEU A 1 153 ? 98.885  37.749  41.588  1.00 25.67  ? 333 LEU A CD1 1 
ATOM   1277 C  CD2 . LEU A 1 153 ? 100.537 38.160  43.441  1.00 25.33  ? 333 LEU A CD2 1 
ATOM   1278 N  N   . ALA A 1 154 ? 103.865 39.139  39.109  1.00 30.24  ? 334 ALA A N   1 
ATOM   1279 C  CA  . ALA A 1 154 ? 104.996 38.652  38.325  1.00 32.06  ? 334 ALA A CA  1 
ATOM   1280 C  C   . ALA A 1 154 ? 106.309 39.229  38.848  1.00 33.70  ? 334 ALA A C   1 
ATOM   1281 O  O   . ALA A 1 154 ? 107.381 38.721  38.534  1.00 35.67  ? 334 ALA A O   1 
ATOM   1282 C  CB  . ALA A 1 154 ? 104.819 39.010  36.859  1.00 32.08  ? 334 ALA A CB  1 
ATOM   1283 N  N   . GLU A 1 155 ? 106.229 40.304  39.625  1.00 34.11  ? 335 GLU A N   1 
ATOM   1284 C  CA  . GLU A 1 155 ? 107.428 40.907  40.203  1.00 35.53  ? 335 GLU A CA  1 
ATOM   1285 C  C   . GLU A 1 155 ? 107.784 40.058  41.419  1.00 35.51  ? 335 GLU A C   1 
ATOM   1286 O  O   . GLU A 1 155 ? 107.008 39.962  42.371  1.00 34.67  ? 335 GLU A O   1 
ATOM   1287 C  CB  . GLU A 1 155 ? 107.156 42.352  40.629  1.00 36.52  ? 335 GLU A CB  1 
ATOM   1288 C  CG  . GLU A 1 155 ? 106.817 43.263  39.467  1.00 38.73  ? 335 GLU A CG  1 
ATOM   1289 C  CD  . GLU A 1 155 ? 107.976 43.414  38.495  1.00 40.98  ? 335 GLU A CD  1 
ATOM   1290 O  OE1 . GLU A 1 155 ? 107.742 43.906  37.369  1.00 42.70  ? 335 GLU A OE1 1 
ATOM   1291 O  OE2 . GLU A 1 155 ? 109.119 43.049  38.857  1.00 41.20  ? 335 GLU A OE2 1 
ATOM   1292 N  N   . PRO A 1 156 ? 108.968 39.430  41.400  1.00 35.95  ? 336 PRO A N   1 
ATOM   1293 C  CA  . PRO A 1 156 ? 109.443 38.572  42.491  1.00 35.74  ? 336 PRO A CA  1 
ATOM   1294 C  C   . PRO A 1 156 ? 109.241 39.065  43.922  1.00 34.92  ? 336 PRO A C   1 
ATOM   1295 O  O   . PRO A 1 156 ? 108.774 38.308  44.768  1.00 33.65  ? 336 PRO A O   1 
ATOM   1296 C  CB  . PRO A 1 156 ? 110.925 38.350  42.148  1.00 36.46  ? 336 PRO A CB  1 
ATOM   1297 C  CG  . PRO A 1 156 ? 111.271 39.537  41.276  1.00 37.56  ? 336 PRO A CG  1 
ATOM   1298 C  CD  . PRO A 1 156 ? 110.041 39.666  40.418  1.00 36.41  ? 336 PRO A CD  1 
ATOM   1299 N  N   . GLU A 1 157 ? 109.583 40.321  44.198  1.00 34.79  ? 337 GLU A N   1 
ATOM   1300 C  CA  . GLU A 1 157 ? 109.438 40.843  45.554  1.00 34.44  ? 337 GLU A CA  1 
ATOM   1301 C  C   . GLU A 1 157 ? 107.980 41.027  45.963  1.00 33.57  ? 337 GLU A C   1 
ATOM   1302 O  O   . GLU A 1 157 ? 107.690 41.281  47.129  1.00 34.02  ? 337 GLU A O   1 
ATOM   1303 C  CB  . GLU A 1 157 ? 110.191 42.176  45.721  1.00 35.96  ? 337 GLU A CB  1 
ATOM   1304 C  CG  . GLU A 1 157 ? 109.460 43.401  45.183  1.00 38.04  ? 337 GLU A CG  1 
ATOM   1305 C  CD  . GLU A 1 157 ? 109.686 43.632  43.697  1.00 39.02  ? 337 GLU A CD  1 
ATOM   1306 O  OE1 . GLU A 1 157 ? 109.892 42.649  42.950  1.00 38.34  ? 337 GLU A OE1 1 
ATOM   1307 O  OE2 . GLU A 1 157 ? 109.644 44.810  43.279  1.00 40.48  ? 337 GLU A OE2 1 
ATOM   1308 N  N   . CYS A 1 158 ? 107.062 40.893  45.010  1.00 31.92  ? 338 CYS A N   1 
ATOM   1309 C  CA  . CYS A 1 158 ? 105.642 41.044  45.312  1.00 30.66  ? 338 CYS A CA  1 
ATOM   1310 C  C   . CYS A 1 158 ? 104.867 39.748  45.111  1.00 29.41  ? 338 CYS A C   1 
ATOM   1311 O  O   . CYS A 1 158 ? 103.656 39.708  45.315  1.00 29.30  ? 338 CYS A O   1 
ATOM   1312 C  CB  . CYS A 1 158 ? 105.017 42.119  44.423  1.00 30.89  ? 338 CYS A CB  1 
ATOM   1313 S  SG  . CYS A 1 158 ? 105.675 43.784  44.629  1.00 32.76  ? 338 CYS A SG  1 
ATOM   1314 N  N   . ASN A 1 159 ? 105.560 38.683  44.732  1.00 28.02  ? 339 ASN A N   1 
ATOM   1315 C  CA  . ASN A 1 159 ? 104.876 37.430  44.462  1.00 27.41  ? 339 ASN A CA  1 
ATOM   1316 C  C   . ASN A 1 159 ? 104.460 36.608  45.676  1.00 27.84  ? 339 ASN A C   1 
ATOM   1317 O  O   . ASN A 1 159 ? 105.156 35.672  46.075  1.00 28.11  ? 339 ASN A O   1 
ATOM   1318 C  CB  . ASN A 1 159 ? 105.726 36.570  43.531  1.00 26.13  ? 339 ASN A CB  1 
ATOM   1319 C  CG  . ASN A 1 159 ? 104.987 35.336  43.058  1.00 26.15  ? 339 ASN A CG  1 
ATOM   1320 O  OD1 . ASN A 1 159 ? 103.807 35.149  43.371  1.00 24.14  ? 339 ASN A OD1 1 
ATOM   1321 N  ND2 . ASN A 1 159 ? 105.670 34.492  42.293  1.00 24.68  ? 339 ASN A ND2 1 
ATOM   1322 N  N   . ILE A 1 160 ? 103.306 36.931  46.248  1.00 27.31  ? 340 ILE A N   1 
ATOM   1323 C  CA  . ILE A 1 160 ? 102.840 36.192  47.409  1.00 26.77  ? 340 ILE A CA  1 
ATOM   1324 C  C   . ILE A 1 160 ? 102.565 34.721  47.085  1.00 27.97  ? 340 ILE A C   1 
ATOM   1325 O  O   . ILE A 1 160 ? 102.289 33.931  47.986  1.00 28.15  ? 340 ILE A O   1 
ATOM   1326 C  CB  . ILE A 1 160 ? 101.564 36.816  48.011  1.00 26.02  ? 340 ILE A CB  1 
ATOM   1327 C  CG1 . ILE A 1 160 ? 100.507 37.014  46.926  1.00 24.36  ? 340 ILE A CG1 1 
ATOM   1328 C  CG2 . ILE A 1 160 ? 101.901 38.126  48.695  1.00 26.17  ? 340 ILE A CG2 1 
ATOM   1329 C  CD1 . ILE A 1 160 ? 99.125  37.300  47.482  1.00 23.96  ? 340 ILE A CD1 1 
ATOM   1330 N  N   . PHE A 1 161 ? 102.644 34.352  45.809  1.00 27.49  ? 341 PHE A N   1 
ATOM   1331 C  CA  . PHE A 1 161 ? 102.405 32.967  45.408  1.00 28.17  ? 341 PHE A CA  1 
ATOM   1332 C  C   . PHE A 1 161 ? 103.704 32.215  45.083  1.00 29.64  ? 341 PHE A C   1 
ATOM   1333 O  O   . PHE A 1 161 ? 103.666 31.083  44.603  1.00 30.12  ? 341 PHE A O   1 
ATOM   1334 C  CB  . PHE A 1 161 ? 101.492 32.906  44.172  1.00 26.84  ? 341 PHE A CB  1 
ATOM   1335 C  CG  . PHE A 1 161 ? 100.152 33.579  44.347  1.00 25.92  ? 341 PHE A CG  1 
ATOM   1336 C  CD1 . PHE A 1 161 ? 99.570  33.709  45.603  1.00 26.00  ? 341 PHE A CD1 1 
ATOM   1337 C  CD2 . PHE A 1 161 ? 99.442  34.031  43.234  1.00 25.48  ? 341 PHE A CD2 1 
ATOM   1338 C  CE1 . PHE A 1 161 ? 98.306  34.275  45.751  1.00 25.58  ? 341 PHE A CE1 1 
ATOM   1339 C  CE2 . PHE A 1 161 ? 98.179  34.596  43.368  1.00 25.22  ? 341 PHE A CE2 1 
ATOM   1340 C  CZ  . PHE A 1 161 ? 97.607  34.719  44.632  1.00 25.75  ? 341 PHE A CZ  1 
ATOM   1341 N  N   . SER A 1 162 ? 104.852 32.828  45.356  1.00 31.09  ? 342 SER A N   1 
ATOM   1342 C  CA  . SER A 1 162 ? 106.134 32.199  45.041  1.00 32.53  ? 342 SER A CA  1 
ATOM   1343 C  C   . SER A 1 162 ? 106.350 30.808  45.631  1.00 33.27  ? 342 SER A C   1 
ATOM   1344 O  O   . SER A 1 162 ? 107.112 30.018  45.073  1.00 33.73  ? 342 SER A O   1 
ATOM   1345 C  CB  . SER A 1 162 ? 107.296 33.106  45.460  1.00 33.06  ? 342 SER A CB  1 
ATOM   1346 O  OG  . SER A 1 162 ? 107.385 33.211  46.871  1.00 34.48  ? 342 SER A OG  1 
ATOM   1347 N  N   . ASN A 1 163 ? 105.691 30.495  46.743  1.00 33.64  ? 343 ASN A N   1 
ATOM   1348 C  CA  . ASN A 1 163 ? 105.869 29.182  47.355  1.00 34.15  ? 343 ASN A CA  1 
ATOM   1349 C  C   . ASN A 1 163 ? 104.725 28.222  47.100  1.00 34.56  ? 343 ASN A C   1 
ATOM   1350 O  O   . ASN A 1 163 ? 104.597 27.203  47.775  1.00 36.10  ? 343 ASN A O   1 
ATOM   1351 C  CB  . ASN A 1 163 ? 106.101 29.309  48.861  1.00 33.69  ? 343 ASN A CB  1 
ATOM   1352 C  CG  . ASN A 1 163 ? 107.341 30.103  49.184  1.00 33.85  ? 343 ASN A CG  1 
ATOM   1353 O  OD1 . ASN A 1 163 ? 108.385 29.940  48.544  1.00 34.90  ? 343 ASN A OD1 1 
ATOM   1354 N  ND2 . ASN A 1 163 ? 107.241 30.967  50.183  1.00 33.78  ? 343 ASN A ND2 1 
ATOM   1355 N  N   . ILE A 1 164 ? 103.887 28.544  46.128  1.00 34.89  ? 344 ILE A N   1 
ATOM   1356 C  CA  . ILE A 1 164 ? 102.781 27.668  45.790  1.00 34.91  ? 344 ILE A CA  1 
ATOM   1357 C  C   . ILE A 1 164 ? 103.212 26.896  44.546  1.00 35.97  ? 344 ILE A C   1 
ATOM   1358 O  O   . ILE A 1 164 ? 103.722 27.483  43.594  1.00 36.38  ? 344 ILE A O   1 
ATOM   1359 C  CB  . ILE A 1 164 ? 101.497 28.481  45.489  1.00 34.78  ? 344 ILE A CB  1 
ATOM   1360 C  CG1 . ILE A 1 164 ? 101.081 29.264  46.740  1.00 33.66  ? 344 ILE A CG1 1 
ATOM   1361 C  CG2 . ILE A 1 164 ? 100.370 27.555  45.039  1.00 32.21  ? 344 ILE A CG2 1 
ATOM   1362 C  CD1 . ILE A 1 164 ? 99.834  30.115  46.548  1.00 33.04  ? 344 ILE A CD1 1 
ATOM   1363 N  N   . PRO A 1 165 ? 103.046 25.563  44.548  1.00 36.29  ? 345 PRO A N   1 
ATOM   1364 C  CA  . PRO A 1 165 ? 103.451 24.806  43.357  1.00 36.62  ? 345 PRO A CA  1 
ATOM   1365 C  C   . PRO A 1 165 ? 102.681 25.286  42.114  1.00 37.09  ? 345 PRO A C   1 
ATOM   1366 O  O   . PRO A 1 165 ? 101.526 25.700  42.215  1.00 37.45  ? 345 PRO A O   1 
ATOM   1367 C  CB  . PRO A 1 165 ? 103.138 23.357  43.743  1.00 36.26  ? 345 PRO A CB  1 
ATOM   1368 C  CG  . PRO A 1 165 ? 102.019 23.496  44.741  1.00 37.29  ? 345 PRO A CG  1 
ATOM   1369 C  CD  . PRO A 1 165 ? 102.457 24.680  45.570  1.00 35.97  ? 345 PRO A CD  1 
ATOM   1370 N  N   . PRO A 1 166 ? 103.319 25.238  40.931  1.00 36.86  ? 346 PRO A N   1 
ATOM   1371 C  CA  . PRO A 1 166 ? 102.716 25.667  39.663  1.00 36.90  ? 346 PRO A CA  1 
ATOM   1372 C  C   . PRO A 1 166 ? 101.264 25.281  39.412  1.00 36.77  ? 346 PRO A C   1 
ATOM   1373 O  O   . PRO A 1 166 ? 100.500 26.087  38.884  1.00 36.93  ? 346 PRO A O   1 
ATOM   1374 C  CB  . PRO A 1 166 ? 103.675 25.103  38.605  1.00 36.96  ? 346 PRO A CB  1 
ATOM   1375 C  CG  . PRO A 1 166 ? 104.406 24.007  39.331  1.00 38.08  ? 346 PRO A CG  1 
ATOM   1376 C  CD  . PRO A 1 166 ? 104.621 24.602  40.687  1.00 36.60  ? 346 PRO A CD  1 
ATOM   1377 N  N   . ASP A 1 167 ? 100.872 24.064  39.774  1.00 36.81  ? 347 ASP A N   1 
ATOM   1378 C  CA  . ASP A 1 167 ? 99.483  23.652  39.568  1.00 37.03  ? 347 ASP A CA  1 
ATOM   1379 C  C   . ASP A 1 167 ? 98.566  24.488  40.451  1.00 35.59  ? 347 ASP A C   1 
ATOM   1380 O  O   . ASP A 1 167 ? 97.446  24.829  40.059  1.00 34.44  ? 347 ASP A O   1 
ATOM   1381 C  CB  . ASP A 1 167 ? 99.287  22.168  39.890  1.00 40.22  ? 347 ASP A CB  1 
ATOM   1382 C  CG  . ASP A 1 167 ? 99.754  21.258  38.764  1.00 43.80  ? 347 ASP A CG  1 
ATOM   1383 O  OD1 . ASP A 1 167 ? 99.560  20.023  38.887  1.00 45.60  ? 347 ASP A OD1 1 
ATOM   1384 O  OD2 . ASP A 1 167 ? 100.311 21.771  37.763  1.00 44.71  ? 347 ASP A OD2 1 
ATOM   1385 N  N   . GLY A 1 168 ? 99.048  24.807  41.648  1.00 34.14  ? 348 GLY A N   1 
ATOM   1386 C  CA  . GLY A 1 168 ? 98.273  25.624  42.563  1.00 32.54  ? 348 GLY A CA  1 
ATOM   1387 C  C   . GLY A 1 168 ? 98.157  27.018  41.983  1.00 31.79  ? 348 GLY A C   1 
ATOM   1388 O  O   . GLY A 1 168 ? 97.090  27.637  42.028  1.00 31.19  ? 348 GLY A O   1 
ATOM   1389 N  N   . PHE A 1 169 ? 99.259  27.513  41.428  1.00 31.13  ? 349 PHE A N   1 
ATOM   1390 C  CA  . PHE A 1 169 ? 99.261  28.833  40.816  1.00 31.60  ? 349 PHE A CA  1 
ATOM   1391 C  C   . PHE A 1 169 ? 98.218  28.901  39.700  1.00 31.27  ? 349 PHE A C   1 
ATOM   1392 O  O   . PHE A 1 169 ? 97.380  29.807  39.685  1.00 29.95  ? 349 PHE A O   1 
ATOM   1393 C  CB  . PHE A 1 169 ? 100.633 29.163  40.230  1.00 31.60  ? 349 PHE A CB  1 
ATOM   1394 C  CG  . PHE A 1 169 ? 100.678 30.493  39.528  1.00 32.38  ? 349 PHE A CG  1 
ATOM   1395 C  CD1 . PHE A 1 169 ? 100.715 31.680  40.259  1.00 32.35  ? 349 PHE A CD1 1 
ATOM   1396 C  CD2 . PHE A 1 169 ? 100.624 30.565  38.141  1.00 31.93  ? 349 PHE A CD2 1 
ATOM   1397 C  CE1 . PHE A 1 169 ? 100.694 32.917  39.618  1.00 32.01  ? 349 PHE A CE1 1 
ATOM   1398 C  CE2 . PHE A 1 169 ? 100.602 31.800  37.490  1.00 32.71  ? 349 PHE A CE2 1 
ATOM   1399 C  CZ  . PHE A 1 169 ? 100.635 32.978  38.231  1.00 32.10  ? 349 PHE A CZ  1 
ATOM   1400 N  N   . LYS A 1 170 ? 98.272  27.941  38.774  1.00 30.91  ? 350 LYS A N   1 
ATOM   1401 C  CA  . LYS A 1 170 ? 97.337  27.903  37.651  1.00 32.25  ? 350 LYS A CA  1 
ATOM   1402 C  C   . LYS A 1 170 ? 95.891  27.914  38.121  1.00 31.72  ? 350 LYS A C   1 
ATOM   1403 O  O   . LYS A 1 170 ? 95.051  28.605  37.546  1.00 31.04  ? 350 LYS A O   1 
ATOM   1404 C  CB  . LYS A 1 170 ? 97.551  26.659  36.776  1.00 34.32  ? 350 LYS A CB  1 
ATOM   1405 C  CG  . LYS A 1 170 ? 98.825  26.648  35.920  1.00 38.99  ? 350 LYS A CG  1 
ATOM   1406 C  CD  . LYS A 1 170 ? 98.785  25.465  34.936  1.00 42.21  ? 350 LYS A CD  1 
ATOM   1407 C  CE  . LYS A 1 170 ? 100.072 25.319  34.128  1.00 44.57  ? 350 LYS A CE  1 
ATOM   1408 N  NZ  . LYS A 1 170 ? 101.226 24.838  34.961  1.00 47.78  ? 350 LYS A NZ  1 
ATOM   1409 N  N   . GLN A 1 171 ? 95.604  27.138  39.161  1.00 30.31  ? 351 GLN A N   1 
ATOM   1410 C  CA  . GLN A 1 171 ? 94.257  27.061  39.702  1.00 30.91  ? 351 GLN A CA  1 
ATOM   1411 C  C   . GLN A 1 171 ? 93.800  28.399  40.302  1.00 29.38  ? 351 GLN A C   1 
ATOM   1412 O  O   . GLN A 1 171 ? 92.656  28.813  40.125  1.00 29.30  ? 351 GLN A O   1 
ATOM   1413 C  CB  . GLN A 1 171 ? 94.186  25.959  40.766  1.00 32.09  ? 351 GLN A CB  1 
ATOM   1414 C  CG  . GLN A 1 171 ? 92.817  25.843  41.419  1.00 37.16  ? 351 GLN A CG  1 
ATOM   1415 C  CD  . GLN A 1 171 ? 92.735  24.745  42.471  1.00 40.19  ? 351 GLN A CD  1 
ATOM   1416 O  OE1 . GLN A 1 171 ? 91.690  24.558  43.100  1.00 41.53  ? 351 GLN A OE1 1 
ATOM   1417 N  NE2 . GLN A 1 171 ? 93.835  24.015  42.667  1.00 40.76  ? 351 GLN A NE2 1 
ATOM   1418 N  N   . ILE A 1 172 ? 94.702  29.060  41.017  1.00 28.57  ? 352 ILE A N   1 
ATOM   1419 C  CA  . ILE A 1 172 ? 94.416  30.342  41.648  1.00 27.69  ? 352 ILE A CA  1 
ATOM   1420 C  C   . ILE A 1 172 ? 94.203  31.422  40.589  1.00 27.19  ? 352 ILE A C   1 
ATOM   1421 O  O   . ILE A 1 172 ? 93.231  32.182  40.643  1.00 27.45  ? 352 ILE A O   1 
ATOM   1422 C  CB  . ILE A 1 172 ? 95.582  30.744  42.574  1.00 27.46  ? 352 ILE A CB  1 
ATOM   1423 C  CG1 . ILE A 1 172 ? 95.625  29.793  43.776  1.00 27.87  ? 352 ILE A CG1 1 
ATOM   1424 C  CG2 . ILE A 1 172 ? 95.430  32.192  43.027  1.00 27.69  ? 352 ILE A CG2 1 
ATOM   1425 C  CD1 . ILE A 1 172 ? 96.935  29.809  44.535  1.00 26.55  ? 352 ILE A CD1 1 
ATOM   1426 N  N   . ARG A 1 173 ? 95.115  31.469  39.622  1.00 26.72  ? 353 ARG A N   1 
ATOM   1427 C  CA  . ARG A 1 173 ? 95.060  32.436  38.531  1.00 26.16  ? 353 ARG A CA  1 
ATOM   1428 C  C   . ARG A 1 173 ? 93.721  32.334  37.806  1.00 26.32  ? 353 ARG A C   1 
ATOM   1429 O  O   . ARG A 1 173 ? 93.024  33.333  37.620  1.00 26.34  ? 353 ARG A O   1 
ATOM   1430 C  CB  . ARG A 1 173 ? 96.217  32.180  37.557  1.00 23.91  ? 353 ARG A CB  1 
ATOM   1431 C  CG  . ARG A 1 173 ? 96.197  33.038  36.301  1.00 23.29  ? 353 ARG A CG  1 
ATOM   1432 C  CD  . ARG A 1 173 ? 97.470  32.840  35.492  1.00 21.51  ? 353 ARG A CD  1 
ATOM   1433 N  NE  . ARG A 1 173 ? 97.344  33.329  34.124  1.00 21.72  ? 353 ARG A NE  1 
ATOM   1434 C  CZ  . ARG A 1 173 ? 97.336  34.613  33.770  1.00 21.30  ? 353 ARG A CZ  1 
ATOM   1435 N  NH1 . ARG A 1 173 ? 97.450  35.568  34.686  1.00 20.67  ? 353 ARG A NH1 1 
ATOM   1436 N  NH2 . ARG A 1 173 ? 97.219  34.941  32.492  1.00 20.58  ? 353 ARG A NH2 1 
ATOM   1437 N  N   . GLN A 1 174 ? 93.360  31.120  37.409  1.00 26.47  ? 354 GLN A N   1 
ATOM   1438 C  CA  . GLN A 1 174 ? 92.100  30.894  36.713  1.00 27.22  ? 354 GLN A CA  1 
ATOM   1439 C  C   . GLN A 1 174 ? 90.934  31.397  37.554  1.00 25.97  ? 354 GLN A C   1 
ATOM   1440 O  O   . GLN A 1 174 ? 90.044  32.079  37.043  1.00 24.23  ? 354 GLN A O   1 
ATOM   1441 C  CB  . GLN A 1 174 ? 91.905  29.402  36.409  1.00 29.79  ? 354 GLN A CB  1 
ATOM   1442 C  CG  . GLN A 1 174 ? 90.544  29.081  35.785  1.00 35.17  ? 354 GLN A CG  1 
ATOM   1443 C  CD  . GLN A 1 174 ? 90.340  29.762  34.431  1.00 38.87  ? 354 GLN A CD  1 
ATOM   1444 O  OE1 . GLN A 1 174 ? 91.032  29.453  33.453  1.00 41.14  ? 354 GLN A OE1 1 
ATOM   1445 N  NE2 . GLN A 1 174 ? 89.391  30.697  34.372  1.00 39.73  ? 354 GLN A NE2 1 
ATOM   1446 N  N   . GLY A 1 175 ? 90.942  31.050  38.841  1.00 24.41  ? 355 GLY A N   1 
ATOM   1447 C  CA  . GLY A 1 175 ? 89.880  31.479  39.733  1.00 23.55  ? 355 GLY A CA  1 
ATOM   1448 C  C   . GLY A 1 175 ? 89.801  32.994  39.877  1.00 23.90  ? 355 GLY A C   1 
ATOM   1449 O  O   . GLY A 1 175 ? 88.713  33.569  39.846  1.00 23.45  ? 355 GLY A O   1 
ATOM   1450 N  N   . MET A 1 176 ? 90.950  33.645  40.035  1.00 23.77  ? 356 MET A N   1 
ATOM   1451 C  CA  . MET A 1 176 ? 90.977  35.094  40.178  1.00 24.01  ? 356 MET A CA  1 
ATOM   1452 C  C   . MET A 1 176 ? 90.464  35.770  38.914  1.00 24.48  ? 356 MET A C   1 
ATOM   1453 O  O   . MET A 1 176 ? 89.676  36.710  38.981  1.00 25.31  ? 356 MET A O   1 
ATOM   1454 C  CB  . MET A 1 176 ? 92.396  35.569  40.491  1.00 23.27  ? 356 MET A CB  1 
ATOM   1455 C  CG  . MET A 1 176 ? 92.808  35.337  41.943  1.00 21.81  ? 356 MET A CG  1 
ATOM   1456 S  SD  . MET A 1 176 ? 94.487  35.881  42.297  1.00 23.30  ? 356 MET A SD  1 
ATOM   1457 C  CE  . MET A 1 176 ? 94.405  37.598  41.781  1.00 22.90  ? 356 MET A CE  1 
ATOM   1458 N  N   . ILE A 1 177 ? 90.901  35.286  37.759  1.00 24.82  ? 357 ILE A N   1 
ATOM   1459 C  CA  . ILE A 1 177 ? 90.455  35.862  36.496  1.00 24.76  ? 357 ILE A CA  1 
ATOM   1460 C  C   . ILE A 1 177 ? 88.930  35.784  36.397  1.00 24.10  ? 357 ILE A C   1 
ATOM   1461 O  O   . ILE A 1 177 ? 88.263  36.775  36.097  1.00 23.33  ? 357 ILE A O   1 
ATOM   1462 C  CB  . ILE A 1 177 ? 91.102  35.123  35.300  1.00 24.98  ? 357 ILE A CB  1 
ATOM   1463 C  CG1 . ILE A 1 177 ? 92.603  35.448  35.253  1.00 24.63  ? 357 ILE A CG1 1 
ATOM   1464 C  CG2 . ILE A 1 177 ? 90.405  35.507  33.994  1.00 25.13  ? 357 ILE A CG2 1 
ATOM   1465 C  CD1 . ILE A 1 177 ? 93.383  34.648  34.224  1.00 23.49  ? 357 ILE A CD1 1 
ATOM   1466 N  N   . THR A 1 178 ? 88.380  34.604  36.659  1.00 24.00  ? 358 THR A N   1 
ATOM   1467 C  CA  . THR A 1 178 ? 86.936  34.409  36.595  1.00 23.63  ? 358 THR A CA  1 
ATOM   1468 C  C   . THR A 1 178 ? 86.183  35.402  37.477  1.00 23.29  ? 358 THR A C   1 
ATOM   1469 O  O   . THR A 1 178 ? 85.200  36.000  37.046  1.00 23.25  ? 358 THR A O   1 
ATOM   1470 C  CB  . THR A 1 178 ? 86.534  32.990  37.053  1.00 24.04  ? 358 THR A CB  1 
ATOM   1471 O  OG1 . THR A 1 178 ? 87.117  32.018  36.178  1.00 24.52  ? 358 THR A OG1 1 
ATOM   1472 C  CG2 . THR A 1 178 ? 85.021  32.836  37.036  1.00 23.44  ? 358 THR A CG2 1 
ATOM   1473 N  N   . LEU A 1 179 ? 86.644  35.569  38.714  1.00 22.41  ? 359 LEU A N   1 
ATOM   1474 C  CA  . LEU A 1 179 ? 85.981  36.465  39.657  1.00 22.65  ? 359 LEU A CA  1 
ATOM   1475 C  C   . LEU A 1 179 ? 86.070  37.951  39.303  1.00 22.30  ? 359 LEU A C   1 
ATOM   1476 O  O   . LEU A 1 179 ? 85.071  38.663  39.359  1.00 23.67  ? 359 LEU A O   1 
ATOM   1477 C  CB  . LEU A 1 179 ? 86.524  36.234  41.075  1.00 22.85  ? 359 LEU A CB  1 
ATOM   1478 C  CG  . LEU A 1 179 ? 86.352  34.815  41.634  1.00 22.03  ? 359 LEU A CG  1 
ATOM   1479 C  CD1 . LEU A 1 179 ? 86.512  34.854  43.148  1.00 19.56  ? 359 LEU A CD1 1 
ATOM   1480 C  CD2 . LEU A 1 179 ? 84.977  34.267  41.263  1.00 20.99  ? 359 LEU A CD2 1 
ATOM   1481 N  N   . ILE A 1 180 ? 87.258  38.416  38.944  1.00 21.11  ? 360 ILE A N   1 
ATOM   1482 C  CA  . ILE A 1 180 ? 87.430  39.810  38.588  1.00 21.55  ? 360 ILE A CA  1 
ATOM   1483 C  C   . ILE A 1 180 ? 86.588  40.144  37.354  1.00 22.86  ? 360 ILE A C   1 
ATOM   1484 O  O   . ILE A 1 180 ? 85.895  41.165  37.334  1.00 23.13  ? 360 ILE A O   1 
ATOM   1485 C  CB  . ILE A 1 180 ? 88.916  40.129  38.340  1.00 20.97  ? 360 ILE A CB  1 
ATOM   1486 C  CG1 . ILE A 1 180 ? 89.696  39.920  39.645  1.00 20.02  ? 360 ILE A CG1 1 
ATOM   1487 C  CG2 . ILE A 1 180 ? 89.069  41.562  37.846  1.00 20.46  ? 360 ILE A CG2 1 
ATOM   1488 C  CD1 . ILE A 1 180 ? 91.185  40.216  39.554  1.00 19.70  ? 360 ILE A CD1 1 
ATOM   1489 N  N   . LEU A 1 181 ? 86.623  39.285  36.337  1.00 21.93  ? 361 LEU A N   1 
ATOM   1490 C  CA  . LEU A 1 181 ? 85.824  39.533  35.137  1.00 22.37  ? 361 LEU A CA  1 
ATOM   1491 C  C   . LEU A 1 181 ? 84.340  39.523  35.487  1.00 21.60  ? 361 LEU A C   1 
ATOM   1492 O  O   . LEU A 1 181 ? 83.540  40.224  34.871  1.00 21.41  ? 361 LEU A O   1 
ATOM   1493 C  CB  . LEU A 1 181 ? 86.105  38.473  34.062  1.00 23.15  ? 361 LEU A CB  1 
ATOM   1494 C  CG  . LEU A 1 181 ? 87.492  38.564  33.413  1.00 24.00  ? 361 LEU A CG  1 
ATOM   1495 C  CD1 . LEU A 1 181 ? 87.664  37.460  32.383  1.00 23.31  ? 361 LEU A CD1 1 
ATOM   1496 C  CD2 . LEU A 1 181 ? 87.646  39.932  32.752  1.00 23.48  ? 361 LEU A CD2 1 
ATOM   1497 N  N   . ALA A 1 182 ? 83.978  38.737  36.492  1.00 20.45  ? 362 ALA A N   1 
ATOM   1498 C  CA  . ALA A 1 182 ? 82.590  38.638  36.904  1.00 20.45  ? 362 ALA A CA  1 
ATOM   1499 C  C   . ALA A 1 182 ? 82.065  39.924  37.541  1.00 21.41  ? 362 ALA A C   1 
ATOM   1500 O  O   . ALA A 1 182 ? 80.856  40.069  37.707  1.00 20.72  ? 362 ALA A O   1 
ATOM   1501 C  CB  . ALA A 1 182 ? 82.413  37.465  37.871  1.00 19.75  ? 362 ALA A CB  1 
ATOM   1502 N  N   . THR A 1 183 ? 82.951  40.861  37.890  1.00 21.65  ? 363 THR A N   1 
ATOM   1503 C  CA  . THR A 1 183 ? 82.482  42.103  38.511  1.00 22.64  ? 363 THR A CA  1 
ATOM   1504 C  C   . THR A 1 183 ? 81.901  43.112  37.514  1.00 23.53  ? 363 THR A C   1 
ATOM   1505 O  O   . THR A 1 183 ? 81.336  44.128  37.916  1.00 23.45  ? 363 THR A O   1 
ATOM   1506 C  CB  . THR A 1 183 ? 83.587  42.806  39.357  1.00 21.87  ? 363 THR A CB  1 
ATOM   1507 O  OG1 . THR A 1 183 ? 84.715  43.125  38.535  1.00 21.77  ? 363 THR A OG1 1 
ATOM   1508 C  CG2 . THR A 1 183 ? 84.025  41.914  40.496  1.00 20.32  ? 363 THR A CG2 1 
ATOM   1509 N  N   . ASP A 1 184 ? 82.031  42.834  36.220  1.00 23.47  ? 364 ASP A N   1 
ATOM   1510 C  CA  . ASP A 1 184 ? 81.478  43.720  35.194  1.00 23.45  ? 364 ASP A CA  1 
ATOM   1511 C  C   . ASP A 1 184 ? 79.952  43.677  35.286  1.00 25.15  ? 364 ASP A C   1 
ATOM   1512 O  O   . ASP A 1 184 ? 79.328  42.678  34.913  1.00 25.09  ? 364 ASP A O   1 
ATOM   1513 C  CB  . ASP A 1 184 ? 81.916  43.254  33.810  1.00 23.41  ? 364 ASP A CB  1 
ATOM   1514 C  CG  . ASP A 1 184 ? 81.359  44.127  32.691  1.00 24.70  ? 364 ASP A CG  1 
ATOM   1515 O  OD1 . ASP A 1 184 ? 80.497  44.992  32.970  1.00 24.21  ? 364 ASP A OD1 1 
ATOM   1516 O  OD2 . ASP A 1 184 ? 81.782  43.937  31.528  1.00 23.44  ? 364 ASP A OD2 1 
ATOM   1517 N  N   . MET A 1 185 ? 79.353  44.759  35.779  1.00 26.44  ? 365 MET A N   1 
ATOM   1518 C  CA  . MET A 1 185 ? 77.897  44.831  35.940  1.00 27.84  ? 365 MET A CA  1 
ATOM   1519 C  C   . MET A 1 185 ? 77.081  44.563  34.676  1.00 28.26  ? 365 MET A C   1 
ATOM   1520 O  O   . MET A 1 185 ? 75.886  44.271  34.759  1.00 27.90  ? 365 MET A O   1 
ATOM   1521 C  CB  . MET A 1 185 ? 77.483  46.187  36.524  1.00 28.14  ? 365 MET A CB  1 
ATOM   1522 C  CG  . MET A 1 185 ? 77.642  46.290  38.039  1.00 29.97  ? 365 MET A CG  1 
ATOM   1523 S  SD  . MET A 1 185 ? 76.784  44.953  38.938  1.00 31.51  ? 365 MET A SD  1 
ATOM   1524 C  CE  . MET A 1 185 ? 75.059  45.314  38.569  1.00 28.98  ? 365 MET A CE  1 
ATOM   1525 N  N   . ALA A 1 186 ? 77.709  44.659  33.511  1.00 27.94  ? 366 ALA A N   1 
ATOM   1526 C  CA  . ALA A 1 186 ? 76.983  44.398  32.273  1.00 30.11  ? 366 ALA A CA  1 
ATOM   1527 C  C   . ALA A 1 186 ? 76.547  42.931  32.230  1.00 30.70  ? 366 ALA A C   1 
ATOM   1528 O  O   . ALA A 1 186 ? 75.592  42.580  31.541  1.00 31.45  ? 366 ALA A O   1 
ATOM   1529 C  CB  . ALA A 1 186 ? 77.862  44.726  31.059  1.00 29.57  ? 366 ALA A CB  1 
ATOM   1530 N  N   . ARG A 1 187 ? 77.250  42.080  32.974  1.00 30.79  ? 367 ARG A N   1 
ATOM   1531 C  CA  . ARG A 1 187 ? 76.940  40.649  33.020  1.00 29.53  ? 367 ARG A CA  1 
ATOM   1532 C  C   . ARG A 1 187 ? 76.108  40.281  34.243  1.00 29.99  ? 367 ARG A C   1 
ATOM   1533 O  O   . ARG A 1 187 ? 75.883  39.099  34.506  1.00 30.81  ? 367 ARG A O   1 
ATOM   1534 C  CB  . ARG A 1 187 ? 78.231  39.830  33.061  1.00 28.70  ? 367 ARG A CB  1 
ATOM   1535 C  CG  . ARG A 1 187 ? 79.107  39.940  31.834  1.00 29.05  ? 367 ARG A CG  1 
ATOM   1536 C  CD  . ARG A 1 187 ? 80.395  39.150  32.044  1.00 30.30  ? 367 ARG A CD  1 
ATOM   1537 N  NE  . ARG A 1 187 ? 80.131  37.751  32.383  1.00 29.57  ? 367 ARG A NE  1 
ATOM   1538 C  CZ  . ARG A 1 187 ? 81.041  36.922  32.887  1.00 30.74  ? 367 ARG A CZ  1 
ATOM   1539 N  NH1 . ARG A 1 187 ? 82.283  37.350  33.113  1.00 28.96  ? 367 ARG A NH1 1 
ATOM   1540 N  NH2 . ARG A 1 187 ? 80.710  35.666  33.169  1.00 28.17  ? 367 ARG A NH2 1 
ATOM   1541 N  N   . HIS A 1 188 ? 75.649  41.283  34.987  1.00 29.04  ? 368 HIS A N   1 
ATOM   1542 C  CA  . HIS A 1 188 ? 74.878  41.023  36.197  1.00 29.04  ? 368 HIS A CA  1 
ATOM   1543 C  C   . HIS A 1 188 ? 73.661  40.109  36.050  1.00 30.64  ? 368 HIS A C   1 
ATOM   1544 O  O   . HIS A 1 188 ? 73.504  39.161  36.823  1.00 31.39  ? 368 HIS A O   1 
ATOM   1545 C  CB  . HIS A 1 188 ? 74.428  42.330  36.844  1.00 26.62  ? 368 HIS A CB  1 
ATOM   1546 C  CG  . HIS A 1 188 ? 73.645  42.129  38.101  1.00 25.47  ? 368 HIS A CG  1 
ATOM   1547 N  ND1 . HIS A 1 188 ? 74.225  41.707  39.279  1.00 24.45  ? 368 HIS A ND1 1 
ATOM   1548 C  CD2 . HIS A 1 188 ? 72.319  42.245  38.355  1.00 24.91  ? 368 HIS A CD2 1 
ATOM   1549 C  CE1 . HIS A 1 188 ? 73.290  41.573  40.204  1.00 24.27  ? 368 HIS A CE1 1 
ATOM   1550 N  NE2 . HIS A 1 188 ? 72.125  41.892  39.669  1.00 24.82  ? 368 HIS A NE2 1 
ATOM   1551 N  N   . ALA A 1 189 ? 72.787  40.404  35.092  1.00 31.27  ? 369 ALA A N   1 
ATOM   1552 C  CA  . ALA A 1 189 ? 71.591  39.585  34.888  1.00 32.77  ? 369 ALA A CA  1 
ATOM   1553 C  C   . ALA A 1 189 ? 71.967  38.149  34.495  1.00 33.33  ? 369 ALA A C   1 
ATOM   1554 O  O   . ALA A 1 189 ? 71.397  37.189  35.011  1.00 33.95  ? 369 ALA A O   1 
ATOM   1555 C  CB  . ALA A 1 189 ? 70.693  40.218  33.816  1.00 32.13  ? 369 ALA A CB  1 
ATOM   1556 N  N   . GLU A 1 190 ? 72.925  38.022  33.580  1.00 34.05  ? 370 GLU A N   1 
ATOM   1557 C  CA  . GLU A 1 190 ? 73.430  36.727  33.112  1.00 35.41  ? 370 GLU A CA  1 
ATOM   1558 C  C   . GLU A 1 190 ? 73.914  35.878  34.291  1.00 34.54  ? 370 GLU A C   1 
ATOM   1559 O  O   . GLU A 1 190 ? 73.484  34.739  34.480  1.00 34.72  ? 370 GLU A O   1 
ATOM   1560 C  CB  . GLU A 1 190 ? 74.609  36.948  32.149  1.00 37.35  ? 370 GLU A CB  1 
ATOM   1561 C  CG  . GLU A 1 190 ? 75.402  35.683  31.777  1.00 41.06  ? 370 GLU A CG  1 
ATOM   1562 C  CD  . GLU A 1 190 ? 76.910  35.938  31.591  1.00 43.14  ? 370 GLU A CD  1 
ATOM   1563 O  OE1 . GLU A 1 190 ? 77.279  36.915  30.893  1.00 43.40  ? 370 GLU A OE1 1 
ATOM   1564 O  OE2 . GLU A 1 190 ? 77.724  35.150  32.140  1.00 42.35  ? 370 GLU A OE2 1 
ATOM   1565 N  N   . ILE A 1 191 ? 74.818  36.446  35.079  1.00 33.45  ? 371 ILE A N   1 
ATOM   1566 C  CA  . ILE A 1 191 ? 75.378  35.750  36.228  1.00 31.68  ? 371 ILE A CA  1 
ATOM   1567 C  C   . ILE A 1 191 ? 74.301  35.426  37.264  1.00 31.95  ? 371 ILE A C   1 
ATOM   1568 O  O   . ILE A 1 191 ? 74.279  34.330  37.823  1.00 32.12  ? 371 ILE A O   1 
ATOM   1569 C  CB  . ILE A 1 191 ? 76.517  36.589  36.849  1.00 30.49  ? 371 ILE A CB  1 
ATOM   1570 C  CG1 . ILE A 1 191 ? 77.631  36.761  35.808  1.00 29.11  ? 371 ILE A CG1 1 
ATOM   1571 C  CG2 . ILE A 1 191 ? 77.052  35.915  38.104  1.00 29.69  ? 371 ILE A CG2 1 
ATOM   1572 C  CD1 . ILE A 1 191 ? 78.713  37.767  36.187  1.00 27.29  ? 371 ILE A CD1 1 
ATOM   1573 N  N   . MET A 1 192 ? 73.396  36.365  37.516  1.00 31.77  ? 372 MET A N   1 
ATOM   1574 C  CA  . MET A 1 192 ? 72.328  36.109  38.473  1.00 32.91  ? 372 MET A CA  1 
ATOM   1575 C  C   . MET A 1 192 ? 71.437  34.963  37.982  1.00 33.63  ? 372 MET A C   1 
ATOM   1576 O  O   . MET A 1 192 ? 71.031  34.104  38.766  1.00 32.59  ? 372 MET A O   1 
ATOM   1577 C  CB  . MET A 1 192 ? 71.480  37.364  38.689  1.00 33.51  ? 372 MET A CB  1 
ATOM   1578 C  CG  . MET A 1 192 ? 72.014  38.308  39.756  1.00 35.19  ? 372 MET A CG  1 
ATOM   1579 S  SD  . MET A 1 192 ? 72.041  37.536  41.389  1.00 38.95  ? 372 MET A SD  1 
ATOM   1580 C  CE  . MET A 1 192 ? 70.300  37.684  41.867  1.00 37.00  ? 372 MET A CE  1 
ATOM   1581 N  N   . ASP A 1 193 ? 71.138  34.946  36.686  1.00 34.63  ? 373 ASP A N   1 
ATOM   1582 C  CA  . ASP A 1 193 ? 70.291  33.893  36.133  1.00 36.47  ? 373 ASP A CA  1 
ATOM   1583 C  C   . ASP A 1 193 ? 70.945  32.522  36.260  1.00 36.55  ? 373 ASP A C   1 
ATOM   1584 O  O   . ASP A 1 193 ? 70.292  31.564  36.669  1.00 36.18  ? 373 ASP A O   1 
ATOM   1585 C  CB  . ASP A 1 193 ? 69.949  34.171  34.662  1.00 38.15  ? 373 ASP A CB  1 
ATOM   1586 C  CG  . ASP A 1 193 ? 68.960  35.327  34.496  1.00 41.54  ? 373 ASP A CG  1 
ATOM   1587 O  OD1 . ASP A 1 193 ? 68.153  35.569  35.424  1.00 41.85  ? 373 ASP A OD1 1 
ATOM   1588 O  OD2 . ASP A 1 193 ? 68.981  35.980  33.427  1.00 43.14  ? 373 ASP A OD2 1 
ATOM   1589 N  N   . SER A 1 194 ? 72.229  32.433  35.915  1.00 36.82  ? 374 SER A N   1 
ATOM   1590 C  CA  . SER A 1 194 ? 72.957  31.170  36.011  1.00 37.92  ? 374 SER A CA  1 
ATOM   1591 C  C   . SER A 1 194 ? 73.002  30.687  37.454  1.00 38.27  ? 374 SER A C   1 
ATOM   1592 O  O   . SER A 1 194 ? 72.849  29.496  37.722  1.00 38.29  ? 374 SER A O   1 
ATOM   1593 C  CB  . SER A 1 194 ? 74.386  31.323  35.494  1.00 37.35  ? 374 SER A CB  1 
ATOM   1594 O  OG  . SER A 1 194 ? 74.387  31.754  34.148  1.00 40.47  ? 374 SER A OG  1 
ATOM   1595 N  N   . PHE A 1 195 ? 73.212  31.614  38.383  1.00 38.09  ? 375 PHE A N   1 
ATOM   1596 C  CA  . PHE A 1 195 ? 73.275  31.257  39.790  1.00 38.43  ? 375 PHE A CA  1 
ATOM   1597 C  C   . PHE A 1 195 ? 71.936  30.719  40.293  1.00 40.04  ? 375 PHE A C   1 
ATOM   1598 O  O   . PHE A 1 195 ? 71.888  29.695  40.968  1.00 40.07  ? 375 PHE A O   1 
ATOM   1599 C  CB  . PHE A 1 195 ? 73.684  32.469  40.624  1.00 36.38  ? 375 PHE A CB  1 
ATOM   1600 C  CG  . PHE A 1 195 ? 73.772  32.190  42.096  1.00 34.31  ? 375 PHE A CG  1 
ATOM   1601 C  CD1 . PHE A 1 195 ? 74.625  31.202  42.580  1.00 33.46  ? 375 PHE A CD1 1 
ATOM   1602 C  CD2 . PHE A 1 195 ? 73.019  32.926  43.001  1.00 33.33  ? 375 PHE A CD2 1 
ATOM   1603 C  CE1 . PHE A 1 195 ? 74.727  30.953  43.951  1.00 32.04  ? 375 PHE A CE1 1 
ATOM   1604 C  CE2 . PHE A 1 195 ? 73.113  32.685  44.369  1.00 32.84  ? 375 PHE A CE2 1 
ATOM   1605 C  CZ  . PHE A 1 195 ? 73.971  31.696  44.844  1.00 32.19  ? 375 PHE A CZ  1 
ATOM   1606 N  N   . LYS A 1 196 ? 70.852  31.418  39.975  1.00 42.36  ? 376 LYS A N   1 
ATOM   1607 C  CA  . LYS A 1 196 ? 69.527  30.990  40.411  1.00 44.91  ? 376 LYS A CA  1 
ATOM   1608 C  C   . LYS A 1 196 ? 69.138  29.646  39.790  1.00 45.56  ? 376 LYS A C   1 
ATOM   1609 O  O   . LYS A 1 196 ? 68.422  28.852  40.402  1.00 44.52  ? 376 LYS A O   1 
ATOM   1610 C  CB  . LYS A 1 196 ? 68.485  32.068  40.075  1.00 46.13  ? 376 LYS A CB  1 
ATOM   1611 C  CG  . LYS A 1 196 ? 68.527  33.267  41.029  1.00 48.69  ? 376 LYS A CG  1 
ATOM   1612 C  CD  . LYS A 1 196 ? 67.496  34.343  40.685  1.00 50.54  ? 376 LYS A CD  1 
ATOM   1613 C  CE  . LYS A 1 196 ? 67.828  35.043  39.371  1.00 51.96  ? 376 LYS A CE  1 
ATOM   1614 N  NZ  . LYS A 1 196 ? 66.868  36.138  39.041  1.00 52.74  ? 376 LYS A NZ  1 
ATOM   1615 N  N   . GLU A 1 197 ? 69.627  29.396  38.579  1.00 47.14  ? 377 GLU A N   1 
ATOM   1616 C  CA  . GLU A 1 197 ? 69.351  28.150  37.870  1.00 49.80  ? 377 GLU A CA  1 
ATOM   1617 C  C   . GLU A 1 197 ? 69.957  26.963  38.620  1.00 49.95  ? 377 GLU A C   1 
ATOM   1618 O  O   . GLU A 1 197 ? 69.385  25.875  38.656  1.00 49.82  ? 377 GLU A O   1 
ATOM   1619 C  CB  . GLU A 1 197 ? 69.934  28.219  36.458  1.00 51.62  ? 377 GLU A CB  1 
ATOM   1620 C  CG  . GLU A 1 197 ? 69.687  26.984  35.619  1.00 55.59  ? 377 GLU A CG  1 
ATOM   1621 C  CD  . GLU A 1 197 ? 70.292  27.105  34.234  1.00 58.55  ? 377 GLU A CD  1 
ATOM   1622 O  OE1 . GLU A 1 197 ? 71.540  27.147  34.125  1.00 60.30  ? 377 GLU A OE1 1 
ATOM   1623 O  OE2 . GLU A 1 197 ? 69.519  27.166  33.253  1.00 60.74  ? 377 GLU A OE2 1 
ATOM   1624 N  N   . LYS A 1 198 ? 71.120  27.187  39.219  1.00 49.91  ? 378 LYS A N   1 
ATOM   1625 C  CA  . LYS A 1 198 ? 71.808  26.152  39.972  1.00 50.59  ? 378 LYS A CA  1 
ATOM   1626 C  C   . LYS A 1 198 ? 71.284  26.156  41.408  1.00 50.78  ? 378 LYS A C   1 
ATOM   1627 O  O   . LYS A 1 198 ? 71.374  25.160  42.127  1.00 49.94  ? 378 LYS A O   1 
ATOM   1628 C  CB  . LYS A 1 198 ? 73.316  26.423  39.943  1.00 51.28  ? 378 LYS A CB  1 
ATOM   1629 C  CG  . LYS A 1 198 ? 73.818  26.846  38.565  1.00 52.22  ? 378 LYS A CG  1 
ATOM   1630 C  CD  . LYS A 1 198 ? 74.787  25.854  37.942  1.00 53.43  ? 378 LYS A CD  1 
ATOM   1631 C  CE  . LYS A 1 198 ? 75.128  26.265  36.507  1.00 54.97  ? 378 LYS A CE  1 
ATOM   1632 N  NZ  . LYS A 1 198 ? 76.220  25.446  35.894  1.00 56.39  ? 378 LYS A NZ  1 
ATOM   1633 N  N   . MET A 1 199 ? 70.715  27.285  41.811  1.00 51.37  ? 379 MET A N   1 
ATOM   1634 C  CA  . MET A 1 199 ? 70.174  27.436  43.154  1.00 52.55  ? 379 MET A CA  1 
ATOM   1635 C  C   . MET A 1 199 ? 68.926  26.575  43.361  1.00 53.71  ? 379 MET A C   1 
ATOM   1636 O  O   . MET A 1 199 ? 68.455  26.419  44.487  1.00 53.94  ? 379 MET A O   1 
ATOM   1637 C  CB  . MET A 1 199 ? 69.851  28.911  43.409  1.00 52.12  ? 379 MET A CB  1 
ATOM   1638 C  CG  . MET A 1 199 ? 69.755  29.305  44.880  1.00 52.63  ? 379 MET A CG  1 
ATOM   1639 S  SD  . MET A 1 199 ? 71.229  28.884  45.849  1.00 49.71  ? 379 MET A SD  1 
ATOM   1640 C  CE  . MET A 1 199 ? 72.461  28.889  44.615  1.00 51.80  ? 379 MET A CE  1 
ATOM   1641 N  N   . GLU A 1 200 ? 68.395  26.019  42.272  1.00 54.82  ? 380 GLU A N   1 
ATOM   1642 C  CA  . GLU A 1 200 ? 67.209  25.166  42.342  1.00 56.43  ? 380 GLU A CA  1 
ATOM   1643 C  C   . GLU A 1 200 ? 67.530  23.845  43.038  1.00 56.19  ? 380 GLU A C   1 
ATOM   1644 O  O   . GLU A 1 200 ? 66.639  23.158  43.543  1.00 56.50  ? 380 GLU A O   1 
ATOM   1645 C  CB  . GLU A 1 200 ? 66.677  24.876  40.937  1.00 58.79  ? 380 GLU A CB  1 
ATOM   1646 C  CG  . GLU A 1 200 ? 66.048  26.075  40.240  1.00 61.56  ? 380 GLU A CG  1 
ATOM   1647 C  CD  . GLU A 1 200 ? 65.503  25.732  38.859  1.00 63.35  ? 380 GLU A CD  1 
ATOM   1648 O  OE1 . GLU A 1 200 ? 66.307  25.376  37.964  1.00 63.59  ? 380 GLU A OE1 1 
ATOM   1649 O  OE2 . GLU A 1 200 ? 64.266  25.818  38.674  1.00 64.26  ? 380 GLU A OE2 1 
ATOM   1650 N  N   . ASN A 1 201 ? 68.812  23.501  43.056  1.00 55.05  ? 381 ASN A N   1 
ATOM   1651 C  CA  . ASN A 1 201 ? 69.286  22.271  43.676  1.00 53.43  ? 381 ASN A CA  1 
ATOM   1652 C  C   . ASN A 1 201 ? 70.785  22.467  43.851  1.00 51.44  ? 381 ASN A C   1 
ATOM   1653 O  O   . ASN A 1 201 ? 71.592  21.796  43.209  1.00 51.15  ? 381 ASN A O   1 
ATOM   1654 C  CB  . ASN A 1 201 ? 68.996  21.081  42.748  1.00 54.80  ? 381 ASN A CB  1 
ATOM   1655 C  CG  . ASN A 1 201 ? 69.235  19.737  43.417  1.00 54.99  ? 381 ASN A CG  1 
ATOM   1656 O  OD1 . ASN A 1 201 ? 70.335  19.190  43.372  1.00 55.08  ? 381 ASN A OD1 1 
ATOM   1657 N  ND2 . ASN A 1 201 ? 68.199  19.205  44.053  1.00 56.48  ? 381 ASN A ND2 1 
ATOM   1658 N  N   . PHE A 1 202 ? 71.152  23.402  44.722  1.00 49.47  ? 382 PHE A N   1 
ATOM   1659 C  CA  . PHE A 1 202 ? 72.557  23.711  44.943  1.00 46.79  ? 382 PHE A CA  1 
ATOM   1660 C  C   . PHE A 1 202 ? 73.367  22.545  45.486  1.00 45.38  ? 382 PHE A C   1 
ATOM   1661 O  O   . PHE A 1 202 ? 72.914  21.802  46.354  1.00 45.58  ? 382 PHE A O   1 
ATOM   1662 C  CB  . PHE A 1 202 ? 72.709  24.906  45.880  1.00 45.28  ? 382 PHE A CB  1 
ATOM   1663 C  CG  . PHE A 1 202 ? 74.050  25.570  45.776  1.00 44.38  ? 382 PHE A CG  1 
ATOM   1664 C  CD1 . PHE A 1 202 ? 74.377  26.324  44.653  1.00 43.37  ? 382 PHE A CD1 1 
ATOM   1665 C  CD2 . PHE A 1 202 ? 75.000  25.417  46.780  1.00 43.38  ? 382 PHE A CD2 1 
ATOM   1666 C  CE1 . PHE A 1 202 ? 75.632  26.916  44.530  1.00 43.56  ? 382 PHE A CE1 1 
ATOM   1667 C  CE2 . PHE A 1 202 ? 76.257  26.005  46.665  1.00 43.50  ? 382 PHE A CE2 1 
ATOM   1668 C  CZ  . PHE A 1 202 ? 76.573  26.757  45.536  1.00 42.43  ? 382 PHE A CZ  1 
ATOM   1669 N  N   . ASP A 1 203 ? 74.583  22.406  44.974  1.00 43.81  ? 383 ASP A N   1 
ATOM   1670 C  CA  . ASP A 1 203 ? 75.476  21.332  45.382  1.00 41.95  ? 383 ASP A CA  1 
ATOM   1671 C  C   . ASP A 1 203 ? 76.862  21.896  45.694  1.00 40.82  ? 383 ASP A C   1 
ATOM   1672 O  O   . ASP A 1 203 ? 77.599  22.267  44.781  1.00 39.45  ? 383 ASP A O   1 
ATOM   1673 C  CB  . ASP A 1 203 ? 75.561  20.303  44.248  1.00 41.54  ? 383 ASP A CB  1 
ATOM   1674 C  CG  . ASP A 1 203 ? 76.461  19.131  44.582  1.00 41.58  ? 383 ASP A CG  1 
ATOM   1675 O  OD1 . ASP A 1 203 ? 76.673  18.284  43.684  1.00 42.21  ? 383 ASP A OD1 1 
ATOM   1676 O  OD2 . ASP A 1 203 ? 76.949  19.055  45.731  1.00 39.93  ? 383 ASP A OD2 1 
ATOM   1677 N  N   . TYR A 1 204 ? 77.216  21.960  46.976  1.00 40.53  ? 384 TYR A N   1 
ATOM   1678 C  CA  . TYR A 1 204 ? 78.520  22.493  47.371  1.00 40.74  ? 384 TYR A CA  1 
ATOM   1679 C  C   . TYR A 1 204 ? 79.695  21.698  46.836  1.00 41.65  ? 384 TYR A C   1 
ATOM   1680 O  O   . TYR A 1 204 ? 80.831  22.173  46.876  1.00 41.40  ? 384 TYR A O   1 
ATOM   1681 C  CB  . TYR A 1 204 ? 78.653  22.573  48.891  1.00 41.05  ? 384 TYR A CB  1 
ATOM   1682 C  CG  . TYR A 1 204 ? 77.898  23.717  49.522  1.00 41.91  ? 384 TYR A CG  1 
ATOM   1683 C  CD1 . TYR A 1 204 ? 76.606  23.538  50.013  1.00 41.68  ? 384 TYR A CD1 1 
ATOM   1684 C  CD2 . TYR A 1 204 ? 78.473  24.988  49.621  1.00 42.33  ? 384 TYR A CD2 1 
ATOM   1685 C  CE1 . TYR A 1 204 ? 75.902  24.595  50.590  1.00 42.33  ? 384 TYR A CE1 1 
ATOM   1686 C  CE2 . TYR A 1 204 ? 77.775  26.054  50.195  1.00 41.76  ? 384 TYR A CE2 1 
ATOM   1687 C  CZ  . TYR A 1 204 ? 76.492  25.850  50.677  1.00 42.36  ? 384 TYR A CZ  1 
ATOM   1688 O  OH  . TYR A 1 204 ? 75.790  26.891  51.245  1.00 43.03  ? 384 TYR A OH  1 
ATOM   1689 N  N   . SER A 1 205 ? 79.434  20.483  46.355  1.00 41.90  ? 385 SER A N   1 
ATOM   1690 C  CA  . SER A 1 205 ? 80.502  19.651  45.819  1.00 42.54  ? 385 SER A CA  1 
ATOM   1691 C  C   . SER A 1 205 ? 80.590  19.768  44.300  1.00 42.38  ? 385 SER A C   1 
ATOM   1692 O  O   . SER A 1 205 ? 81.449  19.154  43.671  1.00 42.36  ? 385 SER A O   1 
ATOM   1693 C  CB  . SER A 1 205 ? 80.305  18.186  46.235  1.00 43.46  ? 385 SER A CB  1 
ATOM   1694 O  OG  . SER A 1 205 ? 79.098  17.659  45.718  1.00 45.27  ? 385 SER A OG  1 
ATOM   1695 N  N   . ASN A 1 206 ? 79.700  20.565  43.715  1.00 42.35  ? 386 ASN A N   1 
ATOM   1696 C  CA  . ASN A 1 206 ? 79.695  20.779  42.271  1.00 42.67  ? 386 ASN A CA  1 
ATOM   1697 C  C   . ASN A 1 206 ? 80.574  21.993  41.971  1.00 43.54  ? 386 ASN A C   1 
ATOM   1698 O  O   . ASN A 1 206 ? 80.256  23.114  42.366  1.00 42.61  ? 386 ASN A O   1 
ATOM   1699 C  CB  . ASN A 1 206 ? 78.274  21.036  41.774  1.00 43.17  ? 386 ASN A CB  1 
ATOM   1700 C  CG  . ASN A 1 206 ? 78.185  21.067  40.264  1.00 43.32  ? 386 ASN A CG  1 
ATOM   1701 O  OD1 . ASN A 1 206 ? 77.551  20.212  39.653  1.00 44.83  ? 386 ASN A OD1 1 
ATOM   1702 N  ND2 . ASN A 1 206 ? 78.830  22.049  39.654  1.00 43.72  ? 386 ASN A ND2 1 
ATOM   1703 N  N   . GLU A 1 207 ? 81.675  21.755  41.267  1.00 44.27  ? 387 GLU A N   1 
ATOM   1704 C  CA  . GLU A 1 207 ? 82.636  22.795  40.924  1.00 45.43  ? 387 GLU A CA  1 
ATOM   1705 C  C   . GLU A 1 207 ? 82.009  23.984  40.191  1.00 44.91  ? 387 GLU A C   1 
ATOM   1706 O  O   . GLU A 1 207 ? 82.378  25.133  40.437  1.00 43.60  ? 387 GLU A O   1 
ATOM   1707 C  CB  . GLU A 1 207 ? 83.750  22.189  40.073  1.00 47.75  ? 387 GLU A CB  1 
ATOM   1708 C  CG  . GLU A 1 207 ? 85.029  22.994  40.032  1.00 52.58  ? 387 GLU A CG  1 
ATOM   1709 C  CD  . GLU A 1 207 ? 86.077  22.348  39.144  1.00 55.58  ? 387 GLU A CD  1 
ATOM   1710 O  OE1 . GLU A 1 207 ? 85.984  22.497  37.903  1.00 56.81  ? 387 GLU A OE1 1 
ATOM   1711 O  OE2 . GLU A 1 207 ? 86.984  21.675  39.687  1.00 56.95  ? 387 GLU A OE2 1 
ATOM   1712 N  N   . GLU A 1 208 ? 81.075  23.707  39.285  1.00 44.40  ? 388 GLU A N   1 
ATOM   1713 C  CA  . GLU A 1 208 ? 80.405  24.771  38.543  1.00 44.20  ? 388 GLU A CA  1 
ATOM   1714 C  C   . GLU A 1 208 ? 79.548  25.596  39.492  1.00 42.53  ? 388 GLU A C   1 
ATOM   1715 O  O   . GLU A 1 208 ? 79.436  26.811  39.342  1.00 41.40  ? 388 GLU A O   1 
ATOM   1716 C  CB  . GLU A 1 208 ? 79.504  24.199  37.451  1.00 46.34  ? 388 GLU A CB  1 
ATOM   1717 C  CG  . GLU A 1 208 ? 80.221  23.456  36.347  1.00 50.51  ? 388 GLU A CG  1 
ATOM   1718 C  CD  . GLU A 1 208 ? 79.263  23.017  35.255  1.00 53.03  ? 388 GLU A CD  1 
ATOM   1719 O  OE1 . GLU A 1 208 ? 78.225  22.398  35.588  1.00 55.38  ? 388 GLU A OE1 1 
ATOM   1720 O  OE2 . GLU A 1 208 ? 79.543  23.290  34.067  1.00 54.10  ? 388 GLU A OE2 1 
ATOM   1721 N  N   . HIS A 1 209 ? 78.934  24.918  40.458  1.00 40.55  ? 389 HIS A N   1 
ATOM   1722 C  CA  . HIS A 1 209 ? 78.083  25.563  41.451  1.00 39.93  ? 389 HIS A CA  1 
ATOM   1723 C  C   . HIS A 1 209 ? 78.901  26.499  42.340  1.00 38.57  ? 389 HIS A C   1 
ATOM   1724 O  O   . HIS A 1 209 ? 78.478  27.616  42.632  1.00 38.42  ? 389 HIS A O   1 
ATOM   1725 C  CB  . HIS A 1 209 ? 77.392  24.506  42.328  1.00 40.71  ? 389 HIS A CB  1 
ATOM   1726 C  CG  . HIS A 1 209 ? 76.201  23.856  41.686  1.00 41.20  ? 389 HIS A CG  1 
ATOM   1727 N  ND1 . HIS A 1 209 ? 76.189  23.451  40.368  1.00 41.37  ? 389 HIS A ND1 1 
ATOM   1728 C  CD2 . HIS A 1 209 ? 74.990  23.523  42.191  1.00 40.91  ? 389 HIS A CD2 1 
ATOM   1729 C  CE1 . HIS A 1 209 ? 75.021  22.899  40.087  1.00 40.55  ? 389 HIS A CE1 1 
ATOM   1730 N  NE2 . HIS A 1 209 ? 74.275  22.930  41.178  1.00 40.92  ? 389 HIS A NE2 1 
ATOM   1731 N  N   . MET A 1 210 ? 80.074  26.038  42.762  1.00 36.79  ? 390 MET A N   1 
ATOM   1732 C  CA  . MET A 1 210 ? 80.930  26.833  43.633  1.00 35.82  ? 390 MET A CA  1 
ATOM   1733 C  C   . MET A 1 210 ? 81.525  28.032  42.919  1.00 33.98  ? 390 MET A C   1 
ATOM   1734 O  O   . MET A 1 210 ? 81.701  29.090  43.517  1.00 33.23  ? 390 MET A O   1 
ATOM   1735 C  CB  . MET A 1 210 ? 82.053  25.970  44.215  1.00 35.54  ? 390 MET A CB  1 
ATOM   1736 C  CG  . MET A 1 210 ? 81.566  24.947  45.226  1.00 36.42  ? 390 MET A CG  1 
ATOM   1737 S  SD  . MET A 1 210 ? 80.654  25.687  46.599  1.00 37.04  ? 390 MET A SD  1 
ATOM   1738 C  CE  . MET A 1 210 ? 81.861  25.583  47.903  1.00 35.16  ? 390 MET A CE  1 
ATOM   1739 N  N   . THR A 1 211 ? 81.846  27.856  41.644  1.00 32.38  ? 391 THR A N   1 
ATOM   1740 C  CA  . THR A 1 211 ? 82.406  28.940  40.861  1.00 31.59  ? 391 THR A CA  1 
ATOM   1741 C  C   . THR A 1 211 ? 81.380  30.060  40.775  1.00 30.99  ? 391 THR A C   1 
ATOM   1742 O  O   . THR A 1 211 ? 81.714  31.228  40.958  1.00 30.59  ? 391 THR A O   1 
ATOM   1743 C  CB  . THR A 1 211 ? 82.801  28.457  39.454  1.00 31.75  ? 391 THR A CB  1 
ATOM   1744 O  OG1 . THR A 1 211 ? 84.038  27.737  39.538  1.00 32.67  ? 391 THR A OG1 1 
ATOM   1745 C  CG2 . THR A 1 211 ? 82.969  29.630  38.497  1.00 32.73  ? 391 THR A CG2 1 
ATOM   1746 N  N   . LEU A 1 212 ? 80.125  29.703  40.517  1.00 30.18  ? 392 LEU A N   1 
ATOM   1747 C  CA  . LEU A 1 212 ? 79.077  30.707  40.430  1.00 30.10  ? 392 LEU A CA  1 
ATOM   1748 C  C   . LEU A 1 212 ? 78.804  31.336  41.795  1.00 30.11  ? 392 LEU A C   1 
ATOM   1749 O  O   . LEU A 1 212 ? 78.463  32.517  41.882  1.00 30.65  ? 392 LEU A O   1 
ATOM   1750 C  CB  . LEU A 1 212 ? 77.800  30.098  39.844  1.00 29.88  ? 392 LEU A CB  1 
ATOM   1751 C  CG  . LEU A 1 212 ? 77.809  30.040  38.311  1.00 30.27  ? 392 LEU A CG  1 
ATOM   1752 C  CD1 . LEU A 1 212 ? 76.735  29.094  37.809  1.00 31.12  ? 392 LEU A CD1 1 
ATOM   1753 C  CD2 . LEU A 1 212 ? 77.593  31.451  37.756  1.00 30.17  ? 392 LEU A CD2 1 
ATOM   1754 N  N   . LEU A 1 213 ? 78.963  30.562  42.865  1.00 29.21  ? 393 LEU A N   1 
ATOM   1755 C  CA  . LEU A 1 213 ? 78.738  31.114  44.196  1.00 28.10  ? 393 LEU A CA  1 
ATOM   1756 C  C   . LEU A 1 213 ? 79.838  32.125  44.533  1.00 26.98  ? 393 LEU A C   1 
ATOM   1757 O  O   . LEU A 1 213 ? 79.581  33.134  45.187  1.00 26.70  ? 393 LEU A O   1 
ATOM   1758 C  CB  . LEU A 1 213 ? 78.707  30.009  45.259  1.00 26.52  ? 393 LEU A CB  1 
ATOM   1759 C  CG  . LEU A 1 213 ? 78.589  30.494  46.712  1.00 26.99  ? 393 LEU A CG  1 
ATOM   1760 C  CD1 . LEU A 1 213 ? 77.387  31.437  46.862  1.00 25.25  ? 393 LEU A CD1 1 
ATOM   1761 C  CD2 . LEU A 1 213 ? 78.451  29.296  47.637  1.00 25.04  ? 393 LEU A CD2 1 
ATOM   1762 N  N   . LYS A 1 214 ? 81.060  31.846  44.089  1.00 25.46  ? 394 LYS A N   1 
ATOM   1763 C  CA  . LYS A 1 214 ? 82.181  32.743  44.343  1.00 25.66  ? 394 LYS A CA  1 
ATOM   1764 C  C   . LYS A 1 214 ? 82.022  34.029  43.523  1.00 25.67  ? 394 LYS A C   1 
ATOM   1765 O  O   . LYS A 1 214 ? 82.349  35.118  44.000  1.00 25.04  ? 394 LYS A O   1 
ATOM   1766 C  CB  . LYS A 1 214 ? 83.511  32.041  44.029  1.00 24.02  ? 394 LYS A CB  1 
ATOM   1767 C  CG  . LYS A 1 214 ? 83.870  30.972  45.059  1.00 24.90  ? 394 LYS A CG  1 
ATOM   1768 C  CD  . LYS A 1 214 ? 85.184  30.278  44.757  1.00 22.96  ? 394 LYS A CD  1 
ATOM   1769 C  CE  . LYS A 1 214 ? 85.039  29.288  43.619  1.00 24.39  ? 394 LYS A CE  1 
ATOM   1770 N  NZ  . LYS A 1 214 ? 86.357  28.685  43.253  1.00 22.97  ? 394 LYS A NZ  1 
ATOM   1771 N  N   . MET A 1 215 ? 81.508  33.901  42.300  1.00 25.21  ? 395 MET A N   1 
ATOM   1772 C  CA  . MET A 1 215 ? 81.279  35.067  41.450  1.00 25.78  ? 395 MET A CA  1 
ATOM   1773 C  C   . MET A 1 215 ? 80.238  35.964  42.129  1.00 26.40  ? 395 MET A C   1 
ATOM   1774 O  O   . MET A 1 215 ? 80.370  37.189  42.135  1.00 27.08  ? 395 MET A O   1 
ATOM   1775 C  CB  . MET A 1 215 ? 80.776  34.630  40.070  1.00 25.28  ? 395 MET A CB  1 
ATOM   1776 C  CG  . MET A 1 215 ? 81.806  33.865  39.254  1.00 25.06  ? 395 MET A CG  1 
ATOM   1777 S  SD  . MET A 1 215 ? 81.099  32.975  37.851  1.00 27.44  ? 395 MET A SD  1 
ATOM   1778 C  CE  . MET A 1 215 ? 80.776  34.301  36.694  1.00 25.78  ? 395 MET A CE  1 
ATOM   1779 N  N   . ILE A 1 216 ? 79.203  35.348  42.698  1.00 26.32  ? 396 ILE A N   1 
ATOM   1780 C  CA  . ILE A 1 216 ? 78.162  36.099  43.390  1.00 26.91  ? 396 ILE A CA  1 
ATOM   1781 C  C   . ILE A 1 216 ? 78.736  36.743  44.653  1.00 27.45  ? 396 ILE A C   1 
ATOM   1782 O  O   . ILE A 1 216 ? 78.391  37.874  44.996  1.00 28.21  ? 396 ILE A O   1 
ATOM   1783 C  CB  . ILE A 1 216 ? 76.978  35.192  43.804  1.00 26.55  ? 396 ILE A CB  1 
ATOM   1784 C  CG1 . ILE A 1 216 ? 76.234  34.686  42.564  1.00 25.58  ? 396 ILE A CG1 1 
ATOM   1785 C  CG2 . ILE A 1 216 ? 76.030  35.953  44.719  1.00 25.79  ? 396 ILE A CG2 1 
ATOM   1786 C  CD1 . ILE A 1 216 ? 75.482  35.746  41.814  1.00 27.00  ? 396 ILE A CD1 1 
ATOM   1787 N  N   . LEU A 1 217 ? 79.615  36.029  45.344  1.00 26.91  ? 397 LEU A N   1 
ATOM   1788 C  CA  . LEU A 1 217 ? 80.201  36.574  46.561  1.00 27.90  ? 397 LEU A CA  1 
ATOM   1789 C  C   . LEU A 1 217 ? 81.037  37.827  46.296  1.00 27.64  ? 397 LEU A C   1 
ATOM   1790 O  O   . LEU A 1 217 ? 80.913  38.820  47.021  1.00 27.23  ? 397 LEU A O   1 
ATOM   1791 C  CB  . LEU A 1 217 ? 81.045  35.515  47.279  1.00 27.25  ? 397 LEU A CB  1 
ATOM   1792 C  CG  . LEU A 1 217 ? 80.217  34.402  47.937  1.00 28.64  ? 397 LEU A CG  1 
ATOM   1793 C  CD1 . LEU A 1 217 ? 81.136  33.393  48.610  1.00 26.35  ? 397 LEU A CD1 1 
ATOM   1794 C  CD2 . LEU A 1 217 ? 79.256  35.014  48.954  1.00 27.39  ? 397 LEU A CD2 1 
ATOM   1795 N  N   . ILE A 1 218 ? 81.884  37.793  45.269  1.00 26.15  ? 398 ILE A N   1 
ATOM   1796 C  CA  . ILE A 1 218 ? 82.699  38.961  44.975  1.00 25.06  ? 398 ILE A CA  1 
ATOM   1797 C  C   . ILE A 1 218 ? 81.809  40.089  44.434  1.00 25.09  ? 398 ILE A C   1 
ATOM   1798 O  O   . ILE A 1 218 ? 82.093  41.263  44.662  1.00 23.88  ? 398 ILE A O   1 
ATOM   1799 C  CB  . ILE A 1 218 ? 83.851  38.634  43.980  1.00 24.77  ? 398 ILE A CB  1 
ATOM   1800 C  CG1 . ILE A 1 218 ? 84.815  39.825  43.907  1.00 24.37  ? 398 ILE A CG1 1 
ATOM   1801 C  CG2 . ILE A 1 218 ? 83.294  38.277  42.608  1.00 22.20  ? 398 ILE A CG2 1 
ATOM   1802 C  CD1 . ILE A 1 218 ? 86.072  39.570  43.088  1.00 23.20  ? 398 ILE A CD1 1 
ATOM   1803 N  N   . LYS A 1 219 ? 80.728  39.738  43.736  1.00 24.15  ? 399 LYS A N   1 
ATOM   1804 C  CA  . LYS A 1 219 ? 79.811  40.760  43.228  1.00 25.03  ? 399 LYS A CA  1 
ATOM   1805 C  C   . LYS A 1 219 ? 79.138  41.440  44.412  1.00 24.73  ? 399 LYS A C   1 
ATOM   1806 O  O   . LYS A 1 219 ? 79.030  42.665  44.446  1.00 25.61  ? 399 LYS A O   1 
ATOM   1807 C  CB  . LYS A 1 219 ? 78.733  40.156  42.324  1.00 23.71  ? 399 LYS A CB  1 
ATOM   1808 C  CG  . LYS A 1 219 ? 79.163  39.905  40.893  1.00 23.83  ? 399 LYS A CG  1 
ATOM   1809 C  CD  . LYS A 1 219 ? 78.093  39.097  40.170  1.00 25.12  ? 399 LYS A CD  1 
ATOM   1810 C  CE  . LYS A 1 219 ? 77.208  39.944  39.277  1.00 26.40  ? 399 LYS A CE  1 
ATOM   1811 N  NZ  . LYS A 1 219 ? 76.813  41.246  39.839  1.00 26.56  ? 399 LYS A NZ  1 
ATOM   1812 N  N   . CYS A 1 220 ? 78.675  40.643  45.373  1.00 24.20  ? 400 CYS A N   1 
ATOM   1813 C  CA  . CYS A 1 220 ? 78.028  41.179  46.572  1.00 25.14  ? 400 CYS A CA  1 
ATOM   1814 C  C   . CYS A 1 220 ? 78.944  42.155  47.299  1.00 25.67  ? 400 CYS A C   1 
ATOM   1815 O  O   . CYS A 1 220 ? 78.519  43.238  47.712  1.00 26.11  ? 400 CYS A O   1 
ATOM   1816 C  CB  . CYS A 1 220 ? 77.648  40.051  47.544  1.00 24.23  ? 400 CYS A CB  1 
ATOM   1817 S  SG  . CYS A 1 220 ? 76.127  39.175  47.115  1.00 26.44  ? 400 CYS A SG  1 
ATOM   1818 N  N   . CYS A 1 221 ? 80.204  41.765  47.455  1.00 24.96  ? 401 CYS A N   1 
ATOM   1819 C  CA  . CYS A 1 221 ? 81.169  42.601  48.155  1.00 25.14  ? 401 CYS A CA  1 
ATOM   1820 C  C   . CYS A 1 221 ? 81.491  43.897  47.410  1.00 25.62  ? 401 CYS A C   1 
ATOM   1821 O  O   . CYS A 1 221 ? 81.629  44.955  48.023  1.00 24.33  ? 401 CYS A O   1 
ATOM   1822 C  CB  . CYS A 1 221 ? 82.453  41.808  48.408  1.00 24.30  ? 401 CYS A CB  1 
ATOM   1823 S  SG  . CYS A 1 221 ? 82.233  40.373  49.515  1.00 23.65  ? 401 CYS A SG  1 
ATOM   1824 N  N   . ASP A 1 222 ? 81.605  43.803  46.090  1.00 25.37  ? 402 ASP A N   1 
ATOM   1825 C  CA  . ASP A 1 222 ? 81.923  44.950  45.256  1.00 25.75  ? 402 ASP A CA  1 
ATOM   1826 C  C   . ASP A 1 222 ? 80.870  46.060  45.383  1.00 25.83  ? 402 ASP A C   1 
ATOM   1827 O  O   . ASP A 1 222 ? 81.209  47.223  45.581  1.00 25.94  ? 402 ASP A O   1 
ATOM   1828 C  CB  . ASP A 1 222 ? 82.073  44.481  43.797  1.00 26.79  ? 402 ASP A CB  1 
ATOM   1829 C  CG  . ASP A 1 222 ? 82.468  45.602  42.832  1.00 26.96  ? 402 ASP A CG  1 
ATOM   1830 O  OD1 . ASP A 1 222 ? 83.198  46.531  43.232  1.00 30.85  ? 402 ASP A OD1 1 
ATOM   1831 O  OD2 . ASP A 1 222 ? 82.061  45.533  41.652  1.00 26.42  ? 402 ASP A OD2 1 
ATOM   1832 N  N   . ILE A 1 223 ? 79.597  45.700  45.311  1.00 25.41  ? 403 ILE A N   1 
ATOM   1833 C  CA  . ILE A 1 223 ? 78.532  46.690  45.391  1.00 25.64  ? 403 ILE A CA  1 
ATOM   1834 C  C   . ILE A 1 223 ? 77.862  46.712  46.756  1.00 25.91  ? 403 ILE A C   1 
ATOM   1835 O  O   . ILE A 1 223 ? 76.688  47.064  46.866  1.00 27.10  ? 403 ILE A O   1 
ATOM   1836 C  CB  . ILE A 1 223 ? 77.451  46.401  44.332  1.00 26.14  ? 403 ILE A CB  1 
ATOM   1837 C  CG1 . ILE A 1 223 ? 76.780  45.057  44.634  1.00 27.07  ? 403 ILE A CG1 1 
ATOM   1838 C  CG2 . ILE A 1 223 ? 78.081  46.371  42.948  1.00 24.96  ? 403 ILE A CG2 1 
ATOM   1839 C  CD1 . ILE A 1 223 ? 75.588  44.749  43.751  1.00 28.49  ? 403 ILE A CD1 1 
ATOM   1840 N  N   . SER A 1 224 ? 78.617  46.369  47.794  1.00 26.18  ? 404 SER A N   1 
ATOM   1841 C  CA  . SER A 1 224 ? 78.087  46.288  49.154  1.00 27.11  ? 404 SER A CA  1 
ATOM   1842 C  C   . SER A 1 224 ? 78.061  47.550  50.025  1.00 27.18  ? 404 SER A C   1 
ATOM   1843 O  O   . SER A 1 224 ? 77.712  47.463  51.207  1.00 26.61  ? 404 SER A O   1 
ATOM   1844 C  CB  . SER A 1 224 ? 78.853  45.211  49.924  1.00 27.16  ? 404 SER A CB  1 
ATOM   1845 O  OG  . SER A 1 224 ? 80.189  45.622  50.163  1.00 26.15  ? 404 SER A OG  1 
ATOM   1846 N  N   . ASN A 1 225 ? 78.419  48.708  49.477  1.00 26.53  ? 405 ASN A N   1 
ATOM   1847 C  CA  . ASN A 1 225 ? 78.440  49.922  50.292  1.00 25.34  ? 405 ASN A CA  1 
ATOM   1848 C  C   . ASN A 1 225 ? 77.160  50.122  51.108  1.00 24.79  ? 405 ASN A C   1 
ATOM   1849 O  O   . ASN A 1 225 ? 77.222  50.356  52.311  1.00 23.85  ? 405 ASN A O   1 
ATOM   1850 C  CB  . ASN A 1 225 ? 78.711  51.167  49.422  1.00 24.19  ? 405 ASN A CB  1 
ATOM   1851 C  CG  . ASN A 1 225 ? 80.180  51.282  48.984  1.00 24.26  ? 405 ASN A CG  1 
ATOM   1852 O  OD1 . ASN A 1 225 ? 81.073  50.680  49.585  1.00 23.72  ? 405 ASN A OD1 1 
ATOM   1853 N  ND2 . ASN A 1 225 ? 80.430  52.075  47.939  1.00 22.88  ? 405 ASN A ND2 1 
ATOM   1854 N  N   . GLU A 1 226 ? 76.003  50.002  50.465  1.00 26.37  ? 406 GLU A N   1 
ATOM   1855 C  CA  . GLU A 1 226 ? 74.725  50.208  51.149  1.00 27.11  ? 406 GLU A CA  1 
ATOM   1856 C  C   . GLU A 1 226 ? 74.381  49.225  52.264  1.00 28.65  ? 406 GLU A C   1 
ATOM   1857 O  O   . GLU A 1 226 ? 73.403  49.427  52.987  1.00 29.36  ? 406 GLU A O   1 
ATOM   1858 C  CB  . GLU A 1 226 ? 73.583  50.256  50.129  1.00 27.40  ? 406 GLU A CB  1 
ATOM   1859 C  CG  . GLU A 1 226 ? 73.608  51.505  49.257  1.00 27.89  ? 406 GLU A CG  1 
ATOM   1860 C  CD  . GLU A 1 226 ? 73.411  52.784  50.063  1.00 29.19  ? 406 GLU A CD  1 
ATOM   1861 O  OE1 . GLU A 1 226 ? 73.868  53.852  49.612  1.00 29.43  ? 406 GLU A OE1 1 
ATOM   1862 O  OE2 . GLU A 1 226 ? 72.797  52.726  51.148  1.00 29.55  ? 406 GLU A OE2 1 
ATOM   1863 N  N   . VAL A 1 227 ? 75.165  48.164  52.409  1.00 28.71  ? 407 VAL A N   1 
ATOM   1864 C  CA  . VAL A 1 227 ? 74.918  47.197  53.473  1.00 30.04  ? 407 VAL A CA  1 
ATOM   1865 C  C   . VAL A 1 227 ? 75.483  47.763  54.780  1.00 29.70  ? 407 VAL A C   1 
ATOM   1866 O  O   . VAL A 1 227 ? 75.033  47.420  55.870  1.00 29.83  ? 407 VAL A O   1 
ATOM   1867 C  CB  . VAL A 1 227 ? 75.607  45.840  53.180  1.00 30.57  ? 407 VAL A CB  1 
ATOM   1868 C  CG1 . VAL A 1 227 ? 75.459  44.926  54.363  1.00 33.02  ? 407 VAL A CG1 1 
ATOM   1869 C  CG2 . VAL A 1 227 ? 74.988  45.191  51.953  1.00 31.86  ? 407 VAL A CG2 1 
ATOM   1870 N  N   . ARG A 1 228 ? 76.475  48.638  54.652  1.00 29.89  ? 408 ARG A N   1 
