data_2HHQ
# 
_entry.id   2HHQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HHQ         
NDB   PD0824       
RCSB  RCSB038359   
WWPDB D_1000038359 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2HHS . unspecified 
PDB 2HHT . unspecified 
PDB 2HHU . unspecified 
PDB 2HHV . unspecified 
PDB 2HHW . unspecified 
PDB 2HHX . unspecified 
PDB 2HHY . unspecified 
# 
_pdbx_database_status.entry_id                        2HHQ 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-06-28 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Warren, J.J.'   1 
'Forsberg, L.J.' 2 
'Beese, L.S.'    3 
# 
_citation.id                        primary 
_citation.title                     'The structural basis for the mutagenicity of O6-methyl-guanine lesions.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            103 
_citation.page_first                19701 
_citation.page_last                 19706 
_citation.year                      2006 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17179038 
_citation.pdbx_database_id_DOI      10.1073/pnas.0609580103 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Warren, J.J.'   1 
primary 'Forsberg, L.J.' 2 
primary 'Beese, L.S.'    3 
# 
_cell.entry_id           2HHQ 
_cell.length_a           86.792 
_cell.length_b           93.274 
_cell.length_c           106.018 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HHQ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*CP*AP*TP*(6OG)P*CP*GP*AP*GP*TP*CP*AP*GP*G)-3'"   4030.650  1   ?       ? ? 'DNA Primer Strand'   
2 polymer     syn "5'-D(*GP*CP*CP*TP*GP*AP*CP*TP*CP*GP*TP*AP*TP*GP*A)-3'" 4584.984  1   ?       ? ? 'DNA Template Strand' 
3 polymer     man 'DNA polymerase I'                                      66230.953 1   2.7.7.7 ? 
'residues 299-876 (analogous to E Coli Klenow Fragment)' ?                     
4 non-polymer man SUCROSE                                                 342.296   3   ?       ? ? ?                     
5 non-polymer syn 'SULFATE ION'                                           96.063    3   ?       ? ? ?                     
6 non-polymer syn 'MAGNESIUM ION'                                         24.305    1   ?       ? ? ?                     
7 water       nat water                                                   18.015    537 ?       ? ? ?                     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DC)(DA)(DT)(6OG)(DC)(DG)(DA)(DG)(DT)(DC)(DA)(DG)(DG)' CATGCGAGTCAGG B ? 
2 polydeoxyribonucleotide no no  '(DG)(DC)(DC)(DT)(DG)(DA)(DC)(DT)(DC)(DG)(DT)(DA)(DT)(DG)(DA)' GCCTGACTCGTATGA C ? 
3 'polypeptide(L)'        no no  
;KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWE
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
;KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWE
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DA  n 
1 3   DT  n 
1 4   6OG n 
1 5   DC  n 
1 6   DG  n 
1 7   DA  n 
1 8   DG  n 
1 9   DT  n 
1 10  DC  n 
1 11  DA  n 
1 12  DG  n 
1 13  DG  n 
2 1   DG  n 
2 2   DC  n 
2 3   DC  n 
2 4   DT  n 
2 5   DG  n 
2 6   DA  n 
2 7   DC  n 
2 8   DT  n 
2 9   DC  n 
2 10  DG  n 
2 11  DT  n 
2 12  DA  n 
2 13  DT  n 
2 14  DG  n 
2 15  DA  n 
3 1   LYS n 
3 2   LYS n 
3 3   MET n 
3 4   ALA n 
3 5   PHE n 
3 6   THR n 
3 7   LEU n 
3 8   ALA n 
3 9   ASP n 
3 10  ARG n 
3 11  VAL n 
3 12  THR n 
3 13  GLU n 
3 14  GLU n 
3 15  MET n 
3 16  LEU n 
3 17  ALA n 
3 18  ASP n 
3 19  LYS n 
3 20  ALA n 
3 21  ALA n 
3 22  LEU n 
3 23  VAL n 
3 24  VAL n 
3 25  GLU n 
3 26  VAL n 
3 27  VAL n 
3 28  GLU n 
3 29  GLU n 
3 30  ASN n 
3 31  TYR n 
3 32  HIS n 
3 33  ASP n 
3 34  ALA n 
3 35  PRO n 
3 36  ILE n 
3 37  VAL n 
3 38  GLY n 
3 39  ILE n 
3 40  ALA n 
3 41  VAL n 
3 42  VAL n 
3 43  ASN n 
3 44  GLU n 
3 45  HIS n 
3 46  GLY n 
3 47  ARG n 
3 48  PHE n 
3 49  PHE n 
3 50  LEU n 
3 51  ARG n 
3 52  PRO n 
3 53  GLU n 
3 54  THR n 
3 55  ALA n 
3 56  LEU n 
3 57  ALA n 
3 58  ASP n 
3 59  PRO n 
3 60  GLN n 
3 61  PHE n 
3 62  VAL n 
3 63  ALA n 
3 64  TRP n 
3 65  LEU n 
3 66  GLY n 
3 67  ASP n 
3 68  GLU n 
3 69  THR n 
3 70  LYS n 
3 71  LYS n 
3 72  LYS n 
3 73  SER n 
3 74  MET n 
3 75  PHE n 
3 76  ASP n 
3 77  SER n 
3 78  LYS n 
3 79  ARG n 
3 80  ALA n 
3 81  ALA n 
3 82  VAL n 
3 83  ALA n 
3 84  LEU n 
3 85  LYS n 
3 86  TRP n 
3 87  LYS n 
3 88  GLY n 
3 89  ILE n 
3 90  GLU n 
3 91  LEU n 
3 92  CYS n 
3 93  GLY n 
3 94  VAL n 
3 95  SER n 
3 96  PHE n 
3 97  ASP n 
3 98  LEU n 
3 99  LEU n 
3 100 LEU n 
3 101 ALA n 
3 102 ALA n 
3 103 TYR n 
3 104 LEU n 
3 105 LEU n 
3 106 ASP n 
3 107 PRO n 
3 108 ALA n 
3 109 GLN n 
3 110 GLY n 
3 111 VAL n 
3 112 ASP n 
3 113 ASP n 
3 114 VAL n 
3 115 ALA n 
3 116 ALA n 
3 117 ALA n 
3 118 ALA n 
3 119 LYS n 
3 120 MET n 
3 121 LYS n 
3 122 GLN n 
3 123 TYR n 
3 124 GLU n 
3 125 ALA n 
3 126 VAL n 
3 127 ARG n 
3 128 PRO n 
3 129 ASP n 
3 130 GLU n 
3 131 ALA n 
3 132 VAL n 
3 133 TYR n 
3 134 GLY n 
3 135 LYS n 
3 136 GLY n 
3 137 ALA n 
3 138 LYS n 
3 139 ARG n 
3 140 ALA n 
3 141 VAL n 
3 142 PRO n 
3 143 ASP n 
3 144 GLU n 
3 145 PRO n 
3 146 VAL n 
3 147 LEU n 
3 148 ALA n 
3 149 GLU n 
3 150 HIS n 
3 151 LEU n 
3 152 VAL n 
3 153 ARG n 
3 154 LYS n 
3 155 ALA n 
3 156 ALA n 
3 157 ALA n 
3 158 ILE n 
3 159 TRP n 
3 160 GLU n 
3 161 LEU n 
3 162 GLU n 
3 163 ARG n 
3 164 PRO n 
3 165 PHE n 
3 166 LEU n 
3 167 ASP n 
3 168 GLU n 
3 169 LEU n 
3 170 ARG n 
3 171 ARG n 
3 172 ASN n 
3 173 GLU n 
3 174 GLN n 
3 175 ASP n 
3 176 ARG n 
3 177 LEU n 
3 178 LEU n 
3 179 VAL n 
3 180 GLU n 
3 181 LEU n 
3 182 GLU n 
3 183 GLN n 
3 184 PRO n 
3 185 LEU n 
3 186 SER n 
3 187 SER n 
3 188 ILE n 
3 189 LEU n 
3 190 ALA n 
3 191 GLU n 
3 192 MET n 
3 193 GLU n 
3 194 PHE n 
3 195 ALA n 
3 196 GLY n 
3 197 VAL n 
3 198 LYS n 
3 199 VAL n 
3 200 ASP n 
3 201 THR n 
3 202 LYS n 
3 203 ARG n 
3 204 LEU n 
3 205 GLU n 
3 206 GLN n 
3 207 MET n 
3 208 GLY n 
3 209 LYS n 
3 210 GLU n 
3 211 LEU n 
3 212 ALA n 
3 213 GLU n 
3 214 GLN n 
3 215 LEU n 
3 216 GLY n 
3 217 THR n 
3 218 VAL n 
3 219 GLU n 
3 220 GLN n 
3 221 ARG n 
3 222 ILE n 
3 223 TYR n 
3 224 GLU n 
3 225 LEU n 
3 226 ALA n 
3 227 GLY n 
3 228 GLN n 
3 229 GLU n 
3 230 PHE n 
3 231 ASN n 
3 232 ILE n 
3 233 ASN n 
3 234 SER n 
3 235 PRO n 
3 236 LYS n 
3 237 GLN n 
3 238 LEU n 
3 239 GLY n 
3 240 VAL n 
3 241 ILE n 
3 242 LEU n 
3 243 PHE n 
3 244 GLU n 
3 245 LYS n 
3 246 LEU n 
3 247 GLN n 
3 248 LEU n 
3 249 PRO n 
3 250 VAL n 
3 251 LEU n 
3 252 LYS n 
3 253 LYS n 
3 254 THR n 
3 255 LYS n 
3 256 THR n 
3 257 GLY n 
3 258 TYR n 
3 259 SER n 
3 260 THR n 
3 261 SER n 
3 262 ALA n 
3 263 ASP n 
3 264 VAL n 
3 265 LEU n 
3 266 GLU n 
3 267 LYS n 
3 268 LEU n 
3 269 ALA n 
3 270 PRO n 
3 271 TYR n 
3 272 HIS n 
3 273 GLU n 
3 274 ILE n 
3 275 VAL n 
3 276 GLU n 
3 277 ASN n 
3 278 ILE n 
3 279 LEU n 
3 280 HIS n 
3 281 TYR n 
3 282 ARG n 
3 283 GLN n 
3 284 LEU n 
3 285 GLY n 
3 286 LYS n 
3 287 LEU n 
3 288 GLN n 
3 289 SER n 
3 290 THR n 
3 291 TYR n 
3 292 ILE n 
3 293 GLU n 
3 294 GLY n 
3 295 LEU n 
3 296 LEU n 
3 297 LYS n 
3 298 VAL n 
3 299 VAL n 
3 300 ARG n 
3 301 PRO n 
3 302 ASP n 
3 303 THR n 
3 304 LYS n 
3 305 LYS n 
3 306 VAL n 
3 307 HIS n 
3 308 THR n 
3 309 ILE n 
3 310 PHE n 
3 311 ASN n 
3 312 GLN n 
3 313 ALA n 
3 314 LEU n 
3 315 THR n 
3 316 GLN n 
3 317 THR n 
3 318 GLY n 
3 319 ARG n 
3 320 LEU n 
3 321 SER n 
3 322 SER n 
3 323 THR n 
3 324 GLU n 
3 325 PRO n 
3 326 ASN n 
3 327 LEU n 
3 328 GLN n 
3 329 ASN n 
3 330 ILE n 
3 331 PRO n 
3 332 ILE n 
3 333 ARG n 
3 334 LEU n 
3 335 GLU n 
3 336 GLU n 
3 337 GLY n 
3 338 ARG n 
3 339 LYS n 
3 340 ILE n 
3 341 ARG n 
3 342 GLN n 
3 343 ALA n 
3 344 PHE n 
3 345 VAL n 
3 346 PRO n 
3 347 SER n 
3 348 GLU n 
3 349 SER n 
3 350 ASP n 
3 351 TRP n 
3 352 LEU n 
3 353 ILE n 
3 354 PHE n 
3 355 ALA n 
3 356 ALA n 
3 357 ASP n 
3 358 TYR n 
3 359 SER n 
3 360 GLN n 
3 361 ILE n 
3 362 GLU n 
3 363 LEU n 
3 364 ARG n 
3 365 VAL n 
3 366 LEU n 
3 367 ALA n 
3 368 HIS n 
3 369 ILE n 
3 370 ALA n 
3 371 GLU n 
3 372 ASP n 
3 373 ASP n 
3 374 ASN n 
3 375 LEU n 
3 376 MET n 
3 377 GLU n 
3 378 ALA n 
3 379 PHE n 
3 380 ARG n 
3 381 ARG n 
3 382 ASP n 
3 383 LEU n 
3 384 ASP n 
3 385 ILE n 
3 386 HIS n 
3 387 THR n 
3 388 LYS n 
3 389 THR n 
3 390 ALA n 
3 391 MET n 
3 392 ASP n 
3 393 ILE n 
3 394 PHE n 
3 395 GLN n 
3 396 VAL n 
3 397 SER n 
3 398 GLU n 
3 399 ASP n 
3 400 GLU n 
3 401 VAL n 
3 402 THR n 
3 403 PRO n 
3 404 ASN n 
3 405 MET n 
3 406 ARG n 
3 407 ARG n 
3 408 GLN n 
3 409 ALA n 
3 410 LYS n 
3 411 ALA n 
3 412 VAL n 
3 413 ASN n 
3 414 PHE n 
3 415 GLY n 
3 416 ILE n 
3 417 VAL n 
3 418 TYR n 
3 419 GLY n 
3 420 ILE n 
3 421 SER n 
3 422 ASP n 
3 423 TYR n 
3 424 GLY n 
3 425 LEU n 
3 426 ALA n 
3 427 GLN n 
3 428 ASN n 
3 429 LEU n 
3 430 ASN n 
3 431 ILE n 
3 432 SER n 
3 433 ARG n 
3 434 LYS n 
3 435 GLU n 
3 436 ALA n 
3 437 ALA n 
3 438 GLU n 
3 439 PHE n 
3 440 ILE n 
3 441 GLU n 
3 442 ARG n 
3 443 TYR n 
3 444 PHE n 
3 445 GLU n 
3 446 SER n 
3 447 PHE n 
3 448 PRO n 
3 449 GLY n 
3 450 VAL n 
3 451 LYS n 
3 452 ARG n 
3 453 TYR n 
3 454 MET n 
3 455 GLU n 
3 456 ASN n 
3 457 ILE n 
3 458 VAL n 
3 459 GLN n 
3 460 GLU n 
3 461 ALA n 
3 462 LYS n 
3 463 GLN n 
3 464 LYS n 
3 465 GLY n 
3 466 TYR n 
3 467 VAL n 
3 468 THR n 
3 469 THR n 
3 470 LEU n 
3 471 LEU n 
3 472 HIS n 
3 473 ARG n 
3 474 ARG n 
3 475 ARG n 
3 476 TYR n 
3 477 LEU n 
3 478 PRO n 
3 479 ASP n 
3 480 ILE n 
3 481 THR n 
3 482 SER n 
3 483 ARG n 
3 484 ASN n 
3 485 PHE n 
3 486 ASN n 
3 487 VAL n 
3 488 ARG n 
3 489 SER n 
3 490 PHE n 
3 491 ALA n 
3 492 GLU n 
3 493 ARG n 
3 494 MET n 
3 495 ALA n 
3 496 MET n 
3 497 ASN n 
3 498 THR n 
3 499 PRO n 
3 500 ILE n 
3 501 GLN n 
3 502 GLY n 
3 503 SER n 
3 504 ALA n 
3 505 ALA n 
3 506 ASP n 
3 507 ILE n 
3 508 ILE n 
3 509 LYS n 
3 510 LYS n 
3 511 ALA n 
3 512 MET n 
3 513 ILE n 
3 514 ASP n 
3 515 LEU n 
3 516 ASN n 
3 517 ALA n 
3 518 ARG n 
3 519 LEU n 
3 520 LYS n 
3 521 GLU n 
3 522 GLU n 
3 523 ARG n 
3 524 LEU n 
3 525 GLN n 
3 526 ALA n 
3 527 HIS n 
3 528 LEU n 
3 529 LEU n 
3 530 LEU n 
3 531 GLN n 
3 532 VAL n 
3 533 HIS n 
3 534 ASP n 
3 535 GLU n 
3 536 LEU n 
3 537 ILE n 
3 538 LEU n 
3 539 GLU n 
3 540 ALA n 
3 541 PRO n 
3 542 LYS n 
3 543 GLU n 
3 544 GLU n 
3 545 MET n 
3 546 GLU n 
3 547 ARG n 
3 548 LEU n 
3 549 CYS n 
3 550 ARG n 
3 551 LEU n 
3 552 VAL n 
3 553 PRO n 
3 554 GLU n 
3 555 VAL n 
3 556 MET n 
3 557 GLU n 
3 558 GLN n 
3 559 ALA n 
3 560 VAL n 
3 561 THR n 
3 562 LEU n 
3 563 ARG n 
3 564 VAL n 
3 565 PRO n 
3 566 LEU n 
3 567 LYS n 
3 568 VAL n 
3 569 ASP n 
3 570 TYR n 
3 571 HIS n 
3 572 TYR n 
3 573 GLY n 
3 574 SER n 
3 575 THR n 
3 576 TRP n 
3 577 TYR n 
3 578 ASP n 
3 579 ALA n 
3 580 LYS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Geobacillus 
_entity_src_gen.pdbx_gene_src_gene                 polA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Geobacillus stearothermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PUC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? ? ? ? 'chemically synthesized' 
2 1 sample ? ? ? ? ? 'chemically synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP Q5KWC1_GEOKA Q5KWC1 3 300 ? ? 
2 PDB 2HHQ         2HHQ   1 ?   ? ? 
3 PDB 2HHQ         2HHQ   2 ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2HHQ A 2 ? 580 ? Q5KWC1 300 ? 878 ? 298 876 
2 2 2HHQ B 1 ? 13  ? 2HHQ   22  ? 34  ? 22  34  
3 3 2HHQ C 1 ? 15  ? 2HHQ   3   ? 17  ? 3   17  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
6OG 'DNA linking'       n 
;6-O-METHYL GUANOSINE-5'-MONOPHOSPHATE
;
? 'C11 H16 N5 O7 P' 361.248 
ALA 'L-peptide linking' y ALANINE                                 ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                              ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                         ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"    ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"     ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"    ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"            ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                               ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                         ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                 ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                               ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                   ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                              ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                 ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                  ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                              ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                         ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                           ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                 ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                  ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                           ? 'O4 S -2'         96.063  
SUC saccharide          . SUCROSE                                 ? 'C12 H22 O11'     342.296 
THR 'L-peptide linking' y THREONINE                               ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                              ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                  ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2HHQ 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.86 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   56.95 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'45% saturated ammonium sulfate, 2.5% MPD, 100mM MES, pH 5.8, VAPOR DIFFUSION, HANGING DROP, temperature 290K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 'ammonium sulfate' ? ? ? 
1 2 1 MPD                ? ? ? 