ATOM   1871 C  CA  . ARG A 1 228 ? 77.134  49.258  55.795  1.00 29.88  ? 408 ARG A CA  1 
ATOM   1872 C  C   . ARG A 1 228 ? 76.257  50.303  56.492  1.00 31.19  ? 408 ARG A C   1 
ATOM   1873 O  O   . ARG A 1 228 ? 75.271  50.779  55.924  1.00 31.94  ? 408 ARG A O   1 
ATOM   1874 C  CB  . ARG A 1 228 ? 78.442  49.907  55.334  1.00 28.84  ? 408 ARG A CB  1 
ATOM   1875 C  CG  . ARG A 1 228 ? 79.414  48.936  54.666  1.00 28.50  ? 408 ARG A CG  1 
ATOM   1876 C  CD  . ARG A 1 228 ? 80.656  49.651  54.128  1.00 27.34  ? 408 ARG A CD  1 
ATOM   1877 N  NE  . ARG A 1 228 ? 81.610  48.719  53.532  1.00 27.55  ? 408 ARG A NE  1 
ATOM   1878 C  CZ  . ARG A 1 228 ? 82.411  47.923  54.232  1.00 27.35  ? 408 ARG A CZ  1 
ATOM   1879 N  NH1 . ARG A 1 228 ? 82.374  47.956  55.556  1.00 26.26  ? 408 ARG A NH1 1 
ATOM   1880 N  NH2 . ARG A 1 228 ? 83.232  47.082  53.611  1.00 26.51  ? 408 ARG A NH2 1 
ATOM   1881 N  N   . PRO A 1 229 ? 76.599  50.669  57.741  1.00 32.39  ? 409 PRO A N   1 
ATOM   1882 C  CA  . PRO A 1 229 ? 75.806  51.669  58.468  1.00 34.19  ? 409 PRO A CA  1 
ATOM   1883 C  C   . PRO A 1 229 ? 75.617  52.935  57.633  1.00 35.23  ? 409 PRO A C   1 
ATOM   1884 O  O   . PRO A 1 229 ? 76.526  53.363  56.915  1.00 35.05  ? 409 PRO A O   1 
ATOM   1885 C  CB  . PRO A 1 229 ? 76.635  51.919  59.725  1.00 34.00  ? 409 PRO A CB  1 
ATOM   1886 C  CG  . PRO A 1 229 ? 77.272  50.572  59.962  1.00 34.01  ? 409 PRO A CG  1 
ATOM   1887 C  CD  . PRO A 1 229 ? 77.721  50.190  58.569  1.00 32.61  ? 409 PRO A CD  1 
ATOM   1888 N  N   . MET A 1 230 ? 74.429  53.520  57.730  1.00 36.74  ? 410 MET A N   1 
ATOM   1889 C  CA  . MET A 1 230 ? 74.077  54.720  56.982  1.00 38.51  ? 410 MET A CA  1 
ATOM   1890 C  C   . MET A 1 230 ? 75.176  55.783  56.923  1.00 37.90  ? 410 MET A C   1 
ATOM   1891 O  O   . MET A 1 230 ? 75.474  56.319  55.855  1.00 37.35  ? 410 MET A O   1 
ATOM   1892 C  CB  . MET A 1 230 ? 72.791  55.314  57.568  1.00 42.14  ? 410 MET A CB  1 
ATOM   1893 C  CG  . MET A 1 230 ? 72.179  56.451  56.761  1.00 47.24  ? 410 MET A CG  1 
ATOM   1894 S  SD  . MET A 1 230 ? 72.977  58.067  57.008  1.00 53.03  ? 410 MET A SD  1 
ATOM   1895 C  CE  . MET A 1 230 ? 72.136  58.616  58.539  1.00 51.44  ? 410 MET A CE  1 
ATOM   1896 N  N   . GLU A 1 231 ? 75.789  56.074  58.062  1.00 37.45  ? 411 GLU A N   1 
ATOM   1897 C  CA  . GLU A 1 231 ? 76.833  57.089  58.119  1.00 38.25  ? 411 GLU A CA  1 
ATOM   1898 C  C   . GLU A 1 231 ? 78.098  56.697  57.377  1.00 35.95  ? 411 GLU A C   1 
ATOM   1899 O  O   . GLU A 1 231 ? 78.873  57.557  56.965  1.00 34.74  ? 411 GLU A O   1 
ATOM   1900 C  CB  . GLU A 1 231 ? 77.164  57.410  59.575  1.00 42.29  ? 411 GLU A CB  1 
ATOM   1901 C  CG  . GLU A 1 231 ? 75.974  57.935  60.350  1.00 49.30  ? 411 GLU A CG  1 
ATOM   1902 C  CD  . GLU A 1 231 ? 76.063  57.608  61.825  1.00 54.69  ? 411 GLU A CD  1 
ATOM   1903 O  OE1 . GLU A 1 231 ? 76.194  56.402  62.150  1.00 57.17  ? 411 GLU A OE1 1 
ATOM   1904 O  OE2 . GLU A 1 231 ? 76.002  58.547  62.655  1.00 56.72  ? 411 GLU A OE2 1 
ATOM   1905 N  N   . VAL A 1 232 ? 78.313  55.398  57.211  1.00 34.01  ? 412 VAL A N   1 
ATOM   1906 C  CA  . VAL A 1 232 ? 79.493  54.927  56.498  1.00 32.48  ? 412 VAL A CA  1 
ATOM   1907 C  C   . VAL A 1 232 ? 79.197  54.798  55.006  1.00 32.04  ? 412 VAL A C   1 
ATOM   1908 O  O   . VAL A 1 232 ? 80.041  55.105  54.163  1.00 31.23  ? 412 VAL A O   1 
ATOM   1909 C  CB  . VAL A 1 232 ? 79.955  53.557  57.035  1.00 32.94  ? 412 VAL A CB  1 
ATOM   1910 C  CG1 . VAL A 1 232 ? 81.162  53.070  56.250  1.00 31.83  ? 412 VAL A CG1 1 
ATOM   1911 C  CG2 . VAL A 1 232 ? 80.296  53.671  58.516  1.00 31.59  ? 412 VAL A CG2 1 
ATOM   1912 N  N   . ALA A 1 233 ? 77.982  54.365  54.688  1.00 31.68  ? 413 ALA A N   1 
ATOM   1913 C  CA  . ALA A 1 233 ? 77.566  54.163  53.306  1.00 32.16  ? 413 ALA A CA  1 
ATOM   1914 C  C   . ALA A 1 233 ? 77.289  55.427  52.488  1.00 33.38  ? 413 ALA A C   1 
ATOM   1915 O  O   . ALA A 1 233 ? 77.741  55.543  51.348  1.00 32.43  ? 413 ALA A O   1 
ATOM   1916 C  CB  . ALA A 1 233 ? 76.336  53.270  53.277  1.00 31.13  ? 413 ALA A CB  1 
ATOM   1917 N  N   . GLU A 1 234 ? 76.542  56.363  53.066  1.00 34.98  ? 414 GLU A N   1 
ATOM   1918 C  CA  . GLU A 1 234 ? 76.161  57.587  52.370  1.00 36.64  ? 414 GLU A CA  1 
ATOM   1919 C  C   . GLU A 1 234 ? 77.247  58.379  51.650  1.00 35.06  ? 414 GLU A C   1 
ATOM   1920 O  O   . GLU A 1 234 ? 77.068  58.766  50.495  1.00 34.83  ? 414 GLU A O   1 
ATOM   1921 C  CB  . GLU A 1 234 ? 75.416  58.527  53.314  1.00 41.21  ? 414 GLU A CB  1 
ATOM   1922 C  CG  . GLU A 1 234 ? 75.140  59.876  52.679  1.00 47.85  ? 414 GLU A CG  1 
ATOM   1923 C  CD  . GLU A 1 234 ? 74.335  60.781  53.570  1.00 52.10  ? 414 GLU A CD  1 
ATOM   1924 O  OE1 . GLU A 1 234 ? 73.127  60.503  53.756  1.00 53.54  ? 414 GLU A OE1 1 
ATOM   1925 O  OE2 . GLU A 1 234 ? 74.919  61.763  54.090  1.00 54.65  ? 414 GLU A OE2 1 
ATOM   1926 N  N   . PRO A 1 235 ? 78.378  58.653  52.316  1.00 33.74  ? 415 PRO A N   1 
ATOM   1927 C  CA  . PRO A 1 235 ? 79.390  59.419  51.580  1.00 32.64  ? 415 PRO A CA  1 
ATOM   1928 C  C   . PRO A 1 235 ? 79.918  58.741  50.318  1.00 31.86  ? 415 PRO A C   1 
ATOM   1929 O  O   . PRO A 1 235 ? 80.475  59.403  49.444  1.00 32.29  ? 415 PRO A O   1 
ATOM   1930 C  CB  . PRO A 1 235 ? 80.472  59.688  52.634  1.00 32.60  ? 415 PRO A CB  1 
ATOM   1931 C  CG  . PRO A 1 235 ? 80.232  58.633  53.687  1.00 34.12  ? 415 PRO A CG  1 
ATOM   1932 C  CD  . PRO A 1 235 ? 78.741  58.502  53.734  1.00 33.14  ? 415 PRO A CD  1 
ATOM   1933 N  N   . TRP A 1 236 ? 79.737  57.428  50.206  1.00 30.57  ? 416 TRP A N   1 
ATOM   1934 C  CA  . TRP A 1 236 ? 80.199  56.727  49.013  1.00 28.73  ? 416 TRP A CA  1 
ATOM   1935 C  C   . TRP A 1 236 ? 79.348  57.113  47.806  1.00 28.51  ? 416 TRP A C   1 
ATOM   1936 O  O   . TRP A 1 236 ? 79.838  57.135  46.679  1.00 27.78  ? 416 TRP A O   1 
ATOM   1937 C  CB  . TRP A 1 236 ? 80.157  55.203  49.209  1.00 26.54  ? 416 TRP A CB  1 
ATOM   1938 C  CG  . TRP A 1 236 ? 81.362  54.671  49.915  1.00 24.65  ? 416 TRP A CG  1 
ATOM   1939 C  CD1 . TRP A 1 236 ? 81.431  54.235  51.207  1.00 23.92  ? 416 TRP A CD1 1 
ATOM   1940 C  CD2 . TRP A 1 236 ? 82.693  54.589  49.393  1.00 22.41  ? 416 TRP A CD2 1 
ATOM   1941 N  NE1 . TRP A 1 236 ? 82.722  53.894  51.523  1.00 22.64  ? 416 TRP A NE1 1 
ATOM   1942 C  CE2 . TRP A 1 236 ? 83.518  54.102  50.428  1.00 22.17  ? 416 TRP A CE2 1 
ATOM   1943 C  CE3 . TRP A 1 236 ? 83.269  54.885  48.151  1.00 22.75  ? 416 TRP A CE3 1 
ATOM   1944 C  CZ2 . TRP A 1 236 ? 84.894  53.904  50.261  1.00 21.03  ? 416 TRP A CZ2 1 
ATOM   1945 C  CZ3 . TRP A 1 236 ? 84.645  54.686  47.985  1.00 21.42  ? 416 TRP A CZ3 1 
ATOM   1946 C  CH2 . TRP A 1 236 ? 85.436  54.202  49.036  1.00 20.30  ? 416 TRP A CH2 1 
ATOM   1947 N  N   . VAL A 1 237 ? 78.077  57.426  48.043  1.00 29.11  ? 417 VAL A N   1 
ATOM   1948 C  CA  . VAL A 1 237 ? 77.186  57.801  46.951  1.00 30.22  ? 417 VAL A CA  1 
ATOM   1949 C  C   . VAL A 1 237 ? 77.650  59.079  46.254  1.00 31.04  ? 417 VAL A C   1 
ATOM   1950 O  O   . VAL A 1 237 ? 77.590  59.180  45.030  1.00 31.68  ? 417 VAL A O   1 
ATOM   1951 C  CB  . VAL A 1 237 ? 75.746  58.015  47.440  1.00 30.61  ? 417 VAL A CB  1 
ATOM   1952 C  CG1 . VAL A 1 237 ? 74.804  58.074  46.239  1.00 29.50  ? 417 VAL A CG1 1 
ATOM   1953 C  CG2 . VAL A 1 237 ? 75.342  56.893  48.386  1.00 30.66  ? 417 VAL A CG2 1 
ATOM   1954 N  N   . ASP A 1 238 ? 78.112  60.052  47.032  1.00 31.87  ? 418 ASP A N   1 
ATOM   1955 C  CA  . ASP A 1 238 ? 78.591  61.303  46.461  1.00 32.78  ? 418 ASP A CA  1 
ATOM   1956 C  C   . ASP A 1 238 ? 79.843  61.043  45.633  1.00 32.18  ? 418 ASP A C   1 
ATOM   1957 O  O   . ASP A 1 238 ? 80.063  61.690  44.608  1.00 30.89  ? 418 ASP A O   1 
ATOM   1958 C  CB  . ASP A 1 238 ? 78.903  62.312  47.571  1.00 36.24  ? 418 ASP A CB  1 
ATOM   1959 C  CG  . ASP A 1 238 ? 77.662  62.746  48.330  1.00 39.73  ? 418 ASP A CG  1 
ATOM   1960 O  OD1 . ASP A 1 238 ? 76.813  63.460  47.742  1.00 41.07  ? 418 ASP A OD1 1 
ATOM   1961 O  OD2 . ASP A 1 238 ? 77.533  62.364  49.512  1.00 42.04  ? 418 ASP A OD2 1 
ATOM   1962 N  N   . CYS A 1 239 ? 80.663  60.093  46.081  1.00 31.13  ? 419 CYS A N   1 
ATOM   1963 C  CA  . CYS A 1 239 ? 81.887  59.749  45.369  1.00 30.70  ? 419 CYS A CA  1 
ATOM   1964 C  C   . CYS A 1 239 ? 81.564  59.111  44.027  1.00 29.78  ? 419 CYS A C   1 
ATOM   1965 O  O   . CYS A 1 239 ? 82.215  59.389  43.023  1.00 30.37  ? 419 CYS A O   1 
ATOM   1966 C  CB  . CYS A 1 239 ? 82.740  58.791  46.199  1.00 31.31  ? 419 CYS A CB  1 
ATOM   1967 S  SG  . CYS A 1 239 ? 83.427  59.509  47.708  1.00 31.67  ? 419 CYS A SG  1 
ATOM   1968 N  N   . LEU A 1 240 ? 80.552  58.256  44.009  1.00 29.79  ? 420 LEU A N   1 
ATOM   1969 C  CA  . LEU A 1 240 ? 80.159  57.587  42.779  1.00 30.39  ? 420 LEU A CA  1 
ATOM   1970 C  C   . LEU A 1 240 ? 79.600  58.603  41.788  1.00 30.41  ? 420 LEU A C   1 
ATOM   1971 O  O   . LEU A 1 240 ? 79.998  58.627  40.624  1.00 30.39  ? 420 LEU A O   1 
ATOM   1972 C  CB  . LEU A 1 240 ? 79.109  56.509  43.063  1.00 30.16  ? 420 LEU A CB  1 
ATOM   1973 C  CG  . LEU A 1 240 ? 78.666  55.687  41.849  1.00 31.21  ? 420 LEU A CG  1 
ATOM   1974 C  CD1 . LEU A 1 240 ? 79.862  54.953  41.269  1.00 30.24  ? 420 LEU A CD1 1 
ATOM   1975 C  CD2 . LEU A 1 240 ? 77.579  54.701  42.260  1.00 30.23  ? 420 LEU A CD2 1 
ATOM   1976 N  N   . LEU A 1 241 ? 78.682  59.447  42.247  1.00 30.65  ? 421 LEU A N   1 
ATOM   1977 C  CA  . LEU A 1 241 ? 78.103  60.451  41.363  1.00 31.71  ? 421 LEU A CA  1 
ATOM   1978 C  C   . LEU A 1 241 ? 79.174  61.406  40.846  1.00 31.59  ? 421 LEU A C   1 
ATOM   1979 O  O   . LEU A 1 241 ? 79.112  61.862  39.709  1.00 31.22  ? 421 LEU A O   1 
ATOM   1980 C  CB  . LEU A 1 241 ? 76.991  61.225  42.078  1.00 31.81  ? 421 LEU A CB  1 
ATOM   1981 C  CG  . LEU A 1 241 ? 75.750  60.387  42.404  1.00 32.23  ? 421 LEU A CG  1 
ATOM   1982 C  CD1 . LEU A 1 241 ? 74.622  61.299  42.881  1.00 33.12  ? 421 LEU A CD1 1 
ATOM   1983 C  CD2 . LEU A 1 241 ? 75.310  59.626  41.170  1.00 32.22  ? 421 LEU A CD2 1 
ATOM   1984 N  N   . GLU A 1 242 ? 80.167  61.700  41.672  1.00 32.68  ? 422 GLU A N   1 
ATOM   1985 C  CA  . GLU A 1 242 ? 81.243  62.580  41.244  1.00 34.84  ? 422 GLU A CA  1 
ATOM   1986 C  C   . GLU A 1 242 ? 81.912  61.949  40.019  1.00 35.64  ? 422 GLU A C   1 
ATOM   1987 O  O   . GLU A 1 242 ? 82.185  62.618  39.019  1.00 36.10  ? 422 GLU A O   1 
ATOM   1988 C  CB  . GLU A 1 242 ? 82.265  62.737  42.367  1.00 36.40  ? 422 GLU A CB  1 
ATOM   1989 C  CG  . GLU A 1 242 ? 83.227  63.900  42.184  1.00 39.85  ? 422 GLU A CG  1 
ATOM   1990 C  CD  . GLU A 1 242 ? 84.157  64.069  43.371  1.00 41.20  ? 422 GLU A CD  1 
ATOM   1991 O  OE1 . GLU A 1 242 ? 83.667  64.012  44.519  1.00 42.53  ? 422 GLU A OE1 1 
ATOM   1992 O  OE2 . GLU A 1 242 ? 85.374  64.268  43.158  1.00 42.97  ? 422 GLU A OE2 1 
ATOM   1993 N  N   . GLU A 1 243 ? 82.151  60.644  40.099  1.00 35.87  ? 423 GLU A N   1 
ATOM   1994 C  CA  . GLU A 1 243 ? 82.794  59.921  39.010  1.00 35.55  ? 423 GLU A CA  1 
ATOM   1995 C  C   . GLU A 1 243 ? 81.867  59.827  37.804  1.00 35.00  ? 423 GLU A C   1 
ATOM   1996 O  O   . GLU A 1 243 ? 82.295  60.011  36.665  1.00 34.90  ? 423 GLU A O   1 
ATOM   1997 C  CB  . GLU A 1 243 ? 83.204  58.525  39.490  1.00 35.76  ? 423 GLU A CB  1 
ATOM   1998 C  CG  . GLU A 1 243 ? 84.442  57.993  38.813  1.00 35.01  ? 423 GLU A CG  1 
ATOM   1999 C  CD  . GLU A 1 243 ? 85.016  56.763  39.494  1.00 34.19  ? 423 GLU A CD  1 
ATOM   2000 O  OE1 . GLU A 1 243 ? 85.461  56.866  40.657  1.00 32.23  ? 423 GLU A OE1 1 
ATOM   2001 O  OE2 . GLU A 1 243 ? 85.029  55.696  38.851  1.00 34.40  ? 423 GLU A OE2 1 
ATOM   2002 N  N   . TYR A 1 244 ? 80.592  59.547  38.054  1.00 34.84  ? 424 TYR A N   1 
ATOM   2003 C  CA  . TYR A 1 244 ? 79.614  59.449  36.981  1.00 35.51  ? 424 TYR A CA  1 
ATOM   2004 C  C   . TYR A 1 244 ? 79.466  60.768  36.220  1.00 37.59  ? 424 TYR A C   1 
ATOM   2005 O  O   . TYR A 1 244 ? 79.501  60.790  34.986  1.00 38.08  ? 424 TYR A O   1 
ATOM   2006 C  CB  . TYR A 1 244 ? 78.249  59.054  37.541  1.00 35.20  ? 424 TYR A CB  1 
ATOM   2007 C  CG  . TYR A 1 244 ? 78.050  57.577  37.797  1.00 35.55  ? 424 TYR A CG  1 
ATOM   2008 C  CD1 . TYR A 1 244 ? 79.100  56.664  37.652  1.00 35.12  ? 424 TYR A CD1 1 
ATOM   2009 C  CD2 . TYR A 1 244 ? 76.797  57.088  38.169  1.00 34.97  ? 424 TYR A CD2 1 
ATOM   2010 C  CE1 . TYR A 1 244 ? 78.900  55.302  37.865  1.00 36.06  ? 424 TYR A CE1 1 
ATOM   2011 C  CE2 . TYR A 1 244 ? 76.585  55.733  38.387  1.00 36.08  ? 424 TYR A CE2 1 
ATOM   2012 C  CZ  . TYR A 1 244 ? 77.637  54.846  38.233  1.00 36.84  ? 424 TYR A CZ  1 
ATOM   2013 O  OH  . TYR A 1 244 ? 77.415  53.507  38.447  1.00 39.37  ? 424 TYR A OH  1 
ATOM   2014 N  N   . PHE A 1 245 ? 79.285  61.866  36.953  1.00 37.73  ? 425 PHE A N   1 
ATOM   2015 C  CA  . PHE A 1 245 ? 79.110  63.163  36.315  1.00 38.79  ? 425 PHE A CA  1 
ATOM   2016 C  C   . PHE A 1 245 ? 80.329  63.567  35.500  1.00 39.39  ? 425 PHE A C   1 
ATOM   2017 O  O   . PHE A 1 245 ? 80.201  64.188  34.441  1.00 39.06  ? 425 PHE A O   1 
ATOM   2018 C  CB  . PHE A 1 245 ? 78.780  64.241  37.356  1.00 37.11  ? 425 PHE A CB  1 
ATOM   2019 C  CG  . PHE A 1 245 ? 77.456  64.036  38.039  1.00 35.83  ? 425 PHE A CG  1 
ATOM   2020 C  CD1 . PHE A 1 245 ? 76.450  63.299  37.426  1.00 35.10  ? 425 PHE A CD1 1 
ATOM   2021 C  CD2 . PHE A 1 245 ? 77.206  64.596  39.287  1.00 36.03  ? 425 PHE A CD2 1 
ATOM   2022 C  CE1 . PHE A 1 245 ? 75.213  63.123  38.046  1.00 35.30  ? 425 PHE A CE1 1 
ATOM   2023 C  CE2 . PHE A 1 245 ? 75.973  64.427  39.917  1.00 35.09  ? 425 PHE A CE2 1 
ATOM   2024 C  CZ  . PHE A 1 245 ? 74.975  63.690  39.294  1.00 35.46  ? 425 PHE A CZ  1 
ATOM   2025 N  N   . MET A 1 246 ? 81.511  63.210  35.986  1.00 40.01  ? 426 MET A N   1 
ATOM   2026 C  CA  . MET A 1 246 ? 82.733  63.533  35.270  1.00 40.92  ? 426 MET A CA  1 
ATOM   2027 C  C   . MET A 1 246 ? 82.705  62.876  33.882  1.00 41.94  ? 426 MET A C   1 
ATOM   2028 O  O   . MET A 1 246 ? 83.136  63.466  32.885  1.00 43.18  ? 426 MET A O   1 
ATOM   2029 C  CB  . MET A 1 246 ? 83.933  63.039  36.061  1.00 41.67  ? 426 MET A CB  1 
ATOM   2030 C  CG  . MET A 1 246 ? 85.260  63.470  35.497  1.00 43.22  ? 426 MET A CG  1 
ATOM   2031 S  SD  . MET A 1 246 ? 86.612  62.892  36.527  1.00 47.79  ? 426 MET A SD  1 
ATOM   2032 C  CE  . MET A 1 246 ? 86.140  63.582  38.151  1.00 43.88  ? 426 MET A CE  1 
ATOM   2033 N  N   . GLN A 1 247 ? 82.173  61.659  33.820  1.00 40.83  ? 427 GLN A N   1 
ATOM   2034 C  CA  . GLN A 1 247 ? 82.092  60.926  32.561  1.00 39.96  ? 427 GLN A CA  1 
ATOM   2035 C  C   . GLN A 1 247 ? 81.027  61.491  31.619  1.00 40.76  ? 427 GLN A C   1 
ATOM   2036 O  O   . GLN A 1 247 ? 81.295  61.716  30.441  1.00 40.68  ? 427 GLN A O   1 
ATOM   2037 C  CB  . GLN A 1 247 ? 81.794  59.451  32.834  1.00 36.60  ? 427 GLN A CB  1 
ATOM   2038 C  CG  . GLN A 1 247 ? 81.670  58.596  31.585  1.00 34.33  ? 427 GLN A CG  1 
ATOM   2039 C  CD  . GLN A 1 247 ? 81.372  57.142  31.917  1.00 32.97  ? 427 GLN A CD  1 
ATOM   2040 O  OE1 . GLN A 1 247 ? 81.972  56.571  32.829  1.00 31.72  ? 427 GLN A OE1 1 
ATOM   2041 N  NE2 . GLN A 1 247 ? 80.451  56.538  31.179  1.00 30.19  ? 427 GLN A NE2 1 
ATOM   2042 N  N   . SER A 1 248 ? 79.816  61.701  32.132  1.00 40.88  ? 428 SER A N   1 
ATOM   2043 C  CA  . SER A 1 248 ? 78.733  62.236  31.312  1.00 41.87  ? 428 SER A CA  1 
ATOM   2044 C  C   . SER A 1 248 ? 79.085  63.635  30.787  1.00 42.06  ? 428 SER A C   1 
ATOM   2045 O  O   . SER A 1 248 ? 78.699  63.998  29.679  1.00 42.64  ? 428 SER A O   1 
ATOM   2046 C  CB  . SER A 1 248 ? 77.426  62.262  32.113  1.00 41.44  ? 428 SER A CB  1 
ATOM   2047 O  OG  . SER A 1 248 ? 77.573  62.987  33.320  1.00 41.94  ? 428 SER A OG  1 
ATOM   2048 N  N   . ASP A 1 249 ? 79.816  64.407  31.588  1.00 42.02  ? 429 ASP A N   1 
ATOM   2049 C  CA  . ASP A 1 249 ? 80.263  65.743  31.197  1.00 42.77  ? 429 ASP A CA  1 
ATOM   2050 C  C   . ASP A 1 249 ? 81.141  65.591  29.962  1.00 43.64  ? 429 ASP A C   1 
ATOM   2051 O  O   . ASP A 1 249 ? 80.912  66.219  28.926  1.00 43.76  ? 429 ASP A O   1 
ATOM   2052 C  CB  . ASP A 1 249 ? 81.110  66.372  32.307  1.00 42.24  ? 429 ASP A CB  1 
ATOM   2053 C  CG  . ASP A 1 249 ? 80.285  67.126  33.336  1.00 42.53  ? 429 ASP A CG  1 
ATOM   2054 O  OD1 . ASP A 1 249 ? 79.052  66.907  33.430  1.00 40.63  ? 429 ASP A OD1 1 
ATOM   2055 O  OD2 . ASP A 1 249 ? 80.897  67.938  34.064  1.00 42.60  ? 429 ASP A OD2 1 
ATOM   2056 N  N   . ARG A 1 250 ? 82.156  64.745  30.102  1.00 44.68  ? 430 ARG A N   1 
ATOM   2057 C  CA  . ARG A 1 250 ? 83.107  64.466  29.040  1.00 45.92  ? 430 ARG A CA  1 
ATOM   2058 C  C   . ARG A 1 250 ? 82.418  63.874  27.814  1.00 46.51  ? 430 ARG A C   1 
ATOM   2059 O  O   . ARG A 1 250 ? 82.757  64.212  26.678  1.00 46.64  ? 430 ARG A O   1 
ATOM   2060 C  CB  . ARG A 1 250 ? 84.178  63.508  29.560  1.00 46.60  ? 430 ARG A CB  1 
ATOM   2061 C  CG  . ARG A 1 250 ? 85.308  63.228  28.589  1.00 48.39  ? 430 ARG A CG  1 
ATOM   2062 C  CD  . ARG A 1 250 ? 86.378  62.381  29.256  1.00 49.33  ? 430 ARG A CD  1 
ATOM   2063 N  NE  . ARG A 1 250 ? 87.475  62.055  28.351  1.00 51.53  ? 430 ARG A NE  1 
ATOM   2064 C  CZ  . ARG A 1 250 ? 88.521  61.301  28.682  1.00 51.62  ? 430 ARG A CZ  1 
ATOM   2065 N  NH1 . ARG A 1 250 ? 88.616  60.790  29.904  1.00 51.86  ? 430 ARG A NH1 1 
ATOM   2066 N  NH2 . ARG A 1 250 ? 89.470  61.054  27.790  1.00 51.75  ? 430 ARG A NH2 1 
ATOM   2067 N  N   . GLU A 1 251 ? 81.443  62.999  28.044  1.00 46.85  ? 431 GLU A N   1 
ATOM   2068 C  CA  . GLU A 1 251 ? 80.716  62.367  26.949  1.00 47.82  ? 431 GLU A CA  1 
ATOM   2069 C  C   . GLU A 1 251 ? 79.920  63.394  26.132  1.00 49.30  ? 431 GLU A C   1 
ATOM   2070 O  O   . GLU A 1 251 ? 79.639  63.179  24.945  1.00 48.55  ? 431 GLU A O   1 
ATOM   2071 C  CB  . GLU A 1 251 ? 79.784  61.274  27.493  1.00 47.12  ? 431 GLU A CB  1 
ATOM   2072 C  CG  . GLU A 1 251 ? 80.521  60.145  28.222  1.00 46.43  ? 431 GLU A CG  1 
ATOM   2073 C  CD  . GLU A 1 251 ? 79.592  59.069  28.757  1.00 45.94  ? 431 GLU A CD  1 
ATOM   2074 O  OE1 . GLU A 1 251 ? 78.633  59.410  29.480  1.00 45.99  ? 431 GLU A OE1 1 
ATOM   2075 O  OE2 . GLU A 1 251 ? 79.825  57.877  28.459  1.00 44.83  ? 431 GLU A OE2 1 
ATOM   2076 N  N   . LYS A 1 252 ? 79.563  64.507  26.768  1.00 49.95  ? 432 LYS A N   1 
ATOM   2077 C  CA  . LYS A 1 252 ? 78.817  65.561  26.090  1.00 50.76  ? 432 LYS A CA  1 
ATOM   2078 C  C   . LYS A 1 252 ? 79.770  66.444  25.283  1.00 50.47  ? 432 LYS A C   1 
ATOM   2079 O  O   . LYS A 1 252 ? 79.445  66.850  24.169  1.00 50.92  ? 432 LYS A O   1 
ATOM   2080 C  CB  . LYS A 1 252 ? 78.024  66.397  27.108  1.00 51.58  ? 432 LYS A CB  1 
ATOM   2081 C  CG  . LYS A 1 252 ? 76.738  65.709  27.579  1.00 52.71  ? 432 LYS A CG  1 
ATOM   2082 C  CD  . LYS A 1 252 ? 76.085  66.399  28.778  1.00 52.76  ? 432 LYS A CD  1 
ATOM   2083 C  CE  . LYS A 1 252 ? 74.797  65.682  29.180  1.00 52.13  ? 432 LYS A CE  1 
ATOM   2084 N  NZ  . LYS A 1 252 ? 74.190  66.225  30.429  1.00 52.97  ? 432 LYS A NZ  1 
ATOM   2085 N  N   . SER A 1 253 ? 80.949  66.716  25.839  1.00 49.81  ? 433 SER A N   1 
ATOM   2086 C  CA  . SER A 1 253 ? 81.955  67.536  25.168  1.00 49.92  ? 433 SER A CA  1 
ATOM   2087 C  C   . SER A 1 253 ? 82.577  66.827  23.969  1.00 50.18  ? 433 SER A C   1 
ATOM   2088 O  O   . SER A 1 253 ? 83.152  67.472  23.089  1.00 51.28  ? 433 SER A O   1 
ATOM   2089 C  CB  . SER A 1 253 ? 83.084  67.896  26.130  1.00 49.89  ? 433 SER A CB  1 
ATOM   2090 O  OG  . SER A 1 253 ? 82.580  68.469  27.318  1.00 53.50  ? 433 SER A OG  1 
ATOM   2091 N  N   . GLU A 1 254 ? 82.483  65.501  23.943  1.00 49.17  ? 434 GLU A N   1 
ATOM   2092 C  CA  . GLU A 1 254 ? 83.072  64.730  22.855  1.00 47.66  ? 434 GLU A CA  1 
ATOM   2093 C  C   . GLU A 1 254 ? 82.017  64.197  21.896  1.00 46.83  ? 434 GLU A C   1 
ATOM   2094 O  O   . GLU A 1 254 ? 82.347  63.567  20.891  1.00 47.57  ? 434 GLU A O   1 
ATOM   2095 C  CB  . GLU A 1 254 ? 83.912  63.575  23.423  1.00 47.11  ? 434 GLU A CB  1 
ATOM   2096 C  CG  . GLU A 1 254 ? 84.930  64.007  24.485  1.00 46.05  ? 434 GLU A CG  1 
ATOM   2097 C  CD  . GLU A 1 254 ? 85.806  62.861  24.971  1.00 45.76  ? 434 GLU A CD  1 
ATOM   2098 O  OE1 . GLU A 1 254 ? 85.382  61.691  24.845  1.00 45.74  ? 434 GLU A OE1 1 
ATOM   2099 O  OE2 . GLU A 1 254 ? 86.912  63.128  25.493  1.00 44.84  ? 434 GLU A OE2 1 
ATOM   2100 N  N   . GLY A 1 255 ? 80.750  64.450  22.208  1.00 45.90  ? 435 GLY A N   1 
ATOM   2101 C  CA  . GLY A 1 255 ? 79.671  64.007  21.343  1.00 44.90  ? 435 GLY A CA  1 
ATOM   2102 C  C   . GLY A 1 255 ? 79.280  62.547  21.474  1.00 44.96  ? 435 GLY A C   1 
ATOM   2103 O  O   . GLY A 1 255 ? 78.562  62.005  20.625  1.00 44.43  ? 435 GLY A O   1 
ATOM   2104 N  N   . LEU A 1 256 ? 79.739  61.904  22.543  1.00 44.59  ? 436 LEU A N   1 
ATOM   2105 C  CA  . LEU A 1 256 ? 79.431  60.497  22.773  1.00 43.34  ? 436 LEU A CA  1 
ATOM   2106 C  C   . LEU A 1 256 ? 78.126  60.360  23.539  1.00 43.68  ? 436 LEU A C   1 
ATOM   2107 O  O   . LEU A 1 256 ? 77.744  61.254  24.293  1.00 44.44  ? 436 LEU A O   1 
ATOM   2108 C  CB  . LEU A 1 256 ? 80.573  59.844  23.548  1.00 41.56  ? 436 LEU A CB  1 
ATOM   2109 C  CG  . LEU A 1 256 ? 81.917  59.998  22.834  1.00 41.03  ? 436 LEU A CG  1 
ATOM   2110 C  CD1 . LEU A 1 256 ? 83.044  59.510  23.719  1.00 39.73  ? 436 LEU A CD1 1 
ATOM   2111 C  CD2 . LEU A 1 256 ? 81.874  59.234  21.514  1.00 40.53  ? 436 LEU A CD2 1 
ATOM   2112 N  N   . PRO A 1 257 ? 77.416  59.238  23.353  1.00 43.94  ? 437 PRO A N   1 
ATOM   2113 C  CA  . PRO A 1 257 ? 76.153  59.063  24.073  1.00 44.74  ? 437 PRO A CA  1 
ATOM   2114 C  C   . PRO A 1 257 ? 76.287  59.184  25.597  1.00 46.09  ? 437 PRO A C   1 
ATOM   2115 O  O   . PRO A 1 257 ? 77.358  58.953  26.167  1.00 45.95  ? 437 PRO A O   1 
ATOM   2116 C  CB  . PRO A 1 257 ? 75.673  57.680  23.607  1.00 45.20  ? 437 PRO A CB  1 
ATOM   2117 C  CG  . PRO A 1 257 ? 76.926  56.993  23.146  1.00 44.09  ? 437 PRO A CG  1 
ATOM   2118 C  CD  . PRO A 1 257 ? 77.698  58.086  22.480  1.00 43.37  ? 437 PRO A CD  1 
ATOM   2119 N  N   . VAL A 1 258 ? 75.195  59.572  26.250  1.00 46.85  ? 438 VAL A N   1 
ATOM   2120 C  CA  . VAL A 1 258 ? 75.190  59.733  27.695  1.00 47.23  ? 438 VAL A CA  1 
ATOM   2121 C  C   . VAL A 1 258 ? 74.157  58.815  28.315  1.00 47.99  ? 438 VAL A C   1 
ATOM   2122 O  O   . VAL A 1 258 ? 73.057  58.644  27.781  1.00 47.89  ? 438 VAL A O   1 
ATOM   2123 C  CB  . VAL A 1 258 ? 74.854  61.183  28.105  1.00 47.32  ? 438 VAL A CB  1 
ATOM   2124 C  CG1 . VAL A 1 258 ? 74.796  61.295  29.622  1.00 46.86  ? 438 VAL A CG1 1 
ATOM   2125 C  CG2 . VAL A 1 258 ? 75.896  62.133  27.550  1.00 46.95  ? 438 VAL A CG2 1 
ATOM   2126 N  N   . ALA A 1 259 ? 74.522  58.216  29.441  1.00 48.23  ? 439 ALA A N   1 
ATOM   2127 C  CA  . ALA A 1 259 ? 73.619  57.325  30.151  1.00 48.28  ? 439 ALA A CA  1 
ATOM   2128 C  C   . ALA A 1 259 ? 72.770  58.188  31.078  1.00 47.89  ? 439 ALA A C   1 
ATOM   2129 O  O   . ALA A 1 259 ? 73.299  59.032  31.807  1.00 47.15  ? 439 ALA A O   1 
ATOM   2130 C  CB  . ALA A 1 259 ? 74.416  56.296  30.959  1.00 48.67  ? 439 ALA A CB  1 
ATOM   2131 N  N   . PRO A 1 260 ? 71.439  58.001  31.049  1.00 47.79  ? 440 PRO A N   1 
ATOM   2132 C  CA  . PRO A 1 260 ? 70.548  58.785  31.905  1.00 47.49  ? 440 PRO A CA  1 
ATOM   2133 C  C   . PRO A 1 260 ? 70.953  58.696  33.374  1.00 47.55  ? 440 PRO A C   1 
ATOM   2134 O  O   . PRO A 1 260 ? 70.931  59.701  34.089  1.00 47.27  ? 440 PRO A O   1 
ATOM   2135 C  CB  . PRO A 1 260 ? 69.181  58.159  31.644  1.00 47.68  ? 440 PRO A CB  1 
ATOM   2136 C  CG  . PRO A 1 260 ? 69.290  57.701  30.228  1.00 47.92  ? 440 PRO A CG  1 
ATOM   2137 C  CD  . PRO A 1 260 ? 70.664  57.074  30.204  1.00 47.77  ? 440 PRO A CD  1 
ATOM   2138 N  N   . PHE A 1 261 ? 71.340  57.499  33.815  1.00 46.94  ? 441 PHE A N   1 
ATOM   2139 C  CA  . PHE A 1 261 ? 71.725  57.303  35.209  1.00 46.75  ? 441 PHE A CA  1 
ATOM   2140 C  C   . PHE A 1 261 ? 73.027  58.001  35.587  1.00 46.45  ? 441 PHE A C   1 
ATOM   2141 O  O   . PHE A 1 261 ? 73.486  57.899  36.722  1.00 45.95  ? 441 PHE A O   1 
ATOM   2142 C  CB  . PHE A 1 261 ? 71.789  55.805  35.548  1.00 47.30  ? 441 PHE A CB  1 
ATOM   2143 C  CG  . PHE A 1 261 ? 72.950  55.074  34.929  1.00 47.44  ? 441 PHE A CG  1 
ATOM   2144 C  CD1 . PHE A 1 261 ? 74.215  55.138  35.503  1.00 48.13  ? 441 PHE A CD1 1 
ATOM   2145 C  CD2 . PHE A 1 261 ? 72.769  54.292  33.791  1.00 48.05  ? 441 PHE A CD2 1 
ATOM   2146 C  CE1 . PHE A 1 261 ? 75.286  54.432  34.955  1.00 48.91  ? 441 PHE A CE1 1 
ATOM   2147 C  CE2 . PHE A 1 261 ? 73.831  53.584  33.234  1.00 48.43  ? 441 PHE A CE2 1 
ATOM   2148 C  CZ  . PHE A 1 261 ? 75.092  53.653  33.819  1.00 48.56  ? 441 PHE A CZ  1 
ATOM   2149 N  N   . MET A 1 262 ? 73.615  58.715  34.632  1.00 46.21  ? 442 MET A N   1 
ATOM   2150 C  CA  . MET A 1 262 ? 74.842  59.468  34.878  1.00 46.77  ? 442 MET A CA  1 
ATOM   2151 C  C   . MET A 1 262 ? 74.597  60.928  34.528  1.00 47.25  ? 442 MET A C   1 
ATOM   2152 O  O   . MET A 1 262 ? 75.502  61.759  34.609  1.00 46.93  ? 442 MET A O   1 
ATOM   2153 C  CB  . MET A 1 262 ? 75.998  58.934  34.029  1.00 45.66  ? 442 MET A CB  1 
ATOM   2154 C  CG  . MET A 1 262 ? 76.687  57.722  34.617  1.00 46.34  ? 442 MET A CG  1 
ATOM   2155 S  SD  . MET A 1 262 ? 78.225  57.302  33.767  1.00 45.12  ? 442 MET A SD  1 
ATOM   2156 C  CE  . MET A 1 262 ? 77.817  55.707  33.154  1.00 44.73  ? 442 MET A CE  1 
ATOM   2157 N  N   . ASP A 1 263 ? 73.359  61.232  34.148  1.00 48.70  ? 443 ASP A N   1 
ATOM   2158 C  CA  . ASP A 1 263 ? 72.980  62.583  33.753  1.00 49.89  ? 443 ASP A CA  1 
ATOM   2159 C  C   . ASP A 1 263 ? 72.852  63.535  34.932  1.00 50.65  ? 443 ASP A C   1 
ATOM   2160 O  O   . ASP A 1 263 ? 71.967  63.393  35.775  1.00 50.29  ? 443 ASP A O   1 
ATOM   2161 C  CB  . ASP A 1 263 ? 71.661  62.558  32.988  1.00 50.37  ? 443 ASP A CB  1 
ATOM   2162 C  CG  . ASP A 1 263 ? 71.474  63.784  32.121  1.00 51.22  ? 443 ASP A CG  1 
ATOM   2163 O  OD1 . ASP A 1 263 ? 71.754  64.902  32.608  1.00 50.69  ? 443 ASP A OD1 1 
ATOM   2164 O  OD2 . ASP A 1 263 ? 71.043  63.628  30.956  1.00 51.41  ? 443 ASP A OD2 1 
ATOM   2165 N  N   . ARG A 1 264 ? 73.744  64.516  34.962  1.00 51.82  ? 444 ARG A N   1 
ATOM   2166 C  CA  . ARG A 1 264 ? 73.794  65.528  36.007  1.00 52.42  ? 444 ARG A CA  1 
ATOM   2167 C  C   . ARG A 1 264 ? 72.442  66.207  36.211  1.00 54.43  ? 444 ARG A C   1 
ATOM   2168 O  O   . ARG A 1 264 ? 72.170  66.761  37.281  1.00 54.89  ? 444 ARG A O   1 
ATOM   2169 C  CB  . ARG A 1 264 ? 74.840  66.572  35.622  1.00 51.41  ? 444 ARG A CB  1 
ATOM   2170 C  CG  . ARG A 1 264 ? 75.609  67.159  36.774  1.00 49.97  ? 444 ARG A CG  1 
ATOM   2171 C  CD  . ARG A 1 264 ? 76.952  67.679  36.293  1.00 47.57  ? 444 ARG A CD  1 
ATOM   2172 N  NE  . ARG A 1 264 ? 77.858  67.883  37.414  1.00 47.44  ? 444 ARG A NE  1 
ATOM   2173 C  CZ  . ARG A 1 264 ? 79.178  67.765  37.336  1.00 47.64  ? 444 ARG A CZ  1 
ATOM   2174 N  NH1 . ARG A 1 264 ? 79.744  67.444  36.186  1.00 47.42  ? 444 ARG A NH1 1 
ATOM   2175 N  NH2 . ARG A 1 264 ? 79.934  67.952  38.410  1.00 47.84  ? 444 ARG A NH2 1 
ATOM   2176 N  N   . ASP A 1 265 ? 71.597  66.153  35.186  1.00 56.08  ? 445 ASP A N   1 
ATOM   2177 C  CA  . ASP A 1 265 ? 70.285  66.792  35.233  1.00 57.71  ? 445 ASP A CA  1 
ATOM   2178 C  C   . ASP A 1 265 ? 69.133  65.890  35.668  1.00 57.79  ? 445 ASP A C   1 
ATOM   2179 O  O   . ASP A 1 265 ? 68.082  66.385  36.084  1.00 58.14  ? 445 ASP A O   1 
ATOM   2180 C  CB  . ASP A 1 265 ? 69.945  67.389  33.857  1.00 59.50  ? 445 ASP A CB  1 
ATOM   2181 C  CG  . ASP A 1 265 ? 70.909  68.493  33.435  1.00 61.22  ? 445 ASP A CG  1 
ATOM   2182 O  OD1 . ASP A 1 265 ? 70.985  69.522  34.146  1.00 62.06  ? 445 ASP A OD1 1 
ATOM   2183 O  OD2 . ASP A 1 265 ? 71.584  68.331  32.390  1.00 61.14  ? 445 ASP A OD2 1 
ATOM   2184 N  N   . LYS A 1 266 ? 69.322  64.577  35.578  1.00 57.36  ? 446 LYS A N   1 
ATOM   2185 C  CA  . LYS A 1 266 ? 68.262  63.636  35.935  1.00 56.31  ? 446 LYS A CA  1 
ATOM   2186 C  C   . LYS A 1 266 ? 68.574  62.742  37.135  1.00 55.46  ? 446 LYS A C   1 
ATOM   2187 O  O   . LYS A 1 266 ? 67.729  61.944  37.550  1.00 55.41  ? 446 LYS A O   1 
ATOM   2188 C  CB  . LYS A 1 266 ? 67.951  62.726  34.745  1.00 56.57  ? 446 LYS A CB  1 
ATOM   2189 C  CG  . LYS A 1 266 ? 68.026  63.385  33.379  1.00 56.46  ? 446 LYS A CG  1 
ATOM   2190 C  CD  . LYS A 1 266 ? 67.762  62.348  32.298  1.00 56.19  ? 446 LYS A CD  1 
ATOM   2191 C  CE  . LYS A 1 266 ? 67.956  62.913  30.903  1.00 56.52  ? 446 LYS A CE  1 
ATOM   2192 N  NZ  . LYS A 1 266 ? 67.632  61.898  29.860  1.00 56.03  ? 446 LYS A NZ  1 
ATOM   2193 N  N   . VAL A 1 267 ? 69.770  62.868  37.696  1.00 54.11  ? 447 VAL A N   1 
ATOM   2194 C  CA  . VAL A 1 267 ? 70.150  62.005  38.806  1.00 52.32  ? 447 VAL A CA  1 
ATOM   2195 C  C   . VAL A 1 267 ? 70.478  62.701  40.113  1.00 51.62  ? 447 VAL A C   1 
ATOM   2196 O  O   . VAL A 1 267 ? 71.167  63.723  40.133  1.00 51.92  ? 447 VAL A O   1 
ATOM   2197 C  CB  . VAL A 1 267 ? 71.370  61.125  38.423  1.00 51.95  ? 447 VAL A CB  1 
ATOM   2198 C  CG1 . VAL A 1 267 ? 71.729  60.195  39.573  1.00 51.41  ? 447 VAL A CG1 1 
ATOM   2199 C  CG2 . VAL A 1 267 ? 71.060  60.323  37.171  1.00 50.89  ? 447 VAL A CG2 1 
ATOM   2200 N  N   . THR A 1 268 ? 69.972  62.125  41.203  1.00 50.08  ? 448 THR A N   1 
ATOM   2201 C  CA  . THR A 1 268 ? 70.228  62.619  42.553  1.00 48.61  ? 448 THR A CA  1 
ATOM   2202 C  C   . THR A 1 268 ? 70.692  61.428  43.375  1.00 48.26  ? 448 THR A C   1 
ATOM   2203 O  O   . THR A 1 268 ? 70.567  60.276  42.951  1.00 48.67  ? 448 THR A O   1 
ATOM   2204 C  CB  . THR A 1 268 ? 68.969  63.184  43.243  1.00 48.13  ? 448 THR A CB  1 
ATOM   2205 O  OG1 . THR A 1 268 ? 67.977  62.155  43.341  1.00 47.65  ? 448 THR A OG1 1 
ATOM   2206 C  CG2 . THR A 1 268 ? 68.414  64.366  42.473  1.00 47.48  ? 448 THR A CG2 1 
ATOM   2207 N  N   . LYS A 1 269 ? 71.224  61.709  44.553  1.00 47.43  ? 449 LYS A N   1 
ATOM   2208 C  CA  . LYS A 1 269 ? 71.698  60.665  45.443  1.00 46.54  ? 449 LYS A CA  1 
ATOM   2209 C  C   . LYS A 1 269 ? 70.568  59.648  45.665  1.00 45.07  ? 449 LYS A C   1 
ATOM   2210 O  O   . LYS A 1 269 ? 70.786  58.437  45.612  1.00 44.74  ? 449 LYS A O   1 
ATOM   2211 C  CB  . LYS A 1 269 ? 72.137  61.312  46.760  1.00 48.08  ? 449 LYS A CB  1 
ATOM   2212 C  CG  . LYS A 1 269 ? 73.098  60.493  47.587  1.00 51.49  ? 449 LYS A CG  1 
ATOM   2213 C  CD  . LYS A 1 269 ? 73.991  61.388  48.447  1.00 53.97  ? 449 LYS A CD  1 
ATOM   2214 C  CE  . LYS A 1 269 ? 73.183  62.275  49.387  1.00 55.98  ? 449 LYS A CE  1 
ATOM   2215 N  NZ  . LYS A 1 269 ? 74.061  63.131  50.241  1.00 57.40  ? 449 LYS A NZ  1 
ATOM   2216 N  N   . ALA A 1 270 ? 69.354  60.153  45.869  1.00 43.05  ? 450 ALA A N   1 
ATOM   2217 C  CA  . ALA A 1 270 ? 68.187  59.310  46.113  1.00 41.53  ? 450 ALA A CA  1 
ATOM   2218 C  C   . ALA A 1 270 ? 67.736  58.434  44.940  1.00 41.11  ? 450 ALA A C   1 
ATOM   2219 O  O   . ALA A 1 270 ? 67.491  57.238  45.114  1.00 40.53  ? 450 ALA A O   1 
ATOM   2220 C  CB  . ALA A 1 270 ? 67.021  60.176  46.582  1.00 40.24  ? 450 ALA A CB  1 
ATOM   2221 N  N   . THR A 1 271 ? 67.609  59.022  43.754  1.00 40.46  ? 451 THR A N   1 
ATOM   2222 C  CA  . THR A 1 271 ? 67.162  58.265  42.586  1.00 40.25  ? 451 THR A CA  1 
ATOM   2223 C  C   . THR A 1 271 ? 68.170  57.193  42.199  1.00 39.48  ? 451 THR A C   1 
ATOM   2224 O  O   . THR A 1 271 ? 67.800  56.130  41.694  1.00 40.47  ? 451 THR A O   1 
ATOM   2225 C  CB  . THR A 1 271 ? 66.932  59.184  41.358  1.00 40.94  ? 451 THR A CB  1 
ATOM   2226 O  OG1 . THR A 1 271 ? 68.169  59.807  40.979  1.00 41.71  ? 451 THR A OG1 1 
ATOM   2227 C  CG2 . THR A 1 271 ? 65.896  60.253  41.683  1.00 40.76  ? 451 THR A CG2 1 
ATOM   2228 N  N   . ALA A 1 272 ? 69.442  57.477  42.442  1.00 37.57  ? 452 ALA A N   1 
ATOM   2229 C  CA  . ALA A 1 272 ? 70.503  56.541  42.112  1.00 37.28  ? 452 ALA A CA  1 
ATOM   2230 C  C   . ALA A 1 272 ? 70.468  55.285  42.981  1.00 37.15  ? 452 ALA A C   1 
ATOM   2231 O  O   . ALA A 1 272 ? 70.645  54.169  42.486  1.00 37.88  ? 452 ALA A O   1 
ATOM   2232 C  CB  . ALA A 1 272 ? 71.852  57.223  42.256  1.00 36.55  ? 452 ALA A CB  1 
ATOM   2233 N  N   . GLN A 1 273 ? 70.227  55.465  44.274  1.00 35.63  ? 453 GLN A N   1 
ATOM   2234 C  CA  . GLN A 1 273 ? 70.219  54.345  45.201  1.00 34.47  ? 453 GLN A CA  1 
ATOM   2235 C  C   . GLN A 1 273 ? 68.910  53.576  45.313  1.00 34.01  ? 453 GLN A C   1 
ATOM   2236 O  O   . GLN A 1 273 ? 68.924  52.356  45.457  1.00 34.06  ? 453 GLN A O   1 
ATOM   2237 C  CB  . GLN A 1 273 ? 70.657  54.828  46.578  1.00 33.58  ? 453 GLN A CB  1 
ATOM   2238 C  CG  . GLN A 1 273 ? 72.035  55.483  46.593  1.00 33.67  ? 453 GLN A CG  1 
ATOM   2239 C  CD  . GLN A 1 273 ? 73.132  54.578  46.045  1.00 33.78  ? 453 GLN A CD  1 
ATOM   2240 O  OE1 . GLN A 1 273 ? 73.369  54.518  44.835  1.00 34.54  ? 453 GLN A OE1 1 
ATOM   2241 N  NE2 . GLN A 1 273 ? 73.794  53.852  46.939  1.00 30.94  ? 453 GLN A NE2 1 
ATOM   2242 N  N   . ILE A 1 274 ? 67.782  54.274  45.248  1.00 34.59  ? 454 ILE A N   1 
ATOM   2243 C  CA  . ILE A 1 274 ? 66.482  53.614  45.351  1.00 34.03  ? 454 ILE A CA  1 
ATOM   2244 C  C   . ILE A 1 274 ? 66.370  52.441  44.376  1.00 33.93  ? 454 ILE A C   1 
ATOM   2245 O  O   . ILE A 1 274 ? 66.114  51.308  44.783  1.00 34.17  ? 454 ILE A O   1 
ATOM   2246 C  CB  . ILE A 1 274 ? 65.329  54.602  45.080  1.00 34.53  ? 454 ILE A CB  1 
ATOM   2247 C  CG1 . ILE A 1 274 ? 65.210  55.593  46.244  1.00 35.49  ? 454 ILE A CG1 1 
ATOM   2248 C  CG2 . ILE A 1 274 ? 64.023  53.842  44.886  1.00 34.31  ? 454 ILE A CG2 1 
ATOM   2249 C  CD1 . ILE A 1 274 ? 64.218  56.706  45.999  1.00 35.26  ? 454 ILE A CD1 1 
ATOM   2250 N  N   . GLY A 1 275 ? 66.568  52.720  43.093  1.00 33.22  ? 455 GLY A N   1 
ATOM   2251 C  CA  . GLY A 1 275 ? 66.480  51.678  42.091  1.00 32.62  ? 455 GLY A CA  1 
ATOM   2252 C  C   . GLY A 1 275 ? 67.560  50.618  42.221  1.00 32.76  ? 455 GLY A C   1 
ATOM   2253 O  O   . GLY A 1 275 ? 67.300  49.425  42.044  1.00 32.60  ? 455 GLY A O   1 
ATOM   2254 N  N   . PHE A 1 276 ? 68.775  51.049  42.537  1.00 31.10  ? 456 PHE A N   1 
ATOM   2255 C  CA  . PHE A 1 276 ? 69.888  50.123  42.673  1.00 31.07  ? 456 PHE A CA  1 
ATOM   2256 C  C   . PHE A 1 276 ? 69.680  49.185  43.860  1.00 31.07  ? 456 PHE A C   1 
ATOM   2257 O  O   . PHE A 1 276 ? 70.014  48.007  43.795  1.00 31.63  ? 456 PHE A O   1 
ATOM   2258 C  CB  . PHE A 1 276 ? 71.195  50.903  42.842  1.00 30.00  ? 456 PHE A CB  1 
ATOM   2259 C  CG  . PHE A 1 276 ? 72.430  50.043  42.790  1.00 29.14  ? 456 PHE A CG  1 
ATOM   2260 C  CD1 . PHE A 1 276 ? 72.814  49.424  41.605  1.00 29.27  ? 456 PHE A CD1 1 
ATOM   2261 C  CD2 . PHE A 1 276 ? 73.210  49.857  43.924  1.00 28.54  ? 456 PHE A CD2 1 
ATOM   2262 C  CE1 . PHE A 1 276 ? 73.956  48.634  41.552  1.00 28.20  ? 456 PHE A CE1 1 
ATOM   2263 C  CE2 . PHE A 1 276 ? 74.352  49.068  43.883  1.00 27.63  ? 456 PHE A CE2 1 
ATOM   2264 C  CZ  . PHE A 1 276 ? 74.727  48.456  42.697  1.00 28.59  ? 456 PHE A CZ  1 
ATOM   2265 N  N   . ILE A 1 277 ? 69.122  49.704  44.944  1.00 30.95  ? 457 ILE A N   1 
ATOM   2266 C  CA  . ILE A 1 277 ? 68.897  48.879  46.119  1.00 32.10  ? 457 ILE A CA  1 
ATOM   2267 C  C   . ILE A 1 277 ? 67.757  47.894  45.885  1.00 33.26  ? 457 ILE A C   1 
ATOM   2268 O  O   . ILE A 1 277 ? 67.864  46.712  46.219  1.00 32.81  ? 457 ILE A O   1 
ATOM   2269 C  CB  . ILE A 1 277 ? 68.572  49.746  47.358  1.00 31.18  ? 457 ILE A CB  1 
ATOM   2270 C  CG1 . ILE A 1 277 ? 69.752  50.675  47.668  1.00 31.64  ? 457 ILE A CG1 1 
ATOM   2271 C  CG2 . ILE A 1 277 ? 68.289  48.859  48.560  1.00 30.68  ? 457 ILE A CG2 1 
ATOM   2272 C  CD1 . ILE A 1 277 ? 69.473  51.684  48.772  1.00 31.10  ? 457 ILE A CD1 1 
ATOM   2273 N  N   . LYS A 1 278 ? 66.679  48.381  45.282  1.00 34.21  ? 458 LYS A N   1 
ATOM   2274 C  CA  . LYS A 1 278 ? 65.509  47.552  45.035  1.00 36.64  ? 458 LYS A CA  1 
ATOM   2275 C  C   . LYS A 1 278 ? 65.644  46.504  43.937  1.00 36.69  ? 458 LYS A C   1 
ATOM   2276 O  O   . LYS A 1 278 ? 65.119  45.398  44.072  1.00 37.52  ? 458 LYS A O   1 
ATOM   2277 C  CB  . LYS A 1 278 ? 64.297  48.441  44.728  1.00 38.24  ? 458 LYS A CB  1 
ATOM   2278 C  CG  . LYS A 1 278 ? 63.913  49.383  45.864  1.00 41.85  ? 458 LYS A CG  1 
ATOM   2279 C  CD  . LYS A 1 278 ? 62.767  50.312  45.469  1.00 44.84  ? 458 LYS A CD  1 
ATOM   2280 C  CE  . LYS A 1 278 ? 61.492  49.538  45.184  1.00 46.86  ? 458 LYS A CE  1 
ATOM   2281 N  NZ  . LYS A 1 278 ? 60.405  50.437  44.715  1.00 49.65  ? 458 LYS A NZ  1 
ATOM   2282 N  N   . PHE A 1 279 ? 66.354  46.822  42.861  1.00 35.83  ? 459 PHE A N   1 
ATOM   2283 C  CA  . PHE A 1 279 ? 66.455  45.874  41.762  1.00 36.13  ? 459 PHE A CA  1 
ATOM   2284 C  C   . PHE A 1 279 ? 67.800  45.211  41.516  1.00 35.14  ? 459 PHE A C   1 
ATOM   2285 O  O   . PHE A 1 279 ? 67.933  44.403  40.597  1.00 35.37  ? 459 PHE A O   1 
ATOM   2286 C  CB  . PHE A 1 279 ? 65.933  46.544  40.489  1.00 38.31  ? 459 PHE A CB  1 
ATOM   2287 C  CG  . PHE A 1 279 ? 64.580  47.184  40.674  1.00 41.22  ? 459 PHE A CG  1 
ATOM   2288 C  CD1 . PHE A 1 279 ? 64.438  48.568  40.660  1.00 41.67  ? 459 PHE A CD1 1 
ATOM   2289 C  CD2 . PHE A 1 279 ? 63.459  46.400  40.945  1.00 42.56  ? 459 PHE A CD2 1 
ATOM   2290 C  CE1 . PHE A 1 279 ? 63.203  49.164  40.919  1.00 42.78  ? 459 PHE A CE1 1 
ATOM   2291 C  CE2 . PHE A 1 279 ? 62.215  46.988  41.208  1.00 43.64  ? 459 PHE A CE2 1 
ATOM   2292 C  CZ  . PHE A 1 279 ? 62.090  48.372  41.195  1.00 43.27  ? 459 PHE A CZ  1 
ATOM   2293 N  N   . VAL A 1 280 ? 68.793  45.534  42.336  1.00 33.64  ? 460 VAL A N   1 
ATOM   2294 C  CA  . VAL A 1 280 ? 70.105  44.915  42.196  1.00 32.97  ? 460 VAL A CA  1 
ATOM   2295 C  C   . VAL A 1 280 ? 70.546  44.308  43.520  1.00 33.16  ? 460 VAL A C   1 
ATOM   2296 O  O   . VAL A 1 280 ? 70.725  43.097  43.629  1.00 32.23  ? 460 VAL A O   1 
ATOM   2297 C  CB  . VAL A 1 280 ? 71.183  45.923  41.746  1.00 32.47  ? 460 VAL A CB  1 
ATOM   2298 C  CG1 . VAL A 1 280 ? 72.543  45.237  41.712  1.00 31.00  ? 460 VAL A CG1 1 
ATOM   2299 C  CG2 . VAL A 1 280 ? 70.839  46.480  40.371  1.00 31.15  ? 460 VAL A CG2 1 
ATOM   2300 N  N   . LEU A 1 281 ? 70.684  45.157  44.534  1.00 32.99  ? 461 LEU A N   1 
ATOM   2301 C  CA  . LEU A 1 281 ? 71.136  44.724  45.848  1.00 33.13  ? 461 LEU A CA  1 
ATOM   2302 C  C   . LEU A 1 281 ? 70.232  43.765  46.612  1.00 33.71  ? 461 LEU A C   1 
ATOM   2303 O  O   . LEU A 1 281 ? 70.672  42.692  47.029  1.00 34.26  ? 461 LEU A O   1 
ATOM   2304 C  CB  . LEU A 1 281 ? 71.426  45.948  46.714  1.00 32.98  ? 461 LEU A CB  1 
ATOM   2305 C  CG  . LEU A 1 281 ? 72.694  46.723  46.354  1.00 32.93  ? 461 LEU A CG  1 
ATOM   2306 C  CD1 . LEU A 1 281 ? 72.688  48.074  47.047  1.00 32.64  ? 461 LEU A CD1 1 
ATOM   2307 C  CD2 . LEU A 1 281 ? 73.916  45.915  46.767  1.00 33.15  ? 461 LEU A CD2 1 
ATOM   2308 N  N   . ILE A 1 282 ? 68.979  44.150  46.818  1.00 33.19  ? 462 ILE A N   1 
ATOM   2309 C  CA  . ILE A 1 282 ? 68.061  43.302  47.564  1.00 33.77  ? 462 ILE A CA  1 
ATOM   2310 C  C   . ILE A 1 282 ? 67.831  41.936  46.915  1.00 33.79  ? 462 ILE A C   1 
ATOM   2311 O  O   . ILE A 1 282 ? 67.946  40.906  47.574  1.00 33.00  ? 462 ILE A O   1 
ATOM   2312 C  CB  . ILE A 1 282 ? 66.713  44.032  47.805  1.00 33.97  ? 462 ILE A CB  1 
ATOM   2313 C  CG1 . ILE A 1 282 ? 66.912  45.109  48.880  1.00 34.31  ? 462 ILE A CG1 1 
ATOM   2314 C  CG2 . ILE A 1 282 ? 65.636  43.052  48.244  1.00 34.15  ? 462 ILE A CG2 1 
ATOM   2315 C  CD1 . ILE A 1 282 ? 65.672  45.921  49.187  1.00 34.68  ? 462 ILE A CD1 1 
ATOM   2316 N  N   . PRO A 1 283 ? 67.512  41.905  45.615  1.00 34.12  ? 463 PRO A N   1 
ATOM   2317 C  CA  . PRO A 1 283 ? 67.283  40.617  44.956  1.00 34.25  ? 463 PRO A CA  1 
ATOM   2318 C  C   . PRO A 1 283 ? 68.478  39.672  45.076  1.00 35.42  ? 463 PRO A C   1 
ATOM   2319 O  O   . PRO A 1 283 ? 68.308  38.479  45.339  1.00 36.35  ? 463 PRO A O   1 
ATOM   2320 C  CB  . PRO A 1 283 ? 67.011  41.011  43.508  1.00 34.34  ? 463 PRO A CB  1 
ATOM   2321 C  CG  . PRO A 1 283 ? 66.396  42.381  43.643  1.00 34.78  ? 463 PRO A CG  1 
ATOM   2322 C  CD  . PRO A 1 283 ? 67.266  43.023  44.687  1.00 33.98  ? 463 PRO A CD  1 
ATOM   2323 N  N   . MET A 1 284 ? 69.683  40.205  44.888  1.00 34.96  ? 464 MET A N   1 
ATOM   2324 C  CA  . MET A 1 284 ? 70.884  39.383  44.963  1.00 35.03  ? 464 MET A CA  1 
ATOM   2325 C  C   . MET A 1 284 ? 71.166  38.833  46.359  1.00 34.90  ? 464 MET A C   1 
ATOM   2326 O  O   . MET A 1 284 ? 71.441  37.647  46.509  1.00 34.21  ? 464 MET A O   1 
ATOM   2327 C  CB  . MET A 1 284 ? 72.100  40.160  44.461  1.00 34.28  ? 464 MET A CB  1 
ATOM   2328 C  CG  . MET A 1 284 ? 73.372  39.330  44.444  1.00 34.27  ? 464 MET A CG  1 
ATOM   2329 S  SD  . MET A 1 284 ? 74.718  40.127  43.553  1.00 35.89  ? 464 MET A SD  1 
ATOM   2330 C  CE  . MET A 1 284 ? 74.946  41.584  44.535  1.00 34.41  ? 464 MET A CE  1 
ATOM   2331 N  N   . PHE A 1 285 ? 71.117  39.690  47.377  1.00 34.54  ? 465 PHE A N   1 
ATOM   2332 C  CA  . PHE A 1 285 ? 71.357  39.243  48.741  1.00 34.94  ? 465 PHE A CA  1 
ATOM   2333 C  C   . PHE A 1 285 ? 70.224  38.336  49.204  1.00 36.36  ? 465 PHE A C   1 
ATOM   2334 O  O   . PHE A 1 285 ? 70.377  37.553  50.137  1.00 36.32  ? 465 PHE A O   1 
ATOM   2335 C  CB  . PHE A 1 285 ? 71.482  40.434  49.691  1.00 33.09  ? 465 PHE A CB  1 
ATOM   2336 C  CG  . PHE A 1 285 ? 72.836  41.069  49.677  1.00 32.36  ? 465 PHE A CG  1 
ATOM   2337 C  CD1 . PHE A 1 285 ? 73.126  42.109  48.803  1.00 31.38  ? 465 PHE A CD1 1 
ATOM   2338 C  CD2 . PHE A 1 285 ? 73.841  40.592  50.510  1.00 31.21  ? 465 PHE A CD2 1 
ATOM   2339 C  CE1 . PHE A 1 285 ? 74.398  42.669  48.755  1.00 31.57  ? 465 PHE A CE1 1 
ATOM   2340 C  CE2 . PHE A 1 285 ? 75.117  41.144  50.470  1.00 32.09  ? 465 PHE A CE2 1 
ATOM   2341 C  CZ  . PHE A 1 285 ? 75.396  42.186  49.587  1.00 30.67  ? 465 PHE A CZ  1 
ATOM   2342 N  N   . GLU A 1 286 ? 69.084  38.458  48.540  1.00 37.81  ? 466 GLU A N   1 
ATOM   2343 C  CA  . GLU A 1 286 ? 67.915  37.656  48.851  1.00 39.67  ? 466 GLU A CA  1 
ATOM   2344 C  C   . GLU A 1 286 ? 68.199  36.203  48.455  1.00 39.77  ? 466 GLU A C   1 
ATOM   2345 O  O   . GLU A 1 286 ? 67.966  35.281  49.239  1.00 39.75  ? 466 GLU A O   1 
ATOM   2346 C  CB  . GLU A 1 286 ? 66.720  38.201  48.074  1.00 41.35  ? 466 GLU A CB  1 
ATOM   2347 C  CG  . GLU A 1 286 ? 65.436  38.271  48.861  1.00 44.98  ? 466 GLU A CG  1 
ATOM   2348 C  CD  . GLU A 1 286 ? 64.531  39.398  48.384  1.00 46.53  ? 466 GLU A CD  1 
ATOM   2349 O  OE1 . GLU A 1 286 ? 64.348  39.542  47.154  1.00 46.47  ? 466 GLU A OE1 1 
ATOM   2350 O  OE2 . GLU A 1 286 ? 63.998  40.137  49.244  1.00 49.18  ? 466 GLU A OE2 1 
ATOM   2351 N  N   . THR A 1 287 ? 68.715  36.003  47.242  1.00 39.99  ? 467 THR A N   1 
ATOM   2352 C  CA  . THR A 1 287 ? 69.030  34.655  46.784  1.00 40.84  ? 467 THR A CA  1 
ATOM   2353 C  C   . THR A 1 287 ? 70.205  34.093  47.586  1.00 40.39  ? 467 THR A C   1 
ATOM   2354 O  O   . THR A 1 287 ? 70.245  32.895  47.885  1.00 41.69  ? 467 THR A O   1 
ATOM   2355 C  CB  . THR A 1 287 ? 69.370  34.610  45.269  1.00 41.52  ? 467 THR A CB  1 
ATOM   2356 O  OG1 . THR A 1 287 ? 70.568  35.346  45.021  1.00 44.03  ? 467 THR A OG1 1 
ATOM   2357 C  CG2 . THR A 1 287 ? 68.236  35.204  44.440  1.00 41.97  ? 467 THR A CG2 1 
ATOM   2358 N  N   . VAL A 1 288 ? 71.155  34.950  47.950  1.00 38.54  ? 468 VAL A N   1 
ATOM   2359 C  CA  . VAL A 1 288 ? 72.300  34.500  48.735  1.00 36.73  ? 468 VAL A CA  1 
ATOM   2360 C  C   . VAL A 1 288 ? 71.812  34.031  50.104  1.00 37.35  ? 468 VAL A C   1 
ATOM   2361 O  O   . VAL A 1 288 ? 72.355  33.085  50.681  1.00 36.44  ? 468 VAL A O   1 
ATOM   2362 C  CB  . VAL A 1 288 ? 73.337  35.631  48.944  1.00 35.73  ? 468 VAL A CB  1 
ATOM   2363 C  CG1 . VAL A 1 288 ? 74.355  35.218  49.991  1.00 34.42  ? 468 VAL A CG1 1 
ATOM   2364 C  CG2 . VAL A 1 288 ? 74.043  35.944  47.638  1.00 34.31  ? 468 VAL A CG2 1 
ATOM   2365 N  N   . THR A 1 289 ? 70.783  34.703  50.615  1.00 37.34  ? 469 THR A N   1 
ATOM   2366 C  CA  . THR A 1 289 ? 70.219  34.376  51.918  1.00 38.38  ? 469 THR A CA  1 
ATOM   2367 C  C   . THR A 1 289 ? 69.641  32.961  51.974  1.00 38.46  ? 469 THR A C   1 
ATOM   2368 O  O   . THR A 1 289 ? 69.563  32.365  53.044  1.00 38.81  ? 469 THR A O   1 
ATOM   2369 C  CB  . THR A 1 289 ? 69.120  35.388  52.313  1.00 39.14  ? 469 THR A CB  1 
ATOM   2370 O  OG1 . THR A 1 289 ? 69.707  36.684  52.481  1.00 39.85  ? 469 THR A OG1 1 
ATOM   2371 C  CG2 . THR A 1 289 ? 68.443  34.973  53.622  1.00 38.43  ? 469 THR A CG2 1 
ATOM   2372 N  N   . LYS A 1 290 ? 69.231  32.427  50.829  1.00 38.92  ? 470 LYS A N   1 
ATOM   2373 C  CA  . LYS A 1 290 ? 68.691  31.073  50.797  1.00 40.11  ? 470 LYS A CA  1 
ATOM   2374 C  C   . LYS A 1 290 ? 69.770  30.089  51.232  1.00 39.98  ? 470 LYS A C   1 
ATOM   2375 O  O   . LYS A 1 290 ? 69.482  29.101  51.909  1.00 40.48  ? 470 LYS A O   1 
ATOM   2376 C  CB  . LYS A 1 290 ? 68.202  30.723  49.394  1.00 40.56  ? 470 LYS A CB  1 
ATOM   2377 C  CG  . LYS A 1 290 ? 66.889  31.389  49.031  1.00 43.33  ? 470 LYS A CG  1 
ATOM   2378 C  CD  . LYS A 1 290 ? 66.516  31.111  47.585  1.00 44.82  ? 470 LYS A CD  1 
ATOM   2379 C  CE  . LYS A 1 290 ? 65.179  31.742  47.236  1.00 46.50  ? 470 LYS A CE  1 
ATOM   2380 N  NZ  . LYS A 1 290 ? 64.959  31.739  45.762  1.00 48.41  ? 470 LYS A NZ  1 
ATOM   2381 N  N   . LEU A 1 291 ? 71.012  30.372  50.843  1.00 39.73  ? 471 LEU A N   1 
ATOM   2382 C  CA  . LEU A 1 291 ? 72.157  29.537  51.198  1.00 38.77  ? 471 LEU A CA  1 
ATOM   2383 C  C   . LEU A 1 291 ? 72.630  29.851  52.616  1.00 38.25  ? 471 LEU A C   1 
ATOM   2384 O  O   . LEU A 1 291 ? 72.936  28.944  53.392  1.00 39.22  ? 471 LEU A O   1 
ATOM   2385 C  CB  . LEU A 1 291 ? 73.303  29.770  50.208  1.00 39.14  ? 471 LEU A CB  1 
ATOM   2386 C  CG  . LEU A 1 291 ? 73.659  28.638  49.243  1.00 39.80  ? 471 LEU A CG  1 
ATOM   2387 C  CD1 . LEU A 1 291 ? 72.404  27.940  48.767  1.00 39.56  ? 471 LEU A CD1 1 
ATOM   2388 C  CD2 . LEU A 1 291 ? 74.448  29.204  48.071  1.00 39.34  ? 471 LEU A CD2 1 
ATOM   2389 N  N   . PHE A 1 292 ? 72.686  31.138  52.948  1.00 36.78  ? 472 PHE A N   1 
ATOM   2390 C  CA  . PHE A 1 292 ? 73.119  31.567  54.272  1.00 36.11  ? 472 PHE A CA  1 
ATOM   2391 C  C   . PHE A 1 292 ? 72.068  32.484  54.880  1.00 36.74  ? 472 PHE A C   1 
ATOM   2392 O  O   . PHE A 1 292 ? 72.115  33.703  54.711  1.00 37.04  ? 472 PHE A O   1 
ATOM   2393 C  CB  . PHE A 1 292 ? 74.453  32.303  54.185  1.00 33.99  ? 472 PHE A CB  1 
ATOM   2394 C  CG  . PHE A 1 292 ? 75.477  31.598  53.350  1.00 32.44  ? 472 PHE A CG  1 
ATOM   2395 C  CD1 . PHE A 1 292 ? 75.626  31.912  52.004  1.00 30.29  ? 472 PHE A CD1 1 
ATOM   2396 C  CD2 . PHE A 1 292 ? 76.292  30.614  53.908  1.00 31.51  ? 472 PHE A CD2 1 
ATOM   2397 C  CE1 . PHE A 1 292 ? 76.576  31.260  51.222  1.00 31.59  ? 472 PHE A CE1 1 
ATOM   2398 C  CE2 . PHE A 1 292 ? 77.242  29.955  53.138  1.00 30.37  ? 472 PHE A CE2 1 
ATOM   2399 C  CZ  . PHE A 1 292 ? 77.388  30.277  51.791  1.00 30.48  ? 472 PHE A CZ  1 
ATOM   2400 N  N   . PRO A 1 293 ? 71.110  31.902  55.615  1.00 37.30  ? 473 PRO A N   1 
ATOM   2401 C  CA  . PRO A 1 293 ? 70.025  32.652  56.258  1.00 36.92  ? 473 PRO A CA  1 
ATOM   2402 C  C   . PRO A 1 293 ? 70.460  33.791  57.179  1.00 36.55  ? 473 PRO A C   1 
ATOM   2403 O  O   . PRO A 1 293 ? 69.736  34.775  57.336  1.00 36.33  ? 473 PRO A O   1 
ATOM   2404 C  CB  . PRO A 1 293 ? 69.248  31.563  57.002  1.00 37.01  ? 473 PRO A CB  1 
ATOM   2405 C  CG  . PRO A 1 293 ? 70.309  30.550  57.325  1.00 38.06  ? 473 PRO A CG  1 
ATOM   2406 C  CD  . PRO A 1 293 ? 71.087  30.486  56.027  1.00 36.97  ? 473 PRO A CD  1 
ATOM   2407 N  N   . MET A 1 294 ? 71.637  33.668  57.783  1.00 36.18  ? 474 MET A N   1 
ATOM   2408 C  CA  . MET A 1 294 ? 72.110  34.705  58.684  1.00 37.30  ? 474 MET A CA  1 
ATOM   2409 C  C   . MET A 1 294 ? 72.393  36.010  57.941  1.00 38.31  ? 474 MET A C   1 
ATOM   2410 O  O   . MET A 1 294 ? 72.535  37.066  58.557  1.00 37.68  ? 474 MET A O   1 
ATOM   2411 C  CB  . MET A 1 294 ? 73.364  34.245  59.435  1.00 37.54  ? 474 MET A CB  1 
ATOM   2412 C  CG  . MET A 1 294 ? 74.578  33.932  58.566  1.00 40.01  ? 474 MET A CG  1 
ATOM   2413 S  SD  . MET A 1 294 ? 74.436  32.427  57.562  1.00 42.90  ? 474 MET A SD  1 
ATOM   2414 C  CE  . MET A 1 294 ? 74.317  31.173  58.856  1.00 43.58  ? 474 MET A CE  1 
ATOM   2415 N  N   . VAL A 1 295 ? 72.464  35.939  56.615  1.00 38.54  ? 475 VAL A N   1 
ATOM   2416 C  CA  . VAL A 1 295 ? 72.726  37.126  55.815  1.00 39.31  ? 475 VAL A CA  1 
ATOM   2417 C  C   . VAL A 1 295 ? 71.533  38.088  55.810  1.00 39.96  ? 475 VAL A C   1 
ATOM   2418 O  O   . VAL A 1 295 ? 71.705  39.289  55.614  1.00 39.76  ? 475 VAL A O   1 
ATOM   2419 C  CB  . VAL A 1 295 ? 73.084  36.750  54.354  1.00 38.36  ? 475 VAL A CB  1 
ATOM   2420 C  CG1 . VAL A 1 295 ? 73.085  37.990  53.472  1.00 39.41  ? 475 VAL A CG1 1 
ATOM   2421 C  CG2 . VAL A 1 295 ? 74.452  36.102  54.308  1.00 38.42  ? 475 VAL A CG2 1 
ATOM   2422 N  N   . GLU A 1 296 ? 70.330  37.569  56.039  1.00 40.58  ? 476 GLU A N   1 
ATOM   2423 C  CA  . GLU A 1 296 ? 69.142  38.419  56.025  1.00 41.66  ? 476 GLU A CA  1 
ATOM   2424 C  C   . GLU A 1 296 ? 69.174  39.522  57.067  1.00 42.03  ? 476 GLU A C   1 
ATOM   2425 O  O   . GLU A 1 296 ? 69.052  40.698  56.745  1.00 41.96  ? 476 GLU A O   1 
ATOM   2426 C  CB  . GLU A 1 296 ? 67.870  37.593  56.223  1.00 42.31  ? 476 GLU A CB  1 
ATOM   2427 C  CG  . GLU A 1 296 ? 66.623  38.454  56.325  1.00 44.40  ? 476 GLU A CG  1 
ATOM   2428 C  CD  . GLU A 1 296 ? 65.339  37.660  56.256  1.00 46.13  ? 476 GLU A CD  1 
ATOM   2429 O  OE1 . GLU A 1 296 ? 65.161  36.911  55.275  1.00 48.06  ? 476 GLU A OE1 1 
ATOM   2430 O  OE2 . GLU A 1 296 ? 64.501  37.791  57.173  1.00 47.05  ? 476 GLU A OE2 1 
ATOM   2431 N  N   . GLU A 1 297 ? 69.334  39.132  58.320  1.00 42.25  ? 477 GLU A N   1 
ATOM   2432 C  CA  . GLU A 1 297 ? 69.364  40.081  59.419  1.00 43.26  ? 477 GLU A CA  1 
ATOM   2433 C  C   . GLU A 1 297 ? 70.581  41.017  59.429  1.00 42.14  ? 477 GLU A C   1 
ATOM   2434 O  O   . GLU A 1 297 ? 70.472  42.178  59.824  1.00 41.99  ? 477 GLU A O   1 
ATOM   2435 C  CB  . GLU A 1 297 ? 69.288  39.301  60.731  1.00 44.84  ? 477 GLU A CB  1 
ATOM   2436 C  CG  . GLU A 1 297 ? 69.414  40.117  61.994  1.00 47.64  ? 477 GLU A CG  1 
ATOM   2437 C  CD  . GLU A 1 297 ? 69.481  39.222  63.221  1.00 50.28  ? 477 GLU A CD  1 
ATOM   2438 O  OE1 . GLU A 1 297 ? 68.493  38.490  63.475  1.00 50.93  ? 477 GLU A OE1 1 
ATOM   2439 O  OE2 . GLU A 1 297 ? 70.522  39.239  63.921  1.00 50.79  ? 477 GLU A OE2 1 
ATOM   2440 N  N   . ILE A 1 298 ? 71.734  40.523  58.991  1.00 40.68  ? 478 ILE A N   1 
ATOM   2441 C  CA  . ILE A 1 298 ? 72.951  41.334  59.004  1.00 39.74  ? 478 ILE A CA  1 
ATOM   2442 C  C   . ILE A 1 298 ? 73.153  42.254  57.799  1.00 39.62  ? 478 ILE A C   1 
ATOM   2443 O  O   . ILE A 1 298 ? 73.815  43.283  57.915  1.00 39.46  ? 478 ILE A O   1 
ATOM   2444 C  CB  . ILE A 1 298 ? 74.209  40.442  59.120  1.00 39.14  ? 478 ILE A CB  1 
ATOM   2445 C  CG1 . ILE A 1 298 ? 74.132  39.579  60.387  1.00 38.60  ? 478 ILE A CG1 1 
ATOM   2446 C  CG2 . ILE A 1 298 ? 75.467  41.309  59.120  1.00 37.81  ? 478 ILE A CG2 1 
ATOM   2447 C  CD1 . ILE A 1 298 ? 74.211  40.351  61.689  1.00 37.55  ? 478 ILE A CD1 1 
ATOM   2448 N  N   . MET A 1 299 ? 72.580  41.903  56.651  1.00 39.18  ? 479 MET A N   1 
ATOM   2449 C  CA  . MET A 1 299 ? 72.779  42.714  55.455  1.00 39.77  ? 479 MET A CA  1 
ATOM   2450 C  C   . MET A 1 299 ? 71.512  43.104  54.688  1.00 39.02  ? 479 MET A C   1 
ATOM   2451 O  O   . MET A 1 299 ? 71.473  44.137  54.023  1.00 38.89  ? 479 MET A O   1 
ATOM   2452 C  CB  . MET A 1 299 ? 73.749  41.983  54.531  1.00 41.15  ? 479 MET A CB  1 
ATOM   2453 C  CG  . MET A 1 299 ? 74.938  41.415  55.280  1.00 43.48  ? 479 MET A CG  1 
ATOM   2454 S  SD  . MET A 1 299 ? 76.002  40.430  54.251  1.00 48.70  ? 479 MET A SD  1 
ATOM   2455 C  CE  . MET A 1 299 ? 77.535  41.305  54.432  1.00 48.34  ? 479 MET A CE  1 
ATOM   2456 N  N   . LEU A 1 300 ? 70.478  42.285  54.769  1.00 37.72  ? 480 LEU A N   1 
ATOM   2457 C  CA  . LEU A 1 300 ? 69.248  42.610  54.071  1.00 37.51  ? 480 LEU A CA  1 
ATOM   2458 C  C   . LEU A 1 300 ? 68.532  43.688  54.886  1.00 36.72  ? 480 LEU A C   1 
ATOM   2459 O  O   . LEU A 1 300 ? 67.877  44.571  54.333  1.00 36.42  ? 480 LEU A O   1 
ATOM   2460 C  CB  . LEU A 1 300 ? 68.388  41.350  53.932  1.00 37.72  ? 480 LEU A CB  1 
ATOM   2461 C  CG  . LEU A 1 300 ? 67.687  41.046  52.602  1.00 39.43  ? 480 LEU A CG  1 
ATOM   2462 C  CD1 . LEU A 1 300 ? 68.575  41.393  51.424  1.00 38.43  ? 480 LEU A CD1 1 
ATOM   2463 C  CD2 . LEU A 1 300 ? 67.315  39.564  52.569  1.00 39.07  ? 480 LEU A CD2 1 
ATOM   2464 N  N   . GLN A 1 301 ? 68.696  43.621  56.205  1.00 36.84  ? 481 GLN A N   1 
ATOM   2465 C  CA  . GLN A 1 301 ? 68.077  44.568  57.127  1.00 38.11  ? 481 GLN A CA  1 
ATOM   2466 C  C   . GLN A 1 301 ? 68.502  46.001  56.808  1.00 37.13  ? 481 GLN A C   1 
ATOM   2467 O  O   . GLN A 1 301 ? 67.657  46.865  56.574  1.00 36.97  ? 481 GLN A O   1 
ATOM   2468 C  CB  . GLN A 1 301 ? 68.467  44.233  58.569  1.00 40.39  ? 481 GLN A CB  1 
ATOM   2469 C  CG  . GLN A 1 301 ? 67.595  44.882  59.625  1.00 44.83  ? 481 GLN A CG  1 
ATOM   2470 C  CD  . GLN A 1 301 ? 66.367  44.047  59.936  1.00 48.73  ? 481 GLN A CD  1 
ATOM   2471 O  OE1 . GLN A 1 301 ? 66.468  42.974  60.550  1.00 49.98  ? 481 GLN A OE1 1 
ATOM   2472 N  NE2 . GLN A 1 301 ? 65.198  44.524  59.503  1.00 48.63  ? 481 GLN A NE2 1 
ATOM   2473 N  N   . PRO A 1 302 ? 69.818  46.279  56.818  1.00 36.60  ? 482 PRO A N   1 
ATOM   2474 C  CA  . PRO A 1 302 ? 70.252  47.643  56.510  1.00 36.16  ? 482 PRO A CA  1 
ATOM   2475 C  C   . PRO A 1 302 ? 69.852  48.085  55.104  1.00 36.01  ? 482 PRO A C   1 
ATOM   2476 O  O   . PRO A 1 302 ? 69.621  49.268  54.874  1.00 35.96  ? 482 PRO A O   1 
ATOM   2477 C  CB  . PRO A 1 302 ? 71.770  47.586  56.716  1.00 36.61  ? 482 PRO A CB  1 
ATOM   2478 C  CG  . PRO A 1 302 ? 72.105  46.137  56.540  1.00 36.89  ? 482 PRO A CG  1 
ATOM   2479 C  CD  . PRO A 1 302 ? 70.964  45.452  57.231  1.00 36.75  ? 482 PRO A CD  1 
ATOM   2480 N  N   . LEU A 1 303 ? 69.765  47.142  54.167  1.00 35.44  ? 483 LEU A N   1 
ATOM   2481 C  CA  . LEU A 1 303 ? 69.364  47.486  52.807  1.00 35.08  ? 483 LEU A CA  1 
ATOM   2482 C  C   . LEU A 1 303 ? 67.908  47.946  52.796  1.00 35.99  ? 483 LEU A C   1 
ATOM   2483 O  O   . LEU A 1 303 ? 67.553  48.896  52.094  1.00 36.00  ? 483 LEU A O   1 
ATOM   2484 C  CB  . LEU A 1 303 ? 69.534  46.293  51.860  1.00 32.95  ? 483 LEU A CB  1 
ATOM   2485 C  CG  . LEU A 1 303 ? 70.960  45.938  51.426  1.00 32.09  ? 483 LEU A CG  1 
ATOM   2486 C  CD1 . LEU A 1 303 ? 70.915  44.718  50.524  1.00 29.25  ? 483 LEU A CD1 1 
ATOM   2487 C  CD2 . LEU A 1 303 ? 71.599  47.113  50.693  1.00 30.60  ? 483 LEU A CD2 1 
ATOM   2488 N  N   . TRP A 1 304 ? 67.060  47.276  53.571  1.00 36.80  ? 484 TRP A N   1 
ATOM   2489 C  CA  . TRP A 1 304 ? 65.656  47.667  53.628  1.00 38.02  ? 484 TRP A CA  1 
ATOM   2490 C  C   . TRP A 1 304 ? 65.556  49.058  54.242  1.00 38.13  ? 484 TRP A C   1 
ATOM   2491 O  O   . TRP A 1 304 ? 64.777  49.897  53.787  1.00 38.34  ? 484 TRP A O   1 
ATOM   2492 C  CB  . TRP A 1 304 ? 64.840  46.679  54.467  1.00 38.46  ? 484 TRP A CB  1 
ATOM   2493 C  CG  . TRP A 1 304 ? 64.716  45.316  53.852  1.00 40.14  ? 484 TRP A CG  1 
ATOM   2494 C  CD1 . TRP A 1 304 ? 64.600  45.023  52.523  1.00 40.15  ? 484 TRP A CD1 1 
ATOM   2495 C  CD2 . TRP A 1 304 ? 64.640  44.065  54.546  1.00 40.22  ? 484 TRP A CD2 1 
ATOM   2496 N  NE1 . TRP A 1 304 ? 64.455  43.671  52.345  1.00 41.11  ? 484 TRP A NE1 1 
ATOM   2497 C  CE2 . TRP A 1 304 ? 64.474  43.056  53.570  1.00 41.48  ? 484 TRP A CE2 1 
ATOM   2498 C  CE3 . TRP A 1 304 ? 64.690  43.699  55.898  1.00 40.77  ? 484 TRP A CE3 1 
ATOM   2499 C  CZ2 . TRP A 1 304 ? 64.361  41.697  53.903  1.00 41.73  ? 484 TRP A CZ2 1 
ATOM   2500 C  CZ3 . TRP A 1 304 ? 64.577  42.349  56.232  1.00 41.73  ? 484 TRP A CZ3 1 
ATOM   2501 C  CH2 . TRP A 1 304 ? 64.413  41.365  55.235  1.00 41.40  ? 484 TRP A CH2 1 
ATOM   2502 N  N   . GLU A 1 305 ? 66.355  49.292  55.276  1.00 37.95  ? 485 GLU A N   1 
ATOM   2503 C  CA  . GLU A 1 305 ? 66.363  50.577  55.952  1.00 39.03  ? 485 GLU A CA  1 
ATOM   2504 C  C   . GLU A 1 305 ? 66.868  51.683  55.035  1.00 38.04  ? 485 GLU A C   1 
ATOM   2505 O  O   . GLU A 1 305 ? 66.340  52.791  55.048  1.00 38.01  ? 485 GLU A O   1 
ATOM   2506 C  CB  . GLU A 1 305 ? 67.228  50.502  57.210  1.00 40.70  ? 485 GLU A CB  1 
ATOM   2507 C  CG  . GLU A 1 305 ? 66.530  49.821  58.376  1.00 44.09  ? 485 GLU A CG  1 
ATOM   2508 C  CD  . GLU A 1 305 ? 67.410  49.693  59.603  1.00 45.01  ? 485 GLU A CD  1 
ATOM   2509 O  OE1 . GLU A 1 305 ? 68.144  50.655  59.915  1.00 47.27  ? 485 GLU A OE1 1 
ATOM   2510 O  OE2 . GLU A 1 305 ? 67.355  48.635  60.264  1.00 47.12  ? 485 GLU A OE2 1 
ATOM   2511 N  N   . SER A 1 306 ? 67.886  51.376  54.240  1.00 36.73  ? 486 SER A N   1 
ATOM   2512 C  CA  . SER A 1 306 ? 68.452  52.349  53.317  1.00 36.26  ? 486 SER A CA  1 
ATOM   2513 C  C   . SER A 1 306 ? 67.440  52.693  52.233  1.00 36.52  ? 486 SER A C   1 
ATOM   2514 O  O   . SER A 1 306 ? 67.294  53.855  51.853  1.00 36.63  ? 486 SER A O   1 
ATOM   2515 C  CB  . SER A 1 306 ? 69.728  51.799  52.682  1.00 35.64  ? 486 SER A CB  1 
ATOM   2516 O  OG  . SER A 1 306 ? 70.336  52.766  51.850  1.00 35.61  ? 486 SER A OG  1 
ATOM   2517 N  N   . ARG A 1 307 ? 66.740  51.677  51.739  1.00 36.14  ? 487 ARG A N   1 
ATOM   2518 C  CA  . ARG A 1 307 ? 65.729  51.873  50.710  1.00 36.70  ? 487 ARG A CA  1 
ATOM   2519 C  C   . ARG A 1 307 ? 64.651  52.826  51.212  1.00 36.89  ? 487 ARG A C   1 
ATOM   2520 O  O   . ARG A 1 307 ? 64.231  53.737  50.500  1.00 36.99  ? 487 ARG A O   1 
ATOM   2521 C  CB  . ARG A 1 307 ? 65.083  50.535  50.348  1.00 36.98  ? 487 ARG A CB  1 
ATOM   2522 C  CG  . ARG A 1 307 ? 63.873  50.644  49.436  1.00 37.43  ? 487 ARG A CG  1 
ATOM   2523 C  CD  . ARG A 1 307 ? 63.016  49.397  49.561  1.00 38.04  ? 487 ARG A CD  1 
ATOM   2524 N  NE  . ARG A 1 307 ? 62.520  49.218  50.926  1.00 39.26  ? 487 ARG A NE  1 
ATOM   2525 C  CZ  . ARG A 1 307 ? 62.103  48.058  51.431  1.00 39.12  ? 487 ARG A CZ  1 
ATOM   2526 N  NH1 . ARG A 1 307 ? 62.122  46.958  50.689  1.00 39.43  ? 487 ARG A NH1 1 
ATOM   2527 N  NH2 . ARG A 1 307 ? 61.663  47.997  52.679  1.00 38.04  ? 487 ARG A NH2 1 
ATOM   2528 N  N   . ASP A 1 308 ? 64.205  52.606  52.443  1.00 37.25  ? 488 ASP A N   1 
ATOM   2529 C  CA  . ASP A 1 308 ? 63.167  53.439  53.031  1.00 38.08  ? 488 ASP A CA  1 
ATOM   2530 C  C   . ASP A 1 308 ? 63.637  54.868  53.291  1.00 37.45  ? 488 ASP A C   1 
ATOM   2531 O  O   . ASP A 1 308 ? 62.879  55.819  53.091  1.00 36.95  ? 488 ASP A O   1 
ATOM   2532 C  CB  . ASP A 1 308 ? 62.652  52.813  54.334  1.00 39.28  ? 488 ASP A CB  1 
ATOM   2533 C  CG  . ASP A 1 308 ? 61.993  51.453  54.116  1.00 40.78  ? 488 ASP A CG  1 
ATOM   2534 O  OD1 . ASP A 1 308 ? 61.460  51.202  53.008  1.00 40.34  ? 488 ASP A OD1 1 
ATOM   2535 O  OD2 . ASP A 1 308 ? 61.996  50.637  55.062  1.00 42.49  ? 488 ASP A OD2 1 
ATOM   2536 N  N   . ARG A 1 309 ? 64.881  55.020  53.731  1.00 36.14  ? 489 ARG A N   1 
ATOM   2537 C  CA  . ARG A 1 309 ? 65.421  56.345  54.000  1.00 36.00  ? 489 ARG A CA  1 
ATOM   2538 C  C   . ARG A 1 309 ? 65.600  57.144  52.707  1.00 35.46  ? 489 ARG A C   1 
ATOM   2539 O  O   . ARG A 1 309 ? 65.264  58.324  52.657  1.00 34.61  ? 489 ARG A O   1 
ATOM   2540 C  CB  . ARG A 1 309 ? 66.752  56.237  54.745  1.00 37.28  ? 489 ARG A CB  1 
ATOM   2541 C  CG  . ARG A 1 309 ? 67.495  57.553  54.857  1.00 38.84  ? 489 ARG A CG  1 
ATOM   2542 C  CD  . ARG A 1 309 ? 68.700  57.437  55.762  1.00 40.68  ? 489 ARG A CD  1 
ATOM   2543 N  NE  . ARG A 1 309 ? 69.454  58.687  55.802  1.00 43.86  ? 489 ARG A NE  1 
ATOM   2544 C  CZ  . ARG A 1 309 ? 70.275  59.103  54.840  1.00 45.79  ? 489 ARG A CZ  1 
ATOM   2545 N  NH1 . ARG A 1 309 ? 70.462  58.365  53.749  1.00 45.16  ? 489 ARG A NH1 1 
ATOM   2546 N  NH2 . ARG A 1 309 ? 70.900  60.270  54.967  1.00 46.61  ? 489 ARG A NH2 1 
ATOM   2547 N  N   . TYR A 1 310 ? 66.118  56.510  51.658  1.00 35.40  ? 490 TYR A N   1 
ATOM   2548 C  CA  . TYR A 1 310 ? 66.302  57.214  50.396  1.00 35.09  ? 490 TYR A CA  1 
ATOM   2549 C  C   . TYR A 1 310 ? 64.970  57.570  49.749  1.00 36.29  ? 490 TYR A C   1 
ATOM   2550 O  O   . TYR A 1 310 ? 64.878  58.546  49.003  1.00 35.83  ? 490 TYR A O   1 
ATOM   2551 C  CB  . TYR A 1 310 ? 67.171  56.402  49.431  1.00 34.17  ? 490 TYR A CB  1 
ATOM   2552 C  CG  . TYR A 1 310 ? 68.653  56.593  49.685  1.00 34.06  ? 490 TYR A CG  1 
ATOM   2553 C  CD1 . TYR A 1 310 ? 69.228  57.864  49.627  1.00 33.78  ? 490 TYR A CD1 1 
ATOM   2554 C  CD2 . TYR A 1 310 ? 69.472  55.515  50.014  1.00 32.95  ? 490 TYR A CD2 1 
ATOM   2555 C  CE1 . TYR A 1 310 ? 70.580  58.056  49.895  1.00 34.82  ? 490 TYR A CE1 1 
ATOM   2556 C  CE2 . TYR A 1 310 ? 70.826  55.696  50.284  1.00 34.11  ? 490 TYR A CE2 1 
ATOM   2557 C  CZ  . TYR A 1 310 ? 71.373  56.969  50.225  1.00 35.55  ? 490 TYR A CZ  1 
ATOM   2558 O  OH  . TYR A 1 310 ? 72.706  57.159  50.515  1.00 37.05  ? 490 TYR A OH  1 
ATOM   2559 N  N   . GLU A 1 311 ? 63.934  56.788  50.025  1.00 36.88  ? 491 GLU A N   1 
ATOM   2560 C  CA  . GLU A 1 311 ? 62.630  57.107  49.467  1.00 38.02  ? 491 GLU A CA  1 
ATOM   2561 C  C   . GLU A 1 311 ? 62.081  58.348  50.169  1.00 37.46  ? 491 GLU A C   1 
ATOM   2562 O  O   . GLU A 1 311 ? 61.369  59.140  49.562  1.00 36.71  ? 491 GLU A O   1 
ATOM   2563 C  CB  . GLU A 1 311 ? 61.678  55.919  49.602  1.00 39.31  ? 491 GLU A CB  1 
ATOM   2564 C  CG  . GLU A 1 311 ? 61.775  54.988  48.403  1.00 42.45  ? 491 GLU A CG  1 
ATOM   2565 C  CD  . GLU A 1 311 ? 60.908  53.753  48.525  1.00 44.97  ? 491 GLU A CD  1 
ATOM   2566 O  OE1 . GLU A 1 311 ? 60.775  53.033  47.508  1.00 46.76  ? 491 GLU A OE1 1 
ATOM   2567 O  OE2 . GLU A 1 311 ? 60.370  53.498  49.630  1.00 45.06  ? 491 GLU A OE2 1 
ATOM   2568 N  N   . GLU A 1 312 ? 62.426  58.519  51.443  1.00 37.49  ? 492 GLU A N   1 
ATOM   2569 C  CA  . GLU A 1 312 ? 61.993  59.696  52.190  1.00 38.09  ? 492 GLU A CA  1 
ATOM   2570 C  C   . GLU A 1 312 ? 62.767  60.897  51.653  1.00 37.53  ? 492 GLU A C   1 
ATOM   2571 O  O   . GLU A 1 312 ? 62.193  61.951  51.390  1.00 37.83  ? 492 GLU A O   1 
ATOM   2572 C  CB  . GLU A 1 312 ? 62.283  59.548  53.687  1.00 38.87  ? 492 GLU A CB  1 
ATOM   2573 C  CG  . GLU A 1 312 ? 61.404  58.542  54.409  1.00 41.47  ? 492 GLU A CG  1 
ATOM   2574 C  CD  . GLU A 1 312 ? 61.458  58.703  55.920  1.00 42.88  ? 492 GLU A CD  1 
ATOM   2575 O  OE1 . GLU A 1 312 ? 62.560  58.594  56.497  1.00 42.31  ? 492 GLU A OE1 1 
ATOM   2576 O  OE2 . GLU A 1 312 ? 60.392  58.943  56.534  1.00 45.86  ? 492 GLU A OE2 1 
ATOM   2577 N  N   . LEU A 1 313 ? 64.077  60.724  51.495  1.00 36.68  ? 493 LEU A N   1 
ATOM   2578 C  CA  . LEU A 1 313 ? 64.932  61.783  50.985  1.00 36.07  ? 493 LEU A CA  1 
ATOM   2579 C  C   . LEU A 1 313 ? 64.417  62.258  49.637  1.00 36.40  ? 493 LEU A C   1 
ATOM   2580 O  O   . LEU A 1 313 ? 64.370  63.462  49.377  1.00 35.38  ? 493 LEU A O   1 
ATOM   2581 C  CB  . LEU A 1 313 ? 66.375  61.288  50.839  1.00 36.25  ? 493 LEU A CB  1 
ATOM   2582 C  CG  . LEU A 1 313 ? 67.387  62.283  50.260  1.00 37.66  ? 493 LEU A CG  1 
ATOM   2583 C  CD1 . LEU A 1 313 ? 67.331  63.597  51.031  1.00 37.54  ? 493 LEU A CD1 1 
ATOM   2584 C  CD2 . LEU A 1 313 ? 68.787  61.686  50.326  1.00 37.38  ? 493 LEU A CD2 1 
ATOM   2585 N  N   . LYS A 1 314 ? 64.020  61.314  48.786  1.00 35.91  ? 494 LYS A N   1 
ATOM   2586 C  CA  . LYS A 1 314 ? 63.512  61.671  47.473  1.00 36.72  ? 494 LYS A CA  1 
ATOM   2587 C  C   . LYS A 1 314 ? 62.287  62.569  47.570  1.00 37.51  ? 494 LYS A C   1 
ATOM   2588 O  O   . LYS A 1 314 ? 62.171  63.544  46.828  1.00 36.84  ? 494 LYS A O   1 
ATOM   2589 C  CB  . LYS A 1 314 ? 63.147  60.432  46.651  1.00 36.23  ? 494 LYS A CB  1 
ATOM   2590 C  CG  . LYS A 1 314 ? 62.646  60.793  45.250  1.00 36.54  ? 494 LYS A CG  1 
ATOM   2591 C  CD  . LYS A 1 314 ? 62.331  59.572  44.406  1.00 37.99  ? 494 LYS A CD  1 
ATOM   2592 C  CE  . LYS A 1 314 ? 62.012  59.959  42.953  1.00 38.71  ? 494 LYS A CE  1 
ATOM   2593 N  NZ  . LYS A 1 314 ? 60.719  60.689  42.797  1.00 37.46  ? 494 LYS A NZ  1 
ATOM   2594 N  N   . ARG A 1 315 ? 61.370  62.240  48.474  1.00 38.87  ? 495 ARG A N   1 
ATOM   2595 C  CA  . ARG A 1 315 ? 60.165  63.045  48.628  1.00 41.37  ? 495 ARG A CA  1 
ATOM   2596 C  C   . ARG A 1 315 ? 60.502  64.495  48.948  1.00 41.36  ? 495 ARG A C   1 
ATOM   2597 O  O   . ARG A 1 315 ? 59.923  65.414  48.372  1.00 41.67  ? 495 ARG A O   1 
ATOM   2598 C  CB  . ARG A 1 315 ? 59.255  62.474  49.716  1.00 42.86  ? 495 ARG A CB  1 
ATOM   2599 C  CG  . ARG A 1 315 ? 58.273  61.415  49.214  1.00 47.19  ? 495 ARG A CG  1 
ATOM   2600 C  CD  . ARG A 1 315 ? 57.321  60.991  50.326  1.00 50.69  ? 495 ARG A CD  1 
ATOM   2601 N  NE  . ARG A 1 315 ? 58.034  60.331  51.418  1.00 54.43  ? 495 ARG A NE  1 
ATOM   2602 C  CZ  . ARG A 1 315 ? 57.590  60.250  52.670  1.00 56.40  ? 495 ARG A CZ  1 
ATOM   2603 N  NH1 . ARG A 1 315 ? 56.423  60.793  53.003  1.00 57.14  ? 495 ARG A NH1 1 
ATOM   2604 N  NH2 . ARG A 1 315 ? 58.315  59.623  53.593  1.00 57.39  ? 495 ARG A NH2 1 
ATOM   2605 N  N   . ILE A 1 316 ? 61.443  64.714  49.856  1.00 41.38  ? 496 ILE A N   1 
ATOM   2606 C  CA  . ILE A 1 316 ? 61.783  66.081  50.180  1.00 42.01  ? 496 ILE A CA  1 
ATOM   2607 C  C   . ILE A 1 316 ? 62.638  66.710  49.079  1.00 42.02  ? 496 ILE A C   1 
ATOM   2608 O  O   . ILE A 1 316 ? 62.595  67.920  48.883  1.00 40.60  ? 496 ILE A O   1 
ATOM   2609 C  CB  . ILE A 1 316 ? 62.472  66.191  51.559  1.00 42.81  ? 496 ILE A CB  1 
ATOM   2610 C  CG1 . ILE A 1 316 ? 62.429  67.649  52.016  1.00 43.41  ? 496 ILE A CG1 1 
ATOM   2611 C  CG2 . ILE A 1 316 ? 63.904  65.685  51.490  1.00 42.83  ? 496 ILE A CG2 1 
ATOM   2612 C  CD1 . ILE A 1 316 ? 62.306  67.817  53.500  1.00 44.34  ? 496 ILE A CD1 1 
ATOM   2613 N  N   . ASP A 1 317 ? 63.404  65.897  48.350  1.00 42.53  ? 497 ASP A N   1 
ATOM   2614 C  CA  . ASP A 1 317 ? 64.208  66.437  47.253  1.00 43.35  ? 497 ASP A CA  1 
ATOM   2615 C  C   . ASP A 1 317 ? 63.252  66.939  46.179  1.00 43.53  ? 497 ASP A C   1 
ATOM   2616 O  O   . ASP A 1 317 ? 63.472  67.995  45.580  1.00 43.07  ? 497 ASP A O   1 
ATOM   2617 C  CB  . ASP A 1 317 ? 65.117  65.376  46.628  1.00 44.38  ? 497 ASP A CB  1 
ATOM   2618 C  CG  . ASP A 1 317 ? 66.462  65.273  47.315  1.00 45.60  ? 497 ASP A CG  1 
ATOM   2619 O  OD1 . ASP A 1 317 ? 66.908  66.271  47.922  1.00 47.09  ? 497 ASP A OD1 1 
ATOM   2620 O  OD2 . ASP A 1 317 ? 67.085  64.193  47.229  1.00 46.94  ? 497 ASP A OD2 1 
ATOM   2621 N  N   . ASP A 1 318 ? 62.196  66.163  45.937  1.00 43.28  ? 498 ASP A N   1 
ATOM   2622 C  CA  . ASP A 1 318 ? 61.191  66.521  44.947  1.00 43.86  ? 498 ASP A CA  1 
ATOM   2623 C  C   . ASP A 1 318 ? 60.459  67.781  45.400  1.00 44.78  ? 498 ASP A C   1 
ATOM   2624 O  O   . ASP A 1 318 ? 60.206  68.680  44.601  1.00 45.27  ? 498 ASP A O   1 
ATOM   2625 C  CB  . ASP A 1 318 ? 60.182  65.376  44.748  1.00 42.23  ? 498 ASP A CB  1 
ATOM   2626 C  CG  . ASP A 1 318 ? 60.768  64.192  43.978  1.00 41.92  ? 498 ASP A CG  1 
ATOM   2627 O  OD1 . ASP A 1 318 ? 61.827  64.348  43.328  1.00 40.29  ? 498 ASP A OD1 1 
ATOM   2628 O  OD2 . ASP A 1 318 ? 60.154  63.103  44.011  1.00 41.69  ? 498 ASP A OD2 1 
ATOM   2629 N  N   . ALA A 1 319 ? 60.120  67.843  46.684  1.00 45.77  ? 499 ALA A N   1 
ATOM   2630 C  CA  . ALA A 1 319 ? 59.425  69.004  47.229  1.00 47.73  ? 499 ALA A CA  1 
ATOM   2631 C  C   . ALA A 1 319 ? 60.285  70.250  47.049  1.00 48.96  ? 499 ALA A C   1 
ATOM   2632 O  O   . ALA A 1 319 ? 59.792  71.304  46.649  1.00 49.43  ? 499 ALA A O   1 
ATOM   2633 C  CB  . ALA A 1 319 ? 59.117  68.787  48.707  1.00 46.43  ? 499 ALA A CB  1 
ATOM   2634 N  N   . MET A 1 320 ? 61.575  70.114  47.336  1.00 50.62  ? 500 MET A N   1 
ATOM   2635 C  CA  . MET A 1 320 ? 62.520  71.216  47.217  1.00 52.98  ? 500 MET A CA  1 
ATOM   2636 C  C   . MET A 1 320 ? 62.609  71.758  45.795  1.00 54.65  ? 500 MET A C   1 
ATOM   2637 O  O   . MET A 1 320 ? 62.712  72.970  45.598  1.00 54.49  ? 500 MET A O   1 
ATOM   2638 C  CB  . MET A 1 320 ? 63.911  70.769  47.676  1.00 52.91  ? 500 MET A CB  1 
ATOM   2639 C  CG  . MET A 1 320 ? 64.004  70.422  49.151  1.00 54.59  ? 500 MET A CG  1 
ATOM   2640 S  SD  . MET A 1 320 ? 64.300  71.847  50.202  1.00 58.03  ? 500 MET A SD  1 
ATOM   2641 C  CE  . MET A 1 320 ? 66.056  71.664  50.496  1.00 56.82  ? 500 MET A CE  1 
ATOM   2642 N  N   . LYS A 1 321 ? 62.574  70.869  44.807  1.00 56.59  ? 501 LYS A N   1 
ATOM   2643 C  CA  . LYS A 1 321 ? 62.662  71.298  43.416  1.00 59.09  ? 501 LYS A CA  1 
ATOM   2644 C  C   . LYS A 1 321 ? 61.327  71.809  42.892  1.00 60.21  ? 501 LYS A C   1 
ATOM   2645 O  O   . LYS A 1 321 ? 61.210  72.196  41.732  1.00 59.90  ? 501 LYS A O   1 
ATOM   2646 C  CB  . LYS A 1 321 ? 63.198  70.160  42.545  1.00 59.74  ? 501 LYS A CB  1 
ATOM   2647 C  CG  . LYS A 1 321 ? 64.608  69.752  42.949  1.00 61.67  ? 501 LYS A CG  1 
ATOM   2648 C  CD  . LYS A 1 321 ? 65.255  68.776  41.978  1.00 63.27  ? 501 LYS A CD  1 
ATOM   2649 C  CE  . LYS A 1 321 ? 66.657  68.399  42.455  1.00 63.70  ? 501 LYS A CE  1 
ATOM   2650 N  NZ  . LYS A 1 321 ? 67.400  67.562  41.471  1.00 63.38  ? 501 LYS A NZ  1 
ATOM   2651 N  N   . GLU A 1 322 ? 60.323  71.813  43.764  1.00 62.36  ? 502 GLU A N   1 
ATOM   2652 C  CA  . GLU A 1 322 ? 59.004  72.318  43.406  1.00 64.37  ? 502 GLU A CA  1 
ATOM   2653 C  C   . GLU A 1 322 ? 58.887  73.767  43.852  1.00 65.26  ? 502 GLU A C   1 
ATOM   2654 O  O   . GLU A 1 322 ? 57.802  74.355  43.836  1.00 65.24  ? 502 GLU A O   1 
ATOM   2655 C  CB  . GLU A 1 322 ? 57.902  71.485  44.054  1.00 64.87  ? 502 GLU A CB  1 
ATOM   2656 C  CG  . GLU A 1 322 ? 57.648  70.191  43.319  1.00 67.01  ? 502 GLU A CG  1 
ATOM   2657 C  CD  . GLU A 1 322 ? 56.217  69.748  43.438  1.00 67.71  ? 502 GLU A CD  1 
ATOM   2658 O  OE1 . GLU A 1 322 ? 55.797  69.435  44.572  1.00 69.11  ? 502 GLU A OE1 1 
ATOM   2659 O  OE2 . GLU A 1 322 ? 55.515  69.725  42.400  1.00 67.58  ? 502 GLU A OE2 1 
ATOM   2660 N  N   . LEU A 1 323 ? 60.022  74.322  44.265  1.00 65.81  ? 503 LEU A N   1 
ATOM   2661 C  CA  . LEU A 1 323 ? 60.121  75.708  44.696  1.00 66.58  ? 503 LEU A CA  1 
ATOM   2662 C  C   . LEU A 1 323 ? 61.065  76.354  43.690  1.00 68.06  ? 503 LEU A C   1 
ATOM   2663 O  O   . LEU A 1 323 ? 61.200  77.578  43.625  1.00 67.96  ? 503 LEU A O   1 
ATOM   2664 C  CB  . LEU A 1 323 ? 60.725  75.789  46.097  1.00 65.26  ? 503 LEU A CB  1 
ATOM   2665 C  CG  . LEU A 1 323 ? 59.998  75.044  47.217  1.00 64.51  ? 503 LEU A CG  1 
ATOM   2666 C  CD1 . LEU A 1 323 ? 60.783  75.189  48.508  1.00 63.74  ? 503 LEU A CD1 1 
ATOM   2667 C  CD2 . LEU A 1 323 ? 58.590  75.595  47.381  1.00 64.16  ? 503 LEU A CD2 1 
ATOM   2668 N  N   . GLN A 1 324 ? 61.710  75.497  42.901  1.00 69.70  ? 504 GLN A N   1 
ATOM   2669 C  CA  . GLN A 1 324 ? 62.662  75.909  41.881  1.00 71.85  ? 504 GLN A CA  1 
ATOM   2670 C  C   . GLN A 1 324 ? 62.031  75.863  40.493  1.00 73.96  ? 504 GLN A C   1 
ATOM   2671 O  O   . GLN A 1 324 ? 60.816  75.715  40.355  1.00 73.73  ? 504 GLN A O   1 
ATOM   2672 C  CB  . GLN A 1 324 ? 63.879  74.987  41.922  1.00 71.15  ? 504 GLN A CB  1 
ATOM   2673 C  CG  . GLN A 1 324 ? 64.618  75.018  43.242  1.00 71.39  ? 504 GLN A CG  1 
ATOM   2674 C  CD  . GLN A 1 324 ? 65.634  73.903  43.372  1.00 71.34  ? 504 GLN A CD  1 
ATOM   2675 O  OE1 . GLN A 1 324 ? 66.395  73.627  42.446  1.00 72.22  ? 504 GLN A OE1 1 
ATOM   2676 N  NE2 . GLN A 1 324 ? 65.661  73.262  44.532  1.00 71.61  ? 504 GLN A NE2 1 
ATOM   2677 N  N   . LYS A 1 325 ? 62.869  75.979  39.467  1.00 76.57  ? 505 LYS A N   1 
ATOM   2678 C  CA  . LYS A 1 325 ? 62.405  75.954  38.083  1.00 79.38  ? 505 LYS A CA  1 
ATOM   2679 C  C   . LYS A 1 325 ? 61.400  77.068  37.828  1.00 80.66  ? 505 LYS A C   1 
ATOM   2680 O  O   . LYS A 1 325 ? 60.186  76.851  37.839  1.00 81.11  ? 505 LYS A O   1 
ATOM   2681 C  CB  . LYS A 1 325 ? 61.784  74.595  37.751  1.00 80.24  ? 505 LYS A CB  1 
ATOM   2682 C  CG  . LYS A 1 325 ? 62.791  73.460  37.774  1.00 82.15  ? 505 LYS A CG  1 
ATOM   2683 C  CD  . LYS A 1 325 ? 62.121  72.103  37.693  1.00 83.46  ? 505 LYS A CD  1 
ATOM   2684 C  CE  . LYS A 1 325 ? 63.158  70.989  37.749  1.00 84.12  ? 505 LYS A CE  1 
ATOM   2685 N  NZ  . LYS A 1 325 ? 62.530  69.641  37.817  1.00 84.89  ? 505 LYS A NZ  1 
ATOM   2686 N  N   . LYS A 1 326 ? 61.934  78.265  37.601  1.00 81.85  ? 506 LYS A N   1 
ATOM   2687 C  CA  . LYS A 1 326 ? 61.143  79.460  37.332  1.00 82.80  ? 506 LYS A CA  1 
ATOM   2688 C  C   . LYS A 1 326 ? 60.188  79.270  36.142  1.00 83.62  ? 506 LYS A C   1 
ATOM   2689 O  O   . LYS A 1 326 ? 60.183  78.171  35.539  1.00 84.16  ? 506 LYS A O   1 
ATOM   2690 C  CB  . LYS A 1 326 ? 62.088  80.640  37.064  1.00 82.31  ? 506 LYS A CB  1 
ATOM   2691 C  CG  . LYS A 1 326 ? 62.990  81.007  38.244  1.00 81.67  ? 506 LYS A CG  1 
ATOM   2692 C  CD  . LYS A 1 326 ? 64.132  81.919  37.804  1.00 81.68  ? 506 LYS A CD  1 
ATOM   2693 C  CE  . LYS A 1 326 ? 64.822  82.593  38.988  1.00 81.77  ? 506 LYS A CE  1 
ATOM   2694 N  NZ  . LYS A 1 326 ? 65.361  81.636  39.991  1.00 81.93  ? 506 LYS A NZ  1 
ATOM   2695 O  OXT . LYS A 1 326 ? 59.448  80.228  35.825  1.00 84.43  ? 506 LYS A OXT 1 
ATOM   2696 N  N   . PRO B 1 1   ? 100.768 46.723  -24.737 1.00 74.37  ? 181 PRO B N   1 
ATOM   2697 C  CA  . PRO B 1 1   ? 102.167 46.231  -24.728 1.00 73.73  ? 181 PRO B CA  1 
ATOM   2698 C  C   . PRO B 1 1   ? 102.386 45.209  -23.611 1.00 73.05  ? 181 PRO B C   1 
ATOM   2699 O  O   . PRO B 1 1   ? 101.722 44.171  -23.558 1.00 72.75  ? 181 PRO B O   1 
ATOM   2700 C  CB  . PRO B 1 1   ? 103.052 47.453  -24.520 1.00 74.10  ? 181 PRO B CB  1 
ATOM   2701 C  CG  . PRO B 1 1   ? 102.113 48.368  -23.714 1.00 74.07  ? 181 PRO B CG  1 
ATOM   2702 C  CD  . PRO B 1 1   ? 100.731 48.152  -24.363 1.00 74.62  ? 181 PRO B CD  1 
ATOM   2703 N  N   . THR B 1 2   ? 103.329 45.521  -22.726 1.00 71.95  ? 182 THR B N   1 
ATOM   2704 C  CA  . THR B 1 2   ? 103.659 44.677  -21.583 1.00 70.80  ? 182 THR B CA  1 
ATOM   2705 C  C   . THR B 1 2   ? 103.443 45.530  -20.338 1.00 69.35  ? 182 THR B C   1 
ATOM   2706 O  O   . THR B 1 2   ? 104.072 46.576  -20.186 1.00 69.54  ? 182 THR B O   1 
ATOM   2707 C  CB  . THR B 1 2   ? 105.133 44.223  -21.634 1.00 71.61  ? 182 THR B CB  1 
ATOM   2708 O  OG1 . THR B 1 2   ? 105.319 43.325  -22.737 1.00 72.66  ? 182 THR B OG1 1 
ATOM   2709 C  CG2 . THR B 1 2   ? 105.526 43.525  -20.340 1.00 71.77  ? 182 THR B CG2 1 
ATOM   2710 N  N   . TYR B 1 3   ? 102.557 45.090  -19.449 1.00 67.07  ? 183 TYR B N   1 
ATOM   2711 C  CA  . TYR B 1 3   ? 102.273 45.858  -18.240 1.00 65.15  ? 183 TYR B CA  1 
ATOM   2712 C  C   . TYR B 1 3   ? 102.955 45.304  -16.990 1.00 64.25  ? 183 TYR B C   1 
ATOM   2713 O  O   . TYR B 1 3   ? 103.174 44.099  -16.873 1.00 64.10  ? 183 TYR B O   1 
ATOM   2714 C  CB  . TYR B 1 3   ? 100.761 45.926  -17.999 1.00 63.96  ? 183 TYR B CB  1 
ATOM   2715 C  CG  . TYR B 1 3   ? 99.957  46.374  -19.198 1.00 62.65  ? 183 TYR B CG  1 
ATOM   2716 C  CD1 . TYR B 1 3   ? 99.560  45.463  -20.174 1.00 61.72  ? 183 TYR B CD1 1 
ATOM   2717 C  CD2 . TYR B 1 3   ? 99.601  47.713  -19.361 1.00 62.13  ? 183 TYR B CD2 1 
ATOM   2718 C  CE1 . TYR B 1 3   ? 98.830  45.872  -21.285 1.00 61.57  ? 183 TYR B CE1 1 
ATOM   2719 C  CE2 . TYR B 1 3   ? 98.872  48.134  -20.470 1.00 61.56  ? 183 TYR B CE2 1 
ATOM   2720 C  CZ  . TYR B 1 3   ? 98.489  47.208  -21.427 1.00 61.42  ? 183 TYR B CZ  1 
ATOM   2721 O  OH  . TYR B 1 3   ? 97.776  47.618  -22.530 1.00 60.87  ? 183 TYR B OH  1 
ATOM   2722 N  N   . PRO B 1 4   ? 103.292 46.187  -16.032 1.00 63.45  ? 184 PRO B N   1 
ATOM   2723 C  CA  . PRO B 1 4   ? 103.947 45.772  -14.788 1.00 62.85  ? 184 PRO B CA  1 
ATOM   2724 C  C   . PRO B 1 4   ? 103.155 44.718  -14.015 1.00 62.15  ? 184 PRO B C   1 
ATOM   2725 O  O   . PRO B 1 4   ? 101.935 44.615  -14.146 1.00 61.93  ? 184 PRO B O   1 
ATOM   2726 C  CB  . PRO B 1 4   ? 104.097 47.088  -14.015 1.00 62.95  ? 184 PRO B CB  1 
ATOM   2727 C  CG  . PRO B 1 4   ? 102.988 47.943  -14.553 1.00 63.27  ? 184 PRO B CG  1 
ATOM   2728 C  CD  . PRO B 1 4   ? 103.039 47.639  -16.027 1.00 63.51  ? 184 PRO B CD  1 
ATOM   2729 N  N   . LYS B 1 5   ? 103.866 43.939  -13.208 1.00 61.53  ? 185 LYS B N   1 
ATOM   2730 C  CA  . LYS B 1 5   ? 103.267 42.873  -12.415 1.00 60.67  ? 185 LYS B CA  1 
ATOM   2731 C  C   . LYS B 1 5   ? 102.056 43.291  -11.586 1.00 59.14  ? 185 LYS B C   1 
ATOM   2732 O  O   . LYS B 1 5   ? 101.064 42.562  -11.526 1.00 58.01  ? 185 LYS B O   1 
ATOM   2733 C  CB  . LYS B 1 5   ? 104.321 42.261  -11.483 1.00 62.05  ? 185 LYS B CB  1 
ATOM   2734 C  CG  . LYS B 1 5   ? 105.498 41.608  -12.193 1.00 64.41  ? 185 LYS B CG  1 
ATOM   2735 C  CD  . LYS B 1 5   ? 106.484 41.021  -11.188 1.00 66.28  ? 185 LYS B CD  1 
ATOM   2736 C  CE  . LYS B 1 5   ? 107.655 40.333  -11.882 1.00 67.49  ? 185 LYS B CE  1 
ATOM   2737 N  NZ  . LYS B 1 5   ? 108.615 39.747  -10.899 1.00 68.56  ? 185 LYS B NZ  1 
ATOM   2738 N  N   . TYR B 1 6   ? 102.131 44.458  -10.947 1.00 57.86  ? 186 TYR B N   1 
ATOM   2739 C  CA  . TYR B 1 6   ? 101.031 44.916  -10.103 1.00 56.81  ? 186 TYR B CA  1 
ATOM   2740 C  C   . TYR B 1 6   ? 99.744  45.302  -10.833 1.00 54.26  ? 186 TYR B C   1 
ATOM   2741 O  O   . TYR B 1 6   ? 98.753  45.676  -10.203 1.00 53.70  ? 186 TYR B O   1 
ATOM   2742 C  CB  . TYR B 1 6   ? 101.495 46.046  -9.166  1.00 59.18  ? 186 TYR B CB  1 
ATOM   2743 C  CG  . TYR B 1 6   ? 102.119 47.253  -9.829  1.00 62.00  ? 186 TYR B CG  1 
ATOM   2744 C  CD1 . TYR B 1 6   ? 101.334 48.187  -10.505 1.00 62.92  ? 186 TYR B CD1 1 
ATOM   2745 C  CD2 . TYR B 1 6   ? 103.494 47.483  -9.744  1.00 63.23  ? 186 TYR B CD2 1 
ATOM   2746 C  CE1 . TYR B 1 6   ? 101.901 49.324  -11.076 1.00 64.25  ? 186 TYR B CE1 1 
ATOM   2747 C  CE2 . TYR B 1 6   ? 104.072 48.616  -10.312 1.00 64.51  ? 186 TYR B CE2 1 
ATOM   2748 C  CZ  . TYR B 1 6   ? 103.269 49.532  -10.976 1.00 65.07  ? 186 TYR B CZ  1 
ATOM   2749 O  OH  . TYR B 1 6   ? 103.832 50.659  -11.534 1.00 65.63  ? 186 TYR B OH  1 
ATOM   2750 N  N   . LEU B 1 7   ? 99.755  45.216  -12.158 1.00 51.20  ? 187 LEU B N   1 
ATOM   2751 C  CA  . LEU B 1 7   ? 98.549  45.492  -12.925 1.00 49.11  ? 187 LEU B CA  1 
ATOM   2752 C  C   . LEU B 1 7   ? 98.052  44.116  -13.345 1.00 48.03  ? 187 LEU B C   1 
ATOM   2753 O  O   . LEU B 1 7   ? 98.481  43.572  -14.358 1.00 48.53  ? 187 LEU B O   1 
ATOM   2754 C  CB  . LEU B 1 7   ? 98.845  46.350  -14.156 1.00 47.89  ? 187 LEU B CB  1 
ATOM   2755 C  CG  . LEU B 1 7   ? 99.320  47.786  -13.906 1.00 48.12  ? 187 LEU B CG  1 
ATOM   2756 C  CD1 . LEU B 1 7   ? 99.269  48.558  -15.217 1.00 47.86  ? 187 LEU B CD1 1 
ATOM   2757 C  CD2 . LEU B 1 7   ? 98.440  48.472  -12.866 1.00 47.47  ? 187 LEU B CD2 1 
ATOM   2758 N  N   . LEU B 1 8   ? 97.165  43.548  -12.537 1.00 46.30  ? 188 LEU B N   1 
ATOM   2759 C  CA  . LEU B 1 8   ? 96.616  42.226  -12.800 1.00 44.85  ? 188 LEU B CA  1 
ATOM   2760 C  C   . LEU B 1 8   ? 96.065  42.111  -14.210 1.00 44.48  ? 188 LEU B C   1 
ATOM   2761 O  O   . LEU B 1 8   ? 95.417  43.029  -14.704 1.00 43.89  ? 188 LEU B O   1 
ATOM   2762 C  CB  . LEU B 1 8   ? 95.499  41.920  -11.806 1.00 43.98  ? 188 LEU B CB  1 
ATOM   2763 C  CG  . LEU B 1 8   ? 95.830  42.137  -10.329 1.00 44.05  ? 188 LEU B CG  1 
ATOM   2764 C  CD1 . LEU B 1 8   ? 94.609  41.788  -9.494  1.00 43.41  ? 188 LEU B CD1 1 
ATOM   2765 C  CD2 . LEU B 1 8   ? 97.030  41.285  -9.926  1.00 42.30  ? 188 LEU B CD2 1 
ATOM   2766 N  N   . SER B 1 9   ? 96.324  40.978  -14.852 1.00 43.49  ? 189 SER B N   1 
ATOM   2767 C  CA  . SER B 1 9   ? 95.832  40.736  -16.200 1.00 43.34  ? 189 SER B CA  1 
ATOM   2768 C  C   . SER B 1 9   ? 94.416  40.175  -16.076 1.00 43.19  ? 189 SER B C   1 
ATOM   2769 O  O   . SER B 1 9   ? 94.031  39.680  -15.015 1.00 43.59  ? 189 SER B O   1 
ATOM   2770 C  CB  . SER B 1 9   ? 96.724  39.717  -16.919 1.00 42.59  ? 189 SER B CB  1 
ATOM   2771 O  OG  . SER B 1 9   ? 96.561  38.422  -16.362 1.00 42.90  ? 189 SER B OG  1 
ATOM   2772 N  N   . PRO B 1 10  ? 93.616  40.251  -17.152 1.00 42.65  ? 190 PRO B N   1 
ATOM   2773 C  CA  . PRO B 1 10  ? 92.254  39.715  -17.060 1.00 42.68  ? 190 PRO B CA  1 
ATOM   2774 C  C   . PRO B 1 10  ? 92.201  38.216  -16.759 1.00 42.71  ? 190 PRO B C   1 
ATOM   2775 O  O   . PRO B 1 10  ? 91.207  37.723  -16.220 1.00 42.50  ? 190 PRO B O   1 
ATOM   2776 C  CB  . PRO B 1 10  ? 91.632  40.082  -18.415 1.00 42.31  ? 190 PRO B CB  1 
ATOM   2777 C  CG  . PRO B 1 10  ? 92.808  40.299  -19.311 1.00 43.04  ? 190 PRO B CG  1 
ATOM   2778 C  CD  . PRO B 1 10  ? 93.813  40.973  -18.418 1.00 42.23  ? 190 PRO B CD  1 
ATOM   2779 N  N   . GLU B 1 11  ? 93.270  37.498  -17.098 1.00 43.04  ? 191 GLU B N   1 
ATOM   2780 C  CA  . GLU B 1 11  ? 93.333  36.060  -16.835 1.00 43.52  ? 191 GLU B CA  1 
ATOM   2781 C  C   . GLU B 1 11  ? 93.423  35.846  -15.330 1.00 42.50  ? 191 GLU B C   1 
ATOM   2782 O  O   . GLU B 1 11  ? 92.719  35.010  -14.763 1.00 41.72  ? 191 GLU B O   1 
ATOM   2783 C  CB  . GLU B 1 11  ? 94.563  35.430  -17.492 1.00 45.52  ? 191 GLU B CB  1 
ATOM   2784 C  CG  . GLU B 1 11  ? 94.534  35.396  -19.013 1.00 50.04  ? 191 GLU B CG  1 
ATOM   2785 C  CD  . GLU B 1 11  ? 94.468  36.780  -19.628 1.00 52.39  ? 191 GLU B CD  1 
ATOM   2786 O  OE1 . GLU B 1 11  ? 95.361  37.609  -19.337 1.00 53.02  ? 191 GLU B OE1 1 
ATOM   2787 O  OE2 . GLU B 1 11  ? 93.520  37.037  -20.404 1.00 54.72  ? 191 GLU B OE2 1 
ATOM   2788 N  N   . THR B 1 12  ? 94.302  36.611  -14.693 1.00 41.05  ? 192 THR B N   1 
ATOM   2789 C  CA  . THR B 1 12  ? 94.496  36.522  -13.258 1.00 40.83  ? 192 THR B CA  1 
ATOM   2790 C  C   . THR B 1 12  ? 93.200  36.895  -12.547 1.00 40.84  ? 192 THR B C   1 
ATOM   2791 O  O   . THR B 1 12  ? 92.742  36.182  -11.657 1.00 40.64  ? 192 THR B O   1 
ATOM   2792 C  CB  . THR B 1 12  ? 95.623  37.466  -12.804 1.00 40.81  ? 192 THR B CB  1 
ATOM   2793 O  OG1 . THR B 1 12  ? 96.841  37.101  -13.465 1.00 41.21  ? 192 THR B OG1 1 
ATOM   2794 C  CG2 . THR B 1 12  ? 95.826  37.381  -11.303 1.00 41.01  ? 192 THR B CG2 1 
ATOM   2795 N  N   . ILE B 1 13  ? 92.606  38.011  -12.961 1.00 41.09  ? 193 ILE B N   1 
ATOM   2796 C  CA  . ILE B 1 13  ? 91.359  38.493  -12.377 1.00 40.73  ? 193 ILE B CA  1 
ATOM   2797 C  C   . ILE B 1 13  ? 90.267  37.425  -12.357 1.00 41.06  ? 193 ILE B C   1 
ATOM   2798 O  O   . ILE B 1 13  ? 89.534  37.304  -11.376 1.00 39.73  ? 193 ILE B O   1 
ATOM   2799 C  CB  . ILE B 1 13  ? 90.854  39.748  -13.126 1.00 40.60  ? 193 ILE B CB  1 
ATOM   2800 C  CG1 . ILE B 1 13  ? 91.714  40.952  -12.726 1.00 41.11  ? 193 ILE B CG1 1 
ATOM   2801 C  CG2 . ILE B 1 13  ? 89.377  39.991  -12.830 1.00 39.84  ? 193 ILE B CG2 1 
ATOM   2802 C  CD1 . ILE B 1 13  ? 91.392  42.230  -13.481 1.00 42.29  ? 193 ILE B CD1 1 
ATOM   2803 N  N   . GLU B 1 14  ? 90.160  36.645  -13.428 1.00 41.47  ? 194 GLU B N   1 
ATOM   2804 C  CA  . GLU B 1 14  ? 89.149  35.599  -13.466 1.00 42.95  ? 194 GLU B CA  1 
ATOM   2805 C  C   . GLU B 1 14  ? 89.531  34.362  -12.645 1.00 41.63  ? 194 GLU B C   1 
ATOM   2806 O  O   . GLU B 1 14  ? 88.669  33.731  -12.031 1.00 42.41  ? 194 GLU B O   1 
ATOM   2807 C  CB  . GLU B 1 14  ? 88.851  35.175  -14.910 1.00 46.10  ? 194 GLU B CB  1 
ATOM   2808 C  CG  . GLU B 1 14  ? 88.114  33.839  -14.991 1.00 51.45  ? 194 GLU B CG  1 
ATOM   2809 C  CD  . GLU B 1 14  ? 87.432  33.595  -16.326 1.00 55.64  ? 194 GLU B CD  1 
ATOM   2810 O  OE1 . GLU B 1 14  ? 88.110  33.684  -17.380 1.00 56.82  ? 194 GLU B OE1 1 
ATOM   2811 O  OE2 . GLU B 1 14  ? 86.211  33.306  -16.316 1.00 57.67  ? 194 GLU B OE2 1 
ATOM   2812 N  N   . ALA B 1 15  ? 90.812  34.005  -12.640 1.00 39.20  ? 195 ALA B N   1 
ATOM   2813 C  CA  . ALA B 1 15  ? 91.259  32.831  -11.890 1.00 37.91  ? 195 ALA B CA  1 
ATOM   2814 C  C   . ALA B 1 15  ? 91.141  33.052  -10.380 1.00 37.13  ? 195 ALA B C   1 
ATOM   2815 O  O   . ALA B 1 15  ? 90.940  32.108  -9.615  1.00 36.83  ? 195 ALA B O   1 
ATOM   2816 C  CB  . ALA B 1 15  ? 92.703  32.495  -12.256 1.00 35.94  ? 195 ALA B CB  1 
ATOM   2817 N  N   . LEU B 1 16  ? 91.263  34.310  -9.969  1.00 36.36  ? 196 LEU B N   1 
ATOM   2818 C  CA  . LEU B 1 16  ? 91.199  34.707  -8.566  1.00 36.51  ? 196 LEU B CA  1 
ATOM   2819 C  C   . LEU B 1 16  ? 89.870  34.356  -7.881  1.00 37.04  ? 196 LEU B C   1 
ATOM   2820 O  O   . LEU B 1 16  ? 89.798  34.279  -6.652  1.00 35.68  ? 196 LEU B O   1 
ATOM   2821 C  CB  . LEU B 1 16  ? 91.462  36.217  -8.472  1.00 35.41  ? 196 LEU B CB  1 
ATOM   2822 C  CG  . LEU B 1 16  ? 91.796  36.871  -7.133  1.00 34.50  ? 196 LEU B CG  1 
ATOM   2823 C  CD1 . LEU B 1 16  ? 93.071  36.265  -6.556  1.00 33.56  ? 196 LEU B CD1 1 
ATOM   2824 C  CD2 . LEU B 1 16  ? 91.973  38.373  -7.349  1.00 33.93  ? 196 LEU B CD2 1 
ATOM   2825 N  N   . ARG B 1 17  ? 88.826  34.135  -8.676  1.00 38.42  ? 197 ARG B N   1 
ATOM   2826 C  CA  . ARG B 1 17  ? 87.505  33.804  -8.138  1.00 40.44  ? 197 ARG B CA  1 
ATOM   2827 C  C   . ARG B 1 17  ? 87.335  32.329  -7.808  1.00 40.33  ? 197 ARG B C   1 
ATOM   2828 O  O   . ARG B 1 17  ? 86.283  31.912  -7.317  1.00 40.03  ? 197 ARG B O   1 
ATOM   2829 C  CB  . ARG B 1 17  ? 86.416  34.197  -9.138  1.00 43.13  ? 197 ARG B CB  1 
ATOM   2830 C  CG  . ARG B 1 17  ? 86.255  35.688  -9.343  1.00 46.42  ? 197 ARG B CG  1 
ATOM   2831 C  CD  . ARG B 1 17  ? 85.496  35.975  -10.626 1.00 49.52  ? 197 ARG B CD  1 
ATOM   2832 N  NE  . ARG B 1 17  ? 85.123  37.382  -10.716 1.00 52.55  ? 197 ARG B NE  1 
ATOM   2833 C  CZ  . ARG B 1 17  ? 83.932  37.855  -10.369 1.00 54.08  ? 197 ARG B CZ  1 
ATOM   2834 N  NH1 . ARG B 1 17  ? 82.993  37.033  -9.914  1.00 54.54  ? 197 ARG B NH1 1 
ATOM   2835 N  NH2 . ARG B 1 17  ? 83.678  39.154  -10.478 1.00 55.50  ? 197 ARG B NH2 1 
ATOM   2836 N  N   . LYS B 1 18  ? 88.364  31.537  -8.068  1.00 40.44  ? 198 LYS B N   1 
ATOM   2837 C  CA  . LYS B 1 18  ? 88.262  30.109  -7.816  1.00 41.82  ? 198 LYS B CA  1 
ATOM   2838 C  C   . LYS B 1 18  ? 89.305  29.599  -6.839  1.00 40.99  ? 198 LYS B C   1 
ATOM   2839 O  O   . LYS B 1 18  ? 90.457  30.039  -6.861  1.00 40.30  ? 198 LYS B O   1 
ATOM   2840 C  CB  . LYS B 1 18  ? 88.348  29.350  -9.146  1.00 44.69  ? 198 LYS B CB  1 
ATOM   2841 C  CG  . LYS B 1 18  ? 87.229  29.731  -10.111 1.00 47.60  ? 198 LYS B CG  1 
ATOM   2842 C  CD  . LYS B 1 18  ? 87.264  28.927  -11.401 1.00 52.21  ? 198 LYS B CD  1 
ATOM   2843 C  CE  . LYS B 1 18  ? 86.066  29.280  -12.282 1.00 54.35  ? 198 LYS B CE  1 
ATOM   2844 N  NZ  . LYS B 1 18  ? 86.009  28.473  -13.537 1.00 56.51  ? 198 LYS B NZ  1 
ATOM   2845 N  N   . PRO B 1 19  ? 88.906  28.656  -5.966  1.00 40.39  ? 199 PRO B N   1 
ATOM   2846 C  CA  . PRO B 1 19  ? 89.750  28.034  -4.940  1.00 40.08  ? 199 PRO B CA  1 
ATOM   2847 C  C   . PRO B 1 19  ? 90.982  27.360  -5.521  1.00 40.12  ? 199 PRO B C   1 
ATOM   2848 O  O   . PRO B 1 19  ? 91.891  26.952  -4.794  1.00 39.78  ? 199 PRO B O   1 
ATOM   2849 C  CB  . PRO B 1 19  ? 88.801  27.041  -4.271  1.00 39.57  ? 199 PRO B CB  1 
ATOM   2850 C  CG  . PRO B 1 19  ? 87.874  26.671  -5.370  1.00 40.33  ? 199 PRO B CG  1 
ATOM   2851 C  CD  . PRO B 1 19  ? 87.585  28.007  -6.006  1.00 40.38  ? 199 PRO B CD  1 
ATOM   2852 N  N   . THR B 1 20  ? 91.007  27.265  -6.844  1.00 40.01  ? 200 THR B N   1 
ATOM   2853 C  CA  . THR B 1 20  ? 92.109  26.641  -7.552  1.00 40.45  ? 200 THR B CA  1 
ATOM   2854 C  C   . THR B 1 20  ? 93.291  27.596  -7.776  1.00 39.88  ? 200 THR B C   1 
ATOM   2855 O  O   . THR B 1 20  ? 94.384  27.165  -8.138  1.00 40.56  ? 200 THR B O   1 
ATOM   2856 C  CB  . THR B 1 20  ? 91.618  26.097  -8.910  1.00 41.38  ? 200 THR B CB  1 
ATOM   2857 O  OG1 . THR B 1 20  ? 92.677  25.370  -9.539  1.00 44.19  ? 200 THR B OG1 1 
ATOM   2858 C  CG2 . THR B 1 20  ? 91.170  27.236  -9.816  1.00 40.46  ? 200 THR B CG2 1 
ATOM   2859 N  N   . PHE B 1 21  ? 93.065  28.889  -7.550  1.00 38.71  ? 201 PHE B N   1 
ATOM   2860 C  CA  . PHE B 1 21  ? 94.094  29.917  -7.722  1.00 37.84  ? 201 PHE B CA  1 
ATOM   2861 C  C   . PHE B 1 21  ? 95.431  29.501  -7.088  1.00 38.11  ? 201 PHE B C   1 
ATOM   2862 O  O   . PHE B 1 21  ? 95.473  29.080  -5.932  1.00 37.52  ? 201 PHE B O   1 
ATOM   2863 C  CB  . PHE B 1 21  ? 93.610  31.226  -7.085  1.00 37.18  ? 201 PHE B CB  1 
ATOM   2864 C  CG  . PHE B 1 21  ? 94.409  32.437  -7.483  1.00 36.69  ? 201 PHE B CG  1 
ATOM   2865 C  CD1 . PHE B 1 21  ? 94.273  32.992  -8.754  1.00 36.41  ? 201 PHE B CD1 1 
ATOM   2866 C  CD2 . PHE B 1 21  ? 95.292  33.031  -6.585  1.00 36.57  ? 201 PHE B CD2 1 
ATOM   2867 C  CE1 . PHE B 1 21  ? 95.003  34.123  -9.124  1.00 35.84  ? 201 PHE B CE1 1 
ATOM   2868 C  CE2 . PHE B 1 21  ? 96.028  34.167  -6.946  1.00 36.85  ? 201 PHE B CE2 1 
ATOM   2869 C  CZ  . PHE B 1 21  ? 95.880  34.712  -8.218  1.00 35.68  ? 201 PHE B CZ  1 
ATOM   2870 N  N   . ASP B 1 22  ? 96.521  29.624  -7.843  1.00 38.67  ? 202 ASP B N   1 
ATOM   2871 C  CA  . ASP B 1 22  ? 97.841  29.255  -7.336  1.00 38.89  ? 202 ASP B CA  1 
ATOM   2872 C  C   . ASP B 1 22  ? 98.422  30.424  -6.551  1.00 38.85  ? 202 ASP B C   1 
ATOM   2873 O  O   . ASP B 1 22  ? 98.953  31.379  -7.116  1.00 39.15  ? 202 ASP B O   1 
ATOM   2874 C  CB  . ASP B 1 22  ? 98.771  28.870  -8.494  1.00 40.25  ? 202 ASP B CB  1 
ATOM   2875 C  CG  . ASP B 1 22  ? 100.126 28.355  -8.018  1.00 41.18  ? 202 ASP B CG  1 
ATOM   2876 O  OD1 . ASP B 1 22  ? 100.915 27.888  -8.867  1.00 42.27  ? 202 ASP B OD1 1 
ATOM   2877 O  OD2 . ASP B 1 22  ? 100.405 28.419  -6.801  1.00 42.44  ? 202 ASP B OD2 1 
ATOM   2878 N  N   . VAL B 1 23  ? 98.313  30.330  -5.233  1.00 38.61  ? 203 VAL B N   1 
ATOM   2879 C  CA  . VAL B 1 23  ? 98.780  31.370  -4.332  1.00 37.83  ? 203 VAL B CA  1 
ATOM   2880 C  C   . VAL B 1 23  ? 100.297 31.535  -4.253  1.00 38.27  ? 203 VAL B C   1 
ATOM   2881 O  O   . VAL B 1 23  ? 100.783 32.551  -3.751  1.00 38.38  ? 203 VAL B O   1 
ATOM   2882 C  CB  . VAL B 1 23  ? 98.231  31.121  -2.914  1.00 37.30  ? 203 VAL B CB  1 
ATOM   2883 C  CG1 . VAL B 1 23  ? 96.709  31.128  -2.945  1.00 35.36  ? 203 VAL B CG1 1 
ATOM   2884 C  CG2 . VAL B 1 23  ? 98.746  29.782  -2.384  1.00 35.54  ? 203 VAL B CG2 1 
ATOM   2885 N  N   . TRP B 1 24  ? 101.044 30.552  -4.749  1.00 37.60  ? 204 TRP B N   1 
ATOM   2886 C  CA  . TRP B 1 24  ? 102.503 30.621  -4.701  1.00 37.60  ? 204 TRP B CA  1 
ATOM   2887 C  C   . TRP B 1 24  ? 103.151 31.434  -5.823  1.00 38.87  ? 204 TRP B C   1 
ATOM   2888 O  O   . TRP B 1 24  ? 104.287 31.881  -5.688  1.00 38.80  ? 204 TRP B O   1 
ATOM   2889 C  CB  . TRP B 1 24  ? 103.101 29.215  -4.708  1.00 35.67  ? 204 TRP B CB  1 
ATOM   2890 C  CG  . TRP B 1 24  ? 102.730 28.397  -3.518  1.00 34.36  ? 204 TRP B CG  1 
ATOM   2891 C  CD1 . TRP B 1 24  ? 101.873 27.337  -3.488  1.00 33.27  ? 204 TRP B CD1 1 
ATOM   2892 C  CD2 . TRP B 1 24  ? 103.209 28.569  -2.179  1.00 33.32  ? 204 TRP B CD2 1 
ATOM   2893 N  NE1 . TRP B 1 24  ? 101.790 26.832  -2.212  1.00 34.09  ? 204 TRP B NE1 1 
ATOM   2894 C  CE2 . TRP B 1 24  ? 102.601 27.567  -1.387  1.00 33.20  ? 204 TRP B CE2 1 
ATOM   2895 C  CE3 . TRP B 1 24  ? 104.095 29.468  -1.568  1.00 32.78  ? 204 TRP B CE3 1 
ATOM   2896 C  CZ2 . TRP B 1 24  ? 102.847 27.441  -0.016  1.00 32.63  ? 204 TRP B CZ2 1 
ATOM   2897 C  CZ3 . TRP B 1 24  ? 104.342 29.346  -0.205  1.00 31.50  ? 204 TRP B CZ3 1 
ATOM   2898 C  CH2 . TRP B 1 24  ? 103.719 28.335  0.556   1.00 32.56  ? 204 TRP B CH2 1 
ATOM   2899 N  N   . LEU B 1 25  ? 102.431 31.630  -6.922  1.00 40.62  ? 205 LEU B N   1 
ATOM   2900 C  CA  . LEU B 1 25  ? 102.963 32.367  -8.068  1.00 42.60  ? 205 LEU B CA  1 
ATOM   2901 C  C   . LEU B 1 25  ? 103.161 33.865  -7.875  1.00 42.62  ? 205 LEU B C   1 
ATOM   2902 O  O   . LEU B 1 25  ? 103.901 34.490  -8.630  1.00 42.62  ? 205 LEU B O   1 
ATOM   2903 C  CB  . LEU B 1 25  ? 102.056 32.184  -9.290  1.00 43.94  ? 205 LEU B CB  1 
ATOM   2904 C  CG  . LEU B 1 25  ? 101.769 30.777  -9.818  1.00 46.75  ? 205 LEU B CG  1 
ATOM   2905 C  CD1 . LEU B 1 25  ? 100.927 30.891  -11.089 1.00 46.64  ? 205 LEU B CD1 1 
ATOM   2906 C  CD2 . LEU B 1 25  ? 103.075 30.040  -10.097 1.00 47.38  ? 205 LEU B CD2 1 
ATOM   2907 N  N   . TRP B 1 26  ? 102.526 34.448  -6.869  1.00 42.62  ? 206 TRP B N   1 
ATOM   2908 C  CA  . TRP B 1 26  ? 102.623 35.889  -6.709  1.00 42.81  ? 206 TRP B CA  1 
ATOM   2909 C  C   . TRP B 1 26  ? 103.437 36.466  -5.566  1.00 42.90  ? 206 TRP B C   1 
ATOM   2910 O  O   . TRP B 1 26  ? 103.479 35.922  -4.465  1.00 43.06  ? 206 TRP B O   1 
ATOM   2911 C  CB  . TRP B 1 26  ? 101.212 36.459  -6.663  1.00 44.23  ? 206 TRP B CB  1 
ATOM   2912 C  CG  . TRP B 1 26  ? 100.295 35.735  -7.593  1.00 46.32  ? 206 TRP B CG  1 
ATOM   2913 C  CD1 . TRP B 1 26  ? 99.570  34.609  -7.321  1.00 46.93  ? 206 TRP B CD1 1 
ATOM   2914 C  CD2 . TRP B 1 26  ? 100.067 36.034  -8.976  1.00 47.00  ? 206 TRP B CD2 1 
ATOM   2915 N  NE1 . TRP B 1 26  ? 98.906  34.188  -8.448  1.00 47.46  ? 206 TRP B NE1 1 
ATOM   2916 C  CE2 . TRP B 1 26  ? 99.193  35.044  -9.479  1.00 47.39  ? 206 TRP B CE2 1 
ATOM   2917 C  CE3 . TRP B 1 26  ? 100.520 37.041  -9.838  1.00 47.91  ? 206 TRP B CE3 1 
ATOM   2918 C  CZ2 . TRP B 1 26  ? 98.761  35.031  -10.811 1.00 48.27  ? 206 TRP B CZ2 1 
ATOM   2919 C  CZ3 . TRP B 1 26  ? 100.092 37.030  -11.162 1.00 48.89  ? 206 TRP B CZ3 1 
ATOM   2920 C  CH2 . TRP B 1 26  ? 99.219  36.029  -11.634 1.00 48.95  ? 206 TRP B CH2 1 
ATOM   2921 N  N   . GLU B 1 27  ? 104.084 37.591  -5.854  1.00 43.26  ? 207 GLU B N   1 
ATOM   2922 C  CA  . GLU B 1 27  ? 104.877 38.308  -4.868  1.00 43.79  ? 207 GLU B CA  1 
ATOM   2923 C  C   . GLU B 1 27  ? 103.927 39.201  -4.083  1.00 42.61  ? 207 GLU B C   1 
ATOM   2924 O  O   . GLU B 1 27  ? 102.836 39.519  -4.553  1.00 41.59  ? 207 GLU B O   1 
ATOM   2925 C  CB  . GLU B 1 27  ? 105.943 39.151  -5.560  1.00 46.33  ? 207 GLU B CB  1 
ATOM   2926 C  CG  . GLU B 1 27  ? 107.272 38.439  -5.710  1.00 50.67  ? 207 GLU B CG  1 
ATOM   2927 C  CD  . GLU B 1 27  ? 108.165 39.110  -6.724  1.00 53.78  ? 207 GLU B CD  1 
ATOM   2928 O  OE1 . GLU B 1 27  ? 108.221 40.363  -6.733  1.00 55.24  ? 207 GLU B OE1 1 
ATOM   2929 O  OE2 . GLU B 1 27  ? 108.814 38.381  -7.510  1.00 55.54  ? 207 GLU B OE2 1 
ATOM   2930 N  N   . PRO B 1 28  ? 104.332 39.624  -2.879  1.00 42.04  ? 208 PRO B N   1 
ATOM   2931 C  CA  . PRO B 1 28  ? 103.479 40.478  -2.053  1.00 41.95  ? 208 PRO B CA  1 
ATOM   2932 C  C   . PRO B 1 28  ? 102.768 41.644  -2.740  1.00 41.88  ? 208 PRO B C   1 
ATOM   2933 O  O   . PRO B 1 28  ? 101.575 41.857  -2.515  1.00 41.47  ? 208 PRO B O   1 
ATOM   2934 C  CB  . PRO B 1 28  ? 104.414 40.920  -0.916  1.00 42.08  ? 208 PRO B CB  1 
ATOM   2935 C  CG  . PRO B 1 28  ? 105.804 40.650  -1.440  1.00 42.77  ? 208 PRO B CG  1 
ATOM   2936 C  CD  . PRO B 1 28  ? 105.631 39.390  -2.226  1.00 42.58  ? 208 PRO B CD  1 
ATOM   2937 N  N   . ASN B 1 29  ? 103.466 42.394  -3.585  1.00 42.06  ? 209 ASN B N   1 
ATOM   2938 C  CA  . ASN B 1 29  ? 102.811 43.521  -4.235  1.00 42.11  ? 209 ASN B CA  1 
ATOM   2939 C  C   . ASN B 1 29  ? 101.690 43.032  -5.150  1.00 40.90  ? 209 ASN B C   1 
ATOM   2940 O  O   . ASN B 1 29  ? 100.646 43.670  -5.261  1.00 40.81  ? 209 ASN B O   1 
ATOM   2941 C  CB  . ASN B 1 29  ? 103.830 44.377  -5.007  1.00 45.25  ? 209 ASN B CB  1 
ATOM   2942 C  CG  . ASN B 1 29  ? 104.330 43.709  -6.278  1.00 48.26  ? 209 ASN B CG  1 
ATOM   2943 O  OD1 . ASN B 1 29  ? 104.820 42.577  -6.254  1.00 50.53  ? 209 ASN B OD1 1 
ATOM   2944 N  ND2 . ASN B 1 29  ? 104.218 44.418  -7.400  1.00 49.64  ? 209 ASN B ND2 1 
ATOM   2945 N  N   . GLU B 1 30  ? 101.892 41.888  -5.788  1.00 39.31  ? 210 GLU B N   1 
ATOM   2946 C  CA  . GLU B 1 30  ? 100.868 41.344  -6.668  1.00 38.60  ? 210 GLU B CA  1 
ATOM   2947 C  C   . GLU B 1 30  ? 99.659  40.905  -5.838  1.00 36.49  ? 210 GLU B C   1 
ATOM   2948 O  O   . GLU B 1 30  ? 98.515  41.180  -6.202  1.00 36.81  ? 210 GLU B O   1 
ATOM   2949 C  CB  . GLU B 1 30  ? 101.423 40.153  -7.453  1.00 40.72  ? 210 GLU B CB  1 
ATOM   2950 C  CG  . GLU B 1 30  ? 102.735 40.451  -8.178  1.00 45.24  ? 210 GLU B CG  1 
ATOM   2951 C  CD  . GLU B 1 30  ? 103.325 39.222  -8.855  1.00 46.65  ? 210 GLU B CD  1 
ATOM   2952 O  OE1 . GLU B 1 30  ? 102.739 38.751  -9.856  1.00 48.39  ? 210 GLU B OE1 1 
ATOM   2953 O  OE2 . GLU B 1 30  ? 104.371 38.725  -8.382  1.00 46.97  ? 210 GLU B OE2 1 
ATOM   2954 N  N   . MET B 1 31  ? 99.916  40.225  -4.723  1.00 33.57  ? 211 MET B N   1 
ATOM   2955 C  CA  . MET B 1 31  ? 98.845  39.756  -3.850  1.00 31.58  ? 211 MET B CA  1 
ATOM   2956 C  C   . MET B 1 31  ? 98.047  40.938  -3.303  1.00 29.94  ? 211 MET B C   1 
ATOM   2957 O  O   . MET B 1 31  ? 96.827  40.863  -3.161  1.00 28.55  ? 211 MET B O   1 
ATOM   2958 C  CB  . MET B 1 31  ? 99.418  38.926  -2.700  1.00 31.30  ? 211 MET B CB  1 
ATOM   2959 C  CG  . MET B 1 31  ? 100.080 37.627  -3.143  1.00 30.64  ? 211 MET B CG  1 
ATOM   2960 S  SD  . MET B 1 31  ? 100.476 36.513  -1.771  1.00 30.58  ? 211 MET B SD  1 
ATOM   2961 C  CE  . MET B 1 31  ? 102.133 37.064  -1.358  1.00 26.35  ? 211 MET B CE  1 
ATOM   2962 N  N   . LEU B 1 32  ? 98.739  42.033  -3.009  1.00 29.00  ? 212 LEU B N   1 
ATOM   2963 C  CA  . LEU B 1 32  ? 98.072  43.227  -2.513  1.00 29.55  ? 212 LEU B CA  1 
ATOM   2964 C  C   . LEU B 1 32  ? 97.098  43.754  -3.569  1.00 29.32  ? 212 LEU B C   1 
ATOM   2965 O  O   . LEU B 1 32  ? 95.991  44.180  -3.232  1.00 30.60  ? 212 LEU B O   1 
ATOM   2966 C  CB  . LEU B 1 32  ? 99.101  44.301  -2.141  1.00 28.70  ? 212 LEU B CB  1 
ATOM   2967 C  CG  . LEU B 1 32  ? 99.910  44.024  -0.867  1.00 29.24  ? 212 LEU B CG  1 
ATOM   2968 C  CD1 . LEU B 1 32  ? 101.042 45.038  -0.728  1.00 30.24  ? 212 LEU B CD1 1 
ATOM   2969 C  CD2 . LEU B 1 32  ? 98.989  44.087  0.345   1.00 27.99  ? 212 LEU B CD2 1 
ATOM   2970 N  N   . SER B 1 33  ? 97.495  43.703  -4.842  1.00 28.53  ? 213 SER B N   1 
ATOM   2971 C  CA  . SER B 1 33  ? 96.633  44.167  -5.925  1.00 28.68  ? 213 SER B CA  1 
ATOM   2972 C  C   . SER B 1 33  ? 95.412  43.272  -6.024  1.00 28.60  ? 213 SER B C   1 
ATOM   2973 O  O   . SER B 1 33  ? 94.310  43.740  -6.320  1.00 27.58  ? 213 SER B O   1 
ATOM   2974 C  CB  . SER B 1 33  ? 97.382  44.170  -7.261  1.00 29.49  ? 213 SER B CB  1 
ATOM   2975 O  OG  . SER B 1 33  ? 98.271  45.274  -7.334  1.00 31.13  ? 213 SER B OG  1 
ATOM   2976 N  N   . CYS B 1 34  ? 95.614  41.980  -5.772  1.00 29.27  ? 214 CYS B N   1 
ATOM   2977 C  CA  . CYS B 1 34  ? 94.517  41.021  -5.797  1.00 29.08  ? 214 CYS B CA  1 
ATOM   2978 C  C   . CYS B 1 34  ? 93.496  41.374  -4.713  1.00 29.16  ? 214 CYS B C   1 
ATOM   2979 O  O   . CYS B 1 34  ? 92.294  41.429  -4.979  1.00 28.89  ? 214 CYS B O   1 
ATOM   2980 C  CB  . CYS B 1 34  ? 95.040  39.604  -5.571  1.00 30.07  ? 214 CYS B CB  1 
ATOM   2981 S  SG  . CYS B 1 34  ? 95.906  38.892  -6.993  1.00 31.73  ? 214 CYS B SG  1 
ATOM   2982 N  N   . LEU B 1 35  ? 93.975  41.614  -3.494  1.00 28.61  ? 215 LEU B N   1 
ATOM   2983 C  CA  . LEU B 1 35  ? 93.080  41.967  -2.394  1.00 29.12  ? 215 LEU B CA  1 
ATOM   2984 C  C   . LEU B 1 35  ? 92.329  43.258  -2.717  1.00 30.12  ? 215 LEU B C   1 
ATOM   2985 O  O   . LEU B 1 35  ? 91.126  43.365  -2.474  1.00 30.26  ? 215 LEU B O   1 
ATOM   2986 C  CB  . LEU B 1 35  ? 93.873  42.119  -1.093  1.00 27.60  ? 215 LEU B CB  1 
ATOM   2987 C  CG  . LEU B 1 35  ? 94.470  40.798  -0.590  1.00 27.94  ? 215 LEU B CG  1 
ATOM   2988 C  CD1 . LEU B 1 35  ? 95.367  41.051  0.603   1.00 26.63  ? 215 LEU B CD1 1 
ATOM   2989 C  CD2 . LEU B 1 35  ? 93.341  39.832  -0.234  1.00 24.92  ? 215 LEU B CD2 1 
ATOM   2990 N  N   . GLU B 1 36  ? 93.047  44.231  -3.272  1.00 31.20  ? 216 GLU B N   1 
ATOM   2991 C  CA  . GLU B 1 36  ? 92.457  45.514  -3.657  1.00 31.54  ? 216 GLU B CA  1 
ATOM   2992 C  C   . GLU B 1 36  ? 91.311  45.283  -4.651  1.00 31.11  ? 216 GLU B C   1 
ATOM   2993 O  O   . GLU B 1 36  ? 90.225  45.851  -4.513  1.00 30.44  ? 216 GLU B O   1 
ATOM   2994 C  CB  . GLU B 1 36  ? 93.525  46.404  -4.302  1.00 32.02  ? 216 GLU B CB  1 
ATOM   2995 C  CG  . GLU B 1 36  ? 92.980  47.673  -4.934  1.00 34.56  ? 216 GLU B CG  1 
ATOM   2996 C  CD  . GLU B 1 36  ? 94.067  48.516  -5.572  1.00 34.69  ? 216 GLU B CD  1 
ATOM   2997 O  OE1 . GLU B 1 36  ? 93.768  49.650  -5.982  1.00 33.70  ? 216 GLU B OE1 1 
ATOM   2998 O  OE2 . GLU B 1 36  ? 95.219  48.045  -5.666  1.00 37.40  ? 216 GLU B OE2 1 
ATOM   2999 N  N   . HIS B 1 37  ? 91.567  44.443  -5.649  1.00 30.55  ? 217 HIS B N   1 
ATOM   3000 C  CA  . HIS B 1 37  ? 90.571  44.122  -6.664  1.00 30.81  ? 217 HIS B CA  1 
ATOM   3001 C  C   . HIS B 1 37  ? 89.314  43.542  -6.025  1.00 30.59  ? 217 HIS B C   1 
ATOM   3002 O  O   . HIS B 1 37  ? 88.195  43.937  -6.365  1.00 31.15  ? 217 HIS B O   1 
ATOM   3003 C  CB  . HIS B 1 37  ? 91.139  43.110  -7.661  1.00 32.33  ? 217 HIS B CB  1 
ATOM   3004 C  CG  . HIS B 1 37  ? 90.115  42.554  -8.602  1.00 33.29  ? 217 HIS B CG  1 
ATOM   3005 N  ND1 . HIS B 1 37  ? 89.574  43.291  -9.634  1.00 33.93  ? 217 HIS B ND1 1 
ATOM   3006 C  CD2 . HIS B 1 37  ? 89.497  41.350  -8.632  1.00 32.84  ? 217 HIS B CD2 1 
ATOM   3007 C  CE1 . HIS B 1 37  ? 88.664  42.565  -10.258 1.00 34.36  ? 217 HIS B CE1 1 
ATOM   3008 N  NE2 . HIS B 1 37  ? 88.597  41.383  -9.669  1.00 34.11  ? 217 HIS B NE2 1 
ATOM   3009 N  N   . MET B 1 38  ? 89.505  42.603  -5.103  1.00 29.08  ? 218 MET B N   1 
ATOM   3010 C  CA  . MET B 1 38  ? 88.388  41.962  -4.416  1.00 28.55  ? 218 MET B CA  1 
ATOM   3011 C  C   . MET B 1 38  ? 87.414  42.965  -3.798  1.00 27.74  ? 218 MET B C   1 
ATOM   3012 O  O   . MET B 1 38  ? 86.203  42.770  -3.862  1.00 28.34  ? 218 MET B O   1 
ATOM   3013 C  CB  . MET B 1 38  ? 88.907  41.020  -3.325  1.00 27.91  ? 218 MET B CB  1 
ATOM   3014 C  CG  . MET B 1 38  ? 89.661  39.803  -3.841  1.00 27.60  ? 218 MET B CG  1 
ATOM   3015 S  SD  . MET B 1 38  ? 90.272  38.787  -2.475  1.00 29.99  ? 218 MET B SD  1 
ATOM   3016 C  CE  . MET B 1 38  ? 91.681  37.933  -3.244  1.00 26.83  ? 218 MET B CE  1 
ATOM   3017 N  N   . TYR B 1 39  ? 87.931  44.032  -3.195  1.00 26.77  ? 219 TYR B N   1 
ATOM   3018 C  CA  . TYR B 1 39  ? 87.058  45.028  -2.578  1.00 26.84  ? 219 TYR B CA  1 
ATOM   3019 C  C   . TYR B 1 39  ? 86.275  45.835  -3.615  1.00 27.46  ? 219 TYR B C   1 
ATOM   3020 O  O   . TYR B 1 39  ? 85.105  46.164  -3.402  1.00 26.37  ? 219 TYR B O   1 
ATOM   3021 C  CB  . TYR B 1 39  ? 87.860  45.956  -1.657  1.00 25.61  ? 219 TYR B CB  1 
ATOM   3022 C  CG  . TYR B 1 39  ? 88.034  45.382  -0.268  1.00 26.60  ? 219 TYR B CG  1 
ATOM   3023 C  CD1 . TYR B 1 39  ? 88.722  44.179  -0.069  1.00 26.43  ? 219 TYR B CD1 1 
ATOM   3024 C  CD2 . TYR B 1 39  ? 87.451  45.995  0.838   1.00 26.12  ? 219 TYR B CD2 1 
ATOM   3025 C  CE1 . TYR B 1 39  ? 88.815  43.602  1.191   1.00 26.62  ? 219 TYR B CE1 1 
ATOM   3026 C  CE2 . TYR B 1 39  ? 87.541  45.426  2.112   1.00 27.12  ? 219 TYR B CE2 1 
ATOM   3027 C  CZ  . TYR B 1 39  ? 88.222  44.228  2.277   1.00 27.07  ? 219 TYR B CZ  1 
ATOM   3028 O  OH  . TYR B 1 39  ? 88.305  43.651  3.525   1.00 27.95  ? 219 TYR B OH  1 
ATOM   3029 N  N   . HIS B 1 40  ? 86.917  46.156  -4.734  1.00 27.79  ? 220 HIS B N   1 
ATOM   3030 C  CA  . HIS B 1 40  ? 86.235  46.888  -5.797  1.00 29.00  ? 220 HIS B CA  1 
ATOM   3031 C  C   . HIS B 1 40  ? 85.199  45.958  -6.426  1.00 29.87  ? 220 HIS B C   1 
ATOM   3032 O  O   . HIS B 1 40  ? 84.022  46.304  -6.552  1.00 29.96  ? 220 HIS B O   1 
ATOM   3033 C  CB  . HIS B 1 40  ? 87.233  47.332  -6.864  1.00 28.20  ? 220 HIS B CB  1 
ATOM   3034 C  CG  . HIS B 1 40  ? 88.003  48.563  -6.498  1.00 29.54  ? 220 HIS B CG  1 
ATOM   3035 N  ND1 . HIS B 1 40  ? 87.434  49.819  -6.482  1.00 28.77  ? 220 HIS B ND1 1 
ATOM   3036 C  CD2 . HIS B 1 40  ? 89.291  48.728  -6.111  1.00 29.51  ? 220 HIS B CD2 1 
ATOM   3037 C  CE1 . HIS B 1 40  ? 88.337  50.704  -6.100  1.00 29.82  ? 220 HIS B CE1 1 
ATOM   3038 N  NE2 . HIS B 1 40  ? 89.473  50.068  -5.869  1.00 30.50  ? 220 HIS B NE2 1 
ATOM   3039 N  N   . ASP B 1 41  ? 85.656  44.765  -6.790  1.00 29.71  ? 221 ASP B N   1 
ATOM   3040 C  CA  . ASP B 1 41  ? 84.831  43.748  -7.429  1.00 30.23  ? 221 ASP B CA  1 
ATOM   3041 C  C   . ASP B 1 41  ? 83.585  43.305  -6.652  1.00 30.04  ? 221 ASP B C   1 
ATOM   3042 O  O   . ASP B 1 41  ? 82.532  43.062  -7.245  1.00 29.69  ? 221 ASP B O   1 
ATOM   3043 C  CB  . ASP B 1 41  ? 85.691  42.523  -7.732  1.00 31.07  ? 221 ASP B CB  1 
ATOM   3044 C  CG  . ASP B 1 41  ? 84.992  41.541  -8.634  1.00 32.80  ? 221 ASP B CG  1 
ATOM   3045 O  OD1 . ASP B 1 41  ? 85.046  40.327  -8.344  1.00 33.95  ? 221 ASP B OD1 1 
ATOM   3046 O  OD2 . ASP B 1 41  ? 84.392  41.984  -9.638  1.00 34.49  ? 221 ASP B OD2 1 
ATOM   3047 N  N   . LEU B 1 42  ? 83.714  43.173  -5.334  1.00 29.24  ? 222 LEU B N   1 
ATOM   3048 C  CA  . LEU B 1 42  ? 82.594  42.761  -4.488  1.00 28.59  ? 222 LEU B CA  1 
ATOM   3049 C  C   . LEU B 1 42  ? 81.662  43.934  -4.216  1.00 29.09  ? 222 LEU B C   1 
ATOM   3050 O  O   . LEU B 1 42  ? 80.634  43.782  -3.549  1.00 28.10  ? 222 LEU B O   1 
ATOM   3051 C  CB  . LEU B 1 42  ? 83.109  42.204  -3.159  1.00 28.75  ? 222 LEU B CB  1 
ATOM   3052 C  CG  . LEU B 1 42  ? 83.798  40.844  -3.226  1.00 28.10  ? 222 LEU B CG  1 
ATOM   3053 C  CD1 . LEU B 1 42  ? 84.410  40.522  -1.873  1.00 29.13  ? 222 LEU B CD1 1 
ATOM   3054 C  CD2 . LEU B 1 42  ? 82.790  39.775  -3.643  1.00 27.52  ? 222 LEU B CD2 1 
ATOM   3055 N  N   . GLY B 1 43  ? 82.036  45.103  -4.739  1.00 29.28  ? 223 GLY B N   1 
ATOM   3056 C  CA  . GLY B 1 43  ? 81.233  46.299  -4.565  1.00 28.91  ? 223 GLY B CA  1 
ATOM   3057 C  C   . GLY B 1 43  ? 81.348  46.927  -3.192  1.00 29.24  ? 223 GLY B C   1 
ATOM   3058 O  O   . GLY B 1 43  ? 80.523  47.762  -2.819  1.00 29.97  ? 223 GLY B O   1 
ATOM   3059 N  N   . LEU B 1 44  ? 82.377  46.549  -2.442  1.00 29.53  ? 224 LEU B N   1 
ATOM   3060 C  CA  . LEU B 1 44  ? 82.562  47.084  -1.094  1.00 29.34  ? 224 LEU B CA  1 
ATOM   3061 C  C   . LEU B 1 44  ? 83.057  48.528  -1.132  1.00 29.61  ? 224 LEU B C   1 