1 3 1 MES                ? ? ? 
1 4 1 H2O                ? ? ? 
1 5 2 'ammonium sulfate' ? ? ? 
1 6 2 MPD                ? ? ? 
1 7 2 H2O                ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2005-03-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si 111' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
# 
_reflns.entry_id                     2HHQ 
_reflns.d_resolution_high            1.540 
_reflns.number_obs                   122488 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_netI_over_sigmaI        13.8 
_reflns.percent_possible_obs         96.100 
_reflns.B_iso_Wilson_estimate        23.310 
_reflns.observed_criterion_sigma_F   -3 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_low             50 
_reflns.number_all                   122488 
_reflns.pdbx_Rsym_value              0.096 
_reflns.pdbx_redundancy              7.1 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.54 
_reflns_shell.d_res_low              1.68 
_reflns_shell.number_measured_obs    177261 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    2.7 
_reflns_shell.pdbx_Rsym_value        0.755 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_redundancy        6.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      26672 
_reflns_shell.percent_possible_all   92.00 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2HHQ 
_refine.ls_d_res_high                            1.800 
_refine.ls_d_res_low                             50.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    100.000 
_refine.ls_number_reflns_obs                     80300 
_refine.ls_R_factor_R_work                       0.212 
_refine.ls_R_factor_R_free                       0.244 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  4090 
_refine.B_iso_mean                               25.417 
_refine.solvent_model_param_bsol                 41.937 
_refine.aniso_B[1][1]                            -11.392 
_refine.aniso_B[2][2]                            4.332 
_refine.aniso_B[3][3]                            7.060 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     80300 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2HHQ 
_refine_analyze.Luzzati_coordinate_error_obs    0.23 
_refine_analyze.Luzzati_sigma_a_obs             0.22 
_refine_analyze.Luzzati_d_res_low_obs           5 
_refine_analyze.Luzzati_coordinate_error_free   0.27 
_refine_analyze.Luzzati_sigma_a_free            0.26 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4650 
_refine_hist.pdbx_number_atoms_nucleic_acid   572 
_refine_hist.pdbx_number_atoms_ligand         85 
_refine_hist.number_atoms_solvent             537 
_refine_hist.number_atoms_total               5844 
_refine_hist.d_res_high                       1.800 
_refine_hist.d_res_low                        50.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           ? 0.005 ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d          ? 1.155 ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d ? 22.5  ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d ? 0.970 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.8 
_refine_ls_shell.d_res_low                        1.86 
_refine_ls_shell.number_reflns_obs                7944 
_refine_ls_shell.number_reflns_R_free             413 
_refine_ls_shell.R_factor_R_work                  0.2775 
_refine_ls_shell.R_factor_R_free                  0.3257 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_obs               100 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 CNS_TOPPAR:protein_rep.param             ? 'X-RAY DIFFRACTION' 
2 CNS_TOPPAR:water_rep.param               ? 'X-RAY DIFFRACTION' 
3 CNS_TOPPAR:dna-rna-multi-endo-new2.param ? 'X-RAY DIFFRACTION' 
4 CNS_TOPPAR:ion.param                     ? 'X-RAY DIFFRACTION' 
5 CNS_TOPPAR:sucrose.par                   ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2HHQ 
_struct.title                     'O6-methyl-guanine:T pair in the polymerase-10 basepair position' 
_struct.pdbx_descriptor           'PROTEIN/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HHQ 
_struct_keywords.pdbx_keywords   Transferase/DNA 
_struct_keywords.text            
'DNA polymerase I, DNA replication, Klenow fragment, Protein-DNA complex, O6-methyl-guanine, Transferase-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 7 ? 
M N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The asymmetric unit contains one biological assembly' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR C 12  ? ALA C 17  ? THR A 308 ALA A 313 5 ? 6  
HELX_P HELX_P2  2  ARG C 51  ? LEU C 56  ? ARG A 347 LEU A 352 1 ? 6  
HELX_P HELX_P3  3  ASP C 58  ? ASP C 67  ? ASP A 354 ASP A 363 1 ? 10 
HELX_P HELX_P4  4  ASP C 76  ? TRP C 86  ? ASP A 372 TRP A 382 1 ? 11 
HELX_P HELX_P5  5  LEU C 98  ? ASP C 106 ? LEU A 394 ASP A 402 1 ? 9  
HELX_P HELX_P6  6  PRO C 107 ? GLY C 110 ? PRO A 403 GLY A 406 5 ? 4  
HELX_P HELX_P7  7  ASP C 113 ? MET C 120 ? ASP A 409 MET A 416 1 ? 8  
HELX_P HELX_P8  8  PRO C 128 ? GLY C 134 ? PRO A 424 GLY A 430 1 ? 7  
HELX_P HELX_P9  9  LYS C 135 ? ARG C 139 ? LYS A 431 ARG A 435 5 ? 5  
HELX_P HELX_P10 10 ASP C 143 ? ASN C 172 ? ASP A 439 ASN A 468 1 ? 30 
HELX_P HELX_P11 11 GLN C 174 ? LEU C 181 ? GLN A 470 LEU A 477 1 ? 8  
HELX_P HELX_P12 12 LEU C 181 ? GLY C 196 ? LEU A 477 GLY A 492 1 ? 16 
HELX_P HELX_P13 13 ASP C 200 ? GLY C 227 ? ASP A 496 GLY A 523 1 ? 28 
HELX_P HELX_P14 14 SER C 234 ? GLU C 244 ? SER A 530 GLU A 540 1 ? 11 
HELX_P HELX_P15 15 SER C 261 ? ALA C 269 ? SER A 557 ALA A 565 1 ? 9  
HELX_P HELX_P16 16 PRO C 270 ? HIS C 272 ? PRO A 566 HIS A 568 5 ? 3  
HELX_P HELX_P17 17 GLU C 273 ? ILE C 292 ? GLU A 569 ILE A 588 1 ? 20 
HELX_P HELX_P18 18 ILE C 292 ? VAL C 298 ? ILE A 588 VAL A 594 1 ? 7  
HELX_P HELX_P19 19 LEU C 334 ? LYS C 339 ? LEU A 630 LYS A 635 1 ? 6  
HELX_P HELX_P20 20 ILE C 340 ? GLN C 342 ? ILE A 636 GLN A 638 5 ? 3  
HELX_P HELX_P21 21 GLN C 360 ? GLU C 371 ? GLN A 656 GLU A 667 1 ? 12 
HELX_P HELX_P22 22 ASP C 372 ? ARG C 381 ? ASP A 668 ARG A 677 1 ? 10 
HELX_P HELX_P23 23 ASP C 384 ? GLN C 395 ? ASP A 680 GLN A 691 1 ? 12 
HELX_P HELX_P24 24 SER C 397 ? VAL C 401 ? SER A 693 VAL A 697 5 ? 5  
HELX_P HELX_P25 25 THR C 402 ? VAL C 417 ? THR A 698 VAL A 713 1 ? 16 
HELX_P HELX_P26 26 SER C 421 ? ASN C 430 ? SER A 717 ASN A 726 1 ? 10 
HELX_P HELX_P27 27 SER C 432 ? PHE C 447 ? SER A 728 PHE A 743 1 ? 16 
HELX_P HELX_P28 28 PHE C 447 ? GLY C 465 ? PHE A 743 GLY A 761 1 ? 19 
HELX_P HELX_P29 29 PRO C 478 ? SER C 482 ? PRO A 774 SER A 778 5 ? 5  
HELX_P HELX_P30 30 ASN C 484 ? GLU C 522 ? ASN A 780 GLU A 818 1 ? 39 
HELX_P HELX_P31 31 GLU C 544 ? GLN C 558 ? GLU A 840 GLN A 854 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? J MG  .  MG    ? ? ? 1_555 C ASP 534 OD2 ? ? A MG  920 A ASP 830  1_555 ? ? ? ? ? ? ?                2.973 ? 
metalc2  metalc ? ? J MG  .  MG    ? ? ? 1_555 C TYR 358 O   ? ? A MG  920 A TYR 654  1_555 ? ? ? ? ? ? ?                2.806 ? 
metalc3  metalc ? ? J MG  .  MG    ? ? ? 1_555 C ASP 357 OD2 ? ? A MG  920 A ASP 653  1_555 ? ? ? ? ? ? ?                2.601 ? 
metalc4  metalc ? ? J MG  .  MG    ? ? ? 1_555 M HOH .   O   ? ? A MG  920 A HOH 2814 1_555 ? ? ? ? ? ? ?                3.095 ? 
covale1  covale ? ? A DT  3  "O3'" ? ? ? 1_555 A 6OG 4   P   ? ? B DT  24  B 6OG 25   1_555 ? ? ? ? ? ? ?                1.610 ? 
covale2  covale ? ? A 6OG 4  "O3'" ? ? ? 1_555 A DC  5   P   ? ? B 6OG 25  B DC  26   1_555 ? ? ? ? ? ? ?                1.607 ? 
hydrog1  hydrog ? ? A DC  1  N3    ? ? ? 1_555 B DG  14  N2  ? ? B DC  22  C DG  16   1_555 ? ? ? ? ? ? 'DC-DG PAIR'     ?     ? 
hydrog2  hydrog ? ? A DA  2  N1    ? ? ? 1_555 B DA  12  N6  ? ? B DA  23  C DA  14   1_555 ? ? ? ? ? ? 'DA-DA MISPAIR'  ?     ? 
hydrog3  hydrog ? ? A DA  2  N1    ? ? ? 1_555 B DT  13  N3  ? ? B DA  23  C DT  15   1_555 ? ? ? ? ? ? 'DA-DT PAIR'     ?     ? 
hydrog4  hydrog ? ? A DT  3  N3    ? ? ? 1_555 B DA  12  N1  ? ? B DT  24  C DA  14   1_555 ? ? ? ? ? ? 'DT-DA PAIR'     ?     ? 
hydrog5  hydrog ? ? A 6OG 4  N2    ? ? ? 1_555 B DT  11  O2  ? ? B 6OG 25  C DT  13   1_555 ? ? ? ? ? ? '6OG-DT MISPAIR' ?     ? 
hydrog6  hydrog ? ? A DC  5  O2    ? ? ? 1_555 B DG  10  N2  ? ? B DC  26  C DG  12   1_555 ? ? ? ? ? ? 'DC-DG PAIR'     ?     ? 
hydrog7  hydrog ? ? A DG  6  N1    ? ? ? 1_555 B DC  9   N3  ? ? B DG  27  C DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog8  hydrog ? ? A DG  6  N2    ? ? ? 1_555 B DC  9   O2  ? ? B DG  27  C DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog9  hydrog ? ? A DG  6  O6    ? ? ? 1_555 B DC  9   N4  ? ? B DG  27  C DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog10 hydrog ? ? A DA  7  N1    ? ? ? 1_555 B DT  8   N3  ? ? B DA  28  C DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog11 hydrog ? ? A DA  7  N6    ? ? ? 1_555 B DT  8   O4  ? ? B DA  28  C DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog12 hydrog ? ? A DG  8  N1    ? ? ? 1_555 B DC  7   N3  ? ? B DG  29  C DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog13 hydrog ? ? A DG  8  N2    ? ? ? 1_555 B DC  7   O2  ? ? B DG  29  C DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog14 hydrog ? ? A DG  8  O6    ? ? ? 1_555 B DC  7   N4  ? ? B DG  29  C DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog15 hydrog ? ? A DT  9  N3    ? ? ? 1_555 B DA  6   N1  ? ? B DT  30  C DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog16 hydrog ? ? A DT  9  O4    ? ? ? 1_555 B DA  6   N6  ? ? B DT  30  C DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog17 hydrog ? ? A DC  10 N3    ? ? ? 1_555 B DG  5   N1  ? ? B DC  31  C DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog18 hydrog ? ? A DC  10 N4    ? ? ? 1_555 B DG  5   O6  ? ? B DC  31  C DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog19 hydrog ? ? A DC  10 O2    ? ? ? 1_555 B DG  5   N2  ? ? B DC  31  C DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog20 hydrog ? ? A DA  11 N1    ? ? ? 1_555 B DT  4   N3  ? ? B DA  32  C DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog21 hydrog ? ? A DA  11 N6    ? ? ? 1_555 B DT  4   O4  ? ? B DA  32  C DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog22 hydrog ? ? A DG  12 N1    ? ? ? 1_555 B DC  3   N3  ? ? B DG  33  C DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog23 hydrog ? ? A DG  12 N2    ? ? ? 1_555 B DC  3   O2  ? ? B DG  33  C DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog24 hydrog ? ? A DG  12 O6    ? ? ? 1_555 B DC  3   N4  ? ? B DG  33  C DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog25 hydrog ? ? A DG  13 N1    ? ? ? 1_555 B DC  2   N3  ? ? B DG  34  C DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog26 hydrog ? ? A DG  13 N2    ? ? ? 1_555 B DC  2   O2  ? ? B DG  34  C DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog27 hydrog ? ? A DG  13 O6    ? ? ? 1_555 B DC  2   N4  ? ? B DG  34  C DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           324 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            620 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    325 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     621 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.03 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 4 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR C 6   ? ALA C 8   ? THR A 302 ALA A 304 
A 2 GLY C 46  ? LEU C 50  ? GLY A 342 LEU A 346 
A 3 GLY C 38  ? ASN C 43  ? GLY A 334 ASN A 339 
A 4 LYS C 19  ? GLU C 25  ? LYS A 315 GLU A 321 
A 5 LYS C 71  ? MET C 74  ? LYS A 367 MET A 370 
A 6 VAL C 94  ? ASP C 97  ? VAL A 390 ASP A 393 
B 1 LYS C 305 ? VAL C 306 ? LYS A 601 VAL A 602 
B 2 VAL C 197 ? VAL C 199 ? VAL A 493 VAL A 495 
B 3 PHE C 344 ? VAL C 345 ? PHE A 640 VAL A 641 
C 1 ILE C 309 ? ASN C 311 ? ILE A 605 ASN A 607 
C 2 SER C 321 ? THR C 323 ? SER A 617 THR A 619 
D 1 HIS C 527 ? GLN C 531 ? HIS A 823 GLN A 827 
D 2 GLU C 535 ? PRO C 541 ? GLU A 831 PRO A 837 
D 3 TRP C 351 ? TYR C 358 ? TRP A 647 TYR A 654 
D 4 VAL C 568 ? GLY C 573 ? VAL A 864 GLY A 869 
E 1 TYR C 466 ? THR C 468 ? TYR A 762 THR A 764 
E 2 ARG C 474 ? TYR C 476 ? ARG A 770 TYR A 772 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR C 6   ? N THR A 302 O PHE C 49  ? O PHE A 345 
A 2 3 O PHE C 48  ? O PHE A 344 N VAL C 41  ? N VAL A 337 
A 3 4 O VAL C 42  ? O VAL A 338 N ALA C 21  ? N ALA A 317 
A 4 5 N LEU C 22  ? N LEU A 318 O SER C 73  ? O SER A 369 
A 5 6 N MET C 74  ? N MET A 370 O PHE C 96  ? O PHE A 392 
B 1 2 O VAL C 306 ? O VAL A 602 N VAL C 197 ? N VAL A 493 
B 2 3 N LYS C 198 ? N LYS A 494 O VAL C 345 ? O VAL A 641 
C 1 2 N ASN C 311 ? N ASN A 607 O SER C 321 ? O SER A 617 
D 1 2 N LEU C 529 ? N LEU A 825 O ILE C 537 ? O ILE A 833 
D 2 3 O LEU C 538 ? O LEU A 834 N PHE C 354 ? N PHE A 650 
D 3 4 N ALA C 355 ? N ALA A 651 O HIS C 571 ? O HIS A 867 
E 1 2 N VAL C 467 ? N VAL A 763 O ARG C 475 ? O ARG A 771 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE SUC A 901' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE SUC A 902' 
AC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE SUC A 903' 
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 904' 
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 905' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 906' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 920'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 16 GLU C 29  ? GLU A 325  . ? 1_555 ? 