ATOM   3062 O  O   . LEU B 1 44  ? 82.676  49.345  -0.285  1.00 29.69  ? 224 LEU B O   1 
ATOM   3063 C  CB  . LEU B 1 44  ? 83.528  46.193  -0.297  1.00 28.75  ? 224 LEU B CB  1 
ATOM   3064 C  CG  . LEU B 1 44  ? 83.106  44.719  -0.117  1.00 28.41  ? 224 LEU B CG  1 
ATOM   3065 C  CD1 . LEU B 1 44  ? 84.181  43.948  0.645   1.00 25.55  ? 224 LEU B CD1 1 
ATOM   3066 C  CD2 . LEU B 1 44  ? 81.778  44.648  0.629   1.00 27.23  ? 224 LEU B CD2 1 
ATOM   3067 N  N   . VAL B 1 45  ? 83.900  48.845  -2.110  1.00 29.65  ? 225 VAL B N   1 
ATOM   3068 C  CA  . VAL B 1 45  ? 84.408  50.204  -2.248  1.00 30.09  ? 225 VAL B CA  1 
ATOM   3069 C  C   . VAL B 1 45  ? 83.222  51.123  -2.526  1.00 31.51  ? 225 VAL B C   1 
ATOM   3070 O  O   . VAL B 1 45  ? 83.100  52.187  -1.918  1.00 31.40  ? 225 VAL B O   1 
ATOM   3071 C  CB  . VAL B 1 45  ? 85.425  50.315  -3.402  1.00 30.00  ? 225 VAL B CB  1 
ATOM   3072 C  CG1 . VAL B 1 45  ? 85.741  51.793  -3.693  1.00 29.74  ? 225 VAL B CG1 1 
ATOM   3073 C  CG2 . VAL B 1 45  ? 86.693  49.577  -3.034  1.00 27.90  ? 225 VAL B CG2 1 
ATOM   3074 N  N   . ARG B 1 46  ? 82.343  50.685  -3.426  1.00 33.37  ? 226 ARG B N   1 
ATOM   3075 C  CA  . ARG B 1 46  ? 81.148  51.443  -3.794  1.00 35.53  ? 226 ARG B CA  1 
ATOM   3076 C  C   . ARG B 1 46  ? 80.191  51.668  -2.626  1.00 35.38  ? 226 ARG B C   1 
ATOM   3077 O  O   . ARG B 1 46  ? 79.911  52.802  -2.243  1.00 35.46  ? 226 ARG B O   1 
ATOM   3078 C  CB  . ARG B 1 46  ? 80.331  50.720  -4.872  1.00 38.40  ? 226 ARG B CB  1 
ATOM   3079 C  CG  . ARG B 1 46  ? 80.996  50.463  -6.208  1.00 43.58  ? 226 ARG B CG  1 
ATOM   3080 C  CD  . ARG B 1 46  ? 79.992  49.739  -7.116  1.00 47.29  ? 226 ARG B CD  1 
ATOM   3081 N  NE  . ARG B 1 46  ? 80.585  49.212  -8.342  1.00 50.65  ? 226 ARG B NE  1 
ATOM   3082 C  CZ  . ARG B 1 46  ? 81.561  48.310  -8.375  1.00 52.53  ? 226 ARG B CZ  1 
ATOM   3083 N  NH1 . ARG B 1 46  ? 82.062  47.833  -7.244  1.00 55.88  ? 226 ARG B NH1 1 
ATOM   3084 N  NH2 . ARG B 1 46  ? 82.031  47.874  -9.537  1.00 54.07  ? 226 ARG B NH2 1 
ATOM   3085 N  N   . ASP B 1 47  ? 79.678  50.570  -2.080  1.00 34.83  ? 227 ASP B N   1 
ATOM   3086 C  CA  . ASP B 1 47  ? 78.690  50.630  -1.010  1.00 34.18  ? 227 ASP B CA  1 
ATOM   3087 C  C   . ASP B 1 47  ? 79.112  51.219  0.328   1.00 33.34  ? 227 ASP B C   1 
ATOM   3088 O  O   . ASP B 1 47  ? 78.260  51.601  1.130   1.00 34.06  ? 227 ASP B O   1 
ATOM   3089 C  CB  . ASP B 1 47  ? 78.081  49.243  -0.809  1.00 34.40  ? 227 ASP B CB  1 
ATOM   3090 C  CG  . ASP B 1 47  ? 77.525  48.670  -2.100  1.00 35.29  ? 227 ASP B CG  1 
ATOM   3091 O  OD1 . ASP B 1 47  ? 77.201  49.469  -3.003  1.00 36.83  ? 227 ASP B OD1 1 
ATOM   3092 O  OD2 . ASP B 1 47  ? 77.402  47.432  -2.217  1.00 35.63  ? 227 ASP B OD2 1 
ATOM   3093 N  N   . PHE B 1 48  ? 80.411  51.315  0.576   1.00 31.31  ? 228 PHE B N   1 
ATOM   3094 C  CA  . PHE B 1 48  ? 80.861  51.878  1.836   1.00 30.30  ? 228 PHE B CA  1 
ATOM   3095 C  C   . PHE B 1 48  ? 81.728  53.116  1.642   1.00 30.58  ? 228 PHE B C   1 
ATOM   3096 O  O   . PHE B 1 48  ? 82.372  53.588  2.576   1.00 29.63  ? 228 PHE B O   1 
ATOM   3097 C  CB  . PHE B 1 48  ? 81.586  50.804  2.647   1.00 29.94  ? 228 PHE B CB  1 
ATOM   3098 C  CG  . PHE B 1 48  ? 80.698  49.643  3.025   1.00 29.03  ? 228 PHE B CG  1 
ATOM   3099 C  CD1 . PHE B 1 48  ? 79.759  49.773  4.050   1.00 28.22  ? 228 PHE B CD1 1 
ATOM   3100 C  CD2 . PHE B 1 48  ? 80.775  48.437  2.336   1.00 27.27  ? 228 PHE B CD2 1 
ATOM   3101 C  CE1 . PHE B 1 48  ? 78.908  48.715  4.383   1.00 28.37  ? 228 PHE B CE1 1 
ATOM   3102 C  CE2 . PHE B 1 48  ? 79.928  47.372  2.658   1.00 28.74  ? 228 PHE B CE2 1 
ATOM   3103 C  CZ  . PHE B 1 48  ? 78.993  47.510  3.684   1.00 27.50  ? 228 PHE B CZ  1 
ATOM   3104 N  N   . SER B 1 49  ? 81.723  53.640  0.421   1.00 30.65  ? 229 SER B N   1 
ATOM   3105 C  CA  . SER B 1 49  ? 82.479  54.839  0.085   1.00 31.08  ? 229 SER B CA  1 
ATOM   3106 C  C   . SER B 1 49  ? 83.914  54.761  0.554   1.00 31.13  ? 229 SER B C   1 
ATOM   3107 O  O   . SER B 1 49  ? 84.448  55.715  1.117   1.00 31.71  ? 229 SER B O   1 
ATOM   3108 C  CB  . SER B 1 49  ? 81.814  56.070  0.701   1.00 31.46  ? 229 SER B CB  1 
ATOM   3109 O  OG  . SER B 1 49  ? 80.464  56.171  0.287   1.00 32.65  ? 229 SER B OG  1 
ATOM   3110 N  N   . ILE B 1 50  ? 84.544  53.620  0.319   1.00 31.90  ? 230 ILE B N   1 
ATOM   3111 C  CA  . ILE B 1 50  ? 85.927  53.447  0.722   1.00 31.50  ? 230 ILE B CA  1 
ATOM   3112 C  C   . ILE B 1 50  ? 86.827  54.238  -0.213  1.00 31.81  ? 230 ILE B C   1 
ATOM   3113 O  O   . ILE B 1 50  ? 86.756  54.067  -1.427  1.00 31.01  ? 230 ILE B O   1 
ATOM   3114 C  CB  . ILE B 1 50  ? 86.354  51.970  0.650   1.00 31.36  ? 230 ILE B CB  1 
ATOM   3115 C  CG1 . ILE B 1 50  ? 85.402  51.114  1.486   1.00 30.16  ? 230 ILE B CG1 1 
ATOM   3116 C  CG2 . ILE B 1 50  ? 87.809  51.829  1.119   1.00 29.72  ? 230 ILE B CG2 1 
ATOM   3117 C  CD1 . ILE B 1 50  ? 85.690  49.627  1.407   1.00 30.73  ? 230 ILE B CD1 1 
ATOM   3118 N  N   . ASN B 1 51  ? 87.663  55.104  0.354   1.00 32.91  ? 231 ASN B N   1 
ATOM   3119 C  CA  . ASN B 1 51  ? 88.604  55.887  -0.442  1.00 34.61  ? 231 ASN B CA  1 
ATOM   3120 C  C   . ASN B 1 51  ? 89.581  54.874  -1.050  1.00 33.79  ? 231 ASN B C   1 
ATOM   3121 O  O   . ASN B 1 51  ? 90.319  54.203  -0.327  1.00 33.81  ? 231 ASN B O   1 
ATOM   3122 C  CB  . ASN B 1 51  ? 89.360  56.883  0.447   1.00 37.74  ? 231 ASN B CB  1 
ATOM   3123 C  CG  . ASN B 1 51  ? 90.296  57.789  -0.346  1.00 42.70  ? 231 ASN B CG  1 
ATOM   3124 O  OD1 . ASN B 1 51  ? 91.189  57.314  -1.056  1.00 46.36  ? 231 ASN B OD1 1 
ATOM   3125 N  ND2 . ASN B 1 51  ? 90.097  59.101  -0.226  1.00 44.59  ? 231 ASN B ND2 1 
ATOM   3126 N  N   . PRO B 1 52  ? 89.584  54.736  -2.386  1.00 33.17  ? 232 PRO B N   1 
ATOM   3127 C  CA  . PRO B 1 52  ? 90.494  53.777  -3.018  1.00 32.36  ? 232 PRO B CA  1 
ATOM   3128 C  C   . PRO B 1 52  ? 91.964  53.900  -2.637  1.00 32.18  ? 232 PRO B C   1 
ATOM   3129 O  O   . PRO B 1 52  ? 92.675  52.899  -2.605  1.00 31.84  ? 232 PRO B O   1 
ATOM   3130 C  CB  . PRO B 1 52  ? 90.235  53.974  -4.516  1.00 31.88  ? 232 PRO B CB  1 
ATOM   3131 C  CG  . PRO B 1 52  ? 89.590  55.324  -4.605  1.00 33.73  ? 232 PRO B CG  1 
ATOM   3132 C  CD  . PRO B 1 52  ? 88.731  55.391  -3.389  1.00 32.71  ? 232 PRO B CD  1 
ATOM   3133 N  N   . VAL B 1 53  ? 92.429  55.110  -2.343  1.00 31.95  ? 233 VAL B N   1 
ATOM   3134 C  CA  . VAL B 1 53  ? 93.826  55.266  -1.952  1.00 32.45  ? 233 VAL B CA  1 
ATOM   3135 C  C   . VAL B 1 53  ? 93.986  54.795  -0.506  1.00 31.60  ? 233 VAL B C   1 
ATOM   3136 O  O   . VAL B 1 53  ? 95.017  54.245  -0.132  1.00 31.42  ? 233 VAL B O   1 
ATOM   3137 C  CB  . VAL B 1 53  ? 94.305  56.732  -2.060  1.00 33.51  ? 233 VAL B CB  1 
ATOM   3138 C  CG1 . VAL B 1 53  ? 95.755  56.835  -1.607  1.00 33.18  ? 233 VAL B CG1 1 
ATOM   3139 C  CG2 . VAL B 1 53  ? 94.167  57.222  -3.499  1.00 33.29  ? 233 VAL B CG2 1 
ATOM   3140 N  N   . THR B 1 54  ? 92.959  55.012  0.306   1.00 30.95  ? 234 THR B N   1 
ATOM   3141 C  CA  . THR B 1 54  ? 93.019  54.572  1.688   1.00 30.62  ? 234 THR B CA  1 
ATOM   3142 C  C   . THR B 1 54  ? 93.034  53.044  1.676   1.00 30.57  ? 234 THR B C   1 
ATOM   3143 O  O   . THR B 1 54  ? 93.767  52.423  2.438   1.00 30.41  ? 234 THR B O   1 
ATOM   3144 C  CB  . THR B 1 54  ? 91.813  55.077  2.494   1.00 30.90  ? 234 THR B CB  1 
ATOM   3145 O  OG1 . THR B 1 54  ? 91.839  56.506  2.534   1.00 31.13  ? 234 THR B OG1 1 
ATOM   3146 C  CG2 . THR B 1 54  ? 91.859  54.540  3.925   1.00 31.87  ? 234 THR B CG2 1 
ATOM   3147 N  N   . LEU B 1 55  ? 92.230  52.446  0.798   1.00 29.41  ? 235 LEU B N   1 
ATOM   3148 C  CA  . LEU B 1 55  ? 92.184  50.991  0.676   1.00 28.65  ? 235 LEU B CA  1 
ATOM   3149 C  C   . LEU B 1 55  ? 93.593  50.446  0.426   1.00 29.43  ? 235 LEU B C   1 
ATOM   3150 O  O   . LEU B 1 55  ? 93.985  49.432  1.005   1.00 27.40  ? 235 LEU B O   1 
ATOM   3151 C  CB  . LEU B 1 55  ? 91.258  50.580  -0.474  1.00 26.91  ? 235 LEU B CB  1 
ATOM   3152 C  CG  . LEU B 1 55  ? 91.272  49.097  -0.862  1.00 27.30  ? 235 LEU B CG  1 
ATOM   3153 C  CD1 . LEU B 1 55  ? 90.739  48.240  0.296   1.00 26.35  ? 235 LEU B CD1 1 
ATOM   3154 C  CD2 . LEU B 1 55  ? 90.429  48.893  -2.114  1.00 25.55  ? 235 LEU B CD2 1 
ATOM   3155 N  N   . ARG B 1 56  ? 94.351  51.124  -0.436  1.00 30.47  ? 236 ARG B N   1 
ATOM   3156 C  CA  . ARG B 1 56  ? 95.718  50.702  -0.735  1.00 32.19  ? 236 ARG B CA  1 
ATOM   3157 C  C   . ARG B 1 56  ? 96.648  50.864  0.455   1.00 32.35  ? 236 ARG B C   1 
ATOM   3158 O  O   . ARG B 1 56  ? 97.423  49.959  0.758   1.00 33.05  ? 236 ARG B O   1 
ATOM   3159 C  CB  . ARG B 1 56  ? 96.305  51.497  -1.896  1.00 34.06  ? 236 ARG B CB  1 
ATOM   3160 C  CG  . ARG B 1 56  ? 95.922  51.009  -3.261  1.00 37.13  ? 236 ARG B CG  1 
ATOM   3161 C  CD  . ARG B 1 56  ? 96.984  51.425  -4.255  1.00 38.97  ? 236 ARG B CD  1 
ATOM   3162 N  NE  . ARG B 1 56  ? 96.421  51.548  -5.586  1.00 41.84  ? 236 ARG B NE  1 
ATOM   3163 C  CZ  . ARG B 1 56  ? 96.646  52.575  -6.397  1.00 43.85  ? 236 ARG B CZ  1 
ATOM   3164 N  NH1 . ARG B 1 56  ? 97.431  53.574  -6.014  1.00 43.76  ? 236 ARG B NH1 1 
ATOM   3165 N  NH2 . ARG B 1 56  ? 96.066  52.612  -7.585  1.00 46.32  ? 236 ARG B NH2 1 
ATOM   3166 N  N   . ARG B 1 57  ? 96.598  52.024  1.111   1.00 32.59  ? 237 ARG B N   1 
ATOM   3167 C  CA  . ARG B 1 57  ? 97.455  52.255  2.268   1.00 32.77  ? 237 ARG B CA  1 
ATOM   3168 C  C   . ARG B 1 57  ? 97.122  51.239  3.351   1.00 31.48  ? 237 ARG B C   1 
ATOM   3169 O  O   . ARG B 1 57  ? 98.018  50.655  3.958   1.00 31.81  ? 237 ARG B O   1 
ATOM   3170 C  CB  . ARG B 1 57  ? 97.293  53.685  2.808   1.00 33.48  ? 237 ARG B CB  1 
ATOM   3171 C  CG  . ARG B 1 57  ? 98.045  54.742  1.997   1.00 37.65  ? 237 ARG B CG  1 
ATOM   3172 C  CD  . ARG B 1 57  ? 98.073  56.096  2.704   1.00 39.04  ? 237 ARG B CD  1 
ATOM   3173 N  NE  . ARG B 1 57  ? 96.723  56.604  2.915   1.00 42.21  ? 237 ARG B NE  1 
ATOM   3174 C  CZ  . ARG B 1 57  ? 96.136  57.527  2.165   1.00 42.61  ? 237 ARG B CZ  1 
ATOM   3175 N  NH1 . ARG B 1 57  ? 96.781  58.068  1.144   1.00 43.10  ? 237 ARG B NH1 1 
ATOM   3176 N  NH2 . ARG B 1 57  ? 94.889  57.893  2.425   1.00 44.25  ? 237 ARG B NH2 1 
ATOM   3177 N  N   . TRP B 1 58  ? 95.831  51.017  3.575   1.00 29.91  ? 238 TRP B N   1 
ATOM   3178 C  CA  . TRP B 1 58  ? 95.382  50.055  4.573   1.00 28.60  ? 238 TRP B CA  1 
ATOM   3179 C  C   . TRP B 1 58  ? 95.945  48.663  4.277   1.00 28.54  ? 238 TRP B C   1 
ATOM   3180 O  O   . TRP B 1 58  ? 96.494  48.014  5.163   1.00 28.71  ? 238 TRP B O   1 
ATOM   3181 C  CB  . TRP B 1 58  ? 93.857  49.996  4.606   1.00 27.38  ? 238 TRP B CB  1 
ATOM   3182 C  CG  . TRP B 1 58  ? 93.339  48.911  5.497   1.00 26.48  ? 238 TRP B CG  1 
ATOM   3183 C  CD1 . TRP B 1 58  ? 93.429  48.853  6.859   1.00 25.80  ? 238 TRP B CD1 1 
ATOM   3184 C  CD2 . TRP B 1 58  ? 92.699  47.701  5.084   1.00 24.62  ? 238 TRP B CD2 1 
ATOM   3185 N  NE1 . TRP B 1 58  ? 92.887  47.679  7.319   1.00 25.51  ? 238 TRP B NE1 1 
ATOM   3186 C  CE2 . TRP B 1 58  ? 92.433  46.950  6.252   1.00 25.85  ? 238 TRP B CE2 1 
ATOM   3187 C  CE3 . TRP B 1 58  ? 92.328  47.174  3.840   1.00 24.90  ? 238 TRP B CE3 1 
ATOM   3188 C  CZ2 . TRP B 1 58  ? 91.807  45.697  6.213   1.00 24.21  ? 238 TRP B CZ2 1 
ATOM   3189 C  CZ3 . TRP B 1 58  ? 91.705  45.924  3.800   1.00 24.61  ? 238 TRP B CZ3 1 
ATOM   3190 C  CH2 . TRP B 1 58  ? 91.454  45.202  4.982   1.00 24.43  ? 238 TRP B CH2 1 
ATOM   3191 N  N   . LEU B 1 59  ? 95.811  48.205  3.035   1.00 27.99  ? 239 LEU B N   1 
ATOM   3192 C  CA  . LEU B 1 59  ? 96.331  46.889  2.663   1.00 28.64  ? 239 LEU B CA  1 
ATOM   3193 C  C   . LEU B 1 59  ? 97.845  46.784  2.871   1.00 29.17  ? 239 LEU B C   1 
ATOM   3194 O  O   . LEU B 1 59  ? 98.360  45.733  3.256   1.00 28.82  ? 239 LEU B O   1 
ATOM   3195 C  CB  . LEU B 1 59  ? 95.981  46.565  1.207   1.00 27.55  ? 239 LEU B CB  1 
ATOM   3196 C  CG  . LEU B 1 59  ? 94.532  46.120  0.976   1.00 27.68  ? 239 LEU B CG  1 
ATOM   3197 C  CD1 . LEU B 1 59  ? 94.276  45.971  -0.521  1.00 27.00  ? 239 LEU B CD1 1 
ATOM   3198 C  CD2 . LEU B 1 59  ? 94.274  44.798  1.694   1.00 26.43  ? 239 LEU B CD2 1 
ATOM   3199 N  N   . PHE B 1 60  ? 98.555  47.877  2.619   1.00 29.79  ? 240 PHE B N   1 
ATOM   3200 C  CA  . PHE B 1 60  ? 99.999  47.898  2.789   1.00 31.36  ? 240 PHE B CA  1 
ATOM   3201 C  C   . PHE B 1 60  ? 100.364 47.831  4.272   1.00 31.59  ? 240 PHE B C   1 
ATOM   3202 O  O   . PHE B 1 60  ? 101.324 47.162  4.655   1.00 30.20  ? 240 PHE B O   1 
ATOM   3203 C  CB  . PHE B 1 60  ? 100.584 49.172  2.189   1.00 33.25  ? 240 PHE B CB  1 
ATOM   3204 C  CG  . PHE B 1 60  ? 102.083 49.218  2.217   1.00 34.95  ? 240 PHE B CG  1 
ATOM   3205 C  CD1 . PHE B 1 60  ? 102.831 48.616  1.207   1.00 36.91  ? 240 PHE B CD1 1 
ATOM   3206 C  CD2 . PHE B 1 60  ? 102.751 49.861  3.252   1.00 34.86  ? 240 PHE B CD2 1 
ATOM   3207 C  CE1 . PHE B 1 60  ? 104.229 48.656  1.229   1.00 37.57  ? 240 PHE B CE1 1 
ATOM   3208 C  CE2 . PHE B 1 60  ? 104.148 49.907  3.284   1.00 37.21  ? 240 PHE B CE2 1 
ATOM   3209 C  CZ  . PHE B 1 60  ? 104.886 49.305  2.271   1.00 36.14  ? 240 PHE B CZ  1 
ATOM   3210 N  N   . CYS B 1 61  ? 99.602  48.534  5.106   1.00 31.93  ? 241 CYS B N   1 
ATOM   3211 C  CA  . CYS B 1 61  ? 99.871  48.520  6.536   1.00 32.28  ? 241 CYS B CA  1 
ATOM   3212 C  C   . CYS B 1 61  ? 99.562  47.124  7.081   1.00 31.87  ? 241 CYS B C   1 
ATOM   3213 O  O   . CYS B 1 61  ? 100.280 46.614  7.938   1.00 31.11  ? 241 CYS B O   1 
ATOM   3214 C  CB  . CYS B 1 61  ? 99.026  49.567  7.259   1.00 32.78  ? 241 CYS B CB  1 
ATOM   3215 S  SG  . CYS B 1 61  ? 99.457  49.736  9.016   1.00 35.93  ? 241 CYS B SG  1 
ATOM   3216 N  N   . VAL B 1 62  ? 98.492  46.510  6.584   1.00 31.33  ? 242 VAL B N   1 
ATOM   3217 C  CA  . VAL B 1 62  ? 98.147  45.162  7.017   1.00 31.20  ? 242 VAL B CA  1 
ATOM   3218 C  C   . VAL B 1 62  ? 99.335  44.259  6.676   1.00 30.43  ? 242 VAL B C   1 
ATOM   3219 O  O   . VAL B 1 62  ? 99.836  43.536  7.525   1.00 29.84  ? 242 VAL B O   1 
ATOM   3220 C  CB  . VAL B 1 62  ? 96.885  44.633  6.299   1.00 30.18  ? 242 VAL B CB  1 
ATOM   3221 C  CG1 . VAL B 1 62  ? 96.739  43.130  6.539   1.00 29.37  ? 242 VAL B CG1 1 
ATOM   3222 C  CG2 . VAL B 1 62  ? 95.656  45.366  6.813   1.00 29.74  ? 242 VAL B CG2 1 
ATOM   3223 N  N   . HIS B 1 63  ? 99.792  44.327  5.433   1.00 30.94  ? 243 HIS B N   1 
ATOM   3224 C  CA  . HIS B 1 63  ? 100.930 43.528  4.998   1.00 32.02  ? 243 HIS B CA  1 
ATOM   3225 C  C   . HIS B 1 63  ? 102.143 43.713  5.910   1.00 31.67  ? 243 HIS B C   1 
ATOM   3226 O  O   . HIS B 1 63  ? 102.778 42.744  6.321   1.00 31.31  ? 243 HIS B O   1 
ATOM   3227 C  CB  . HIS B 1 63  ? 101.313 43.888  3.560   1.00 33.53  ? 243 HIS B CB  1 
ATOM   3228 C  CG  . HIS B 1 63  ? 102.688 43.444  3.179   1.00 36.37  ? 243 HIS B CG  1 
ATOM   3229 N  ND1 . HIS B 1 63  ? 103.808 44.213  3.410   1.00 37.84  ? 243 HIS B ND1 1 
ATOM   3230 C  CD2 . HIS B 1 63  ? 103.135 42.280  2.647   1.00 37.99  ? 243 HIS B CD2 1 
ATOM   3231 C  CE1 . HIS B 1 63  ? 104.884 43.543  3.040   1.00 39.21  ? 243 HIS B CE1 1 
ATOM   3232 N  NE2 . HIS B 1 63  ? 104.504 42.367  2.573   1.00 39.22  ? 243 HIS B NE2 1 
ATOM   3233 N  N   . ASP B 1 64  ? 102.460 44.963  6.224   1.00 32.13  ? 244 ASP B N   1 
ATOM   3234 C  CA  . ASP B 1 64  ? 103.599 45.273  7.083   1.00 32.63  ? 244 ASP B CA  1 
ATOM   3235 C  C   . ASP B 1 64  ? 103.444 44.685  8.490   1.00 32.03  ? 244 ASP B C   1 
ATOM   3236 O  O   . ASP B 1 64  ? 104.435 44.429  9.178   1.00 31.11  ? 244 ASP B O   1 
ATOM   3237 C  CB  . ASP B 1 64  ? 103.768 46.797  7.182   1.00 35.00  ? 244 ASP B CB  1 
ATOM   3238 C  CG  . ASP B 1 64  ? 105.007 47.205  7.971   1.00 36.86  ? 244 ASP B CG  1 
ATOM   3239 O  OD1 . ASP B 1 64  ? 106.127 46.827  7.562   1.00 37.50  ? 244 ASP B OD1 1 
ATOM   3240 O  OD2 . ASP B 1 64  ? 104.858 47.908  8.996   1.00 38.65  ? 244 ASP B OD2 1 
ATOM   3241 N  N   . ASN B 1 65  ? 102.205 44.461  8.914   1.00 31.13  ? 245 ASN B N   1 
ATOM   3242 C  CA  . ASN B 1 65  ? 101.974 43.939  10.253  1.00 31.39  ? 245 ASN B CA  1 
ATOM   3243 C  C   . ASN B 1 65  ? 101.866 42.423  10.408  1.00 30.56  ? 245 ASN B C   1 
ATOM   3244 O  O   . ASN B 1 65  ? 101.513 41.925  11.479  1.00 29.68  ? 245 ASN B O   1 
ATOM   3245 C  CB  . ASN B 1 65  ? 100.773 44.650  10.873  1.00 31.82  ? 245 ASN B CB  1 
ATOM   3246 C  CG  . ASN B 1 65  ? 101.137 46.029  11.387  1.00 33.33  ? 245 ASN B CG  1 
ATOM   3247 O  OD1 . ASN B 1 65  ? 101.833 46.159  12.399  1.00 34.53  ? 245 ASN B OD1 1 
ATOM   3248 N  ND2 . ASN B 1 65  ? 100.689 47.068  10.683  1.00 32.17  ? 245 ASN B ND2 1 
ATOM   3249 N  N   . TYR B 1 66  ? 102.163 41.695  9.337   1.00 30.10  ? 246 TYR B N   1 
ATOM   3250 C  CA  . TYR B 1 66  ? 102.198 40.240  9.396   1.00 31.03  ? 246 TYR B CA  1 
ATOM   3251 C  C   . TYR B 1 66  ? 103.696 39.935  9.519   1.00 32.57  ? 246 TYR B C   1 
ATOM   3252 O  O   . TYR B 1 66  ? 104.509 40.589  8.866   1.00 31.87  ? 246 TYR B O   1 
ATOM   3253 C  CB  . TYR B 1 66  ? 101.629 39.613  8.119   1.00 30.03  ? 246 TYR B CB  1 
ATOM   3254 C  CG  . TYR B 1 66  ? 100.156 39.273  8.220   1.00 29.77  ? 246 TYR B CG  1 
ATOM   3255 C  CD1 . TYR B 1 66  ? 99.171  40.229  7.941   1.00 28.38  ? 246 TYR B CD1 1 
ATOM   3256 C  CD2 . TYR B 1 66  ? 99.746  38.012  8.655   1.00 27.93  ? 246 TYR B CD2 1 
ATOM   3257 C  CE1 . TYR B 1 66  ? 97.812  39.930  8.094   1.00 28.20  ? 246 TYR B CE1 1 
ATOM   3258 C  CE2 . TYR B 1 66  ? 98.397  37.707  8.817   1.00 27.46  ? 246 TYR B CE2 1 
ATOM   3259 C  CZ  . TYR B 1 66  ? 97.436  38.665  8.538   1.00 28.82  ? 246 TYR B CZ  1 
ATOM   3260 O  OH  . TYR B 1 66  ? 96.102  38.363  8.725   1.00 28.69  ? 246 TYR B OH  1 
ATOM   3261 N  N   . ARG B 1 67  ? 104.067 38.973  10.361  1.00 33.60  ? 247 ARG B N   1 
ATOM   3262 C  CA  . ARG B 1 67  ? 105.478 38.639  10.540  1.00 35.61  ? 247 ARG B CA  1 
ATOM   3263 C  C   . ARG B 1 67  ? 105.972 37.603  9.536   1.00 36.99  ? 247 ARG B C   1 
ATOM   3264 O  O   . ARG B 1 67  ? 105.178 36.889  8.916   1.00 36.95  ? 247 ARG B O   1 
ATOM   3265 C  CB  . ARG B 1 67  ? 105.737 38.117  11.957  1.00 36.54  ? 247 ARG B CB  1 
ATOM   3266 C  CG  . ARG B 1 67  ? 105.443 39.105  13.074  1.00 38.21  ? 247 ARG B CG  1 
ATOM   3267 C  CD  . ARG B 1 67  ? 106.122 38.662  14.370  1.00 40.61  ? 247 ARG B CD  1 
ATOM   3268 N  NE  . ARG B 1 67  ? 105.456 39.197  15.552  1.00 42.84  ? 247 ARG B NE  1 
ATOM   3269 C  CZ  . ARG B 1 67  ? 105.836 38.949  16.804  1.00 44.49  ? 247 ARG B CZ  1 
ATOM   3270 N  NH1 . ARG B 1 67  ? 106.890 38.177  17.041  1.00 45.29  ? 247 ARG B NH1 1 
ATOM   3271 N  NH2 . ARG B 1 67  ? 105.149 39.454  17.822  1.00 44.78  ? 247 ARG B NH2 1 
ATOM   3272 N  N   . ASN B 1 68  ? 107.292 37.517  9.392   1.00 38.01  ? 248 ASN B N   1 
ATOM   3273 C  CA  . ASN B 1 68  ? 107.903 36.570  8.468   1.00 39.26  ? 248 ASN B CA  1 
ATOM   3274 C  C   . ASN B 1 68  ? 107.998 35.177  9.075   1.00 38.29  ? 248 ASN B C   1 
ATOM   3275 O  O   . ASN B 1 68  ? 109.092 34.637  9.229   1.00 38.75  ? 248 ASN B O   1 
ATOM   3276 C  CB  . ASN B 1 68  ? 109.309 37.033  8.065   1.00 42.93  ? 248 ASN B CB  1 
ATOM   3277 C  CG  . ASN B 1 68  ? 109.300 38.358  7.313   1.00 46.93  ? 248 ASN B CG  1 
ATOM   3278 O  OD1 . ASN B 1 68  ? 108.628 38.504  6.285   1.00 49.20  ? 248 ASN B OD1 1 
ATOM   3279 N  ND2 . ASN B 1 68  ? 110.056 39.331  7.821   1.00 48.38  ? 248 ASN B ND2 1 
ATOM   3280 N  N   . ASN B 1 69  ? 106.851 34.607  9.428   1.00 36.93  ? 249 ASN B N   1 
ATOM   3281 C  CA  . ASN B 1 69  ? 106.800 33.262  9.991   1.00 34.89  ? 249 ASN B CA  1 
ATOM   3282 C  C   . ASN B 1 69  ? 106.696 32.279  8.836   1.00 34.14  ? 249 ASN B C   1 
ATOM   3283 O  O   . ASN B 1 69  ? 106.288 32.645  7.732   1.00 32.87  ? 249 ASN B O   1 
ATOM   3284 C  CB  . ASN B 1 69  ? 105.572 33.075  10.891  1.00 34.40  ? 249 ASN B CB  1 
ATOM   3285 C  CG  . ASN B 1 69  ? 105.578 33.990  12.092  1.00 34.34  ? 249 ASN B CG  1 
ATOM   3286 O  OD1 . ASN B 1 69  ? 106.609 34.170  12.740  1.00 35.75  ? 249 ASN B OD1 1 
ATOM   3287 N  ND2 . ASN B 1 69  ? 104.420 34.561  12.409  1.00 31.93  ? 249 ASN B ND2 1 
ATOM   3288 N  N   . PRO B 1 70  ? 107.062 31.010  9.074   1.00 34.09  ? 250 PRO B N   1 
ATOM   3289 C  CA  . PRO B 1 70  ? 106.968 30.035  7.985   1.00 33.32  ? 250 PRO B CA  1 
ATOM   3290 C  C   . PRO B 1 70  ? 105.530 29.745  7.544   1.00 32.20  ? 250 PRO B C   1 
ATOM   3291 O  O   . PRO B 1 70  ? 105.278 29.491  6.365   1.00 31.30  ? 250 PRO B O   1 
ATOM   3292 C  CB  . PRO B 1 70  ? 107.690 28.805  8.549   1.00 33.63  ? 250 PRO B CB  1 
ATOM   3293 C  CG  . PRO B 1 70  ? 107.583 28.971  10.028  1.00 35.22  ? 250 PRO B CG  1 
ATOM   3294 C  CD  . PRO B 1 70  ? 107.779 30.448  10.230  1.00 34.16  ? 250 PRO B CD  1 
ATOM   3295 N  N   . PHE B 1 71  ? 104.583 29.796  8.477   1.00 30.92  ? 251 PHE B N   1 
ATOM   3296 C  CA  . PHE B 1 71  ? 103.193 29.532  8.119   1.00 30.20  ? 251 PHE B CA  1 
ATOM   3297 C  C   . PHE B 1 71  ? 102.269 30.734  8.286   1.00 29.65  ? 251 PHE B C   1 
ATOM   3298 O  O   . PHE B 1 71  ? 101.629 31.168  7.330   1.00 29.35  ? 251 PHE B O   1 
ATOM   3299 C  CB  . PHE B 1 71  ? 102.633 28.370  8.936   1.00 29.60  ? 251 PHE B CB  1 
ATOM   3300 C  CG  . PHE B 1 71  ? 101.226 27.997  8.557   1.00 28.80  ? 251 PHE B CG  1 
ATOM   3301 C  CD1 . PHE B 1 71  ? 100.984 27.055  7.565   1.00 28.01  ? 251 PHE B CD1 1 
ATOM   3302 C  CD2 . PHE B 1 71  ? 100.140 28.607  9.179   1.00 28.94  ? 251 PHE B CD2 1 
ATOM   3303 C  CE1 . PHE B 1 71  ? 99.680  26.726  7.199   1.00 28.89  ? 251 PHE B CE1 1 
ATOM   3304 C  CE2 . PHE B 1 71  ? 98.829  28.284  8.818   1.00 27.71  ? 251 PHE B CE2 1 
ATOM   3305 C  CZ  . PHE B 1 71  ? 98.600  27.344  7.829   1.00 27.59  ? 251 PHE B CZ  1 
ATOM   3306 N  N   . HIS B 1 72  ? 102.184 31.261  9.504   1.00 28.90  ? 252 HIS B N   1 
ATOM   3307 C  CA  . HIS B 1 72  ? 101.316 32.404  9.778   1.00 28.14  ? 252 HIS B CA  1 
ATOM   3308 C  C   . HIS B 1 72  ? 101.921 33.721  9.311   1.00 28.11  ? 252 HIS B C   1 
ATOM   3309 O  O   . HIS B 1 72  ? 102.370 34.546  10.112  1.00 27.98  ? 252 HIS B O   1 
ATOM   3310 C  CB  . HIS B 1 72  ? 100.979 32.456  11.269  1.00 27.68  ? 252 HIS B CB  1 
ATOM   3311 C  CG  . HIS B 1 72  ? 100.156 31.294  11.731  1.00 27.37  ? 252 HIS B CG  1 
ATOM   3312 N  ND1 . HIS B 1 72  ? 100.703 30.189  12.344  1.00 27.04  ? 252 HIS B ND1 1 
ATOM   3313 C  CD2 . HIS B 1 72  ? 98.833  31.035  11.602  1.00 27.90  ? 252 HIS B CD2 1 
ATOM   3314 C  CE1 . HIS B 1 72  ? 99.754  29.298  12.572  1.00 27.35  ? 252 HIS B CE1 1 
ATOM   3315 N  NE2 . HIS B 1 72  ? 98.610  29.787  12.129  1.00 28.27  ? 252 HIS B NE2 1 
ATOM   3316 N  N   . ASN B 1 73  ? 101.906 33.904  7.995   1.00 28.40  ? 253 ASN B N   1 
ATOM   3317 C  CA  . ASN B 1 73  ? 102.464 35.083  7.350   1.00 28.59  ? 253 ASN B CA  1 
ATOM   3318 C  C   . ASN B 1 73  ? 101.456 35.772  6.433   1.00 28.84  ? 253 ASN B C   1 
ATOM   3319 O  O   . ASN B 1 73  ? 100.285 35.402  6.377   1.00 29.42  ? 253 ASN B O   1 
ATOM   3320 C  CB  . ASN B 1 73  ? 103.690 34.681  6.534   1.00 27.78  ? 253 ASN B CB  1 
ATOM   3321 C  CG  . ASN B 1 73  ? 103.421 33.483  5.644   1.00 28.39  ? 253 ASN B CG  1 
ATOM   3322 O  OD1 . ASN B 1 73  ? 102.376 33.400  4.991   1.00 29.14  ? 253 ASN B OD1 1 
ATOM   3323 N  ND2 . ASN B 1 73  ? 104.364 32.548  5.608   1.00 26.35  ? 253 ASN B ND2 1 
ATOM   3324 N  N   . PHE B 1 74  ? 101.923 36.771  5.696   1.00 29.53  ? 254 PHE B N   1 
ATOM   3325 C  CA  . PHE B 1 74  ? 101.040 37.492  4.801   1.00 29.42  ? 254 PHE B CA  1 
ATOM   3326 C  C   . PHE B 1 74  ? 100.418 36.599  3.734   1.00 28.77  ? 254 PHE B C   1 
ATOM   3327 O  O   . PHE B 1 74  ? 99.255  36.793  3.362   1.00 28.55  ? 254 PHE B O   1 
ATOM   3328 C  CB  . PHE B 1 74  ? 101.774 38.642  4.124   1.00 29.85  ? 254 PHE B CB  1 
ATOM   3329 C  CG  . PHE B 1 74  ? 100.905 39.419  3.180   1.00 31.53  ? 254 PHE B CG  1 
ATOM   3330 C  CD1 . PHE B 1 74  ? 99.858  40.191  3.664   1.00 31.44  ? 254 PHE B CD1 1 
ATOM   3331 C  CD2 . PHE B 1 74  ? 101.098 39.336  1.807   1.00 31.32  ? 254 PHE B CD2 1 
ATOM   3332 C  CE1 . PHE B 1 74  ? 99.007  40.868  2.794   1.00 32.63  ? 254 PHE B CE1 1 
ATOM   3333 C  CE2 . PHE B 1 74  ? 100.258 40.007  0.933   1.00 32.87  ? 254 PHE B CE2 1 
ATOM   3334 C  CZ  . PHE B 1 74  ? 99.208  40.775  1.425   1.00 32.93  ? 254 PHE B CZ  1 
ATOM   3335 N  N   . ARG B 1 75  ? 101.174 35.625  3.238   1.00 27.56  ? 255 ARG B N   1 
ATOM   3336 C  CA  . ARG B 1 75  ? 100.630 34.746  2.217   1.00 28.49  ? 255 ARG B CA  1 
ATOM   3337 C  C   . ARG B 1 75  ? 99.452  33.915  2.754   1.00 27.78  ? 255 ARG B C   1 
ATOM   3338 O  O   . ARG B 1 75  ? 98.484  33.691  2.026   1.00 27.44  ? 255 ARG B O   1 
ATOM   3339 C  CB  . ARG B 1 75  ? 101.721 33.835  1.634   1.00 28.98  ? 255 ARG B CB  1 
ATOM   3340 C  CG  . ARG B 1 75  ? 101.344 33.232  0.269   1.00 29.01  ? 255 ARG B CG  1 
ATOM   3341 C  CD  . ARG B 1 75  ? 102.455 32.345  -0.297  1.00 29.22  ? 255 ARG B CD  1 
ATOM   3342 N  NE  . ARG B 1 75  ? 103.656 33.114  -0.620  1.00 29.80  ? 255 ARG B NE  1 
ATOM   3343 C  CZ  . ARG B 1 75  ? 103.820 33.826  -1.733  1.00 28.83  ? 255 ARG B CZ  1 
ATOM   3344 N  NH1 . ARG B 1 75  ? 102.864 33.870  -2.652  1.00 26.29  ? 255 ARG B NH1 1 
ATOM   3345 N  NH2 . ARG B 1 75  ? 104.940 34.513  -1.917  1.00 29.40  ? 255 ARG B NH2 1 
ATOM   3346 N  N   . HIS B 1 76  ? 99.527  33.471  4.013   1.00 27.77  ? 256 HIS B N   1 
ATOM   3347 C  CA  . HIS B 1 76  ? 98.436  32.692  4.628   1.00 27.91  ? 256 HIS B CA  1 
ATOM   3348 C  C   . HIS B 1 76  ? 97.214  33.591  4.666   1.00 27.94  ? 256 HIS B C   1 
ATOM   3349 O  O   . HIS B 1 76  ? 96.101  33.184  4.343   1.00 28.35  ? 256 HIS B O   1 
ATOM   3350 C  CB  . HIS B 1 76  ? 98.794  32.276  6.065   1.00 29.47  ? 256 HIS B CB  1 
ATOM   3351 C  CG  . HIS B 1 76  ? 97.623  31.792  6.877   1.00 31.52  ? 256 HIS B CG  1 
ATOM   3352 N  ND1 . HIS B 1 76  ? 96.838  30.723  6.498   1.00 30.82  ? 256 HIS B ND1 1 
ATOM   3353 C  CD2 . HIS B 1 76  ? 97.123  32.222  8.062   1.00 32.10  ? 256 HIS B CD2 1 
ATOM   3354 C  CE1 . HIS B 1 76  ? 95.908  30.513  7.416   1.00 31.89  ? 256 HIS B CE1 1 
ATOM   3355 N  NE2 . HIS B 1 76  ? 96.058  31.409  8.379   1.00 34.92  ? 256 HIS B NE2 1 
ATOM   3356 N  N   . CYS B 1 77  ? 97.447  34.825  5.085   1.00 27.73  ? 257 CYS B N   1 
ATOM   3357 C  CA  . CYS B 1 77  ? 96.406  35.825  5.157   1.00 28.07  ? 257 CYS B CA  1 
ATOM   3358 C  C   . CYS B 1 77  ? 95.772  35.947  3.771   1.00 27.81  ? 257 CYS B C   1 
ATOM   3359 O  O   . CYS B 1 77  ? 94.552  35.964  3.642   1.00 28.00  ? 257 CYS B O   1 
ATOM   3360 C  CB  . CYS B 1 77  ? 97.036  37.145  5.623   1.00 28.49  ? 257 CYS B CB  1 
ATOM   3361 S  SG  . CYS B 1 77  ? 96.475  38.663  4.855   1.00 27.95  ? 257 CYS B SG  1 
ATOM   3362 N  N   . PHE B 1 78  ? 96.603  36.005  2.734   1.00 27.67  ? 258 PHE B N   1 
ATOM   3363 C  CA  . PHE B 1 78  ? 96.099  36.110  1.368   1.00 27.59  ? 258 PHE B CA  1 
ATOM   3364 C  C   . PHE B 1 78  ? 95.261  34.878  1.008   1.00 27.76  ? 258 PHE B C   1 
ATOM   3365 O  O   . PHE B 1 78  ? 94.209  35.000  0.378   1.00 28.02  ? 258 PHE B O   1 
ATOM   3366 C  CB  . PHE B 1 78  ? 97.264  36.285  0.380   1.00 27.82  ? 258 PHE B CB  1 
ATOM   3367 C  CG  . PHE B 1 78  ? 96.844  36.260  -1.065  1.00 28.43  ? 258 PHE B CG  1 
ATOM   3368 C  CD1 . PHE B 1 78  ? 97.022  35.113  -1.835  1.00 28.37  ? 258 PHE B CD1 1 
ATOM   3369 C  CD2 . PHE B 1 78  ? 96.205  37.359  -1.636  1.00 27.62  ? 258 PHE B CD2 1 
ATOM   3370 C  CE1 . PHE B 1 78  ? 96.567  35.058  -3.152  1.00 28.87  ? 258 PHE B CE1 1 
ATOM   3371 C  CE2 . PHE B 1 78  ? 95.743  37.314  -2.955  1.00 28.41  ? 258 PHE B CE2 1 
ATOM   3372 C  CZ  . PHE B 1 78  ? 95.924  36.162  -3.713  1.00 28.80  ? 258 PHE B CZ  1 
ATOM   3373 N  N   . CYS B 1 79  ? 95.719  33.699  1.422   1.00 27.55  ? 259 CYS B N   1 
ATOM   3374 C  CA  . CYS B 1 79  ? 94.996  32.453  1.156   1.00 28.23  ? 259 CYS B CA  1 
ATOM   3375 C  C   . CYS B 1 79  ? 93.609  32.455  1.776   1.00 27.78  ? 259 CYS B C   1 
ATOM   3376 O  O   . CYS B 1 79  ? 92.631  32.059  1.137   1.00 28.11  ? 259 CYS B O   1 
ATOM   3377 C  CB  . CYS B 1 79  ? 95.763  31.242  1.707   1.00 28.05  ? 259 CYS B CB  1 
ATOM   3378 S  SG  . CYS B 1 79  ? 97.290  30.860  0.835   1.00 29.35  ? 259 CYS B SG  1 
ATOM   3379 N  N   . VAL B 1 80  ? 93.526  32.889  3.028   1.00 26.58  ? 260 VAL B N   1 
ATOM   3380 C  CA  . VAL B 1 80  ? 92.248  32.920  3.726   1.00 25.68  ? 260 VAL B CA  1 
ATOM   3381 C  C   . VAL B 1 80  ? 91.278  33.887  3.048   1.00 26.20  ? 260 VAL B C   1 
ATOM   3382 O  O   . VAL B 1 80  ? 90.108  33.570  2.847   1.00 26.47  ? 260 VAL B O   1 
ATOM   3383 C  CB  . VAL B 1 80  ? 92.443  33.327  5.202   1.00 24.30  ? 260 VAL B CB  1 
ATOM   3384 C  CG1 . VAL B 1 80  ? 91.119  33.230  5.950   1.00 24.55  ? 260 VAL B CG1 1 
ATOM   3385 C  CG2 . VAL B 1 80  ? 93.495  32.427  5.851   1.00 23.65  ? 260 VAL B CG2 1 
ATOM   3386 N  N   . ALA B 1 81  ? 91.769  35.070  2.694   1.00 26.58  ? 261 ALA B N   1 
ATOM   3387 C  CA  . ALA B 1 81  ? 90.933  36.066  2.037   1.00 26.87  ? 261 ALA B CA  1 
ATOM   3388 C  C   . ALA B 1 81  ? 90.554  35.597  0.641   1.00 27.58  ? 261 ALA B C   1 
ATOM   3389 O  O   . ALA B 1 81  ? 89.424  35.785  0.198   1.00 28.43  ? 261 ALA B O   1 
ATOM   3390 C  CB  . ALA B 1 81  ? 91.666  37.397  1.955   1.00 26.85  ? 261 ALA B CB  1 
ATOM   3391 N  N   . GLN B 1 82  ? 91.501  34.975  -0.051  1.00 27.70  ? 262 GLN B N   1 
ATOM   3392 C  CA  . GLN B 1 82  ? 91.237  34.505  -1.398  1.00 27.80  ? 262 GLN B CA  1 
ATOM   3393 C  C   . GLN B 1 82  ? 90.243  33.346  -1.395  1.00 27.66  ? 262 GLN B C   1 
ATOM   3394 O  O   . GLN B 1 82  ? 89.491  33.168  -2.358  1.00 27.26  ? 262 GLN B O   1 
ATOM   3395 C  CB  . GLN B 1 82  ? 92.549  34.101  -2.079  1.00 27.69  ? 262 GLN B CB  1 
ATOM   3396 C  CG  . GLN B 1 82  ? 92.434  33.853  -3.581  1.00 27.34  ? 262 GLN B CG  1 
ATOM   3397 C  CD  . GLN B 1 82  ? 91.917  32.468  -3.895  1.00 29.14  ? 262 GLN B CD  1 
ATOM   3398 O  OE1 . GLN B 1 82  ? 92.288  31.495  -3.233  1.00 29.90  ? 262 GLN B OE1 1 
ATOM   3399 N  NE2 . GLN B 1 82  ? 91.068  32.364  -4.917  1.00 28.24  ? 262 GLN B NE2 1 
ATOM   3400 N  N   . MET B 1 83  ? 90.229  32.562  -0.319  1.00 26.90  ? 263 MET B N   1 
ATOM   3401 C  CA  . MET B 1 83  ? 89.295  31.440  -0.232  1.00 26.65  ? 263 MET B CA  1 
ATOM   3402 C  C   . MET B 1 83  ? 87.910  31.985  0.128   1.00 26.81  ? 263 MET B C   1 
ATOM   3403 O  O   . MET B 1 83  ? 86.889  31.469  -0.324  1.00 25.70  ? 263 MET B O   1 
ATOM   3404 C  CB  . MET B 1 83  ? 89.754  30.431  0.824   1.00 26.71  ? 263 MET B CB  1 
ATOM   3405 C  CG  . MET B 1 83  ? 88.890  29.167  0.878   1.00 27.40  ? 263 MET B CG  1 
ATOM   3406 S  SD  . MET B 1 83  ? 88.860  28.267  -0.702  1.00 27.83  ? 263 MET B SD  1 
ATOM   3407 C  CE  . MET B 1 83  ? 90.566  27.672  -0.770  1.00 24.85  ? 263 MET B CE  1 
ATOM   3408 N  N   . MET B 1 84  ? 87.888  33.032  0.947   1.00 26.24  ? 264 MET B N   1 
ATOM   3409 C  CA  . MET B 1 84  ? 86.634  33.660  1.337   1.00 27.55  ? 264 MET B CA  1 
ATOM   3410 C  C   . MET B 1 84  ? 86.029  34.235  0.057   1.00 28.13  ? 264 MET B C   1 
ATOM   3411 O  O   . MET B 1 84  ? 84.839  34.067  -0.223  1.00 27.27  ? 264 MET B O   1 
ATOM   3412 C  CB  . MET B 1 84  ? 86.891  34.783  2.350   1.00 27.08  ? 264 MET B CB  1 
ATOM   3413 C  CG  . MET B 1 84  ? 85.624  35.445  2.874   1.00 27.46  ? 264 MET B CG  1 
ATOM   3414 S  SD  . MET B 1 84  ? 84.493  34.277  3.674   1.00 27.99  ? 264 MET B SD  1 
ATOM   3415 C  CE  . MET B 1 84  ? 85.222  34.199  5.326   1.00 26.03  ? 264 MET B CE  1 
ATOM   3416 N  N   . TYR B 1 85  ? 86.872  34.907  -0.721  1.00 28.96  ? 265 TYR B N   1 
ATOM   3417 C  CA  . TYR B 1 85  ? 86.457  35.500  -1.989  1.00 29.78  ? 265 TYR B CA  1 
ATOM   3418 C  C   . TYR B 1 85  ? 85.870  34.396  -2.877  1.00 29.87  ? 265 TYR B C   1 
ATOM   3419 O  O   . TYR B 1 85  ? 84.786  34.558  -3.436  1.00 31.25  ? 265 TYR B O   1 
ATOM   3420 C  CB  . TYR B 1 85  ? 87.674  36.155  -2.656  1.00 31.30  ? 265 TYR B CB  1 
ATOM   3421 C  CG  . TYR B 1 85  ? 87.413  36.865  -3.970  1.00 32.65  ? 265 TYR B CG  1 
ATOM   3422 C  CD1 . TYR B 1 85  ? 86.521  37.938  -4.049  1.00 32.59  ? 265 TYR B CD1 1 
ATOM   3423 C  CD2 . TYR B 1 85  ? 88.110  36.498  -5.124  1.00 32.77  ? 265 TYR B CD2 1 
ATOM   3424 C  CE1 . TYR B 1 85  ? 86.334  38.631  -5.246  1.00 33.49  ? 265 TYR B CE1 1 
ATOM   3425 C  CE2 . TYR B 1 85  ? 87.935  37.180  -6.321  1.00 33.13  ? 265 TYR B CE2 1 
ATOM   3426 C  CZ  . TYR B 1 85  ? 87.049  38.245  -6.379  1.00 34.01  ? 265 TYR B CZ  1 
ATOM   3427 O  OH  . TYR B 1 85  ? 86.886  38.920  -7.567  1.00 34.34  ? 265 TYR B OH  1 
ATOM   3428 N  N   . SER B 1 86  ? 86.578  33.271  -2.990  1.00 28.88  ? 266 SER B N   1 
ATOM   3429 C  CA  . SER B 1 86  ? 86.108  32.141  -3.797  1.00 29.51  ? 266 SER B CA  1 
ATOM   3430 C  C   . SER B 1 86  ? 84.757  31.617  -3.323  1.00 29.82  ? 266 SER B C   1 
ATOM   3431 O  O   . SER B 1 86  ? 83.896  31.282  -4.135  1.00 29.18  ? 266 SER B O   1 
ATOM   3432 C  CB  . SER B 1 86  ? 87.110  30.974  -3.759  1.00 28.76  ? 266 SER B CB  1 
ATOM   3433 O  OG  . SER B 1 86  ? 88.329  31.300  -4.399  1.00 27.55  ? 266 SER B OG  1 
ATOM   3434 N  N   . MET B 1 87  ? 84.574  31.536  -2.009  1.00 31.07  ? 267 MET B N   1 
ATOM   3435 C  CA  . MET B 1 87  ? 83.326  31.024  -1.474  1.00 32.58  ? 267 MET B CA  1 
ATOM   3436 C  C   . MET B 1 87  ? 82.145  31.962  -1.681  1.00 33.35  ? 267 MET B C   1 
ATOM   3437 O  O   . MET B 1 87  ? 81.002  31.514  -1.761  1.00 33.17  ? 267 MET B O   1 
ATOM   3438 C  CB  . MET B 1 87  ? 83.492  30.671  -0.002  1.00 34.40  ? 267 MET B CB  1 
ATOM   3439 C  CG  . MET B 1 87  ? 84.430  29.494  0.209   1.00 37.13  ? 267 MET B CG  1 
ATOM   3440 S  SD  . MET B 1 87  ? 84.348  28.857  1.882   1.00 40.70  ? 267 MET B SD  1 
ATOM   3441 C  CE  . MET B 1 87  ? 82.810  27.906  1.749   1.00 38.95  ? 267 MET B CE  1 
ATOM   3442 N  N   . VAL B 1 88  ? 82.417  33.260  -1.775  1.00 33.56  ? 268 VAL B N   1 
ATOM   3443 C  CA  . VAL B 1 88  ? 81.353  34.222  -2.017  1.00 33.47  ? 268 VAL B CA  1 
ATOM   3444 C  C   . VAL B 1 88  ? 80.696  33.899  -3.360  1.00 33.89  ? 268 VAL B C   1 
ATOM   3445 O  O   . VAL B 1 88  ? 79.471  33.896  -3.477  1.00 34.29  ? 268 VAL B O   1 
ATOM   3446 C  CB  . VAL B 1 88  ? 81.894  35.670  -2.066  1.00 32.96  ? 268 VAL B CB  1 
ATOM   3447 C  CG1 . VAL B 1 88  ? 80.830  36.605  -2.641  1.00 31.94  ? 268 VAL B CG1 1 
ATOM   3448 C  CG2 . VAL B 1 88  ? 82.287  36.120  -0.669  1.00 31.40  ? 268 VAL B CG2 1 
ATOM   3449 N  N   . TRP B 1 89  ? 81.520  33.621  -4.366  1.00 34.35  ? 269 TRP B N   1 
ATOM   3450 C  CA  . TRP B 1 89  ? 81.029  33.303  -5.705  1.00 35.42  ? 269 TRP B CA  1 
ATOM   3451 C  C   . TRP B 1 89  ? 80.460  31.890  -5.785  1.00 36.87  ? 269 TRP B C   1 
ATOM   3452 O  O   . TRP B 1 89  ? 79.330  31.684  -6.239  1.00 37.51  ? 269 TRP B O   1 
ATOM   3453 C  CB  . TRP B 1 89  ? 82.160  33.458  -6.721  1.00 35.88  ? 269 TRP B CB  1 
ATOM   3454 C  CG  . TRP B 1 89  ? 82.714  34.842  -6.751  1.00 37.26  ? 269 TRP B CG  1 
ATOM   3455 C  CD1 . TRP B 1 89  ? 84.004  35.215  -6.509  1.00 37.68  ? 269 TRP B CD1 1 
ATOM   3456 C  CD2 . TRP B 1 89  ? 81.984  36.053  -6.988  1.00 38.10  ? 269 TRP B CD2 1 
ATOM   3457 N  NE1 . TRP B 1 89  ? 84.123  36.584  -6.574  1.00 38.27  ? 269 TRP B NE1 1 
ATOM   3458 C  CE2 . TRP B 1 89  ? 82.898  37.122  -6.865  1.00 38.36  ? 269 TRP B CE2 1 
ATOM   3459 C  CE3 . TRP B 1 89  ? 80.641  36.336  -7.286  1.00 39.58  ? 269 TRP B CE3 1 
ATOM   3460 C  CZ2 . TRP B 1 89  ? 82.515  38.461  -7.033  1.00 39.16  ? 269 TRP B CZ2 1 
ATOM   3461 C  CZ3 . TRP B 1 89  ? 80.259  37.669  -7.451  1.00 39.88  ? 269 TRP B CZ3 1 
ATOM   3462 C  CH2 . TRP B 1 89  ? 81.195  38.714  -7.322  1.00 40.04  ? 269 TRP B CH2 1 
ATOM   3463 N  N   . LEU B 1 90  ? 81.249  30.919  -5.340  1.00 36.68  ? 270 LEU B N   1 
ATOM   3464 C  CA  . LEU B 1 90  ? 80.831  29.528  -5.363  1.00 37.42  ? 270 LEU B CA  1 
ATOM   3465 C  C   . LEU B 1 90  ? 79.477  29.308  -4.690  1.00 37.39  ? 270 LEU B C   1 
ATOM   3466 O  O   . LEU B 1 90  ? 78.636  28.568  -5.203  1.00 36.99  ? 270 LEU B O   1 
ATOM   3467 C  CB  . LEU B 1 90  ? 81.888  28.660  -4.679  1.00 37.60  ? 270 LEU B CB  1 
ATOM   3468 C  CG  . LEU B 1 90  ? 81.507  27.199  -4.433  1.00 38.65  ? 270 LEU B CG  1 
ATOM   3469 C  CD1 . LEU B 1 90  ? 81.278  26.487  -5.762  1.00 38.19  ? 270 LEU B CD1 1 
ATOM   3470 C  CD2 . LEU B 1 90  ? 82.616  26.521  -3.644  1.00 39.11  ? 270 LEU B CD2 1 
ATOM   3471 N  N   . CYS B 1 91  ? 79.269  29.957  -3.548  1.00 37.27  ? 271 CYS B N   1 
ATOM   3472 C  CA  . CYS B 1 91  ? 78.030  29.805  -2.792  1.00 37.39  ? 271 CYS B CA  1 
ATOM   3473 C  C   . CYS B 1 91  ? 77.022  30.940  -3.005  1.00 37.67  ? 271 CYS B C   1 
ATOM   3474 O  O   . CYS B 1 91  ? 75.954  30.942  -2.388  1.00 37.70  ? 271 CYS B O   1 
ATOM   3475 C  CB  . CYS B 1 91  ? 78.342  29.693  -1.291  1.00 37.33  ? 271 CYS B CB  1 
ATOM   3476 S  SG  . CYS B 1 91  ? 79.498  28.367  -0.808  1.00 36.63  ? 271 CYS B SG  1 
ATOM   3477 N  N   . SER B 1 92  ? 77.354  31.898  -3.869  1.00 37.36  ? 272 SER B N   1 
ATOM   3478 C  CA  . SER B 1 92  ? 76.464  33.032  -4.126  1.00 37.59  ? 272 SER B CA  1 
ATOM   3479 C  C   . SER B 1 92  ? 76.092  33.675  -2.794  1.00 36.89  ? 272 SER B C   1 
ATOM   3480 O  O   . SER B 1 92  ? 74.915  33.912  -2.507  1.00 36.02  ? 272 SER B O   1 
ATOM   3481 C  CB  . SER B 1 92  ? 75.191  32.566  -4.845  1.00 37.97  ? 272 SER B CB  1 
ATOM   3482 O  OG  . SER B 1 92  ? 75.495  31.960  -6.091  1.00 40.03  ? 272 SER B OG  1 
ATOM   3483 N  N   . LEU B 1 93  ? 77.104  33.954  -1.981  1.00 36.89  ? 273 LEU B N   1 
ATOM   3484 C  CA  . LEU B 1 93  ? 76.876  34.537  -0.670  1.00 37.54  ? 273 LEU B CA  1 
ATOM   3485 C  C   . LEU B 1 93  ? 76.193  35.899  -0.701  1.00 38.80  ? 273 LEU B C   1 
ATOM   3486 O  O   . LEU B 1 93  ? 75.571  36.299  0.283   1.00 38.26  ? 273 LEU B O   1 
ATOM   3487 C  CB  . LEU B 1 93  ? 78.198  34.616  0.104   1.00 35.98  ? 273 LEU B CB  1 
ATOM   3488 C  CG  . LEU B 1 93  ? 78.798  33.244  0.448   1.00 36.25  ? 273 LEU B CG  1 
ATOM   3489 C  CD1 . LEU B 1 93  ? 79.977  33.413  1.394   1.00 34.23  ? 273 LEU B CD1 1 
ATOM   3490 C  CD2 . LEU B 1 93  ? 77.738  32.361  1.098   1.00 34.41  ? 273 LEU B CD2 1 
ATOM   3491 N  N   . GLN B 1 94  ? 76.287  36.600  -1.827  1.00 40.17  ? 274 GLN B N   1 
ATOM   3492 C  CA  . GLN B 1 94  ? 75.667  37.915  -1.943  1.00 43.02  ? 274 GLN B CA  1 
ATOM   3493 C  C   . GLN B 1 94  ? 74.134  37.857  -2.011  1.00 44.19  ? 274 GLN B C   1 
ATOM   3494 O  O   . GLN B 1 94  ? 73.461  38.889  -1.927  1.00 44.66  ? 274 GLN B O   1 
ATOM   3495 C  CB  . GLN B 1 94  ? 76.251  38.665  -3.147  1.00 43.78  ? 274 GLN B CB  1 
ATOM   3496 C  CG  . GLN B 1 94  ? 77.765  38.869  -3.028  1.00 45.70  ? 274 GLN B CG  1 
ATOM   3497 C  CD  . GLN B 1 94  ? 78.321  39.884  -4.011  1.00 46.99  ? 274 GLN B CD  1 
ATOM   3498 O  OE1 . GLN B 1 94  ? 78.189  39.728  -5.223  1.00 48.08  ? 274 GLN B OE1 1 
ATOM   3499 N  NE2 . GLN B 1 94  ? 78.954  40.935  -3.486  1.00 48.22  ? 274 GLN B NE2 1 
ATOM   3500 N  N   . GLU B 1 95  ? 73.583  36.652  -2.144  1.00 44.77  ? 275 GLU B N   1 
ATOM   3501 C  CA  . GLU B 1 95  ? 72.133  36.482  -2.174  1.00 45.91  ? 275 GLU B CA  1 
ATOM   3502 C  C   . GLU B 1 95  ? 71.656  36.231  -0.749  1.00 45.64  ? 275 GLU B C   1 
ATOM   3503 O  O   . GLU B 1 95  ? 70.507  36.504  -0.413  1.00 46.55  ? 275 GLU B O   1 
ATOM   3504 C  CB  . GLU B 1 95  ? 71.721  35.274  -3.021  1.00 47.54  ? 275 GLU B CB  1 
ATOM   3505 C  CG  . GLU B 1 95  ? 72.311  35.210  -4.415  1.00 50.65  ? 275 GLU B CG  1 
ATOM   3506 C  CD  . GLU B 1 95  ? 71.765  34.033  -5.211  1.00 53.06  ? 275 GLU B CD  1 
ATOM   3507 O  OE1 . GLU B 1 95  ? 71.544  32.954  -4.607  1.00 53.82  ? 275 GLU B OE1 1 
ATOM   3508 O  OE2 . GLU B 1 95  ? 71.569  34.182  -6.439  1.00 54.08  ? 275 GLU B OE2 1 
ATOM   3509 N  N   . LYS B 1 96  ? 72.551  35.714  0.088   1.00 44.58  ? 276 LYS B N   1 
ATOM   3510 C  CA  . LYS B 1 96  ? 72.221  35.388  1.472   1.00 43.56  ? 276 LYS B CA  1 
ATOM   3511 C  C   . LYS B 1 96  ? 72.668  36.440  2.478   1.00 42.15  ? 276 LYS B C   1 
ATOM   3512 O  O   . LYS B 1 96  ? 72.023  36.644  3.507   1.00 42.17  ? 276 LYS B O   1 
ATOM   3513 C  CB  . LYS B 1 96  ? 72.877  34.059  1.852   1.00 44.90  ? 276 LYS B CB  1 
ATOM   3514 C  CG  . LYS B 1 96  ? 72.635  32.923  0.874   1.00 47.00  ? 276 LYS B CG  1 
ATOM   3515 C  CD  . LYS B 1 96  ? 71.202  32.441  0.931   1.00 48.72  ? 276 LYS B CD  1 
ATOM   3516 C  CE  . LYS B 1 96  ? 71.004  31.221  0.044   1.00 50.20  ? 276 LYS B CE  1 
ATOM   3517 N  NZ  . LYS B 1 96  ? 69.611  30.705  0.139   1.00 50.91  ? 276 LYS B NZ  1 
ATOM   3518 N  N   . PHE B 1 97  ? 73.779  37.100  2.179   1.00 40.24  ? 277 PHE B N   1 
ATOM   3519 C  CA  . PHE B 1 97  ? 74.338  38.097  3.080   1.00 38.67  ? 277 PHE B CA  1 
ATOM   3520 C  C   . PHE B 1 97  ? 74.272  39.531  2.577   1.00 36.68  ? 277 PHE B C   1 
ATOM   3521 O  O   . PHE B 1 97  ? 74.344  39.792  1.376   1.00 35.86  ? 277 PHE B O   1 
ATOM   3522 C  CB  . PHE B 1 97  ? 75.804  37.749  3.375   1.00 39.37  ? 277 PHE B CB  1 
ATOM   3523 C  CG  . PHE B 1 97  ? 75.985  36.496  4.184   1.00 39.91  ? 277 PHE B CG  1 
ATOM   3524 C  CD1 . PHE B 1 97  ? 75.784  36.508  5.564   1.00 40.82  ? 277 PHE B CD1 1 
ATOM   3525 C  CD2 . PHE B 1 97  ? 76.354  35.305  3.569   1.00 40.47  ? 277 PHE B CD2 1 
ATOM   3526 C  CE1 . PHE B 1 97  ? 75.950  35.346  6.320   1.00 41.32  ? 277 PHE B CE1 1 
ATOM   3527 C  CE2 . PHE B 1 97  ? 76.522  34.136  4.312   1.00 40.99  ? 277 PHE B CE2 1 
ATOM   3528 C  CZ  . PHE B 1 97  ? 76.320  34.155  5.691   1.00 41.48  ? 277 PHE B CZ  1 
ATOM   3529 N  N   . SER B 1 98  ? 74.152  40.460  3.518   1.00 34.76  ? 278 SER B N   1 
ATOM   3530 C  CA  . SER B 1 98  ? 74.117  41.879  3.199   1.00 33.99  ? 278 SER B CA  1 
ATOM   3531 C  C   . SER B 1 98  ? 75.554  42.269  2.861   1.00 32.62  ? 278 SER B C   1 
ATOM   3532 O  O   . SER B 1 98  ? 76.481  41.502  3.127   1.00 31.76  ? 278 SER B O   1 
ATOM   3533 C  CB  . SER B 1 98  ? 73.652  42.682  4.411   1.00 33.14  ? 278 SER B CB  1 
ATOM   3534 O  OG  . SER B 1 98  ? 74.604  42.590  5.457   1.00 35.50  ? 278 SER B OG  1 
ATOM   3535 N  N   . GLN B 1 99  ? 75.745  43.455  2.290   1.00 31.61  ? 279 GLN B N   1 
ATOM   3536 C  CA  . GLN B 1 99  ? 77.090  43.907  1.940   1.00 30.20  ? 279 GLN B CA  1 
ATOM   3537 C  C   . GLN B 1 99  ? 77.908  44.127  3.209   1.00 29.91  ? 279 GLN B C   1 
ATOM   3538 O  O   . GLN B 1 99  ? 79.120  43.927  3.228   1.00 29.26  ? 279 GLN B O   1 
ATOM   3539 C  CB  . GLN B 1 99  ? 77.020  45.200  1.125   1.00 29.62  ? 279 GLN B CB  1 
ATOM   3540 C  CG  . GLN B 1 99  ? 76.586  45.012  -0.326  1.00 28.87  ? 279 GLN B CG  1 
ATOM   3541 C  CD  . GLN B 1 99  ? 77.616  44.252  -1.153  1.00 28.12  ? 279 GLN B CD  1 
ATOM   3542 O  OE1 . GLN B 1 99  ? 77.737  43.029  -1.056  1.00 27.91  ? 279 GLN B OE1 1 
ATOM   3543 N  NE2 . GLN B 1 99  ? 78.370  44.981  -1.961  1.00 25.24  ? 279 GLN B NE2 1 
ATOM   3544 N  N   . THR B 1 100 ? 77.240  44.542  4.276   1.00 29.89  ? 280 THR B N   1 
ATOM   3545 C  CA  . THR B 1 100 ? 77.923  44.759  5.540   1.00 29.75  ? 280 THR B CA  1 
ATOM   3546 C  C   . THR B 1 100 ? 78.537  43.434  6.015   1.00 29.29  ? 280 THR B C   1 
ATOM   3547 O  O   . THR B 1 100 ? 79.654  43.415  6.526   1.00 28.89  ? 280 THR B O   1 
ATOM   3548 C  CB  . THR B 1 100 ? 76.948  45.307  6.603   1.00 30.36  ? 280 THR B CB  1 
ATOM   3549 O  OG1 . THR B 1 100 ? 76.398  46.544  6.140   1.00 31.26  ? 280 THR B OG1 1 
ATOM   3550 C  CG2 . THR B 1 100 ? 77.661  45.551  7.923   1.00 30.78  ? 280 THR B CG2 1 
ATOM   3551 N  N   . ASP B 1 101 ? 77.815  42.329  5.832   1.00 29.48  ? 281 ASP B N   1 
ATOM   3552 C  CA  . ASP B 1 101 ? 78.325  41.016  6.237   1.00 28.97  ? 281 ASP B CA  1 
ATOM   3553 C  C   . ASP B 1 101 ? 79.490  40.572  5.361   1.00 27.85  ? 281 ASP B C   1 
ATOM   3554 O  O   . ASP B 1 101 ? 80.441  39.965  5.850   1.00 27.05  ? 281 ASP B O   1 
ATOM   3555 C  CB  . ASP B 1 101 ? 77.227  39.948  6.187   1.00 30.11  ? 281 ASP B CB  1 
ATOM   3556 C  CG  . ASP B 1 101 ? 76.377  39.920  7.445   1.00 32.43  ? 281 ASP B CG  1 
ATOM   3557 O  OD1 . ASP B 1 101 ? 76.878  40.314  8.522   1.00 33.64  ? 281 ASP B OD1 1 
ATOM   3558 O  OD2 . ASP B 1 101 ? 75.214  39.480  7.361   1.00 34.30  ? 281 ASP B OD2 1 
ATOM   3559 N  N   . ILE B 1 102 ? 79.410  40.866  4.067   1.00 27.14  ? 282 ILE B N   1 
ATOM   3560 C  CA  . ILE B 1 102 ? 80.479  40.506  3.143   1.00 26.90  ? 282 ILE B CA  1 
ATOM   3561 C  C   . ILE B 1 102 ? 81.743  41.277  3.544   1.00 27.12  ? 282 ILE B C   1 
ATOM   3562 O  O   . ILE B 1 102 ? 82.856  40.748  3.471   1.00 26.12  ? 282 ILE B O   1 
ATOM   3563 C  CB  . ILE B 1 102 ? 80.106  40.863  1.671   1.00 27.34  ? 282 ILE B CB  1 
ATOM   3564 C  CG1 . ILE B 1 102 ? 78.908  40.025  1.210   1.00 27.37  ? 282 ILE B CG1 1 
ATOM   3565 C  CG2 . ILE B 1 102 ? 81.299  40.615  0.743   1.00 26.83  ? 282 ILE B CG2 1 
ATOM   3566 C  CD1 . ILE B 1 102 ? 79.161  38.528  1.214   1.00 26.98  ? 282 ILE B CD1 1 
ATOM   3567 N  N   . LEU B 1 103 ? 81.551  42.527  3.966   1.00 25.84  ? 283 LEU B N   1 
ATOM   3568 C  CA  . LEU B 1 103 ? 82.649  43.389  4.389   1.00 26.15  ? 283 LEU B CA  1 
ATOM   3569 C  C   . LEU B 1 103 ? 83.286  42.818  5.656   1.00 25.97  ? 283 LEU B C   1 
ATOM   3570 O  O   . LEU B 1 103 ? 84.512  42.809  5.805   1.00 25.17  ? 283 LEU B O   1 
ATOM   3571 C  CB  . LEU B 1 103 ? 82.129  44.810  4.656   1.00 25.77  ? 283 LEU B CB  1 
ATOM   3572 C  CG  . LEU B 1 103 ? 83.129  45.865  5.140   1.00 25.80  ? 283 LEU B CG  1 
ATOM   3573 C  CD1 . LEU B 1 103 ? 84.189  46.097  4.083   1.00 25.74  ? 283 LEU B CD1 1 
ATOM   3574 C  CD2 . LEU B 1 103 ? 82.399  47.167  5.449   1.00 25.21  ? 283 LEU B CD2 1 
ATOM   3575 N  N   . ILE B 1 104 ? 82.442  42.345  6.568   1.00 25.83  ? 284 ILE B N   1 
ATOM   3576 C  CA  . ILE B 1 104 ? 82.917  41.760  7.815   1.00 25.18  ? 284 ILE B CA  1 
ATOM   3577 C  C   . ILE B 1 104 ? 83.746  40.507  7.508   1.00 24.34  ? 284 ILE B C   1 
ATOM   3578 O  O   . ILE B 1 104 ? 84.880  40.376  7.967   1.00 23.63  ? 284 ILE B O   1 
ATOM   3579 C  CB  . ILE B 1 104 ? 81.724  41.399  8.743   1.00 25.11  ? 284 ILE B CB  1 
ATOM   3580 C  CG1 . ILE B 1 104 ? 81.065  42.691  9.249   1.00 25.07  ? 284 ILE B CG1 1 
ATOM   3581 C  CG2 . ILE B 1 104 ? 82.197  40.532  9.911   1.00 24.81  ? 284 ILE B CG2 1 
ATOM   3582 C  CD1 . ILE B 1 104 ? 79.843  42.483  10.121  1.00 23.01  ? 284 ILE B CD1 1 
ATOM   3583 N  N   . LEU B 1 105 ? 83.181  39.607  6.710   1.00 23.57  ? 285 LEU B N   1 
ATOM   3584 C  CA  . LEU B 1 105 ? 83.849  38.368  6.333   1.00 23.85  ? 285 LEU B CA  1 
ATOM   3585 C  C   . LEU B 1 105 ? 85.206  38.602  5.692   1.00 24.50  ? 285 LEU B C   1 
ATOM   3586 O  O   . LEU B 1 105 ? 86.209  38.012  6.099   1.00 24.72  ? 285 LEU B O   1 
ATOM   3587 C  CB  . LEU B 1 105 ? 82.971  37.578  5.365   1.00 23.61  ? 285 LEU B CB  1 
ATOM   3588 C  CG  . LEU B 1 105 ? 81.798  36.839  6.006   1.00 24.31  ? 285 LEU B CG  1 
ATOM   3589 C  CD1 . LEU B 1 105 ? 80.746  36.535  4.959   1.00 22.84  ? 285 LEU B CD1 1 
ATOM   3590 C  CD2 . LEU B 1 105 ? 82.312  35.557  6.674   1.00 22.84  ? 285 LEU B CD2 1 
ATOM   3591 N  N   . MET B 1 106 ? 85.235  39.469  4.685   1.00 24.72  ? 286 MET B N   1 
ATOM   3592 C  CA  . MET B 1 106 ? 86.471  39.763  3.976   1.00 25.08  ? 286 MET B CA  1 
ATOM   3593 C  C   . MET B 1 106 ? 87.539  40.446  4.832   1.00 25.12  ? 286 MET B C   1 
ATOM   3594 O  O   . MET B 1 106 ? 88.705  40.036  4.838   1.00 24.82  ? 286 MET B O   1 
ATOM   3595 C  CB  . MET B 1 106 ? 86.177  40.626  2.739   1.00 24.95  ? 286 MET B CB  1 
ATOM   3596 C  CG  . MET B 1 106 ? 85.475  39.885  1.595   1.00 24.49  ? 286 MET B CG  1 
ATOM   3597 S  SD  . MET B 1 106 ? 86.380  38.411  0.974   1.00 23.76  ? 286 MET B SD  1 
ATOM   3598 C  CE  . MET B 1 106 ? 87.865  39.131  0.415   1.00 20.87  ? 286 MET B CE  1 
ATOM   3599 N  N   . THR B 1 107 ? 87.142  41.487  5.554   1.00 24.19  ? 287 THR B N   1 
ATOM   3600 C  CA  . THR B 1 107 ? 88.084  42.225  6.377   1.00 23.49  ? 287 THR B CA  1 
ATOM   3601 C  C   . THR B 1 107 ? 88.614  41.352  7.514   1.00 23.45  ? 287 THR B C   1 
ATOM   3602 O  O   . THR B 1 107 ? 89.806  41.401  7.841   1.00 23.45  ? 287 THR B O   1 
ATOM   3603 C  CB  . THR B 1 107 ? 87.424  43.514  6.925   1.00 23.35  ? 287 THR B CB  1 
ATOM   3604 O  OG1 . THR B 1 107 ? 86.773  44.201  5.845   1.00 23.79  ? 287 THR B OG1 1 
ATOM   3605 C  CG2 . THR B 1 107 ? 88.472  44.445  7.520   1.00 21.79  ? 287 THR B CG2 1 
ATOM   3606 N  N   . ALA B 1 108 ? 87.738  40.541  8.103   1.00 22.61  ? 288 ALA B N   1 
ATOM   3607 C  CA  . ALA B 1 108 ? 88.150  39.649  9.186   1.00 22.09  ? 288 ALA B CA  1 
ATOM   3608 C  C   . ALA B 1 108 ? 89.130  38.621  8.636   1.00 21.74  ? 288 ALA B C   1 
ATOM   3609 O  O   . ALA B 1 108 ? 90.126  38.296  9.280   1.00 19.91  ? 288 ALA B O   1 
ATOM   3610 C  CB  . ALA B 1 108 ? 86.941  38.938  9.788   1.00 21.92  ? 288 ALA B CB  1 
ATOM   3611 N  N   . ALA B 1 109 ? 88.845  38.114  7.438   1.00 22.09  ? 289 ALA B N   1 
ATOM   3612 C  CA  . ALA B 1 109 ? 89.713  37.118  6.821   1.00 22.82  ? 289 ALA B CA  1 
ATOM   3613 C  C   . ALA B 1 109 ? 91.116  37.684  6.637   1.00 23.56  ? 289 ALA B C   1 
ATOM   3614 O  O   . ALA B 1 109 ? 92.109  37.023  6.936   1.00 24.06  ? 289 ALA B O   1 
ATOM   3615 C  CB  . ALA B 1 109 ? 89.141  36.680  5.475   1.00 22.41  ? 289 ALA B CB  1 
ATOM   3616 N  N   . ILE B 1 110 ? 91.190  38.918  6.152   1.00 23.77  ? 290 ILE B N   1 
ATOM   3617 C  CA  . ILE B 1 110 ? 92.472  39.566  5.920   1.00 23.97  ? 290 ILE B CA  1 
ATOM   3618 C  C   . ILE B 1 110 ? 93.234  39.828  7.213   1.00 25.08  ? 290 ILE B C   1 
ATOM   3619 O  O   . ILE B 1 110 ? 94.451  39.645  7.276   1.00 25.36  ? 290 ILE B O   1 
ATOM   3620 C  CB  . ILE B 1 110 ? 92.279  40.906  5.174   1.00 22.76  ? 290 ILE B CB  1 
ATOM   3621 C  CG1 . ILE B 1 110 ? 91.872  40.634  3.728   1.00 22.72  ? 290 ILE B CG1 1 
ATOM   3622 C  CG2 . ILE B 1 110 ? 93.557  41.721  5.203   1.00 22.97  ? 290 ILE B CG2 1 
ATOM   3623 C  CD1 . ILE B 1 110 ? 91.512  41.874  2.957   1.00 22.05  ? 290 ILE B CD1 1 
ATOM   3624 N  N   . CYS B 1 111 ? 92.508  40.233  8.248   1.00 25.42  ? 291 CYS B N   1 
ATOM   3625 C  CA  . CYS B 1 111 ? 93.115  40.565  9.527   1.00 26.14  ? 291 CYS B CA  1 
ATOM   3626 C  C   . CYS B 1 111 ? 93.242  39.462  10.577  1.00 26.93  ? 291 CYS B C   1 
ATOM   3627 O  O   . CYS B 1 111 ? 93.933  39.655  11.578  1.00 25.99  ? 291 CYS B O   1 
ATOM   3628 C  CB  . CYS B 1 111 ? 92.343  41.725  10.161  1.00 26.76  ? 291 CYS B CB  1 
ATOM   3629 S  SG  . CYS B 1 111 ? 92.210  43.206  9.140   1.00 27.03  ? 291 CYS B SG  1 
ATOM   3630 N  N   . HIS B 1 112 ? 92.611  38.311  10.357  1.00 26.96  ? 292 HIS B N   1 
ATOM   3631 C  CA  . HIS B 1 112 ? 92.612  37.248  11.372  1.00 27.43  ? 292 HIS B CA  1 
ATOM   3632 C  C   . HIS B 1 112 ? 93.926  36.776  12.032  1.00 26.26  ? 292 HIS B C   1 
ATOM   3633 O  O   . HIS B 1 112 ? 93.887  36.271  13.149  1.00 25.66  ? 292 HIS B O   1 
ATOM   3634 C  CB  . HIS B 1 112 ? 91.830  36.026  10.855  1.00 28.34  ? 292 HIS B CB  1 
ATOM   3635 C  CG  . HIS B 1 112 ? 92.686  35.004  10.182  1.00 31.31  ? 292 HIS B CG  1 
ATOM   3636 N  ND1 . HIS B 1 112 ? 93.125  35.136  8.883   1.00 32.03  ? 292 HIS B ND1 1 
ATOM   3637 C  CD2 . HIS B 1 112 ? 93.240  33.862  10.655  1.00 32.50  ? 292 HIS B CD2 1 
ATOM   3638 C  CE1 . HIS B 1 112 ? 93.917  34.122  8.585   1.00 33.85  ? 292 HIS B CE1 1 
ATOM   3639 N  NE2 . HIS B 1 112 ? 94.006  33.333  9.643   1.00 35.30  ? 292 HIS B NE2 1 
ATOM   3640 N  N   . ASP B 1 113 ? 95.074  36.921  11.377  1.00 25.90  ? 293 ASP B N   1 
ATOM   3641 C  CA  . ASP B 1 113 ? 96.340  36.485  11.986  1.00 26.04  ? 293 ASP B CA  1 
ATOM   3642 C  C   . ASP B 1 113 ? 97.399  37.579  12.100  1.00 26.00  ? 293 ASP B C   1 
ATOM   3643 O  O   . ASP B 1 113 ? 98.604  37.296  12.115  1.00 26.25  ? 293 ASP B O   1 
ATOM   3644 C  CB  . ASP B 1 113 ? 96.943  35.297  11.219  1.00 25.77  ? 293 ASP B CB  1 
ATOM   3645 C  CG  . ASP B 1 113 ? 96.406  33.955  11.699  1.00 26.87  ? 293 ASP B CG  1 
ATOM   3646 O  OD1 . ASP B 1 113 ? 96.052  33.843  12.889  1.00 28.08  ? 293 ASP B OD1 1 
ATOM   3647 O  OD2 . ASP B 1 113 ? 96.348  33.005  10.892  1.00 30.08  ? 293 ASP B OD2 1 
ATOM   3648 N  N   . LEU B 1 114 ? 96.955  38.826  12.193  1.00 25.24  ? 294 LEU B N   1 
ATOM   3649 C  CA  . LEU B 1 114 ? 97.882  39.947  12.284  1.00 25.69  ? 294 LEU B CA  1 
ATOM   3650 C  C   . LEU B 1 114 ? 98.905  39.812  13.404  1.00 25.69  ? 294 LEU B C   1 
ATOM   3651 O  O   . LEU B 1 114 ? 98.569  39.459  14.535  1.00 25.64  ? 294 LEU B O   1 
ATOM   3652 C  CB  . LEU B 1 114 ? 97.106  41.257  12.450  1.00 25.38  ? 294 LEU B CB  1 
ATOM   3653 C  CG  . LEU B 1 114 ? 96.595  41.873  11.142  1.00 24.94  ? 294 LEU B CG  1 
ATOM   3654 C  CD1 . LEU B 1 114 ? 95.496  42.889  11.427  1.00 24.39  ? 294 LEU B CD1 1 
ATOM   3655 C  CD2 . LEU B 1 114 ? 97.775  42.516  10.411  1.00 25.21  ? 294 LEU B CD2 1 
ATOM   3656 N  N   . ASP B 1 115 ? 100.159 40.087  13.068  1.00 24.57  ? 295 ASP B N   1 
ATOM   3657 C  CA  . ASP B 1 115 ? 101.256 40.037  14.025  1.00 25.32  ? 295 ASP B CA  1 
ATOM   3658 C  C   . ASP B 1 115 ? 101.351 38.733  14.828  1.00 25.71  ? 295 ASP B C   1 
ATOM   3659 O  O   . ASP B 1 115 ? 101.664 38.747  16.014  1.00 25.60  ? 295 ASP B O   1 
ATOM   3660 C  CB  . ASP B 1 115 ? 101.154 41.235  14.977  1.00 23.96  ? 295 ASP B CB  1 
ATOM   3661 C  CG  . ASP B 1 115 ? 102.448 41.507  15.716  1.00 23.38  ? 295 ASP B CG  1 
ATOM   3662 O  OD1 . ASP B 1 115 ? 103.514 41.513  15.072  1.00 25.77  ? 295 ASP B OD1 1 
ATOM   3663 O  OD2 . ASP B 1 115 ? 102.408 41.729  16.939  1.00 24.70  ? 295 ASP B OD2 1 
ATOM   3664 N  N   . HIS B 1 116 ? 101.080 37.611  14.174  1.00 27.02  ? 296 HIS B N   1 
ATOM   3665 C  CA  . HIS B 1 116 ? 101.164 36.305  14.818  1.00 27.71  ? 296 HIS B CA  1 
ATOM   3666 C  C   . HIS B 1 116 ? 102.640 36.092  15.185  1.00 27.93  ? 296 HIS B C   1 
ATOM   3667 O  O   . HIS B 1 116 ? 103.523 36.301  14.358  1.00 28.80  ? 296 HIS B O   1 
ATOM   3668 C  CB  . HIS B 1 116 ? 100.694 35.235  13.834  1.00 26.89  ? 296 HIS B CB  1 
ATOM   3669 C  CG  . HIS B 1 116 ? 100.438 33.897  14.455  1.00 27.42  ? 296 HIS B CG  1 
ATOM   3670 N  ND1 . HIS B 1 116 ? 101.430 33.151  15.056  1.00 26.64  ? 296 HIS B ND1 1 
ATOM   3671 C  CD2 . HIS B 1 116 ? 99.308  33.153  14.531  1.00 26.54  ? 296 HIS B CD2 1 
ATOM   3672 C  CE1 . HIS B 1 116 ? 100.922 32.003  15.472  1.00 26.63  ? 296 HIS B CE1 1 
ATOM   3673 N  NE2 . HIS B 1 116 ? 99.636  31.980  15.165  1.00 26.38  ? 296 HIS B NE2 1 
ATOM   3674 N  N   . PRO B 1 117 ? 102.927 35.670  16.427  1.00 28.64  ? 297 PRO B N   1 
ATOM   3675 C  CA  . PRO B 1 117 ? 104.318 35.452  16.850  1.00 28.95  ? 297 PRO B CA  1 
ATOM   3676 C  C   . PRO B 1 117 ? 104.996 34.153  16.393  1.00 29.88  ? 297 PRO B C   1 
ATOM   3677 O  O   . PRO B 1 117 ? 106.213 34.014  16.514  1.00 30.14  ? 297 PRO B O   1 
ATOM   3678 C  CB  . PRO B 1 117 ? 104.223 35.540  18.368  1.00 28.12  ? 297 PRO B CB  1 
ATOM   3679 C  CG  . PRO B 1 117 ? 102.903 34.902  18.632  1.00 28.70  ? 297 PRO B CG  1 
ATOM   3680 C  CD  . PRO B 1 117 ? 102.002 35.490  17.561  1.00 28.27  ? 297 PRO B CD  1 
ATOM   3681 N  N   . GLY B 1 118 ? 104.221 33.203  15.881  1.00 30.11  ? 298 GLY B N   1 
ATOM   3682 C  CA  . GLY B 1 118 ? 104.811 31.952  15.443  1.00 31.45  ? 298 GLY B CA  1 
ATOM   3683 C  C   . GLY B 1 118 ? 104.799 30.867  16.512  1.00 32.23  ? 298 GLY B C   1 
ATOM   3684 O  O   . GLY B 1 118 ? 105.415 29.815  16.338  1.00 33.09  ? 298 GLY B O   1 
ATOM   3685 N  N   . TYR B 1 119 ? 104.113 31.135  17.621  1.00 31.93  ? 299 TYR B N   1 
ATOM   3686 C  CA  . TYR B 1 119 ? 103.983 30.189  18.731  1.00 31.41  ? 299 TYR B CA  1 
ATOM   3687 C  C   . TYR B 1 119 ? 102.529 30.284  19.173  1.00 30.76  ? 299 TYR B C   1 
ATOM   3688 O  O   . TYR B 1 119 ? 102.022 31.386  19.403  1.00 30.82  ? 299 TYR B O   1 
ATOM   3689 C  CB  . TYR B 1 119 ? 104.923 30.566  19.876  1.00 32.49  ? 299 TYR B CB  1 
ATOM   3690 C  CG  . TYR B 1 119 ? 106.373 30.573  19.467  1.00 35.11  ? 299 TYR B CG  1 
ATOM   3691 C  CD1 . TYR B 1 119 ? 106.905 31.638  18.734  1.00 36.63  ? 299 TYR B CD1 1 
ATOM   3692 C  CD2 . TYR B 1 119 ? 107.204 29.488  19.756  1.00 35.73  ? 299 TYR B CD2 1 
ATOM   3693 C  CE1 . TYR B 1 119 ? 108.230 31.620  18.294  1.00 36.62  ? 299 TYR B CE1 1 
ATOM   3694 C  CE2 . TYR B 1 119 ? 108.529 29.458  19.320  1.00 36.51  ? 299 TYR B CE2 1 
ATOM   3695 C  CZ  . TYR B 1 119 ? 109.035 30.525  18.590  1.00 38.07  ? 299 TYR B CZ  1 
ATOM   3696 O  OH  . TYR B 1 119 ? 110.341 30.495  18.147  1.00 38.98  ? 299 TYR B OH  1 
ATOM   3697 N  N   . ASN B 1 120 ? 101.861 29.140  19.303  1.00 29.02  ? 300 ASN B N   1 
ATOM   3698 C  CA  . ASN B 1 120 ? 100.442 29.138  19.644  1.00 27.41  ? 300 ASN B CA  1 
ATOM   3699 C  C   . ASN B 1 120 ? 100.063 29.568  21.056  1.00 26.89  ? 300 ASN B C   1 
ATOM   3700 O  O   . ASN B 1 120 ? 100.925 29.843  21.892  1.00 26.67  ? 300 ASN B O   1 
ATOM   3701 C  CB  . ASN B 1 120 ? 99.817  27.772  19.293  1.00 26.04  ? 300 ASN B CB  1 
ATOM   3702 C  CG  . ASN B 1 120 ? 100.123 26.690  20.312  1.00 26.34  ? 300 ASN B CG  1 
ATOM   3703 O  OD1 . ASN B 1 120 ? 100.793 26.922  21.317  1.00 27.52  ? 300 ASN B OD1 1 
ATOM   3704 N  ND2 . ASN B 1 120 ? 99.614  25.493  20.056  1.00 26.00  ? 300 ASN B ND2 1 
ATOM   3705 N  N   . ASN B 1 121 ? 98.760  29.645  21.308  1.00 26.54  ? 301 ASN B N   1 
ATOM   3706 C  CA  . ASN B 1 121 ? 98.251  30.074  22.607  1.00 26.34  ? 301 ASN B CA  1 
ATOM   3707 C  C   . ASN B 1 121 ? 98.796  29.263  23.777  1.00 27.43  ? 301 ASN B C   1 
ATOM   3708 O  O   . ASN B 1 121 ? 99.128  29.818  24.826  1.00 27.81  ? 301 ASN B O   1 
ATOM   3709 C  CB  . ASN B 1 121 ? 96.717  30.027  22.622  1.00 24.84  ? 301 ASN B CB  1 
ATOM   3710 C  CG  . ASN B 1 121 ? 96.089  31.142  21.793  1.00 24.66  ? 301 ASN B CG  1 
ATOM   3711 O  OD1 . ASN B 1 121 ? 96.532  32.294  21.847  1.00 26.09  ? 301 ASN B OD1 1 
ATOM   3712 N  ND2 . ASN B 1 121 ? 95.044  30.809  21.037  1.00 20.11  ? 301 ASN B ND2 1 
ATOM   3713 N  N   . THR B 1 122 ? 98.886  27.951  23.599  1.00 27.11  ? 302 THR B N   1 
ATOM   3714 C  CA  . THR B 1 122 ? 99.383  27.086  24.657  1.00 27.47  ? 302 THR B CA  1 
ATOM   3715 C  C   . THR B 1 122 ? 100.776 27.525  25.089  1.00 27.26  ? 302 THR B C   1 
ATOM   3716 O  O   . THR B 1 122 ? 101.096 27.534  26.278  1.00 27.79  ? 302 THR B O   1 
ATOM   3717 C  CB  . THR B 1 122 ? 99.406  25.626  24.189  1.00 27.57  ? 302 THR B CB  1 
ATOM   3718 O  OG1 . THR B 1 122 ? 98.082  25.252  23.792  1.00 26.91  ? 302 THR B OG1 1 
ATOM   3719 C  CG2 . THR B 1 122 ? 99.869  24.706  25.307  1.00 26.68  ? 302 THR B CG2 1 
ATOM   3720 N  N   . TYR B 1 123 ? 101.608 27.893  24.126  1.00 27.69  ? 303 TYR B N   1 
ATOM   3721 C  CA  . TYR B 1 123 ? 102.945 28.353  24.458  1.00 27.97  ? 303 TYR B CA  1 
ATOM   3722 C  C   . TYR B 1 123 ? 102.864 29.679  25.223  1.00 28.08  ? 303 TYR B C   1 
ATOM   3723 O  O   . TYR B 1 123 ? 103.549 29.859  26.232  1.00 27.69  ? 303 TYR B O   1 
ATOM   3724 C  CB  . TYR B 1 123 ? 103.789 28.565  23.202  1.00 28.44  ? 303 TYR B CB  1 
ATOM   3725 C  CG  . TYR B 1 123 ? 105.151 29.121  23.555  1.00 30.53  ? 303 TYR B CG  1 
ATOM   3726 C  CD1 . TYR B 1 123 ? 106.180 28.277  23.973  1.00 30.04  ? 303 TYR B CD1 1 
ATOM   3727 C  CD2 . TYR B 1 123 ? 105.372 30.499  23.596  1.00 30.03  ? 303 TYR B CD2 1 
ATOM   3728 C  CE1 . TYR B 1 123 ? 107.385 28.792  24.435  1.00 31.56  ? 303 TYR B CE1 1 
ATOM   3729 C  CE2 . TYR B 1 123 ? 106.574 31.025  24.057  1.00 31.01  ? 303 TYR B CE2 1 
ATOM   3730 C  CZ  . TYR B 1 123 ? 107.575 30.168  24.479  1.00 31.23  ? 303 TYR B CZ  1 
ATOM   3731 O  OH  . TYR B 1 123 ? 108.749 30.684  24.977  1.00 30.93  ? 303 TYR B OH  1 
ATOM   3732 N  N   . GLN B 1 124 ? 102.038 30.606  24.736  1.00 26.62  ? 304 GLN B N   1 
ATOM   3733 C  CA  . GLN B 1 124 ? 101.893 31.905  25.388  1.00 26.95  ? 304 GLN B CA  1 
ATOM   3734 C  C   . GLN B 1 124 ? 101.496 31.692  26.838  1.00 26.42  ? 304 GLN B C   1 
ATOM   3735 O  O   . GLN B 1 124 ? 102.036 32.320  27.746  1.00 26.04  ? 304 GLN B O   1 
ATOM   3736 C  CB  . GLN B 1 124 ? 100.814 32.749  24.699  1.00 26.57  ? 304 GLN B CB  1 
ATOM   3737 C  CG  . GLN B 1 124 ? 100.994 32.888  23.198  1.00 28.01  ? 304 GLN B CG  1 
ATOM   3738 C  CD  . GLN B 1 124 ? 102.269 33.616  22.823  1.00 27.90  ? 304 GLN B CD  1 
ATOM   3739 O  OE1 . GLN B 1 124 ? 102.925 33.280  21.833  1.00 29.89  ? 304 GLN B OE1 1 
ATOM   3740 N  NE2 . GLN B 1 124 ? 102.621 34.624  23.603  1.00 28.79  ? 304 GLN B NE2 1 
ATOM   3741 N  N   . ILE B 1 125 ? 100.552 30.785  27.048  1.00 25.93  ? 305 ILE B N   1 
ATOM   3742 C  CA  . ILE B 1 125 ? 100.067 30.510  28.383  1.00 26.14  ? 305 ILE B CA  1 
ATOM   3743 C  C   . ILE B 1 125 ? 101.094 29.800  29.260  1.00 26.71  ? 305 ILE B C   1 
ATOM   3744 O  O   . ILE B 1 125 ? 101.369 30.243  30.374  1.00 26.73  ? 305 ILE B O   1 
ATOM   3745 C  CB  . ILE B 1 125 ? 98.754  29.703  28.318  1.00 25.45  ? 305 ILE B CB  1 
ATOM   3746 C  CG1 . ILE B 1 125 ? 97.673  30.547  27.631  1.00 25.36  ? 305 ILE B CG1 1 
ATOM   3747 C  CG2 . ILE B 1 125 ? 98.306  29.321  29.716  1.00 25.89  ? 305 ILE B CG2 1 
ATOM   3748 C  CD1 . ILE B 1 125 ? 96.383  29.804  27.333  1.00 25.04  ? 305 ILE B CD1 1 
ATOM   3749 N  N   . ASN B 1 126 ? 101.681 28.716  28.766  1.00 26.87  ? 306 ASN B N   1 
ATOM   3750 C  CA  . ASN B 1 126 ? 102.666 27.998  29.570  1.00 28.07  ? 306 ASN B CA  1 
ATOM   3751 C  C   . ASN B 1 126 ? 103.909 28.827  29.862  1.00 28.26  ? 306 ASN B C   1 
ATOM   3752 O  O   . ASN B 1 126 ? 104.464 28.745  30.956  1.00 28.77  ? 306 ASN B O   1 
ATOM   3753 C  CB  . ASN B 1 126 ? 103.069 26.684  28.894  1.00 28.59  ? 306 ASN B CB  1 
ATOM   3754 C  CG  . ASN B 1 126 ? 101.943 25.686  28.872  1.00 28.75  ? 306 ASN B CG  1 
ATOM   3755 O  OD1 . ASN B 1 126 ? 100.951 25.848  29.580  1.00 30.60  ? 306 ASN B OD1 1 
ATOM   3756 N  ND2 . ASN B 1 126 ? 102.088 24.640  28.070  1.00 28.82  ? 306 ASN B ND2 1 
ATOM   3757 N  N   . ALA B 1 127 ? 104.346 29.623  28.889  1.00 28.01  ? 307 ALA B N   1 
ATOM   3758 C  CA  . ALA B 1 127 ? 105.527 30.459  29.076  1.00 28.60  ? 307 ALA B CA  1 
ATOM   3759 C  C   . ALA B 1 127 ? 105.161 31.753  29.804  1.00 29.55  ? 307 ALA B C   1 
ATOM   3760 O  O   . ALA B 1 127 ? 106.036 32.557  30.136  1.00 29.43  ? 307 ALA B O   1 
ATOM   3761 C  CB  . ALA B 1 127 ? 106.161 30.784  27.731  1.00 27.76  ? 307 ALA B CB  1 
ATOM   3762 N  N   . ARG B 1 128 ? 103.870 31.941  30.057  1.00 29.54  ? 308 ARG B N   1 
ATOM   3763 C  CA  . ARG B 1 128 ? 103.390 33.139  30.735  1.00 31.57  ? 308 ARG B CA  1 
ATOM   3764 C  C   . ARG B 1 128 ? 103.948 34.391  30.064  1.00 31.12  ? 308 ARG B C   1 
ATOM   3765 O  O   . ARG B 1 128 ? 104.566 35.232  30.711  1.00 31.75  ? 308 ARG B O   1 
ATOM   3766 C  CB  . ARG B 1 128 ? 103.801 33.108  32.210  1.00 33.53  ? 308 ARG B CB  1 
ATOM   3767 C  CG  . ARG B 1 128 ? 103.328 31.855  32.924  1.00 35.83  ? 308 ARG B CG  1 
ATOM   3768 C  CD  . ARG B 1 128 ? 103.657 31.867  34.397  1.00 36.84  ? 308 ARG B CD  1 
ATOM   3769 N  NE  . ARG B 1 128 ? 103.361 30.575  35.010  1.00 37.92  ? 308 ARG B NE  1 
ATOM   3770 C  CZ  . ARG B 1 128 ? 103.537 30.298  36.299  1.00 39.07  ? 308 ARG B CZ  1 
ATOM   3771 N  NH1 . ARG B 1 128 ? 104.006 31.231  37.121  1.00 37.57  ? 308 ARG B NH1 1 
ATOM   3772 N  NH2 . ARG B 1 128 ? 103.256 29.084  36.762  1.00 38.34  ? 308 ARG B NH2 1 
ATOM   3773 N  N   . THR B 1 129 ? 103.726 34.503  28.758  1.00 30.49  ? 309 THR B N   1 
ATOM   3774 C  CA  . THR B 1 129 ? 104.210 35.642  27.983  1.00 29.94  ? 309 THR B CA  1 
ATOM   3775 C  C   . THR B 1 129 ? 103.402 36.901  28.281  1.00 30.74  ? 309 THR B C   1 
ATOM   3776 O  O   . THR B 1 129 ? 102.367 36.842  28.956  1.00 30.06  ? 309 THR B O   1 
ATOM   3777 C  CB  . THR B 1 129 ? 104.110 35.366  26.471  1.00 28.84  ? 309 THR B CB  1 
ATOM   3778 O  OG1 . THR B 1 129 ? 102.735 35.166  26.113  1.00 25.70  ? 309 THR B OG1 1 
ATOM   3779 C  CG2 . THR B 1 129 ? 104.911 34.131  26.103  1.00 28.83  ? 309 THR B CG2 1 
ATOM   3780 N  N   . GLU B 1 130 ? 103.874 38.036  27.772  1.00 32.01  ? 310 GLU B N   1 
ATOM   3781 C  CA  . GLU B 1 130 ? 103.174 39.298  27.977  1.00 34.19  ? 310 GLU B CA  1 
ATOM   3782 C  C   . GLU B 1 130 ? 101.769 39.194  27.403  1.00 32.76  ? 310 GLU B C   1 
ATOM   3783 O  O   . GLU B 1 130 ? 100.813 39.684  28.009  1.00 32.91  ? 310 GLU B O   1 
ATOM   3784 C  CB  . GLU B 1 130 ? 103.919 40.453  27.302  1.00 38.27  ? 310 GLU B CB  1 
ATOM   3785 C  CG  . GLU B 1 130 ? 105.207 40.852  28.006  1.00 45.02  ? 310 GLU B CG  1 
ATOM   3786 C  CD  . GLU B 1 130 ? 105.861 42.088  27.390  1.00 49.34  ? 310 GLU B CD  1 
ATOM   3787 O  OE1 . GLU B 1 130 ? 106.930 42.504  27.902  1.00 51.43  ? 310 GLU B OE1 1 
ATOM   3788 O  OE2 . GLU B 1 130 ? 105.308 42.637  26.400  1.00 50.58  ? 310 GLU B OE2 1 
ATOM   3789 N  N   . LEU B 1 131 ? 101.644 38.556  26.239  1.00 31.38  ? 311 LEU B N   1 
ATOM   3790 C  CA  . LEU B 1 131 ? 100.331 38.381  25.617  1.00 29.93  ? 311 LEU B CA  1 
ATOM   3791 C  C   . LEU B 1 131 ? 99.396  37.594  26.525  1.00 28.61  ? 311 LEU B C   1 
ATOM   3792 O  O   . LEU B 1 131 ? 98.250  37.992  26.730  1.00 28.90  ? 311 LEU B O   1 
ATOM   3793 C  CB  . LEU B 1 131 ? 100.435 37.653  24.274  1.00 30.08  ? 311 LEU B CB  1 
ATOM   3794 C  CG  . LEU B 1 131 ? 100.687 38.496  23.026  1.00 32.14  ? 311 LEU B CG  1 
ATOM   3795 C  CD1 . LEU B 1 131 ? 100.493 37.615  21.804  1.00 33.05  ? 311 LEU B CD1 1 
ATOM   3796 C  CD2 . LEU B 1 131 ? 99.722  39.678  22.973  1.00 31.57  ? 311 LEU B CD2 1 
ATOM   3797 N  N   . ALA B 1 132 ? 99.879  36.476  27.066  1.00 26.93  ? 312 ALA B N   1 
ATOM   3798 C  CA  . ALA B 1 132 ? 99.050  35.651  27.955  1.00 25.63  ? 312 ALA B CA  1 
ATOM   3799 C  C   . ALA B 1 132 ? 98.629  36.448  29.191  1.00 23.87  ? 312 ALA B C   1 
ATOM   3800 O  O   . ALA B 1 132 ? 97.486  36.365  29.640  1.00 24.26  ? 312 ALA B O   1 
ATOM   3801 C  CB  . ALA B 1 132 ? 99.815  34.382  28.375  1.00 24.27  ? 312 ALA B CB  1 
ATOM   3802 N  N   . VAL B 1 133 ? 99.563  37.214  29.739  1.00 23.56  ? 313 VAL B N   1 
ATOM   3803 C  CA  . VAL B 1 133 ? 99.287  38.035  30.908  1.00 23.72  ? 313 VAL B CA  1 
ATOM   3804 C  C   . VAL B 1 133 ? 98.326  39.160  30.530  1.00 24.02  ? 313 VAL B C   1 
ATOM   3805 O  O   . VAL B 1 133 ? 97.389  39.455  31.264  1.00 23.49  ? 313 VAL B O   1 
ATOM   3806 C  CB  . VAL B 1 133 ? 100.589 38.637  31.481  1.00 23.62  ? 313 VAL B CB  1 
ATOM   3807 C  CG1 . VAL B 1 133 ? 100.267 39.691  32.542  1.00 21.76  ? 313 VAL B CG1 1 
ATOM   3808 C  CG2 . VAL B 1 133 ? 101.443 37.519  32.087  1.00 22.89  ? 313 VAL B CG2 1 
ATOM   3809 N  N   . ARG B 1 134 ? 98.546  39.775  29.372  1.00 24.46  ? 314 ARG B N   1 
ATOM   3810 C  CA  . ARG B 1 134 ? 97.667  40.857  28.938  1.00 24.22  ? 314 ARG B CA  1 
ATOM   3811 C  C   . ARG B 1 134 ? 96.237  40.373  28.735  1.00 23.42  ? 314 ARG B C   1 
ATOM   3812 O  O   . ARG B 1 134 ? 95.283  41.072  29.073  1.00 23.28  ? 314 ARG B O   1 
ATOM   3813 C  CB  . ARG B 1 134 ? 98.163  41.477  27.628  1.00 24.48  ? 314 ARG B CB  1 
ATOM   3814 C  CG  . ARG B 1 134 ? 97.160  42.455  27.003  1.00 25.69  ? 314 ARG B CG  1 
ATOM   3815 C  CD  . ARG B 1 134 ? 97.704  43.003  25.713  1.00 26.96  ? 314 ARG B CD  1 
ATOM   3816 N  NE  . ARG B 1 134 ? 99.021  43.587  25.926  1.00 29.74  ? 314 ARG B NE  1 
ATOM   3817 C  CZ  . ARG B 1 134 ? 99.965  43.652  24.996  1.00 32.32  ? 314 ARG B CZ  1 
ATOM   3818 N  NH1 . ARG B 1 134 ? 99.740  43.169  23.777  1.00 33.14  ? 314 ARG B NH1 1 
ATOM   3819 N  NH2 . ARG B 1 134 ? 101.145 44.176  25.287  1.00 32.85  ? 314 ARG B NH2 1 
ATOM   3820 N  N   . TYR B 1 135 ? 96.087  39.169  28.197  1.00 22.19  ? 315 TYR B N   1 
ATOM   3821 C  CA  . TYR B 1 135 ? 94.758  38.649  27.924  1.00 22.07  ? 315 TYR B CA  1 
ATOM   3822 C  C   . TYR B 1 135 ? 94.175  37.648  28.908  1.00 22.72  ? 315 TYR B C   1 
ATOM   3823 O  O   . TYR B 1 135 ? 93.149  37.018  28.631  1.00 22.57  ? 315 TYR B O   1 
ATOM   3824 C  CB  . TYR B 1 135 ? 94.729  38.101  26.493  1.00 21.01  ? 315 TYR B CB  1 
ATOM   3825 C  CG  . TYR B 1 135 ? 94.773  39.228  25.485  1.00 21.22  ? 315 TYR B CG  1 
ATOM   3826 C  CD1 . TYR B 1 135 ? 93.730  40.158  25.415  1.00 20.00  ? 315 TYR B CD1 1 
ATOM   3827 C  CD2 . TYR B 1 135 ? 95.876  39.410  24.651  1.00 21.44  ? 315 TYR B CD2 1 
ATOM   3828 C  CE1 . TYR B 1 135 ? 93.786  41.246  24.543  1.00 20.71  ? 315 TYR B CE1 1 
ATOM   3829 C  CE2 . TYR B 1 135 ? 95.943  40.497  23.770  1.00 22.48  ? 315 TYR B CE2 1 
ATOM   3830 C  CZ  . TYR B 1 135 ? 94.891  41.411  23.726  1.00 21.76  ? 315 TYR B CZ  1 
ATOM   3831 O  OH  . TYR B 1 135 ? 94.944  42.491  22.877  1.00 20.56  ? 315 TYR B OH  1 
ATOM   3832 N  N   . ASN B 1 136 ? 94.821  37.499  30.058  1.00 22.71  ? 316 ASN B N   1 
ATOM   3833 C  CA  . ASN B 1 136 ? 94.316  36.592  31.076  1.00 23.46  ? 316 ASN B CA  1 
ATOM   3834 C  C   . ASN B 1 136 ? 94.065  35.169  30.548  1.00 23.21  ? 316 ASN B C   1 
ATOM   3835 O  O   . ASN B 1 136 ? 93.044  34.546  30.856  1.00 24.35  ? 316 ASN B O   1 
ATOM   3836 C  CB  . ASN B 1 136 ? 93.037  37.193  31.662  1.00 24.11  ? 316 ASN B CB  1 
ATOM   3837 C  CG  . ASN B 1 136 ? 93.259  38.601  32.215  1.00 26.87  ? 316 ASN B CG  1 
ATOM   3838 O  OD1 . ASN B 1 136 ? 94.099  38.803  33.095  1.00 27.58  ? 316 ASN B OD1 1 
ATOM   3839 N  ND2 . ASN B 1 136 ? 92.514  39.578  31.695  1.00 24.77  ? 316 ASN B ND2 1 
ATOM   3840 N  N   . ASP B 1 137 ? 95.007  34.671  29.750  1.00 22.32  ? 317 ASP B N   1 
ATOM   3841 C  CA  . ASP B 1 137 ? 94.949  33.332  29.162  1.00 22.11  ? 317 ASP B CA  1 
ATOM   3842 C  C   . ASP B 1 137 ? 93.759  33.028  28.254  1.00 22.65  ? 317 ASP B C   1 
ATOM   3843 O  O   . ASP B 1 137 ? 93.546  31.873  27.883  1.00 23.60  ? 317 ASP B O   1 
ATOM   3844 C  CB  . ASP B 1 137 ? 95.012  32.267  30.263  1.00 20.75  ? 317 ASP B CB  1 
ATOM   3845 C  CG  . ASP B 1 137 ? 96.307  32.315  31.043  1.00 20.62  ? 317 ASP B CG  1 
ATOM   3846 O  OD1 . ASP B 1 137 ? 97.292  32.867  30.521  1.00 22.32  ? 317 ASP B OD1 1 
ATOM   3847 O  OD2 . ASP B 1 137 ? 96.350  31.792  32.173  1.00 22.21  ? 317 ASP B OD2 1 
ATOM   3848 N  N   . ILE B 1 138 ? 92.984  34.046  27.889  1.00 23.00  ? 318 ILE B N   1 
ATOM   3849 C  CA  . ILE B 1 138 ? 91.819  33.847  27.027  1.00 21.20  ? 318 ILE B CA  1 
ATOM   3850 C  C   . ILE B 1 138 ? 92.189  34.158  25.575  1.00 21.99  ? 318 ILE B C   1 
ATOM   3851 O  O   . ILE B 1 138 ? 92.428  35.316  25.236  1.00 21.19  ? 318 ILE B O   1 
ATOM   3852 C  CB  . ILE B 1 138 ? 90.677  34.772  27.467  1.00 23.24  ? 318 ILE B CB  1 
ATOM   3853 C  CG1 . ILE B 1 138 ? 90.258  34.415  28.899  1.00 22.32  ? 318 ILE B CG1 1 
ATOM   3854 C  CG2 . ILE B 1 138 ? 89.503  34.681  26.482  1.00 21.53  ? 318 ILE B CG2 1 
ATOM   3855 C  CD1 . ILE B 1 138 ? 89.356  35.451  29.553  1.00 23.01  ? 318 ILE B CD1 1 
ATOM   3856 N  N   . SER B 1 139 ? 92.241  33.125  24.729  1.00 21.63  ? 319 SER B N   1 
ATOM   3857 C  CA  . SER B 1 139 ? 92.606  33.280  23.319  1.00 22.88  ? 319 SER B CA  1 
ATOM   3858 C  C   . SER B 1 139 ? 93.518  34.486  23.118  1.00 23.77  ? 319 SER B C   1 
ATOM   3859 O  O   . SER B 1 139 ? 93.181  35.415  22.386  1.00 25.03  ? 319 SER B O   1 
ATOM   3860 C  CB  . SER B 1 139 ? 91.361  33.450  22.450  1.00 22.69  ? 319 SER B CB  1 
ATOM   3861 O  OG  . SER B 1 139 ? 90.525  32.312  22.527  1.00 22.60  ? 319 SER B OG  1 
ATOM   3862 N  N   . PRO B 1 140 ? 94.688  34.487  23.770  1.00 24.25  ? 320 PRO B N   1 
ATOM   3863 C  CA  . PRO B 1 140 ? 95.611  35.617  23.630  1.00 24.22  ? 320 PRO B CA  1 
ATOM   3864 C  C   . PRO B 1 140 ? 96.016  35.996  22.207  1.00 24.77  ? 320 PRO B C   1 
ATOM   3865 O  O   . PRO B 1 140 ? 96.083  37.184  21.884  1.00 23.44  ? 320 PRO B O   1 
ATOM   3866 C  CB  . PRO B 1 140 ? 96.800  35.222  24.518  1.00 24.98  ? 320 PRO B CB  1 
ATOM   3867 C  CG  . PRO B 1 140 ? 96.651  33.719  24.703  1.00 26.49  ? 320 PRO B CG  1 
ATOM   3868 C  CD  . PRO B 1 140 ? 95.171  33.514  24.766  1.00 24.07  ? 320 PRO B CD  1 
ATOM   3869 N  N   . LEU B 1 141 ? 96.289  35.012  21.355  1.00 24.82  ? 321 LEU B N   1 
ATOM   3870 C  CA  . LEU B 1 141 ? 96.665  35.325  19.977  1.00 25.36  ? 321 LEU B CA  1 
ATOM   3871 C  C   . LEU B 1 141 ? 95.540  36.009  19.201  1.00 24.58  ? 321 LEU B C   1 
ATOM   3872 O  O   . LEU B 1 141 ? 95.738  37.077  18.632  1.00 25.15  ? 321 LEU B O   1 
ATOM   3873 C  CB  . LEU B 1 141 ? 97.085  34.064  19.214  1.00 26.40  ? 321 LEU B CB  1 
ATOM   3874 C  CG  . LEU B 1 141 ? 98.406  33.394  19.607  1.00 27.76  ? 321 LEU B CG  1 
ATOM   3875 C  CD1 . LEU B 1 141 ? 98.718  32.273  18.623  1.00 26.82  ? 321 LEU B CD1 1 
ATOM   3876 C  CD2 . LEU B 1 141 ? 99.519  34.414  19.604  1.00 27.66  ? 321 LEU B CD2 1 
ATOM   3877 N  N   . GLU B 1 142 ? 94.364  35.390  19.176  1.00 23.77  ? 322 GLU B N   1 
ATOM   3878 C  CA  . GLU B 1 142 ? 93.236  35.948  18.444  1.00 23.58  ? 322 GLU B CA  1 
ATOM   3879 C  C   . GLU B 1 142 ? 92.806  37.323  18.967  1.00 24.53  ? 322 GLU B C   1 
ATOM   3880 O  O   . GLU B 1 142 ? 92.392  38.189  18.188  1.00 22.71  ? 322 GLU B O   1 
ATOM   3881 C  CB  . GLU B 1 142 ? 92.052  34.984  18.474  1.00 24.10  ? 322 GLU B CB  1 
ATOM   3882 C  CG  . GLU B 1 142 ? 92.276  33.669  17.710  1.00 24.86  ? 322 GLU B CG  1 
ATOM   3883 C  CD  . GLU B 1 142 ? 93.324  32.767  18.352  1.00 25.72  ? 322 GLU B CD  1 
ATOM   3884 O  OE1 . GLU B 1 142 ? 93.427  32.741  19.602  1.00 25.32  ? 322 GLU B OE1 1 
ATOM   3885 O  OE2 . GLU B 1 142 ? 94.033  32.065  17.602  1.00 27.30  ? 322 GLU B OE2 1 
ATOM   3886 N  N   . ASN B 1 143 ? 92.887  37.522  20.283  1.00 23.58  ? 323 ASN B N   1 
ATOM   3887 C  CA  . ASN B 1 143 ? 92.536  38.813  20.854  1.00 23.93  ? 323 ASN B CA  1 
ATOM   3888 C  C   . ASN B 1 143 ? 93.539  39.830  20.336  1.00 24.13  ? 323 ASN B C   1 
ATOM   3889 O  O   . ASN B 1 143 ? 93.184  40.971  20.039  1.00 25.11  ? 323 ASN B O   1 
ATOM   3890 C  CB  . ASN B 1 143 ? 92.599  38.779  22.385  1.00 22.83  ? 323 ASN B CB  1 
ATOM   3891 C  CG  . ASN B 1 143 ? 91.264  38.479  23.005  1.00 22.30  ? 323 ASN B CG  1 
ATOM   3892 O  OD1 . ASN B 1 143 ? 90.311  39.228  22.826  1.00 22.37  ? 323 ASN B OD1 1 
ATOM   3893 N  ND2 . ASN B 1 143 ? 91.179  37.374  23.730  1.00 22.51  ? 323 ASN B ND2 1 
ATOM   3894 N  N   . HIS B 1 144 ? 94.794  39.401  20.220  1.00 23.38  ? 324 HIS B N   1 
ATOM   3895 C  CA  . HIS B 1 144 ? 95.847  40.280  19.752  1.00 23.41  ? 324 HIS B CA  1 
ATOM   3896 C  C   . HIS B 1 144 ? 95.671  40.626  18.278  1.00 24.74  ? 324 HIS B C   1 
ATOM   3897 O  O   . HIS B 1 144 ? 95.768  41.799  17.901  1.00 24.91  ? 324 HIS B O   1 
ATOM   3898 C  CB  . HIS B 1 144 ? 97.215  39.638  19.978  1.00 23.44  ? 324 HIS B CB  1 
ATOM   3899 C  CG  . HIS B 1 144 ? 98.357  40.503  19.550  1.00 24.39  ? 324 HIS B CG  1 
ATOM   3900 N  ND1 . HIS B 1 144 ? 98.635  41.715  20.146  1.00 24.47  ? 324 HIS B ND1 1 
ATOM   3901 C  CD2 . HIS B 1 144 ? 99.284  40.340  18.577  1.00 25.00  ? 324 HIS B CD2 1 
ATOM   3902 C  CE1 . HIS B 1 144 ? 99.686  42.260  19.558  1.00 25.20  ? 324 HIS B CE1 1 
ATOM   3903 N  NE2 . HIS B 1 144 ? 100.100 41.447  18.603  1.00 24.03  ? 324 HIS B NE2 1 
ATOM   3904 N  N   . HIS B 1 145 ? 95.413  39.618  17.443  1.00 24.08  ? 325 HIS B N   1 
ATOM   3905 C  CA  . HIS B 1 145 ? 95.218  39.869  16.016  1.00 24.22  ? 325 HIS B CA  1 
ATOM   3906 C  C   . HIS B 1 145 ? 94.126  40.921  15.831  1.00 23.94  ? 325 HIS B C   1 
ATOM   3907 O  O   . HIS B 1 145 ? 94.289  41.884  15.077  1.00 22.25  ? 325 HIS B O   1 
ATOM   3908 C  CB  . HIS B 1 145 ? 94.789  38.596  15.268  1.00 22.83  ? 325 HIS B CB  1 
ATOM   3909 C  CG  . HIS B 1 145 ? 95.675  37.415  15.512  1.00 23.66  ? 325 HIS B CG  1 
ATOM   3910 N  ND1 . HIS B 1 145 ? 97.048  37.512  15.567  1.00 21.24  ? 325 HIS B ND1 1 
ATOM   3911 C  CD2 . HIS B 1 145 ? 95.380  36.105  15.708  1.00 22.93  ? 325 HIS B CD2 1 
ATOM   3912 C  CE1 . HIS B 1 145 ? 97.563  36.315  15.790  1.00 22.61  ? 325 HIS B CE1 1 
ATOM   3913 N  NE2 . HIS B 1 145 ? 96.574  35.443  15.879  1.00 22.87  ? 325 HIS B NE2 1 
ATOM   3914 N  N   . CYS B 1 146 ? 93.008  40.726  16.522  1.00 24.35  ? 326 CYS B N   1 
ATOM   3915 C  CA  . CYS B 1 146 ? 91.886  41.651  16.414  1.00 26.36  ? 326 CYS B CA  1 
ATOM   3916 C  C   . CYS B 1 146 ? 92.262  43.060  16.914  1.00 25.88  ? 326 CYS B C   1 
ATOM   3917 O  O   . CYS B 1 146 ? 91.840  44.063  16.337  1.00 25.81  ? 326 CYS B O   1 
ATOM   3918 C  CB  . CYS B 1 146 ? 90.679  41.096  17.183  1.00 27.35  ? 326 CYS B CB  1 
ATOM   3919 S  SG  . CYS B 1 146 ? 89.100  41.817  16.685  1.00 35.30  ? 326 CYS B SG  1 
ATOM   3920 N  N   . ALA B 1 147 ? 93.075  43.137  17.966  1.00 24.51  ? 327 ALA B N   1 
ATOM   3921 C  CA  . ALA B 1 147 ? 93.494  44.431  18.496  1.00 24.47  ? 327 ALA B CA  1 
ATOM   3922 C  C   . ALA B 1 147 ? 94.377  45.174  17.495  1.00 24.18  ? 327 ALA B C   1 
ATOM   3923 O  O   . ALA B 1 147 ? 94.235  46.380  17.300  1.00 23.75  ? 327 ALA B O   1 
ATOM   3924 C  CB  . ALA B 1 147 ? 94.241  44.251  19.822  1.00 22.78  ? 327 ALA B CB  1 
ATOM   3925 N  N   . VAL B 1 148 ? 95.302  44.455  16.874  1.00 24.68  ? 328 VAL B N   1 
ATOM   3926 C  CA  . VAL B 1 148 ? 96.188  45.060  15.890  1.00 25.55  ? 328 VAL B CA  1 
ATOM   3927 C  C   . VAL B 1 148 ? 95.356  45.519  14.680  1.00 26.88  ? 328 VAL B C   1 
ATOM   3928 O  O   . VAL B 1 148 ? 95.589  46.596  14.116  1.00 26.75  ? 328 VAL B O   1 
ATOM   3929 C  CB  . VAL B 1 148 ? 97.282  44.055  15.443  1.00 25.26  ? 328 VAL B CB  1 
ATOM   3930 C  CG1 . VAL B 1 148 ? 98.069  44.617  14.272  1.00 23.86  ? 328 VAL B CG1 1 
ATOM   3931 C  CG2 . VAL B 1 148 ? 98.227  43.767  16.611  1.00 24.95  ? 328 VAL B CG2 1 
ATOM   3932 N  N   . ALA B 1 149 ? 94.378  44.703  14.292  1.00 25.99  ? 329 ALA B N   1 
ATOM   3933 C  CA  . ALA B 1 149 ? 93.508  45.045  13.168  1.00 26.10  ? 329 ALA B CA  1 
ATOM   3934 C  C   . ALA B 1 149 ? 92.870  46.418  13.385  1.00 26.66  ? 329 ALA B C   1 
ATOM   3935 O  O   . ALA B 1 149 ? 92.838  47.255  12.481  1.00 26.67  ? 329 ALA B O   1 
ATOM   3936 C  CB  . ALA B 1 149 ? 92.409  43.994  13.008  1.00 23.80  ? 329 ALA B CB  1 
ATOM   3937 N  N   . PHE B 1 150 ? 92.363  46.654  14.588  1.00 26.19  ? 330 PHE B N   1 
ATOM   3938 C  CA  . PHE B 1 150 ? 91.719  47.921  14.856  1.00 26.70  ? 330 PHE B CA  1 
ATOM   3939 C  C   . PHE B 1 150 ? 92.664  49.056  15.182  1.00 26.75  ? 330 PHE B C   1 
ATOM   3940 O  O   . PHE B 1 150 ? 92.303  50.229  15.047  1.00 26.61  ? 330 PHE B O   1 
ATOM   3941 C  CB  . PHE B 1 150 ? 90.640  47.725  15.910  1.00 26.49  ? 330 PHE B CB  1 
ATOM   3942 C  CG  . PHE B 1 150 ? 89.422  47.061  15.356  1.00 27.97  ? 330 PHE B CG  1 
ATOM   3943 C  CD1 . PHE B 1 150 ? 88.441  47.813  14.712  1.00 28.56  ? 330 PHE B CD1 1 
ATOM   3944 C  CD2 . PHE B 1 150 ? 89.300  45.675  15.374  1.00 27.61  ? 330 PHE B CD2 1 
ATOM   3945 C  CE1 . PHE B 1 150 ? 87.355  47.193  14.088  1.00 29.30  ? 330 PHE B CE1 1 
ATOM   3946 C  CE2 . PHE B 1 150 ? 88.222  45.044  14.754  1.00 28.63  ? 330 PHE B CE2 1 
ATOM   3947 C  CZ  . PHE B 1 150 ? 87.247  45.802  14.109  1.00 29.46  ? 330 PHE B CZ  1 
ATOM   3948 N  N   . GLN B 1 151 ? 93.880  48.716  15.591  1.00 26.66  ? 331 GLN B N   1 
ATOM   3949 C  CA  . GLN B 1 151 ? 94.878  49.737  15.851  1.00 27.01  ? 331 GLN B CA  1 
ATOM   3950 C  C   . GLN B 1 151 ? 95.236  50.307  14.479  1.00 27.30  ? 331 GLN B C   1 
ATOM   3951 O  O   . GLN B 1 151 ? 95.445  51.510  14.324  1.00 28.26  ? 331 GLN B O   1 
ATOM   3952 C  CB  . GLN B 1 151 ? 96.111  49.128  16.525  1.00 27.87  ? 331 GLN B CB  1 
ATOM   3953 C  CG  . GLN B 1 151 ? 95.981  49.036  18.048  1.00 29.37  ? 331 GLN B CG  1 
ATOM   3954 C  CD  . GLN B 1 151 ? 96.960  48.055  18.682  1.00 30.37  ? 331 GLN B CD  1 
ATOM   3955 O  OE1 . GLN B 1 151 ? 98.037  47.787  18.144  1.00 30.88  ? 331 GLN B OE1 1 
ATOM   3956 N  NE2 . GLN B 1 151 ? 96.592  47.530  19.844  1.00 32.49  ? 331 GLN B NE2 1 
ATOM   3957 N  N   . ILE B 1 152 ? 95.287  49.437  13.475  1.00 27.11  ? 332 ILE B N   1 
ATOM   3958 C  CA  . ILE B 1 152 ? 95.600  49.867  12.117  1.00 27.09  ? 332 ILE B CA  1 
ATOM   3959 C  C   . ILE B 1 152 ? 94.471  50.739  11.573  1.00 27.32  ? 332 ILE B C   1 
ATOM   3960 O  O   . ILE B 1 152 ? 94.717  51.826  11.046  1.00 27.61  ? 332 ILE B O   1 
ATOM   3961 C  CB  . ILE B 1 152 ? 95.803  48.660  11.170  1.00 26.75  ? 332 ILE B CB  1 
ATOM   3962 C  CG1 . ILE B 1 152 ? 97.060  47.889  11.579  1.00 25.64  ? 332 ILE B CG1 1 
ATOM   3963 C  CG2 . ILE B 1 152 ? 95.896  49.141  9.723   1.00 25.53  ? 332 ILE B CG2 1 
ATOM   3964 C  CD1 . ILE B 1 152 ? 97.307  46.623  10.768  1.00 25.44  ? 332 ILE B CD1 1 
ATOM   3965 N  N   . LEU B 1 153 ? 93.235  50.265  11.714  1.00 27.34  ? 333 LEU B N   1 
ATOM   3966 C  CA  . LEU B 1 153 ? 92.073  51.004  11.234  1.00 28.69  ? 333 LEU B CA  1 
ATOM   3967 C  C   . LEU B 1 153 ? 91.882  52.335  11.957  1.00 30.38  ? 333 LEU B C   1 
ATOM   3968 O  O   . LEU B 1 153 ? 91.174  53.210  11.466  1.00 31.35  ? 333 LEU B O   1 
ATOM   3969 C  CB  . LEU B 1 153 ? 90.799  50.164  11.377  1.00 27.16  ? 333 LEU B CB  1 
ATOM   3970 C  CG  . LEU B 1 153 ? 90.646  48.936  10.468  1.00 28.33  ? 333 LEU B CG  1 
ATOM   3971 C  CD1 . LEU B 1 153 ? 89.421  48.131  10.893  1.00 26.95  ? 333 LEU B CD1 1 
ATOM   3972 C  CD2 . LEU B 1 153 ? 90.517  49.378  9.013   1.00 27.12  ? 333 LEU B CD2 1 
ATOM   3973 N  N   . ALA B 1 154 ? 92.499  52.486  13.125  1.00 30.94  ? 334 ALA B N   1 
ATOM   3974 C  CA  . ALA B 1 154 ? 92.375  53.733  13.869  1.00 32.29  ? 334 ALA B CA  1 
ATOM   3975 C  C   . ALA B 1 154 ? 93.323  54.771  13.279  1.00 33.31  ? 334 ALA B C   1 
ATOM   3976 O  O   . ALA B 1 154 ? 93.202  55.964  13.560  1.00 34.63  ? 334 ALA B O   1 
ATOM   3977 C  CB  . ALA B 1 154 ? 92.688  53.511  15.343  1.00 32.09  ? 334 ALA B CB  1 
ATOM   3978 N  N   . GLU B 1 155 ? 94.284  54.315  12.481  1.00 33.88  ? 335 GLU B N   1 
ATOM   3979 C  CA  . GLU B 1 155 ? 95.213  55.235  11.829  1.00 35.11  ? 335 GLU B CA  1 
ATOM   3980 C  C   . GLU B 1 155 ? 94.420  55.868  10.692  1.00 33.75  ? 335 GLU B C   1 
ATOM   3981 O  O   . GLU B 1 155 ? 94.063  55.198  9.725   1.00 33.52  ? 335 GLU B O   1 
ATOM   3982 C  CB  . GLU B 1 155 ? 96.427  54.488  11.271  1.00 36.68  ? 335 GLU B CB  1 
ATOM   3983 C  CG  . GLU B 1 155 ? 97.437  54.084  12.328  1.00 40.78  ? 335 GLU B CG  1 
ATOM   3984 C  CD  . GLU B 1 155 ? 97.976  55.283  13.095  1.00 43.68  ? 335 GLU B CD  1 
ATOM   3985 O  OE1 . GLU B 1 155 ? 97.752  55.360  14.320  1.00 44.98  ? 335 GLU B OE1 1 
ATOM   3986 O  OE2 . GLU B 1 155 ? 98.620  56.153  12.468  1.00 47.00  ? 335 GLU B OE2 1 
ATOM   3987 N  N   . PRO B 1 156 ? 94.136  57.172  10.795  1.00 33.12  ? 336 PRO B N   1 
ATOM   3988 C  CA  . PRO B 1 156 ? 93.367  57.868  9.759   1.00 32.07  ? 336 PRO B CA  1 
ATOM   3989 C  C   . PRO B 1 156 ? 93.707  57.527  8.307   1.00 30.47  ? 336 PRO B C   1 
ATOM   3990 O  O   . PRO B 1 156 ? 92.806  57.327  7.495   1.00 29.32  ? 336 PRO B O   1 
ATOM   3991 C  CB  . PRO B 1 156 ? 93.584  59.345  10.097  1.00 33.60  ? 336 PRO B CB  1 
ATOM   3992 C  CG  . PRO B 1 156 ? 94.914  59.346  10.812  1.00 35.24  ? 336 PRO B CG  1 
ATOM   3993 C  CD  . PRO B 1 156 ? 94.794  58.134  11.695  1.00 33.44  ? 336 PRO B CD  1 
ATOM   3994 N  N   . GLU B 1 157 ? 94.990  57.436  7.976   1.00 29.76  ? 337 GLU B N   1 
ATOM   3995 C  CA  . GLU B 1 157 ? 95.359  57.137  6.598   1.00 29.70  ? 337 GLU B CA  1 
ATOM   3996 C  C   . GLU B 1 157 ? 95.083  55.686  6.206   1.00 28.73  ? 337 GLU B C   1 
ATOM   3997 O  O   . GLU B 1 157 ? 95.238  55.315  5.044   1.00 26.78  ? 337 GLU B O   1 
ATOM   3998 C  CB  . GLU B 1 157 ? 96.837  57.471  6.332   1.00 31.51  ? 337 GLU B CB  1 
ATOM   3999 C  CG  . GLU B 1 157 ? 97.818  56.384  6.738   1.00 34.73  ? 337 GLU B CG  1 
ATOM   4000 C  CD  . GLU B 1 157 ? 98.290  56.516  8.172   1.00 36.42  ? 337 GLU B CD  1 
ATOM   4001 O  OE1 . GLU B 1 157 ? 97.631  57.236  8.956   1.00 37.29  ? 337 GLU B OE1 1 
ATOM   4002 O  OE2 . GLU B 1 157 ? 99.320  55.893  8.514   1.00 37.49  ? 337 GLU B OE2 1 
ATOM   4003 N  N   . CYS B 1 158 ? 94.665  54.868  7.167   1.00 28.54  ? 338 CYS B N   1 
ATOM   4004 C  CA  . CYS B 1 158 ? 94.367  53.461  6.884   1.00 27.82  ? 338 CYS B CA  1 
ATOM   4005 C  C   . CYS B 1 158 ? 92.921  53.110  7.156   1.00 27.20  ? 338 CYS B C   1 
ATOM   4006 O  O   . CYS B 1 158 ? 92.498  51.976  6.913   1.00 28.32  ? 338 CYS B O   1 
ATOM   4007 C  CB  . CYS B 1 158 ? 95.237  52.540  7.736   1.00 28.03  ? 338 CYS B CB  1 
ATOM   4008 S  SG  . CYS B 1 158 ? 96.993  52.644  7.425   1.00 31.21  ? 338 CYS B SG  1 
ATOM   4009 N  N   . ASN B 1 159 ? 92.156  54.070  7.652   1.00 26.26  ? 339 ASN B N   1 
ATOM   4010 C  CA  . ASN B 1 159 ? 90.769  53.799  7.992   1.00 26.81  ? 339 ASN B CA  1 
ATOM   4011 C  C   . ASN B 1 159 ? 89.833  53.669  6.795   1.00 26.99  ? 339 ASN B C   1 
ATOM   4012 O  O   . ASN B 1 159 ? 89.231  54.645  6.351   1.00 28.05  ? 339 ASN B O   1 
ATOM   4013 C  CB  . ASN B 1 159 ? 90.260  54.875  8.951   1.00 26.63  ? 339 ASN B CB  1 
ATOM   4014 C  CG  . ASN B 1 159 ? 88.900  54.546  9.524   1.00 27.16  ? 339 ASN B CG  1 
ATOM   4015 O  OD1 . ASN B 1 159 ? 88.322  53.501  9.228   1.00 27.60  ? 339 ASN B OD1 1 
ATOM   4016 N  ND2 . ASN B 1 159 ? 88.381  55.442  10.353  1.00 27.57  ? 339 ASN B ND2 1 
ATOM   4017 N  N   . ILE B 1 160 ? 89.706  52.452  6.279   1.00 26.56  ? 340 ILE B N   1 
ATOM   4018 C  CA  . ILE B 1 160 ? 88.824  52.203  5.147   1.00 25.50  ? 340 ILE B CA  1 
ATOM   4019 C  C   . ILE B 1 160 ? 87.365  52.303  5.573   1.00 26.34  ? 340 ILE B C   1 
ATOM   4020 O  O   . ILE B 1 160 ? 86.458  52.168  4.755   1.00 26.66  ? 340 ILE B O   1 
ATOM   4021 C  CB  . ILE B 1 160 ? 89.056  50.813  4.564   1.00 24.82  ? 340 ILE B CB  1 
ATOM   4022 C  CG1 . ILE B 1 160 ? 88.969  49.770  5.684   1.00 23.06  ? 340 ILE B CG1 1 
ATOM   4023 C  CG2 . ILE B 1 160 ? 90.392  50.779  3.838   1.00 21.33  ? 340 ILE B CG2 1 
ATOM   4024 C  CD1 . ILE B 1 160 ? 88.823  48.342  5.184   1.00 21.86  ? 340 ILE B CD1 1 
ATOM   4025 N  N   . PHE B 1 161 ? 87.140  52.532  6.861   1.00 26.82  ? 341 PHE B N   1 
ATOM   4026 C  CA  . PHE B 1 161 ? 85.787  52.662  7.375   1.00 28.28  ? 341 PHE B CA  1 
ATOM   4027 C  C   . PHE B 1 161 ? 85.470  54.126  7.700   1.00 29.68  ? 341 PHE B C   1 
ATOM   4028 O  O   . PHE B 1 161 ? 84.445  54.416  8.320   1.00 29.49  ? 341 PHE B O   1 
ATOM   4029 C  CB  . PHE B 1 161 ? 85.613  51.821  8.646   1.00 28.22  ? 341 PHE B CB  1 
ATOM   4030 C  CG  . PHE B 1 161 ? 85.825  50.341  8.445   1.00 28.99  ? 341 PHE B CG  1 
ATOM   4031 C  CD1 . PHE B 1 161 ? 85.629  49.750  7.200   1.00 28.65  ? 341 PHE B CD1 1 
ATOM   4032 C  CD2 . PHE B 1 161 ? 86.161  49.524  9.528   1.00 29.05  ? 341 PHE B CD2 1 
ATOM   4033 C  CE1 . PHE B 1 161 ? 85.761  48.367  7.033   1.00 28.64  ? 341 PHE B CE1 1 
ATOM   4034 C  CE2 . PHE B 1 161 ? 86.295  48.140  9.370   1.00 28.26  ? 341 PHE B CE2 1 
ATOM   4035 C  CZ  . PHE B 1 161 ? 86.092  47.563  8.120   1.00 27.53  ? 341 PHE B CZ  1 
ATOM   4036 N  N   . SER B 1 162 ? 86.343  55.041  7.279   1.00 30.12  ? 342 SER B N   1 
ATOM   4037 C  CA  . SER B 1 162 ? 86.155  56.467  7.568   1.00 31.70  ? 342 SER B CA  1 
ATOM   4038 C  C   . SER B 1 162 ? 84.824  57.071  7.128   1.00 31.83  ? 342 SER B C   1 
ATOM   4039 O  O   . SER B 1 162 ? 84.313  57.976  7.783   1.00 32.15  ? 342 SER B O   1 
ATOM   4040 C  CB  . SER B 1 162 ? 87.294  57.295  6.968   1.00 30.78  ? 342 SER B CB  1 
ATOM   4041 O  OG  . SER B 1 162 ? 87.266  57.247  5.558   1.00 33.08  ? 342 SER B OG  1 
ATOM   4042 N  N   . ASN B 1 163 ? 84.256  56.583  6.031   1.00 32.63  ? 343 ASN B N   1 
ATOM   4043 C  CA  . ASN B 1 163 ? 82.985  57.125  5.566   1.00 33.72  ? 343 ASN B CA  1 
ATOM   4044 C  C   . ASN B 1 163 ? 81.775  56.270  5.938   1.00 34.61  ? 343 ASN B C   1 
ATOM   4045 O  O   . ASN B 1 163 ? 80.739  56.322  5.275   1.00 35.49  ? 343 ASN B O   1 
ATOM   4046 C  CB  . ASN B 1 163 ? 83.030  57.344  4.051   1.00 34.13  ? 343 ASN B CB  1 
ATOM   4047 C  CG  . ASN B 1 163 ? 84.084  58.358  3.647   1.00 34.65  ? 343 ASN B CG  1 
ATOM   4048 O  OD1 . ASN B 1 163 ? 84.178  59.438  4.236   1.00 34.07  ? 343 ASN B OD1 1 
ATOM   4049 N  ND2 . ASN B 1 163 ? 84.883  58.019  2.636   1.00 34.87  ? 343 ASN B ND2 1 
ATOM   4050 N  N   . ILE B 1 164 ? 81.908  55.471  6.990   1.00 34.27  ? 344 ILE B N   1 
ATOM   4051 C  CA  . ILE B 1 164 ? 80.793  54.652  7.442   1.00 34.61  ? 344 ILE B CA  1 
ATOM   4052 C  C   . ILE B 1 164 ? 80.298  55.270  8.749   1.00 36.05  ? 344 ILE B C   1 
ATOM   4053 O  O   . ILE B 1 164 ? 81.089  55.520  9.661   1.00 35.59  ? 344 ILE B O   1 
ATOM   4054 C  CB  . ILE B 1 164 ? 81.216  53.186  7.707   1.00 33.45  ? 344 ILE B CB  1 
ATOM   4055 C  CG1 . ILE B 1 164 ? 81.860  52.588  6.458   1.00 32.23  ? 344 ILE B CG1 1 
ATOM   4056 C  CG2 . ILE B 1 164 ? 80.000  52.361  8.103   1.00 31.77  ? 344 ILE B CG2 1 
ATOM   4057 C  CD1 . ILE B 1 164 ? 82.424  51.192  6.668   1.00 30.80  ? 344 ILE B CD1 1 
ATOM   4058 N  N   . PRO B 1 165 ? 78.985  55.544  8.852   1.00 37.52  ? 345 PRO B N   1 
ATOM   4059 C  CA  . PRO B 1 165 ? 78.452  56.137  10.085  1.00 38.87  ? 345 PRO B CA  1 
ATOM   4060 C  C   . PRO B 1 165 ? 78.784  55.272  11.301  1.00 40.03  ? 345 PRO B C   1 
ATOM   4061 O  O   . PRO B 1 165 ? 78.992  54.069  11.174  1.00 40.12  ? 345 PRO B O   1 
ATOM   4062 C  CB  . PRO B 1 165 ? 76.949  56.224  9.807   1.00 38.71  ? 345 PRO B CB  1 
ATOM   4063 C  CG  . PRO B 1 165 ? 76.711  55.090  8.847   1.00 39.54  ? 345 PRO B CG  1 
ATOM   4064 C  CD  . PRO B 1 165 ? 77.899  55.199  7.918   1.00 37.96  ? 345 PRO B CD  1 
ATOM   4065 N  N   . PRO B 1 166 ? 78.839  55.877  12.495  1.00 41.20  ? 346 PRO B N   1 
ATOM   4066 C  CA  . PRO B 1 166 ? 79.154  55.138  13.725  1.00 41.69  ? 346 PRO B CA  1 
ATOM   4067 C  C   . PRO B 1 166 ? 78.352  53.854  13.967  1.00 41.25  ? 346 PRO B C   1 
ATOM   4068 O  O   . PRO B 1 166 ? 78.909  52.855  14.420  1.00 40.42  ? 346 PRO B O   1 
ATOM   4069 C  CB  . PRO B 1 166 ? 78.962  56.186  14.829  1.00 41.77  ? 346 PRO B CB  1 
ATOM   4070 C  CG  . PRO B 1 166 ? 78.038  57.211  14.202  1.00 43.18  ? 346 PRO B CG  1 
ATOM   4071 C  CD  . PRO B 1 166 ? 78.546  57.290  12.788  1.00 42.19  ? 346 PRO B CD  1 
ATOM   4072 N  N   . ASP B 1 167 ? 77.058  53.867  13.663  1.00 40.94  ? 347 ASP B N   1 
ATOM   4073 C  CA  . ASP B 1 167 ? 76.249  52.667  13.858  1.00 41.28  ? 347 ASP B CA  1 
ATOM   4074 C  C   . ASP B 1 167 ? 76.711  51.548  12.929  1.00 40.18  ? 347 ASP B C   1 
ATOM   4075 O  O   . ASP B 1 167 ? 76.540  50.364  13.230  1.00 39.09  ? 347 ASP B O   1 
ATOM   4076 C  CB  . ASP B 1 167 ? 74.765  52.962  13.623  1.00 43.68  ? 347 ASP B CB  1 
ATOM   4077 C  CG  . ASP B 1 167 ? 74.102  53.637  14.824  1.00 47.09  ? 347 ASP B CG  1 
ATOM   4078 O  OD1 . ASP B 1 167 ? 72.871  53.862  14.768  1.00 48.72  ? 347 ASP B OD1 1 
ATOM   4079 O  OD2 . ASP B 1 167 ? 74.805  53.941  15.820  1.00 47.41  ? 347 ASP B OD2 1 
ATOM   4080 N  N   . GLY B 1 168 ? 77.293  51.929  11.796  1.00 38.02  ? 348 GLY B N   1 
ATOM   4081 C  CA  . GLY B 1 168 ? 77.791  50.942  10.855  1.00 35.95  ? 348 GLY B CA  1 
ATOM   4082 C  C   . GLY B 1 168 ? 79.106  50.382  11.372  1.00 34.72  ? 348 GLY B C   1 
ATOM   4083 O  O   . GLY B 1 168 ? 79.322  49.170  11.378  1.00 33.41  ? 348 GLY B O   1 
ATOM   4084 N  N   . PHE B 1 169 ? 79.983  51.277  11.813  1.00 33.39  ? 349 PHE B N   1 
ATOM   4085 C  CA  . PHE B 1 169 ? 81.275  50.884  12.349  1.00 33.71  ? 349 PHE B CA  1 
ATOM   4086 C  C   . PHE B 1 169 ? 81.088  49.862  13.466  1.00 33.82  ? 349 PHE B C   1 
ATOM   4087 O  O   . PHE B 1 169 ? 81.677  48.784  13.436  1.00 34.02  ? 349 PHE B O   1 
ATOM   4088 C  CB  . PHE B 1 169 ? 82.011  52.106  12.901  1.00 32.63  ? 349 PHE B CB  1 
ATOM   4089 C  CG  . PHE B 1 169 ? 83.332  51.776  13.532  1.00 33.05  ? 349 PHE B CG  1 
ATOM   4090 C  CD1 . PHE B 1 169 ? 84.439  51.475  12.745  1.00 32.60  ? 349 PHE B CD1 1 
ATOM   4091 C  CD2 . PHE B 1 169 ? 83.464  51.740  14.918  1.00 32.77  ? 349 PHE B CD2 1 
ATOM   4092 C  CE1 . PHE B 1 169 ? 85.667  51.142  13.330  1.00 33.17  ? 349 PHE B CE1 1 
ATOM   4093 C  CE2 . PHE B 1 169 ? 84.683  51.408  15.513  1.00 33.63  ? 349 PHE B CE2 1 
ATOM   4094 C  CZ  . PHE B 1 169 ? 85.788  51.109  14.717  1.00 32.35  ? 349 PHE B CZ  1 
ATOM   4095 N  N   . LYS B 1 170 ? 80.262  50.212  14.448  1.00 34.04  ? 350 LYS B N   1 
ATOM   4096 C  CA  . LYS B 1 170 ? 79.991  49.337  15.583  1.00 34.49  ? 350 LYS B CA  1 
ATOM   4097 C  C   . LYS B 1 170 ? 79.562  47.935  15.157  1.00 33.58  ? 350 LYS B C   1 
ATOM   4098 O  O   . LYS B 1 170 ? 80.060  46.936  15.679  1.00 33.20  ? 350 LYS B O   1 
ATOM   4099 C  CB  . LYS B 1 170 ? 78.897  49.934  16.481  1.00 35.98  ? 350 LYS B CB  1 
ATOM   4100 C  CG  . LYS B 1 170 ? 79.361  51.022  17.441  1.00 39.62  ? 350 LYS B CG  1 
ATOM   4101 C  CD  . LYS B 1 170 ? 78.306  51.240  18.531  1.00 42.24  ? 350 LYS B CD  1 
ATOM   4102 C  CE  . LYS B 1 170 ? 78.683  52.362  19.484  1.00 44.59  ? 350 LYS B CE  1 
ATOM   4103 N  NZ  . LYS B 1 170 ? 78.652  53.686  18.802  1.00 47.60  ? 350 LYS B NZ  1 
ATOM   4104 N  N   . GLN B 1 171 ? 78.631  47.867  14.216  1.00 32.50  ? 351 GLN B N   1 
ATOM   4105 C  CA  . GLN B 1 171 ? 78.138  46.586  13.738  1.00 32.69  ? 351 GLN B CA  1 
ATOM   4106 C  C   . GLN B 1 171 ? 79.248  45.794  13.046  1.00 31.47  ? 351 GLN B C   1 
ATOM   4107 O  O   . GLN B 1 171 ? 79.359  44.585  13.230  1.00 30.99  ? 351 GLN B O   1 
ATOM   4108 C  CB  . GLN B 1 171 ? 76.974  46.804  12.777  1.00 34.68  ? 351 GLN B CB  1 
ATOM   4109 C  CG  . GLN B 1 171 ? 76.441  45.529  12.158  1.00 39.45  ? 351 GLN B CG  1 
ATOM   4110 C  CD  . GLN B 1 171 ? 75.376  45.796  11.114  1.00 43.61  ? 351 GLN B CD  1 
ATOM   4111 O  OE1 . GLN B 1 171 ? 74.908  44.873  10.437  1.00 45.83  ? 351 GLN B OE1 1 
ATOM   4112 N  NE2 . GLN B 1 171 ? 74.981  47.064  10.977  1.00 44.27  ? 351 GLN B NE2 1 
ATOM   4113 N  N   . ILE B 1 172 ? 80.066  46.480  12.253  1.00 30.13  ? 352 ILE B N   1 
ATOM   4114 C  CA  . ILE B 1 172 ? 81.163  45.830  11.540  1.00 28.94  ? 352 ILE B CA  1 
ATOM   4115 C  C   . ILE B 1 172 ? 82.242  45.384  12.524  1.00 28.53  ? 352 ILE B C   1 
ATOM   4116 O  O   . ILE B 1 172 ? 82.747  44.269  12.443  1.00 28.27  ? 352 ILE B O   1 
ATOM   4117 C  CB  . ILE B 1 172 ? 81.793  46.782  10.499  1.00 28.61  ? 352 ILE B CB  1 
ATOM   4118 C  CG1 . ILE B 1 172 ? 80.766  47.101  9.409   1.00 28.18  ? 352 ILE B CG1 1 
ATOM   4119 C  CG2 . ILE B 1 172 ? 83.048  46.147  9.890   1.00 27.31  ? 352 ILE B CG2 1 
ATOM   4120 C  CD1 . ILE B 1 172 ? 81.179  48.237  8.474   1.00 28.79  ? 352 ILE B CD1 1 
ATOM   4121 N  N   . ARG B 1 173 ? 82.586  46.261  13.460  1.00 28.04  ? 353 ARG B N   1 
ATOM   4122 C  CA  . ARG B 1 173 ? 83.606  45.943  14.452  1.00 28.34  ? 353 ARG B CA  1 
ATOM   4123 C  C   . ARG B 1 173 ? 83.224  44.706  15.265  1.00 28.07  ? 353 ARG B C   1 
ATOM   4124 O  O   . ARG B 1 173 ? 84.023  43.789  15.412  1.00 27.73  ? 353 ARG B O   1 
ATOM   4125 C  CB  . ARG B 1 173 ? 83.815  47.136  15.381  1.00 27.08  ? 353 ARG B CB  1 
ATOM   4126 C  CG  . ARG B 1 173 ? 84.729  46.863  16.548  1.00 26.87  ? 353 ARG B CG  1 
ATOM   4127 C  CD  . ARG B 1 173 ? 84.872  48.104  17.403  1.00 25.67  ? 353 ARG B CD  1 
ATOM   4128 N  NE  . ARG B 1 173 ? 85.507  47.850  18.695  1.00 24.35  ? 353 ARG B NE  1 
ATOM   4129 C  CZ  . ARG B 1 173 ? 86.779  47.498  18.863  1.00 24.51  ? 353 ARG B CZ  1 
ATOM   4130 N  NH1 . ARG B 1 173 ? 87.573  47.343  17.817  1.00 23.55  ? 353 ARG B NH1 1 
ATOM   4131 N  NH2 . ARG B 1 173 ? 87.266  47.333  20.089  1.00 24.55  ? 353 ARG B NH2 1 
ATOM   4132 N  N   . GLN B 1 174 ? 82.000  44.683  15.776  1.00 27.97  ? 354 GLN B N   1 
ATOM   4133 C  CA  . GLN B 1 174 ? 81.520  43.564  16.573  1.00 30.13  ? 354 GLN B CA  1 
ATOM   4134 C  C   . GLN B 1 174 ? 81.563  42.255  15.784  1.00 29.74  ? 354 GLN B C   1 
ATOM   4135 O  O   . GLN B 1 174 ? 81.895  41.203  16.327  1.00 29.16  ? 354 GLN B O   1 
ATOM   4136 C  CB  . GLN B 1 174 ? 80.091  43.846  17.049  1.00 33.83  ? 354 GLN B CB  1 
ATOM   4137 C  CG  . GLN B 1 174 ? 79.409  42.688  17.784  1.00 40.72  ? 354 GLN B CG  1 
ATOM   4138 C  CD  . GLN B 1 174 ? 80.105  42.306  19.092  1.00 44.87  ? 354 GLN B CD  1 
ATOM   4139 O  OE1 . GLN B 1 174 ? 80.198  43.114  20.031  1.00 46.32  ? 354 GLN B OE1 1 
ATOM   4140 N  NE2 . GLN B 1 174 ? 80.596  41.065  19.158  1.00 46.35  ? 354 GLN B NE2 1 
ATOM   4141 N  N   . GLY B 1 175 ? 81.223  42.327  14.502  1.00 28.56  ? 355 GLY B N   1 
ATOM   4142 C  CA  . GLY B 1 175 ? 81.229  41.137  13.672  1.00 27.33  ? 355 GLY B CA  1 
ATOM   4143 C  C   . GLY B 1 175 ? 82.640  40.639  13.430  1.00 26.25  ? 355 GLY B C   1 
ATOM   4144 O  O   . GLY B 1 175 ? 82.905  39.443  13.513  1.00 26.56  ? 355 GLY B O   1 
ATOM   4145 N  N   . MET B 1 176 ? 83.552  41.557  13.136  1.00 24.70  ? 356 MET B N   1 
ATOM   4146 C  CA  . MET B 1 176 ? 84.930  41.179  12.886  1.00 25.36  ? 356 MET B CA  1 
ATOM   4147 C  C   . MET B 1 176 ? 85.540  40.535  14.119  1.00 25.51  ? 356 MET B C   1 
ATOM   4148 O  O   . MET B 1 176 ? 86.246  39.532  14.019  1.00 26.19  ? 356 MET B O   1 
ATOM   4149 C  CB  . MET B 1 176 ? 85.745  42.397  12.472  1.00 25.17  ? 356 MET B CB  1 
ATOM   4150 C  CG  . MET B 1 176 ? 85.425  42.893  11.072  1.00 25.52  ? 356 MET B CG  1 
ATOM   4151 S  SD  . MET B 1 176 ? 86.401  44.345  10.636  1.00 26.53  ? 356 MET B SD  1 
ATOM   4152 C  CE  . MET B 1 176 ? 88.095  43.721  10.843  1.00 24.17  ? 356 MET B CE  1 
ATOM   4153 N  N   . ILE B 1 177 ? 85.260  41.120  15.279  1.00 25.27  ? 357 ILE B N   1 
ATOM   4154 C  CA  . ILE B 1 177 ? 85.757  40.615  16.547  1.00 24.51  ? 357 ILE B CA  1 
ATOM   4155 C  C   . ILE B 1 177 ? 85.263  39.185  16.756  1.00 25.10  ? 357 ILE B C   1 
ATOM   4156 O  O   . ILE B 1 177 ? 86.045  38.285  17.063  1.00 23.90  ? 357 ILE B O   1 
ATOM   4157 C  CB  . ILE B 1 177 ? 85.276  41.516  17.713  1.00 26.28  ? 357 ILE B CB  1 
ATOM   4158 C  CG1 . ILE B 1 177 ? 86.054  42.838  17.686  1.00 25.23  ? 357 ILE B CG1 1 
ATOM   4159 C  CG2 . ILE B 1 177 ? 85.444  40.791  19.069  1.00 22.97  ? 357 ILE B CG2 1 
ATOM   4160 C  CD1 . ILE B 1 177 ? 85.518  43.890  18.635  1.00 27.30  ? 357 ILE B CD1 1 
ATOM   4161 N  N   . THR B 1 178 ? 83.960  38.984  16.590  1.00 24.62  ? 358 THR B N   1 
ATOM   4162 C  CA  . THR B 1 178 ? 83.361  37.663  16.746  1.00 24.54  ? 358 THR B CA  1 
ATOM   4163 C  C   . THR B 1 178 ? 84.056  36.657  15.808  1.00 24.89  ? 358 THR B C   1 
ATOM   4164 O  O   . THR B 1 178 ? 84.439  35.562  16.231  1.00 23.81  ? 358 THR B O   1 
ATOM   4165 C  CB  . THR B 1 178 ? 81.834  37.705  16.418  1.00 25.49  ? 358 THR B CB  1 
ATOM   4166 O  OG1 . THR B 1 178 ? 81.171  38.608  17.312  1.00 25.59  ? 358 THR B OG1 1 
ATOM   4167 C  CG2 . THR B 1 178 ? 81.202  36.321  16.553  1.00 24.16  ? 358 THR B CG2 1 
ATOM   4168 N  N   . LEU B 1 179 ? 84.235  37.038  14.542  1.00 24.20  ? 359 LEU B N   1 
ATOM   4169 C  CA  . LEU B 1 179 ? 84.862  36.151  13.560  1.00 24.15  ? 359 LEU B CA  1 
ATOM   4170 C  C   . LEU B 1 179 ? 86.334  35.832  13.807  1.00 24.20  ? 359 LEU B C   1 
ATOM   4171 O  O   . LEU B 1 179 ? 86.745  34.678  13.689  1.00 23.99  ? 359 LEU B O   1 
ATOM   4172 C  CB  . LEU B 1 179 ? 84.705  36.718  12.150  1.00 24.67  ? 359 LEU B CB  1 
ATOM   4173 C  CG  . LEU B 1 179 ? 83.270  36.886  11.655  1.00 24.71  ? 359 LEU B CG  1 
ATOM   4174 C  CD1 . LEU B 1 179 ? 83.296  37.098  10.154  1.00 24.15  ? 359 LEU B CD1 1 
ATOM   4175 C  CD2 . LEU B 1 179 ? 82.445  35.650  12.001  1.00 24.30  ? 359 LEU B CD2 1 
ATOM   4176 N  N   . ILE B 1 180 ? 87.130  36.843  14.135  1.00 23.25  ? 360 ILE B N   1 
ATOM   4177 C  CA  . ILE B 1 180 ? 88.548  36.616  14.392  1.00 23.00  ? 360 ILE B CA  1 
ATOM   4178 C  C   . ILE B 1 180 ? 88.753  35.780  15.656  1.00 23.79  ? 360 ILE B C   1 
ATOM   4179 O  O   . ILE B 1 180 ? 89.628  34.918  15.697  1.00 22.35  ? 360 ILE B O   1 
ATOM   4180 C  CB  . ILE B 1 180 ? 89.306  37.944  14.534  1.00 22.97  ? 360 ILE B CB  1 
ATOM   4181 C  CG1 . ILE B 1 180 ? 89.253  38.703  13.204  1.00 22.35  ? 360 ILE B CG1 1 
ATOM   4182 C  CG2 . ILE B 1 180 ? 90.760  37.685  14.947  1.00 21.11  ? 360 ILE B CG2 1 
ATOM   4183 C  CD1 . ILE B 1 180 ? 89.866  40.082  13.269  1.00 22.32  ? 360 ILE B CD1 1 
ATOM   4184 N  N   . LEU B 1 181 ? 87.940  36.019  16.682  1.00 23.76  ? 361 LEU B N   1 
ATOM   4185 C  CA  . LEU B 1 181 ? 88.079  35.244  17.913  1.00 24.30  ? 361 LEU B CA  1 
ATOM   4186 C  C   . LEU B 1 181 ? 87.657  33.804  17.680  1.00 24.06  ? 361 LEU B C   1 
ATOM   4187 O  O   . LEU B 1 181 ? 88.119  32.900  18.366  1.00 24.76  ? 361 LEU B O   1 
ATOM   4188 C  CB  . LEU B 1 181 ? 87.236  35.838  19.038  1.00 23.98  ? 361 LEU B CB  1 
ATOM   4189 C  CG  . LEU B 1 181 ? 87.746  37.127  19.693  1.00 26.16  ? 361 LEU B CG  1 
ATOM   4190 C  CD1 . LEU B 1 181 ? 86.741  37.576  20.765  1.00 23.36  ? 361 LEU B CD1 1 
ATOM   4191 C  CD2 . LEU B 1 181 ? 89.121  36.891  20.317  1.00 24.12  ? 361 LEU B CD2 1 
ATOM   4192 N  N   . ALA B 1 182 ? 86.786  33.601  16.697  1.00 23.94  ? 362 ALA B N   1 
ATOM   4193 C  CA  . ALA B 1 182 ? 86.283  32.275  16.365  1.00 23.43  ? 362 ALA B CA  1 
ATOM   4194 C  C   . ALA B 1 182 ? 87.310  31.385  15.664  1.00 23.85  ? 362 ALA B C   1 
ATOM   4195 O  O   . ALA B 1 182 ? 87.070  30.194  15.481  1.00 24.04  ? 362 ALA B O   1 
ATOM   4196 C  CB  . ALA B 1 182 ? 85.024  32.397  15.495  1.00 23.22  ? 362 ALA B CB  1 
ATOM   4197 N  N   . THR B 1 183 ? 88.451  31.950  15.277  1.00 24.13  ? 363 THR B N   1 
ATOM   4198 C  CA  . THR B 1 183 ? 89.472  31.162  14.601  1.00 23.68  ? 363 THR B CA  1 
ATOM   4199 C  C   . THR B 1 183 ? 90.391  30.388  15.545  1.00 24.64  ? 363 THR B C   1 
ATOM   4200 O  O   . THR B 1 183 ? 91.208  29.587  15.097  1.00 26.10  ? 363 THR B O   1 
ATOM   4201 C  CB  . THR B 1 183 ? 90.334  32.031  13.668  1.00 23.67  ? 363 THR B CB  1 
ATOM   4202 O  OG1 . THR B 1 183 ? 91.016  33.043  14.424  1.00 22.97  ? 363 THR B OG1 1 
ATOM   4203 C  CG2 . THR B 1 183 ? 89.456  32.676  12.607  1.00 22.31  ? 363 THR B CG2 1 
ATOM   4204 N  N   . ASP B 1 184 ? 90.265  30.622  16.847  1.00 24.20  ? 364 ASP B N   1 
ATOM   4205 C  CA  . ASP B 1 184 ? 91.083  29.901  17.821  1.00 24.54  ? 364 ASP B CA  1 
ATOM   4206 C  C   . ASP B 1 184 ? 90.601  28.440  17.790  1.00 24.97  ? 364 ASP B C   1 
ATOM   4207 O  O   . ASP B 1 184 ? 89.465  28.145  18.169  1.00 23.85  ? 364 ASP B O   1 
ATOM   4208 C  CB  . ASP B 1 184 ? 90.880  30.502  19.218  1.00 24.84  ? 364 ASP B CB  1 
ATOM   4209 C  CG  . ASP B 1 184 ? 91.723  29.816  20.284  1.00 25.19  ? 364 ASP B CG  1 
ATOM   4210 O  OD1 . ASP B 1 184 ? 92.360  28.784  19.972  1.00 26.19  ? 364 ASP B OD1 1 
ATOM   4211 O  OD2 . ASP B 1 184 ? 91.748  30.310  21.433  1.00 24.35  ? 364 ASP B OD2 1 
ATOM   4212 N  N   . MET B 1 185 ? 91.452  27.527  17.336  1.00 25.42  ? 365 MET B N   1 
ATOM   4213 C  CA  . MET B 1 185 ? 91.039  26.128  17.227  1.00 26.84  ? 365 MET B CA  1 
ATOM   4214 C  C   . MET B 1 185 ? 90.612  25.473  18.534  1.00 28.12  ? 365 MET B C   1 
ATOM   4215 O  O   . MET B 1 185 ? 89.922  24.449  18.525  1.00 27.57  ? 365 MET B O   1 
ATOM   4216 C  CB  . MET B 1 185 ? 92.131  25.301  16.537  1.00 26.58  ? 365 MET B CB  1 
ATOM   4217 C  CG  . MET B 1 185 ? 92.148  25.476  15.020  1.00 25.59  ? 365 MET B CG  1 
ATOM   4218 S  SD  . MET B 1 185 ? 90.576  24.960  14.250  1.00 29.49  ? 365 MET B SD  1 
ATOM   4219 C  CE  . MET B 1 185 ? 90.690  23.185  14.473  1.00 24.69  ? 365 MET B CE  1 
ATOM   4220 N  N   . ALA B 1 186 ? 90.993  26.074  19.658  1.00 27.95  ? 366 ALA B N   1 
ATOM   4221 C  CA  . ALA B 1 186 ? 90.613  25.538  20.956  1.00 28.97  ? 366 ALA B CA  1 
ATOM   4222 C  C   . ALA B 1 186 ? 89.090  25.541  21.102  1.00 29.06  ? 366 ALA B C   1 
ATOM   4223 O  O   . ALA B 1 186 ? 88.536  24.839  21.951  1.00 29.80  ? 366 ALA B O   1 
ATOM   4224 C  CB  . ALA B 1 186 ? 91.245  26.369  22.072  1.00 29.32  ? 366 ALA B CB  1 
ATOM   4225 N  N   . ARG B 1 187 ? 88.418  26.329  20.270  1.00 28.20  ? 367 ARG B N   1 
ATOM   4226 C  CA  . ARG B 1 187 ? 86.960  26.446  20.320  1.00 27.73  ? 367 ARG B CA  1 
ATOM   4227 C  C   . ARG B 1 187 ? 86.258  25.717  19.171  1.00 27.89  ? 367 ARG B C   1 
ATOM   4228 O  O   . ARG B 1 187 ? 85.044  25.831  19.007  1.00 28.02  ? 367 ARG B O   1 
ATOM   4229 C  CB  . ARG B 1 187 ? 86.560  27.926  20.291  1.00 27.18  ? 367 ARG B CB  1 
ATOM   4230 C  CG  . ARG B 1 187 ? 86.975  28.734  21.532  1.00 28.11  ? 367 ARG B CG  1 
ATOM   4231 C  CD  . ARG B 1 187 ? 86.572  30.207  21.396  1.00 26.39  ? 367 ARG B CD  1 
ATOM   4232 N  NE  . ARG B 1 187 ? 85.151  30.347  21.079  1.00 26.30  ? 367 ARG B NE  1 
ATOM   4233 C  CZ  . ARG B 1 187 ? 84.602  31.432  20.536  1.00 26.49  ? 367 ARG B CZ  1 
ATOM   4234 N  NH1 . ARG B 1 187 ? 85.346  32.494  20.240  1.00 24.46  ? 367 ARG B NH1 1 
ATOM   4235 N  NH2 . ARG B 1 187 ? 83.304  31.452  20.272  1.00 25.72  ? 367 ARG B NH2 1 
ATOM   4236 N  N   . HIS B 1 188 ? 87.017  24.961  18.389  1.00 27.74  ? 368 HIS B N   1 
ATOM   4237 C  CA  . HIS B 1 188 ? 86.449  24.266  17.243  1.00 29.16  ? 368 HIS B CA  1 
ATOM   4238 C  C   . HIS B 1 188 ? 85.216  23.413  17.519  1.00 29.76  ? 368 HIS B C   1 
ATOM   4239 O  O   . HIS B 1 188 ? 84.167  23.610  16.897  1.00 29.26  ? 368 HIS B O   1 
ATOM   4240 C  CB  . HIS B 1 188 ? 87.497  23.386  16.564  1.00 28.23  ? 368 HIS B CB  1 
ATOM   4241 C  CG  . HIS B 1 188 ? 86.980  22.703  15.337  1.00 29.64  ? 368 HIS B CG  1 
ATOM   4242 N  ND1 . HIS B 1 188 ? 86.733  23.378  14.160  1.00 28.11  ? 368 HIS B ND1 1 
ATOM   4243 C  CD2 . HIS B 1 188 ? 86.585  21.424  15.128  1.00 28.86  ? 368 HIS B CD2 1 
ATOM   4244 C  CE1 . HIS B 1 188 ? 86.207  22.546  13.279  1.00 28.19  ? 368 HIS B CE1 1 
ATOM   4245 N  NE2 . HIS B 1 188 ? 86.105  21.354  13.842  1.00 29.51  ? 368 HIS B NE2 1 
ATOM   4246 N  N   . ALA B 1 189 ? 85.348  22.455  18.430  1.00 30.96  ? 369 ALA B N   1 
ATOM   4247 C  CA  . ALA B 1 189 ? 84.240  21.562  18.762  1.00 32.84  ? 369 ALA B CA  1 
ATOM   4248 C  C   . ALA B 1 189 ? 83.047  22.371  19.248  1.00 33.80  ? 369 ALA B C   1 
ATOM   4249 O  O   . ALA B 1 189 ? 81.913  22.128  18.837  1.00 35.58  ? 369 ALA B O   1 
ATOM   4250 C  CB  . ALA B 1 189 ? 84.677  20.552  19.830  1.00 31.68  ? 369 ALA B CB  1 
ATOM   4251 N  N   . GLU B 1 190 ? 83.314  23.336  20.121  1.00 34.54  ? 370 GLU B N   1 