2  AC1 16 TYR C 31  ? TYR A 327  . ? 1_555 ? 
3  AC1 16 ASP C 76  ? ASP A 372  . ? 1_555 ? 
4  AC1 16 ARG C 79  ? ARG A 375  . ? 1_555 ? 
5  AC1 16 LEU C 99  ? LEU A 395  . ? 1_555 ? 
6  AC1 16 ASP C 112 ? ASP A 408  . ? 1_555 ? 
7  AC1 16 ILE C 309 ? ILE A 605  . ? 1_555 ? 
8  AC1 16 ASN C 311 ? ASN A 607  . ? 1_555 ? 
9  AC1 16 HOH M .   ? HOH A 1031 . ? 1_555 ? 
10 AC1 16 HOH M .   ? HOH A 1045 . ? 1_555 ? 
11 AC1 16 HOH M .   ? HOH A 2121 . ? 1_555 ? 
12 AC1 16 HOH M .   ? HOH A 2355 . ? 1_555 ? 
13 AC1 16 HOH M .   ? HOH A 3442 . ? 1_555 ? 
14 AC1 16 HOH M .   ? HOH A 3525 . ? 1_555 ? 
15 AC1 16 HOH M .   ? HOH A 3569 . ? 1_555 ? 
16 AC1 16 HOH M .   ? HOH A 3673 . ? 1_555 ? 
17 AC2 11 TYR C 223 ? TYR A 519  . ? 1_555 ? 
18 AC2 11 PHE C 230 ? PHE A 526  . ? 1_555 ? 
19 AC2 11 ASN C 231 ? ASN A 527  . ? 1_555 ? 
20 AC2 11 ILE C 232 ? ILE A 528  . ? 1_555 ? 
21 AC2 11 ASN C 233 ? ASN A 529  . ? 1_555 ? 
22 AC2 11 TYR C 281 ? TYR A 577  . ? 1_555 ? 
23 AC2 11 HOH M .   ? HOH A 3488 . ? 1_555 ? 
24 AC2 11 HOH M .   ? HOH A 3631 . ? 1_555 ? 
25 AC2 11 DT  B 8   ? DT  C 10   . ? 1_555 ? 
26 AC2 11 DC  B 9   ? DC  C 11   . ? 1_555 ? 
27 AC2 11 HOH L .   ? HOH C 3287 . ? 1_555 ? 
28 AC3 13 GLU C 244 ? GLU A 540  . ? 4_456 ? 
29 AC3 13 GLN C 247 ? GLN A 543  . ? 4_456 ? 
30 AC3 13 TYR C 258 ? TYR A 554  . ? 4_456 ? 
31 AC3 13 GLU C 455 ? GLU A 751  . ? 1_555 ? 
32 AC3 13 LYS C 462 ? LYS A 758  . ? 1_555 ? 
33 AC3 13 ARG C 488 ? ARG A 784  . ? 1_555 ? 
34 AC3 13 GLU C 492 ? GLU A 788  . ? 1_555 ? 
35 AC3 13 HOH M .   ? HOH A 3094 . ? 1_555 ? 
36 AC3 13 HOH M .   ? HOH A 3410 . ? 1_555 ? 
37 AC3 13 HOH M .   ? HOH A 3425 . ? 1_555 ? 
38 AC3 13 HOH M .   ? HOH A 3444 . ? 1_555 ? 
39 AC3 13 HOH M .   ? HOH A 3550 . ? 1_555 ? 
40 AC3 13 HOH M .   ? HOH A 3611 . ? 1_555 ? 
41 AC4 5  MET C 3   ? MET A 299  . ? 1_555 ? 
42 AC4 5  ALA C 4   ? ALA A 300  . ? 1_555 ? 
43 AC4 5  ARG C 47  ? ARG A 343  . ? 1_555 ? 
44 AC4 5  ARG C 381 ? ARG A 677  . ? 3_545 ? 
45 AC4 5  HOH M .   ? HOH A 3430 . ? 3_545 ? 
46 AC5 3  HIS C 386 ? HIS A 682  . ? 1_555 ? 
47 AC5 3  ARG C 406 ? ARG A 702  . ? 1_555 ? 
48 AC5 3  LYS C 410 ? LYS A 706  . ? 1_555 ? 
49 AC6 4  HIS C 272 ? HIS A 568  . ? 2_564 ? 
50 AC6 4  ARG C 483 ? ARG A 779  . ? 3_555 ? 
51 AC6 4  ARG C 523 ? ARG A 819  . ? 1_555 ? 
52 AC6 4  HOH M .   ? HOH A 3139 . ? 1_555 ? 
53 AC7 4  ASP C 357 ? ASP A 653  . ? 1_555 ? 
54 AC7 4  TYR C 358 ? TYR A 654  . ? 1_555 ? 
55 AC7 4  ASP C 534 ? ASP A 830  . ? 1_555 ? 
56 AC7 4  HOH M .   ? HOH A 2814 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2HHQ 
_atom_sites.fract_transf_matrix[1][1]   0.011522 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010721 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009432 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DC  A 1 1   ? 50.053  20.573 20.863  1.00 83.71 ? 22   DC  B "O5'" 1 
ATOM   2    C  "C5'" . DC  A 1 1   ? 48.911  21.435 20.849  1.00 83.66 ? 22   DC  B "C5'" 1 
ATOM   3    C  "C4'" . DC  A 1 1   ? 47.776  20.858 20.035  1.00 83.81 ? 22   DC  B "C4'" 1 
ATOM   4    O  "O4'" . DC  A 1 1   ? 47.325  19.627 20.650  1.00 83.71 ? 22   DC  B "O4'" 1 
ATOM   5    C  "C3'" . DC  A 1 1   ? 46.544  21.759 19.927  1.00 83.89 ? 22   DC  B "C3'" 1 
ATOM   6    O  "O3'" . DC  A 1 1   ? 45.976  21.669 18.614  1.00 84.45 ? 22   DC  B "O3'" 1 
ATOM   7    C  "C2'" . DC  A 1 1   ? 45.584  21.180 20.952  1.00 83.38 ? 22   DC  B "C2'" 1 
ATOM   8    C  "C1'" . DC  A 1 1   ? 45.941  19.702 20.964  1.00 83.06 ? 22   DC  B "C1'" 1 
ATOM   9    N  N1    . DC  A 1 1   ? 45.735  19.039 22.268  1.00 82.49 ? 22   DC  B N1    1 
ATOM   10   C  C2    . DC  A 1 1   ? 44.829  17.967 22.352  1.00 82.14 ? 22   DC  B C2    1 
ATOM   11   O  O2    . DC  A 1 1   ? 44.226  17.597 21.328  1.00 81.73 ? 22   DC  B O2    1 
ATOM   12   N  N3    . DC  A 1 1   ? 44.634  17.362 23.548  1.00 81.84 ? 22   DC  B N3    1 
ATOM   13   C  C4    . DC  A 1 1   ? 45.299  17.784 24.628  1.00 81.58 ? 22   DC  B C4    1 
ATOM   14   N  N4    . DC  A 1 1   ? 45.073  17.159 25.786  1.00 81.28 ? 22   DC  B N4    1 
ATOM   15   C  C5    . DC  A 1 1   ? 46.224  18.867 24.570  1.00 81.59 ? 22   DC  B C5    1 
ATOM   16   C  C6    . DC  A 1 1   ? 46.410  19.459 23.383  1.00 82.13 ? 22   DC  B C6    1 
ATOM   17   P  P     . DA  A 1 2   ? 45.101  22.890 18.033  1.00 85.09 ? 23   DA  B P     1 
ATOM   18   O  OP1   . DA  A 1 2   ? 45.458  23.061 16.599  1.00 84.72 ? 23   DA  B OP1   1 
ATOM   19   O  OP2   . DA  A 1 2   ? 45.233  24.046 18.962  1.00 84.77 ? 23   DA  B OP2   1 
ATOM   20   O  "O5'" . DA  A 1 2   ? 43.599  22.357 18.121  1.00 84.31 ? 23   DA  B "O5'" 1 
ATOM   21   C  "C5'" . DA  A 1 2   ? 43.012  21.611 17.035  1.00 82.93 ? 23   DA  B "C5'" 1 
ATOM   22   C  "C4'" . DA  A 1 2   ? 41.694  21.001 17.457  1.00 82.15 ? 23   DA  B "C4'" 1 
ATOM   23   O  "O4'" . DA  A 1 2   ? 41.906  19.980 18.457  1.00 81.74 ? 23   DA  B "O4'" 1 
ATOM   24   C  "C3'" . DA  A 1 2   ? 40.680  21.959 18.072  1.00 81.92 ? 23   DA  B "C3'" 1 
ATOM   25   O  "O3'" . DA  A 1 2   ? 39.919  22.605 17.040  1.00 82.10 ? 23   DA  B "O3'" 1 
ATOM   26   C  "C2'" . DA  A 1 2   ? 39.821  21.034 18.916  1.00 81.30 ? 23   DA  B "C2'" 1 
ATOM   27   C  "C1'" . DA  A 1 2   ? 40.795  19.940 19.352  1.00 81.12 ? 23   DA  B "C1'" 1 
ATOM   28   N  N9    . DA  A 1 2   ? 41.307  20.078 20.717  1.00 80.39 ? 23   DA  B N9    1 
ATOM   29   C  C8    . DA  A 1 2   ? 42.147  21.043 21.219  1.00 79.86 ? 23   DA  B C8    1 
ATOM   30   N  N7    . DA  A 1 2   ? 42.429  20.890 22.490  1.00 79.48 ? 23   DA  B N7    1 
ATOM   31   C  C5    . DA  A 1 2   ? 41.727  19.748 22.851  1.00 79.55 ? 23   DA  B C5    1 
ATOM   32   C  C6    . DA  A 1 2   ? 41.612  19.056 24.069  1.00 79.74 ? 23   DA  B C6    1 
ATOM   33   N  N6    . DA  A 1 2   ? 42.227  19.429 25.194  1.00 80.01 ? 23   DA  B N6    1 
ATOM   34   N  N1    . DA  A 1 2   ? 40.832  17.952 24.093  1.00 79.67 ? 23   DA  B N1    1 
ATOM   35   C  C2    . DA  A 1 2   ? 40.216  17.579 22.964  1.00 79.46 ? 23   DA  B C2    1 
ATOM   36   N  N3    . DA  A 1 2   ? 40.247  18.145 21.760  1.00 79.53 ? 23   DA  B N3    1 
ATOM   37   C  C4    . DA  A 1 2   ? 41.030  19.238 21.770  1.00 79.86 ? 23   DA  B C4    1 
ATOM   38   P  P     . DT  A 1 3   ? 38.889  23.786 17.417  1.00 82.56 ? 24   DT  B P     1 
ATOM   39   O  OP1   . DT  A 1 3   ? 38.456  24.444 16.156  1.00 81.82 ? 24   DT  B OP1   1 
ATOM   40   O  OP2   . DT  A 1 3   ? 39.501  24.604 18.500  1.00 82.30 ? 24   DT  B OP2   1 
ATOM   41   O  "O5'" . DT  A 1 3   ? 37.636  23.014 18.031  1.00 81.42 ? 24   DT  B "O5'" 1 
ATOM   42   C  "C5'" . DT  A 1 3   ? 37.039  21.910 17.326  1.00 79.63 ? 24   DT  B "C5'" 1 
ATOM   43   C  "C4'" . DT  A 1 3   ? 35.955  21.266 18.160  1.00 78.42 ? 24   DT  B "C4'" 1 
ATOM   44   O  "O4'" . DT  A 1 3   ? 36.527  20.656 19.345  1.00 78.06 ? 24   DT  B "O4'" 1 
ATOM   45   C  "C3'" . DT  A 1 3   ? 34.846  22.200 18.650  1.00 77.69 ? 24   DT  B "C3'" 1 
ATOM   46   O  "O3'" . DT  A 1 3   ? 33.578  21.536 18.531  1.00 77.07 ? 24   DT  B "O3'" 1 
ATOM   47   C  "C2'" . DT  A 1 3   ? 35.195  22.434 20.110  1.00 77.24 ? 24   DT  B "C2'" 1 
ATOM   48   C  "C1'" . DT  A 1 3   ? 35.861  21.126 20.508  1.00 77.15 ? 24   DT  B "C1'" 1 
ATOM   49   N  N1    . DT  A 1 3   ? 36.856  21.223 21.605  1.00 76.58 ? 24   DT  B N1    1 
ATOM   50   C  C2    . DT  A 1 3   ? 36.897  20.201 22.534  1.00 76.15 ? 24   DT  B C2    1 
ATOM   51   O  O2    . DT  A 1 3   ? 36.164  19.223 22.492  1.00 76.34 ? 24   DT  B O2    1 
ATOM   52   N  N3    . DT  A 1 3   ? 37.835  20.365 23.524  1.00 75.68 ? 24   DT  B N3    1 
ATOM   53   C  C4    . DT  A 1 3   ? 38.715  21.420 23.678  1.00 75.78 ? 24   DT  B C4    1 
ATOM   54   O  O4    . DT  A 1 3   ? 39.501  21.426 24.625  1.00 75.66 ? 24   DT  B O4    1 
ATOM   55   C  C5    . DT  A 1 3   ? 38.620  22.455 22.669  1.00 75.61 ? 24   DT  B C5    1 
ATOM   56   C  C7    . DT  A 1 3   ? 39.532  23.639 22.749  1.00 75.05 ? 24   DT  B C7    1 
ATOM   57   C  C6    . DT  A 1 3   ? 37.710  22.305 21.698  1.00 75.85 ? 24   DT  B C6    1 
HETATM 58   P  P     . 6OG A 1 4   ? 32.248  22.218 19.129  1.00 76.60 ? 25   6OG B P     1 
HETATM 59   O  OP1   . 6OG A 1 4   ? 31.091  21.763 18.314  1.00 76.75 ? 25   6OG B OP1   1 
HETATM 60   O  OP2   . 6OG A 1 4   ? 32.494  23.676 19.305  1.00 76.30 ? 25   6OG B OP2   1 
HETATM 61   O  "O5'" . 6OG A 1 4   ? 32.119  21.557 20.572  1.00 74.98 ? 25   6OG B "O5'" 1 
HETATM 62   N  N9    . 6OG A 1 4   ? 33.679  21.426 24.445  1.00 63.99 ? 25   6OG B N9    1 
HETATM 63   C  C4    . 6OG A 1 4   ? 34.446  21.202 25.565  1.00 61.65 ? 25   6OG B C4    1 
HETATM 64   N  N3    . 6OG A 1 4   ? 34.188  20.297 26.533  1.00 59.99 ? 25   6OG B N3    1 
HETATM 65   C  C2    . 6OG A 1 4   ? 35.107  20.313 27.482  1.00 59.21 ? 25   6OG B C2    1 
HETATM 66   N  N2    . 6OG A 1 4   ? 34.999  19.478 28.524  1.00 57.74 ? 25   6OG B N2    1 
HETATM 67   N  N1    . 6OG A 1 4   ? 36.197  21.148 27.481  1.00 58.94 ? 25   6OG B N1    1 
HETATM 68   C  C6    . 6OG A 1 4   ? 36.488  22.090 26.493  1.00 60.17 ? 25   6OG B C6    1 
HETATM 69   O  O6    . 6OG A 1 4   ? 37.511  22.810 26.574  1.00 59.57 ? 25   6OG B O6    1 
HETATM 70   C  C5    . 6OG A 1 4   ? 35.502  22.084 25.468  1.00 61.05 ? 25   6OG B C5    1 
HETATM 71   N  N7    . 6OG A 1 4   ? 35.401  22.850 24.314  1.00 62.13 ? 25   6OG B N7    1 
HETATM 72   C  C8    . 6OG A 1 4   ? 34.307  22.427 23.739  1.00 63.49 ? 25   6OG B C8    1 
HETATM 73   C  "C2'" . 6OG A 1 4   ? 31.293  21.614 23.652  1.00 67.30 ? 25   6OG B "C2'" 1 
HETATM 74   C  "C5'" . 6OG A 1 4   ? 31.946  20.133 20.712  1.00 71.99 ? 25   6OG B "C5'" 1 
HETATM 75   C  "C4'" . 6OG A 1 4   ? 31.567  19.784 22.133  1.00 69.48 ? 25   6OG B "C4'" 1 
HETATM 76   O  "O4'" . 6OG A 1 4   ? 32.720  19.864 23.004  1.00 68.29 ? 25   6OG B "O4'" 1 
HETATM 77   C  "C1'" . 6OG A 1 4   ? 32.444  20.726 24.097  1.00 66.33 ? 25   6OG B "C1'" 1 
HETATM 78   C  "C3'" . 6OG A 1 4   ? 30.498  20.688 22.748  1.00 68.49 ? 25   6OG B "C3'" 1 
HETATM 79   O  "O3'" . 6OG A 1 4   ? 29.603  19.904 23.536  1.00 68.15 ? 25   6OG B "O3'" 1 
HETATM 80   C  C     . 6OG A 1 4   ? 38.398  22.631 27.694  1.00 59.08 ? 25   6OG B C     1 
ATOM   81   P  P     . DC  A 1 5   ? 28.165  20.496 23.941  1.00 68.73 ? 26   DC  B P     1 
ATOM   82   O  OP1   . DC  A 1 5   ? 27.125  19.682 23.255  1.00 67.90 ? 26   DC  B OP1   1 
ATOM   83   O  OP2   . DC  A 1 5   ? 28.184  21.973 23.757  1.00 67.89 ? 26   DC  B OP2   1 
ATOM   84   O  "O5'" . DC  A 1 5   ? 28.079  20.201 25.502  1.00 66.59 ? 26   DC  B "O5'" 1 
ATOM   85   C  "C5'" . DC  A 1 5   ? 28.203  18.858 25.999  1.00 64.02 ? 26   DC  B "C5'" 1 
ATOM   86   C  "C4'" . DC  A 1 5   ? 28.791  18.863 27.391  1.00 61.40 ? 26   DC  B "C4'" 1 
ATOM   87   O  "O4'" . DC  A 1 5   ? 30.188  19.228 27.369  1.00 60.02 ? 26   DC  B "O4'" 1 
ATOM   88   C  "C3'" . DC  A 1 5   ? 28.144  19.840 28.363  1.00 59.98 ? 26   DC  B "C3'" 1 
ATOM   89   O  "O3'" . DC  A 1 5   ? 26.971  19.246 28.929  1.00 59.75 ? 26   DC  B "O3'" 1 
ATOM   90   C  "C2'" . DC  A 1 5   ? 29.236  20.050 29.396  1.00 59.33 ? 26   DC  B "C2'" 1 
ATOM   91   C  "C1'" . DC  A 1 5   ? 30.529  19.859 28.603  1.00 57.95 ? 26   DC  B "C1'" 1 
ATOM   92   N  N1    . DC  A 1 5   ? 31.304  21.083 28.311  1.00 55.84 ? 26   DC  B N1    1 
ATOM   93   C  C2    . DC  A 1 5   ? 32.337  21.448 29.191  1.00 54.69 ? 26   DC  B C2    1 
ATOM   94   O  O2    . DC  A 1 5   ? 32.555  20.744 30.192  1.00 54.17 ? 26   DC  B O2    1 
ATOM   95   N  N3    . DC  A 1 5   ? 33.070  22.555 28.930  1.00 52.86 ? 26   DC  B N3    1 
ATOM   96   C  C4    . DC  A 1 5   ? 32.805  23.291 27.849  1.00 52.85 ? 26   DC  B C4    1 
ATOM   97   N  N4    . DC  A 1 5   ? 33.562  24.369 27.629  1.00 51.32 ? 26   DC  B N4    1 
ATOM   98   C  C5    . DC  A 1 5   ? 31.754  22.953 26.945  1.00 53.21 ? 26   DC  B C5    1 