ATOM   4252 C  CA  . GLU B 1 190 ? 82.273  24.208  20.661  1.00 35.82  ? 370 GLU B CA  1 
ATOM   4253 C  C   . GLU B 1 190 ? 81.481  24.875  19.529  1.00 34.68  ? 370 GLU B C   1 
ATOM   4254 O  O   . GLU B 1 190 ? 80.258  24.750  19.451  1.00 34.43  ? 370 GLU B O   1 
ATOM   4255 C  CB  . GLU B 1 190 ? 82.916  25.290  21.539  1.00 38.20  ? 370 GLU B CB  1 
ATOM   4256 C  CG  . GLU B 1 190 ? 81.972  26.412  21.983  1.00 42.52  ? 370 GLU B CG  1 
ATOM   4257 C  CD  . GLU B 1 190 ? 82.703  27.744  22.231  1.00 44.90  ? 370 GLU B CD  1 
ATOM   4258 O  OE1 . GLU B 1 190 ? 83.724  27.740  22.957  1.00 46.46  ? 370 GLU B OE1 1 
ATOM   4259 O  OE2 . GLU B 1 190 ? 82.250  28.791  21.704  1.00 44.77  ? 370 GLU B OE2 1 
ATOM   4260 N  N   . ILE B 1 191 ? 82.189  25.576  18.649  1.00 33.50  ? 371 ILE B N   1 
ATOM   4261 C  CA  . ILE B 1 191 ? 81.548  26.275  17.541  1.00 32.19  ? 371 ILE B CA  1 
ATOM   4262 C  C   . ILE B 1 191 ? 80.828  25.318  16.596  1.00 32.07  ? 371 ILE B C   1 
ATOM   4263 O  O   . ILE B 1 191 ? 79.709  25.590  16.166  1.00 31.10  ? 371 ILE B O   1 
ATOM   4264 C  CB  . ILE B 1 191 ? 82.585  27.138  16.782  1.00 31.92  ? 371 ILE B CB  1 
ATOM   4265 C  CG1 . ILE B 1 191 ? 83.083  28.252  17.711  1.00 30.74  ? 371 ILE B CG1 1 
ATOM   4266 C  CG2 . ILE B 1 191 ? 81.975  27.737  15.525  1.00 29.94  ? 371 ILE B CG2 1 
ATOM   4267 C  CD1 . ILE B 1 191 ? 84.145  29.140  17.103  1.00 30.94  ? 371 ILE B CD1 1 
ATOM   4268 N  N   . MET B 1 192 ? 81.455  24.192  16.282  1.00 33.21  ? 372 MET B N   1 
ATOM   4269 C  CA  . MET B 1 192 ? 80.822  23.213  15.401  1.00 35.22  ? 372 MET B CA  1 
ATOM   4270 C  C   . MET B 1 192 ? 79.519  22.701  16.015  1.00 35.60  ? 372 MET B C   1 
ATOM   4271 O  O   . MET B 1 192 ? 78.510  22.559  15.320  1.00 34.30  ? 372 MET B O   1 
ATOM   4272 C  CB  . MET B 1 192 ? 81.764  22.037  15.130  1.00 36.06  ? 372 MET B CB  1 
ATOM   4273 C  CG  . MET B 1 192 ? 82.763  22.284  14.003  1.00 38.50  ? 372 MET B CG  1 
ATOM   4274 S  SD  . MET B 1 192 ? 81.960  22.453  12.385  1.00 42.50  ? 372 MET B SD  1 
ATOM   4275 C  CE  . MET B 1 192 ? 81.291  20.782  12.149  1.00 42.29  ? 372 MET B CE  1 
ATOM   4276 N  N   . ASP B 1 193 ? 79.538  22.431  17.317  1.00 36.67  ? 373 ASP B N   1 
ATOM   4277 C  CA  . ASP B 1 193 ? 78.335  21.950  17.991  1.00 38.39  ? 373 ASP B CA  1 
ATOM   4278 C  C   . ASP B 1 193 ? 77.209  22.974  17.907  1.00 38.63  ? 373 ASP B C   1 
ATOM   4279 O  O   . ASP B 1 193 ? 76.071  22.622  17.594  1.00 38.30  ? 373 ASP B O   1 
ATOM   4280 C  CB  . ASP B 1 193 ? 78.614  21.625  19.464  1.00 39.12  ? 373 ASP B CB  1 
ATOM   4281 C  CG  . ASP B 1 193 ? 79.383  20.331  19.643  1.00 40.11  ? 373 ASP B CG  1 
ATOM   4282 O  OD1 . ASP B 1 193 ? 79.382  19.499  18.712  1.00 40.59  ? 373 ASP B OD1 1 
ATOM   4283 O  OD2 . ASP B 1 193 ? 79.975  20.138  20.726  1.00 41.87  ? 373 ASP B OD2 1 
ATOM   4284 N  N   . SER B 1 194 ? 77.522  24.239  18.188  1.00 39.07  ? 374 SER B N   1 
ATOM   4285 C  CA  . SER B 1 194 ? 76.510  25.290  18.129  1.00 40.45  ? 374 SER B CA  1 
ATOM   4286 C  C   . SER B 1 194 ? 75.942  25.398  16.725  1.00 40.78  ? 374 SER B C   1 
ATOM   4287 O  O   . SER B 1 194 ? 74.730  25.551  16.544  1.00 40.84  ? 374 SER B O   1 
ATOM   4288 C  CB  . SER B 1 194 ? 77.102  26.639  18.532  1.00 40.19  ? 374 SER B CB  1 
ATOM   4289 O  OG  . SER B 1 194 ? 77.552  26.609  19.869  1.00 42.49  ? 374 SER B OG  1 
ATOM   4290 N  N   . PHE B 1 195 ? 76.826  25.319  15.733  1.00 41.49  ? 375 PHE B N   1 
ATOM   4291 C  CA  . PHE B 1 195 ? 76.413  25.409  14.340  1.00 42.59  ? 375 PHE B CA  1 
ATOM   4292 C  C   . PHE B 1 195 ? 75.497  24.252  13.965  1.00 44.10  ? 375 PHE B C   1 
ATOM   4293 O  O   . PHE B 1 195 ? 74.416  24.469  13.420  1.00 43.89  ? 375 PHE B O   1 
ATOM   4294 C  CB  . PHE B 1 195 ? 77.634  25.422  13.416  1.00 41.11  ? 375 PHE B CB  1 
ATOM   4295 C  CG  . PHE B 1 195 ? 77.293  25.625  11.965  1.00 39.90  ? 375 PHE B CG  1 
ATOM   4296 C  CD1 . PHE B 1 195 ? 76.560  26.739  11.557  1.00 39.91  ? 375 PHE B CD1 1 
ATOM   4297 C  CD2 . PHE B 1 195 ? 77.700  24.708  11.004  1.00 39.27  ? 375 PHE B CD2 1 
ATOM   4298 C  CE1 . PHE B 1 195 ? 76.237  26.934  10.214  1.00 39.28  ? 375 PHE B CE1 1 
ATOM   4299 C  CE2 . PHE B 1 195 ? 77.382  24.894  9.655   1.00 39.66  ? 375 PHE B CE2 1 
ATOM   4300 C  CZ  . PHE B 1 195 ? 76.649  26.008  9.261   1.00 39.08  ? 375 PHE B CZ  1 
ATOM   4301 N  N   . LYS B 1 196 ? 75.928  23.025  14.255  1.00 46.38  ? 376 LYS B N   1 
ATOM   4302 C  CA  . LYS B 1 196 ? 75.126  21.842  13.939  1.00 49.03  ? 376 LYS B CA  1 
ATOM   4303 C  C   . LYS B 1 196 ? 73.784  21.881  14.670  1.00 50.45  ? 376 LYS B C   1 
ATOM   4304 O  O   . LYS B 1 196 ? 72.754  21.466  14.141  1.00 50.27  ? 376 LYS B O   1 
ATOM   4305 C  CB  . LYS B 1 196 ? 75.884  20.563  14.318  1.00 48.89  ? 376 LYS B CB  1 
ATOM   4306 C  CG  . LYS B 1 196 ? 77.140  20.316  13.492  1.00 49.80  ? 376 LYS B CG  1 
ATOM   4307 C  CD  . LYS B 1 196 ? 77.649  18.891  13.652  1.00 50.29  ? 376 LYS B CD  1 
ATOM   4308 C  CE  . LYS B 1 196 ? 78.054  18.596  15.085  1.00 51.70  ? 376 LYS B CE  1 
ATOM   4309 N  NZ  . LYS B 1 196 ? 78.538  17.190  15.242  1.00 53.46  ? 376 LYS B NZ  1 
ATOM   4310 N  N   . GLU B 1 197 ? 73.811  22.390  15.891  1.00 52.51  ? 377 GLU B N   1 
ATOM   4311 C  CA  . GLU B 1 197 ? 72.614  22.497  16.706  1.00 54.90  ? 377 GLU B CA  1 
ATOM   4312 C  C   . GLU B 1 197 ? 71.573  23.324  15.962  1.00 55.64  ? 377 GLU B C   1 
ATOM   4313 O  O   . GLU B 1 197 ? 70.428  22.910  15.807  1.00 56.28  ? 377 GLU B O   1 
ATOM   4314 C  CB  . GLU B 1 197 ? 72.972  23.168  18.032  1.00 57.22  ? 377 GLU B CB  1 
ATOM   4315 C  CG  . GLU B 1 197 ? 71.891  23.173  19.091  1.00 60.23  ? 377 GLU B CG  1 
ATOM   4316 C  CD  . GLU B 1 197 ? 72.388  23.780  20.396  1.00 62.29  ? 377 GLU B CD  1 
ATOM   4317 O  OE1 . GLU B 1 197 ? 72.652  25.004  20.428  1.00 63.00  ? 377 GLU B OE1 1 
ATOM   4318 O  OE2 . GLU B 1 197 ? 72.527  23.029  21.387  1.00 63.65  ? 377 GLU B OE2 1 
ATOM   4319 N  N   . LYS B 1 198 ? 71.981  24.489  15.481  1.00 55.95  ? 378 LYS B N   1 
ATOM   4320 C  CA  . LYS B 1 198 ? 71.064  25.365  14.774  1.00 56.63  ? 378 LYS B CA  1 
ATOM   4321 C  C   . LYS B 1 198 ? 70.876  24.965  13.317  1.00 57.11  ? 378 LYS B C   1 
ATOM   4322 O  O   . LYS B 1 198 ? 69.981  25.465  12.636  1.00 56.92  ? 378 LYS B O   1 
ATOM   4323 C  CB  . LYS B 1 198 ? 71.551  26.809  14.909  1.00 56.75  ? 378 LYS B CB  1 
ATOM   4324 C  CG  . LYS B 1 198 ? 71.727  27.177  16.378  1.00 57.34  ? 378 LYS B CG  1 
ATOM   4325 C  CD  . LYS B 1 198 ? 71.971  28.645  16.641  1.00 57.89  ? 378 LYS B CD  1 
ATOM   4326 C  CE  . LYS B 1 198 ? 72.033  28.881  18.148  1.00 58.52  ? 378 LYS B CE  1 
ATOM   4327 N  NZ  . LYS B 1 198 ? 72.239  30.309  18.518  1.00 59.57  ? 378 LYS B NZ  1 
ATOM   4328 N  N   . MET B 1 199 ? 71.700  24.034  12.852  1.00 57.60  ? 379 MET B N   1 
ATOM   4329 C  CA  . MET B 1 199 ? 71.611  23.563  11.478  1.00 58.86  ? 379 MET B CA  1 
ATOM   4330 C  C   . MET B 1 199 ? 70.398  22.643  11.318  1.00 60.44  ? 379 MET B C   1 
ATOM   4331 O  O   . MET B 1 199 ? 69.924  22.411  10.202  1.00 60.62  ? 379 MET B O   1 
ATOM   4332 C  CB  . MET B 1 199 ? 72.901  22.826  11.099  1.00 58.10  ? 379 MET B CB  1 
ATOM   4333 C  CG  . MET B 1 199 ? 73.066  22.538  9.611   1.00 58.29  ? 379 MET B CG  1 
ATOM   4334 S  SD  . MET B 1 199 ? 72.851  23.991  8.555   1.00 56.16  ? 379 MET B SD  1 
ATOM   4335 C  CE  . MET B 1 199 ? 73.619  25.216  9.504   1.00 57.68  ? 379 MET B CE  1 
ATOM   4336 N  N   . GLU B 1 200 ? 69.895  22.129  12.441  1.00 61.51  ? 380 GLU B N   1 
ATOM   4337 C  CA  . GLU B 1 200 ? 68.731  21.241  12.435  1.00 62.52  ? 380 GLU B CA  1 
ATOM   4338 C  C   . GLU B 1 200 ? 67.556  21.893  11.711  1.00 62.19  ? 380 GLU B C   1 
ATOM   4339 O  O   . GLU B 1 200 ? 66.758  21.219  11.059  1.00 62.55  ? 380 GLU B O   1 
ATOM   4340 C  CB  . GLU B 1 200 ? 68.305  20.905  13.866  1.00 64.17  ? 380 GLU B CB  1 
ATOM   4341 C  CG  . GLU B 1 200 ? 69.324  20.110  14.665  1.00 66.55  ? 380 GLU B CG  1 
ATOM   4342 C  CD  . GLU B 1 200 ? 68.829  19.775  16.066  1.00 68.28  ? 380 GLU B CD  1 
ATOM   4343 O  OE1 . GLU B 1 200 ? 68.516  20.714  16.834  1.00 68.43  ? 380 GLU B OE1 1 
ATOM   4344 O  OE2 . GLU B 1 200 ? 68.752  18.571  16.400  1.00 69.64  ? 380 GLU B OE2 1 
ATOM   4345 N  N   . ASN B 1 201 ? 67.453  23.210  11.842  1.00 61.64  ? 381 ASN B N   1 
ATOM   4346 C  CA  . ASN B 1 201 ? 66.386  23.967  11.204  1.00 60.75  ? 381 ASN B CA  1 
ATOM   4347 C  C   . ASN B 1 201 ? 66.933  25.372  10.958  1.00 59.14  ? 381 ASN B C   1 
ATOM   4348 O  O   . ASN B 1 201 ? 66.438  26.353  11.520  1.00 58.36  ? 381 ASN B O   1 
ATOM   4349 C  CB  . ASN B 1 201 ? 65.163  24.020  12.127  1.00 62.83  ? 381 ASN B CB  1 
ATOM   4350 C  CG  . ASN B 1 201 ? 63.884  24.374  11.386  1.00 64.64  ? 381 ASN B CG  1 
ATOM   4351 O  OD1 . ASN B 1 201 ? 63.751  25.467  10.831  1.00 66.16  ? 381 ASN B OD1 1 
ATOM   4352 N  ND2 . ASN B 1 201 ? 62.935  23.443  11.371  1.00 65.49  ? 381 ASN B ND2 1 
ATOM   4353 N  N   . PHE B 1 202 ? 67.963  25.454  10.116  1.00 56.92  ? 382 PHE B N   1 
ATOM   4354 C  CA  . PHE B 1 202 ? 68.608  26.725  9.802   1.00 54.70  ? 382 PHE B CA  1 
ATOM   4355 C  C   . PHE B 1 202 ? 67.622  27.776  9.321   1.00 53.57  ? 382 PHE B C   1 
ATOM   4356 O  O   . PHE B 1 202 ? 66.705  27.481  8.562   1.00 54.08  ? 382 PHE B O   1 
ATOM   4357 C  CB  . PHE B 1 202 ? 69.692  26.538  8.743   1.00 53.06  ? 382 PHE B CB  1 
ATOM   4358 C  CG  . PHE B 1 202 ? 70.654  27.685  8.666   1.00 51.23  ? 382 PHE B CG  1 
ATOM   4359 C  CD1 . PHE B 1 202 ? 71.632  27.853  9.644   1.00 50.45  ? 382 PHE B CD1 1 
ATOM   4360 C  CD2 . PHE B 1 202 ? 70.573  28.614  7.636   1.00 50.75  ? 382 PHE B CD2 1 
ATOM   4361 C  CE1 . PHE B 1 202 ? 72.515  28.926  9.597   1.00 49.93  ? 382 PHE B CE1 1 
ATOM   4362 C  CE2 . PHE B 1 202 ? 71.453  29.695  7.580   1.00 50.36  ? 382 PHE B CE2 1 
ATOM   4363 C  CZ  . PHE B 1 202 ? 72.425  29.850  8.564   1.00 50.09  ? 382 PHE B CZ  1 
ATOM   4364 N  N   . ASP B 1 203 ? 67.839  29.007  9.760   1.00 52.75  ? 383 ASP B N   1 
ATOM   4365 C  CA  . ASP B 1 203 ? 66.981  30.130  9.414   1.00 51.88  ? 383 ASP B CA  1 
ATOM   4366 C  C   . ASP B 1 203 ? 67.868  31.318  9.028   1.00 51.08  ? 383 ASP B C   1 
ATOM   4367 O  O   . ASP B 1 203 ? 68.565  31.872  9.877   1.00 50.47  ? 383 ASP B O   1 
ATOM   4368 C  CB  . ASP B 1 203 ? 66.112  30.464  10.637  1.00 52.72  ? 383 ASP B CB  1 
ATOM   4369 C  CG  . ASP B 1 203 ? 65.142  31.615  10.396  1.00 53.47  ? 383 ASP B CG  1 
ATOM   4370 O  OD1 . ASP B 1 203 ? 64.367  31.921  11.330  1.00 53.70  ? 383 ASP B OD1 1 
ATOM   4371 O  OD2 . ASP B 1 203 ? 65.148  32.213  9.297   1.00 52.70  ? 383 ASP B OD2 1 
ATOM   4372 N  N   . TYR B 1 204 ? 67.855  31.693  7.749   1.00 50.40  ? 384 TYR B N   1 
ATOM   4373 C  CA  . TYR B 1 204 ? 68.664  32.819  7.273   1.00 50.11  ? 384 TYR B CA  1 
ATOM   4374 C  C   . TYR B 1 204 ? 68.173  34.170  7.785   1.00 50.81  ? 384 TYR B C   1 
ATOM   4375 O  O   . TYR B 1 204 ? 68.775  35.204  7.491   1.00 50.89  ? 384 TYR B O   1 
ATOM   4376 C  CB  . TYR B 1 204 ? 68.691  32.869  5.742   1.00 49.73  ? 384 TYR B CB  1 
ATOM   4377 C  CG  . TYR B 1 204 ? 69.588  31.847  5.085   1.00 48.55  ? 384 TYR B CG  1 
ATOM   4378 C  CD1 . TYR B 1 204 ? 69.103  30.590  4.723   1.00 48.18  ? 384 TYR B CD1 1 
ATOM   4379 C  CD2 . TYR B 1 204 ? 70.925  32.140  4.817   1.00 48.12  ? 384 TYR B CD2 1 
ATOM   4380 C  CE1 . TYR B 1 204 ? 69.930  29.650  4.104   1.00 47.72  ? 384 TYR B CE1 1 
ATOM   4381 C  CE2 . TYR B 1 204 ? 71.759  31.210  4.203   1.00 47.66  ? 384 TYR B CE2 1 
ATOM   4382 C  CZ  . TYR B 1 204 ? 71.256  29.970  3.849   1.00 47.61  ? 384 TYR B CZ  1 
ATOM   4383 O  OH  . TYR B 1 204 ? 72.077  29.055  3.235   1.00 46.98  ? 384 TYR B OH  1 
ATOM   4384 N  N   . SER B 1 205 ? 67.074  34.160  8.534   1.00 51.29  ? 385 SER B N   1 
ATOM   4385 C  CA  . SER B 1 205 ? 66.495  35.381  9.089   1.00 52.05  ? 385 SER B CA  1 
ATOM   4386 C  C   . SER B 1 205 ? 66.946  35.551  10.531  1.00 51.92  ? 385 SER B C   1 
ATOM   4387 O  O   . SER B 1 205 ? 66.927  36.654  11.080  1.00 52.13  ? 385 SER B O   1 
ATOM   4388 C  CB  . SER B 1 205 ? 64.963  35.307  9.054   1.00 53.07  ? 385 SER B CB  1 
ATOM   4389 O  OG  . SER B 1 205 ? 64.482  35.099  7.736   1.00 56.11  ? 385 SER B OG  1 
ATOM   4390 N  N   . ASN B 1 206 ? 67.339  34.440  11.142  1.00 51.70  ? 386 ASN B N   1 
ATOM   4391 C  CA  . ASN B 1 206 ? 67.786  34.432  12.525  1.00 50.74  ? 386 ASN B CA  1 
ATOM   4392 C  C   . ASN B 1 206 ? 69.230  34.917  12.607  1.00 51.08  ? 386 ASN B C   1 
ATOM   4393 O  O   . ASN B 1 206 ? 70.152  34.249  12.142  1.00 50.63  ? 386 ASN B O   1 
ATOM   4394 C  CB  . ASN B 1 206 ? 67.676  33.021  13.092  1.00 50.25  ? 386 ASN B CB  1 
ATOM   4395 C  CG  . ASN B 1 206 ? 67.822  32.989  14.588  1.00 49.75  ? 386 ASN B CG  1 
ATOM   4396 O  OD1 . ASN B 1 206 ? 68.552  33.791  15.165  1.00 50.16  ? 386 ASN B OD1 1 
ATOM   4397 N  ND2 . ASN B 1 206 ? 67.137  32.052  15.228  1.00 49.21  ? 386 ASN B ND2 1 
ATOM   4398 N  N   . GLU B 1 207 ? 69.412  36.083  13.212  1.00 51.84  ? 387 GLU B N   1 
ATOM   4399 C  CA  . GLU B 1 207 ? 70.722  36.705  13.361  1.00 52.08  ? 387 GLU B CA  1 
ATOM   4400 C  C   . GLU B 1 207 ? 71.767  35.800  14.017  1.00 50.59  ? 387 GLU B C   1 
ATOM   4401 O  O   . GLU B 1 207 ? 72.938  35.827  13.638  1.00 49.75  ? 387 GLU B O   1 
ATOM   4402 C  CB  . GLU B 1 207 ? 70.578  37.996  14.168  1.00 54.27  ? 387 GLU B CB  1 
ATOM   4403 C  CG  . GLU B 1 207 ? 71.771  38.921  14.102  1.00 58.20  ? 387 GLU B CG  1 
ATOM   4404 C  CD  . GLU B 1 207 ? 71.591  40.145  14.979  1.00 61.08  ? 387 GLU B CD  1 
ATOM   4405 O  OE1 . GLU B 1 207 ? 71.686  40.008  16.219  1.00 61.95  ? 387 GLU B OE1 1 
ATOM   4406 O  OE2 . GLU B 1 207 ? 71.342  41.242  14.429  1.00 62.53  ? 387 GLU B OE2 1 
ATOM   4407 N  N   . GLU B 1 208 ? 71.348  35.013  15.005  1.00 49.06  ? 388 GLU B N   1 
ATOM   4408 C  CA  . GLU B 1 208 ? 72.266  34.115  15.695  1.00 48.11  ? 388 GLU B CA  1 
ATOM   4409 C  C   . GLU B 1 208 ? 72.668  32.968  14.778  1.00 45.70  ? 388 GLU B C   1 
ATOM   4410 O  O   . GLU B 1 208 ? 73.768  32.439  14.883  1.00 44.99  ? 388 GLU B O   1 
ATOM   4411 C  CB  . GLU B 1 208 ? 71.627  33.557  16.974  1.00 50.54  ? 388 GLU B CB  1 
ATOM   4412 C  CG  . GLU B 1 208 ? 71.395  34.596  18.065  1.00 54.87  ? 388 GLU B CG  1 
ATOM   4413 C  CD  . GLU B 1 208 ? 70.921  33.979  19.377  1.00 57.43  ? 388 GLU B CD  1 
ATOM   4414 O  OE1 . GLU B 1 208 ? 69.905  33.247  19.366  1.00 59.34  ? 388 GLU B OE1 1 
ATOM   4415 O  OE2 . GLU B 1 208 ? 71.562  34.230  20.423  1.00 58.99  ? 388 GLU B OE2 1 
ATOM   4416 N  N   . HIS B 1 209 ? 71.762  32.583  13.887  1.00 43.19  ? 389 HIS B N   1 
ATOM   4417 C  CA  . HIS B 1 209 ? 72.035  31.515  12.940  1.00 41.29  ? 389 HIS B CA  1 
ATOM   4418 C  C   . HIS B 1 209 ? 73.107  31.999  11.977  1.00 40.03  ? 389 HIS B C   1 
ATOM   4419 O  O   . HIS B 1 209 ? 74.096  31.311  11.728  1.00 38.97  ? 389 HIS B O   1 
ATOM   4420 C  CB  . HIS B 1 209 ? 70.768  31.163  12.157  1.00 41.81  ? 389 HIS B CB  1 
ATOM   4421 C  CG  . HIS B 1 209 ? 69.876  30.179  12.851  1.00 42.73  ? 389 HIS B CG  1 
ATOM   4422 N  ND1 . HIS B 1 209 ? 69.509  30.308  14.173  1.00 43.53  ? 389 HIS B ND1 1 
ATOM   4423 C  CD2 . HIS B 1 209 ? 69.273  29.054  12.400  1.00 42.73  ? 389 HIS B CD2 1 
ATOM   4424 C  CE1 . HIS B 1 209 ? 68.719  29.303  14.508  1.00 43.21  ? 389 HIS B CE1 1 
ATOM   4425 N  NE2 . HIS B 1 209 ? 68.559  28.528  13.450  1.00 42.43  ? 389 HIS B NE2 1 
ATOM   4426 N  N   . MET B 1 210 ? 72.903  33.200  11.449  1.00 38.70  ? 390 MET B N   1 
ATOM   4427 C  CA  . MET B 1 210 ? 73.830  33.800  10.501  1.00 37.42  ? 390 MET B CA  1 
ATOM   4428 C  C   . MET B 1 210 ? 75.198  34.074  11.116  1.00 36.00  ? 390 MET B C   1 
ATOM   4429 O  O   . MET B 1 210 ? 76.222  33.932  10.445  1.00 34.80  ? 390 MET B O   1 
ATOM   4430 C  CB  . MET B 1 210 ? 73.237  35.097  9.936   1.00 37.93  ? 390 MET B CB  1 
ATOM   4431 C  CG  . MET B 1 210 ? 72.014  34.880  9.049   1.00 38.47  ? 390 MET B CG  1 
ATOM   4432 S  SD  . MET B 1 210 ? 72.366  33.853  7.590   1.00 40.45  ? 390 MET B SD  1 
ATOM   4433 C  CE  . MET B 1 210 ? 72.663  35.106  6.355   1.00 40.58  ? 390 MET B CE  1 
ATOM   4434 N  N   . THR B 1 211 ? 75.218  34.462  12.389  1.00 34.52  ? 391 THR B N   1 
ATOM   4435 C  CA  . THR B 1 211 ? 76.486  34.738  13.062  1.00 33.81  ? 391 THR B CA  1 
ATOM   4436 C  C   . THR B 1 211 ? 77.300  33.449  13.125  1.00 32.25  ? 391 THR B C   1 
ATOM   4437 O  O   . THR B 1 211 ? 78.499  33.445  12.850  1.00 31.79  ? 391 THR B O   1 
ATOM   4438 C  CB  . THR B 1 211 ? 76.260  35.299  14.494  1.00 33.96  ? 391 THR B CB  1 
ATOM   4439 O  OG1 . THR B 1 211 ? 75.660  36.600  14.402  1.00 35.82  ? 391 THR B OG1 1 
ATOM   4440 C  CG2 . THR B 1 211 ? 77.585  35.420  15.254  1.00 32.93  ? 391 THR B CG2 1 
ATOM   4441 N  N   . LEU B 1 212 ? 76.642  32.351  13.480  1.00 31.28  ? 392 LEU B N   1 
ATOM   4442 C  CA  . LEU B 1 212 ? 77.330  31.073  13.547  1.00 31.10  ? 392 LEU B CA  1 
ATOM   4443 C  C   . LEU B 1 212 ? 77.793  30.652  12.159  1.00 29.92  ? 392 LEU B C   1 
ATOM   4444 O  O   . LEU B 1 212 ? 78.882  30.105  12.010  1.00 29.36  ? 392 LEU B O   1 
ATOM   4445 C  CB  . LEU B 1 212 ? 76.422  30.011  14.166  1.00 31.58  ? 392 LEU B CB  1 
ATOM   4446 C  CG  . LEU B 1 212 ? 76.445  30.035  15.702  1.00 34.26  ? 392 LEU B CG  1 
ATOM   4447 C  CD1 . LEU B 1 212 ? 75.276  29.241  16.262  1.00 35.08  ? 392 LEU B CD1 1 
ATOM   4448 C  CD2 . LEU B 1 212 ? 77.774  29.463  16.198  1.00 33.54  ? 392 LEU B CD2 1 
ATOM   4449 N  N   . LEU B 1 213 ? 76.978  30.920  11.140  1.00 29.50  ? 393 LEU B N   1 
ATOM   4450 C  CA  . LEU B 1 213 ? 77.356  30.562  9.776   1.00 29.09  ? 393 LEU B CA  1 
ATOM   4451 C  C   . LEU B 1 213 ? 78.615  31.324  9.356   1.00 28.39  ? 393 LEU B C   1 
ATOM   4452 O  O   . LEU B 1 213 ? 79.524  30.746  8.747   1.00 28.50  ? 393 LEU B O   1 
ATOM   4453 C  CB  . LEU B 1 213 ? 76.222  30.860  8.789   1.00 28.40  ? 393 LEU B CB  1 
ATOM   4454 C  CG  . LEU B 1 213 ? 76.542  30.616  7.302   1.00 29.58  ? 393 LEU B CG  1 
ATOM   4455 C  CD1 . LEU B 1 213 ? 77.120  29.214  7.088   1.00 27.00  ? 393 LEU B CD1 1 
ATOM   4456 C  CD2 . LEU B 1 213 ? 75.264  30.792  6.474   1.00 29.15  ? 393 LEU B CD2 1 
ATOM   4457 N  N   . LYS B 1 214 ? 78.663  32.615  9.683   1.00 26.29  ? 394 LYS B N   1 
ATOM   4458 C  CA  . LYS B 1 214 ? 79.811  33.442  9.340   1.00 25.29  ? 394 LYS B CA  1 
ATOM   4459 C  C   . LYS B 1 214 ? 81.041  32.948  10.081  1.00 24.42  ? 394 LYS B C   1 
ATOM   4460 O  O   . LYS B 1 214 ? 82.142  32.990  9.546   1.00 24.56  ? 394 LYS B O   1 
ATOM   4461 C  CB  . LYS B 1 214 ? 79.534  34.918  9.666   1.00 25.15  ? 394 LYS B CB  1 
ATOM   4462 C  CG  . LYS B 1 214 ? 78.622  35.599  8.656   1.00 25.18  ? 394 LYS B CG  1 
ATOM   4463 C  CD  . LYS B 1 214 ? 78.340  37.056  9.015   1.00 26.84  ? 394 LYS B CD  1 
ATOM   4464 C  CE  . LYS B 1 214 ? 77.459  37.172  10.256  1.00 26.60  ? 394 LYS B CE  1 
ATOM   4465 N  NZ  . LYS B 1 214 ? 77.271  38.592  10.671  1.00 28.08  ? 394 LYS B NZ  1 
ATOM   4466 N  N   . MET B 1 215 ? 80.856  32.476  11.312  1.00 24.99  ? 395 MET B N   1 
ATOM   4467 C  CA  . MET B 1 215 ? 81.968  31.938  12.091  1.00 24.66  ? 395 MET B CA  1 
ATOM   4468 C  C   . MET B 1 215 ? 82.503  30.676  11.408  1.00 24.58  ? 395 MET B C   1 
ATOM   4469 O  O   . MET B 1 215 ? 83.720  30.473  11.302  1.00 23.99  ? 395 MET B O   1 
ATOM   4470 C  CB  . MET B 1 215 ? 81.514  31.612  13.512  1.00 26.33  ? 395 MET B CB  1 
ATOM   4471 C  CG  . MET B 1 215 ? 81.303  32.837  14.386  1.00 26.44  ? 395 MET B CG  1 
ATOM   4472 S  SD  . MET B 1 215 ? 80.357  32.428  15.853  1.00 30.15  ? 395 MET B SD  1 
ATOM   4473 C  CE  . MET B 1 215 ? 81.628  31.680  16.906  1.00 27.14  ? 395 MET B CE  1 
ATOM   4474 N  N   . ILE B 1 216 ? 81.591  29.830  10.945  1.00 23.78  ? 396 ILE B N   1 
ATOM   4475 C  CA  . ILE B 1 216 ? 81.985  28.611  10.251  1.00 24.59  ? 396 ILE B CA  1 
ATOM   4476 C  C   . ILE B 1 216 ? 82.691  28.973  8.942   1.00 24.90  ? 396 ILE B C   1 
ATOM   4477 O  O   . ILE B 1 216 ? 83.695  28.361  8.570   1.00 23.84  ? 396 ILE B O   1 
ATOM   4478 C  CB  . ILE B 1 216 ? 80.757  27.724  9.944   1.00 24.68  ? 396 ILE B CB  1 
ATOM   4479 C  CG1 . ILE B 1 216 ? 80.215  27.125  11.249  1.00 25.12  ? 396 ILE B CG1 1 
ATOM   4480 C  CG2 . ILE B 1 216 ? 81.136  26.624  8.972   1.00 23.83  ? 396 ILE B CG2 1 
ATOM   4481 C  CD1 . ILE B 1 216 ? 81.183  26.168  11.934  1.00 25.00  ? 396 ILE B CD1 1 
ATOM   4482 N  N   . LEU B 1 217 ? 82.172  29.984  8.253   1.00 25.27  ? 397 LEU B N   1 
ATOM   4483 C  CA  . LEU B 1 217 ? 82.771  30.405  6.992   1.00 26.12  ? 397 LEU B CA  1 
ATOM   4484 C  C   . LEU B 1 217 ? 84.214  30.867  7.141   1.00 26.43  ? 397 LEU B C   1 
ATOM   4485 O  O   . LEU B 1 217 ? 85.064  30.525  6.317   1.00 26.67  ? 397 LEU B O   1 
ATOM   4486 C  CB  . LEU B 1 217 ? 81.946  31.519  6.347   1.00 25.39  ? 397 LEU B CB  1 
ATOM   4487 C  CG  . LEU B 1 217 ? 80.638  31.052  5.710   1.00 26.07  ? 397 LEU B CG  1 
ATOM   4488 C  CD1 . LEU B 1 217 ? 79.895  32.243  5.135   1.00 26.23  ? 397 LEU B CD1 1 
ATOM   4489 C  CD2 . LEU B 1 217 ? 80.937  30.038  4.620   1.00 26.73  ? 397 LEU B CD2 1 
ATOM   4490 N  N   . ILE B 1 218 ? 84.509  31.642  8.180   1.00 25.70  ? 398 ILE B N   1 
ATOM   4491 C  CA  . ILE B 1 218 ? 85.877  32.103  8.327   1.00 24.54  ? 398 ILE B CA  1 
ATOM   4492 C  C   . ILE B 1 218 ? 86.765  30.957  8.814   1.00 23.52  ? 398 ILE B C   1 
ATOM   4493 O  O   . ILE B 1 218 ? 87.937  30.877  8.446   1.00 22.67  ? 398 ILE B O   1 
ATOM   4494 C  CB  . ILE B 1 218 ? 85.971  33.353  9.255   1.00 24.79  ? 398 ILE B CB  1 
ATOM   4495 C  CG1 . ILE B 1 218 ? 87.392  33.928  9.194   1.00 25.87  ? 398 ILE B CG1 1 
ATOM   4496 C  CG2 . ILE B 1 218 ? 85.586  33.001  10.675  1.00 24.37  ? 398 ILE B CG2 1 
ATOM   4497 C  CD1 . ILE B 1 218 ? 87.526  35.316  9.788   1.00 27.27  ? 398 ILE B CD1 1 
ATOM   4498 N  N   . LYS B 1 219 ? 86.207  30.061  9.621   1.00 22.27  ? 399 LYS B N   1 
ATOM   4499 C  CA  . LYS B 1 219 ? 86.973  28.914  10.094  1.00 22.25  ? 399 LYS B CA  1 
ATOM   4500 C  C   . LYS B 1 219 ? 87.347  28.051  8.883   1.00 23.94  ? 399 LYS B C   1 
ATOM   4501 O  O   . LYS B 1 219 ? 88.489  27.603  8.756   1.00 24.86  ? 399 LYS B O   1 
ATOM   4502 C  CB  . LYS B 1 219 ? 86.161  28.107  11.113  1.00 20.07  ? 399 LYS B CB  1 
ATOM   4503 C  CG  . LYS B 1 219 ? 86.253  28.676  12.520  1.00 18.89  ? 399 LYS B CG  1 
ATOM   4504 C  CD  . LYS B 1 219 ? 85.406  27.906  13.536  1.00 19.23  ? 399 LYS B CD  1 
ATOM   4505 C  CE  . LYS B 1 219 ? 85.735  26.414  13.558  1.00 19.25  ? 399 LYS B CE  1 
ATOM   4506 N  NZ  . LYS B 1 219 ? 87.207  26.167  13.685  1.00 18.38  ? 399 LYS B NZ  1 
ATOM   4507 N  N   . CYS B 1 220 ? 86.387  27.839  7.986   1.00 24.67  ? 400 CYS B N   1 
ATOM   4508 C  CA  . CYS B 1 220 ? 86.635  27.060  6.775   1.00 26.04  ? 400 CYS B CA  1 
ATOM   4509 C  C   . CYS B 1 220 ? 87.792  27.634  5.967   1.00 26.30  ? 400 CYS B C   1 
ATOM   4510 O  O   . CYS B 1 220 ? 88.716  26.914  5.597   1.00 26.04  ? 400 CYS B O   1 
ATOM   4511 C  CB  . CYS B 1 220 ? 85.395  27.035  5.880   1.00 26.23  ? 400 CYS B CB  1 
ATOM   4512 S  SG  . CYS B 1 220 ? 84.124  25.852  6.368   1.00 30.60  ? 400 CYS B SG  1 
ATOM   4513 N  N   . CYS B 1 221 ? 87.731  28.934  5.691   1.00 26.51  ? 401 CYS B N   1 
ATOM   4514 C  CA  . CYS B 1 221 ? 88.763  29.599  4.904   1.00 26.33  ? 401 CYS B CA  1 
ATOM   4515 C  C   . CYS B 1 221 ? 90.125  29.596  5.567   1.00 26.75  ? 401 CYS B C   1 
ATOM   4516 O  O   . CYS B 1 221 ? 91.144  29.455  4.896   1.00 26.17  ? 401 CYS B O   1 
ATOM   4517 C  CB  . CYS B 1 221 ? 88.360  31.044  4.607   1.00 26.40  ? 401 CYS B CB  1 
ATOM   4518 S  SG  . CYS B 1 221 ? 86.847  31.222  3.637   1.00 26.25  ? 401 CYS B SG  1 
ATOM   4519 N  N   . ASP B 1 222 ? 90.143  29.758  6.885   1.00 27.13  ? 402 ASP B N   1 
ATOM   4520 C  CA  . ASP B 1 222 ? 91.398  29.795  7.619   1.00 27.79  ? 402 ASP B CA  1 
ATOM   4521 C  C   . ASP B 1 222 ? 92.193  28.507  7.467   1.00 28.06  ? 402 ASP B C   1 
ATOM   4522 O  O   . ASP B 1 222 ? 93.383  28.542  7.178   1.00 28.43  ? 402 ASP B O   1 
ATOM   4523 C  CB  . ASP B 1 222 ? 91.135  30.068  9.100   1.00 28.22  ? 402 ASP B CB  1 
ATOM   4524 C  CG  . ASP B 1 222 ? 92.418  30.144  9.916   1.00 29.58  ? 402 ASP B CG  1 
ATOM   4525 O  OD1 . ASP B 1 222 ? 93.468  30.549  9.365   1.00 32.77  ? 402 ASP B OD1 1 
ATOM   4526 O  OD2 . ASP B 1 222 ? 92.378  29.821  11.120  1.00 29.94  ? 402 ASP B OD2 1 
ATOM   4527 N  N   . ILE B 1 223 ? 91.535  27.371  7.652   1.00 27.90  ? 403 ILE B N   1 
ATOM   4528 C  CA  . ILE B 1 223 ? 92.217  26.091  7.541   1.00 27.88  ? 403 ILE B CA  1 
ATOM   4529 C  C   . ILE B 1 223 ? 91.885  25.405  6.217   1.00 28.50  ? 403 ILE B C   1 
ATOM   4530 O  O   . ILE B 1 223 ? 91.868  24.182  6.134   1.00 28.74  ? 403 ILE B O   1 
ATOM   4531 C  CB  . ILE B 1 223 ? 91.829  25.169  8.728   1.00 27.30  ? 403 ILE B CB  1 
ATOM   4532 C  CG1 . ILE B 1 223 ? 90.324  24.882  8.712   1.00 26.58  ? 403 ILE B CG1 1 
ATOM   4533 C  CG2 . ILE B 1 223 ? 92.201  25.847  10.051  1.00 26.03  ? 403 ILE B CG2 1 
ATOM   4534 C  CD1 . ILE B 1 223 ? 89.862  23.961  9.832   1.00 27.20  ? 403 ILE B CD1 1 
ATOM   4535 N  N   . SER B 1 224 ? 91.650  26.206  5.179   1.00 29.20  ? 404 SER B N   1 
ATOM   4536 C  CA  . SER B 1 224 ? 91.282  25.686  3.859   1.00 29.31  ? 404 SER B CA  1 
ATOM   4537 C  C   . SER B 1 224 ? 92.420  25.226  2.942   1.00 29.11  ? 404 SER B C   1 
ATOM   4538 O  O   . SER B 1 224 ? 92.168  24.860  1.793   1.00 29.51  ? 404 SER B O   1 
ATOM   4539 C  CB  . SER B 1 224 ? 90.463  26.740  3.102   1.00 29.56  ? 404 SER B CB  1 
ATOM   4540 O  OG  . SER B 1 224 ? 91.287  27.820  2.682   1.00 28.25  ? 404 SER B OG  1 
ATOM   4541 N  N   . ASN B 1 225 ? 93.659  25.243  3.421   1.00 29.05  ? 405 ASN B N   1 
ATOM   4542 C  CA  . ASN B 1 225 ? 94.779  24.839  2.572   1.00 29.49  ? 405 ASN B CA  1 
ATOM   4543 C  C   . ASN B 1 225 ? 94.588  23.513  1.837   1.00 30.44  ? 405 ASN B C   1 
ATOM   4544 O  O   . ASN B 1 225 ? 94.852  23.432  0.637   1.00 31.11  ? 405 ASN B O   1 
ATOM   4545 C  CB  . ASN B 1 225 ? 96.088  24.792  3.370   1.00 29.02  ? 405 ASN B CB  1 
ATOM   4546 C  CG  . ASN B 1 225 ? 96.665  26.181  3.631   1.00 29.73  ? 405 ASN B CG  1 
ATOM   4547 O  OD1 . ASN B 1 225 ? 96.280  27.163  2.985   1.00 29.21  ? 405 ASN B OD1 1 
ATOM   4548 N  ND2 . ASN B 1 225 ? 97.605  26.266  4.572   1.00 28.56  ? 405 ASN B ND2 1 
ATOM   4549 N  N   . GLU B 1 226 ? 94.119  22.483  2.538   1.00 31.01  ? 406 GLU B N   1 
ATOM   4550 C  CA  . GLU B 1 226 ? 93.928  21.173  1.919   1.00 32.03  ? 406 GLU B CA  1 
ATOM   4551 C  C   . GLU B 1 226 ? 92.812  21.096  0.876   1.00 33.41  ? 406 GLU B C   1 
ATOM   4552 O  O   . GLU B 1 226 ? 92.638  20.061  0.226   1.00 33.14  ? 406 GLU B O   1 
ATOM   4553 C  CB  . GLU B 1 226 ? 93.708  20.106  2.998   1.00 31.60  ? 406 GLU B CB  1 
ATOM   4554 C  CG  . GLU B 1 226 ? 94.977  19.780  3.776   1.00 31.35  ? 406 GLU B CG  1 
ATOM   4555 C  CD  . GLU B 1 226 ? 96.077  19.235  2.881   1.00 31.08  ? 406 GLU B CD  1 
ATOM   4556 O  OE1 . GLU B 1 226 ? 97.269  19.371  3.235   1.00 32.80  ? 406 GLU B OE1 1 
ATOM   4557 O  OE2 . GLU B 1 226 ? 95.749  18.659  1.823   1.00 31.09  ? 406 GLU B OE2 1 
ATOM   4558 N  N   . VAL B 1 227 ? 92.053  22.180  0.723   1.00 33.61  ? 407 VAL B N   1 
ATOM   4559 C  CA  . VAL B 1 227 ? 90.977  22.223  -0.265  1.00 34.31  ? 407 VAL B CA  1 
ATOM   4560 C  C   . VAL B 1 227 ? 91.603  22.582  -1.612  1.00 34.85  ? 407 VAL B C   1 
ATOM   4561 O  O   . VAL B 1 227 ? 91.070  22.253  -2.673  1.00 34.99  ? 407 VAL B O   1 
ATOM   4562 C  CB  . VAL B 1 227 ? 89.911  23.298  0.098   1.00 35.41  ? 407 VAL B CB  1 
ATOM   4563 C  CG1 . VAL B 1 227 ? 88.933  23.477  -1.047  1.00 35.51  ? 407 VAL B CG1 1 
ATOM   4564 C  CG2 . VAL B 1 227 ? 89.155  22.885  1.359   1.00 35.14  ? 407 VAL B CG2 1 
ATOM   4565 N  N   . ARG B 1 228 ? 92.749  23.252  -1.551  1.00 34.76  ? 408 ARG B N   1 
ATOM   4566 C  CA  . ARG B 1 228 ? 93.465  23.685  -2.742  1.00 35.35  ? 408 ARG B CA  1 
ATOM   4567 C  C   . ARG B 1 228 ? 94.130  22.517  -3.476  1.00 36.67  ? 408 ARG B C   1 
ATOM   4568 O  O   . ARG B 1 228 ? 94.372  21.458  -2.886  1.00 36.99  ? 408 ARG B O   1 
ATOM   4569 C  CB  . ARG B 1 228 ? 94.516  24.731  -2.351  1.00 34.07  ? 408 ARG B CB  1 
ATOM   4570 C  CG  . ARG B 1 228 ? 93.919  25.999  -1.731  1.00 33.95  ? 408 ARG B CG  1 
ATOM   4571 C  CD  . ARG B 1 228 ? 94.994  27.002  -1.299  1.00 33.48  ? 408 ARG B CD  1 
ATOM   4572 N  NE  . ARG B 1 228 ? 94.409  28.225  -0.745  1.00 32.97  ? 408 ARG B NE  1 
ATOM   4573 C  CZ  . ARG B 1 228 ? 93.789  29.156  -1.465  1.00 31.95  ? 408 ARG B CZ  1 
ATOM   4574 N  NH1 . ARG B 1 228 ? 93.671  29.021  -2.778  1.00 31.58  ? 408 ARG B NH1 1 
ATOM   4575 N  NH2 . ARG B 1 228 ? 93.272  30.218  -0.869  1.00 32.16  ? 408 ARG B NH2 1 
ATOM   4576 N  N   . PRO B 1 229 ? 94.424  22.693  -4.780  1.00 37.64  ? 409 PRO B N   1 
ATOM   4577 C  CA  . PRO B 1 229 ? 95.065  21.641  -5.577  1.00 38.71  ? 409 PRO B CA  1 
ATOM   4578 C  C   . PRO B 1 229 ? 96.306  21.097  -4.869  1.00 39.47  ? 409 PRO B C   1 
ATOM   4579 O  O   . PRO B 1 229 ? 97.064  21.856  -4.255  1.00 38.98  ? 409 PRO B O   1 
ATOM   4580 C  CB  . PRO B 1 229 ? 95.400  22.359  -6.882  1.00 38.51  ? 409 PRO B CB  1 
ATOM   4581 C  CG  . PRO B 1 229 ? 94.259  23.317  -7.020  1.00 37.81  ? 409 PRO B CG  1 
ATOM   4582 C  CD  . PRO B 1 229 ? 94.155  23.881  -5.614  1.00 37.59  ? 409 PRO B CD  1 
ATOM   4583 N  N   . MET B 1 230 ? 96.496  19.784  -4.965  1.00 40.67  ? 410 MET B N   1 
ATOM   4584 C  CA  . MET B 1 230 ? 97.612  19.088  -4.327  1.00 42.71  ? 410 MET B CA  1 
ATOM   4585 C  C   . MET B 1 230 ? 98.940  19.851  -4.348  1.00 42.50  ? 410 MET B C   1 
ATOM   4586 O  O   . MET B 1 230 ? 99.564  20.054  -3.306  1.00 42.41  ? 410 MET B O   1 
ATOM   4587 C  CB  . MET B 1 230 ? 97.779  17.699  -4.969  1.00 45.34  ? 410 MET B CB  1 
ATOM   4588 C  CG  . MET B 1 230 ? 98.862  16.813  -4.345  1.00 49.29  ? 410 MET B CG  1 
ATOM   4589 S  SD  . MET B 1 230 ? 100.547 17.404  -4.699  1.00 54.00  ? 410 MET B SD  1 
ATOM   4590 C  CE  . MET B 1 230 ? 101.538 16.292  -3.776  1.00 53.82  ? 410 MET B CE  1 
ATOM   4591 N  N   . GLU B 1 231 ? 99.368  20.281  -5.528  1.00 42.72  ? 411 GLU B N   1 
ATOM   4592 C  CA  . GLU B 1 231 ? 100.635 20.993  -5.654  1.00 43.69  ? 411 GLU B CA  1 
ATOM   4593 C  C   . GLU B 1 231 ? 100.676 22.319  -4.904  1.00 42.29  ? 411 GLU B C   1 
ATOM   4594 O  O   . GLU B 1 231 ? 101.743 22.753  -4.464  1.00 41.30  ? 411 GLU B O   1 
ATOM   4595 C  CB  . GLU B 1 231 ? 100.944 21.216  -7.131  1.00 47.56  ? 411 GLU B CB  1 
ATOM   4596 C  CG  . GLU B 1 231 ? 100.947 19.924  -7.920  1.00 53.73  ? 411 GLU B CG  1 
ATOM   4597 C  CD  . GLU B 1 231 ? 100.756 20.152  -9.401  1.00 58.38  ? 411 GLU B CD  1 
ATOM   4598 O  OE1 . GLU B 1 231 ? 99.693  20.702  -9.776  1.00 61.47  ? 411 GLU B OE1 1 
ATOM   4599 O  OE2 . GLU B 1 231 ? 101.663 19.784  -10.186 1.00 60.38  ? 411 GLU B OE2 1 
ATOM   4600 N  N   . VAL B 1 232 ? 99.522  22.963  -4.758  1.00 40.72  ? 412 VAL B N   1 
ATOM   4601 C  CA  . VAL B 1 232 ? 99.457  24.235  -4.043  1.00 39.86  ? 412 VAL B CA  1 
ATOM   4602 C  C   . VAL B 1 232 ? 99.382  23.982  -2.541  1.00 40.00  ? 412 VAL B C   1 
ATOM   4603 O  O   . VAL B 1 232 ? 100.027 24.671  -1.750  1.00 39.18  ? 412 VAL B O   1 
ATOM   4604 C  CB  . VAL B 1 232 ? 98.221  25.060  -4.459  1.00 39.49  ? 412 VAL B CB  1 
ATOM   4605 C  CG1 . VAL B 1 232 ? 98.160  26.346  -3.651  1.00 38.28  ? 412 VAL B CG1 1 
ATOM   4606 C  CG2 . VAL B 1 232 ? 98.282  25.370  -5.951  1.00 37.74  ? 412 VAL B CG2 1 
ATOM   4607 N  N   . ALA B 1 233 ? 98.598  22.979  -2.162  1.00 39.73  ? 413 ALA B N   1 
ATOM   4608 C  CA  . ALA B 1 233 ? 98.413  22.628  -0.761  1.00 39.75  ? 413 ALA B CA  1 
ATOM   4609 C  C   . ALA B 1 233 ? 99.645  22.039  -0.074  1.00 39.67  ? 413 ALA B C   1 
ATOM   4610 O  O   . ALA B 1 233 ? 100.013 22.460  1.022   1.00 39.30  ? 413 ALA B O   1 
ATOM   4611 C  CB  . ALA B 1 233 ? 97.242  21.660  -0.632  1.00 39.42  ? 413 ALA B CB  1 
ATOM   4612 N  N   . GLU B 1 234 ? 100.281 21.070  -0.720  1.00 40.23  ? 414 GLU B N   1 
ATOM   4613 C  CA  . GLU B 1 234 ? 101.445 20.391  -0.154  1.00 40.64  ? 414 GLU B CA  1 
ATOM   4614 C  C   . GLU B 1 234 ? 102.534 21.228  0.508   1.00 38.64  ? 414 GLU B C   1 
ATOM   4615 O  O   . GLU B 1 234 ? 102.922 20.960  1.645   1.00 38.27  ? 414 GLU B O   1 
ATOM   4616 C  CB  . GLU B 1 234 ? 102.082 19.488  -1.213  1.00 44.77  ? 414 GLU B CB  1 
ATOM   4617 C  CG  . GLU B 1 234 ? 101.868 18.005  -0.949  1.00 50.98  ? 414 GLU B CG  1 
ATOM   4618 C  CD  . GLU B 1 234 ? 103.167 17.268  -0.648  1.00 54.73  ? 414 GLU B CD  1 
ATOM   4619 O  OE1 . GLU B 1 234 ? 104.001 17.127  -1.573  1.00 56.86  ? 414 GLU B OE1 1 
ATOM   4620 O  OE2 . GLU B 1 234 ? 103.353 16.832  0.512   1.00 56.40  ? 414 GLU B OE2 1 
ATOM   4621 N  N   . PRO B 1 235 ? 103.060 22.247  -0.189  1.00 37.21  ? 415 PRO B N   1 
ATOM   4622 C  CA  . PRO B 1 235 ? 104.108 23.036  0.462   1.00 35.80  ? 415 PRO B CA  1 
ATOM   4623 C  C   . PRO B 1 235 ? 103.686 23.768  1.741   1.00 35.06  ? 415 PRO B C   1 
ATOM   4624 O  O   . PRO B 1 235 ? 104.543 24.166  2.535   1.00 34.11  ? 415 PRO B O   1 
ATOM   4625 C  CB  . PRO B 1 235 ? 104.592 23.971  -0.654  1.00 35.59  ? 415 PRO B CB  1 
ATOM   4626 C  CG  . PRO B 1 235 ? 103.417 24.064  -1.577  1.00 37.20  ? 415 PRO B CG  1 
ATOM   4627 C  CD  . PRO B 1 235 ? 102.860 22.668  -1.585  1.00 36.95  ? 415 PRO B CD  1 
ATOM   4628 N  N   . TRP B 1 236 ? 102.379 23.937  1.947   1.00 34.16  ? 416 TRP B N   1 
ATOM   4629 C  CA  . TRP B 1 236 ? 101.889 24.604  3.154   1.00 33.49  ? 416 TRP B CA  1 
ATOM   4630 C  C   . TRP B 1 236 ? 101.991 23.677  4.354   1.00 34.20  ? 416 TRP B C   1 
ATOM   4631 O  O   . TRP B 1 236 ? 102.017 24.137  5.494   1.00 34.42  ? 416 TRP B O   1 
ATOM   4632 C  CB  . TRP B 1 236 ? 100.435 25.059  3.005   1.00 32.15  ? 416 TRP B CB  1 
ATOM   4633 C  CG  . TRP B 1 236 ? 100.274 26.367  2.291   1.00 31.63  ? 416 TRP B CG  1 
ATOM   4634 C  CD1 . TRP B 1 236 ? 99.793  26.555  1.031   1.00 30.39  ? 416 TRP B CD1 1 
ATOM   4635 C  CD2 . TRP B 1 236 ? 100.585 27.670  2.803   1.00 30.23  ? 416 TRP B CD2 1 
ATOM   4636 N  NE1 . TRP B 1 236 ? 99.781  27.892  0.723   1.00 31.19  ? 416 TRP B NE1 1 
ATOM   4637 C  CE2 . TRP B 1 236 ? 100.262 28.602  1.792   1.00 31.60  ? 416 TRP B CE2 1 
ATOM   4638 C  CE3 . TRP B 1 236 ? 101.104 28.142  4.016   1.00 31.11  ? 416 TRP B CE3 1 
ATOM   4639 C  CZ2 . TRP B 1 236 ? 100.441 29.983  1.957   1.00 30.64  ? 416 TRP B CZ2 1 
ATOM   4640 C  CZ3 . TRP B 1 236 ? 101.282 29.518  4.182   1.00 30.01  ? 416 TRP B CZ3 1 
ATOM   4641 C  CH2 . TRP B 1 236 ? 100.949 30.419  3.154   1.00 30.73  ? 416 TRP B CH2 1 
ATOM   4642 N  N   . VAL B 1 237 ? 102.039 22.370  4.107   1.00 35.01  ? 417 VAL B N   1 
ATOM   4643 C  CA  . VAL B 1 237 ? 102.161 21.427  5.213   1.00 36.08  ? 417 VAL B CA  1 
ATOM   4644 C  C   . VAL B 1 237 ? 103.563 21.577  5.803   1.00 36.11  ? 417 VAL B C   1 
ATOM   4645 O  O   . VAL B 1 237 ? 103.731 21.578  7.018   1.00 35.57  ? 417 VAL B O   1 
ATOM   4646 C  CB  . VAL B 1 237 ? 101.946 19.966  4.761   1.00 36.74  ? 417 VAL B CB  1 
ATOM   4647 C  CG1 . VAL B 1 237 ? 102.026 19.043  5.966   1.00 37.08  ? 417 VAL B CG1 1 
ATOM   4648 C  CG2 . VAL B 1 237 ? 100.592 19.819  4.076   1.00 36.91  ? 417 VAL B CG2 1 
ATOM   4649 N  N   . ASP B 1 238 ? 104.560 21.730  4.933   1.00 37.18  ? 418 ASP B N   1 
ATOM   4650 C  CA  . ASP B 1 238 ? 105.951 21.904  5.362   1.00 38.71  ? 418 ASP B CA  1 
ATOM   4651 C  C   . ASP B 1 238 ? 106.108 23.181  6.176   1.00 37.67  ? 418 ASP B C   1 
ATOM   4652 O  O   . ASP B 1 238 ? 106.835 23.206  7.169   1.00 37.61  ? 418 ASP B O   1 
ATOM   4653 C  CB  . ASP B 1 238 ? 106.890 21.970  4.149   1.00 41.49  ? 418 ASP B CB  1 
ATOM   4654 C  CG  . ASP B 1 238 ? 107.032 20.632  3.445   1.00 45.63  ? 418 ASP B CG  1 
ATOM   4655 O  OD1 . ASP B 1 238 ? 107.616 19.700  4.047   1.00 46.75  ? 418 ASP B OD1 1 
ATOM   4656 O  OD2 . ASP B 1 238 ? 106.555 20.515  2.292   1.00 47.37  ? 418 ASP B OD2 1 
ATOM   4657 N  N   . CYS B 1 239 ? 105.435 24.245  5.739   1.00 37.04  ? 419 CYS B N   1 
ATOM   4658 C  CA  . CYS B 1 239 ? 105.487 25.526  6.432   1.00 35.99  ? 419 CYS B CA  1 
ATOM   4659 C  C   . CYS B 1 239 ? 104.913 25.378  7.834   1.00 34.94  ? 419 CYS B C   1 
ATOM   4660 O  O   . CYS B 1 239 ? 105.528 25.793  8.810   1.00 35.23  ? 419 CYS B O   1 
ATOM   4661 C  CB  . CYS B 1 239 ? 104.689 26.583  5.666   1.00 37.22  ? 419 CYS B CB  1 
ATOM   4662 S  SG  . CYS B 1 239 ? 105.393 27.025  4.078   1.00 39.01  ? 419 CYS B SG  1 
ATOM   4663 N  N   . LEU B 1 240 ? 103.729 24.783  7.921   1.00 34.03  ? 420 LEU B N   1 
ATOM   4664 C  CA  . LEU B 1 240 ? 103.069 24.571  9.204   1.00 33.81  ? 420 LEU B CA  1 
ATOM   4665 C  C   . LEU B 1 240 ? 103.969 23.798  10.173  1.00 33.63  ? 420 LEU B C   1 
ATOM   4666 O  O   . LEU B 1 240 ? 104.193 24.229  11.306  1.00 33.35  ? 420 LEU B O   1 
ATOM   4667 C  CB  . LEU B 1 240 ? 101.754 23.809  9.000   1.00 32.55  ? 420 LEU B CB  1 
ATOM   4668 C  CG  . LEU B 1 240 ? 100.918 23.580  10.265  1.00 33.33  ? 420 LEU B CG  1 
ATOM   4669 C  CD1 . LEU B 1 240 ? 100.469 24.921  10.832  1.00 32.36  ? 420 LEU B CD1 1 
ATOM   4670 C  CD2 . LEU B 1 240 ? 99.718  22.707  9.938   1.00 32.09  ? 420 LEU B CD2 1 
ATOM   4671 N  N   . LEU B 1 241 ? 104.483 22.653  9.733   1.00 33.64  ? 421 LEU B N   1 
ATOM   4672 C  CA  . LEU B 1 241 ? 105.351 21.856  10.591  1.00 34.58  ? 421 LEU B CA  1 
ATOM   4673 C  C   . LEU B 1 241 ? 106.590 22.639  10.999  1.00 34.58  ? 421 LEU B C   1 
ATOM   4674 O  O   . LEU B 1 241 ? 107.033 22.554  12.138  1.00 34.74  ? 421 LEU B O   1 
ATOM   4675 C  CB  . LEU B 1 241 ? 105.761 20.550  9.895   1.00 34.70  ? 421 LEU B CB  1 
ATOM   4676 C  CG  . LEU B 1 241 ? 104.645 19.521  9.672   1.00 34.81  ? 421 LEU B CG  1 
ATOM   4677 C  CD1 . LEU B 1 241 ? 105.256 18.218  9.191   1.00 35.58  ? 421 LEU B CD1 1 
ATOM   4678 C  CD2 . LEU B 1 241 ? 103.882 19.282  10.965  1.00 34.39  ? 421 LEU B CD2 1 
ATOM   4679 N  N   . GLU B 1 242 ? 107.148 23.412  10.074  1.00 35.25  ? 422 GLU B N   1 
ATOM   4680 C  CA  . GLU B 1 242 ? 108.335 24.198  10.387  1.00 36.59  ? 422 GLU B CA  1 
ATOM   4681 C  C   . GLU B 1 242 ? 108.067 25.061  11.626  1.00 36.55  ? 422 GLU B C   1 
ATOM   4682 O  O   . GLU B 1 242 ? 108.927 25.215  12.500  1.00 36.59  ? 422 GLU B O   1 
ATOM   4683 C  CB  . GLU B 1 242 ? 108.699 25.088  9.196   1.00 38.56  ? 422 GLU B CB  1 
ATOM   4684 C  CG  . GLU B 1 242 ? 110.123 25.629  9.228   1.00 41.50  ? 422 GLU B CG  1 
ATOM   4685 C  CD  . GLU B 1 242 ? 110.403 26.589  8.083   1.00 44.16  ? 422 GLU B CD  1 
ATOM   4686 O  OE1 . GLU B 1 242 ? 110.025 26.272  6.930   1.00 44.77  ? 422 GLU B OE1 1 
ATOM   4687 O  OE2 . GLU B 1 242 ? 111.005 27.658  8.335   1.00 45.15  ? 422 GLU B OE2 1 
ATOM   4688 N  N   . GLU B 1 243 ? 106.859 25.613  11.700  1.00 35.81  ? 423 GLU B N   1 
ATOM   4689 C  CA  . GLU B 1 243 ? 106.468 26.460  12.820  1.00 35.31  ? 423 GLU B CA  1 
ATOM   4690 C  C   . GLU B 1 243 ? 106.259 25.607  14.075  1.00 34.55  ? 423 GLU B C   1 
ATOM   4691 O  O   . GLU B 1 243 ? 106.750 25.938  15.155  1.00 34.29  ? 423 GLU B O   1 
ATOM   4692 C  CB  . GLU B 1 243 ? 105.186 27.229  12.460  1.00 35.70  ? 423 GLU B CB  1 
ATOM   4693 C  CG  . GLU B 1 243 ? 105.077 28.604  13.107  1.00 35.88  ? 423 GLU B CG  1 
ATOM   4694 C  CD  . GLU B 1 243 ? 104.050 29.507  12.432  1.00 35.80  ? 423 GLU B CD  1 
ATOM   4695 O  OE1 . GLU B 1 243 ? 104.253 29.891  11.258  1.00 35.25  ? 423 GLU B OE1 1 
ATOM   4696 O  OE2 . GLU B 1 243 ? 103.037 29.832  13.082  1.00 35.53  ? 423 GLU B OE2 1 
ATOM   4697 N  N   . TYR B 1 244 ? 105.537 24.501  13.928  1.00 34.14  ? 424 TYR B N   1 
ATOM   4698 C  CA  . TYR B 1 244 ? 105.286 23.607  15.051  1.00 33.69  ? 424 TYR B CA  1 
ATOM   4699 C  C   . TYR B 1 244 ? 106.600 23.103  15.648  1.00 33.76  ? 424 TYR B C   1 
ATOM   4700 O  O   . TYR B 1 244 ? 106.801 23.162  16.865  1.00 34.04  ? 424 TYR B O   1 
ATOM   4701 C  CB  . TYR B 1 244 ? 104.441 22.406  14.609  1.00 33.26  ? 424 TYR B CB  1 
ATOM   4702 C  CG  . TYR B 1 244 ? 102.969 22.684  14.349  1.00 33.24  ? 424 TYR B CG  1 
ATOM   4703 C  CD1 . TYR B 1 244 ? 102.428 23.963  14.495  1.00 32.52  ? 424 TYR B CD1 1 
ATOM   4704 C  CD2 . TYR B 1 244 ? 102.112 21.648  13.974  1.00 33.42  ? 424 TYR B CD2 1 
ATOM   4705 C  CE1 . TYR B 1 244 ? 101.067 24.201  14.272  1.00 32.87  ? 424 TYR B CE1 1 
ATOM   4706 C  CE2 . TYR B 1 244 ? 100.757 21.871  13.750  1.00 33.19  ? 424 TYR B CE2 1 
ATOM   4707 C  CZ  . TYR B 1 244 ? 100.240 23.145  13.900  1.00 33.73  ? 424 TYR B CZ  1 
ATOM   4708 O  OH  . TYR B 1 244 ? 98.901  23.351  13.665  1.00 33.25  ? 424 TYR B OH  1 
ATOM   4709 N  N   . PHE B 1 245 ? 107.489 22.602  14.792  1.00 33.44  ? 425 PHE B N   1 
ATOM   4710 C  CA  . PHE B 1 245 ? 108.778 22.085  15.251  1.00 33.62  ? 425 PHE B CA  1 
ATOM   4711 C  C   . PHE B 1 245 ? 109.586 23.187  15.927  1.00 33.58  ? 425 PHE B C   1 
ATOM   4712 O  O   . PHE B 1 245 ? 110.279 22.940  16.915  1.00 33.60  ? 425 PHE B O   1 
ATOM   4713 C  CB  . PHE B 1 245 ? 109.583 21.495  14.080  1.00 32.66  ? 425 PHE B CB  1 
ATOM   4714 C  CG  . PHE B 1 245 ? 108.961 20.267  13.460  1.00 31.70  ? 425 PHE B CG  1 
ATOM   4715 C  CD1 . PHE B 1 245 ? 107.872 19.636  14.056  1.00 31.88  ? 425 PHE B CD1 1 
ATOM   4716 C  CD2 . PHE B 1 245 ? 109.481 19.731  12.286  1.00 31.96  ? 425 PHE B CD2 1 
ATOM   4717 C  CE1 . PHE B 1 245 ? 107.310 18.488  13.490  1.00 31.49  ? 425 PHE B CE1 1 
ATOM   4718 C  CE2 . PHE B 1 245 ? 108.929 18.588  11.713  1.00 31.15  ? 425 PHE B CE2 1 
ATOM   4719 C  CZ  . PHE B 1 245 ? 107.842 17.965  12.315  1.00 32.18  ? 425 PHE B CZ  1 
ATOM   4720 N  N   . MET B 1 246 ? 109.497 24.401  15.393  1.00 33.81  ? 426 MET B N   1 
ATOM   4721 C  CA  . MET B 1 246 ? 110.217 25.522  15.978  1.00 34.28  ? 426 MET B CA  1 
ATOM   4722 C  C   . MET B 1 246 ? 109.738 25.727  17.414  1.00 33.23  ? 426 MET B C   1 
ATOM   4723 O  O   . MET B 1 246 ? 110.538 25.991  18.311  1.00 33.73  ? 426 MET B O   1 
ATOM   4724 C  CB  . MET B 1 246 ? 109.979 26.799  15.162  1.00 36.23  ? 426 MET B CB  1 
ATOM   4725 C  CG  . MET B 1 246 ? 110.786 28.003  15.654  1.00 39.34  ? 426 MET B CG  1 
ATOM   4726 S  SD  . MET B 1 246 ? 110.557 29.506  14.653  1.00 43.46  ? 426 MET B SD  1 
ATOM   4727 C  CE  . MET B 1 246 ? 110.958 28.874  13.010  1.00 39.81  ? 426 MET B CE  1 
ATOM   4728 N  N   . GLN B 1 247 ? 108.430 25.589  17.629  1.00 32.27  ? 427 GLN B N   1 
ATOM   4729 C  CA  . GLN B 1 247 ? 107.856 25.772  18.957  1.00 30.87  ? 427 GLN B CA  1 
ATOM   4730 C  C   . GLN B 1 247 ? 108.200 24.637  19.909  1.00 31.19  ? 427 GLN B C   1 
ATOM   4731 O  O   . GLN B 1 247 ? 108.594 24.888  21.048  1.00 31.72  ? 427 GLN B O   1 
ATOM   4732 C  CB  . GLN B 1 247 ? 106.334 25.909  18.884  1.00 29.68  ? 427 GLN B CB  1 
ATOM   4733 C  CG  . GLN B 1 247 ? 105.672 26.045  20.253  1.00 26.48  ? 427 GLN B CG  1 
ATOM   4734 C  CD  . GLN B 1 247 ? 104.165 26.125  20.168  1.00 26.39  ? 427 GLN B CD  1 
ATOM   4735 O  OE1 . GLN B 1 247 ? 103.618 26.679  19.209  1.00 25.31  ? 427 GLN B OE1 1 
ATOM   4736 N  NE2 . GLN B 1 247 ? 103.480 25.590  21.178  1.00 24.17  ? 427 GLN B NE2 1 
ATOM   4737 N  N   . SER B 1 248 ? 108.035 23.392  19.463  1.00 31.42  ? 428 SER B N   1 
ATOM   4738 C  CA  . SER B 1 248 ? 108.348 22.254  20.327  1.00 32.07  ? 428 SER B CA  1 
ATOM   4739 C  C   . SER B 1 248 ? 109.829 22.230  20.710  1.00 32.81  ? 428 SER B C   1 
ATOM   4740 O  O   . SER B 1 248 ? 110.160 21.934  21.858  1.00 33.09  ? 428 SER B O   1 
ATOM   4741 C  CB  . SER B 1 248 ? 107.936 20.930  19.669  1.00 31.12  ? 428 SER B CB  1 
ATOM   4742 O  OG  . SER B 1 248 ? 108.535 20.760  18.403  1.00 31.99  ? 428 SER B OG  1 
ATOM   4743 N  N   . ASP B 1 249 ? 110.721 22.552  19.773  1.00 34.43  ? 429 ASP B N   1 
ATOM   4744 C  CA  . ASP B 1 249 ? 112.150 22.581  20.098  1.00 36.06  ? 429 ASP B CA  1 
ATOM   4745 C  C   . ASP B 1 249 ? 112.360 23.595  21.217  1.00 36.84  ? 429 ASP B C   1 
ATOM   4746 O  O   . ASP B 1 249 ? 113.085 23.337  22.181  1.00 37.26  ? 429 ASP B O   1 
ATOM   4747 C  CB  . ASP B 1 249 ? 113.005 22.999  18.896  1.00 36.59  ? 429 ASP B CB  1 
ATOM   4748 C  CG  . ASP B 1 249 ? 113.061 21.938  17.813  1.00 37.77  ? 429 ASP B CG  1 
ATOM   4749 O  OD1 . ASP B 1 249 ? 112.801 20.754  18.109  1.00 38.04  ? 429 ASP B OD1 1 
ATOM   4750 O  OD2 . ASP B 1 249 ? 113.383 22.292  16.664  1.00 37.30  ? 429 ASP B OD2 1 
ATOM   4751 N  N   . ARG B 1 250 ? 111.718 24.752  21.082  1.00 37.18  ? 430 ARG B N   1 
ATOM   4752 C  CA  . ARG B 1 250 ? 111.836 25.799  22.086  1.00 37.42  ? 430 ARG B CA  1 
ATOM   4753 C  C   . ARG B 1 250 ? 111.285 25.331  23.431  1.00 37.27  ? 430 ARG B C   1 
ATOM   4754 O  O   . ARG B 1 250 ? 111.922 25.515  24.468  1.00 38.14  ? 430 ARG B O   1 
ATOM   4755 C  CB  . ARG B 1 250 ? 111.101 27.064  21.627  1.00 38.28  ? 430 ARG B CB  1 
ATOM   4756 C  CG  . ARG B 1 250 ? 111.254 28.243  22.577  1.00 38.99  ? 430 ARG B CG  1 
ATOM   4757 C  CD  . ARG B 1 250 ? 110.543 29.480  22.055  1.00 40.26  ? 430 ARG B CD  1 
ATOM   4758 N  NE  . ARG B 1 250 ? 110.731 30.630  22.937  1.00 41.31  ? 430 ARG B NE  1 
ATOM   4759 C  CZ  . ARG B 1 250 ? 110.196 31.831  22.728  1.00 42.35  ? 430 ARG B CZ  1 
ATOM   4760 N  NH1 . ARG B 1 250 ? 109.435 32.049  21.661  1.00 42.37  ? 430 ARG B NH1 1 
ATOM   4761 N  NH2 . ARG B 1 250 ? 110.416 32.817  23.591  1.00 42.83  ? 430 ARG B NH2 1 
ATOM   4762 N  N   . GLU B 1 251 ? 110.102 24.726  23.415  1.00 36.62  ? 431 GLU B N   1 
ATOM   4763 C  CA  . GLU B 1 251 ? 109.486 24.239  24.647  1.00 36.91  ? 431 GLU B CA  1 
ATOM   4764 C  C   . GLU B 1 251 ? 110.366 23.174  25.310  1.00 37.62  ? 431 GLU B C   1 
ATOM   4765 O  O   . GLU B 1 251 ? 110.460 23.111  26.538  1.00 35.96  ? 431 GLU B O   1 
ATOM   4766 C  CB  . GLU B 1 251 ? 108.093 23.668  24.350  1.00 35.88  ? 431 GLU B CB  1 
ATOM   4767 C  CG  . GLU B 1 251 ? 107.144 24.678  23.717  1.00 35.32  ? 431 GLU B CG  1 
ATOM   4768 C  CD  . GLU B 1 251 ? 105.825 24.067  23.282  1.00 35.51  ? 431 GLU B CD  1 
ATOM   4769 O  OE1 . GLU B 1 251 ? 105.845 23.045  22.561  1.00 36.32  ? 431 GLU B OE1 1 
ATOM   4770 O  OE2 . GLU B 1 251 ? 104.767 24.617  23.653  1.00 34.82  ? 431 GLU B OE2 1 
ATOM   4771 N  N   . LYS B 1 252 ? 110.999 22.332  24.494  1.00 38.74  ? 432 LYS B N   1 
ATOM   4772 C  CA  . LYS B 1 252 ? 111.881 21.288  25.013  1.00 40.01  ? 432 LYS B CA  1 
ATOM   4773 C  C   . LYS B 1 252 ? 113.055 21.961  25.708  1.00 40.70  ? 432 LYS B C   1 
ATOM   4774 O  O   . LYS B 1 252 ? 113.428 21.592  26.819  1.00 40.66  ? 432 LYS B O   1 
ATOM   4775 C  CB  . LYS B 1 252 ? 112.405 20.399  23.879  1.00 40.01  ? 432 LYS B CB  1 
ATOM   4776 C  CG  . LYS B 1 252 ? 111.397 19.386  23.342  1.00 39.77  ? 432 LYS B CG  1 
ATOM   4777 C  CD  . LYS B 1 252 ? 111.919 18.698  22.090  1.00 39.10  ? 432 LYS B CD  1 
ATOM   4778 C  CE  . LYS B 1 252 ? 110.955 17.631  21.584  1.00 39.73  ? 432 LYS B CE  1 
ATOM   4779 N  NZ  . LYS B 1 252 ? 111.474 16.953  20.362  1.00 39.96  ? 432 LYS B NZ  1 
ATOM   4780 N  N   . SER B 1 253 ? 113.617 22.966  25.049  1.00 41.27  ? 433 SER B N   1 
ATOM   4781 C  CA  . SER B 1 253 ? 114.756 23.700  25.585  1.00 42.37  ? 433 SER B CA  1 
ATOM   4782 C  C   . SER B 1 253 ? 114.441 24.519  26.847  1.00 42.47  ? 433 SER B C   1 
ATOM   4783 O  O   . SER B 1 253 ? 115.266 24.601  27.757  1.00 42.60  ? 433 SER B O   1 
ATOM   4784 C  CB  . SER B 1 253 ? 115.327 24.618  24.500  1.00 42.67  ? 433 SER B CB  1 
ATOM   4785 O  OG  . SER B 1 253 ? 116.503 25.271  24.948  1.00 45.94  ? 433 SER B OG  1 
ATOM   4786 N  N   . GLU B 1 254 ? 113.252 25.117  26.911  1.00 41.86  ? 434 GLU B N   1 
ATOM   4787 C  CA  . GLU B 1 254 ? 112.881 25.932  28.069  1.00 40.56  ? 434 GLU B CA  1 
ATOM   4788 C  C   . GLU B 1 254 ? 112.269 25.102  29.195  1.00 40.19  ? 434 GLU B C   1 
ATOM   4789 O  O   . GLU B 1 254 ? 111.980 25.624  30.277  1.00 40.08  ? 434 GLU B O   1 
ATOM   4790 C  CB  . GLU B 1 254 ? 111.897 27.035  27.656  1.00 39.78  ? 434 GLU B CB  1 
ATOM   4791 C  CG  . GLU B 1 254 ? 112.345 27.856  26.454  1.00 40.18  ? 434 GLU B CG  1 
ATOM   4792 C  CD  . GLU B 1 254 ? 111.399 29.008  26.138  1.00 40.38  ? 434 GLU B CD  1 
ATOM   4793 O  OE1 . GLU B 1 254 ? 110.186 28.879  26.410  1.00 40.42  ? 434 GLU B OE1 1 
ATOM   4794 O  OE2 . GLU B 1 254 ? 111.863 30.039  25.604  1.00 40.29  ? 434 GLU B OE2 1 
ATOM   4795 N  N   . GLY B 1 255 ? 112.069 23.813  28.936  1.00 39.30  ? 435 GLY B N   1 
ATOM   4796 C  CA  . GLY B 1 255 ? 111.495 22.934  29.939  1.00 38.67  ? 435 GLY B CA  1 
ATOM   4797 C  C   . GLY B 1 255 ? 109.989 23.070  30.085  1.00 38.79  ? 435 GLY B C   1 
ATOM   4798 O  O   . GLY B 1 255 ? 109.435 22.827  31.159  1.00 38.67  ? 435 GLY B O   1 
ATOM   4799 N  N   . LEU B 1 256 ? 109.322 23.461  29.005  1.00 38.14  ? 436 LEU B N   1 
ATOM   4800 C  CA  . LEU B 1 256 ? 107.872 23.625  29.026  1.00 37.91  ? 436 LEU B CA  1 
ATOM   4801 C  C   . LEU B 1 256 ? 107.214 22.434  28.347  1.00 37.02  ? 436 LEU B C   1 
ATOM   4802 O  O   . LEU B 1 256 ? 107.820 21.782  27.498  1.00 37.17  ? 436 LEU B O   1 
ATOM   4803 C  CB  . LEU B 1 256 ? 107.474 24.916  28.304  1.00 37.19  ? 436 LEU B CB  1 
ATOM   4804 C  CG  . LEU B 1 256 ? 107.900 26.227  28.969  1.00 37.05  ? 436 LEU B CG  1 
ATOM   4805 C  CD1 . LEU B 1 256 ? 107.607 27.401  28.038  1.00 37.26  ? 436 LEU B CD1 1 
ATOM   4806 C  CD2 . LEU B 1 256 ? 107.169 26.391  30.289  1.00 35.96  ? 436 LEU B CD2 1 
ATOM   4807 N  N   . PRO B 1 257 ? 105.961 22.131  28.711  1.00 36.42  ? 437 PRO B N   1 
ATOM   4808 C  CA  . PRO B 1 257 ? 105.300 20.990  28.077  1.00 36.08  ? 437 PRO B CA  1 
ATOM   4809 C  C   . PRO B 1 257 ? 105.293 21.024  26.547  1.00 36.35  ? 437 PRO B C   1 
ATOM   4810 O  O   . PRO B 1 257 ? 105.112 22.071  25.917  1.00 36.33  ? 437 PRO B O   1 
ATOM   4811 C  CB  . PRO B 1 257 ? 103.895 21.004  28.695  1.00 37.09  ? 437 PRO B CB  1 
ATOM   4812 C  CG  . PRO B 1 257 ? 103.742 22.393  29.255  1.00 37.24  ? 437 PRO B CG  1 
ATOM   4813 C  CD  . PRO B 1 257 ? 105.105 22.744  29.740  1.00 36.07  ? 437 PRO B CD  1 
ATOM   4814 N  N   . VAL B 1 258 ? 105.521 19.857  25.961  1.00 35.65  ? 438 VAL B N   1 
ATOM   4815 C  CA  . VAL B 1 258 ? 105.555 19.696  24.521  1.00 34.74  ? 438 VAL B CA  1 
ATOM   4816 C  C   . VAL B 1 258 ? 104.327 18.913  24.099  1.00 34.74  ? 438 VAL B C   1 
ATOM   4817 O  O   . VAL B 1 258 ? 103.979 17.917  24.728  1.00 36.12  ? 438 VAL B O   1 
ATOM   4818 C  CB  . VAL B 1 258 ? 106.812 18.913  24.092  1.00 34.70  ? 438 VAL B CB  1 
ATOM   4819 C  CG1 . VAL B 1 258 ? 106.774 18.628  22.600  1.00 35.25  ? 438 VAL B CG1 1 
ATOM   4820 C  CG2 . VAL B 1 258 ? 108.055 19.700  24.454  1.00 33.84  ? 438 VAL B CG2 1 
ATOM   4821 N  N   . ALA B 1 259 ? 103.668 19.369  23.041  1.00 34.41  ? 439 ALA B N   1 
ATOM   4822 C  CA  . ALA B 1 259 ? 102.482 18.693  22.532  1.00 34.06  ? 439 ALA B CA  1 
ATOM   4823 C  C   . ALA B 1 259 ? 102.932 17.691  21.472  1.00 34.21  ? 439 ALA B C   1 
ATOM   4824 O  O   . ALA B 1 259 ? 103.640 18.053  20.532  1.00 34.09  ? 439 ALA B O   1 
ATOM   4825 C  CB  . ALA B 1 259 ? 101.516 19.710  21.924  1.00 33.09  ? 439 ALA B CB  1 
ATOM   4826 N  N   . PRO B 1 260 ? 102.522 16.419  21.607  1.00 34.47  ? 440 PRO B N   1 
ATOM   4827 C  CA  . PRO B 1 260 ? 102.901 15.379  20.646  1.00 34.54  ? 440 PRO B CA  1 
ATOM   4828 C  C   . PRO B 1 260 ? 102.665 15.742  19.182  1.00 34.37  ? 440 PRO B C   1 
ATOM   4829 O  O   . PRO B 1 260 ? 103.507 15.462  18.333  1.00 34.29  ? 440 PRO B O   1 
ATOM   4830 C  CB  . PRO B 1 260 ? 102.067 14.179  21.093  1.00 34.48  ? 440 PRO B CB  1 
ATOM   4831 C  CG  . PRO B 1 260 ? 102.031 14.360  22.586  1.00 34.63  ? 440 PRO B CG  1 
ATOM   4832 C  CD  . PRO B 1 260 ? 101.729 15.843  22.708  1.00 34.87  ? 440 PRO B CD  1 
ATOM   4833 N  N   . PHE B 1 261 ? 101.534 16.372  18.878  1.00 33.99  ? 441 PHE B N   1 
ATOM   4834 C  CA  . PHE B 1 261 ? 101.263 16.719  17.488  1.00 34.16  ? 441 PHE B CA  1 
ATOM   4835 C  C   . PHE B 1 261 ? 102.253 17.738  16.920  1.00 33.72  ? 441 PHE B C   1 
ATOM   4836 O  O   . PHE B 1 261 ? 102.275 17.989  15.719  1.00 33.85  ? 441 PHE B O   1 
ATOM   4837 C  CB  . PHE B 1 261 ? 99.805  17.187  17.324  1.00 34.04  ? 441 PHE B CB  1 
ATOM   4838 C  CG  . PHE B 1 261 ? 99.570  18.638  17.633  1.00 34.24  ? 441 PHE B CG  1 
ATOM   4839 C  CD1 . PHE B 1 261 ? 99.739  19.608  16.648  1.00 33.66  ? 441 PHE B CD1 1 
ATOM   4840 C  CD2 . PHE B 1 261 ? 99.127  19.032  18.892  1.00 33.63  ? 441 PHE B CD2 1 
ATOM   4841 C  CE1 . PHE B 1 261 ? 99.465  20.948  16.910  1.00 34.02  ? 441 PHE B CE1 1 
ATOM   4842 C  CE2 . PHE B 1 261 ? 98.851  20.367  19.164  1.00 33.88  ? 441 PHE B CE2 1 
ATOM   4843 C  CZ  . PHE B 1 261 ? 99.019  21.329  18.168  1.00 33.53  ? 441 PHE B CZ  1 
ATOM   4844 N  N   . MET B 1 262 ? 103.091 18.303  17.779  1.00 34.10  ? 442 MET B N   1 
ATOM   4845 C  CA  . MET B 1 262 ? 104.089 19.269  17.331  1.00 35.67  ? 442 MET B CA  1 
ATOM   4846 C  C   . MET B 1 262 ? 105.507 18.729  17.480  1.00 36.75  ? 442 MET B C   1 
ATOM   4847 O  O   . MET B 1 262 ? 106.474 19.404  17.116  1.00 36.87  ? 442 MET B O   1 
ATOM   4848 C  CB  . MET B 1 262 ? 103.973 20.576  18.120  1.00 34.93  ? 442 MET B CB  1 
ATOM   4849 C  CG  . MET B 1 262 ? 102.875 21.507  17.644  1.00 36.21  ? 442 MET B CG  1 
ATOM   4850 S  SD  . MET B 1 262 ? 103.000 23.140  18.411  1.00 36.49  ? 442 MET B SD  1 
ATOM   4851 C  CE  . MET B 1 262 ? 101.534 23.130  19.385  1.00 38.35  ? 442 MET B CE  1 
ATOM   4852 N  N   . ASP B 1 263 ? 105.629 17.513  18.009  1.00 38.14  ? 443 ASP B N   1 
ATOM   4853 C  CA  . ASP B 1 263 ? 106.939 16.904  18.235  1.00 40.09  ? 443 ASP B CA  1 
ATOM   4854 C  C   . ASP B 1 263 ? 107.702 16.508  16.972  1.00 41.28  ? 443 ASP B C   1 
ATOM   4855 O  O   . ASP B 1 263 ? 107.252 15.678  16.185  1.00 40.55  ? 443 ASP B O   1 
ATOM   4856 C  CB  . ASP B 1 263 ? 106.808 15.673  19.129  1.00 40.08  ? 443 ASP B CB  1 
ATOM   4857 C  CG  . ASP B 1 263 ? 108.094 15.360  19.870  1.00 39.58  ? 443 ASP B CG  1 
ATOM   4858 O  OD1 . ASP B 1 263 ? 109.176 15.407  19.244  1.00 38.24  ? 443 ASP B OD1 1 
ATOM   4859 O  OD2 . ASP B 1 263 ? 108.017 15.069  21.083  1.00 40.22  ? 443 ASP B OD2 1 
ATOM   4860 N  N   . ARG B 1 264 ? 108.874 17.107  16.806  1.00 43.61  ? 444 ARG B N   1 
ATOM   4861 C  CA  . ARG B 1 264 ? 109.736 16.842  15.663  1.00 46.20  ? 444 ARG B CA  1 
ATOM   4862 C  C   . ARG B 1 264 ? 110.102 15.360  15.531  1.00 47.35  ? 444 ARG B C   1 
ATOM   4863 O  O   . ARG B 1 264 ? 110.388 14.884  14.431  1.00 47.63  ? 444 ARG B O   1 
ATOM   4864 C  CB  . ARG B 1 264 ? 111.000 17.699  15.786  1.00 46.86  ? 444 ARG B CB  1 
ATOM   4865 C  CG  . ARG B 1 264 ? 112.121 17.352  14.832  1.00 48.78  ? 444 ARG B CG  1 
ATOM   4866 C  CD  . ARG B 1 264 ? 113.137 18.477  14.805  1.00 49.55  ? 444 ARG B CD  1 
ATOM   4867 N  NE  . ARG B 1 264 ? 112.639 19.616  14.039  1.00 51.68  ? 444 ARG B NE  1 
ATOM   4868 C  CZ  . ARG B 1 264 ? 113.204 20.817  14.034  1.00 52.48  ? 444 ARG B CZ  1 
ATOM   4869 N  NH1 . ARG B 1 264 ? 114.286 21.041  14.762  1.00 55.14  ? 444 ARG B NH1 1 
ATOM   4870 N  NH2 . ARG B 1 264 ? 112.699 21.790  13.293  1.00 53.50  ? 444 ARG B NH2 1 
ATOM   4871 N  N   . ASP B 1 265 ? 110.069 14.633  16.647  1.00 48.73  ? 445 ASP B N   1 
ATOM   4872 C  CA  . ASP B 1 265 ? 110.415 13.213  16.651  1.00 49.59  ? 445 ASP B CA  1 
ATOM   4873 C  C   . ASP B 1 265 ? 109.247 12.273  16.357  1.00 49.97  ? 445 ASP B C   1 
ATOM   4874 O  O   . ASP B 1 265 ? 109.462 11.083  16.116  1.00 50.62  ? 445 ASP B O   1 
ATOM   4875 C  CB  . ASP B 1 265 ? 111.020 12.808  18.004  1.00 50.26  ? 445 ASP B CB  1 
ATOM   4876 C  CG  . ASP B 1 265 ? 112.226 13.647  18.389  1.00 50.86  ? 445 ASP B CG  1 
ATOM   4877 O  OD1 . ASP B 1 265 ? 113.091 13.890  17.520  1.00 51.59  ? 445 ASP B OD1 1 
ATOM   4878 O  OD2 . ASP B 1 265 ? 112.315 14.053  19.570  1.00 51.24  ? 445 ASP B OD2 1 
ATOM   4879 N  N   . LYS B 1 266 ? 108.022 12.790  16.370  1.00 49.32  ? 446 LYS B N   1 
ATOM   4880 C  CA  . LYS B 1 266 ? 106.854 11.943  16.137  1.00 48.79  ? 446 LYS B CA  1 
ATOM   4881 C  C   . LYS B 1 266 ? 105.960 12.356  14.972  1.00 49.03  ? 446 LYS B C   1 
ATOM   4882 O  O   . LYS B 1 266 ? 104.972 11.678  14.674  1.00 48.86  ? 446 LYS B O   1 
ATOM   4883 C  CB  . LYS B 1 266 ? 105.980 11.912  17.389  1.00 48.30  ? 446 LYS B CB  1 
ATOM   4884 C  CG  . LYS B 1 266 ? 106.711 11.732  18.703  1.00 49.41  ? 446 LYS B CG  1 
ATOM   4885 C  CD  . LYS B 1 266 ? 105.691 11.647  19.830  1.00 50.24  ? 446 LYS B CD  1 
ATOM   4886 C  CE  . LYS B 1 266 ? 106.335 11.443  21.188  1.00 50.65  ? 446 LYS B CE  1 
ATOM   4887 N  NZ  . LYS B 1 266 ? 105.291 11.354  22.252  1.00 51.26  ? 446 LYS B NZ  1 
ATOM   4888 N  N   . VAL B 1 267 ? 106.291 13.453  14.303  1.00 48.76  ? 447 VAL B N   1 
ATOM   4889 C  CA  . VAL B 1 267 ? 105.429 13.926  13.228  1.00 48.55  ? 447 VAL B CA  1 
ATOM   4890 C  C   . VAL B 1 267 ? 105.969 13.898  11.801  1.00 49.08  ? 447 VAL B C   1 
ATOM   4891 O  O   . VAL B 1 267 ? 107.141 14.189  11.548  1.00 48.82  ? 447 VAL B O   1 
ATOM   4892 C  CB  . VAL B 1 267 ? 104.946 15.366  13.541  1.00 47.59  ? 447 VAL B CB  1 
ATOM   4893 C  CG1 . VAL B 1 267 ? 103.965 15.839  12.482  1.00 46.46  ? 447 VAL B CG1 1 
ATOM   4894 C  CG2 . VAL B 1 267 ? 104.308 15.404  14.922  1.00 46.47  ? 447 VAL B CG2 1 
ATOM   4895 N  N   . THR B 1 268 ? 105.080 13.540  10.877  1.00 49.91  ? 448 THR B N   1 
ATOM   4896 C  CA  . THR B 1 268 ? 105.376 13.500  9.447   1.00 50.95  ? 448 THR B CA  1 
ATOM   4897 C  C   . THR B 1 268 ? 104.210 14.209  8.767   1.00 51.18  ? 448 THR B C   1 
ATOM   4898 O  O   . THR B 1 268 ? 103.117 14.301  9.329   1.00 50.72  ? 448 THR B O   1 
ATOM   4899 C  CB  . THR B 1 268 ? 105.433 12.062  8.894   1.00 51.11  ? 448 THR B CB  1 
ATOM   4900 O  OG1 . THR B 1 268 ? 104.124 11.480  8.937   1.00 51.17  ? 448 THR B OG1 1 
ATOM   4901 C  CG2 . THR B 1 268 ? 106.395 11.215  9.713   1.00 51.59  ? 448 THR B CG2 1 
ATOM   4902 N  N   . LYS B 1 269 ? 104.438 14.704  7.559   1.00 51.85  ? 449 LYS B N   1 
ATOM   4903 C  CA  . LYS B 1 269 ? 103.391 15.398  6.824   1.00 52.25  ? 449 LYS B CA  1 
ATOM   4904 C  C   . LYS B 1 269 ? 102.120 14.548  6.777   1.00 51.15  ? 449 LYS B C   1 
ATOM   4905 O  O   . LYS B 1 269 ? 101.005 15.069  6.847   1.00 50.85  ? 449 LYS B O   1 
ATOM   4906 C  CB  . LYS B 1 269 ? 103.874 15.704  5.405   1.00 54.35  ? 449 LYS B CB  1 
ATOM   4907 C  CG  . LYS B 1 269 ? 105.220 16.421  5.362   1.00 57.16  ? 449 LYS B CG  1 
ATOM   4908 C  CD  . LYS B 1 269 ? 105.733 16.608  3.940   1.00 59.03  ? 449 LYS B CD  1 
ATOM   4909 C  CE  . LYS B 1 269 ? 104.805 17.493  3.119   1.00 60.39  ? 449 LYS B CE  1 
ATOM   4910 N  NZ  . LYS B 1 269 ? 105.385 17.798  1.776   1.00 61.97  ? 449 LYS B NZ  1 
ATOM   4911 N  N   . ALA B 1 270 ? 102.302 13.234  6.684   1.00 49.83  ? 450 ALA B N   1 
ATOM   4912 C  CA  . ALA B 1 270 ? 101.184 12.302  6.607   1.00 48.59  ? 450 ALA B CA  1 
ATOM   4913 C  C   . ALA B 1 270 ? 100.400 12.168  7.908   1.00 47.63  ? 450 ALA B C   1 
ATOM   4914 O  O   . ALA B 1 270 ? 99.183  12.353  7.925   1.00 47.65  ? 450 ALA B O   1 
ATOM   4915 C  CB  . ALA B 1 270 ? 101.683 10.931  6.154   1.00 48.53  ? 450 ALA B CB  1 
ATOM   4916 N  N   . THR B 1 271 ? 101.088 11.836  8.996   1.00 46.49  ? 451 THR B N   1 
ATOM   4917 C  CA  . THR B 1 271 ? 100.417 11.682  10.285  1.00 45.84  ? 451 THR B CA  1 
ATOM   4918 C  C   . THR B 1 271 ? 99.728  12.981  10.714  1.00 43.59  ? 451 THR B C   1 
ATOM   4919 O  O   . THR B 1 271 ? 98.675  12.957  11.358  1.00 43.68  ? 451 THR B O   1 
ATOM   4920 C  CB  . THR B 1 271 ? 101.413 11.232  11.394  1.00 46.65  ? 451 THR B CB  1 
ATOM   4921 O  OG1 . THR B 1 271 ? 102.558 12.100  11.412  1.00 47.80  ? 451 THR B OG1 1 
ATOM   4922 C  CG2 . THR B 1 271 ? 101.872 9.800   11.138  1.00 47.47  ? 451 THR B CG2 1 
ATOM   4923 N  N   . ALA B 1 272 ? 100.314 14.111  10.332  1.00 41.23  ? 452 ALA B N   1 
ATOM   4924 C  CA  . ALA B 1 272 ? 99.758  15.412  10.680  1.00 39.09  ? 452 ALA B CA  1 
ATOM   4925 C  C   . ALA B 1 272 ? 98.440  15.705  9.972   1.00 38.14  ? 452 ALA B C   1 
ATOM   4926 O  O   . ALA B 1 272 ? 97.456  16.091  10.612  1.00 37.16  ? 452 ALA B O   1 
ATOM   4927 C  CB  . ALA B 1 272 ? 100.760 16.507  10.363  1.00 37.99  ? 452 ALA B CB  1 
ATOM   4928 N  N   . GLN B 1 273 ? 98.413  15.501  8.658   1.00 35.99  ? 453 GLN B N   1 
ATOM   4929 C  CA  . GLN B 1 273 ? 97.224  15.802  7.876   1.00 35.27  ? 453 GLN B CA  1 
ATOM   4930 C  C   . GLN B 1 273 ? 96.109  14.764  7.837   1.00 35.30  ? 453 GLN B C   1 
ATOM   4931 O  O   . GLN B 1 273 ? 94.939  15.129  7.675   1.00 35.44  ? 453 GLN B O   1 
ATOM   4932 C  CB  . GLN B 1 273 ? 97.633  16.165  6.449   1.00 34.81  ? 453 GLN B CB  1 
ATOM   4933 C  CG  . GLN B 1 273 ? 98.579  17.361  6.349   1.00 33.95  ? 453 GLN B CG  1 
ATOM   4934 C  CD  . GLN B 1 273 ? 97.986  18.638  6.935   1.00 34.16  ? 453 GLN B CD  1 
ATOM   4935 O  OE1 . GLN B 1 273 ? 98.039  18.868  8.144   1.00 34.08  ? 453 GLN B OE1 1 
ATOM   4936 N  NE2 . GLN B 1 273 ? 97.397  19.460  6.077   1.00 32.91  ? 453 GLN B NE2 1 
ATOM   4937 N  N   . ILE B 1 274 ? 96.444  13.483  7.981   1.00 34.90  ? 454 ILE B N   1 
ATOM   4938 C  CA  . ILE B 1 274 ? 95.419  12.440  7.939   1.00 34.57  ? 454 ILE B CA  1 
ATOM   4939 C  C   . ILE B 1 274 ? 94.279  12.700  8.916   1.00 33.74  ? 454 ILE B C   1 
ATOM   4940 O  O   . ILE B 1 274 ? 93.125  12.856  8.509   1.00 34.60  ? 454 ILE B O   1 
ATOM   4941 C  CB  . ILE B 1 274 ? 95.996  11.038  8.247   1.00 35.87  ? 454 ILE B CB  1 
ATOM   4942 C  CG1 . ILE B 1 274 ? 96.938  10.599  7.121   1.00 36.87  ? 454 ILE B CG1 1 
ATOM   4943 C  CG2 . ILE B 1 274 ? 94.857  10.027  8.390   1.00 35.95  ? 454 ILE B CG2 1 
ATOM   4944 C  CD1 . ILE B 1 274 ? 97.517  9.201   7.308   1.00 37.31  ? 454 ILE B CD1 1 
ATOM   4945 N  N   . GLY B 1 275 ? 94.610  12.740  10.203  1.00 32.43  ? 455 GLY B N   1 
ATOM   4946 C  CA  . GLY B 1 275 ? 93.602  12.970  11.223  1.00 31.09  ? 455 GLY B CA  1 
ATOM   4947 C  C   . GLY B 1 275 ? 92.894  14.304  11.086  1.00 30.73  ? 455 GLY B C   1 
ATOM   4948 O  O   . GLY B 1 275 ? 91.672  14.390  11.277  1.00 29.10  ? 455 GLY B O   1 
ATOM   4949 N  N   . PHE B 1 276 ? 93.665  15.340  10.754  1.00 30.22  ? 456 PHE B N   1 
ATOM   4950 C  CA  . PHE B 1 276 ? 93.140  16.690  10.587  1.00 30.42  ? 456 PHE B CA  1 
ATOM   4951 C  C   . PHE B 1 276 ? 92.089  16.736  9.479   1.00 30.93  ? 456 PHE B C   1 
ATOM   4952 O  O   . PHE B 1 276 ? 90.996  17.275  9.660   1.00 29.88  ? 456 PHE B O   1 
ATOM   4953 C  CB  . PHE B 1 276 ? 94.283  17.659  10.265  1.00 30.31  ? 456 PHE B CB  1 
ATOM   4954 C  CG  . PHE B 1 276 ? 93.870  19.099  10.250  1.00 29.91  ? 456 PHE B CG  1 
ATOM   4955 C  CD1 . PHE B 1 276 ? 93.352  19.697  11.399  1.00 30.17  ? 456 PHE B CD1 1 
ATOM   4956 C  CD2 . PHE B 1 276 ? 93.977  19.857  9.089   1.00 29.31  ? 456 PHE B CD2 1 
ATOM   4957 C  CE1 . PHE B 1 276 ? 92.946  21.029  11.390  1.00 29.00  ? 456 PHE B CE1 1 
ATOM   4958 C  CE2 . PHE B 1 276 ? 93.574  21.188  9.071   1.00 29.54  ? 456 PHE B CE2 1 
ATOM   4959 C  CZ  . PHE B 1 276 ? 93.058  21.775  10.223  1.00 29.38  ? 456 PHE B CZ  1 
ATOM   4960 N  N   . ILE B 1 277 ? 92.422  16.161  8.329   1.00 32.32  ? 457 ILE B N   1 
ATOM   4961 C  CA  . ILE B 1 277 ? 91.498  16.135  7.202   1.00 33.11  ? 457 ILE B CA  1 
ATOM   4962 C  C   . ILE B 1 277 ? 90.250  15.320  7.536   1.00 33.85  ? 457 ILE B C   1 
ATOM   4963 O  O   . ILE B 1 277 ? 89.121  15.785  7.357   1.00 34.66  ? 457 ILE B O   1 
ATOM   4964 C  CB  . ILE B 1 277 ? 92.176  15.527  5.947   1.00 33.44  ? 457 ILE B CB  1 
ATOM   4965 C  CG1 . ILE B 1 277 ? 93.322  16.428  5.491   1.00 33.98  ? 457 ILE B CG1 1 
ATOM   4966 C  CG2 . ILE B 1 277 ? 91.165  15.368  4.820   1.00 34.02  ? 457 ILE B CG2 1 
ATOM   4967 C  CD1 . ILE B 1 277 ? 94.129  15.855  4.345   1.00 35.55  ? 457 ILE B CD1 1 
ATOM   4968 N  N   . LYS B 1 278 ? 90.463  14.110  8.041   1.00 34.18  ? 458 LYS B N   1 
ATOM   4969 C  CA  . LYS B 1 278 ? 89.374  13.199  8.378   1.00 34.13  ? 458 LYS B CA  1 
ATOM   4970 C  C   . LYS B 1 278 ? 88.441  13.630  9.504   1.00 34.10  ? 458 LYS B C   1 
ATOM   4971 O  O   . LYS B 1 278 ? 87.217  13.506  9.384   1.00 33.71  ? 458 LYS B O   1 
ATOM   4972 C  CB  . LYS B 1 278 ? 89.946  11.814  8.706   1.00 34.91  ? 458 LYS B CB  1 
ATOM   4973 C  CG  . LYS B 1 278 ? 90.513  11.082  7.493   1.00 38.17  ? 458 LYS B CG  1 
ATOM   4974 C  CD  . LYS B 1 278 ? 91.281  9.809   7.862   1.00 39.48  ? 458 LYS B CD  1 
ATOM   4975 C  CE  . LYS B 1 278 ? 90.377  8.717   8.399   1.00 39.98  ? 458 LYS B CE  1 
ATOM   4976 N  NZ  . LYS B 1 278 ? 91.143  7.464   8.676   1.00 40.41  ? 458 LYS B NZ  1 
ATOM   4977 N  N   . PHE B 1 279 ? 89.004  14.146  10.592  1.00 33.34  ? 459 PHE B N   1 
ATOM   4978 C  CA  . PHE B 1 279 ? 88.183  14.523  11.729  1.00 32.66  ? 459 PHE B CA  1 
ATOM   4979 C  C   . PHE B 1 279 ? 87.938  16.012  11.969  1.00 32.80  ? 459 PHE B C   1 
ATOM   4980 O  O   . PHE B 1 279 ? 87.147  16.376  12.841  1.00 32.75  ? 459 PHE B O   1 
ATOM   4981 C  CB  . PHE B 1 279 ? 88.748  13.860  12.983  1.00 33.52  ? 459 PHE B CB  1 
ATOM   4982 C  CG  . PHE B 1 279 ? 88.994  12.381  12.814  1.00 35.20  ? 459 PHE B CG  1 
ATOM   4983 C  CD1 . PHE B 1 279 ? 90.292  11.879  12.746  1.00 35.59  ? 459 PHE B CD1 1 
ATOM   4984 C  CD2 . PHE B 1 279 ? 87.926  11.495  12.683  1.00 35.17  ? 459 PHE B CD2 1 
ATOM   4985 C  CE1 . PHE B 1 279 ? 90.525  10.513  12.547  1.00 36.48  ? 459 PHE B CE1 1 
ATOM   4986 C  CE2 . PHE B 1 279 ? 88.147  10.127  12.480  1.00 36.08  ? 459 PHE B CE2 1 
ATOM   4987 C  CZ  . PHE B 1 279 ? 89.450  9.636   12.414  1.00 35.86  ? 459 PHE B CZ  1 
ATOM   4988 N  N   . VAL B 1 280 ? 88.601  16.882  11.217  1.00 31.75  ? 460 VAL B N   1 
ATOM   4989 C  CA  . VAL B 1 280 ? 88.349  18.304  11.391  1.00 31.53  ? 460 VAL B CA  1 
ATOM   4990 C  C   . VAL B 1 280 ? 87.829  18.918  10.100  1.00 31.64  ? 460 VAL B C   1 
ATOM   4991 O  O   . VAL B 1 280 ? 86.710  19.431  10.068  1.00 32.69  ? 460 VAL B O   1 
ATOM   4992 C  CB  . VAL B 1 280 ? 89.610  19.086  11.859  1.00 31.33  ? 460 VAL B CB  1 
ATOM   4993 C  CG1 . VAL B 1 280 ? 89.296  20.584  11.932  1.00 30.73  ? 460 VAL B CG1 1 
ATOM   4994 C  CG2 . VAL B 1 280 ? 90.048  18.592  13.223  1.00 29.60  ? 460 VAL B CG2 1 
ATOM   4995 N  N   . LEU B 1 281 ? 88.616  18.843  9.030   1.00 31.31  ? 461 LEU B N   1 
ATOM   4996 C  CA  . LEU B 1 281 ? 88.210  19.436  7.760   1.00 31.86  ? 461 LEU B CA  1 
ATOM   4997 C  C   . LEU B 1 281 ? 86.960  18.852  7.126   1.00 32.45  ? 461 LEU B C   1 
ATOM   4998 O  O   . LEU B 1 281 ? 85.966  19.558  6.929   1.00 32.64  ? 461 LEU B O   1 
ATOM   4999 C  CB  . LEU B 1 281 ? 89.349  19.366  6.743   1.00 32.25  ? 461 LEU B CB  1 
ATOM   5000 C  CG  . LEU B 1 281 ? 90.622  20.139  7.086   1.00 33.12  ? 461 LEU B CG  1 
ATOM   5001 C  CD1 . LEU B 1 281 ? 91.575  20.080  5.904   1.00 31.31  ? 461 LEU B CD1 1 
ATOM   5002 C  CD2 . LEU B 1 281 ? 90.276  21.585  7.429   1.00 33.01  ? 461 LEU B CD2 1 
ATOM   5003 N  N   . ILE B 1 282 ? 87.008  17.566  6.794   1.00 32.67  ? 462 ILE B N   1 
ATOM   5004 C  CA  . ILE B 1 282 ? 85.876  16.918  6.148   1.00 32.32  ? 462 ILE B CA  1 
ATOM   5005 C  C   . ILE B 1 282 ? 84.533  17.127  6.847   1.00 32.77  ? 462 ILE B C   1 
ATOM   5006 O  O   . ILE B 1 282 ? 83.573  17.578  6.220   1.00 32.87  ? 462 ILE B O   1 
ATOM   5007 C  CB  . ILE B 1 282 ? 86.143  15.408  5.959   1.00 32.66  ? 462 ILE B CB  1 
ATOM   5008 C  CG1 . ILE B 1 282 ? 87.269  15.222  4.934   1.00 32.42  ? 462 ILE B CG1 1 
ATOM   5009 C  CG2 . ILE B 1 282 ? 84.872  14.698  5.502   1.00 30.54  ? 462 ILE B CG2 1 
ATOM   5010 C  CD1 . ILE B 1 282 ? 87.632  13.777  4.663   1.00 33.47  ? 462 ILE B CD1 1 
ATOM   5011 N  N   . PRO B 1 283 ? 84.442  16.811  8.152   1.00 33.30  ? 463 PRO B N   1 
ATOM   5012 C  CA  . PRO B 1 283 ? 83.171  16.993  8.863   1.00 33.14  ? 463 PRO B CA  1 
ATOM   5013 C  C   . PRO B 1 283 ? 82.630  18.420  8.793   1.00 34.31  ? 463 PRO B C   1 
ATOM   5014 O  O   . PRO B 1 283 ? 81.437  18.631  8.537   1.00 34.48  ? 463 PRO B O   1 
ATOM   5015 C  CB  . PRO B 1 283 ? 83.512  16.579  10.293  1.00 33.03  ? 463 PRO B CB  1 
ATOM   5016 C  CG  . PRO B 1 283 ? 84.569  15.536  10.092  1.00 33.31  ? 463 PRO B CG  1 
ATOM   5017 C  CD  . PRO B 1 283 ? 85.442  16.173  9.029   1.00 32.45  ? 463 PRO B CD  1 
ATOM   5018 N  N   . MET B 1 284 ? 83.505  19.397  9.021   1.00 34.41  ? 464 MET B N   1 
ATOM   5019 C  CA  . MET B 1 284 ? 83.090  20.792  8.984   1.00 34.56  ? 464 MET B CA  1 
ATOM   5020 C  C   . MET B 1 284 ? 82.520  21.157  7.613   1.00 34.94  ? 464 MET B C   1 
ATOM   5021 O  O   . MET B 1 284 ? 81.460  21.774  7.525   1.00 34.54  ? 464 MET B O   1 
ATOM   5022 C  CB  . MET B 1 284 ? 84.263  21.719  9.339   1.00 33.63  ? 464 MET B CB  1 
ATOM   5023 C  CG  . MET B 1 284 ? 83.902  23.209  9.273   1.00 33.69  ? 464 MET B CG  1 
ATOM   5024 S  SD  . MET B 1 284 ? 85.137  24.342  9.961   1.00 32.20  ? 464 MET B SD  1 
ATOM   5025 C  CE  . MET B 1 284 ? 86.516  24.081  8.864   1.00 30.49  ? 464 MET B CE  1 
ATOM   5026 N  N   . PHE B 1 285 ? 83.211  20.767  6.546   1.00 35.31  ? 465 PHE B N   1 
ATOM   5027 C  CA  . PHE B 1 285 ? 82.725  21.075  5.208   1.00 36.32  ? 465 PHE B CA  1 
ATOM   5028 C  C   . PHE B 1 285 ? 81.457  20.313  4.834   1.00 37.53  ? 465 PHE B C   1 
ATOM   5029 O  O   . PHE B 1 285 ? 80.692  20.774  3.990   1.00 37.12  ? 465 PHE B O   1 
ATOM   5030 C  CB  . PHE B 1 285 ? 83.816  20.833  4.160   1.00 35.39  ? 465 PHE B CB  1 
ATOM   5031 C  CG  . PHE B 1 285 ? 84.813  21.952  4.066   1.00 34.28  ? 465 PHE B CG  1 
ATOM   5032 C  CD1 . PHE B 1 285 ? 85.960  21.954  4.855   1.00 33.82  ? 465 PHE B CD1 1 
ATOM   5033 C  CD2 . PHE B 1 285 ? 84.582  23.032  3.217   1.00 33.72  ? 465 PHE B CD2 1 
ATOM   5034 C  CE1 . PHE B 1 285 ? 86.861  23.012  4.802   1.00 32.87  ? 465 PHE B CE1 1 
ATOM   5035 C  CE2 . PHE B 1 285 ? 85.477  24.098  3.156   1.00 33.15  ? 465 PHE B CE2 1 
ATOM   5036 C  CZ  . PHE B 1 285 ? 86.619  24.087  3.951   1.00 34.09  ? 465 PHE B CZ  1 
ATOM   5037 N  N   . GLU B 1 286 ? 81.229  19.154  5.449   1.00 38.73  ? 466 GLU B N   1 
ATOM   5038 C  CA  . GLU B 1 286 ? 80.017  18.394  5.156   1.00 40.64  ? 466 GLU B CA  1 
ATOM   5039 C  C   . GLU B 1 286 ? 78.805  19.183  5.655   1.00 40.17  ? 466 GLU B C   1 
ATOM   5040 O  O   . GLU B 1 286 ? 77.792  19.288  4.958   1.00 39.33  ? 466 GLU B O   1 
ATOM   5041 C  CB  . GLU B 1 286 ? 80.042  17.012  5.829   1.00 42.52  ? 466 GLU B CB  1 
ATOM   5042 C  CG  . GLU B 1 286 ? 81.166  16.089  5.354   1.00 47.22  ? 466 GLU B CG  1 
ATOM   5043 C  CD  . GLU B 1 286 ? 81.082  14.684  5.956   1.00 50.40  ? 466 GLU B CD  1 
ATOM   5044 O  OE1 . GLU B 1 286 ? 80.334  13.842  5.412   1.00 52.92  ? 466 GLU B OE1 1 
ATOM   5045 O  OE2 . GLU B 1 286 ? 81.753  14.419  6.980   1.00 52.13  ? 466 GLU B OE2 1 
ATOM   5046 N  N   . THR B 1 287 ? 78.914  19.744  6.858   1.00 40.05  ? 467 THR B N   1 
ATOM   5047 C  CA  . THR B 1 287 ? 77.812  20.517  7.423   1.00 41.07  ? 467 THR B CA  1 
ATOM   5048 C  C   . THR B 1 287 ? 77.526  21.724  6.540   1.00 40.52  ? 467 THR B C   1 
ATOM   5049 O  O   . THR B 1 287 ? 76.372  22.085  6.327   1.00 40.96  ? 467 THR B O   1 
ATOM   5050 C  CB  . THR B 1 287 ? 78.118  21.022  8.846   1.00 41.94  ? 467 THR B CB  1 
ATOM   5051 O  OG1 . THR B 1 287 ? 78.535  19.928  9.673   1.00 43.39  ? 467 THR B OG1 1 
ATOM   5052 C  CG2 . THR B 1 287 ? 76.869  21.642  9.455   1.00 42.32  ? 467 THR B CG2 1 
ATOM   5053 N  N   . VAL B 1 288 ? 78.583  22.342  6.024   1.00 40.28  ? 468 VAL B N   1 
ATOM   5054 C  CA  . VAL B 1 288 ? 78.431  23.499  5.158   1.00 40.08  ? 468 VAL B CA  1 
ATOM   5055 C  C   . VAL B 1 288 ? 77.733  23.101  3.860   1.00 41.24  ? 468 VAL B C   1 
ATOM   5056 O  O   . VAL B 1 288 ? 76.905  23.849  3.338   1.00 41.36  ? 468 VAL B O   1 
ATOM   5057 C  CB  . VAL B 1 288 ? 79.799  24.124  4.813   1.00 39.84  ? 468 VAL B CB  1 
ATOM   5058 C  CG1 . VAL B 1 288 ? 79.615  25.254  3.814   1.00 38.34  ? 468 VAL B CG1 1 
ATOM   5059 C  CG2 . VAL B 1 288 ? 80.465  24.642  6.076   1.00 39.35  ? 468 VAL B CG2 1 
ATOM   5060 N  N   . THR B 1 289 ? 78.068  21.922  3.345   1.00 41.31  ? 469 THR B N   1 
ATOM   5061 C  CA  . THR B 1 289 ? 77.475  21.438  2.103   1.00 41.80  ? 469 THR B CA  1 
ATOM   5062 C  C   . THR B 1 289 ? 75.963  21.265  2.195   1.00 41.68  ? 469 THR B C   1 
ATOM   5063 O  O   . THR B 1 289 ? 75.275  21.287  1.177   1.00 41.55  ? 469 THR B O   1 
ATOM   5064 C  CB  . THR B 1 289 ? 78.122  20.109  1.658   1.00 41.79  ? 469 THR B CB  1 
ATOM   5065 O  OG1 . THR B 1 289 ? 79.487  20.353  1.290   1.00 41.11  ? 469 THR B OG1 1 
ATOM   5066 C  CG2 . THR B 1 289 ? 77.383  19.519  0.460   1.00 41.47  ? 469 THR B CG2 1 
ATOM   5067 N  N   . LYS B 1 290 ? 75.445  21.097  3.408   1.00 42.35  ? 470 LYS B N   1 
ATOM   5068 C  CA  . LYS B 1 290 ? 74.008  20.949  3.594   1.00 42.78  ? 470 LYS B CA  1 
ATOM   5069 C  C   . LYS B 1 290 ? 73.304  22.248  3.199   1.00 42.93  ? 470 LYS B C   1 
ATOM   5070 O  O   . LYS B 1 290 ? 72.173  22.225  2.714   1.00 42.87  ? 470 LYS B O   1 
ATOM   5071 C  CB  . LYS B 1 290 ? 73.682  20.602  5.050   1.00 44.57  ? 470 LYS B CB  1 
ATOM   5072 C  CG  . LYS B 1 290 ? 74.097  19.197  5.460   1.00 47.05  ? 470 LYS B CG  1 
ATOM   5073 C  CD  . LYS B 1 290 ? 73.482  18.806  6.804   1.00 49.53  ? 470 LYS B CD  1 
ATOM   5074 C  CE  . LYS B 1 290 ? 73.711  17.327  7.106   1.00 51.06  ? 470 LYS B CE  1 
ATOM   5075 N  NZ  . LYS B 1 290 ? 73.062  16.890  8.380   1.00 53.06  ? 470 LYS B NZ  1 
ATOM   5076 N  N   . LEU B 1 291 ? 73.981  23.377  3.403   1.00 42.22  ? 471 LEU B N   1 
ATOM   5077 C  CA  . LEU B 1 291 ? 73.426  24.683  3.050   1.00 41.70  ? 471 LEU B CA  1 
ATOM   5078 C  C   . LEU B 1 291 ? 73.842  25.083  1.638   1.00 41.47  ? 471 LEU B C   1 
ATOM   5079 O  O   . LEU B 1 291 ? 73.092  25.757  0.930   1.00 41.65  ? 471 LEU B O   1 
ATOM   5080 C  CB  . LEU B 1 291 ? 73.898  25.764  4.032   1.00 41.37  ? 471 LEU B CB  1 
ATOM   5081 C  CG  . LEU B 1 291 ? 73.438  25.686  5.490   1.00 41.32  ? 471 LEU B CG  1 
ATOM   5082 C  CD1 . LEU B 1 291 ? 73.924  26.913  6.240   1.00 40.44  ? 471 LEU B CD1 1 
ATOM   5083 C  CD2 . LEU B 1 291 ? 71.923  25.610  5.551   1.00 41.08  ? 471 LEU B CD2 1 
ATOM   5084 N  N   . PHE B 1 292 ? 75.048  24.679  1.241   1.00 40.76  ? 472 PHE B N   1 
ATOM   5085 C  CA  . PHE B 1 292 ? 75.572  24.994  -0.085  1.00 40.38  ? 472 PHE B CA  1 
ATOM   5086 C  C   . PHE B 1 292 ? 76.089  23.724  -0.747  1.00 41.18  ? 472 PHE B C   1 
ATOM   5087 O  O   . PHE B 1 292 ? 77.296  23.454  -0.747  1.00 40.68  ? 472 PHE B O   1 
ATOM   5088 C  CB  . PHE B 1 292 ? 76.702  26.024  0.014   1.00 38.86  ? 472 PHE B CB  1 
ATOM   5089 C  CG  . PHE B 1 292 ? 76.322  27.264  0.767   1.00 37.01  ? 472 PHE B CG  1 
ATOM   5090 C  CD1 . PHE B 1 292 ? 76.650  27.405  2.111   1.00 35.54  ? 472 PHE B CD1 1 
ATOM   5091 C  CD2 . PHE B 1 292 ? 75.603  28.280  0.142   1.00 36.61  ? 472 PHE B CD2 1 
ATOM   5092 C  CE1 . PHE B 1 292 ? 76.270  28.539  2.825   1.00 35.34  ? 472 PHE B CE1 1 
ATOM   5093 C  CE2 . PHE B 1 292 ? 75.216  29.419  0.846   1.00 35.87  ? 472 PHE B CE2 1 
ATOM   5094 C  CZ  . PHE B 1 292 ? 75.549  29.549  2.190   1.00 35.47  ? 472 PHE B CZ  1 
ATOM   5095 N  N   . PRO B 1 293 ? 75.174  22.935  -1.339  1.00 41.97  ? 473 PRO B N   1 
ATOM   5096 C  CA  . PRO B 1 293 ? 75.506  21.676  -2.012  1.00 41.66  ? 473 PRO B CA  1 
ATOM   5097 C  C   . PRO B 1 293 ? 76.637  21.752  -3.031  1.00 40.93  ? 473 PRO B C   1 
ATOM   5098 O  O   . PRO B 1 293 ? 77.329  20.760  -3.251  1.00 41.41  ? 473 PRO B O   1 
ATOM   5099 C  CB  . PRO B 1 293 ? 74.171  21.249  -2.632  1.00 42.38  ? 473 PRO B CB  1 
ATOM   5100 C  CG  . PRO B 1 293 ? 73.461  22.557  -2.859  1.00 42.89  ? 473 PRO B CG  1 
ATOM   5101 C  CD  . PRO B 1 293 ? 73.764  23.297  -1.580  1.00 42.69  ? 473 PRO B CD  1 
ATOM   5102 N  N   . MET B 1 294 ? 76.836  22.916  -3.647  1.00 39.91  ? 474 MET B N   1 
ATOM   5103 C  CA  . MET B 1 294 ? 77.905  23.056  -4.635  1.00 39.74  ? 474 MET B CA  1 
ATOM   5104 C  C   . MET B 1 294 ? 79.292  22.930  -4.001  1.00 39.84  ? 474 MET B C   1 
ATOM   5105 O  O   . MET B 1 294 ? 80.289  22.752  -4.701  1.00 39.14  ? 474 MET B O   1 
ATOM   5106 C  CB  . MET B 1 294 ? 77.797  24.392  -5.392  1.00 40.09  ? 474 MET B CB  1 
ATOM   5107 C  CG  . MET B 1 294 ? 77.863  25.658  -4.542  1.00 40.18  ? 474 MET B CG  1 
ATOM   5108 S  SD  . MET B 1 294 ? 76.379  25.967  -3.545  1.00 41.82  ? 474 MET B SD  1 
ATOM   5109 C  CE  . MET B 1 294 ? 75.213  26.439  -4.827  1.00 42.21  ? 474 MET B CE  1 
ATOM   5110 N  N   . VAL B 1 295 ? 79.347  23.004  -2.673  1.00 40.16  ? 475 VAL B N   1 
ATOM   5111 C  CA  . VAL B 1 295 ? 80.612  22.894  -1.954  1.00 39.78  ? 475 VAL B CA  1 
ATOM   5112 C  C   . VAL B 1 295 ? 81.184  21.479  -2.009  1.00 40.55  ? 475 VAL B C   1 
ATOM   5113 O  O   . VAL B 1 295 ? 82.402  21.294  -1.946  1.00 39.48  ? 475 VAL B O   1 
ATOM   5114 C  CB  . VAL B 1 295 ? 80.457  23.317  -0.465  1.00 39.01  ? 475 VAL B CB  1 
ATOM   5115 C  CG1 . VAL B 1 295 ? 81.722  22.965  0.320   1.00 38.19  ? 475 VAL B CG1 1 
ATOM   5116 C  CG2 . VAL B 1 295 ? 80.208  24.816  -0.375  1.00 38.48  ? 475 VAL B CG2 1 
ATOM   5117 N  N   . GLU B 1 296 ? 80.310  20.483  -2.136  1.00 41.57  ? 476 GLU B N   1 
ATOM   5118 C  CA  . GLU B 1 296 ? 80.758  19.093  -2.184  1.00 42.95  ? 476 GLU B CA  1 
ATOM   5119 C  C   . GLU B 1 296 ? 81.727  18.819  -3.325  1.00 43.01  ? 476 GLU B C   1 
ATOM   5120 O  O   . GLU B 1 296 ? 82.822  18.304  -3.110  1.00 42.81  ? 476 GLU B O   1 
ATOM   5121 C  CB  . GLU B 1 296 ? 79.569  18.137  -2.308  1.00 44.28  ? 476 GLU B CB  1 
ATOM   5122 C  CG  . GLU B 1 296 ? 79.991  16.671  -2.304  1.00 45.77  ? 476 GLU B CG  1 
ATOM   5123 C  CD  . GLU B 1 296 ? 78.823  15.708  -2.375  1.00 46.93  ? 476 GLU B CD  1 
ATOM   5124 O  OE1 . GLU B 1 296 ? 77.913  15.801  -1.522  1.00 47.51  ? 476 GLU B OE1 1 
ATOM   5125 O  OE2 . GLU B 1 296 ? 78.824  14.846  -3.280  1.00 47.60  ? 476 GLU B OE2 1 
ATOM   5126 N  N   . GLU B 1 297 ? 81.319  19.173  -4.537  1.00 44.11  ? 477 GLU B N   1 
ATOM   5127 C  CA  . GLU B 1 297 ? 82.133  18.946  -5.724  1.00 44.99  ? 477 GLU B CA  1 
ATOM   5128 C  C   . GLU B 1 297 ? 83.399  19.790  -5.772  1.00 44.01  ? 477 GLU B C   1 
ATOM   5129 O  O   . GLU B 1 297 ? 84.453  19.314  -6.193  1.00 44.06  ? 477 GLU B O   1 
ATOM   5130 C  CB  . GLU B 1 297 ? 81.308  19.229  -6.980  1.00 47.20  ? 477 GLU B CB  1 
ATOM   5131 C  CG  . GLU B 1 297 ? 82.036  18.927  -8.282  1.00 51.73  ? 477 GLU B CG  1 
ATOM   5132 C  CD  . GLU B 1 297 ? 81.330  19.504  -9.503  1.00 54.27  ? 477 GLU B CD  1 
ATOM   5133 O  OE1 . GLU B 1 297 ? 80.104  19.282  -9.649  1.00 55.25  ? 477 GLU B OE1 1 
ATOM   5134 O  OE2 . GLU B 1 297 ? 82.006  20.174  -10.320 1.00 55.51  ? 477 GLU B OE2 1 
ATOM   5135 N  N   . ILE B 1 298 ? 83.293  21.041  -5.339  1.00 42.78  ? 478 ILE B N   1 
ATOM   5136 C  CA  . ILE B 1 298 ? 84.426  21.957  -5.382  1.00 41.49  ? 478 ILE B CA  1 
ATOM   5137 C  C   . ILE B 1 298 ? 85.387  21.919  -4.193  1.00 40.86  ? 478 ILE B C   1 
ATOM   5138 O  O   . ILE B 1 298 ? 86.569  22.220  -4.350  1.00 40.54  ? 478 ILE B O   1 
ATOM   5139 C  CB  . ILE B 1 298 ? 83.933  23.411  -5.573  1.00 40.64  ? 478 ILE B CB  1 
ATOM   5140 C  CG1 . ILE B 1 298 ? 83.125  23.514  -6.870  1.00 40.85  ? 478 ILE B CG1 1 
ATOM   5141 C  CG2 . ILE B 1 298 ? 85.116  24.373  -5.619  1.00 40.40  ? 478 ILE B CG2 1 
ATOM   5142 C  CD1 . ILE B 1 298 ? 83.887  23.057  -8.111  1.00 39.87  ? 478 ILE B CD1 1 
ATOM   5143 N  N   . MET B 1 299 ? 84.904  21.542  -3.015  1.00 40.60  ? 479 MET B N   1 
ATOM   5144 C  CA  . MET B 1 299 ? 85.778  21.522  -1.848  1.00 41.05  ? 479 MET B CA  1 
ATOM   5145 C  C   . MET B 1 299 ? 85.907  20.188  -1.115  1.00 40.54  ? 479 MET B C   1 
ATOM   5146 O  O   . MET B 1 299 ? 86.994  19.849  -0.650  1.00 40.54  ? 479 MET B O   1 
ATOM   5147 C  CB  . MET B 1 299 ? 85.360  22.643  -0.890  1.00 41.26  ? 479 MET B CB  1 
ATOM   5148 C  CG  . MET B 1 299 ? 85.432  24.010  -1.565  1.00 42.18  ? 479 MET B CG  1 
ATOM   5149 S  SD  . MET B 1 299 ? 84.815  25.374  -0.592  1.00 45.15  ? 479 MET B SD  1 
ATOM   5150 C  CE  . MET B 1 299 ? 86.328  25.958  0.167   1.00 44.53  ? 479 MET B CE  1 
ATOM   5151 N  N   . LEU B 1 300 ? 84.825  19.428  -1.004  1.00 40.19  ? 480 LEU B N   1 
ATOM   5152 C  CA  . LEU B 1 300 ? 84.917  18.134  -0.336  1.00 40.31  ? 480 LEU B CA  1 
ATOM   5153 C  C   . LEU B 1 300 ? 85.741  17.173  -1.190  1.00 40.78  ? 480 LEU B C   1 
ATOM   5154 O  O   . LEU B 1 300 ? 86.589  16.445  -0.680  1.00 40.94  ? 480 LEU B O   1 
ATOM   5155 C  CB  . LEU B 1 300 ? 83.525  17.551  -0.089  1.00 39.35  ? 480 LEU B CB  1 
ATOM   5156 C  CG  . LEU B 1 300 ? 82.834  18.070  1.173   1.00 39.70  ? 480 LEU B CG  1 
ATOM   5157 C  CD1 . LEU B 1 300 ? 81.397  17.597  1.219   1.00 39.53  ? 480 LEU B CD1 1 
ATOM   5158 C  CD2 . LEU B 1 300 ? 83.599  17.584  2.399   1.00 39.22  ? 480 LEU B CD2 1 
ATOM   5159 N  N   . GLN B 1 301 ? 85.493  17.195  -2.496  1.00 40.91  ? 481 GLN B N   1 
ATOM   5160 C  CA  . GLN B 1 301 ? 86.195  16.340  -3.448  1.00 40.94  ? 481 GLN B CA  1 
ATOM   5161 C  C   . GLN B 1 301 ? 87.714  16.356  -3.240  1.00 40.06  ? 481 GLN B C   1 
ATOM   5162 O  O   . GLN B 1 301 ? 88.329  15.309  -3.033  1.00 39.35  ? 481 GLN B O   1 
ATOM   5163 C  CB  . GLN B 1 301 ? 85.868  16.783  -4.876  1.00 43.64  ? 481 GLN B CB  1 
ATOM   5164 C  CG  . GLN B 1 301 ? 86.109  15.726  -5.925  1.00 47.20  ? 481 GLN B CG  1 
ATOM   5165 C  CD  . GLN B 1 301 ? 85.131  14.576  -5.796  1.00 49.41  ? 481 GLN B CD  1 
ATOM   5166 O  OE1 . GLN B 1 301 ? 83.914  14.772  -5.874  1.00 50.83  ? 481 GLN B OE1 1 
ATOM   5167 N  NE2 . GLN B 1 301 ? 85.655  13.369  -5.592  1.00 49.40  ? 481 GLN B NE2 1 
ATOM   5168 N  N   . PRO B 1 302 ? 88.343  17.547  -3.298  1.00 39.48  ? 482 PRO B N   1 
ATOM   5169 C  CA  . PRO B 1 302 ? 89.796  17.599  -3.102  1.00 38.54  ? 482 PRO B CA  1 
ATOM   5170 C  C   . PRO B 1 302 ? 90.224  17.145  -1.702  1.00 38.27  ? 482 PRO B C   1 
ATOM   5171 O  O   . PRO B 1 302 ? 91.341  16.649  -1.516  1.00 37.72  ? 482 PRO B O   1 
ATOM   5172 C  CB  . PRO B 1 302 ? 90.133  19.064  -3.387  1.00 38.34  ? 482 PRO B CB  1 
ATOM   5173 C  CG  . PRO B 1 302 ? 88.890  19.782  -2.987  1.00 39.41  ? 482 PRO B CG  1 
ATOM   5174 C  CD  . PRO B 1 302 ? 87.804  18.895  -3.554  1.00 39.00  ? 482 PRO B CD  1 
ATOM   5175 N  N   . LEU B 1 303 ? 89.341  17.316  -0.721  1.00 37.46  ? 483 LEU B N   1 
ATOM   5176 C  CA  . LEU B 1 303 ? 89.647  16.883  0.636   1.00 37.11  ? 483 LEU B CA  1 
ATOM   5177 C  C   . LEU B 1 303 ? 89.666  15.354  0.686   1.00 37.15  ? 483 LEU B C   1 
ATOM   5178 O  O   . LEU B 1 303 ? 90.507  14.757  1.355   1.00 36.98  ? 483 LEU B O   1 
ATOM   5179 C  CB  . LEU B 1 303 ? 88.618  17.435  1.631   1.00 36.05  ? 483 LEU B CB  1 
ATOM   5180 C  CG  . LEU B 1 303 ? 88.756  18.903  2.068   1.00 35.93  ? 483 LEU B CG  1 
ATOM   5181 C  CD1 . LEU B 1 303 ? 87.615  19.250  3.009   1.00 34.54  ? 483 LEU B CD1 1 
ATOM   5182 C  CD2 . LEU B 1 303 ? 90.098  19.137  2.760   1.00 33.38  ? 483 LEU B CD2 1 
ATOM   5183 N  N   . TRP B 1 304 ? 88.741  14.719  -0.024  1.00 37.79  ? 484 TRP B N   1 
ATOM   5184 C  CA  . TRP B 1 304 ? 88.698  13.262  -0.049  1.00 38.75  ? 484 TRP B CA  1 
ATOM   5185 C  C   . TRP B 1 304 ? 89.969  12.740  -0.709  1.00 39.22  ? 484 TRP B C   1 
ATOM   5186 O  O   . TRP B 1 304 ? 90.584  11.789  -0.225  1.00 39.82  ? 484 TRP B O   1 
ATOM   5187 C  CB  . TRP B 1 304 ? 87.470  12.763  -0.818  1.00 38.33  ? 484 TRP B CB  1 
ATOM   5188 C  CG  . TRP B 1 304 ? 86.170  13.043  -0.130  1.00 37.42  ? 484 TRP B CG  1 
ATOM   5189 C  CD1 . TRP B 1 304 ? 85.936  13.014  1.212   1.00 37.21  ? 484 TRP B CD1 1 
ATOM   5190 C  CD2 . TRP B 1 304 ? 84.910  13.329  -0.751  1.00 37.61  ? 484 TRP B CD2 1 
ATOM   5191 N  NE1 . TRP B 1 304 ? 84.611  13.262  1.467   1.00 37.26  ? 484 TRP B NE1 1 
ATOM   5192 C  CE2 . TRP B 1 304 ? 83.957  13.458  0.280   1.00 37.34  ? 484 TRP B CE2 1 
ATOM   5193 C  CE3 . TRP B 1 304 ? 84.494  13.486  -2.080  1.00 37.60  ? 484 TRP B CE3 1 
ATOM   5194 C  CZ2 . TRP B 1 304 ? 82.609  13.739  0.028   1.00 37.42  ? 484 TRP B CZ2 1 
ATOM   5195 C  CZ3 . TRP B 1 304 ? 83.155  13.766  -2.333  1.00 37.31  ? 484 TRP B CZ3 1 
ATOM   5196 C  CH2 . TRP B 1 304 ? 82.229  13.890  -1.281  1.00 37.87  ? 484 TRP B CH2 1 
ATOM   5197 N  N   . GLU B 1 305 ? 90.360  13.384  -1.807  1.00 40.15  ? 485 GLU B N   1 
ATOM   5198 C  CA  . GLU B 1 305 ? 91.560  13.015  -2.556  1.00 40.26  ? 485 GLU B CA  1 
ATOM   5199 C  C   . GLU B 1 305 ? 92.829  13.188  -1.728  1.00 39.89  ? 485 GLU B C   1 
ATOM   5200 O  O   . GLU B 1 305 ? 93.757  12.377  -1.821  1.00 39.85  ? 485 GLU B O   1 
ATOM   5201 C  CB  . GLU B 1 305 ? 91.663  13.861  -3.831  1.00 42.02  ? 485 GLU B CB  1 
ATOM   5202 C  CG  . GLU B 1 305 ? 90.787  13.377  -4.978  1.00 46.05  ? 485 GLU B CG  1 
ATOM   5203 C  CD  . GLU B 1 305 ? 90.596  14.421  -6.072  1.00 48.50  ? 485 GLU B CD  1 
ATOM   5204 O  OE1 . GLU B 1 305 ? 91.583  15.090  -6.457  1.00 50.67  ? 485 GLU B OE1 1 
ATOM   5205 O  OE2 . GLU B 1 305 ? 89.452  14.565  -6.555  1.00 50.73  ? 485 GLU B OE2 1 
ATOM   5206 N  N   . SER B 1 306 ? 92.875  14.246  -0.923  1.00 39.04  ? 486 SER B N   1 
ATOM   5207 C  CA  . SER B 1 306 ? 94.043  14.496  -0.089  1.00 37.83  ? 486 SER B CA  1 
ATOM   5208 C  C   . SER B 1 306 ? 94.083  13.452  1.019   1.00 37.21  ? 486 SER B C   1 
ATOM   5209 O  O   . SER B 1 306 ? 95.150  12.961  1.383   1.00 36.83  ? 486 SER B O   1 
ATOM   5210 C  CB  . SER B 1 306 ? 93.992  15.906  0.510   1.00 37.22  ? 486 SER B CB  1 
ATOM   5211 O  OG  . SER B 1 306 ? 95.177  16.191  1.234   1.00 34.60  ? 486 SER B OG  1 
ATOM   5212 N  N   . ARG B 1 307 ? 92.912  13.117  1.549   1.00 37.06  ? 487 ARG B N   1 
ATOM   5213 C  CA  . ARG B 1 307 ? 92.815  12.114  2.602   1.00 37.40  ? 487 ARG B CA  1 
ATOM   5214 C  C   . ARG B 1 307 ? 93.390  10.799  2.088   1.00 38.24  ? 487 ARG B C   1 
ATOM   5215 O  O   . ARG B 1 307 ? 94.248  10.193  2.728   1.00 38.15  ? 487 ARG B O   1 
ATOM   5216 C  CB  . ARG B 1 307 ? 91.356  11.892  3.004   1.00 37.25  ? 487 ARG B CB  1 
ATOM   5217 C  CG  . ARG B 1 307 ? 91.145  10.719  3.967   1.00 37.67  ? 487 ARG B CG  1 
ATOM   5218 C  CD  . ARG B 1 307 ? 89.696  10.261  3.949   1.00 37.56  ? 487 ARG B CD  1 
ATOM   5219 N  NE  . ARG B 1 307 ? 89.309  9.828   2.611   1.00 38.60  ? 487 ARG B NE  1 
ATOM   5220 C  CZ  . ARG B 1 307 ? 88.056  9.756   2.177   1.00 38.03  ? 487 ARG B CZ  1 
ATOM   5221 N  NH1 . ARG B 1 307 ? 87.057  10.089  2.980   1.00 39.32  ? 487 ARG B NH1 1 
ATOM   5222 N  NH2 . ARG B 1 307 ? 87.803  9.357   0.936   1.00 37.72  ? 487 ARG B NH2 1 
ATOM   5223 N  N   . ASP B 1 308 ? 92.913  10.361  0.926   1.00 38.83  ? 488 ASP B N   1 
ATOM   5224 C  CA  . ASP B 1 308 ? 93.380  9.108   0.343   1.00 40.05  ? 488 ASP B CA  1 
ATOM   5225 C  C   . ASP B 1 308 ? 94.867  9.156   0.012   1.00 39.96  ? 488 ASP B C   1 
ATOM   5226 O  O   . ASP B 1 308 ? 95.600  8.205   0.275   1.00 39.57  ? 488 ASP B O   1 
ATOM   5227 C  CB  . ASP B 1 308 ? 92.571  8.769   -0.914  1.00 39.95  ? 488 ASP B CB  1 
ATOM   5228 C  CG  . ASP B 1 308 ? 91.099  8.534   -0.616  1.00 40.78  ? 488 ASP B CG  1 
ATOM   5229 O  OD1 . ASP B 1 308 ? 90.754  8.326   0.568   1.00 40.91  ? 488 ASP B OD1 1 
ATOM   5230 O  OD2 . ASP B 1 308 ? 90.288  8.546   -1.567  1.00 42.07  ? 488 ASP B OD2 1 
ATOM   5231 N  N   . ARG B 1 309 ? 95.310  10.273  -0.551  1.00 40.60  ? 489 ARG B N   1 
ATOM   5232 C  CA  . ARG B 1 309 ? 96.707  10.427  -0.911  1.00 41.46  ? 489 ARG B CA  1 
ATOM   5233 C  C   . ARG B 1 309 ? 97.627  10.345  0.308   1.00 41.64  ? 489 ARG B C   1 
ATOM   5234 O  O   . ARG B 1 309 ? 98.681  9.710   0.252   1.00 41.72  ? 489 ARG B O   1 
ATOM   5235 C  CB  . ARG B 1 309 ? 96.927  11.756  -1.647  1.00 42.67  ? 489 ARG B CB  1 
ATOM   5236 C  CG  . ARG B 1 309 ? 98.393  12.043  -1.930  1.00 44.93  ? 489 ARG B CG  1 
ATOM   5237 C  CD  . ARG B 1 309 ? 98.614  13.250  -2.830  1.00 47.15  ? 489 ARG B CD  1 
ATOM   5238 N  NE  . ARG B 1 309 ? 100.023 13.643  -2.807  1.00 49.46  ? 489 ARG B NE  1 
ATOM   5239 C  CZ  . ARG B 1 309 ? 100.635 14.164  -1.743  1.00 51.23  ? 489 ARG B CZ  1 
ATOM   5240 N  NH1 . ARG B 1 309 ? 99.959  14.365  -0.618  1.00 51.77  ? 489 ARG B NH1 1 
ATOM   5241 N  NH2 . ARG B 1 309 ? 101.931 14.458  -1.790  1.00 51.51  ? 489 ARG B NH2 1 
ATOM   5242 N  N   . TYR B 1 310 ? 97.235  10.980  1.409   1.00 41.24  ? 490 TYR B N   1 
ATOM   5243 C  CA  . TYR B 1 310 ? 98.064  10.952  2.613   1.00 41.45  ? 490 TYR B CA  1 
ATOM   5244 C  C   . TYR B 1 310 ? 97.998  9.615   3.338   1.00 41.14  ? 490 TYR B C   1 
ATOM   5245 O  O   . TYR B 1 310 ? 98.997  9.156   3.887   1.00 40.01  ? 490 TYR B O   1 
ATOM   5246 C  CB  . TYR B 1 310 ? 97.682  12.090  3.567   1.00 40.44  ? 490 TYR B CB  1 
ATOM   5247 C  CG  . TYR B 1 310 ? 98.357  13.397  3.223   1.00 40.73  ? 490 TYR B CG  1 
ATOM   5248 C  CD1 . TYR B 1 310 ? 99.747  13.498  3.213   1.00 39.99  ? 490 TYR B CD1 1 
ATOM   5249 C  CD2 . TYR B 1 310 ? 97.611  14.527  2.888   1.00 40.72  ? 490 TYR B CD2 1 
ATOM   5250 C  CE1 . TYR B 1 310 ? 100.382 14.690  2.878   1.00 40.82  ? 490 TYR B CE1 1 
ATOM   5251 C  CE2 . TYR B 1 310 ? 98.239  15.731  2.549   1.00 41.35  ? 490 TYR B CE2 1 
ATOM   5252 C  CZ  . TYR B 1 310 ? 99.624  15.802  2.545   1.00 40.77  ? 490 TYR B CZ  1 
ATOM   5253 O  OH  . TYR B 1 310 ? 100.251 16.976  2.202   1.00 40.69  ? 490 TYR B OH  1 
ATOM   5254 N  N   . GLU B 1 311 ? 96.826  8.993   3.345   1.00 41.56  ? 491 GLU B N   1 
ATOM   5255 C  CA  . GLU B 1 311 ? 96.689  7.699   3.999   1.00 43.64  ? 491 GLU B CA  1 
ATOM   5256 C  C   . GLU B 1 311 ? 97.546  6.679   3.251   1.00 44.16  ? 491 GLU B C   1 
ATOM   5257 O  O   . GLU B 1 311 ? 98.216  5.848   3.865   1.00 43.91  ? 491 GLU B O   1 
ATOM   5258 C  CB  . GLU B 1 311 ? 95.225  7.266   4.026   1.00 43.72  ? 491 GLU B CB  1 
ATOM   5259 C  CG  . GLU B 1 311 ? 94.627  7.320   5.421   1.00 45.20  ? 491 GLU B CG  1 
ATOM   5260 C  CD  . GLU B 1 311 ? 93.126  7.167   5.424   1.00 46.18  ? 491 GLU B CD  1 
ATOM   5261 O  OE1 . GLU B 1 311 ? 92.556  6.991   6.522   1.00 47.91  ? 491 GLU B OE1 1 
ATOM   5262 O  OE2 . GLU B 1 311 ? 92.515  7.228   4.336   1.00 46.30  ? 491 GLU B OE2 1 
ATOM   5263 N  N   . GLU B 1 312 ? 97.528  6.755   1.923   1.00 44.69  ? 492 GLU B N   1 
ATOM   5264 C  CA  . GLU B 1 312 ? 98.336  5.860   1.103   1.00 45.56  ? 492 GLU B CA  1 
ATOM   5265 C  C   . GLU B 1 312 ? 99.807  6.172   1.377   1.00 46.20  ? 492 GLU B C   1 
ATOM   5266 O  O   . GLU B 1 312 ? 100.638 5.272   1.499   1.00 45.76  ? 492 GLU B O   1 
ATOM   5267 C  CB  . GLU B 1 312 ? 98.029  6.071   -0.387  1.00 45.46  ? 492 GLU B CB  1 
ATOM   5268 C  CG  . GLU B 1 312 ? 99.050  5.435   -1.348  1.00 45.91  ? 492 GLU B CG  1 
ATOM   5269 C  CD  . GLU B 1 312 ? 99.029  3.905   -1.350  1.00 45.41  ? 492 GLU B CD  1 
ATOM   5270 O  OE1 . GLU B 1 312 ? 98.383  3.303   -0.466  1.00 45.12  ? 492 GLU B OE1 1 
ATOM   5271 O  OE2 . GLU B 1 312 ? 99.671  3.305   -2.241  1.00 46.35  ? 492 GLU B OE2 1 
ATOM   5272 N  N   . LEU B 1 313 ? 100.113 7.460   1.485   1.00 47.23  ? 493 LEU B N   1 
ATOM   5273 C  CA  . LEU B 1 313 ? 101.474 7.910   1.742   1.00 48.33  ? 493 LEU B CA  1 
ATOM   5274 C  C   . LEU B 1 313 ? 101.989 7.401   3.094   1.00 48.75  ? 493 LEU B C   1 
ATOM   5275 O  O   . LEU B 1 313 ? 103.195 7.204   3.274   1.00 48.75  ? 493 LEU B O   1 
ATOM   5276 C  CB  . LEU B 1 313 ? 101.521 9.435   1.699   1.00 49.13  ? 493 LEU B CB  1 
ATOM   5277 C  CG  . LEU B 1 313 ? 102.857 10.103  1.384   1.00 50.58  ? 493 LEU B CG  1 
ATOM   5278 C  CD1 . LEU B 1 313 ? 103.413 9.571   0.064   1.00 50.71  ? 493 LEU B CD1 1 
ATOM   5279 C  CD2 . LEU B 1 313 ? 102.647 11.609  1.297   1.00 51.37  ? 493 LEU B CD2 1 
ATOM   5280 N  N   . LYS B 1 314 ? 101.080 7.184   4.041   1.00 48.68  ? 494 LYS B N   1 
ATOM   5281 C  CA  . LYS B 1 314 ? 101.481 6.696   5.353   1.00 49.09  ? 494 LYS B CA  1 
ATOM   5282 C  C   . LYS B 1 314 ? 101.727 5.191   5.320   1.00 49.25  ? 494 LYS B C   1 
ATOM   5283 O  O   . LYS B 1 314 ? 102.566 4.683   6.061   1.00 48.76  ? 494 LYS B O   1 
ATOM   5284 C  CB  . LYS B 1 314 ? 100.423 7.002   6.413   1.00 48.98  ? 494 LYS B CB  1 
ATOM   5285 C  CG  . LYS B 1 314 ? 100.915 6.689   7.821   1.00 49.33  ? 494 LYS B CG  1 
ATOM   5286 C  CD  . LYS B 1 314 ? 99.811  6.153   8.701   1.00 50.73  ? 494 LYS B CD  1 
ATOM   5287 C  CE  . LYS B 1 314 ? 100.374 5.674   10.031  1.00 51.68  ? 494 LYS B CE  1 
ATOM   5288 N  NZ  . LYS B 1 314 ? 99.365  4.887   10.793  1.00 52.57  ? 494 LYS B NZ  1 
ATOM   5289 N  N   . ARG B 1 315 ? 100.978 4.480   4.480   1.00 50.10  ? 495 ARG B N   1 
ATOM   5290 C  CA  . ARG B 1 315 ? 101.155 3.036   4.351   1.00 51.19  ? 495 ARG B CA  1 
ATOM   5291 C  C   . ARG B 1 315 ? 102.564 2.804   3.832   1.00 50.04  ? 495 ARG B C   1 
ATOM   5292 O  O   . ARG B 1 315 ? 103.262 1.899   4.275   1.00 49.49  ? 495 ARG B O   1 
ATOM   5293 C  CB  . ARG B 1 315 ? 100.152 2.444   3.360   1.00 54.05  ? 495 ARG B CB  1 
ATOM   5294 C  CG  . ARG B 1 315 ? 98.708  2.482   3.818   1.00 57.99  ? 495 ARG B CG  1 
ATOM   5295 C  CD  . ARG B 1 315 ? 97.802  1.860   2.768   1.00 62.27  ? 495 ARG B CD  1 
ATOM   5296 N  NE  . ARG B 1 315 ? 96.395  1.856   3.171   1.00 66.43  ? 495 ARG B NE  1 
ATOM   5297 C  CZ  . ARG B 1 315 ? 95.413  1.314   2.451   1.00 69.04  ? 495 ARG B CZ  1 
ATOM   5298 N  NH1 . ARG B 1 315 ? 95.682  0.732   1.287   1.00 69.87  ? 495 ARG B NH1 1 
ATOM   5299 N  NH2 . ARG B 1 315 ? 94.162  1.344   2.898   1.00 70.01  ? 495 ARG B NH2 1 
ATOM   5300 N  N   . ILE B 1 316 ? 102.972 3.639   2.886   1.00 49.79  ? 496 ILE B N   1 
ATOM   5301 C  CA  . ILE B 1 316 ? 104.299 3.544   2.304   1.00 51.00  ? 496 ILE B CA  1 
ATOM   5302 C  C   . ILE B 1 316 ? 105.339 3.827   3.386   1.00 52.11  ? 496 ILE B C   1 
ATOM   5303 O  O   . ILE B 1 316 ? 106.360 3.148   3.465   1.00 51.65  ? 496 ILE B O   1 
ATOM   5304 C  CB  . ILE B 1 316 ? 104.458 4.543   1.126   1.00 50.25  ? 496 ILE B CB  1 
ATOM   5305 C  CG1 . ILE B 1 316 ? 103.516 4.148   -0.014  1.00 49.63  ? 496 ILE B CG1 1 
ATOM   5306 C  CG2 . ILE B 1 316 ? 105.897 4.564   0.635   1.00 50.25  ? 496 ILE B CG2 1 
ATOM   5307 C  CD1 . ILE B 1 316 ? 103.544 5.091   -1.204  1.00 50.54  ? 496 ILE B CD1 1 
ATOM   5308 N  N   . ASP B 1 317 ? 105.071 4.824   4.227   1.00 54.18  ? 497 ASP B N   1 
ATOM   5309 C  CA  . ASP B 1 317 ? 105.987 5.168   5.314   1.00 55.69  ? 497 ASP B CA  1 
ATOM   5310 C  C   . ASP B 1 317 ? 106.125 4.029   6.323   1.00 55.16  ? 497 ASP B C   1 
ATOM   5311 O  O   . ASP B 1 317 ? 107.232 3.702   6.735   1.00 54.91  ? 497 ASP B O   1 
ATOM   5312 C  CB  . ASP B 1 317 ? 105.518 6.429   6.053   1.00 57.63  ? 497 ASP B CB  1 
ATOM   5313 C  CG  . ASP B 1 317 ? 105.947 7.708   5.361   1.00 59.84  ? 497 ASP B CG  1 
ATOM   5314 O  OD1 . ASP B 1 317 ? 107.132 7.798   4.970   1.00 60.93  ? 497 ASP B OD1 1 
ATOM   5315 O  OD2 . ASP B 1 317 ? 105.107 8.628   5.224   1.00 60.89  ? 497 ASP B OD2 1 
ATOM   5316 N  N   . ASP B 1 318 ? 105.004 3.438   6.726   1.00 55.10  ? 498 ASP B N   1 
ATOM   5317 C  CA  . ASP B 1 318 ? 105.035 2.342   7.693   1.00 56.47  ? 498 ASP B CA  1 
ATOM   5318 C  C   . ASP B 1 318 ? 105.745 1.111   7.133   1.00 57.34  ? 498 ASP B C   1 
ATOM   5319 O  O   . ASP B 1 318 ? 106.544 0.475   7.827   1.00 56.91  ? 498 ASP B O   1 
ATOM   5320 C  CB  . ASP B 1 318 ? 103.615 1.951   8.131   1.00 55.46  ? 498 ASP B CB  1 
ATOM   5321 C  CG  . ASP B 1 318 ? 102.876 3.088   8.818   1.00 55.00  ? 498 ASP B CG  1 
ATOM   5322 O  OD1 . ASP B 1 318 ? 103.515 3.862   9.566   1.00 53.60  ? 498 ASP B OD1 1 
ATOM   5323 O  OD2 . ASP B 1 318 ? 101.648 3.195   8.620   1.00 54.90  ? 498 ASP B OD2 1 
ATOM   5324 N  N   . ALA B 1 319 ? 105.443 0.775   5.881   1.00 58.53  ? 499 ALA B N   1 
ATOM   5325 C  CA  . ALA B 1 319 ? 106.058 -0.375  5.225   1.00 60.28  ? 499 ALA B CA  1 
ATOM   5326 C  C   . ALA B 1 319 ? 107.556 -0.140  5.110   1.00 61.80  ? 499 ALA B C   1 
ATOM   5327 O  O   . ALA B 1 319 ? 108.359 -1.057  5.282   1.00 62.09  ? 499 ALA B O   1 
ATOM   5328 C  CB  . ALA B 1 319 ? 105.455 -0.576  3.841   1.00 59.44  ? 499 ALA B CB  1 
ATOM   5329 N  N   . MET B 1 320 ? 107.922 1.103   4.822   1.00 63.86  ? 500 MET B N   1 
ATOM   5330 C  CA  . MET B 1 320 ? 109.318 1.483   4.683   1.00 66.44  ? 500 MET B CA  1 
ATOM   5331 C  C   . MET B 1 320 ? 110.044 1.419   6.026   1.00 68.54  ? 500 MET B C   1 
ATOM   5332 O  O   . MET B 1 320 ? 111.181 0.960   6.102   1.00 68.45  ? 500 MET B O   1 
ATOM   5333 C  CB  . MET B 1 320 ? 109.413 2.899   4.121   1.00 66.35  ? 500 MET B CB  1 
ATOM   5334 C  CG  . MET B 1 320 ? 110.825 3.347   3.816   1.00 66.93  ? 500 MET B CG  1 
ATOM   5335 S  SD  . MET B 1 320 ? 111.581 2.328   2.544   1.00 68.01  ? 500 MET B SD  1 
ATOM   5336 C  CE  . MET B 1 320 ? 111.044 3.181   1.052   1.00 66.95  ? 500 MET B CE  1 
ATOM   5337 N  N   . LYS B 1 321 ? 109.380 1.880   7.083   1.00 71.29  ? 501 LYS B N   1 
ATOM   5338 C  CA  . LYS B 1 321 ? 109.974 1.877   8.414   1.00 74.33  ? 501 LYS B CA  1 
ATOM   5339 C  C   . LYS B 1 321 ? 110.167 0.477   8.966   1.00 76.19  ? 501 LYS B C   1 
ATOM   5340 O  O   . LYS B 1 321 ? 111.043 0.253   9.799   1.00 76.51  ? 501 LYS B O   1 
ATOM   5341 C  CB  . LYS B 1 321 ? 109.132 2.709   9.390   1.00 74.62  ? 501 LYS B CB  1 
ATOM   5342 C  CG  . LYS B 1 321 ? 109.226 4.208   9.146   1.00 76.23  ? 501 LYS B CG  1 
ATOM   5343 C  CD  . LYS B 1 321 ? 108.725 5.025   10.332  1.00 77.44  ? 501 LYS B CD  1 
ATOM   5344 C  CE  . LYS B 1 321 ? 109.014 6.513   10.122  1.00 78.65  ? 501 LYS B CE  1 
ATOM   5345 N  NZ  . LYS B 1 321 ? 108.704 7.355   11.318  1.00 79.18  ? 501 LYS B NZ  1 
ATOM   5346 N  N   . GLU B 1 322 ? 109.359 -0.471  8.504   1.00 78.48  ? 502 GLU B N   1 
ATOM   5347 C  CA  . GLU B 1 322 ? 109.494 -1.837  8.982   1.00 81.08  ? 502 GLU B CA  1 
ATOM   5348 C  C   . GLU B 1 322 ? 110.644 -2.575  8.303   1.00 82.57  ? 502 GLU B C   1 
ATOM   5349 O  O   . GLU B 1 322 ? 111.200 -3.517  8.868   1.00 83.04  ? 502 GLU B O   1 
ATOM   5350 C  CB  . GLU B 1 322 ? 108.196 -2.615  8.792   1.00 81.37  ? 502 GLU B CB  1 
ATOM   5351 C  CG  . GLU B 1 322 ? 108.320 -4.043  9.279   1.00 83.21  ? 502 GLU B CG  1 
ATOM   5352 C  CD  . GLU B 1 322 ? 106.992 -4.665  9.624   1.00 84.20  ? 502 GLU B CD  1 
ATOM   5353 O  OE1 . GLU B 1 322 ? 106.324 -4.152  10.547  1.00 84.22  ? 502 GLU B OE1 1 
ATOM   5354 O  OE2 . GLU B 1 322 ? 106.621 -5.669  8.977   1.00 85.09  ? 502 GLU B OE2 1 
ATOM   5355 N  N   . LEU B 1 323 ? 110.999 -2.155  7.093   1.00 84.36  ? 503 LEU B N   1 
ATOM   5356 C  CA  . LEU B 1 323 ? 112.106 -2.779  6.376   1.00 86.46  ? 503 LEU B CA  1 
ATOM   5357 C  C   . LEU B 1 323 ? 113.418 -2.402  7.043   1.00 88.15  ? 503 LEU B C   1 
ATOM   5358 O  O   . LEU B 1 323 ? 114.481 -2.899  6.669   1.00 88.53  ? 503 LEU B O   1 
ATOM   5359 C  CB  . LEU B 1 323 ? 112.158 -2.307  4.924   1.00 86.35  ? 503 LEU B CB  1 
ATOM   5360 C  CG  . LEU B 1 323 ? 111.237 -2.961  3.902   1.00 86.62  ? 503 LEU B CG  1 
ATOM   5361 C  CD1 . LEU B 1 323 ? 111.538 -2.388  2.526   1.00 86.41  ? 503 LEU B CD1 1 
ATOM   5362 C  CD2 . LEU B 1 323 ? 111.450 -4.469  3.908   1.00 86.79  ? 503 LEU B CD2 1 
ATOM   5363 N  N   . GLN B 1 324 ? 113.336 -1.517  8.031   1.00 90.12  ? 504 GLN B N   1 
ATOM   5364 C  CA  . GLN B 1 324 ? 114.521 -1.053  8.734   1.00 92.33  ? 504 GLN B CA  1 
ATOM   5365 C  C   . GLN B 1 324 ? 114.700 -1.664  10.121  1.00 93.79  ? 504 GLN B C   1 
ATOM   5366 O  O   . GLN B 1 324 ? 115.258 -1.039  11.026  1.00 93.95  ? 504 GLN B O   1 
ATOM   5367 C  CB  . GLN B 1 324 ? 114.492 0.471   8.810   1.00 92.44  ? 504 GLN B CB  1 
ATOM   5368 C  CG  . GLN B 1 324 ? 114.420 1.114   7.436   1.00 92.65  ? 504 GLN B CG  1 
ATOM   5369 C  CD  . GLN B 1 324 ? 114.392 2.621   7.493   1.00 93.13  ? 504 GLN B CD  1 
ATOM   5370 O  OE1 . GLN B 1 324 ? 115.295 3.246   8.048   1.00 93.52  ? 504 GLN B OE1 1 
ATOM   5371 N  NE2 . GLN B 1 324 ? 113.355 3.219   6.914   1.00 93.01  ? 504 GLN B NE2 1 
ATOM   5372 N  N   . LYS B 1 325 ? 114.217 -2.893  10.272  1.00 95.51  ? 505 LYS B N   1 
ATOM   5373 C  CA  . LYS B 1 325 ? 114.340 -3.643  11.517  1.00 97.11  ? 505 LYS B CA  1 
ATOM   5374 C  C   . LYS B 1 325 ? 114.044 -5.114  11.223  1.00 98.16  ? 505 LYS B C   1 
ATOM   5375 O  O   . LYS B 1 325 ? 113.317 -5.786  11.958  1.00 98.41  ? 505 LYS B O   1 
ATOM   5376 C  CB  . LYS B 1 325 ? 113.384 -3.109  12.589  1.00 97.02  ? 505 LYS B CB  1 
ATOM   5377 C  CG  . LYS B 1 325 ? 113.686 -3.686  13.968  1.00 97.32  ? 505 LYS B CG  1 
ATOM   5378 C  CD  . LYS B 1 325 ? 112.954 -2.969  15.084  1.00 97.28  ? 505 LYS B CD  1 
ATOM   5379 C  CE  . LYS B 1 325 ? 113.384 -3.523  16.434  1.00 97.36  ? 505 LYS B CE  1 
ATOM   5380 N  NZ  . LYS B 1 325 ? 112.729 -2.825  17.574  1.00 97.21  ? 505 LYS B NZ  1 
ATOM   5381 N  N   . LYS B 1 326 ? 114.622 -5.597  10.127  1.00 99.17  ? 506 LYS B N   1 
ATOM   5382 C  CA  . LYS B 1 326 ? 114.454 -6.977  9.685   1.00 99.93  ? 506 LYS B CA  1 
ATOM   5383 C  C   . LYS B 1 326 ? 115.619 -7.347  8.767   1.00 100.30 ? 506 LYS B C   1 
ATOM   5384 O  O   . LYS B 1 326 ? 116.385 -6.426  8.403   1.00 100.33 ? 506 LYS B O   1 
ATOM   5385 C  CB  . LYS B 1 326 ? 113.123 -7.128  8.933   1.00 100.03 ? 506 LYS B CB  1 
ATOM   5386 C  CG  . LYS B 1 326 ? 112.842 -8.519  8.366   1.00 100.15 ? 506 LYS B CG  1 
ATOM   5387 C  CD  . LYS B 1 326 ? 112.508 -9.546  9.448   1.00 100.33 ? 506 LYS B CD  1 
ATOM   5388 C  CE  . LYS B 1 326 ? 113.717 -9.930  10.291  1.00 100.33 ? 506 LYS B CE  1 
ATOM   5389 N  NZ  . LYS B 1 326 ? 113.367 -10.942 11.324  1.00 100.33 ? 506 LYS B NZ  1 
ATOM   5390 O  OXT . LYS B 1 326 ? 115.752 -8.542  8.417   1.00 100.33 ? 506 LYS B OXT 1 
HETATM 5391 ZN ZN  . ZN  C 2 .   ? 84.649  47.659  42.302  1.00 41.07  ? 101 ZN  A ZN  1 
HETATM 5392 MG MG  . MG  D 3 .   ? 85.198  47.256  38.716  1.00 34.47  ? 102 MG  A MG  1 
HETATM 5393 N  N9  . IBM E 4 .   ? 75.240  51.913  40.798  1.00 44.80  ? 1   IBM A N9  1 
HETATM 5394 C  C8  . IBM E 4 .   ? 74.320  52.713  41.438  1.00 43.21  ? 1   IBM A C8  1 
HETATM 5395 N  N7  . IBM E 4 .   ? 74.517  52.815  42.730  1.00 42.82  ? 1   IBM A N7  1 
HETATM 5396 C  C5  . IBM E 4 .   ? 75.637  52.026  42.959  1.00 43.43  ? 1   IBM A C5  1 
HETATM 5397 C  C4  . IBM E 4 .   ? 76.096  51.465  41.782  1.00 44.25  ? 1   IBM A C4  1 
HETATM 5398 N  N3  . IBM E 4 .   ? 77.162  50.643  41.622  1.00 45.21  ? 1   IBM A N3  1 
HETATM 5399 C  C2  . IBM E 4 .   ? 77.855  50.379  42.772  1.00 45.11  ? 1   IBM A C2  1 
HETATM 5400 N  N1  . IBM E 4 .   ? 77.462  50.893  44.011  1.00 44.72  ? 1   IBM A N1  1 
HETATM 5401 C  C6  . IBM E 4 .   ? 76.352  51.710  44.113  1.00 44.47  ? 1   IBM A C6  1 
HETATM 5402 O  O6  . IBM E 4 .   ? 75.992  52.147  45.210  1.00 41.56  ? 1   IBM A O6  1 
HETATM 5403 O  O2  . IBM E 4 .   ? 78.850  49.662  42.717  1.00 47.58  ? 1   IBM A O2  1 
HETATM 5404 C  C10 . IBM E 4 .   ? 78.226  50.559  45.203  1.00 45.11  ? 1   IBM A C10 1 
HETATM 5405 C  C11 . IBM E 4 .   ? 77.514  50.046  40.335  1.00 45.01  ? 1   IBM A C11 1 
HETATM 5406 C  C12 . IBM E 4 .   ? 78.575  50.898  39.628  1.00 46.90  ? 1   IBM A C12 1 
HETATM 5407 C  C13 . IBM E 4 .   ? 78.432  50.743  38.113  1.00 47.13  ? 1   IBM A C13 1 
HETATM 5408 C  C14 . IBM E 4 .   ? 79.994  50.528  40.058  1.00 47.19  ? 1   IBM A C14 1 
HETATM 5409 ZN ZN  . ZN  F 2 .   ? 95.023  31.581  10.225  1.00 42.12  ? 101 ZN  B ZN  1 
HETATM 5410 MG MG  . MG  G 3 .   ? 95.282  32.149  13.855  1.00 33.46  ? 102 MG  B MG  1 
HETATM 5411 N  N9  . IBM H 4 .   ? 97.187  19.600  12.526  1.00 30.13  ? 1   IBM B N9  1 
HETATM 5412 C  C8  . IBM H 4 .   ? 97.461  19.316  11.213  1.00 31.02  ? 1   IBM B C8  1 
HETATM 5413 N  N7  . IBM H 4 .   ? 97.167  20.292  10.389  1.00 31.07  ? 1   IBM B N7  1 
HETATM 5414 C  C5  . IBM H 4 .   ? 96.673  21.287  11.220  1.00 30.62  ? 1   IBM B C5  1 
HETATM 5415 C  C4  . IBM H 4 .   ? 96.679  20.878  12.534  1.00 30.94  ? 1   IBM B C4  1 
HETATM 5416 N  N3  . IBM H 4 .   ? 96.285  21.581  13.614  1.00 32.48  ? 1   IBM B N3  1 
HETATM 5417 C  C2  . IBM H 4 .   ? 95.791  22.829  13.334  1.00 31.38  ? 1   IBM B C2  1 
HETATM 5418 N  N1  . IBM H 4 .   ? 95.752  23.330  12.034  1.00 31.63  ? 1   IBM B N1  1 
HETATM 5419 C  C6  . IBM H 4 .   ? 96.200  22.568  10.976  1.00 31.27  ? 1   IBM B C6  1 
HETATM 5420 O  O6  . IBM H 4 .   ? 96.177  23.009  9.833   1.00 28.87  ? 1   IBM B O6  1 
HETATM 5421 O  O2  . IBM H 4 .   ? 95.378  23.526  14.243  1.00 31.77  ? 1   IBM B O2  1 
HETATM 5422 C  C10 . IBM H 4 .   ? 95.256  24.676  11.800  1.00 30.71  ? 1   IBM B C10 1 
HETATM 5423 C  C11 . IBM H 4 .   ? 96.468  21.081  14.976  1.00 33.23  ? 1   IBM B C11 1 
HETATM 5424 C  C12 . IBM H 4 .   ? 95.126  20.681  15.602  1.00 35.07  ? 1   IBM B C12 1 
HETATM 5425 C  C13 . IBM H 4 .   ? 95.339  19.513  16.538  1.00 35.28  ? 1   IBM B C13 1 
HETATM 5426 C  C14 . IBM H 4 .   ? 94.028  20.372  14.612  1.00 36.05  ? 1   IBM B C14 1 
HETATM 5427 O  O   . HOH I 5 .   ? 82.631  49.278  41.794  1.00 36.02  ? 507 HOH A O   1 
HETATM 5428 O  O   . HOH I 5 .   ? 84.221  49.298  38.445  1.00 40.92  ? 508 HOH A O   1 
HETATM 5429 O  O   . HOH I 5 .   ? 83.377  46.120  37.683  1.00 25.72  ? 509 HOH A O   1 
HETATM 5430 O  O   . HOH I 5 .   ? 85.806  47.978  36.503  1.00 24.59  ? 510 HOH A O   1 
HETATM 5431 O  O   . HOH I 5 .   ? 86.141  45.266  38.637  1.00 25.60  ? 511 HOH A O   1 
HETATM 5432 O  O   . HOH I 5 .   ? 89.858  45.961  19.106  1.00 21.88  ? 512 HOH A O   1 
HETATM 5433 O  O   . HOH I 5 .   ? 80.771  49.529  57.434  1.00 25.68  ? 513 HOH A O   1 
HETATM 5434 O  O   . HOH I 5 .   ? 78.099  43.137  41.312  1.00 21.88  ? 514 HOH A O   1 
HETATM 5435 O  O   . HOH I 5 .   ? 98.191  32.550  58.541  1.00 24.26  ? 515 HOH A O   1 
HETATM 5436 O  O   . HOH I 5 .   ? 78.352  41.137  36.971  1.00 26.64  ? 516 HOH A O   1 
HETATM 5437 O  O   . HOH I 5 .   ? 103.179 40.059  57.285  1.00 29.31  ? 517 HOH A O   1 
HETATM 5438 O  O   . HOH I 5 .   ? 95.899  45.934  29.971  1.00 30.42  ? 518 HOH A O   1 
HETATM 5439 O  O   . HOH I 5 .   ? 98.324  41.555  42.387  1.00 21.78  ? 519 HOH A O   1 
HETATM 5440 O  O   . HOH I 5 .   ? 82.197  57.079  35.483  1.00 27.25  ? 520 HOH A O   1 
HETATM 5441 O  O   . HOH I 5 .   ? 73.061  51.529  54.505  1.00 28.18  ? 521 HOH A O   1 
HETATM 5442 O  O   . HOH I 5 .   ? 86.759  30.927  41.230  1.00 30.29  ? 522 HOH A O   1 