ATOM   99   C  C6    . DC  A 1 5   ? 31.036  21.851 27.211  1.00 54.43 ? 26   DC  B C6    1 
ATOM   100  P  P     . DG  A 1 6   ? 26.002  20.123 29.862  1.00 59.89 ? 27   DG  B P     1 
ATOM   101  O  OP1   . DG  A 1 6   ? 24.734  19.370 30.051  1.00 59.86 ? 27   DG  B OP1   1 
ATOM   102  O  OP2   . DG  A 1 6   ? 25.961  21.509 29.317  1.00 59.59 ? 27   DG  B OP2   1 
ATOM   103  O  "O5'" . DG  A 1 6   ? 26.771  20.167 31.255  1.00 57.21 ? 27   DG  B "O5'" 1 
ATOM   104  C  "C5'" . DG  A 1 6   ? 27.310  18.965 31.835  1.00 53.03 ? 27   DG  B "C5'" 1 
ATOM   105  C  "C4'" . DG  A 1 6   ? 28.031  19.285 33.123  1.00 49.91 ? 27   DG  B "C4'" 1 
ATOM   106  O  "O4'" . DG  A 1 6   ? 29.215  20.071 32.840  1.00 47.89 ? 27   DG  B "O4'" 1 
ATOM   107  C  "C3'" . DG  A 1 6   ? 27.204  20.100 34.115  1.00 48.31 ? 27   DG  B "C3'" 1 
ATOM   108  O  "O3'" . DG  A 1 6   ? 27.428  19.614 35.439  1.00 48.26 ? 27   DG  B "O3'" 1 
ATOM   109  C  "C2'" . DG  A 1 6   ? 27.724  21.517 33.942  1.00 46.68 ? 27   DG  B "C2'" 1 
ATOM   110  C  "C1'" . DG  A 1 6   ? 29.174  21.311 33.535  1.00 44.49 ? 27   DG  B "C1'" 1 
ATOM   111  N  N9    . DG  A 1 6   ? 29.700  22.338 32.636  1.00 41.22 ? 27   DG  B N9    1 
ATOM   112  C  C8    . DG  A 1 6   ? 29.132  22.783 31.464  1.00 39.61 ? 27   DG  B C8    1 
ATOM   113  N  N7    . DG  A 1 6   ? 29.844  23.697 30.864  1.00 38.63 ? 27   DG  B N7    1 
ATOM   114  C  C5    . DG  A 1 6   ? 30.947  23.872 31.689  1.00 37.28 ? 27   DG  B C5    1 
ATOM   115  C  C6    . DG  A 1 6   ? 32.070  24.729 31.550  1.00 35.62 ? 27   DG  B C6    1 
ATOM   116  O  O6    . DG  A 1 6   ? 32.326  25.523 30.638  1.00 34.85 ? 27   DG  B O6    1 
ATOM   117  N  N1    . DG  A 1 6   ? 32.952  24.592 32.616  1.00 35.38 ? 27   DG  B N1    1 
ATOM   118  C  C2    . DG  A 1 6   ? 32.782  23.739 33.678  1.00 35.64 ? 27   DG  B C2    1 
ATOM   119  N  N2    . DG  A 1 6   ? 33.748  23.757 34.610  1.00 35.60 ? 27   DG  B N2    1 
ATOM   120  N  N3    . DG  A 1 6   ? 31.743  22.929 33.817  1.00 36.61 ? 27   DG  B N3    1 
ATOM   121  C  C4    . DG  A 1 6   ? 30.871  23.047 32.792  1.00 37.94 ? 27   DG  B C4    1 
ATOM   122  P  P     . DA  A 1 7   ? 26.692  20.314 36.684  1.00 48.51 ? 28   DA  B P     1 
ATOM   123  O  OP1   . DA  A 1 7   ? 26.467  19.279 37.726  1.00 48.18 ? 28   DA  B OP1   1 
ATOM   124  O  OP2   . DA  A 1 7   ? 25.537  21.105 36.170  1.00 47.75 ? 28   DA  B OP2   1 
ATOM   125  O  "O5'" . DA  A 1 7   ? 27.799  21.326 37.217  1.00 46.04 ? 28   DA  B "O5'" 1 
ATOM   126  C  "C5'" . DA  A 1 7   ? 29.102  20.843 37.601  1.00 41.64 ? 28   DA  B "C5'" 1 
ATOM   127  C  "C4'" . DA  A 1 7   ? 29.907  21.948 38.243  1.00 37.38 ? 28   DA  B "C4'" 1 
ATOM   128  O  "O4'" . DA  A 1 7   ? 30.473  22.827 37.241  1.00 35.56 ? 28   DA  B "O4'" 1 
ATOM   129  C  "C3'" . DA  A 1 7   ? 29.113  22.834 39.199  1.00 36.28 ? 28   DA  B "C3'" 1 
ATOM   130  O  "O3'" . DA  A 1 7   ? 29.885  23.089 40.373  1.00 34.53 ? 28   DA  B "O3'" 1 
ATOM   131  C  "C2'" . DA  A 1 7   ? 28.875  24.104 38.398  1.00 34.00 ? 28   DA  B "C2'" 1 
ATOM   132  C  "C1'" . DA  A 1 7   ? 30.094  24.174 37.488  1.00 33.37 ? 28   DA  B "C1'" 1 
ATOM   133  N  N9    . DA  A 1 7   ? 29.855  24.816 36.192  1.00 30.50 ? 28   DA  B N9    1 
ATOM   134  C  C8    . DA  A 1 7   ? 28.798  24.619 35.335  1.00 28.75 ? 28   DA  B C8    1 
ATOM   135  N  N7    . DA  A 1 7   ? 28.863  25.338 34.241  1.00 28.78 ? 28   DA  B N7    1 
ATOM   136  C  C5    . DA  A 1 7   ? 30.042  26.058 34.383  1.00 27.65 ? 28   DA  B C5    1 
ATOM   137  C  C6    . DA  A 1 7   ? 30.679  27.002 33.556  1.00 25.28 ? 28   DA  B C6    1 
ATOM   138  N  N6    . DA  A 1 7   ? 30.195  27.398 32.378  1.00 24.95 ? 28   DA  B N6    1 
ATOM   139  N  N1    . DA  A 1 7   ? 31.844  27.532 33.988  1.00 26.09 ? 28   DA  B N1    1 
ATOM   140  C  C2    . DA  A 1 7   ? 32.326  27.136 35.173  1.00 26.66 ? 28   DA  B C2    1 
ATOM   141  N  N3    . DA  A 1 7   ? 31.819  26.259 36.040  1.00 27.93 ? 28   DA  B N3    1 
ATOM   142  C  C4    . DA  A 1 7   ? 30.663  25.749 35.580  1.00 28.04 ? 28   DA  B C4    1 
ATOM   143  P  P     . DG  A 1 8   ? 29.229  23.887 41.602  1.00 34.36 ? 29   DG  B P     1 
ATOM   144  O  OP1   . DG  A 1 8   ? 29.840  23.355 42.847  1.00 36.59 ? 29   DG  B OP1   1 
ATOM   145  O  OP2   . DG  A 1 8   ? 27.751  23.910 41.461  1.00 33.50 ? 29   DG  B OP2   1 
ATOM   146  O  "O5'" . DG  A 1 8   ? 29.761  25.368 41.369  1.00 32.02 ? 29   DG  B "O5'" 1 
ATOM   147  C  "C5'" . DG  A 1 8   ? 31.164  25.605 41.172  1.00 29.50 ? 29   DG  B "C5'" 1 
ATOM   148  C  "C4'" . DG  A 1 8   ? 31.421  27.056 40.844  1.00 27.50 ? 29   DG  B "C4'" 1 
ATOM   149  O  "O4'" . DG  A 1 8   ? 31.151  27.352 39.451  1.00 26.96 ? 29   DG  B "O4'" 1 
ATOM   150  C  "C3'" . DG  A 1 8   ? 30.635  28.076 41.667  1.00 26.83 ? 29   DG  B "C3'" 1 
ATOM   151  O  "O3'" . DG  A 1 8   ? 31.522  29.101 42.115  1.00 24.75 ? 29   DG  B "O3'" 1 
ATOM   152  C  "C2'" . DG  A 1 8   ? 29.634  28.645 40.675  1.00 26.23 ? 29   DG  B "C2'" 1 
ATOM   153  C  "C1'" . DG  A 1 8   ? 30.403  28.554 39.368  1.00 25.84 ? 29   DG  B "C1'" 1 
ATOM   154  N  N9    . DG  A 1 8   ? 29.608  28.518 38.141  1.00 24.76 ? 29   DG  B N9    1 
ATOM   155  C  C8    . DG  A 1 8   ? 28.461  27.798 37.898  1.00 22.45 ? 29   DG  B C8    1 
ATOM   156  N  N7    . DG  A 1 8   ? 27.979  27.991 36.699  1.00 22.64 ? 29   DG  B N7    1 
ATOM   157  C  C5    . DG  A 1 8   ? 28.860  28.891 36.113  1.00 22.63 ? 29   DG  B C5    1 
ATOM   158  C  C6    . DG  A 1 8   ? 28.853  29.480 34.819  1.00 21.90 ? 29   DG  B C6    1 
ATOM   159  O  O6    . DG  A 1 8   ? 28.041  29.317 33.900  1.00 20.71 ? 29   DG  B O6    1 
ATOM   160  N  N1    . DG  A 1 8   ? 29.932  30.340 34.643  1.00 21.37 ? 29   DG  B N1    1 
ATOM   161  C  C2    . DG  A 1 8   ? 30.892  30.605 35.587  1.00 21.18 ? 29   DG  B C2    1 
ATOM   162  N  N2    . DG  A 1 8   ? 31.851  31.472 35.228  1.00 21.09 ? 29   DG  B N2    1 
ATOM   163  N  N3    . DG  A 1 8   ? 30.911  30.065 36.794  1.00 21.74 ? 29   DG  B N3    1 
ATOM   164  C  C4    . DG  A 1 8   ? 29.872  29.225 36.988  1.00 22.56 ? 29   DG  B C4    1 
ATOM   165  P  P     . DT  A 1 9   ? 31.020  30.176 43.195  1.00 23.88 ? 30   DT  B P     1 
ATOM   166  O  OP1   . DT  A 1 9   ? 32.163  30.448 44.099  1.00 23.62 ? 30   DT  B OP1   1 
ATOM   167  O  OP2   . DT  A 1 9   ? 29.719  29.750 43.764  1.00 22.52 ? 30   DT  B OP2   1 
ATOM   168  O  "O5'" . DT  A 1 9   ? 30.763  31.478 42.314  1.00 21.75 ? 30   DT  B "O5'" 1 
ATOM   169  C  "C5'" . DT  A 1 9   ? 31.838  32.078 41.570  1.00 21.01 ? 30   DT  B "C5'" 1 
ATOM   170  C  "C4'" . DT  A 1 9   ? 31.294  32.981 40.488  1.00 21.35 ? 30   DT  B "C4'" 1 
ATOM   171  O  "O4'" . DT  A 1 9   ? 30.595  32.228 39.479  1.00 21.40 ? 30   DT  B "O4'" 1 
ATOM   172  C  "C3'" . DT  A 1 9   ? 30.289  34.034 40.941  1.00 21.19 ? 30   DT  B "C3'" 1 
ATOM   173  O  "O3'" . DT  A 1 9   ? 31.001  35.202 41.367  1.00 21.02 ? 30   DT  B "O3'" 1 
ATOM   174  C  "C2'" . DT  A 1 9   ? 29.502  34.323 39.673  1.00 21.52 ? 30   DT  B "C2'" 1 
ATOM   175  C  "C1'" . DT  A 1 9   ? 29.858  33.180 38.728  1.00 20.81 ? 30   DT  B "C1'" 1 
ATOM   176  N  N1    . DT  A 1 9   ? 28.720  32.507 38.076  1.00 19.78 ? 30   DT  B N1    1 
ATOM   177  C  C2    . DT  A 1 9   ? 28.480  32.838 36.758  1.00 18.11 ? 30   DT  B C2    1 
ATOM   178  O  O2    . DT  A 1 9   ? 29.157  33.641 36.135  1.00 19.31 ? 30   DT  B O2    1 
ATOM   179  N  N3    . DT  A 1 9   ? 27.415  32.197 36.191  1.00 18.34 ? 30   DT  B N3    1 
ATOM   180  C  C4    . DT  A 1 9   ? 26.577  31.281 36.786  1.00 21.32 ? 30   DT  B C4    1 
ATOM   181  O  O4    . DT  A 1 9   ? 25.657  30.794 36.135  1.00 21.26 ? 30   DT  B O4    1 
ATOM   182  C  C5    . DT  A 1 9   ? 26.881  30.973 38.173  1.00 21.71 ? 30   DT  B C5    1 
ATOM   183  C  C7    . DT  A 1 9   ? 26.028  29.986 38.906  1.00 20.92 ? 30   DT  B C7    1 
ATOM   184  C  C6    . DT  A 1 9   ? 27.926  31.594 38.741  1.00 20.61 ? 30   DT  B C6    1 
ATOM   185  P  P     . DC  A 1 10  ? 30.193  36.505 41.856  1.00 19.87 ? 31   DC  B P     1 
ATOM   186  O  OP1   . DC  A 1 10  ? 31.195  37.501 42.300  1.00 20.54 ? 31   DC  B OP1   1 
ATOM   187  O  OP2   . DC  A 1 10  ? 29.117  36.079 42.780  1.00 18.80 ? 31   DC  B OP2   1 
ATOM   188  O  "O5'" . DC  A 1 10  ? 29.501  37.057 40.534  1.00 20.81 ? 31   DC  B "O5'" 1 
ATOM   189  C  "C5'" . DC  A 1 10  ? 30.297  37.504 39.422  1.00 20.14 ? 31   DC  B "C5'" 1 
ATOM   190  C  "C4'" . DC  A 1 10  ? 29.416  38.166 38.390  1.00 21.79 ? 31   DC  B "C4'" 1 
ATOM   191  O  "O4'" . DC  A 1 10  ? 28.618  37.181 37.691  1.00 20.74 ? 31   DC  B "O4'" 1 
ATOM   192  C  "C3'" . DC  A 1 10  ? 28.432  39.187 38.963  1.00 20.86 ? 31   DC  B "C3'" 1 
ATOM   193  O  "O3'" . DC  A 1 10  ? 28.315  40.265 38.038  1.00 20.30 ? 31   DC  B "O3'" 1 
ATOM   194  C  "C2'" . DC  A 1 10  ? 27.116  38.432 38.986  1.00 21.82 ? 31   DC  B "C2'" 1 
ATOM   195  C  "C1'" . DC  A 1 10  ? 27.256  37.565 37.748  1.00 20.65 ? 31   DC  B "C1'" 1 
ATOM   196  N  N1    . DC  A 1 10  ? 26.415  36.356 37.650  1.00 20.84 ? 31   DC  B N1    1 
ATOM   197  C  C2    . DC  A 1 10  ? 25.917  35.996 36.384  1.00 20.37 ? 31   DC  B C2    1 
ATOM   198  O  O2    . DC  A 1 10  ? 26.242  36.671 35.389  1.00 20.97 ? 31   DC  B O2    1 
ATOM   199  N  N3    . DC  A 1 10  ? 25.103  34.926 36.274  1.00 20.88 ? 31   DC  B N3    1 
ATOM   200  C  C4    . DC  A 1 10  ? 24.783  34.217 37.356  1.00 20.33 ? 31   DC  B C4    1 
ATOM   201  N  N4    . DC  A 1 10  ? 23.960  33.180 37.193  1.00 20.00 ? 31   DC  B N4    1 
ATOM   202  C  C5    . DC  A 1 10  ? 25.290  34.542 38.652  1.00 20.29 ? 31   DC  B C5    1 
ATOM   203  C  C6    . DC  A 1 10  ? 26.098  35.608 38.751  1.00 20.10 ? 31   DC  B C6    1 
ATOM   204  P  P     . DA  A 1 11  ? 27.924  41.729 38.554  1.00 21.07 ? 32   DA  B P     1 
ATOM   205  O  OP1   . DA  A 1 11  ? 29.153  42.563 38.484  1.00 21.00 ? 32   DA  B OP1   1 
ATOM   206  O  OP2   . DA  A 1 11  ? 27.178  41.626 39.830  1.00 19.20 ? 32   DA  B OP2   1 
ATOM   207  O  "O5'" . DA  A 1 11  ? 26.904  42.235 37.442  1.00 20.73 ? 32   DA  B "O5'" 1 
ATOM   208  C  "C5'" . DA  A 1 11  ? 27.377  42.749 36.189  1.00 20.03 ? 32   DA  B "C5'" 1 
ATOM   209  C  "C4'" . DA  A 1 11  ? 26.324  42.581 35.119  1.00 19.00 ? 32   DA  B "C4'" 1 
ATOM   210  O  "O4'" . DA  A 1 11  ? 26.219  41.202 34.703  1.00 19.16 ? 32   DA  B "O4'" 1 
ATOM   211  C  "C3'" . DA  A 1 11  ? 24.910  42.965 35.529  1.00 19.10 ? 32   DA  B "C3'" 1 
ATOM   212  O  "O3'" . DA  A 1 11  ? 24.706  44.376 35.454  1.00 17.76 ? 32   DA  B "O3'" 1 
ATOM   213  C  "C2'" . DA  A 1 11  ? 24.066  42.204 34.528  1.00 18.97 ? 32   DA  B "C2'" 1 
ATOM   214  C  "C1'" . DA  A 1 11  ? 24.867  40.919 34.333  1.00 19.54 ? 32   DA  B "C1'" 1 
ATOM   215  N  N9    . DA  A 1 11  ? 24.371  39.844 35.193  1.00 19.06 ? 32   DA  B N9    1 
ATOM   216  C  C8    . DA  A 1 11  ? 24.725  39.547 36.488  1.00 19.01 ? 32   DA  B C8    1 
ATOM   217  N  N7    . DA  A 1 11  ? 24.069  38.532 36.993  1.00 19.19 ? 32   DA  B N7    1 
ATOM   218  C  C5    . DA  A 1 11  ? 23.231  38.131 35.962  1.00 18.13 ? 32   DA  B C5    1 
ATOM   219  C  C6    . DA  A 1 11  ? 22.283  37.103 35.864  1.00 16.63 ? 32   DA  B C6    1 
ATOM   220  N  N6    . DA  A 1 11  ? 22.003  36.254 36.861  1.00 15.82 ? 32   DA  B N6    1 
ATOM   221  N  N1    . DA  A 1 11  ? 21.620  36.971 34.693  1.00 16.36 ? 32   DA  B N1    1 
ATOM   222  C  C2    . DA  A 1 11  ? 21.896  37.822 33.698  1.00 17.04 ? 32   DA  B C2    1 
ATOM   223  N  N3    . DA  A 1 11  ? 22.765  38.829 33.671  1.00 17.05 ? 32   DA  B N3    1 
ATOM   224  C  C4    . DA  A 1 11  ? 23.409  38.928 34.847  1.00 18.08 ? 32   DA  B C4    1 
ATOM   225  P  P     . DG  A 1 12  ? 23.560  45.055 36.346  1.00 20.10 ? 33   DG  B P     1 
ATOM   226  O  OP1   . DG  A 1 12  ? 23.774  46.524 36.304  1.00 20.05 ? 33   DG  B OP1   1 
ATOM   227  O  OP2   . DG  A 1 12  ? 23.502  44.357 37.656  1.00 20.45 ? 33   DG  B OP2   1 
ATOM   228  O  "O5'" . DG  A 1 12  ? 22.209  44.708 35.569  1.00 18.56 ? 33   DG  B "O5'" 1 
ATOM   229  C  "C5'" . DG  A 1 12  ? 22.013  45.146 34.213  1.00 18.87 ? 33   DG  B "C5'" 1 
ATOM   230  C  "C4'" . DG  A 1 12  ? 20.795  44.486 33.603  1.00 20.44 ? 33   DG  B "C4'" 1 
ATOM   231  O  "O4'" . DG  A 1 12  ? 20.984  43.059 33.475  1.00 20.94 ? 33   DG  B "O4'" 1 
ATOM   232  C  "C3'" . DG  A 1 12  ? 19.487  44.627 34.368  1.00 21.00 ? 33   DG  B "C3'" 1 
ATOM   233  O  "O3'" . DG  A 1 12  ? 18.856  45.882 34.106  1.00 21.24 ? 33   DG  B "O3'" 1 
ATOM   234  C  "C2'" . DG  A 1 12  ? 18.667  43.475 33.819  1.00 20.50 ? 33   DG  B "C2'" 1 
ATOM   235  C  "C1'" . DG  A 1 12  ? 19.717  42.400 33.547  1.00 21.10 ? 33   DG  B "C1'" 1 
ATOM   236  N  N9    . DG  A 1 12  ? 19.768  41.394 34.606  1.00 21.17 ? 33   DG  B N9    1 
ATOM   237  C  C8    . DG  A 1 12  ? 20.603  41.352 35.699  1.00 22.02 ? 33   DG  B C8    1 
ATOM   238  N  N7    . DG  A 1 12  ? 20.369  40.332 36.483  1.00 20.85 ? 33   DG  B N7    1 
ATOM   239  C  C5    . DG  A 1 12  ? 19.323  39.659 35.866  1.00 21.09 ? 33   DG  B C5    1 
ATOM   240  C  C6    . DG  A 1 12  ? 18.635  38.482 36.248  1.00 19.58 ? 33   DG  B C6    1 
ATOM   241  O  O6    . DG  A 1 12  ? 18.816  37.773 37.241  1.00 24.36 ? 33   DG  B O6    1 
ATOM   242  N  N1    . DG  A 1 12  ? 17.639  38.151 35.332  1.00 20.94 ? 33   DG  B N1    1 
ATOM   243  C  C2    . DG  A 1 12  ? 17.343  38.862 34.199  1.00 20.84 ? 33   DG  B C2    1 
ATOM   244  N  N2    . DG  A 1 12  ? 16.345  38.390 33.441  1.00 20.00 ? 33   DG  B N2    1 
ATOM   245  N  N3    . DG  A 1 12  ? 17.977  39.959 33.834  1.00 21.59 ? 33   DG  B N3    1 
ATOM   246  C  C4    . DG  A 1 12  ? 18.946  40.299 34.706  1.00 19.73 ? 33   DG  B C4    1 
ATOM   247  P  P     . DG  A 1 13  ? 17.677  46.386 35.078  1.00 24.03 ? 34   DG  B P     1 
ATOM   248  O  OP1   . DG  A 1 13  ? 17.361  47.791 34.747  1.00 24.70 ? 34   DG  B OP1   1 
ATOM   249  O  OP2   . DG  A 1 13  ? 18.080  46.025 36.462  1.00 23.67 ? 34   DG  B OP2   1 
ATOM   250  O  "O5'" . DG  A 1 13  ? 16.427  45.477 34.689  1.00 23.65 ? 34   DG  B "O5'" 1 
ATOM   251  C  "C5'" . DG  A 1 13  ? 15.940  45.430 33.337  1.00 22.16 ? 34   DG  B "C5'" 1 
ATOM   252  C  "C4'" . DG  A 1 13  ? 14.766  44.483 33.232  1.00 22.84 ? 34   DG  B "C4'" 1 
ATOM   253  O  "O4'" . DG  A 1 13  ? 15.175  43.166 33.681  1.00 21.21 ? 34   DG  B "O4'" 1 
ATOM   254  C  "C3'" . DG  A 1 13  ? 13.541  44.867 34.071  1.00 26.32 ? 34   DG  B "C3'" 1 
ATOM   255  O  "O3'" . DG  A 1 13  ? 12.306  44.606 33.396  1.00 26.05 ? 34   DG  B "O3'" 1 
ATOM   256  C  "C2'" . DG  A 1 13  ? 13.616  43.934 35.263  1.00 25.28 ? 34   DG  B "C2'" 1 
ATOM   257  C  "C1'" . DG  A 1 13  ? 14.294  42.698 34.693  1.00 24.71 ? 34   DG  B "C1'" 1 
ATOM   258  N  N9    . DG  A 1 13  ? 15.082  41.991 35.699  1.00 23.89 ? 34   DG  B N9    1 
ATOM   259  C  C8    . DG  A 1 13  ? 16.211  42.445 36.339  1.00 23.88 ? 34   DG  B C8    1 
ATOM   260  N  N7    . DG  A 1 13  ? 16.647  41.623 37.253  1.00 23.63 ? 34   DG  B N7    1 
ATOM   261  C  C5    . DG  A 1 13  ? 15.764  40.555 37.206  1.00 24.69 ? 34   DG  B C5    1 
ATOM   262  C  C6    . DG  A 1 13  ? 15.717  39.371 37.981  1.00 24.82 ? 34   DG  B C6    1 
ATOM   263  O  O6    . DG  A 1 13  ? 16.470  39.021 38.899  1.00 26.00 ? 34   DG  B O6    1 
ATOM   264  N  N1    . DG  A 1 13  ? 14.657  38.555 37.602  1.00 24.77 ? 34   DG  B N1    1 
ATOM   265  C  C2    . DG  A 1 13  ? 13.753  38.843 36.612  1.00 25.00 ? 34   DG  B C2    1 
ATOM   266  N  N2    . DG  A 1 13  ? 12.800  37.925 36.392  1.00 24.81 ? 34   DG  B N2    1 
ATOM   267  N  N3    . DG  A 1 13  ? 13.780  39.949 35.889  1.00 25.32 ? 34   DG  B N3    1 
ATOM   268  C  C4    . DG  A 1 13  ? 14.804  40.756 36.238  1.00 24.37 ? 34   DG  B C4    1 
ATOM   269  O  "O5'" . DG  B 2 1   ? 15.430  32.004 47.438  1.00 53.92 ? 3    DG  C "O5'" 1 
ATOM   270  C  "C5'" . DG  B 2 1   ? 14.707  32.621 46.365  1.00 51.71 ? 3    DG  C "C5'" 1 
ATOM   271  C  "C4'" . DG  B 2 1   ? 13.405  31.912 46.074  1.00 51.02 ? 3    DG  C "C4'" 1 
ATOM   272  O  "O4'" . DG  B 2 1   ? 12.402  32.297 47.041  1.00 51.26 ? 3    DG  C "O4'" 1 
ATOM   273  C  "C3'" . DG  B 2 1   ? 12.812  32.215 44.701  1.00 48.95 ? 3    DG  C "C3'" 1 
ATOM   274  O  "O3'" . DG  B 2 1   ? 12.253  31.026 44.149  1.00 44.29 ? 3    DG  C "O3'" 1 
ATOM   275  C  "C2'" . DG  B 2 1   ? 11.736  33.248 44.982  1.00 50.65 ? 3    DG  C "C2'" 1 
ATOM   276  C  "C1'" . DG  B 2 1   ? 11.320  32.986 46.426  1.00 52.65 ? 3    DG  C "C1'" 1 
ATOM   277  N  N9    . DG  B 2 1   ? 11.128  34.227 47.172  1.00 54.36 ? 3    DG  C N9    1 
ATOM   278  C  C8    . DG  B 2 1   ? 10.102  34.547 48.029  1.00 54.63 ? 3    DG  C C8    1 
ATOM   279  N  N7    . DG  B 2 1   ? 10.232  35.733 48.562  1.00 54.50 ? 3    DG  C N7    1 
ATOM   280  C  C5    . DG  B 2 1   ? 11.413  36.226 48.019  1.00 55.29 ? 3    DG  C C5    1 
ATOM   281  C  C6    . DG  B 2 1   ? 12.074  37.467 48.217  1.00 55.62 ? 3    DG  C C6    1 
ATOM   282  O  O6    . DG  B 2 1   ? 11.741  38.411 48.945  1.00 57.28 ? 3    DG  C O6    1 
ATOM   283  N  N1    . DG  B 2 1   ? 13.238  37.552 47.457  1.00 55.43 ? 3    DG  C N1    1 
ATOM   284  C  C2    . DG  B 2 1   ? 13.707  36.574 46.615  1.00 54.62 ? 3    DG  C C2    1 
ATOM   285  N  N2    . DG  B 2 1   ? 14.841  36.843 45.954  1.00 55.13 ? 3    DG  C N2    1 
ATOM   286  N  N3    . DG  B 2 1   ? 13.106  35.417 46.429  1.00 54.71 ? 3    DG  C N3    1 
ATOM   287  C  C4    . DG  B 2 1   ? 11.973  35.311 47.156  1.00 54.73 ? 3    DG  C C4    1 
ATOM   288  P  P     . DC  B 2 2   ? 12.944  30.358 42.867  1.00 42.15 ? 4    DC  C P     1 
ATOM   289  O  OP1   . DC  B 2 2   ? 12.644  28.905 42.932  1.00 42.65 ? 4    DC  C OP1   1 
ATOM   290  O  OP2   . DC  B 2 2   ? 14.361  30.812 42.804  1.00 41.85 ? 4    DC  C OP2   1 
ATOM   291  O  "O5'" . DC  B 2 2   ? 12.181  31.008 41.631  1.00 38.87 ? 4    DC  C "O5'" 1 
ATOM   292  C  "C5'" . DC  B 2 2   ? 10.744  31.006 41.559  1.00 36.23 ? 4    DC  C "C5'" 1 
ATOM   293  C  "C4'" . DC  B 2 2   ? 10.273  32.001 40.524  1.00 31.65 ? 4    DC  C "C4'" 1 
ATOM   294  O  "O4'" . DC  B 2 2   ? 10.563  33.350 40.952  1.00 31.35 ? 4    DC  C "O4'" 1 
ATOM   295  C  "C3'" . DC  B 2 2   ? 10.944  31.876 39.161  1.00 29.80 ? 4    DC  C "C3'" 1 
ATOM   296  O  "O3'" . DC  B 2 2   ? 10.301  30.890 38.357  1.00 27.53 ? 4    DC  C "O3'" 1 
ATOM   297  C  "C2'" . DC  B 2 2   ? 10.781  33.267 38.582  1.00 29.99 ? 4    DC  C "C2'" 1 
ATOM   298  C  "C1'" . DC  B 2 2   ? 10.875  34.160 39.815  1.00 31.15 ? 4    DC  C "C1'" 1 
ATOM   299  N  N1    . DC  B 2 2   ? 12.216  34.755 40.009  1.00 30.79 ? 4    DC  C N1    1 
ATOM   300  C  C2    . DC  B 2 2   ? 12.560  35.884 39.247  1.00 31.15 ? 4    DC  C C2    1 
ATOM   301  O  O2    . DC  B 2 2   ? 11.731  36.342 38.439  1.00 30.47 ? 4    DC  C O2    1 
ATOM   302  N  N3    . DC  B 2 2   ? 13.783  36.445 39.407  1.00 28.51 ? 4    DC  C N3    1 
ATOM   303  C  C4    . DC  B 2 2   ? 14.646  35.926 40.283  1.00 30.52 ? 4    DC  C C4    1 
ATOM   304  N  N4    . DC  B 2 2   ? 15.840  36.522 40.410  1.00 28.64 ? 4    DC  C N4    1 
ATOM   305  C  C5    . DC  B 2 2   ? 14.326  34.777 41.070  1.00 28.39 ? 4    DC  C C5    1 
ATOM   306  C  C6    . DC  B 2 2   ? 13.112  34.230 40.902  1.00 29.27 ? 4    DC  C C6    1 
ATOM   307  P  P     . DC  B 2 3   ? 11.129  30.153 37.197  1.00 23.56 ? 5    DC  C P     1 
ATOM   308  O  OP1   . DC  B 2 3   ? 10.207  29.219 36.503  1.00 25.11 ? 5    DC  C OP1   1 
ATOM   309  O  OP2   . DC  B 2 3   ? 12.396  29.632 37.793  1.00 25.83 ? 5    DC  C OP2   1 
ATOM   310  O  "O5'" . DC  B 2 3   ? 11.506  31.336 36.201  1.00 24.24 ? 5    DC  C "O5'" 1 
ATOM   311  C  "C5'" . DC  B 2 3   ? 10.489  31.977 35.413  1.00 21.19 ? 5    DC  C "C5'" 1 
ATOM   312  C  "C4'" . DC  B 2 3   ? 11.107  32.983 34.471  1.00 20.36 ? 5    DC  C "C4'" 1 
ATOM   313  O  "O4'" . DC  B 2 3   ? 11.601  34.141 35.181  1.00 20.50 ? 5    DC  C "O4'" 1 
ATOM   314  C  "C3'" . DC  B 2 3   ? 12.306  32.483 33.679  1.00 22.16 ? 5    DC  C "C3'" 1 
ATOM   315  O  "O3'" . DC  B 2 3   ? 11.899  31.725 32.540  1.00 21.88 ? 5    DC  C "O3'" 1 
ATOM   316  C  "C2'" . DC  B 2 3   ? 13.000  33.774 33.287  1.00 21.70 ? 5    DC  C "C2'" 1 
ATOM   317  C  "C1'" . DC  B 2 3   ? 12.723  34.684 34.480  1.00 23.55 ? 5    DC  C "C1'" 1 
ATOM   318  N  N1    . DC  B 2 3   ? 13.867  34.783 35.410  1.00 22.70 ? 5    DC  C N1    1 
ATOM   319  C  C2    . DC  B 2 3   ? 14.882  35.710 35.114  1.00 25.10 ? 5    DC  C C2    1 
ATOM   320  O  O2    . DC  B 2 3   ? 14.773  36.414 34.098  1.00 24.46 ? 5    DC  C O2    1 
ATOM   321  N  N3    . DC  B 2 3   ? 15.949  35.814 35.938  1.00 24.63 ? 5    DC  C N3    1 
ATOM   322  C  C4    . DC  B 2 3   ? 16.029  35.044 37.024  1.00 26.33 ? 5    DC  C C4    1 
ATOM   323  N  N4    . DC  B 2 3   ? 17.100  35.191 37.811  1.00 25.13 ? 5    DC  C N4    1 
ATOM   324  C  C5    . DC  B 2 3   ? 15.015  34.092 37.353  1.00 25.19 ? 5    DC  C C5    1 
ATOM   325  C  C6    . DC  B 2 3   ? 13.960  33.996 36.526  1.00 23.98 ? 5    DC  C C6    1 
ATOM   326  P  P     . DT  B 2 4   ? 13.011  30.951 31.674  1.00 21.49 ? 6    DT  C P     1 
ATOM   327  O  OP1   . DT  B 2 4   ? 12.294  30.153 30.648  1.00 21.76 ? 6    DT  C OP1   1 
ATOM   328  O  OP2   . DT  B 2 4   ? 13.951  30.276 32.609  1.00 20.47 ? 6    DT  C OP2   1 
ATOM   329  O  "O5'" . DT  B 2 4   ? 13.814  32.136 30.980  1.00 21.59 ? 6    DT  C "O5'" 1 
ATOM   330  C  "C5'" . DT  B 2 4   ? 15.170  31.954 30.544  1.00 18.18 ? 6    DT  C "C5'" 1 
ATOM   331  C  "C4'" . DT  B 2 4   ? 15.816  33.296 30.293  1.00 18.09 ? 6    DT  C "C4'" 1 
ATOM   332  O  "O4'" . DT  B 2 4   ? 15.964  34.029 31.530  1.00 19.57 ? 6    DT  C "O4'" 1 
ATOM   333  C  "C3'" . DT  B 2 4   ? 17.218  33.211 29.708  1.00 19.07 ? 6    DT  C "C3'" 1 
ATOM   334  O  "O3'" . DT  B 2 4   ? 17.096  33.141 28.282  1.00 16.40 ? 6    DT  C "O3'" 1 
ATOM   335  C  "C2'" . DT  B 2 4   ? 17.855  34.513 30.161  1.00 18.13 ? 6    DT  C "C2'" 1 
ATOM   336  C  "C1'" . DT  B 2 4   ? 17.139  34.834 31.474  1.00 19.12 ? 6    DT  C "C1'" 1 
ATOM   337  N  N1    . DT  B 2 4   ? 17.913  34.633 32.728  1.00 21.03 ? 6    DT  C N1    1 
ATOM   338  C  C2    . DT  B 2 4   ? 18.894  35.556 33.029  1.00 21.77 ? 6    DT  C C2    1 
ATOM   339  O  O2    . DT  B 2 4   ? 19.167  36.506 32.306  1.00 20.21 ? 6    DT  C O2    1 
ATOM   340  N  N3    . DT  B 2 4   ? 19.551  35.327 34.215  1.00 17.88 ? 6    DT  C N3    1 
ATOM   341  C  C4    . DT  B 2 4   ? 19.339  34.293 35.108  1.00 21.04 ? 6    DT  C C4    1 
ATOM   342  O  O4    . DT  B 2 4   ? 20.008  34.231 36.145  1.00 17.47 ? 6    DT  C O4    1 
ATOM   343  C  C5    . DT  B 2 4   ? 18.308  33.352 34.723  1.00 20.59 ? 6    DT  C C5    1 
ATOM   344  C  C7    . DT  B 2 4   ? 18.013  32.187 35.618  1.00 23.02 ? 6    DT  C C7    1 
ATOM   345  C  C6    . DT  B 2 4   ? 17.656  33.567 33.570  1.00 21.83 ? 6    DT  C C6    1 
ATOM   346  P  P     . DG  B 2 5   ? 18.267  32.484 27.405  1.00 18.98 ? 7    DG  C P     1 
ATOM   347  O  OP1   . DG  B 2 5   ? 17.885  32.572 25.975  1.00 16.13 ? 7    DG  C OP1   1 
ATOM   348  O  OP2   . DG  B 2 5   ? 18.607  31.163 27.995  1.00 18.23 ? 7    DG  C OP2   1 
ATOM   349  O  "O5'" . DG  B 2 5   ? 19.514  33.438 27.647  1.00 18.87 ? 7    DG  C "O5'" 1 
ATOM   350  C  "C5'" . DG  B 2 5   ? 19.550  34.756 27.089  1.00 17.47 ? 7    DG  C "C5'" 1 
ATOM   351  C  "C4'" . DG  B 2 5   ? 20.964  35.282 27.115  1.00 17.76 ? 7    DG  C "C4'" 1 
ATOM   352  O  "O4'" . DG  B 2 5   ? 21.398  35.417 28.488  1.00 17.73 ? 7    DG  C "O4'" 1 
ATOM   353  C  "C3'" . DG  B 2 5   ? 21.991  34.383 26.429  1.00 18.86 ? 7    DG  C "C3'" 1 
ATOM   354  O  "O3'" . DG  B 2 5   ? 22.919  35.234 25.754  1.00 18.83 ? 7    DG  C "O3'" 1 
ATOM   355  C  "C2'" . DG  B 2 5   ? 22.633  33.628 27.585  1.00 18.72 ? 7    DG  C "C2'" 1 