HETATM 5443 O  O   . HOH I 5 .   ? 91.862  52.726  40.696  1.00 20.54  ? 523 HOH A O   1 
HETATM 5444 O  O   . HOH I 5 .   ? 93.693  55.301  45.504  1.00 29.83  ? 524 HOH A O   1 
HETATM 5445 O  O   . HOH I 5 .   ? 81.519  48.216  50.955  1.00 27.44  ? 525 HOH A O   1 
HETATM 5446 O  O   . HOH I 5 .   ? 103.802 31.557  48.504  1.00 27.00  ? 526 HOH A O   1 
HETATM 5447 O  O   . HOH I 5 .   ? 100.297 33.706  60.149  1.00 29.25  ? 527 HOH A O   1 
HETATM 5448 O  O   . HOH I 5 .   ? 85.318  50.586  20.830  1.00 26.75  ? 528 HOH A O   1 
HETATM 5449 O  O   . HOH I 5 .   ? 57.880  81.241  34.059  1.00 28.35  ? 529 HOH A O   1 
HETATM 5450 O  O   . HOH I 5 .   ? 83.443  50.439  36.437  1.00 26.05  ? 530 HOH A O   1 
HETATM 5451 O  O   . HOH I 5 .   ? 76.634  53.737  49.680  1.00 24.69  ? 531 HOH A O   1 
HETATM 5452 O  O   . HOH I 5 .   ? 83.292  51.303  48.347  1.00 29.60  ? 532 HOH A O   1 
HETATM 5453 O  O   . HOH I 5 .   ? 93.235  24.296  49.427  1.00 25.98  ? 533 HOH A O   1 
HETATM 5454 O  O   . HOH I 5 .   ? 83.609  35.552  34.871  1.00 25.61  ? 534 HOH A O   1 
HETATM 5455 O  O   . HOH I 5 .   ? 91.693  55.692  48.602  1.00 35.67  ? 535 HOH A O   1 
HETATM 5456 O  O   . HOH I 5 .   ? 97.467  39.248  62.320  1.00 31.70  ? 536 HOH A O   1 
HETATM 5457 O  O   . HOH I 5 .   ? 91.124  38.813  27.679  1.00 26.61  ? 537 HOH A O   1 
HETATM 5458 O  O   . HOH I 5 .   ? 76.144  49.785  47.608  1.00 30.00  ? 538 HOH A O   1 
HETATM 5459 O  O   . HOH I 5 .   ? 80.320  44.010  40.406  1.00 25.61  ? 539 HOH A O   1 
HETATM 5460 O  O   . HOH I 5 .   ? 79.464  57.113  25.892  1.00 35.79  ? 540 HOH A O   1 
HETATM 5461 O  O   . HOH I 5 .   ? 90.828  53.819  18.599  1.00 26.53  ? 541 HOH A O   1 
HETATM 5462 O  O   . HOH I 5 .   ? 70.832  51.290  56.278  1.00 31.53  ? 542 HOH A O   1 
HETATM 5463 O  O   . HOH I 5 .   ? 102.290 48.807  78.205  1.00 46.50  ? 543 HOH A O   1 
HETATM 5464 O  O   . HOH I 5 .   ? 98.532  55.373  42.627  1.00 35.66  ? 544 HOH A O   1 
HETATM 5465 O  O   . HOH I 5 .   ? 70.621  55.536  53.491  1.00 28.89  ? 545 HOH A O   1 
HETATM 5466 O  O   . HOH I 5 .   ? 72.810  54.010  53.592  1.00 28.00  ? 546 HOH A O   1 
HETATM 5467 O  O   . HOH I 5 .   ? 69.075  60.454  57.693  1.00 39.74  ? 547 HOH A O   1 
HETATM 5468 O  O   . HOH I 5 .   ? 89.665  56.400  30.467  1.00 31.03  ? 548 HOH A O   1 
HETATM 5469 O  O   . HOH I 5 .   ? 80.336  47.259  31.651  1.00 33.01  ? 549 HOH A O   1 
HETATM 5470 O  O   . HOH I 5 .   ? 89.788  27.687  39.131  1.00 42.46  ? 550 HOH A O   1 
HETATM 5471 O  O   . HOH I 5 .   ? 83.048  42.768  21.583  1.00 35.80  ? 551 HOH A O   1 
HETATM 5472 O  O   . HOH I 5 .   ? 101.800 36.676  37.788  1.00 31.38  ? 552 HOH A O   1 
HETATM 5473 O  O   . HOH I 5 .   ? 95.060  49.366  22.047  1.00 30.09  ? 553 HOH A O   1 
HETATM 5474 O  O   . HOH I 5 .   ? 101.746 41.158  60.735  1.00 25.75  ? 554 HOH A O   1 
HETATM 5475 O  O   . HOH I 5 .   ? 103.494 35.515  39.275  1.00 31.64  ? 555 HOH A O   1 
HETATM 5476 O  O   . HOH I 5 .   ? 82.128  45.533  19.715  1.00 34.58  ? 556 HOH A O   1 
HETATM 5477 O  O   . HOH I 5 .   ? 69.961  41.148  41.421  1.00 42.68  ? 557 HOH A O   1 
HETATM 5478 O  O   . HOH I 5 .   ? 83.565  55.097  36.676  1.00 31.53  ? 558 HOH A O   1 
HETATM 5479 O  O   . HOH I 5 .   ? 83.626  40.001  31.977  1.00 33.75  ? 559 HOH A O   1 
HETATM 5480 O  O   . HOH I 5 .   ? 87.192  29.526  37.279  1.00 34.47  ? 560 HOH A O   1 
HETATM 5481 O  O   . HOH I 5 .   ? 96.187  58.520  40.416  1.00 39.17  ? 561 HOH A O   1 
HETATM 5482 O  O   . HOH I 5 .   ? 85.483  26.625  41.785  1.00 34.47  ? 562 HOH A O   1 
HETATM 5483 O  O   . HOH I 5 .   ? 105.420 34.348  49.257  1.00 26.30  ? 563 HOH A O   1 
HETATM 5484 O  O   . HOH I 5 .   ? 82.728  46.702  63.275  1.00 31.42  ? 564 HOH A O   1 
HETATM 5485 O  O   . HOH I 5 .   ? 80.677  47.442  36.452  1.00 36.78  ? 565 HOH A O   1 
HETATM 5486 O  O   . HOH I 5 .   ? 84.416  30.430  58.082  1.00 39.72  ? 566 HOH A O   1 
HETATM 5487 O  O   . HOH I 5 .   ? 81.898  49.518  19.482  1.00 37.92  ? 567 HOH A O   1 
HETATM 5488 O  O   . HOH I 5 .   ? 93.944  50.642  65.755  1.00 37.29  ? 568 HOH A O   1 
HETATM 5489 O  O   . HOH I 5 .   ? 77.374  56.235  28.689  1.00 41.37  ? 569 HOH A O   1 
HETATM 5490 O  O   . HOH I 5 .   ? 88.928  57.571  49.743  1.00 29.66  ? 570 HOH A O   1 
HETATM 5491 O  O   . HOH I 5 .   ? 99.034  41.236  60.741  1.00 28.72  ? 571 HOH A O   1 
HETATM 5492 O  O   . HOH I 5 .   ? 56.137  67.874  46.792  1.00 34.72  ? 572 HOH A O   1 
HETATM 5493 O  O   . HOH I 5 .   ? 95.164  28.949  34.900  1.00 33.40  ? 573 HOH A O   1 
HETATM 5494 O  O   . HOH I 5 .   ? 82.057  52.792  36.891  1.00 33.68  ? 574 HOH A O   1 
HETATM 5495 O  O   . HOH I 5 .   ? 85.415  50.812  63.106  1.00 33.21  ? 575 HOH A O   1 
HETATM 5496 O  O   . HOH I 5 .   ? 66.871  34.301  57.040  1.00 38.61  ? 576 HOH A O   1 
HETATM 5497 O  O   . HOH I 5 .   ? 97.750  30.397  61.378  1.00 43.59  ? 577 HOH A O   1 
HETATM 5498 O  O   . HOH I 5 .   ? 73.709  40.386  31.832  1.00 33.25  ? 578 HOH A O   1 
HETATM 5499 O  O   . HOH I 5 .   ? 65.765  62.697  44.923  1.00 31.72  ? 579 HOH A O   1 
HETATM 5500 O  O   . HOH I 5 .   ? 105.099 32.250  55.840  1.00 31.93  ? 580 HOH A O   1 
HETATM 5501 O  O   . HOH I 5 .   ? 55.451  82.281  33.058  1.00 37.14  ? 581 HOH A O   1 
HETATM 5502 O  O   . HOH I 5 .   ? 62.253  46.667  47.864  1.00 44.69  ? 582 HOH A O   1 
HETATM 5503 O  O   . HOH I 5 .   ? 69.016  36.441  59.566  1.00 39.82  ? 583 HOH A O   1 
HETATM 5504 O  O   . HOH I 5 .   ? 100.500 33.368  34.147  1.00 36.50  ? 584 HOH A O   1 
HETATM 5505 O  O   . HOH I 5 .   ? 91.595  23.706  52.542  1.00 37.82  ? 585 HOH A O   1 
HETATM 5506 O  O   . HOH I 5 .   ? 98.344  34.191  62.242  1.00 32.69  ? 586 HOH A O   1 
HETATM 5507 O  O   . HOH I 5 .   ? 86.468  59.956  37.364  1.00 32.95  ? 587 HOH A O   1 
HETATM 5508 O  O   . HOH I 5 .   ? 102.534 21.420  40.612  1.00 44.06  ? 588 HOH A O   1 
HETATM 5509 O  O   . HOH I 5 .   ? 81.566  43.515  27.718  1.00 39.20  ? 589 HOH A O   1 
HETATM 5510 O  O   . HOH I 5 .   ? 86.434  60.650  22.442  1.00 40.00  ? 590 HOH A O   1 
HETATM 5511 O  O   . HOH I 5 .   ? 88.742  27.111  54.432  1.00 33.87  ? 591 HOH A O   1 
HETATM 5512 O  O   . HOH I 5 .   ? 92.878  56.039  24.725  1.00 34.25  ? 592 HOH A O   1 
HETATM 5513 O  O   . HOH I 5 .   ? 98.556  55.293  39.969  1.00 30.41  ? 593 HOH A O   1 
HETATM 5514 O  O   . HOH I 5 .   ? 111.106 38.371  51.133  1.00 44.68  ? 594 HOH A O   1 
HETATM 5515 O  O   . HOH I 5 .   ? 93.863  56.433  31.328  1.00 47.49  ? 595 HOH A O   1 
HETATM 5516 O  O   . HOH I 5 .   ? 82.510  52.162  19.304  1.00 43.72  ? 596 HOH A O   1 
HETATM 5517 O  O   . HOH I 5 .   ? 80.951  47.487  39.786  1.00 37.47  ? 597 HOH A O   1 
HETATM 5518 O  O   . HOH I 5 .   ? 69.360  62.965  46.883  1.00 38.99  ? 598 HOH A O   1 
HETATM 5519 O  O   . HOH I 5 .   ? 98.618  43.949  60.377  1.00 32.88  ? 599 HOH A O   1 
HETATM 5520 O  O   . HOH I 5 .   ? 79.628  47.303  28.550  1.00 47.28  ? 600 HOH A O   1 
HETATM 5521 O  O   . HOH J 5 .   ? 95.864  28.261  10.392  1.00 33.83  ? 507 HOH B O   1 
HETATM 5522 O  O   . HOH J 5 .   ? 96.652  30.433  13.741  1.00 31.67  ? 508 HOH B O   1 
HETATM 5523 O  O   . HOH J 5 .   ? 93.871  30.768  15.003  1.00 30.06  ? 509 HOH B O   1 
HETATM 5524 O  O   . HOH J 5 .   ? 96.237  32.722  15.870  1.00 26.16  ? 510 HOH B O   1 
HETATM 5525 O  O   . HOH J 5 .   ? 93.663  33.735  14.092  1.00 23.34  ? 511 HOH B O   1 
HETATM 5526 O  O   . HOH J 5 .   ? 96.668  37.918  33.351  1.00 19.73  ? 512 HOH B O   1 
HETATM 5527 O  O   . HOH J 5 .   ? 93.202  46.300  9.828   1.00 19.60  ? 513 HOH B O   1 
HETATM 5528 O  O   . HOH J 5 .   ? 98.076  29.870  15.823  1.00 28.22  ? 514 HOH B O   1 
HETATM 5529 O  O   . HOH J 5 .   ? 84.639  54.317  4.403   1.00 27.12  ? 515 HOH B O   1 
HETATM 5530 O  O   . HOH J 5 .   ? 97.443  43.044  22.117  1.00 21.84  ? 516 HOH B O   1 
HETATM 5531 O  O   . HOH J 5 .   ? 94.846  26.327  5.801   1.00 24.96  ? 517 HOH B O   1 
HETATM 5532 O  O   . HOH J 5 .   ? 93.977  28.342  1.921   1.00 26.61  ? 518 HOH B O   1 
HETATM 5533 O  O   . HOH J 5 .   ? 94.720  26.982  -4.744  1.00 28.12  ? 519 HOH B O   1 
HETATM 5534 O  O   . HOH J 5 .   ? 96.760  28.141  19.596  1.00 24.67  ? 520 HOH B O   1 
HETATM 5535 O  O   . HOH J 5 .   ? 104.528 37.875  6.159   1.00 28.00  ? 521 HOH B O   1 
HETATM 5536 O  O   . HOH J 5 .   ? 97.028  27.683  12.674  1.00 26.75  ? 522 HOH B O   1 
HETATM 5537 O  O   . HOH J 5 .   ? 87.539  27.686  16.167  1.00 25.57  ? 523 HOH B O   1 
HETATM 5538 O  O   . HOH J 5 .   ? 99.819  32.324  31.584  1.00 23.19  ? 524 HOH B O   1 
HETATM 5539 O  O   . HOH J 5 .   ? 105.954 34.177  21.309  1.00 36.26  ? 525 HOH B O   1 
HETATM 5540 O  O   . HOH J 5 .   ? 110.665 19.333  18.371  1.00 30.80  ? 526 HOH B O   1 
HETATM 5541 O  O   . HOH J 5 .   ? 77.793  47.842  -5.791  1.00 33.61  ? 527 HOH B O   1 
HETATM 5542 O  O   . HOH J 5 .   ? 101.829 37.268  11.361  1.00 25.66  ? 528 HOH B O   1 
HETATM 5543 O  O   . HOH J 5 .   ? 89.000  26.787  11.851  1.00 24.43  ? 529 HOH B O   1 
HETATM 5544 O  O   . HOH J 5 .   ? 92.203  51.314  -4.984  1.00 30.67  ? 530 HOH B O   1 
HETATM 5545 O  O   . HOH J 5 .   ? 103.934 26.911  16.521  1.00 30.42  ? 531 HOH B O   1 
HETATM 5546 O  O   . HOH J 5 .   ? 102.367 22.796  23.476  1.00 30.52  ? 532 HOH B O   1 
HETATM 5547 O  O   . HOH J 5 .   ? 102.217 28.717  15.565  1.00 32.16  ? 533 HOH B O   1 
HETATM 5548 O  O   . HOH J 5 .   ? 84.814  50.273  -7.237  1.00 27.93  ? 534 HOH B O   1 
HETATM 5549 O  O   . HOH J 5 .   ? 85.866  23.530  21.698  1.00 31.28  ? 535 HOH B O   1 
HETATM 5550 O  O   . HOH J 5 .   ? 83.898  34.424  18.529  1.00 25.84  ? 536 HOH B O   1 
HETATM 5551 O  O   . HOH J 5 .   ? 97.718  29.184  4.279   1.00 34.77  ? 537 HOH B O   1 
HETATM 5552 O  O   . HOH J 5 .   ? 93.613  17.244  -2.805  1.00 35.22  ? 538 HOH B O   1 
HETATM 5553 O  O   . HOH J 5 .   ? 74.560  46.207  4.399   1.00 34.65  ? 539 HOH B O   1 
HETATM 5554 O  O   . HOH J 5 .   ? 87.436  55.267  3.272   1.00 27.19  ? 540 HOH B O   1 
HETATM 5555 O  O   . HOH J 5 .   ? 73.226  44.779  1.152   1.00 32.56  ? 541 HOH B O   1 
HETATM 5556 O  O   . HOH J 5 .   ? 93.174  29.670  24.225  1.00 34.10  ? 542 HOH B O   1 
HETATM 5557 O  O   . HOH J 5 .   ? 108.503 32.223  13.518  1.00 32.69  ? 543 HOH B O   1 
HETATM 5558 O  O   . HOH J 5 .   ? 93.913  30.938  33.637  1.00 25.40  ? 544 HOH B O   1 
HETATM 5559 O  O   . HOH J 5 .   ? 98.575  23.583  5.561   1.00 31.41  ? 545 HOH B O   1 
HETATM 5560 O  O   . HOH J 5 .   ? 94.719  28.029  16.316  1.00 35.69  ? 546 HOH B O   1 
HETATM 5561 O  O   . HOH J 5 .   ? 100.564 16.412  13.712  1.00 36.90  ? 547 HOH B O   1 
HETATM 5562 O  O   . HOH J 5 .   ? 94.706  19.137  -1.357  1.00 31.95  ? 548 HOH B O   1 
HETATM 5563 O  O   . HOH J 5 .   ? 86.997  10.249  5.951   1.00 46.47  ? 549 HOH B O   1 
HETATM 5564 O  O   . HOH J 5 .   ? 84.656  48.561  -9.374  1.00 33.56  ? 550 HOH B O   1 
HETATM 5565 O  O   . HOH J 5 .   ? 92.017  49.101  -8.399  1.00 34.10  ? 551 HOH B O   1 
HETATM 5566 O  O   . HOH J 5 .   ? 104.333 35.602  3.206   1.00 34.10  ? 552 HOH B O   1 
HETATM 5567 O  O   . HOH J 5 .   ? 105.838 14.634  22.549  1.00 43.25  ? 553 HOH B O   1 
HETATM 5568 O  O   . HOH J 5 .   ? 79.689  38.264  12.393  1.00 37.94  ? 554 HOH B O   1 
HETATM 5569 O  O   . HOH J 5 .   ? 97.461  15.535  -0.625  1.00 30.70  ? 555 HOH B O   1 
HETATM 5570 O  O   . HOH J 5 .   ? 99.923  23.252  21.876  1.00 33.28  ? 556 HOH B O   1 
HETATM 5571 O  O   . HOH J 5 .   ? 75.776  41.338  -0.686  1.00 27.00  ? 557 HOH B O   1 
HETATM 5572 O  O   . HOH J 5 .   ? 88.205  33.117  20.953  1.00 27.78  ? 558 HOH B O   1 
HETATM 5573 O  O   . HOH J 5 .   ? 86.118  46.218  -9.757  1.00 31.76  ? 559 HOH B O   1 
HETATM 5574 O  O   . HOH J 5 .   ? 99.824  27.809  15.856  1.00 30.28  ? 560 HOH B O   1 
HETATM 5575 O  O   . HOH J 5 .   ? 83.769  52.798  -7.280  1.00 25.79  ? 561 HOH B O   1 
HETATM 5576 O  O   . HOH J 5 .   ? 95.580  30.005  17.502  1.00 34.96  ? 562 HOH B O   1 
HETATM 5577 O  O   . HOH J 5 .   ? 94.616  27.682  21.021  1.00 31.15  ? 563 HOH B O   1 
HETATM 5578 O  O   . HOH J 5 .   ? 95.878  15.391  -3.109  1.00 39.63  ? 564 HOH B O   1 
HETATM 5579 O  O   . HOH J 5 .   ? 104.343 24.689  26.263  1.00 30.37  ? 565 HOH B O   1 
HETATM 5580 O  O   . HOH J 5 .   ? 94.093  22.716  5.475   1.00 30.48  ? 566 HOH B O   1 
HETATM 5581 O  O   . HOH J 5 .   ? 98.006  22.163  3.180   1.00 32.74  ? 567 HOH B O   1 
HETATM 5582 O  O   . HOH J 5 .   ? 88.608  38.585  26.605  1.00 29.04  ? 568 HOH B O   1 
HETATM 5583 O  O   . HOH J 5 .   ? 104.615 37.431  1.366   1.00 33.11  ? 569 HOH B O   1 
HETATM 5584 O  O   . HOH J 5 .   ? 91.694  32.204  32.071  1.00 33.19  ? 570 HOH B O   1 
HETATM 5585 O  O   . HOH J 5 .   ? 106.867 37.914  26.865  1.00 39.24  ? 571 HOH B O   1 
HETATM 5586 O  O   . HOH J 5 .   ? 90.716  28.506  12.753  1.00 29.88  ? 572 HOH B O   1 
HETATM 5587 O  O   . HOH J 5 .   ? 104.392 34.068  36.912  1.00 36.90  ? 573 HOH B O   1 
HETATM 5588 O  O   . HOH J 5 .   ? 97.145  18.175  -0.810  1.00 39.18  ? 574 HOH B O   1 
HETATM 5589 O  O   . HOH J 5 .   ? 104.955 33.132  1.650   1.00 37.70  ? 575 HOH B O   1 
HETATM 5590 O  O   . HOH J 5 .   ? 81.564  34.396  -10.814 1.00 37.61  ? 576 HOH B O   1 
HETATM 5591 O  O   . HOH J 5 .   ? 107.445 30.000  14.583  1.00 42.93  ? 577 HOH B O   1 
HETATM 5592 O  O   . HOH J 5 .   ? 74.975  38.302  12.171  1.00 32.47  ? 578 HOH B O   1 
HETATM 5593 O  O   . HOH J 5 .   ? 105.659 39.723  2.595   1.00 36.22  ? 579 HOH B O   1 
HETATM 5594 O  O   . HOH J 5 .   ? 89.526  51.119  14.904  1.00 38.86  ? 580 HOH B O   1 
HETATM 5595 O  O   . HOH J 5 .   ? 98.806  48.097  -0.991  1.00 33.56  ? 581 HOH B O   1 
HETATM 5596 O  O   . HOH J 5 .   ? 97.659  17.032  14.219  1.00 37.46  ? 582 HOH B O   1 
HETATM 5597 O  O   . HOH J 5 .   ? 94.283  28.310  13.341  1.00 34.71  ? 583 HOH B O   1 
HETATM 5598 O  O   . HOH J 5 .   ? 96.558  15.038  12.749  1.00 40.90  ? 584 HOH B O   1 
HETATM 5599 O  O   . HOH J 5 .   ? 100.316 22.180  27.814  1.00 30.09  ? 585 HOH B O   1 
HETATM 5600 O  O   . HOH J 5 .   ? 93.890  45.929  -8.286  1.00 33.09  ? 586 HOH B O   1 
HETATM 5601 O  O   . HOH J 5 .   ? 105.912 17.387  27.768  1.00 43.38  ? 587 HOH B O   1 
HETATM 5602 O  O   . HOH J 5 .   ? 88.568  52.989  12.884  1.00 39.67  ? 588 HOH B O   1 
HETATM 5603 O  O   . HOH J 5 .   ? 95.907  3.586   0.925   1.00 46.25  ? 589 HOH B O   1 
HETATM 5604 O  O   . HOH J 5 .   ? 89.478  40.628  25.046  1.00 29.78  ? 590 HOH B O   1 
HETATM 5605 O  O   . HOH J 5 .   ? 79.608  42.158  -6.733  1.00 41.53  ? 591 HOH B O   1 
HETATM 5606 O  O   . HOH J 5 .   ? 87.863  21.946  19.902  1.00 37.64  ? 592 HOH B O   1 
HETATM 5607 O  O   . HOH J 5 .   ? 80.654  47.364  18.282  1.00 36.39  ? 593 HOH B O   1 
HETATM 5608 O  O   . HOH J 5 .   ? 106.514 42.661  -3.943  1.00 40.95  ? 594 HOH B O   1 
HETATM 5609 O  O   . HOH J 5 .   ? 97.655  56.046  -4.749  1.00 38.51  ? 595 HOH B O   1 
HETATM 5610 O  O   . HOH J 5 .   ? 84.752  55.300  -3.033  1.00 31.38  ? 596 HOH B O   1 
HETATM 5611 O  O   . HOH J 5 .   ? 84.943  19.520  12.259  1.00 35.17  ? 597 HOH B O   1 
HETATM 5612 O  O   . HOH J 5 .   ? 89.674  57.513  4.281   1.00 39.58  ? 598 HOH B O   1 
HETATM 5613 O  O   . HOH J 5 .   ? 104.234 29.145  39.345  1.00 37.39  ? 599 HOH B O   1 
HETATM 5614 O  O   . HOH J 5 .   ? 95.972  45.989  -10.729 1.00 37.35  ? 600 HOH B O   1 
HETATM 5615 O  O   . HOH J 5 .   ? 75.328  56.278  13.004  1.00 41.81  ? 601 HOH B O   1 
HETATM 5616 O  O   . HOH J 5 .   ? 78.693  19.788  -5.747  1.00 49.94  ? 602 HOH B O   1 
HETATM 5617 O  O   . HOH J 5 .   ? 102.384 35.227  35.272  1.00 34.79  ? 603 HOH B O   1 
HETATM 5618 O  O   . HOH J 5 .   ? 103.242 26.720  -7.803  1.00 41.88  ? 604 HOH B O   1 
HETATM 5619 O  O   . HOH J 5 .   ? 100.854 13.579  13.672  1.00 43.47  ? 605 HOH B O   1 
HETATM 5620 O  O   . HOH J 5 .   ? 89.708  61.998  -1.347  1.00 47.26  ? 606 HOH B O   1 
HETATM 5621 O  O   . HOH J 5 .   ? 101.411 21.210  25.646  1.00 36.34  ? 607 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   181 181 PRO PRO A . n 
A 1 2   THR 2   182 182 THR THR A . n 
A 1 3   TYR 3   183 183 TYR TYR A . n 
A 1 4   PRO 4   184 184 PRO PRO A . n 
A 1 5   LYS 5   185 185 LYS LYS A . n 
A 1 6   TYR 6   186 186 TYR TYR A . n 
A 1 7   LEU 7   187 187 LEU LEU A . n 
A 1 8   LEU 8   188 188 LEU LEU A . n 
A 1 9   SER 9   189 189 SER SER A . n 
A 1 10  PRO 10  190 190 PRO PRO A . n 
A 1 11  GLU 11  191 191 GLU GLU A . n 
A 1 12  THR 12  192 192 THR THR A . n 
A 1 13  ILE 13  193 193 ILE ILE A . n 
A 1 14  GLU 14  194 194 GLU GLU A . n 
A 1 15  ALA 15  195 195 ALA ALA A . n 
A 1 16  LEU 16  196 196 LEU LEU A . n 
A 1 17  ARG 17  197 197 ARG ARG A . n 
A 1 18  LYS 18  198 198 LYS LYS A . n 
A 1 19  PRO 19  199 199 PRO PRO A . n 
A 1 20  THR 20  200 200 THR THR A . n 
A 1 21  PHE 21  201 201 PHE PHE A . n 
A 1 22  ASP 22  202 202 ASP ASP A . n 
A 1 23  VAL 23  203 203 VAL VAL A . n 
A 1 24  TRP 24  204 204 TRP TRP A . n 
A 1 25  LEU 25  205 205 LEU LEU A . n 
A 1 26  TRP 26  206 206 TRP TRP A . n 
A 1 27  GLU 27  207 207 GLU GLU A . n 
A 1 28  PRO 28  208 208 PRO PRO A . n 
A 1 29  ASN 29  209 209 ASN ASN A . n 
A 1 30  GLU 30  210 210 GLU GLU A . n 
A 1 31  MET 31  211 211 MET MET A . n 
A 1 32  LEU 32  212 212 LEU LEU A . n 
A 1 33  SER 33  213 213 SER SER A . n 
A 1 34  CYS 34  214 214 CYS CYS A . n 
A 1 35  LEU 35  215 215 LEU LEU A . n 
A 1 36  GLU 36  216 216 GLU GLU A . n 
A 1 37  HIS 37  217 217 HIS HIS A . n 
A 1 38  MET 38  218 218 MET MET A . n 
A 1 39  TYR 39  219 219 TYR TYR A . n 
A 1 40  HIS 40  220 220 HIS HIS A . n 
A 1 41  ASP 41  221 221 ASP ASP A . n 
A 1 42  LEU 42  222 222 LEU LEU A . n 
A 1 43  GLY 43  223 223 GLY GLY A . n 
A 1 44  LEU 44  224 224 LEU LEU A . n 
A 1 45  VAL 45  225 225 VAL VAL A . n 
A 1 46  ARG 46  226 226 ARG ARG A . n 
A 1 47  ASP 47  227 227 ASP ASP A . n 
A 1 48  PHE 48  228 228 PHE PHE A . n 
A 1 49  SER 49  229 229 SER SER A . n 
A 1 50  ILE 50  230 230 ILE ILE A . n 
A 1 51  ASN 51  231 231 ASN ASN A . n 
A 1 52  PRO 52  232 232 PRO PRO A . n 
A 1 53  VAL 53  233 233 VAL VAL A . n 
A 1 54  THR 54  234 234 THR THR A . n 
A 1 55  LEU 55  235 235 LEU LEU A . n 
A 1 56  ARG 56  236 236 ARG ARG A . n 
A 1 57  ARG 57  237 237 ARG ARG A . n 
A 1 58  TRP 58  238 238 TRP TRP A . n 
A 1 59  LEU 59  239 239 LEU LEU A . n 
A 1 60  PHE 60  240 240 PHE PHE A . n 
A 1 61  CYS 61  241 241 CYS CYS A . n 
A 1 62  VAL 62  242 242 VAL VAL A . n 
A 1 63  HIS 63  243 243 HIS HIS A . n 
A 1 64  ASP 64  244 244 ASP ASP A . n 
A 1 65  ASN 65  245 245 ASN ASN A . n 
A 1 66  TYR 66  246 246 TYR TYR A . n 
A 1 67  ARG 67  247 247 ARG ARG A . n 
A 1 68  ASN 68  248 248 ASN ASN A . n 
A 1 69  ASN 69  249 249 ASN ASN A . n 
A 1 70  PRO 70  250 250 PRO PRO A . n 
A 1 71  PHE 71  251 251 PHE PHE A . n 
A 1 72  HIS 72  252 252 HIS HIS A . n 
A 1 73  ASN 73  253 253 ASN ASN A . n 
A 1 74  PHE 74  254 254 PHE PHE A . n 
A 1 75  ARG 75  255 255 ARG ARG A . n 
A 1 76  HIS 76  256 256 HIS HIS A . n 
A 1 77  CYS 77  257 257 CYS CYS A . n 
A 1 78  PHE 78  258 258 PHE PHE A . n 
A 1 79  CYS 79  259 259 CYS CYS A . n 
A 1 80  VAL 80  260 260 VAL VAL A . n 
A 1 81  ALA 81  261 261 ALA ALA A . n 
A 1 82  GLN 82  262 262 GLN GLN A . n 
A 1 83  MET 83  263 263 MET MET A . n 
A 1 84  MET 84  264 264 MET MET A . n 
A 1 85  TYR 85  265 265 TYR TYR A . n 
A 1 86  SER 86  266 266 SER SER A . n 
A 1 87  MET 87  267 267 MET MET A . n 
A 1 88  VAL 88  268 268 VAL VAL A . n 
A 1 89  TRP 89  269 269 TRP TRP A . n 
A 1 90  LEU 90  270 270 LEU LEU A . n 
A 1 91  CYS 91  271 271 CYS CYS A . n 
A 1 92  SER 92  272 272 SER SER A . n 
A 1 93  LEU 93  273 273 LEU LEU A . n 
A 1 94  GLN 94  274 274 GLN GLN A . n 
A 1 95  GLU 95  275 275 GLU GLU A . n 
A 1 96  LYS 96  276 276 LYS LYS A . n 
A 1 97  PHE 97  277 277 PHE PHE A . n 
A 1 98  SER 98  278 278 SER SER A . n 
A 1 99  GLN 99  279 279 GLN GLN A . n 
A 1 100 THR 100 280 280 THR THR A . n 
A 1 101 ASP 101 281 281 ASP ASP A . n 
A 1 102 ILE 102 282 282 ILE ILE A . n 
A 1 103 LEU 103 283 283 LEU LEU A . n 
A 1 104 ILE 104 284 284 ILE ILE A . n 
A 1 105 LEU 105 285 285 LEU LEU A . n 
A 1 106 MET 106 286 286 MET MET A . n 
A 1 107 THR 107 287 287 THR THR A . n 
A 1 108 ALA 108 288 288 ALA ALA A . n 
A 1 109 ALA 109 289 289 ALA ALA A . n 
A 1 110 ILE 110 290 290 ILE ILE A . n 
A 1 111 CYS 111 291 291 CYS CYS A . n 
A 1 112 HIS 112 292 292 HIS HIS A . n 
A 1 113 ASP 113 293 293 ASP ASP A . n 
A 1 114 LEU 114 294 294 LEU LEU A . n 
A 1 115 ASP 115 295 295 ASP ASP A . n 
A 1 116 HIS 116 296 296 HIS HIS A . n 
A 1 117 PRO 117 297 297 PRO PRO A . n 
A 1 118 GLY 118 298 298 GLY GLY A . n 
A 1 119 TYR 119 299 299 TYR TYR A . n 
A 1 120 ASN 120 300 300 ASN ASN A . n 
A 1 121 ASN 121 301 301 ASN ASN A . n 
A 1 122 THR 122 302 302 THR THR A . n 
A 1 123 TYR 123 303 303 TYR TYR A . n 
A 1 124 GLN 124 304 304 GLN GLN A . n 
A 1 125 ILE 125 305 305 ILE ILE A . n 
A 1 126 ASN 126 306 306 ASN ASN A . n 
A 1 127 ALA 127 307 307 ALA ALA A . n 
A 1 128 ARG 128 308 308 ARG ARG A . n 
A 1 129 THR 129 309 309 THR THR A . n 
A 1 130 GLU 130 310 310 GLU GLU A . n 
A 1 131 LEU 131 311 311 LEU LEU A . n 
A 1 132 ALA 132 312 312 ALA ALA A . n 
A 1 133 VAL 133 313 313 VAL VAL A . n 
A 1 134 ARG 134 314 314 ARG ARG A . n 
A 1 135 TYR 135 315 315 TYR TYR A . n 
A 1 136 ASN 136 316 316 ASN ASN A . n 
A 1 137 ASP 137 317 317 ASP ASP A . n 
A 1 138 ILE 138 318 318 ILE ILE A . n 
A 1 139 SER 139 319 319 SER SER A . n 
A 1 140 PRO 140 320 320 PRO PRO A . n 
A 1 141 LEU 141 321 321 LEU LEU A . n 
A 1 142 GLU 142 322 322 GLU GLU A . n 
A 1 143 ASN 143 323 323 ASN ASN A . n 
A 1 144 HIS 144 324 324 HIS HIS A . n 
A 1 145 HIS 145 325 325 HIS HIS A . n 
A 1 146 CYS 146 326 326 CYS CYS A . n 
A 1 147 ALA 147 327 327 ALA ALA A . n 
A 1 148 VAL 148 328 328 VAL VAL A . n 
A 1 149 ALA 149 329 329 ALA ALA A . n 
A 1 150 PHE 150 330 330 PHE PHE A . n 
A 1 151 GLN 151 331 331 GLN GLN A . n 
A 1 152 ILE 152 332 332 ILE ILE A . n 
A 1 153 LEU 153 333 333 LEU LEU A . n 
A 1 154 ALA 154 334 334 ALA ALA A . n 
A 1 155 GLU 155 335 335 GLU GLU A . n 
A 1 156 PRO 156 336 336 PRO PRO A . n 
A 1 157 GLU 157 337 337 GLU GLU A . n 
A 1 158 CYS 158 338 338 CYS CYS A . n 
A 1 159 ASN 159 339 339 ASN ASN A . n 
A 1 160 ILE 160 340 340 ILE ILE A . n 
A 1 161 PHE 161 341 341 PHE PHE A . n 
A 1 162 SER 162 342 342 SER SER A . n 
A 1 163 ASN 163 343 343 ASN ASN A . n 
A 1 164 ILE 164 344 344 ILE ILE A . n 
A 1 165 PRO 165 345 345 PRO PRO A . n 
A 1 166 PRO 166 346 346 PRO PRO A . n 
A 1 167 ASP 167 347 347 ASP ASP A . n 
A 1 168 GLY 168 348 348 GLY GLY A . n 
A 1 169 PHE 169 349 349 PHE PHE A . n 
A 1 170 LYS 170 350 350 LYS LYS A . n 
A 1 171 GLN 171 351 351 GLN GLN A . n 
A 1 172 ILE 172 352 352 ILE ILE A . n 
A 1 173 ARG 173 353 353 ARG ARG A . n 
A 1 174 GLN 174 354 354 GLN GLN A . n 
A 1 175 GLY 175 355 355 GLY GLY A . n 
A 1 176 MET 176 356 356 MET MET A . n 
A 1 177 ILE 177 357 357 ILE ILE A . n 
A 1 178 THR 178 358 358 THR THR A . n 
A 1 179 LEU 179 359 359 LEU LEU A . n 
A 1 180 ILE 180 360 360 ILE ILE A . n 
A 1 181 LEU 181 361 361 LEU LEU A . n 
A 1 182 ALA 182 362 362 ALA ALA A . n 
A 1 183 THR 183 363 363 THR THR A . n 
A 1 184 ASP 184 364 364 ASP ASP A . n 
A 1 185 MET 185 365 365 MET MET A . n 
A 1 186 ALA 186 366 366 ALA ALA A . n 
A 1 187 ARG 187 367 367 ARG ARG A . n 
A 1 188 HIS 188 368 368 HIS HIS A . n 
A 1 189 ALA 189 369 369 ALA ALA A . n 
A 1 190 GLU 190 370 370 GLU GLU A . n 
A 1 191 ILE 191 371 371 ILE ILE A . n 
A 1 192 MET 192 372 372 MET MET A . n 
A 1 193 ASP 193 373 373 ASP ASP A . n 
A 1 194 SER 194 374 374 SER SER A . n 
A 1 195 PHE 195 375 375 PHE PHE A . n 
A 1 196 LYS 196 376 376 LYS LYS A . n 
A 1 197 GLU 197 377 377 GLU GLU A . n 
A 1 198 LYS 198 378 378 LYS LYS A . n 
A 1 199 MET 199 379 379 MET MET A . n 
A 1 200 GLU 200 380 380 GLU GLU A . n 
A 1 201 ASN 201 381 381 ASN ASN A . n 
A 1 202 PHE 202 382 382 PHE PHE A . n 
A 1 203 ASP 203 383 383 ASP ASP A . n 
A 1 204 TYR 204 384 384 TYR TYR A . n 
A 1 205 SER 205 385 385 SER SER A . n 
A 1 206 ASN 206 386 386 ASN ASN A . n 
A 1 207 GLU 207 387 387 GLU GLU A . n 
A 1 208 GLU 208 388 388 GLU GLU A . n 
A 1 209 HIS 209 389 389 HIS HIS A . n 
A 1 210 MET 210 390 390 MET MET A . n 
A 1 211 THR 211 391 391 THR THR A . n 
A 1 212 LEU 212 392 392 LEU LEU A . n 
A 1 213 LEU 213 393 393 LEU LEU A . n 
A 1 214 LYS 214 394 394 LYS LYS A . n 
A 1 215 MET 215 395 395 MET MET A . n 
A 1 216 ILE 216 396 396 ILE ILE A . n 
A 1 217 LEU 217 397 397 LEU LEU A . n 
A 1 218 ILE 218 398 398 ILE ILE A . n 
A 1 219 LYS 219 399 399 LYS LYS A . n 
A 1 220 CYS 220 400 400 CYS CYS A . n 
A 1 221 CYS 221 401 401 CYS CYS A . n 
A 1 222 ASP 222 402 402 ASP ASP A . n 
A 1 223 ILE 223 403 403 ILE ILE A . n 
A 1 224 SER 224 404 404 SER SER A . n 
A 1 225 ASN 225 405 405 ASN ASN A . n 
A 1 226 GLU 226 406 406 GLU GLU A . n 
A 1 227 VAL 227 407 407 VAL VAL A . n 
A 1 228 ARG 228 408 408 ARG ARG A . n 
A 1 229 PRO 229 409 409 PRO PRO A . n 
A 1 230 MET 230 410 410 MET MET A . n 
A 1 231 GLU 231 411 411 GLU GLU A . n 
A 1 232 VAL 232 412 412 VAL VAL A . n 
A 1 233 ALA 233 413 413 ALA ALA A . n 
A 1 234 GLU 234 414 414 GLU GLU A . n 
A 1 235 PRO 235 415 415 PRO PRO A . n 
A 1 236 TRP 236 416 416 TRP TRP A . n 
A 1 237 VAL 237 417 417 VAL VAL A . n 
A 1 238 ASP 238 418 418 ASP ASP A . n 
A 1 239 CYS 239 419 419 CYS CYS A . n 
A 1 240 LEU 240 420 420 LEU LEU A . n 
A 1 241 LEU 241 421 421 LEU LEU A . n 
A 1 242 GLU 242 422 422 GLU GLU A . n 
A 1 243 GLU 243 423 423 GLU GLU A . n 
A 1 244 TYR 244 424 424 TYR TYR A . n 
A 1 245 PHE 245 425 425 PHE PHE A . n 
A 1 246 MET 246 426 426 MET MET A . n 
A 1 247 GLN 247 427 427 GLN GLN A . n 
A 1 248 SER 248 428 428 SER SER A . n 
A 1 249 ASP 249 429 429 ASP ASP A . n 
A 1 250 ARG 250 430 430 ARG ARG A . n 
A 1 251 GLU 251 431 431 GLU GLU A . n 
A 1 252 LYS 252 432 432 LYS LYS A . n 
A 1 253 SER 253 433 433 SER SER A . n 
A 1 254 GLU 254 434 434 GLU GLU A . n 
A 1 255 GLY 255 435 435 GLY GLY A . n 
A 1 256 LEU 256 436 436 LEU LEU A . n 
A 1 257 PRO 257 437 437 PRO PRO A . n 
A 1 258 VAL 258 438 438 VAL VAL A . n 
A 1 259 ALA 259 439 439 ALA ALA A . n 
A 1 260 PRO 260 440 440 PRO PRO A . n 
A 1 261 PHE 261 441 441 PHE PHE A . n 
A 1 262 MET 262 442 442 MET MET A . n 
A 1 263 ASP 263 443 443 ASP ASP A . n 
A 1 264 ARG 264 444 444 ARG ARG A . n 
A 1 265 ASP 265 445 445 ASP ASP A . n 
A 1 266 LYS 266 446 446 LYS LYS A . n 
A 1 267 VAL 267 447 447 VAL VAL A . n 
A 1 268 THR 268 448 448 THR THR A . n 
A 1 269 LYS 269 449 449 LYS LYS A . n 
A 1 270 ALA 270 450 450 ALA ALA A . n 
A 1 271 THR 271 451 451 THR THR A . n 
A 1 272 ALA 272 452 452 ALA ALA A . n 
A 1 273 GLN 273 453 453 GLN GLN A . n 
A 1 274 ILE 274 454 454 ILE ILE A . n 
A 1 275 GLY 275 455 455 GLY GLY A . n 
A 1 276 PHE 276 456 456 PHE PHE A . n 
A 1 277 ILE 277 457 457 ILE ILE A . n 
A 1 278 LYS 278 458 458 LYS LYS A . n 
A 1 279 PHE 279 459 459 PHE PHE A . n 
A 1 280 VAL 280 460 460 VAL VAL A . n 
A 1 281 LEU 281 461 461 LEU LEU A . n 
A 1 282 ILE 282 462 462 ILE ILE A . n 
A 1 283 PRO 283 463 463 PRO PRO A . n 
A 1 284 MET 284 464 464 MET MET A . n 
A 1 285 PHE 285 465 465 PHE PHE A . n 
A 1 286 GLU 286 466 466 GLU GLU A . n 
A 1 287 THR 287 467 467 THR THR A . n 
A 1 288 VAL 288 468 468 VAL VAL A . n 
A 1 289 THR 289 469 469 THR THR A . n 
A 1 290 LYS 290 470 470 LYS LYS A . n 
A 1 291 LEU 291 471 471 LEU LEU A . n 
A 1 292 PHE 292 472 472 PHE PHE A . n 
A 1 293 PRO 293 473 473 PRO PRO A . n 
A 1 294 MET 294 474 474 MET MET A . n 
A 1 295 VAL 295 475 475 VAL VAL A . n 
A 1 296 GLU 296 476 476 GLU GLU A . n 
A 1 297 GLU 297 477 477 GLU GLU A . n 
A 1 298 ILE 298 478 478 ILE ILE A . n 
A 1 299 MET 299 479 479 MET MET A . n 
A 1 300 LEU 300 480 480 LEU LEU A . n 
A 1 301 GLN 301 481 481 GLN GLN A . n 
A 1 302 PRO 302 482 482 PRO PRO A . n 
A 1 303 LEU 303 483 483 LEU LEU A . n 
A 1 304 TRP 304 484 484 TRP TRP A . n 
A 1 305 GLU 305 485 485 GLU GLU A . n 
A 1 306 SER 306 486 486 SER SER A . n 
A 1 307 ARG 307 487 487 ARG ARG A . n 
A 1 308 ASP 308 488 488 ASP ASP A . n 
A 1 309 ARG 309 489 489 ARG ARG A . n 
A 1 310 TYR 310 490 490 TYR TYR A . n 
A 1 311 GLU 311 491 491 GLU GLU A . n 
A 1 312 GLU 312 492 492 GLU GLU A . n 
A 1 313 LEU 313 493 493 LEU LEU A . n 
A 1 314 LYS 314 494 494 LYS LYS A . n 
A 1 315 ARG 315 495 495 ARG ARG A . n 
A 1 316 ILE 316 496 496 ILE ILE A . n 
A 1 317 ASP 317 497 497 ASP ASP A . n 
A 1 318 ASP 318 498 498 ASP ASP A . n 
A 1 319 ALA 319 499 499 ALA ALA A . n 
A 1 320 MET 320 500 500 MET MET A . n 
A 1 321 LYS 321 501 501 LYS LYS A . n 
A 1 322 GLU 322 502 502 GLU GLU A . n 
A 1 323 LEU 323 503 503 LEU LEU A . n 
A 1 324 GLN 324 504 504 GLN GLN A . n 
A 1 325 LYS 325 505 505 LYS LYS A . n 
A 1 326 LYS 326 506 506 LYS LYS A . n 
B 1 1   PRO 1   181 181 PRO PRO B . n 
B 1 2   THR 2   182 182 THR THR B . n 
B 1 3   TYR 3   183 183 TYR TYR B . n 
B 1 4   PRO 4   184 184 PRO PRO B . n 
B 1 5   LYS 5   185 185 LYS LYS B . n 
B 1 6   TYR 6   186 186 TYR TYR B . n 
B 1 7   LEU 7   187 187 LEU LEU B . n 
B 1 8   LEU 8   188 188 LEU LEU B . n 
B 1 9   SER 9   189 189 SER SER B . n 
B 1 10  PRO 10  190 190 PRO PRO B . n 
B 1 11  GLU 11  191 191 GLU GLU B . n 
B 1 12  THR 12  192 192 THR THR B . n 
B 1 13  ILE 13  193 193 ILE ILE B . n 
B 1 14  GLU 14  194 194 GLU GLU B . n 
B 1 15  ALA 15  195 195 ALA ALA B . n 
B 1 16  LEU 16  196 196 LEU LEU B . n 
B 1 17  ARG 17  197 197 ARG ARG B . n 
B 1 18  LYS 18  198 198 LYS LYS B . n 
B 1 19  PRO 19  199 199 PRO PRO B . n 
B 1 20  THR 20  200 200 THR THR B . n 
B 1 21  PHE 21  201 201 PHE PHE B . n 
B 1 22  ASP 22  202 202 ASP ASP B . n 
B 1 23  VAL 23  203 203 VAL VAL B . n 
B 1 24  TRP 24  204 204 TRP TRP B . n 
B 1 25  LEU 25  205 205 LEU LEU B . n 
B 1 26  TRP 26  206 206 TRP TRP B . n 
B 1 27  GLU 27  207 207 GLU GLU B . n 
B 1 28  PRO 28  208 208 PRO PRO B . n 
B 1 29  ASN 29  209 209 ASN ASN B . n 
B 1 30  GLU 30  210 210 GLU GLU B . n 
B 1 31  MET 31  211 211 MET MET B . n 
B 1 32  LEU 32  212 212 LEU LEU B . n 
B 1 33  SER 33  213 213 SER SER B . n 
B 1 34  CYS 34  214 214 CYS CYS B . n 
B 1 35  LEU 35  215 215 LEU LEU B . n 
B 1 36  GLU 36  216 216 GLU GLU B . n 
B 1 37  HIS 37  217 217 HIS HIS B . n 
B 1 38  MET 38  218 218 MET MET B . n 
B 1 39  TYR 39  219 219 TYR TYR B . n 
B 1 40  HIS 40  220 220 HIS HIS B . n 
B 1 41  ASP 41  221 221 ASP ASP B . n 
B 1 42  LEU 42  222 222 LEU LEU B . n 
B 1 43  GLY 43  223 223 GLY GLY B . n 
B 1 44  LEU 44  224 224 LEU LEU B . n 
B 1 45  VAL 45  225 225 VAL VAL B . n 
B 1 46  ARG 46  226 226 ARG ARG B . n 
B 1 47  ASP 47  227 227 ASP ASP B . n 
B 1 48  PHE 48  228 228 PHE PHE B . n 
B 1 49  SER 49  229 229 SER SER B . n 
B 1 50  ILE 50  230 230 ILE ILE B . n 
B 1 51  ASN 51  231 231 ASN ASN B . n 
B 1 52  PRO 52  232 232 PRO PRO B . n 
B 1 53  VAL 53  233 233 VAL VAL B . n 
B 1 54  THR 54  234 234 THR THR B . n 
B 1 55  LEU 55  235 235 LEU LEU B . n 
B 1 56  ARG 56  236 236 ARG ARG B . n 
B 1 57  ARG 57  237 237 ARG ARG B . n 
B 1 58  TRP 58  238 238 TRP TRP B . n 
B 1 59  LEU 59  239 239 LEU LEU B . n 
B 1 60  PHE 60  240 240 PHE PHE B . n 
B 1 61  CYS 61  241 241 CYS CYS B . n 
B 1 62  VAL 62  242 242 VAL VAL B . n 
B 1 63  HIS 63  243 243 HIS HIS B . n 
B 1 64  ASP 64  244 244 ASP ASP B . n 
B 1 65  ASN 65  245 245 ASN ASN B . n 
B 1 66  TYR 66  246 246 TYR TYR B . n 
B 1 67  ARG 67  247 247 ARG ARG B . n 
B 1 68  ASN 68  248 248 ASN ASN B . n 
B 1 69  ASN 69  249 249 ASN ASN B . n 
B 1 70  PRO 70  250 250 PRO PRO B . n 
B 1 71  PHE 71  251 251 PHE PHE B . n 
B 1 72  HIS 72  252 252 HIS HIS B . n 
B 1 73  ASN 73  253 253 ASN ASN B . n 
B 1 74  PHE 74  254 254 PHE PHE B . n 
B 1 75  ARG 75  255 255 ARG ARG B . n 
B 1 76  HIS 76  256 256 HIS HIS B . n 
B 1 77  CYS 77  257 257 CYS CYS B . n 
B 1 78  PHE 78  258 258 PHE PHE B . n 
B 1 79  CYS 79  259 259 CYS CYS B . n 
B 1 80  VAL 80  260 260 VAL VAL B . n 
B 1 81  ALA 81  261 261 ALA ALA B . n 
B 1 82  GLN 82  262 262 GLN GLN B . n 
B 1 83  MET 83  263 263 MET MET B . n 
B 1 84  MET 84  264 264 MET MET B . n 
B 1 85  TYR 85  265 265 TYR TYR B . n 
B 1 86  SER 86  266 266 SER SER B . n 
B 1 87  MET 87  267 267 MET MET B . n 
B 1 88  VAL 88  268 268 VAL VAL B . n 
B 1 89  TRP 89  269 269 TRP TRP B . n 
B 1 90  LEU 90  270 270 LEU LEU B . n 
B 1 91  CYS 91  271 271 CYS CYS B . n 
B 1 92  SER 92  272 272 SER SER B . n 
B 1 93  LEU 93  273 273 LEU LEU B . n 
B 1 94  GLN 94  274 274 GLN GLN B . n 
B 1 95  GLU 95  275 275 GLU GLU B . n 
B 1 96  LYS 96  276 276 LYS LYS B . n 
B 1 97  PHE 97  277 277 PHE PHE B . n 
B 1 98  SER 98  278 278 SER SER B . n 
B 1 99  GLN 99  279 279 GLN GLN B . n 
B 1 100 THR 100 280 280 THR THR B . n 
B 1 101 ASP 101 281 281 ASP ASP B . n 
B 1 102 ILE 102 282 282 ILE ILE B . n 
B 1 103 LEU 103 283 283 LEU LEU B . n 
B 1 104 ILE 104 284 284 ILE ILE B . n 
B 1 105 LEU 105 285 285 LEU LEU B . n 
B 1 106 MET 106 286 286 MET MET B . n 
B 1 107 THR 107 287 287 THR THR B . n 
B 1 108 ALA 108 288 288 ALA ALA B . n 
B 1 109 ALA 109 289 289 ALA ALA B . n 
B 1 110 ILE 110 290 290 ILE ILE B . n 
B 1 111 CYS 111 291 291 CYS CYS B . n 
B 1 112 HIS 112 292 292 HIS HIS B . n 
B 1 113 ASP 113 293 293 ASP ASP B . n 
B 1 114 LEU 114 294 294 LEU LEU B . n 
B 1 115 ASP 115 295 295 ASP ASP B . n 
B 1 116 HIS 116 296 296 HIS HIS B . n 
B 1 117 PRO 117 297 297 PRO PRO B . n 
B 1 118 GLY 118 298 298 GLY GLY B . n 
B 1 119 TYR 119 299 299 TYR TYR B . n 
B 1 120 ASN 120 300 300 ASN ASN B . n 
B 1 121 ASN 121 301 301 ASN ASN B . n 
B 1 122 THR 122 302 302 THR THR B . n 
B 1 123 TYR 123 303 303 TYR TYR B . n 
B 1 124 GLN 124 304 304 GLN GLN B . n 
B 1 125 ILE 125 305 305 ILE ILE B . n 
B 1 126 ASN 126 306 306 ASN ASN B . n 
B 1 127 ALA 127 307 307 ALA ALA B . n 
B 1 128 ARG 128 308 308 ARG ARG B . n 
B 1 129 THR 129 309 309 THR THR B . n 
B 1 130 GLU 130 310 310 GLU GLU B . n 
B 1 131 LEU 131 311 311 LEU LEU B . n 
B 1 132 ALA 132 312 312 ALA ALA B . n 
B 1 133 VAL 133 313 313 VAL VAL B . n 
B 1 134 ARG 134 314 314 ARG ARG B . n 
B 1 135 TYR 135 315 315 TYR TYR B . n 
B 1 136 ASN 136 316 316 ASN ASN B . n 
B 1 137 ASP 137 317 317 ASP ASP B . n 
B 1 138 ILE 138 318 318 ILE ILE B . n 
B 1 139 SER 139 319 319 SER SER B . n 
B 1 140 PRO 140 320 320 PRO PRO B . n 
B 1 141 LEU 141 321 321 LEU LEU B . n 
B 1 142 GLU 142 322 322 GLU GLU B . n 
B 1 143 ASN 143 323 323 ASN ASN B . n 
B 1 144 HIS 144 324 324 HIS HIS B . n 
B 1 145 HIS 145 325 325 HIS HIS B . n 
B 1 146 CYS 146 326 326 CYS CYS B . n 
B 1 147 ALA 147 327 327 ALA ALA B . n 
B 1 148 VAL 148 328 328 VAL VAL B . n 
B 1 149 ALA 149 329 329 ALA ALA B . n 
B 1 150 PHE 150 330 330 PHE PHE B . n 
B 1 151 GLN 151 331 331 GLN GLN B . n 
B 1 152 ILE 152 332 332 ILE ILE B . n 
B 1 153 LEU 153 333 333 LEU LEU B . n 
B 1 154 ALA 154 334 334 ALA ALA B . n 
B 1 155 GLU 155 335 335 GLU GLU B . n 
B 1 156 PRO 156 336 336 PRO PRO B . n 
B 1 157 GLU 157 337 337 GLU GLU B . n 
B 1 158 CYS 158 338 338 CYS CYS B . n 
B 1 159 ASN 159 339 339 ASN ASN B . n 
B 1 160 ILE 160 340 340 ILE ILE B . n 
B 1 161 PHE 161 341 341 PHE PHE B . n 
B 1 162 SER 162 342 342 SER SER B . n 
B 1 163 ASN 163 343 343 ASN ASN B . n 
B 1 164 ILE 164 344 344 ILE ILE B . n 
B 1 165 PRO 165 345 345 PRO PRO B . n 
B 1 166 PRO 166 346 346 PRO PRO B . n 
B 1 167 ASP 167 347 347 ASP ASP B . n 
B 1 168 GLY 168 348 348 GLY GLY B . n 
B 1 169 PHE 169 349 349 PHE PHE B . n 
B 1 170 LYS 170 350 350 LYS LYS B . n 
B 1 171 GLN 171 351 351 GLN GLN B . n 
B 1 172 ILE 172 352 352 ILE ILE B . n 
B 1 173 ARG 173 353 353 ARG ARG B . n 
B 1 174 GLN 174 354 354 GLN GLN B . n 
B 1 175 GLY 175 355 355 GLY GLY B . n 
B 1 176 MET 176 356 356 MET MET B . n 
B 1 177 ILE 177 357 357 ILE ILE B . n 
B 1 178 THR 178 358 358 THR THR B . n 
B 1 179 LEU 179 359 359 LEU LEU B . n 
B 1 180 ILE 180 360 360 ILE ILE B . n 
B 1 181 LEU 181 361 361 LEU LEU B . n 
B 1 182 ALA 182 362 362 ALA ALA B . n 
B 1 183 THR 183 363 363 THR THR B . n 
B 1 184 ASP 184 364 364 ASP ASP B . n 
B 1 185 MET 185 365 365 MET MET B . n 
B 1 186 ALA 186 366 366 ALA ALA B . n 
B 1 187 ARG 187 367 367 ARG ARG B . n 
B 1 188 HIS 188 368 368 HIS HIS B . n 
B 1 189 ALA 189 369 369 ALA ALA B . n 
B 1 190 GLU 190 370 370 GLU GLU B . n 
B 1 191 ILE 191 371 371 ILE ILE B . n 
B 1 192 MET 192 372 372 MET MET B . n 
B 1 193 ASP 193 373 373 ASP ASP B . n 
B 1 194 SER 194 374 374 SER SER B . n 
B 1 195 PHE 195 375 375 PHE PHE B . n 
B 1 196 LYS 196 376 376 LYS LYS B . n 
B 1 197 GLU 197 377 377 GLU GLU B . n 
B 1 198 LYS 198 378 378 LYS LYS B . n 
B 1 199 MET 199 379 379 MET MET B . n 
B 1 200 GLU 200 380 380 GLU GLU B . n 
B 1 201 ASN 201 381 381 ASN ASN B . n 
B 1 202 PHE 202 382 382 PHE PHE B . n 
B 1 203 ASP 203 383 383 ASP ASP B . n 
B 1 204 TYR 204 384 384 TYR TYR B . n 
B 1 205 SER 205 385 385 SER SER B . n 
B 1 206 ASN 206 386 386 ASN ASN B . n 
B 1 207 GLU 207 387 387 GLU GLU B . n 
B 1 208 GLU 208 388 388 GLU GLU B . n 
B 1 209 HIS 209 389 389 HIS HIS B . n 
B 1 210 MET 210 390 390 MET MET B . n 
B 1 211 THR 211 391 391 THR THR B . n 
B 1 212 LEU 212 392 392 LEU LEU B . n 
B 1 213 LEU 213 393 393 LEU LEU B . n 
B 1 214 LYS 214 394 394 LYS LYS B . n 
B 1 215 MET 215 395 395 MET MET B . n 
B 1 216 ILE 216 396 396 ILE ILE B . n 
B 1 217 LEU 217 397 397 LEU LEU B . n 
B 1 218 ILE 218 398 398 ILE ILE B . n 
B 1 219 LYS 219 399 399 LYS LYS B . n 
B 1 220 CYS 220 400 400 CYS CYS B . n 
B 1 221 CYS 221 401 401 CYS CYS B . n 
B 1 222 ASP 222 402 402 ASP ASP B . n 
B 1 223 ILE 223 403 403 ILE ILE B . n 
B 1 224 SER 224 404 404 SER SER B . n 
B 1 225 ASN 225 405 405 ASN ASN B . n 
B 1 226 GLU 226 406 406 GLU GLU B . n 
B 1 227 VAL 227 407 407 VAL VAL B . n 
B 1 228 ARG 228 408 408 ARG ARG B . n 
B 1 229 PRO 229 409 409 PRO PRO B . n 
B 1 230 MET 230 410 410 MET MET B . n 
B 1 231 GLU 231 411 411 GLU GLU B . n 
B 1 232 VAL 232 412 412 VAL VAL B . n 
B 1 233 ALA 233 413 413 ALA ALA B . n 
B 1 234 GLU 234 414 414 GLU GLU B . n 
B 1 235 PRO 235 415 415 PRO PRO B . n 
B 1 236 TRP 236 416 416 TRP TRP B . n 
B 1 237 VAL 237 417 417 VAL VAL B . n 
B 1 238 ASP 238 418 418 ASP ASP B . n 
B 1 239 CYS 239 419 419 CYS CYS B . n 
B 1 240 LEU 240 420 420 LEU LEU B . n 
B 1 241 LEU 241 421 421 LEU LEU B . n 
B 1 242 GLU 242 422 422 GLU GLU B . n 
B 1 243 GLU 243 423 423 GLU GLU B . n 
B 1 244 TYR 244 424 424 TYR TYR B . n 
B 1 245 PHE 245 425 425 PHE PHE B . n 
B 1 246 MET 246 426 426 MET MET B . n 
B 1 247 GLN 247 427 427 GLN GLN B . n 
B 1 248 SER 248 428 428 SER SER B . n 
B 1 249 ASP 249 429 429 ASP ASP B . n 
B 1 250 ARG 250 430 430 ARG ARG B . n 
B 1 251 GLU 251 431 431 GLU GLU B . n 
B 1 252 LYS 252 432 432 LYS LYS B . n 
B 1 253 SER 253 433 433 SER SER B . n 
B 1 254 GLU 254 434 434 GLU GLU B . n 
B 1 255 GLY 255 435 435 GLY GLY B . n 
B 1 256 LEU 256 436 436 LEU LEU B . n 
B 1 257 PRO 257 437 437 PRO PRO B . n 
B 1 258 VAL 258 438 438 VAL VAL B . n 
B 1 259 ALA 259 439 439 ALA ALA B . n 
B 1 260 PRO 260 440 440 PRO PRO B . n 
B 1 261 PHE 261 441 441 PHE PHE B . n 
B 1 262 MET 262 442 442 MET MET B . n 
B 1 263 ASP 263 443 443 ASP ASP B . n 
B 1 264 ARG 264 444 444 ARG ARG B . n 
B 1 265 ASP 265 445 445 ASP ASP B . n 
B 1 266 LYS 266 446 446 LYS LYS B . n 
B 1 267 VAL 267 447 447 VAL VAL B . n 
B 1 268 THR 268 448 448 THR THR B . n 
B 1 269 LYS 269 449 449 LYS LYS B . n 
B 1 270 ALA 270 450 450 ALA ALA B . n 
B 1 271 THR 271 451 451 THR THR B . n 
B 1 272 ALA 272 452 452 ALA ALA B . n 
B 1 273 GLN 273 453 453 GLN GLN B . n 
B 1 274 ILE 274 454 454 ILE ILE B . n 
B 1 275 GLY 275 455 455 GLY GLY B . n 
B 1 276 PHE 276 456 456 PHE PHE B . n 
B 1 277 ILE 277 457 457 ILE ILE B . n 
B 1 278 LYS 278 458 458 LYS LYS B . n 
B 1 279 PHE 279 459 459 PHE PHE B . n 
B 1 280 VAL 280 460 460 VAL VAL B . n 
B 1 281 LEU 281 461 461 LEU LEU B . n 
B 1 282 ILE 282 462 462 ILE ILE B . n 
B 1 283 PRO 283 463 463 PRO PRO B . n 
B 1 284 MET 284 464 464 MET MET B . n 
B 1 285 PHE 285 465 465 PHE PHE B . n 
B 1 286 GLU 286 466 466 GLU GLU B . n 
B 1 287 THR 287 467 467 THR THR B . n 
B 1 288 VAL 288 468 468 VAL VAL B . n 
B 1 289 THR 289 469 469 THR THR B . n 
B 1 290 LYS 290 470 470 LYS LYS B . n 
B 1 291 LEU 291 471 471 LEU LEU B . n 
B 1 292 PHE 292 472 472 PHE PHE B . n 
B 1 293 PRO 293 473 473 PRO PRO B . n 
B 1 294 MET 294 474 474 MET MET B . n 
B 1 295 VAL 295 475 475 VAL VAL B . n 
B 1 296 GLU 296 476 476 GLU GLU B . n 
B 1 297 GLU 297 477 477 GLU GLU B . n 
B 1 298 ILE 298 478 478 ILE ILE B . n 
B 1 299 MET 299 479 479 MET MET B . n 
B 1 300 LEU 300 480 480 LEU LEU B . n 
B 1 301 GLN 301 481 481 GLN GLN B . n 
B 1 302 PRO 302 482 482 PRO PRO B . n 
B 1 303 LEU 303 483 483 LEU LEU B . n 
B 1 304 TRP 304 484 484 TRP TRP B . n 
B 1 305 GLU 305 485 485 GLU GLU B . n 
B 1 306 SER 306 486 486 SER SER B . n 
B 1 307 ARG 307 487 487 ARG ARG B . n 
B 1 308 ASP 308 488 488 ASP ASP B . n 
B 1 309 ARG 309 489 489 ARG ARG B . n 
B 1 310 TYR 310 490 490 TYR TYR B . n 
B 1 311 GLU 311 491 491 GLU GLU B . n 
B 1 312 GLU 312 492 492 GLU GLU B . n 
B 1 313 LEU 313 493 493 LEU LEU B . n 
B 1 314 LYS 314 494 494 LYS LYS B . n 
B 1 315 ARG 315 495 495 ARG ARG B . n 
B 1 316 ILE 316 496 496 ILE ILE B . n 
B 1 317 ASP 317 497 497 ASP ASP B . n 
B 1 318 ASP 318 498 498 ASP ASP B . n 
B 1 319 ALA 319 499 499 ALA ALA B . n 
B 1 320 MET 320 500 500 MET MET B . n 
B 1 321 LYS 321 501 501 LYS LYS B . n 
B 1 322 GLU 322 502 502 GLU GLU B . n 
B 1 323 LEU 323 503 503 LEU LEU B . n 
B 1 324 GLN 324 504 504 GLN GLN B . n 
B 1 325 LYS 325 505 505 LYS LYS B . n 
B 1 326 LYS 326 506 506 LYS LYS B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,I 
2 1 B,F,G,H,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 76  ? A HIS 256 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 OD1 ? A ASP 222 ? A ASP 402 ? 1_555 88.5  ? 
2  NE2 ? A HIS 76  ? A HIS 256 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 O   ? I HOH .   ? A HOH 507 ? 1_555 85.9  ? 
3  OD1 ? A ASP 222 ? A ASP 402 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 O   ? I HOH .   ? A HOH 507 ? 1_555 83.3  ? 
4  NE2 ? A HIS 76  ? A HIS 256 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 112 ? A HIS 292 ? 1_555 87.4  ? 
5  OD1 ? A ASP 222 ? A ASP 402 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 112 ? A HIS 292 ? 1_555 88.8  ? 
6  O   ? I HOH .   ? A HOH 507 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 112 ? A HIS 292 ? 1_555 169.8 ? 
7  NE2 ? A HIS 76  ? A HIS 256 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 OD2 ? A ASP 113 ? A ASP 293 ? 1_555 86.4  ? 
8  OD1 ? A ASP 222 ? A ASP 402 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 OD2 ? A ASP 113 ? A ASP 293 ? 1_555 166.1 ? 
9  O   ? I HOH .   ? A HOH 507 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 OD2 ? A ASP 113 ? A ASP 293 ? 1_555 109.2 ? 
10 NE2 ? A HIS 112 ? A HIS 292 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 OD2 ? A ASP 113 ? A ASP 293 ? 1_555 78.0  ? 
11 O   ? I HOH .   ? A HOH 509 ? 1_555 MG ? D MG . ? A MG 102 ? 1_555 OD1 ? A ASP 113 ? A ASP 293 ? 1_555 172.3 ? 
12 O   ? I HOH .   ? A HOH 509 ? 1_555 MG ? D MG . ? A MG 102 ? 1_555 O   ? I HOH .   ? A HOH 510 ? 1_555 86.4  ? 
13 OD1 ? A ASP 113 ? A ASP 293 ? 1_555 MG ? D MG . ? A MG 102 ? 1_555 O   ? I HOH .   ? A HOH 510 ? 1_555 94.4  ? 
14 O   ? I HOH .   ? A HOH 509 ? 1_555 MG ? D MG . ? A MG 102 ? 1_555 O   ? I HOH .   ? A HOH 511 ? 1_555 83.2  ? 
15 OD1 ? A ASP 113 ? A ASP 293 ? 1_555 MG ? D MG . ? A MG 102 ? 1_555 O   ? I HOH .   ? A HOH 511 ? 1_555 89.2  ? 
16 O   ? I HOH .   ? A HOH 510 ? 1_555 MG ? D MG . ? A MG 102 ? 1_555 O   ? I HOH .   ? A HOH 511 ? 1_555 97.5  ? 
17 O   ? I HOH .   ? A HOH 509 ? 1_555 MG ? D MG . ? A MG 102 ? 1_555 O   ? I HOH .   ? A HOH 508 ? 1_555 92.8  ? 
18 OD1 ? A ASP 113 ? A ASP 293 ? 1_555 MG ? D MG . ? A MG 102 ? 1_555 O   ? I HOH .   ? A HOH 508 ? 1_555 94.8  ? 
19 O   ? I HOH .   ? A HOH 510 ? 1_555 MG ? D MG . ? A MG 102 ? 1_555 O   ? I HOH .   ? A HOH 508 ? 1_555 74.3  ? 
20 O   ? I HOH .   ? A HOH 511 ? 1_555 MG ? D MG . ? A MG 102 ? 1_555 O   ? I HOH .   ? A HOH 508 ? 1_555 171.1 ? 
21 OD1 ? B ASP 222 ? B ASP 402 ? 1_555 ZN ? F ZN . ? B ZN 101 ? 1_555 OD2 ? B ASP 113 ? B ASP 293 ? 1_555 166.2 ? 
22 OD1 ? B ASP 222 ? B ASP 402 ? 1_555 ZN ? F ZN . ? B ZN 101 ? 1_555 NE2 ? B HIS 112 ? B HIS 292 ? 1_555 86.4  ? 
23 OD2 ? B ASP 113 ? B ASP 293 ? 1_555 ZN ? F ZN . ? B ZN 101 ? 1_555 NE2 ? B HIS 112 ? B HIS 292 ? 1_555 79.9  ? 
24 OD1 ? B ASP 222 ? B ASP 402 ? 1_555 ZN ? F ZN . ? B ZN 101 ? 1_555 NE2 ? B HIS 76  ? B HIS 256 ? 1_555 88.0  ? 
25 OD2 ? B ASP 113 ? B ASP 293 ? 1_555 ZN ? F ZN . ? B ZN 101 ? 1_555 NE2 ? B HIS 76  ? B HIS 256 ? 1_555 91.4  ? 
26 NE2 ? B HIS 112 ? B HIS 292 ? 1_555 ZN ? F ZN . ? B ZN 101 ? 1_555 NE2 ? B HIS 76  ? B HIS 256 ? 1_555 93.6  ? 
27 O   ? J HOH .   ? B HOH 508 ? 1_555 MG ? G MG . ? B MG 102 ? 1_555 O   ? J HOH .   ? B HOH 511 ? 1_555 172.4 ? 
28 O   ? J HOH .   ? B HOH 508 ? 1_555 MG ? G MG . ? B MG 102 ? 1_555 O   ? J HOH .   ? B HOH 509 ? 1_555 86.5  ? 
29 O   ? J HOH .   ? B HOH 511 ? 1_555 MG ? G MG . ? B MG 102 ? 1_555 O   ? J HOH .   ? B HOH 509 ? 1_555 86.0  ? 
30 O   ? J HOH .   ? B HOH 508 ? 1_555 MG ? G MG . ? B MG 102 ? 1_555 O   ? J HOH .   ? B HOH 510 ? 1_555 88.9  ? 
31 O   ? J HOH .   ? B HOH 511 ? 1_555 MG ? G MG . ? B MG 102 ? 1_555 O   ? J HOH .   ? B HOH 510 ? 1_555 91.7  ? 
32 O   ? J HOH .   ? B HOH 509 ? 1_555 MG ? G MG . ? B MG 102 ? 1_555 O   ? J HOH .   ? B HOH 510 ? 1_555 88.1  ? 
33 O   ? J HOH .   ? B HOH 508 ? 1_555 MG ? G MG . ? B MG 102 ? 1_555 OD1 ? B ASP 113 ? B ASP 293 ? 1_555 112.2 ? 
34 O   ? J HOH .   ? B HOH 511 ? 1_555 MG ? G MG . ? B MG 102 ? 1_555 OD1 ? B ASP 113 ? B ASP 293 ? 1_555 75.3  ? 
35 O   ? J HOH .   ? B HOH 509 ? 1_555 MG ? G MG . ? B MG 102 ? 1_555 OD1 ? B ASP 113 ? B ASP 293 ? 1_555 161.3 ? 
36 O   ? J HOH .   ? B HOH 510 ? 1_555 MG ? G MG . ? B MG 102 ? 1_555 OD1 ? B ASP 113 ? B ASP 293 ? 1_555 92.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-06-27 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC      'data collection' .   ? 1 
DENZO     'data reduction'  .   ? 2 
AMoRE     phasing           .   ? 3 
CNS       refinement        1.0 ? 4 
SCALEPACK 'data scaling'    .   ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 300 ? ? -67.76  -178.11 
2  1 SER A 319 ? ? 28.31   60.29   
3  1 ASN A 381 ? ? -163.29 66.99   
4  1 PHE A 441 ? ? -68.62  1.79    
5  1 VAL A 460 ? ? -126.53 -61.42  
6  1 GLN A 504 ? ? -101.91 -168.05 
7  1 LYS A 505 ? ? 58.71   81.06   
8  1 PRO B 199 ? ? -57.61  -9.38   
9  1 ASP B 317 ? ? 59.98   10.55   
10 1 SER B 319 ? ? 27.55   59.91   
11 1 ASN B 381 ? ? -151.92 63.70   
12 1 LYS B 505 ? ? -164.22 44.51   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'                  ZN  
3 'MAGNESIUM ION'             MG  
4 3-ISOBUTYL-1-METHYLXANTHINE IBM 
5 water                       HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1   101 101 ZN  ZN  A . 
D 3 MG  1   102 102 MG  MG  A . 
E 4 IBM 1   1   1   IBM IBM A . 
F 2 ZN  1   101 101 ZN  ZN  B . 
G 3 MG  1   102 102 MG  MG  B . 
H 4 IBM 1   1   1   IBM IBM B . 
I 5 HOH 1   507 1   HOH TIP A . 
I 5 HOH 2   508 2   HOH TIP A . 
I 5 HOH 3   509 3   HOH TIP A . 
I 5 HOH 4   510 4   HOH TIP A . 
I 5 HOH 5   511 5   HOH TIP A . 
I 5 HOH 6   512 11  HOH TIP A . 
I 5 HOH 7   513 12  HOH TIP A . 
I 5 HOH 8   514 14  HOH TIP A . 
I 5 HOH 9   515 17  HOH TIP A . 
I 5 HOH 10  516 20  HOH TIP A . 
I 5 HOH 11  517 22  HOH TIP A . 
I 5 HOH 12  518 23  HOH TIP A . 
I 5 HOH 13  519 24  HOH TIP A . 
I 5 HOH 14  520 25  HOH TIP A . 
I 5 HOH 15  521 26  HOH TIP A . 
I 5 HOH 16  522 28  HOH TIP A . 
I 5 HOH 17  523 32  HOH TIP A . 
I 5 HOH 18  524 34  HOH TIP A . 
I 5 HOH 19  525 35  HOH TIP A . 
I 5 HOH 20  526 36  HOH TIP A . 
I 5 HOH 21  527 37  HOH TIP A . 
I 5 HOH 22  528 38  HOH TIP A . 
I 5 HOH 23  529 40  HOH TIP A . 
I 5 HOH 24  530 41  HOH TIP A . 
I 5 HOH 25  531 43  HOH TIP A . 
I 5 HOH 26  532 45  HOH TIP A . 
I 5 HOH 27  533 48  HOH TIP A . 
I 5 HOH 28  534 51  HOH TIP A . 
I 5 HOH 29  535 53  HOH TIP A . 
I 5 HOH 30  536 56  HOH TIP A . 
I 5 HOH 31  537 57  HOH TIP A . 
I 5 HOH 32  538 58  HOH TIP A . 
I 5 HOH 33  539 60  HOH TIP A . 
I 5 HOH 34  540 61  HOH TIP A . 
I 5 HOH 35  541 62  HOH TIP A . 
I 5 HOH 36  542 63  HOH TIP A . 
I 5 HOH 37  543 64  HOH TIP A . 
I 5 HOH 38  544 66  HOH TIP A . 
I 5 HOH 39  545 67  HOH TIP A . 
I 5 HOH 40  546 68  HOH TIP A . 
I 5 HOH 41  547 69  HOH TIP A . 
I 5 HOH 42  548 72  HOH TIP A . 
I 5 HOH 43  549 74  HOH TIP A . 
I 5 HOH 44  550 75  HOH TIP A . 
I 5 HOH 45  551 76  HOH TIP A . 
I 5 HOH 46  552 81  HOH TIP A . 
I 5 HOH 47  553 82  HOH TIP A . 
I 5 HOH 48  554 84  HOH TIP A . 
I 5 HOH 49  555 85  HOH TIP A . 
I 5 HOH 50  556 89  HOH TIP A . 
I 5 HOH 51  557 90  HOH TIP A . 
I 5 HOH 52  558 91  HOH TIP A . 
I 5 HOH 53  559 94  HOH TIP A . 
I 5 HOH 54  560 95  HOH TIP A . 
I 5 HOH 55  561 97  HOH TIP A . 
I 5 HOH 56  562 101 HOH TIP A . 
I 5 HOH 57  563 102 HOH TIP A . 
I 5 HOH 58  564 105 HOH TIP A . 
I 5 HOH 59  565 106 HOH TIP A . 
I 5 HOH 60  566 108 HOH TIP A . 
I 5 HOH 61  567 109 HOH TIP A . 
I 5 HOH 62  568 112 HOH TIP A . 
I 5 HOH 63  569 113 HOH TIP A . 
I 5 HOH 64  570 115 HOH TIP A . 
I 5 HOH 65  571 116 HOH TIP A . 
I 5 HOH 66  572 121 HOH TIP A . 
I 5 HOH 67  573 124 HOH TIP A . 
I 5 HOH 68  574 125 HOH TIP A . 
I 5 HOH 69  575 128 HOH TIP A . 
I 5 HOH 70  576 129 HOH TIP A . 
I 5 HOH 71  577 131 HOH TIP A . 
I 5 HOH 72  578 133 HOH TIP A . 
I 5 HOH 73  579 134 HOH TIP A . 
I 5 HOH 74  580 137 HOH TIP A . 
I 5 HOH 75  581 139 HOH TIP A . 
I 5 HOH 76  582 143 HOH TIP A . 
I 5 HOH 77  583 144 HOH TIP A . 
I 5 HOH 78  584 145 HOH TIP A . 
I 5 HOH 79  585 150 HOH TIP A . 
I 5 HOH 80  586 160 HOH TIP A . 
I 5 HOH 81  587 161 HOH TIP A . 
I 5 HOH 82  588 163 HOH TIP A . 
I 5 HOH 83  589 166 HOH TIP A . 
I 5 HOH 84  590 167 HOH TIP A . 
I 5 HOH 85  591 170 HOH TIP A . 
I 5 HOH 86  592 173 HOH TIP A . 
I 5 HOH 87  593 177 HOH TIP A . 
I 5 HOH 88  594 183 HOH TIP A . 
I 5 HOH 89  595 184 HOH TIP A . 
I 5 HOH 90  596 188 HOH TIP A . 
I 5 HOH 91  597 189 HOH TIP A . 
I 5 HOH 92  598 192 HOH TIP A . 
I 5 HOH 93  599 193 HOH TIP A . 
I 5 HOH 94  600 194 HOH TIP A . 
J 5 HOH 1   507 6   HOH TIP B . 
J 5 HOH 2   508 7   HOH TIP B . 
J 5 HOH 3   509 8   HOH TIP B . 
J 5 HOH 4   510 9   HOH TIP B . 
J 5 HOH 5   511 10  HOH TIP B . 
J 5 HOH 6   512 13  HOH TIP B . 
J 5 HOH 7   513 15  HOH TIP B . 
J 5 HOH 8   514 16  HOH TIP B . 
J 5 HOH 9   515 18  HOH TIP B . 
J 5 HOH 10  516 19  HOH TIP B . 
J 5 HOH 11  517 21  HOH TIP B . 
J 5 HOH 12  518 27  HOH TIP B . 
J 5 HOH 13  519 29  HOH TIP B . 
J 5 HOH 14  520 30  HOH TIP B . 
J 5 HOH 15  521 31  HOH TIP B . 
J 5 HOH 16  522 33  HOH TIP B . 
J 5 HOH 17  523 39  HOH TIP B . 
J 5 HOH 18  524 42  HOH TIP B . 
J 5 HOH 19  525 44  HOH TIP B . 
J 5 HOH 20  526 46  HOH TIP B . 
J 5 HOH 21  527 47  HOH TIP B . 
J 5 HOH 22  528 49  HOH TIP B . 
J 5 HOH 23  529 50  HOH TIP B . 
J 5 HOH 24  530 52  HOH TIP B . 
J 5 HOH 25  531 54  HOH TIP B . 
J 5 HOH 26  532 55  HOH TIP B . 
J 5 HOH 27  533 59  HOH TIP B . 
J 5 HOH 28  534 65  HOH TIP B . 
J 5 HOH 29  535 70  HOH TIP B . 
J 5 HOH 30  536 71  HOH TIP B . 
J 5 HOH 31  537 73  HOH TIP B . 
J 5 HOH 32  538 77  HOH TIP B . 
J 5 HOH 33  539 78  HOH TIP B . 
J 5 HOH 34  540 79  HOH TIP B . 
J 5 HOH 35  541 80  HOH TIP B . 
J 5 HOH 36  542 83  HOH TIP B . 
J 5 HOH 37  543 86  HOH TIP B . 
J 5 HOH 38  544 87  HOH TIP B . 
J 5 HOH 39  545 88  HOH TIP B . 
J 5 HOH 40  546 92  HOH TIP B . 
J 5 HOH 41  547 93  HOH TIP B . 
J 5 HOH 42  548 96  HOH TIP B . 
J 5 HOH 43  549 98  HOH TIP B . 
J 5 HOH 44  550 99  HOH TIP B . 
J 5 HOH 45  551 100 HOH TIP B . 
J 5 HOH 46  552 103 HOH TIP B . 
J 5 HOH 47  553 104 HOH TIP B . 
J 5 HOH 48  554 107 HOH TIP B . 
J 5 HOH 49  555 110 HOH TIP B . 
J 5 HOH 50  556 111 HOH TIP B . 
J 5 HOH 51  557 114 HOH TIP B . 
J 5 HOH 52  558 117 HOH TIP B . 
J 5 HOH 53  559 118 HOH TIP B . 
J 5 HOH 54  560 119 HOH TIP B . 
J 5 HOH 55  561 120 HOH TIP B . 
J 5 HOH 56  562 122 HOH TIP B . 
J 5 HOH 57  563 123 HOH TIP B . 
J 5 HOH 58  564 126 HOH TIP B . 
J 5 HOH 59  565 127 HOH TIP B . 
J 5 HOH 60  566 130 HOH TIP B . 
J 5 HOH 61  567 132 HOH TIP B . 
J 5 HOH 62  568 135 HOH TIP B . 
J 5 HOH 63  569 136 HOH TIP B . 
J 5 HOH 64  570 138 HOH TIP B . 
J 5 HOH 65  571 140 HOH TIP B . 
J 5 HOH 66  572 141 HOH TIP B . 
J 5 HOH 67  573 142 HOH TIP B . 
J 5 HOH 68  574 146 HOH TIP B . 
J 5 HOH 69  575 147 HOH TIP B . 
J 5 HOH 70  576 148 HOH TIP B . 
J 5 HOH 71  577 149 HOH TIP B . 
J 5 HOH 72  578 151 HOH TIP B . 
J 5 HOH 73  579 152 HOH TIP B . 
J 5 HOH 74  580 153 HOH TIP B . 
J 5 HOH 75  581 154 HOH TIP B . 
J 5 HOH 76  582 155 HOH TIP B . 
J 5 HOH 77  583 156 HOH TIP B . 
J 5 HOH 78  584 157 HOH TIP B . 
J 5 HOH 79  585 158 HOH TIP B . 
J 5 HOH 80  586 159 HOH TIP B . 
J 5 HOH 81  587 162 HOH TIP B . 
J 5 HOH 82  588 164 HOH TIP B . 
J 5 HOH 83  589 165 HOH TIP B . 
J 5 HOH 84  590 168 HOH TIP B . 
J 5 HOH 85  591 169 HOH TIP B . 
J 5 HOH 86  592 171 HOH TIP B . 
J 5 HOH 87  593 172 HOH TIP B . 
J 5 HOH 88  594 174 HOH TIP B . 
J 5 HOH 89  595 175 HOH TIP B . 
J 5 HOH 90  596 176 HOH TIP B . 
J 5 HOH 91  597 178 HOH TIP B . 
J 5 HOH 92  598 179 HOH TIP B . 
J 5 HOH 93  599 180 HOH TIP B . 
J 5 HOH 94  600 181 HOH TIP B . 
J 5 HOH 95  601 182 HOH TIP B . 
J 5 HOH 96  602 185 HOH TIP B . 
J 5 HOH 97  603 186 HOH TIP B . 
J 5 HOH 98  604 187 HOH TIP B . 
J 5 HOH 99  605 190 HOH TIP B . 
J 5 HOH 100 606 191 HOH TIP B . 
J 5 HOH 101 607 195 HOH TIP B . 
#