ATOM   356  C  "C1'" . DG  B 2 5   ? 22.537  34.611 28.743  1.00 18.25 ? 7    DG  C "C1'" 1 
ATOM   357  N  N9    . DG  B 2 5   ? 22.357  34.013 30.066  1.00 20.76 ? 7    DG  C N9    1 
ATOM   358  C  C8    . DG  B 2 5   ? 21.515  32.981 30.415  1.00 19.90 ? 7    DG  C C8    1 
ATOM   359  N  N7    . DG  B 2 5   ? 21.565  32.688 31.687  1.00 20.73 ? 7    DG  C N7    1 
ATOM   360  C  C5    . DG  B 2 5   ? 22.500  33.574 32.208  1.00 20.28 ? 7    DG  C C5    1 
ATOM   361  C  C6    . DG  B 2 5   ? 22.973  33.739 33.537  1.00 19.75 ? 7    DG  C C6    1 
ATOM   362  O  O6    . DG  B 2 5   ? 22.646  33.116 34.556  1.00 19.56 ? 7    DG  C O6    1 
ATOM   363  N  N1    . DG  B 2 5   ? 23.921  34.756 33.620  1.00 20.09 ? 7    DG  C N1    1 
ATOM   364  C  C2    . DG  B 2 5   ? 24.357  35.519 32.561  1.00 17.83 ? 7    DG  C C2    1 
ATOM   365  N  N2    . DG  B 2 5   ? 25.273  36.459 32.838  1.00 16.99 ? 7    DG  C N2    1 
ATOM   366  N  N3    . DG  B 2 5   ? 23.923  35.375 31.323  1.00 19.35 ? 7    DG  C N3    1 
ATOM   367  C  C4    . DG  B 2 5   ? 23.002  34.393 31.218  1.00 19.17 ? 7    DG  C C4    1 
ATOM   368  P  P     . DA  B 2 6   ? 24.174  34.610 24.970  1.00 19.37 ? 8    DA  C P     1 
ATOM   369  O  OP1   . DA  B 2 6   ? 24.360  35.419 23.740  1.00 17.86 ? 8    DA  C OP1   1 
ATOM   370  O  OP2   . DA  B 2 6   ? 24.020  33.138 24.871  1.00 18.82 ? 8    DA  C OP2   1 
ATOM   371  O  "O5'" . DA  B 2 6   ? 25.386  34.940 25.942  1.00 18.54 ? 8    DA  C "O5'" 1 
ATOM   372  C  "C5'" . DA  B 2 6   ? 25.718  36.307 26.226  1.00 20.12 ? 8    DA  C "C5'" 1 
ATOM   373  C  "C4'" . DA  B 2 6   ? 27.038  36.386 26.950  1.00 21.79 ? 8    DA  C "C4'" 1 
ATOM   374  O  "O4'" . DA  B 2 6   ? 26.876  35.938 28.313  1.00 23.55 ? 8    DA  C "O4'" 1 
ATOM   375  C  "C3'" . DA  B 2 6   ? 28.152  35.538 26.341  1.00 23.99 ? 8    DA  C "C3'" 1 
ATOM   376  O  "O3'" . DA  B 2 6   ? 29.364  36.294 26.381  1.00 24.82 ? 8    DA  C "O3'" 1 
ATOM   377  C  "C2'" . DA  B 2 6   ? 28.207  34.317 27.246  1.00 22.14 ? 8    DA  C "C2'" 1 
ATOM   378  C  "C1'" . DA  B 2 6   ? 27.753  34.862 28.598  1.00 23.52 ? 8    DA  C "C1'" 1 
ATOM   379  N  N9    . DA  B 2 6   ? 27.020  33.916 29.443  1.00 21.53 ? 8    DA  C N9    1 
ATOM   380  C  C8    . DA  B 2 6   ? 26.049  33.014 29.073  1.00 19.83 ? 8    DA  C C8    1 
ATOM   381  N  N7    . DA  B 2 6   ? 25.573  32.310 30.070  1.00 20.72 ? 8    DA  C N7    1 
ATOM   382  C  C5    . DA  B 2 6   ? 26.276  32.777 31.173  1.00 20.09 ? 8    DA  C C5    1 
ATOM   383  C  C6    . DA  B 2 6   ? 26.239  32.432 32.538  1.00 21.24 ? 8    DA  C C6    1 
ATOM   384  N  N6    . DA  B 2 6   ? 25.431  31.499 33.045  1.00 20.22 ? 8    DA  C N6    1 
ATOM   385  N  N1    . DA  B 2 6   ? 27.072  33.086 33.374  1.00 19.33 ? 8    DA  C N1    1 
ATOM   386  C  C2    . DA  B 2 6   ? 27.886  34.019 32.866  1.00 19.57 ? 8    DA  C C2    1 
ATOM   387  N  N3    . DA  B 2 6   ? 28.016  34.430 31.608  1.00 20.24 ? 8    DA  C N3    1 
ATOM   388  C  C4    . DA  B 2 6   ? 27.172  33.763 30.801  1.00 21.11 ? 8    DA  C C4    1 
ATOM   389  P  P     . DC  B 2 7   ? 30.685  35.740 25.656  1.00 26.14 ? 9    DC  C P     1 
ATOM   390  O  OP1   . DC  B 2 7   ? 31.250  36.831 24.825  1.00 28.03 ? 9    DC  C OP1   1 
ATOM   391  O  OP2   . DC  B 2 7   ? 30.418  34.410 25.043  1.00 21.67 ? 9    DC  C OP2   1 
ATOM   392  O  "O5'" . DC  B 2 7   ? 31.660  35.528 26.893  1.00 26.41 ? 9    DC  C "O5'" 1 
ATOM   393  C  "C5'" . DC  B 2 7   ? 31.849  36.588 27.841  1.00 26.88 ? 9    DC  C "C5'" 1 
ATOM   394  C  "C4'" . DC  B 2 7   ? 32.553  36.070 29.070  1.00 26.51 ? 9    DC  C "C4'" 1 
ATOM   395  O  "O4'" . DC  B 2 7   ? 31.629  35.380 29.955  1.00 27.03 ? 9    DC  C "O4'" 1 
ATOM   396  C  "C3'" . DC  B 2 7   ? 33.675  35.085 28.745  1.00 26.53 ? 9    DC  C "C3'" 1 
ATOM   397  O  "O3'" . DC  B 2 7   ? 34.916  35.425 29.344  1.00 26.69 ? 9    DC  C "O3'" 1 
ATOM   398  C  "C2'" . DC  B 2 7   ? 33.172  33.762 29.280  1.00 28.63 ? 9    DC  C "C2'" 1 
ATOM   399  C  "C1'" . DC  B 2 7   ? 32.220  34.168 30.395  1.00 27.15 ? 9    DC  C "C1'" 1 
ATOM   400  N  N1    . DC  B 2 7   ? 31.155  33.162 30.600  1.00 24.61 ? 9    DC  C N1    1 
ATOM   401  C  C2    . DC  B 2 7   ? 30.915  32.674 31.901  1.00 24.08 ? 9    DC  C C2    1 
ATOM   402  O  O2    . DC  B 2 7   ? 31.524  33.176 32.866  1.00 22.16 ? 9    DC  C O2    1 
ATOM   403  N  N3    . DC  B 2 7   ? 30.019  31.674 32.072  1.00 21.37 ? 9    DC  C N3    1 
ATOM   404  C  C4    . DC  B 2 7   ? 29.366  31.173 31.021  1.00 21.02 ? 9    DC  C C4    1 
ATOM   405  N  N4    . DC  B 2 7   ? 28.516  30.170 31.235  1.00 22.18 ? 9    DC  C N4    1 
ATOM   406  C  C5    . DC  B 2 7   ? 29.559  31.676 29.701  1.00 22.29 ? 9    DC  C C5    1 
ATOM   407  C  C6    . DC  B 2 7   ? 30.447  32.664 29.538  1.00 22.92 ? 9    DC  C C6    1 
ATOM   408  P  P     . DT  B 2 8   ? 36.255  34.699 28.828  1.00 25.97 ? 10   DT  C P     1 
ATOM   409  O  OP1   . DT  B 2 8   ? 37.240  35.739 28.445  1.00 28.05 ? 10   DT  C OP1   1 
ATOM   410  O  OP2   . DT  B 2 8   ? 35.864  33.660 27.843  1.00 25.61 ? 10   DT  C OP2   1 
ATOM   411  O  "O5'" . DT  B 2 8   ? 36.791  33.921 30.110  1.00 26.00 ? 10   DT  C "O5'" 1 
ATOM   412  C  "C5'" . DT  B 2 8   ? 37.115  34.613 31.334  1.00 26.94 ? 10   DT  C "C5'" 1 
ATOM   413  C  "C4'" . DT  B 2 8   ? 37.133  33.632 32.483  1.00 27.71 ? 10   DT  C "C4'" 1 
ATOM   414  O  "O4'" . DT  B 2 8   ? 35.820  33.056 32.617  1.00 28.60 ? 10   DT  C "O4'" 1 
ATOM   415  C  "C3'" . DT  B 2 8   ? 38.084  32.451 32.296  1.00 29.21 ? 10   DT  C "C3'" 1 
ATOM   416  O  "O3'" . DT  B 2 8   ? 39.320  32.791 32.949  1.00 27.41 ? 10   DT  C "O3'" 1 
ATOM   417  C  "C2'" . DT  B 2 8   ? 37.386  31.314 33.025  1.00 30.70 ? 10   DT  C "C2'" 1 
ATOM   418  C  "C1'" . DT  B 2 8   ? 35.917  31.713 33.058  1.00 29.93 ? 10   DT  C "C1'" 1 
ATOM   419  N  N1    . DT  B 2 8   ? 34.915  30.907 32.326  1.00 30.51 ? 10   DT  C N1    1 
ATOM   420  C  C2    . DT  B 2 8   ? 34.215  29.959 33.046  1.00 30.92 ? 10   DT  C C2    1 
ATOM   421  O  O2    . DT  B 2 8   ? 34.443  29.700 34.218  1.00 32.00 ? 10   DT  C O2    1 
ATOM   422  N  N3    . DT  B 2 8   ? 33.234  29.315 32.339  1.00 29.83 ? 10   DT  C N3    1 
ATOM   423  C  C4    . DT  B 2 8   ? 32.904  29.490 31.013  1.00 28.44 ? 10   DT  C C4    1 
ATOM   424  O  O4    . DT  B 2 8   ? 31.967  28.861 30.533  1.00 25.78 ? 10   DT  C O4    1 
ATOM   425  C  C5    . DT  B 2 8   ? 33.719  30.448 30.296  1.00 28.83 ? 10   DT  C C5    1 
ATOM   426  C  C7    . DT  B 2 8   ? 33.475  30.660 28.834  1.00 28.83 ? 10   DT  C C7    1 
ATOM   427  C  C6    . DT  B 2 8   ? 34.666  31.107 30.981  1.00 30.64 ? 10   DT  C C6    1 
ATOM   428  P  P     . DC  B 2 9   ? 40.546  31.745 32.975  1.00 27.03 ? 11   DC  C P     1 
ATOM   429  O  OP1   . DC  B 2 9   ? 41.618  32.347 33.816  1.00 26.90 ? 11   DC  C OP1   1 
ATOM   430  O  OP2   . DC  B 2 9   ? 40.849  31.345 31.575  1.00 27.14 ? 11   DC  C OP2   1 
ATOM   431  O  "O5'" . DC  B 2 9   ? 39.970  30.477 33.739  1.00 24.78 ? 11   DC  C "O5'" 1 
ATOM   432  C  "C5'" . DC  B 2 9   ? 39.576  30.576 35.115  1.00 25.45 ? 11   DC  C "C5'" 1 
ATOM   433  C  "C4'" . DC  B 2 9   ? 39.192  29.219 35.654  1.00 26.98 ? 11   DC  C "C4'" 1 
ATOM   434  O  "O4'" . DC  B 2 9   ? 37.961  28.755 35.047  1.00 27.31 ? 11   DC  C "O4'" 1 
ATOM   435  C  "C3'" . DC  B 2 9   ? 40.221  28.107 35.450  1.00 26.75 ? 11   DC  C "C3'" 1 
ATOM   436  O  "O3'" . DC  B 2 9   ? 40.312  27.344 36.655  1.00 28.07 ? 11   DC  C "O3'" 1 
ATOM   437  C  "C2'" . DC  B 2 9   ? 39.632  27.274 34.322  1.00 27.72 ? 11   DC  C "C2'" 1 
ATOM   438  C  "C1'" . DC  B 2 9   ? 38.132  27.447 34.524  1.00 27.89 ? 11   DC  C "C1'" 1 
ATOM   439  N  N1    . DC  B 2 9   ? 37.283  27.328 33.319  1.00 28.39 ? 11   DC  C N1    1 
ATOM   440  C  C2    . DC  B 2 9   ? 36.160  26.488 33.368  1.00 28.08 ? 11   DC  C C2    1 
ATOM   441  O  O2    . DC  B 2 9   ? 35.927  25.850 34.407  1.00 30.67 ? 11   DC  C O2    1 
ATOM   442  N  N3    . DC  B 2 9   ? 35.357  26.391 32.282  1.00 28.73 ? 11   DC  C N3    1 
ATOM   443  C  C4    . DC  B 2 9   ? 35.641  27.084 31.179  1.00 27.59 ? 11   DC  C C4    1 
ATOM   444  N  N4    . DC  B 2 9   ? 34.814  26.964 30.139  1.00 30.84 ? 11   DC  C N4    1 
ATOM   445  C  C5    . DC  B 2 9   ? 36.784  27.932 31.093  1.00 28.74 ? 11   DC  C C5    1 
ATOM   446  C  C6    . DC  B 2 9   ? 37.570  28.025 32.176  1.00 28.54 ? 11   DC  C C6    1 
ATOM   447  P  P     . DG  B 2 10  ? 41.530  26.313 36.869  1.00 28.59 ? 12   DG  C P     1 
ATOM   448  O  OP1   . DG  B 2 10  ? 41.879  26.343 38.313  1.00 28.71 ? 12   DG  C OP1   1 
ATOM   449  O  OP2   . DG  B 2 10  ? 42.587  26.576 35.857  1.00 25.79 ? 12   DG  C OP2   1 
ATOM   450  O  "O5'" . DG  B 2 10  ? 40.854  24.913 36.546  1.00 29.47 ? 12   DG  C "O5'" 1 
ATOM   451  C  "C5'" . DG  B 2 10  ? 39.721  24.461 37.305  1.00 35.52 ? 12   DG  C "C5'" 1 
ATOM   452  C  "C4'" . DG  B 2 10  ? 39.196  23.162 36.740  1.00 39.88 ? 12   DG  C "C4'" 1 
ATOM   453  O  "O4'" . DG  B 2 10  ? 38.427  23.401 35.536  1.00 39.12 ? 12   DG  C "O4'" 1 
ATOM   454  C  "C3'" . DG  B 2 10  ? 40.272  22.138 36.370  1.00 43.36 ? 12   DG  C "C3'" 1 
ATOM   455  O  "O3'" . DG  B 2 10  ? 39.820  20.829 36.729  1.00 50.88 ? 12   DG  C "O3'" 1 
ATOM   456  C  "C2'" . DG  B 2 10  ? 40.353  22.246 34.857  1.00 42.38 ? 12   DG  C "C2'" 1 
ATOM   457  C  "C1'" . DG  B 2 10  ? 38.915  22.577 34.491  1.00 39.32 ? 12   DG  C "C1'" 1 
ATOM   458  N  N9    . DG  B 2 10  ? 38.686  23.262 33.221  1.00 37.83 ? 12   DG  C N9    1 
ATOM   459  C  C8    . DG  B 2 10  ? 39.509  24.156 32.573  1.00 36.61 ? 12   DG  C C8    1 
ATOM   460  N  N7    . DG  B 2 10  ? 39.009  24.584 31.443  1.00 35.40 ? 12   DG  C N7    1 
ATOM   461  C  C5    . DG  B 2 10  ? 37.785  23.936 31.341  1.00 35.66 ? 12   DG  C C5    1 
ATOM   462  C  C6    . DG  B 2 10  ? 36.786  24.001 30.330  1.00 35.42 ? 12   DG  C C6    1 
ATOM   463  O  O6    . DG  B 2 10  ? 36.784  24.665 29.286  1.00 36.13 ? 12   DG  C O6    1 
ATOM   464  N  N1    . DG  B 2 10  ? 35.701  23.181 30.631  1.00 35.65 ? 12   DG  C N1    1 
ATOM   465  C  C2    . DG  B 2 10  ? 35.590  22.400 31.755  1.00 34.98 ? 12   DG  C C2    1 
ATOM   466  N  N2    . DG  B 2 10  ? 34.468  21.676 31.869  1.00 35.19 ? 12   DG  C N2    1 
ATOM   467  N  N3    . DG  B 2 10  ? 36.510  22.331 32.699  1.00 35.85 ? 12   DG  C N3    1 
ATOM   468  C  C4    . DG  B 2 10  ? 37.572  23.119 32.430  1.00 34.92 ? 12   DG  C C4    1 
ATOM   469  P  P     . DT  B 2 11  ? 40.867  19.611 36.818  1.00 54.98 ? 13   DT  C P     1 
ATOM   470  O  OP1   . DT  B 2 11  ? 40.987  19.233 38.250  1.00 55.35 ? 13   DT  C OP1   1 
ATOM   471  O  OP2   . DT  B 2 11  ? 42.090  19.966 36.046  1.00 54.86 ? 13   DT  C OP2   1 
ATOM   472  O  "O5'" . DT  B 2 11  ? 40.117  18.434 36.048  1.00 56.76 ? 13   DT  C "O5'" 1 
ATOM   473  C  "C5'" . DT  B 2 11  ? 38.813  17.995 36.478  1.00 60.08 ? 13   DT  C "C5'" 1 
ATOM   474  C  "C4'" . DT  B 2 11  ? 37.916  17.723 35.290  1.00 62.32 ? 13   DT  C "C4'" 1 
ATOM   475  O  "O4'" . DT  B 2 11  ? 37.720  18.922 34.506  1.00 62.67 ? 13   DT  C "O4'" 1 
ATOM   476  C  "C3'" . DT  B 2 11  ? 38.403  16.683 34.289  1.00 63.91 ? 13   DT  C "C3'" 1 
ATOM   477  O  "O3'" . DT  B 2 11  ? 38.059  15.366 34.736  1.00 67.17 ? 13   DT  C "O3'" 1 
ATOM   478  C  "C2'" . DT  B 2 11  ? 37.635  17.053 33.034  1.00 63.19 ? 13   DT  C "C2'" 1 
ATOM   479  C  "C1'" . DT  B 2 11  ? 37.446  18.562 33.152  1.00 61.58 ? 13   DT  C "C1'" 1 
ATOM   480  N  N1    . DT  B 2 11  ? 38.300  19.378 32.257  1.00 60.15 ? 13   DT  C N1    1 
ATOM   481  C  C2    . DT  B 2 11  ? 37.758  19.770 31.049  1.00 59.53 ? 13   DT  C C2    1 
ATOM   482  O  O2    . DT  B 2 11  ? 36.630  19.468 30.692  1.00 59.64 ? 13   DT  C O2    1 
ATOM   483  N  N3    . DT  B 2 11  ? 38.590  20.531 30.267  1.00 59.14 ? 13   DT  C N3    1 
ATOM   484  C  C4    . DT  B 2 11  ? 39.879  20.930 30.557  1.00 59.16 ? 13   DT  C C4    1 
ATOM   485  O  O4    . DT  B 2 11  ? 40.499  21.624 29.752  1.00 58.35 ? 13   DT  C O4    1 
ATOM   486  C  C5    . DT  B 2 11  ? 40.391  20.476 31.834  1.00 59.24 ? 13   DT  C C5    1 
ATOM   487  C  C7    . DT  B 2 11  ? 41.785  20.849 32.233  1.00 59.32 ? 13   DT  C C7    1 
ATOM   488  C  C6    . DT  B 2 11  ? 39.586  19.734 32.610  1.00 59.61 ? 13   DT  C C6    1 
ATOM   489  P  P     . DA  B 2 12  ? 38.475  14.086 33.854  1.00 69.66 ? 14   DA  C P     1 
ATOM   490  O  OP1   . DA  B 2 12  ? 38.216  12.863 34.659  1.00 69.47 ? 14   DA  C OP1   1 
ATOM   491  O  OP2   . DA  B 2 12  ? 39.839  14.331 33.307  1.00 69.14 ? 14   DA  C OP2   1 
ATOM   492  O  "O5'" . DA  B 2 12  ? 37.444  14.113 32.639  1.00 69.52 ? 14   DA  C "O5'" 1 
ATOM   493  C  "C5'" . DA  B 2 12  ? 36.020  14.110 32.876  1.00 70.84 ? 14   DA  C "C5'" 1 
ATOM   494  C  "C4'" . DA  B 2 12  ? 35.274  14.368 31.587  1.00 71.63 ? 14   DA  C "C4'" 1 
ATOM   495  O  "O4'" . DA  B 2 12  ? 35.582  15.689 31.094  1.00 71.36 ? 14   DA  C "O4'" 1 
ATOM   496  C  "C3'" . DA  B 2 12  ? 35.635  13.424 30.448  1.00 73.12 ? 14   DA  C "C3'" 1 
ATOM   497  O  "O3'" . DA  B 2 12  ? 34.810  12.254 30.507  1.00 76.06 ? 14   DA  C "O3'" 1 
ATOM   498  C  "C2'" . DA  B 2 12  ? 35.354  14.257 29.211  1.00 71.59 ? 14   DA  C "C2'" 1 
ATOM   499  C  "C1'" . DA  B 2 12  ? 35.663  15.679 29.670  1.00 69.97 ? 14   DA  C "C1'" 1 
ATOM   500  N  N9    . DA  B 2 12  ? 36.981  16.195 29.293  1.00 67.58 ? 14   DA  C N9    1 
ATOM   501  C  C8    . DA  B 2 12  ? 38.162  16.081 29.988  1.00 66.64 ? 14   DA  C C8    1 
ATOM   502  N  N7    . DA  B 2 12  ? 39.176  16.679 29.412  1.00 65.74 ? 14   DA  C N7    1 
ATOM   503  C  C5    . DA  B 2 12  ? 38.631  17.217 28.255  1.00 65.38 ? 14   DA  C C5    1 
ATOM   504  C  C6    . DA  B 2 12  ? 39.189  17.980 27.214  1.00 64.51 ? 14   DA  C C6    1 
ATOM   505  N  N6    . DA  B 2 12  ? 40.469  18.355 27.178  1.00 64.53 ? 14   DA  C N6    1 
ATOM   506  N  N1    . DA  B 2 12  ? 38.377  18.352 26.202  1.00 64.04 ? 14   DA  C N1    1 
ATOM   507  C  C2    . DA  B 2 12  ? 37.092  17.982 26.244  1.00 64.16 ? 14   DA  C C2    1 
ATOM   508  N  N3    . DA  B 2 12  ? 36.448  17.272 27.169  1.00 65.22 ? 14   DA  C N3    1 
ATOM   509  C  C4    . DA  B 2 12  ? 37.284  16.917 28.161  1.00 66.04 ? 14   DA  C C4    1 
ATOM   510  P  P     . DT  B 2 13  ? 35.171  10.976 29.603  1.00 78.07 ? 15   DT  C P     1 
ATOM   511  O  OP1   . DT  B 2 13  ? 34.178  9.907  29.890  1.00 78.05 ? 15   DT  C OP1   1 
ATOM   512  O  OP2   . DT  B 2 13  ? 36.623  10.697 29.776  1.00 77.88 ? 15   DT  C OP2   1 
ATOM   513  O  "O5'" . DT  B 2 13  ? 34.934  11.498 28.117  1.00 78.19 ? 15   DT  C "O5'" 1 
ATOM   514  C  "C5'" . DT  B 2 13  ? 35.454  10.780 26.989  1.00 79.16 ? 15   DT  C "C5'" 1 
ATOM   515  C  "C4'" . DT  B 2 13  ? 35.380  11.638 25.748  1.00 79.73 ? 15   DT  C "C4'" 1 
ATOM   516  O  "O4'" . DT  B 2 13  ? 36.058  12.894 26.000  1.00 79.37 ? 15   DT  C "O4'" 1 
ATOM   517  C  "C3'" . DT  B 2 13  ? 36.059  11.020 24.526  1.00 80.66 ? 15   DT  C "C3'" 1 
ATOM   518  O  "O3'" . DT  B 2 13  ? 35.305  11.279 23.335  1.00 82.31 ? 15   DT  C "O3'" 1 
ATOM   519  C  "C2'" . DT  B 2 13  ? 37.402  11.723 24.469  1.00 79.90 ? 15   DT  C "C2'" 1 
ATOM   520  C  "C1'" . DT  B 2 13  ? 37.109  13.090 25.064  1.00 79.01 ? 15   DT  C "C1'" 1 
ATOM   521  N  N1    . DT  B 2 13  ? 38.265  13.674 25.783  1.00 78.18 ? 15   DT  C N1    1 
ATOM   522  C  C2    . DT  B 2 13  ? 38.979  14.683 25.163  1.00 77.70 ? 15   DT  C C2    1 
ATOM   523  O  O2    . DT  B 2 13  ? 38.692  15.133 24.064  1.00 77.06 ? 15   DT  C O2    1 
ATOM   524  N  N3    . DT  B 2 13  ? 40.049  15.152 25.886  1.00 77.19 ? 15   DT  C N3    1 
ATOM   525  C  C4    . DT  B 2 13  ? 40.469  14.729 27.133  1.00 77.22 ? 15   DT  C C4    1 
ATOM   526  O  O4    . DT  B 2 13  ? 41.458  15.245 27.651  1.00 77.04 ? 15   DT  C O4    1 
ATOM   527  C  C5    . DT  B 2 13  ? 39.671  13.676 27.728  1.00 77.25 ? 15   DT  C C5    1 
ATOM   528  C  C7    . DT  B 2 13  ? 40.043  13.155 29.081  1.00 77.33 ? 15   DT  C C7    1 
ATOM   529  C  C6    . DT  B 2 13  ? 38.625  13.210 27.033  1.00 77.54 ? 15   DT  C C6    1 
ATOM   530  P  P     . DG  B 2 14  ? 35.487  10.323 22.051  1.00 83.58 ? 16   DG  C P     1 
ATOM   531  O  OP1   . DG  B 2 14  ? 34.269  10.454 21.206  1.00 83.20 ? 16   DG  C OP1   1 
ATOM   532  O  OP2   . DG  B 2 14  ? 35.903  8.977  22.533  1.00 83.11 ? 16   DG  C OP2   1 
ATOM   533  O  "O5'" . DG  B 2 14  ? 36.719  10.963 21.267  1.00 83.35 ? 16   DG  C "O5'" 1 
ATOM   534  C  "C5'" . DG  B 2 14  ? 36.544  12.138 20.450  1.00 83.38 ? 16   DG  C "C5'" 1 
ATOM   535  C  "C4'" . DG  B 2 14  ? 37.876  12.794 20.166  1.00 83.67 ? 16   DG  C "C4'" 1 
ATOM   536  O  "O4'" . DG  B 2 14  ? 38.468  13.277 21.393  1.00 83.62 ? 16   DG  C "O4'" 1 
ATOM   537  C  "C3'" . DG  B 2 14  ? 38.944  11.905 19.538  1.00 84.30 ? 16   DG  C "C3'" 1 
ATOM   538  O  "O3'" . DG  B 2 14  ? 38.796  11.857 18.113  1.00 85.57 ? 16   DG  C "O3'" 1 
ATOM   539  C  "C2'" . DG  B 2 14  ? 40.231  12.597 19.949  1.00 83.63 ? 16   DG  C "C2'" 1 
ATOM   540  C  "C1'" . DG  B 2 14  ? 39.890  13.178 21.319  1.00 82.85 ? 16   DG  C "C1'" 1 
ATOM   541  N  N9    . DG  B 2 14  ? 40.345  12.353 22.436  1.00 82.22 ? 16   DG  C N9    1 
ATOM   542  C  C8    . DG  B 2 14  ? 39.904  11.095 22.775  1.00 81.88 ? 16   DG  C C8    1 
ATOM   543  N  N7    . DG  B 2 14  ? 40.502  10.608 23.828  1.00 81.84 ? 16   DG  C N7    1 
ATOM   544  C  C5    . DG  B 2 14  ? 41.392  11.604 24.209  1.00 81.90 ? 16   DG  C C5    1 
ATOM   545  C  C6    . DG  B 2 14  ? 42.319  11.647 25.286  1.00 81.67 ? 16   DG  C C6    1 
ATOM   546  O  O6    . DG  B 2 14  ? 42.543  10.787 26.148  1.00 81.44 ? 16   DG  C O6    1 
ATOM   547  N  N1    . DG  B 2 14  ? 43.027  12.845 25.302  1.00 81.51 ? 16   DG  C N1    1 
ATOM   548  C  C2    . DG  B 2 14  ? 42.867  13.870 24.402  1.00 81.31 ? 16   DG  C C2    1 
ATOM   549  N  N2    . DG  B 2 14  ? 43.645  14.945 24.587  1.00 80.87 ? 16   DG  C N2    1 
ATOM   550  N  N3    . DG  B 2 14  ? 42.008  13.843 23.395  1.00 81.54 ? 16   DG  C N3    1 
ATOM   551  C  C4    . DG  B 2 14  ? 41.308  12.688 23.359  1.00 81.80 ? 16   DG  C C4    1 
ATOM   552  P  P     . DA  B 2 15  ? 39.823  10.984 17.230  1.00 86.73 ? 17   DA  C P     1 
ATOM   553  O  OP1   . DA  B 2 15  ? 39.233  10.803 15.876  1.00 86.35 ? 17   DA  C OP1   1 
ATOM   554  O  OP2   . DA  B 2 15  ? 40.217  9.788  18.026  1.00 85.97 ? 17   DA  C OP2   1 
ATOM   555  O  "O5'" . DA  B 2 15  ? 41.102  11.927 17.098  1.00 85.96 ? 17   DA  C "O5'" 1 
ATOM   556  C  "C5'" . DA  B 2 15  ? 40.994  13.241 16.512  1.00 84.99 ? 17   DA  C "C5'" 1 
ATOM   557  C  "C4'" . DA  B 2 15  ? 42.264  14.029 16.740  1.00 84.37 ? 17   DA  C "C4'" 1 
ATOM   558  O  "O4'" . DA  B 2 15  ? 42.446  14.289 18.151  1.00 84.09 ? 17   DA  C "O4'" 1 
ATOM   559  C  "C3'" . DA  B 2 15  ? 43.547  13.336 16.294  1.00 84.14 ? 17   DA  C "C3'" 1 
ATOM   560  O  "O3'" . DA  B 2 15  ? 43.797  13.553 14.900  1.00 83.86 ? 17   DA  C "O3'" 1 
ATOM   561  C  "C2'" . DA  B 2 15  ? 44.597  13.976 17.183  1.00 83.71 ? 17   DA  C "C2'" 1 
ATOM   562  C  "C1'" . DA  B 2 15  ? 43.835  14.272 18.475  1.00 83.25 ? 17   DA  C "C1'" 1 
ATOM   563  N  N9    . DA  B 2 15  ? 44.042  13.289 19.542  1.00 82.68 ? 17   DA  C N9    1 
ATOM   564  C  C8    . DA  B 2 15  ? 43.520  12.020 19.643  1.00 82.28 ? 17   DA  C C8    1 
ATOM   565  N  N7    . DA  B 2 15  ? 43.898  11.377 20.722  1.00 82.06 ? 17   DA  C N7    1 
ATOM   566  C  C5    . DA  B 2 15  ? 44.724  12.282 21.377  1.00 82.01 ? 17   DA  C C5    1 
ATOM   567  C  C6    . DA  B 2 15  ? 45.444  12.204 22.584  1.00 81.69 ? 17   DA  C C6    1 
ATOM   568  N  N6    . DA  B 2 15  ? 45.447  11.130 23.378  1.00 81.45 ? 17   DA  C N6    1 
ATOM   569  N  N1    . DA  B 2 15  ? 46.171  13.282 22.952  1.00 81.45 ? 17   DA  C N1    1 
ATOM   570  C  C2    . DA  B 2 15  ? 46.168  14.359 22.156  1.00 81.66 ? 17   DA  C C2    1 
ATOM   571  N  N3    . DA  B 2 15  ? 45.534  14.553 21.001  1.00 82.18 ? 17   DA  C N3    1 
ATOM   572  C  C4    . DA  B 2 15  ? 44.820  13.464 20.662  1.00 82.31 ? 17   DA  C C4    1 
ATOM   573  N  N     . LYS C 3 1   ? 9.548   4.981  3.781   1.00 44.40 ? 297  LYS A N     1 
ATOM   574  C  CA    . LYS C 3 1   ? 9.260   5.247  2.342   1.00 44.55 ? 297  LYS A CA    1 
ATOM   575  C  C     . LYS C 3 1   ? 9.511   6.717  2.013   1.00 43.98 ? 297  LYS A C     1 
ATOM   576  O  O     . LYS C 3 1   ? 8.850   7.606  2.555   1.00 43.77 ? 297  LYS A O     1 
ATOM   577  C  CB    . LYS C 3 1   ? 7.812   4.876  2.025   1.00 46.18 ? 297  LYS A CB    1 
ATOM   578  N  N     . LYS C 3 2   ? 10.470  6.962  1.123   1.00 42.21 ? 298  LYS A N     1 
ATOM   579  C  CA    . LYS C 3 2   ? 10.828  8.318  0.714   1.00 40.21 ? 298  LYS A CA    1 
ATOM   580  C  C     . LYS C 3 2   ? 9.601   9.151  0.353   1.00 37.93 ? 298  LYS A C     1 
ATOM   581  O  O     . LYS C 3 2   ? 8.576   8.615  -0.070  1.00 39.21 ? 298  LYS A O     1 
ATOM   582  C  CB    . LYS C 3 2   ? 11.789  8.262  -0.471  1.00 40.97 ? 298  LYS A CB    1 
ATOM   583  N  N     . MET C 3 3   ? 9.708   10.466 0.526   1.00 33.89 ? 299  MET A N     1 
ATOM   584  C  CA    . MET C 3 3   ? 8.600   11.359 0.204   1.00 28.67 ? 299  MET A CA    1 
ATOM   585  C  C     . MET C 3 3   ? 8.783   11.939 -1.192  1.00 27.26 ? 299  MET A C     1 
ATOM   586  O  O     . MET C 3 3   ? 9.849   12.452 -1.527  1.00 25.60 ? 299  MET A O     1 
ATOM   587  C  CB    . MET C 3 3   ? 8.508   12.497 1.225   1.00 26.33 ? 299  MET A CB    1 
ATOM   588  C  CG    . MET C 3 3   ? 7.380   13.471 0.937   1.00 23.73 ? 299  MET A CG    1 
ATOM   589  S  SD    . MET C 3 3   ? 7.080   14.608 2.297   1.00 20.71 ? 299  MET A SD    1 
ATOM   590  C  CE    . MET C 3 3   ? 6.063   13.566 3.376   1.00 19.57 ? 299  MET A CE    1 
ATOM   591  N  N     . ALA C 3 4   ? 7.732   11.861 -1.998  1.00 25.55 ? 300  ALA A N     1 
ATOM   592  C  CA    . ALA C 3 4   ? 7.785   12.363 -3.362  1.00 25.47 ? 300  ALA A CA    1 
ATOM   593  C  C     . ALA C 3 4   ? 7.696   13.880 -3.443  1.00 24.35 ? 300  ALA A C     1 
ATOM   594  O  O     . ALA C 3 4   ? 6.928   14.511 -2.718  1.00 24.39 ? 300  ALA A O     1 
ATOM   595  C  CB    . ALA C 3 4   ? 6.671   11.742 -4.184  1.00 25.57 ? 300  ALA A CB    1 
ATOM   596  N  N     . PHE C 3 5   ? 8.490   14.453 -4.338  1.00 23.13 ? 301  PHE A N     1 
ATOM   597  C  CA    . PHE C 3 5   ? 8.499   15.892 -4.555  1.00 23.44 ? 301  PHE A CA    1 
ATOM   598  C  C     . PHE C 3 5   ? 9.238   16.182 -5.851  1.00 23.73 ? 301  PHE A C     1 
ATOM   599  O  O     . PHE C 3 5   ? 9.924   15.315 -6.390  1.00 23.57 ? 301  PHE A O     1 
ATOM   600  C  CB    . PHE C 3 5   ? 9.176   16.612 -3.383  1.00 21.66 ? 301  PHE A CB    1 
ATOM   601  C  CG    . PHE C 3 5   ? 10.636  16.301 -3.236  1.00 19.97 ? 301  PHE A CG    1 
ATOM   602  C  CD1   . PHE C 3 5   ? 11.589  17.019 -3.949  1.00 21.63 ? 301  PHE A CD1   1 
ATOM   603  C  CD2   . PHE C 3 5   ? 11.059  15.290 -2.380  1.00 21.47 ? 301  PHE A CD2   1 
ATOM   604  C  CE1   . PHE C 3 5   ? 12.946  16.736 -3.811  1.00 23.07 ? 301  PHE A CE1   1 
ATOM   605  C  CE2   . PHE C 3 5   ? 12.415  14.996 -2.233  1.00 23.13 ? 301  PHE A CE2   1 
ATOM   606  C  CZ    . PHE C 3 5   ? 13.360  15.721 -2.950  1.00 23.25 ? 301  PHE A CZ    1 
ATOM   607  N  N     . THR C 3 6   ? 9.089   17.404 -6.346  1.00 24.56 ? 302  THR A N     1 
ATOM   608  C  CA    . THR C 3 6   ? 9.740   17.815 -7.577  1.00 25.88 ? 302  THR A CA    1 
ATOM   609  C  C     . THR C 3 6   ? 10.957  18.679 -7.284  1.00 26.46 ? 302  THR A C     1 
ATOM   610  O  O     . THR C 3 6   ? 10.841  19.741 -6.672  1.00 24.75 ? 302  THR A O     1 
ATOM   611  C  CB    . THR C 3 6   ? 8.783   18.629 -8.464  1.00 25.63 ? 302  THR A CB    1 
ATOM   612  O  OG1   . THR C 3 6   ? 7.612   17.853 -8.739  1.00 27.02 ? 302  THR A OG1   1 
ATOM   613  C  CG2   . THR C 3 6   ? 9.459   19.007 -9.771  1.00 24.64 ? 302  THR A CG2   1 
ATOM   614  N  N     . LEU C 3 7   ? 12.124  18.219 -7.713  1.00 27.33 ? 303  LEU A N     1 
ATOM   615  C  CA    . LEU C 3 7   ? 13.339  18.993 -7.525  1.00 29.86 ? 303  LEU A CA    1 
ATOM   616  C  C     . LEU C 3 7   ? 13.340  19.887 -8.761  1.00 31.31 ? 303  LEU A C     1 
ATOM   617  O  O     . LEU C 3 7   ? 13.850  19.510 -9.816  1.00 31.06 ? 303  LEU A O     1 
ATOM   618  C  CB    . LEU C 3 7   ? 14.562  18.074 -7.507  1.00 30.53 ? 303  LEU A CB    1 
ATOM   619  C  CG    . LEU C 3 7   ? 15.745  18.556 -6.659  1.00 31.95 ? 303  LEU A CG    1 
ATOM   620  C  CD1   . LEU C 3 7   ? 16.761  17.438 -6.530  1.00 34.93 ? 303  LEU A CD1   1 
ATOM   621  C  CD2   . LEU C 3 7   ? 16.371  19.793 -7.281  1.00 33.46 ? 303  LEU A CD2   1 
ATOM   622  N  N     . ALA C 3 8   ? 12.745  21.068 -8.615  1.00 31.85 ? 304  ALA A N     1 
ATOM   623  C  CA    . ALA C 3 8   ? 12.609  22.025 -9.709  1.00 32.87 ? 304  ALA A CA    1 
ATOM   624  C  C     . ALA C 3 8   ? 13.879  22.755 -10.125 1.00 34.24 ? 304  ALA A C     1 
ATOM   625  O  O     . ALA C 3 8   ? 14.712  23.115 -9.293  1.00 34.39 ? 304  ALA A O     1 
ATOM   626  C  CB    . ALA C 3 8   ? 11.526  23.042 -9.362  1.00 32.17 ? 304  ALA A CB    1 
ATOM   627  N  N     . ASP C 3 9   ? 14.009  22.971 -11.432 1.00 34.84 ? 305  ASP A N     1 
ATOM   628  C  CA    . ASP C 3 9   ? 15.151  23.674 -11.994 1.00 35.56 ? 305  ASP A CA    1 
ATOM   629  C  C     . ASP C 3 9   ? 14.751  25.126 -12.197 1.00 34.51 ? 305  ASP A C     1 
ATOM   630  O  O     . ASP C 3 9   ? 15.602  26.010 -12.286 1.00 35.61 ? 305  ASP A O     1 
ATOM   631  C  CB    . ASP C 3 9   ? 15.551  23.059 -13.337 1.00 38.92 ? 305  ASP A CB    1 
ATOM   632  C  CG    . ASP C 3 9   ? 16.022  21.625 -13.205 1.00 43.34 ? 305  ASP A CG    1 
ATOM   633  O  OD1   . ASP C 3 9   ? 17.019  21.388 -12.488 1.00 45.72 ? 305  ASP A OD1   1 
ATOM   634  O  OD2   . ASP C 3 9   ? 15.396  20.733 -13.818 1.00 46.28 ? 305  ASP A OD2   1 
ATOM   635  N  N     . ARG C 3 10  ? 13.445  25.360 -12.267 1.00 32.85 ? 306  ARG A N     1 
ATOM   636  C  CA    . ARG C 3 10  ? 12.911  26.702 -12.456 1.00 33.04 ? 306  ARG A CA    1 
ATOM   637  C  C     . ARG C 3 10  ? 11.582  26.844 -11.716 1.00 31.24 ? 306  ARG A C     1 
ATOM   638  O  O     . ARG C 3 10  ? 10.925  25.849 -11.412 1.00 29.69 ? 306  ARG A O     1 
ATOM   639  C  CB    . ARG C 3 10  ? 12.694  26.978 -13.945 1.00 35.82 ? 306  ARG A CB    1 
ATOM   640  C  CG    . ARG C 3 10  ? 11.531  26.203 -14.551 1.00 39.31 ? 306  ARG A CG    1 
ATOM   641  C  CD    . ARG C 3 10  ? 11.378  26.478 -16.041 1.00 42.34 ? 306  ARG A CD    1 
ATOM   642  N  NE    . ARG C 3 10  ? 10.157  25.878 -16.575 1.00 45.34 ? 306  ARG A NE    1 
ATOM   643  C  CZ    . ARG C 3 10  ? 8.929   26.321 -16.320 1.00 45.93 ? 306  ARG A CZ    1 
ATOM   644  N  NH1   . ARG C 3 10  ? 8.748   27.380 -15.539 1.00 46.56 ? 306  ARG A NH1   1 
ATOM   645  N  NH2   . ARG C 3 10  ? 7.878   25.703 -16.843 1.00 46.78 ? 306  ARG A NH2   1 
ATOM   646  N  N     . VAL C 3 11  ? 11.195  28.085 -11.436 1.00 30.29 ? 307  VAL A N     1 
ATOM   647  C  CA    . VAL C 3 11  ? 9.945   28.378 -10.742 1.00 28.84 ? 307  VAL A CA    1 
ATOM   648  C  C     . VAL C 3 11  ? 8.768   28.289 -11.706 1.00 29.36 ? 307  VAL A C     1 
ATOM   649  O  O     . VAL C 3 11  ? 8.817   28.843 -12.804 1.00 30.08 ? 307  VAL A O     1 
ATOM   650  C  CB    . VAL C 3 11  ? 9.961   29.802 -10.136 1.00 28.12 ? 307  VAL A CB    1 
ATOM   651  C  CG1   . VAL C 3 11  ? 8.613   30.121 -9.508  1.00 26.04 ? 307  VAL A CG1   1 
ATOM   652  C  CG2   . VAL C 3 11  ? 11.064  29.913 -9.101  1.00 28.16 ? 307  VAL A CG2   1 
ATOM   653  N  N     . THR C 3 12  ? 7.713   27.594 -11.292 1.00 28.65 ? 308  THR A N     1 
ATOM   654  C  CA    . THR C 3 12  ? 6.520   27.453 -12.117 1.00 28.57 ? 308  THR A CA    1 
ATOM   655  C  C     . THR C 3 12  ? 5.333   28.106 -11.418 1.00 29.56 ? 308  THR A C     1 
ATOM   656  O  O     . THR C 3 12  ? 5.379   28.381 -10.216 1.00 28.53 ? 308  THR A O     1 
ATOM   657  C  CB    . THR C 3 12  ? 6.180   25.978 -12.378 1.00 28.22 ? 308  THR A CB    1 
ATOM   658  O  OG1   . THR C 3 12  ? 5.885   25.330 -11.136 1.00 27.88 ? 308  THR A OG1   1 
ATOM   659  C  CG2   . THR C 3 12  ? 7.349   25.275 -13.055 1.00 28.03 ? 308  THR A CG2   1 
ATOM   660  N  N     . GLU C 3 13  ? 4.269   28.343 -12.177 1.00 29.41 ? 309  GLU A N     1 
ATOM   661  C  CA    . GLU C 3 13  ? 3.069   28.976 -11.649 1.00 30.25 ? 309  GLU A CA    1 
ATOM   662  C  C     . GLU C 3 13  ? 2.427   28.225 -10.481 1.00 29.00 ? 309  GLU A C     1 
ATOM   663  O  O     . GLU C 3 13  ? 2.023   28.844 -9.499  1.00 27.47 ? 309  GLU A O     1 
ATOM   664  C  CB    . GLU C 3 13  ? 2.041   29.161 -12.771 1.00 33.31 ? 309  GLU A CB    1 
ATOM   665  C  CG    . GLU C 3 13  ? 0.732   29.790 -12.315 1.00 39.85 ? 309  GLU A CG    1 
ATOM   666  C  CD    . GLU C 3 13  ? -0.237  30.041 -13.460 1.00 44.17 ? 309  GLU A CD    1 
ATOM   667  O  OE1   . GLU C 3 13  ? -1.375  30.484 -13.190 1.00 46.31 ? 309  GLU A OE1   1 
ATOM   668  O  OE2   . GLU C 3 13  ? 0.139   29.799 -14.629 1.00 45.97 ? 309  GLU A OE2   1 
ATOM   669  N  N     . GLU C 3 14  ? 2.334   26.902 -10.575 1.00 27.55 ? 310  GLU A N     1 
ATOM   670  C  CA    . GLU C 3 14  ? 1.711   26.142 -9.498  1.00 27.44 ? 310  GLU A CA    1 
ATOM   671  C  C     . GLU C 3 14  ? 2.463   26.241 -8.179  1.00 25.93 ? 310  GLU A C     1 
ATOM   672  O  O     . GLU C 3 14  ? 1.939   25.868 -7.134  1.00 25.68 ? 310  GLU A O     1 
ATOM   673  C  CB    . GLU C 3 14  ? 1.521   24.671 -9.892  1.00 30.38 ? 310  GLU A CB    1 
ATOM   674  C  CG    . GLU C 3 14  ? 2.742   23.965 -10.428 1.00 33.38 ? 310  GLU A CG    1 
ATOM   675  C  CD    . GLU C 3 14  ? 2.469   22.493 -10.682 1.00 35.89 ? 310  GLU A CD    1 
ATOM   676  O  OE1   . GLU C 3 14  ? 1.368   22.172 -11.179 1.00 37.92 ? 310  GLU A OE1   1 
ATOM   677  O  OE2   . GLU C 3 14  ? 3.351   21.659 -10.393 1.00 36.61 ? 310  GLU A OE2   1 
ATOM   678  N  N     . MET C 3 15  ? 3.688   26.751 -8.226  1.00 24.38 ? 311  MET A N     1 
ATOM   679  C  CA    . MET C 3 15  ? 4.478   26.915 -7.012  1.00 24.03 ? 311  MET A CA    1 
ATOM   680  C  C     . MET C 3 15  ? 4.096   28.214 -6.319  1.00 22.85 ? 311  MET A C     1 
ATOM   681  O  O     . MET C 3 15  ? 4.547   28.489 -5.209  1.00 23.11 ? 311  MET A O     1 
ATOM   682  C  CB    . MET C 3 15  ? 5.968   26.959 -7.340  1.00 22.88 ? 311  MET A CB    1 
ATOM   683  C  CG    . MET C 3 15  ? 6.540   25.659 -7.843  1.00 25.92 ? 311  MET A CG    1 
ATOM   684  S  SD    . MET C 3 15  ? 8.268   25.861 -8.274  1.00 27.06 ? 311  MET A SD    1 
ATOM   685  C  CE    . MET C 3 15  ? 8.419   24.649 -9.591  1.00 26.87 ? 311  MET A CE    1 
ATOM   686  N  N     . LEU C 3 16  ? 3.253   29.005 -6.974  1.00 21.77 ? 312  LEU A N     1 
ATOM   687  C  CA    . LEU C 3 16  ? 2.838   30.293 -6.439  1.00 20.64 ? 312  LEU A CA    1 
ATOM   688  C  C     . LEU C 3 16  ? 1.369   30.369 -6.035  1.00 21.31 ? 312  LEU A C     1 
ATOM   689  O  O     . LEU C 3 16  ? 0.750   31.429 -6.135  1.00 20.59 ? 312  LEU A O     1 
ATOM   690  C  CB    . LEU C 3 16  ? 3.150   31.388 -7.461  1.00 21.28 ? 312  LEU A CB    1 
ATOM   691  C  CG    . LEU C 3 16  ? 4.566   31.284 -8.031  1.00 21.21 ? 312  LEU A CG    1 
ATOM   692  C  CD1   . LEU C 3 16  ? 4.794   32.361 -9.081  1.00 24.78 ? 312  LEU A CD1   1 
ATOM   693  C  CD2   . LEU C 3 16  ? 5.573   31.405 -6.898  1.00 22.72 ? 312  LEU A CD2   1 
ATOM   694  N  N     . ALA C 3 17  ? 0.818   29.249 -5.573  1.00 21.66 ? 313  ALA A N     1 
ATOM   695  C  CA    . ALA C 3 17  ? -0.574  29.200 -5.130  1.00 22.06 ? 313  ALA A CA    1 
ATOM   696  C  C     . ALA C 3 17  ? -0.737  30.178 -3.973  1.00 21.59 ? 313  ALA A C     1 
ATOM   697  O  O     . ALA C 3 17  ? 0.249   30.543 -3.329  1.00 22.15 ? 313  ALA A O     1 
ATOM   698  C  CB    . ALA C 3 17  ? -0.936  27.791 -4.685  1.00 21.67 ? 313  ALA A CB    1 
ATOM   699  N  N     . ASP C 3 18  ? -1.972  30.591 -3.699  1.00 20.41 ? 314  ASP A N     1 
ATOM   700  C  CA    . ASP C 3 18  ? -2.227  31.555 -2.636  1.00 21.93 ? 314  ASP A CA    1 
ATOM   701  C  C     . ASP C 3 18  ? -2.200  31.007 -1.208  1.00 21.23 ? 314  ASP A C     1 
ATOM   702  O  O     . ASP C 3 18  ? -2.529  31.718 -0.259  1.00 19.42 ? 314  ASP A O     1 
ATOM   703  C  CB    . ASP C 3 18  ? -3.545  32.287 -2.888  1.00 24.62 ? 314  ASP A CB    1 
ATOM   704  C  CG    . ASP C 3 18  ? -4.745  31.379 -2.795  1.00 27.42 ? 314  ASP A CG    1 
ATOM   705  O  OD1   . ASP C 3 18  ? -5.875  31.890 -2.944  1.00 30.99 ? 314  ASP A OD1   1 
ATOM   706  O  OD2   . ASP C 3 18  ? -4.565  30.163 -2.577  1.00 26.60 ? 314  ASP A OD2   1 
ATOM   707  N  N     . LYS C 3 19  ? -1.819  29.745 -1.058  1.00 20.13 ? 315  LYS A N     1 
ATOM   708  C  CA    . LYS C 3 19  ? -1.685  29.140 0.264   1.00 20.79 ? 315  LYS A CA    1 
ATOM   709  C  C     . LYS C 3 19  ? -0.688  28.002 0.168   1.00 18.48 ? 315  LYS A C     1 
ATOM   710  O  O     . LYS C 3 19  ? -0.803  27.135 -0.697  1.00 17.68 ? 315  LYS A O     1 
ATOM   711  C  CB    . LYS C 3 19  ? -3.012  28.605 0.811   1.00 21.57 ? 315  LYS A CB    1 
ATOM   712  C  CG    . LYS C 3 19  ? -2.838  28.050 2.232   1.00 25.12 ? 315  LYS A CG    1 
ATOM   713  C  CD    . LYS C 3 19  ? -4.147  27.672 2.898   1.00 27.88 ? 315  LYS A CD    1 
ATOM   714  C  CE    . LYS C 3 19  ? -3.898  27.164 4.319   1.00 28.36 ? 315  LYS A CE    1 
ATOM   715  N  NZ    . LYS C 3 19  ? -3.272  28.200 5.200   1.00 29.31 ? 315  LYS A NZ    1 
ATOM   716  N  N     . ALA C 3 20  ? 0.293   28.003 1.060   1.00 17.93 ? 316  ALA A N     1 
ATOM   717  C  CA    . ALA C 3 20  ? 1.303   26.964 1.031   1.00 16.66 ? 316  ALA A CA    1 
ATOM   718  C  C     . ALA C 3 20  ? 2.143   26.918 2.290   1.00 14.83 ? 316  ALA A C     1 
ATOM   719  O  O     . ALA C 3 20  ? 2.191   27.877 3.059   1.00 16.26 ? 316  ALA A O     1 
ATOM   720  C  CB    . ALA C 3 20  ? 2.219   27.186 -0.165  1.00 17.26 ? 316  ALA A CB    1 
ATOM   721  N  N     . ALA C 3 21  ? 2.803   25.783 2.489   1.00 13.66 ? 317  ALA A N     1 
ATOM   722  C  CA    . ALA C 3 21  ? 3.723   25.620 3.600   1.00 12.18 ? 317  ALA A CA    1 
ATOM   723  C  C     . ALA C 3 21  ? 5.028   26.026 2.922   1.00 14.72 ? 317  ALA A C     1 
ATOM   724  O  O     . ALA C 3 21  ? 5.329   25.553 1.825   1.00 14.53 ? 317  ALA A O     1 
ATOM   725  C  CB    . ALA C 3 21  ? 3.776   24.170 4.040   1.00 12.36 ? 317  ALA A CB    1 
ATOM   726  N  N     . LEU C 3 22  ? 5.797   26.900 3.562   1.00 14.76 ? 318  LEU A N     1 
ATOM   727  C  CA    . LEU C 3 22  ? 7.046   27.377 2.984   1.00 12.90 ? 318  LEU A CA    1 
ATOM   728  C  C     . LEU C 3 22  ? 8.234   27.185 3.913   1.00 13.29 ? 318  LEU A C     1 
ATOM   729  O  O     . LEU C 3 22  ? 8.142   27.445 5.109   1.00 13.97 ? 318  LEU A O     1 
ATOM   730  C  CB    . LEU C 3 22  ? 6.927   28.870 2.647   1.00 12.13 ? 318  LEU A CB    1 
ATOM   731  C  CG    . LEU C 3 22  ? 8.191   29.589 2.164   1.00 13.69 ? 318  LEU A CG    1 
ATOM   732  C  CD1   . LEU C 3 22  ? 8.572   29.092 0.776   1.00 11.22 ? 318  LEU A CD1   1 
ATOM   733  C  CD2   . LEU C 3 22  ? 7.942   31.100 2.133   1.00 12.55 ? 318  LEU A CD2   1 
ATOM   734  N  N     . VAL C 3 23  ? 9.346   26.731 3.348   1.00 12.67 ? 319  VAL A N     1 
ATOM   735  C  CA    . VAL C 3 23  ? 10.571  26.546 4.103   1.00 12.87 ? 319  VAL A CA    1 
ATOM   736  C  C     . VAL C 3 23  ? 11.680  27.300 3.377   1.00 13.94 ? 319  VAL A C     1 
ATOM   737  O  O     . VAL C 3 23  ? 11.953  27.043 2.206   1.00 13.30 ? 319  VAL A O     1 
ATOM   738  C  CB    . VAL C 3 23  ? 10.982  25.049 4.217   1.00 13.56 ? 319  VAL A CB    1 
ATOM   739  C  CG1   . VAL C 3 23  ? 12.370  24.930 4.874   1.00 11.87 ? 319  VAL A CG1   1 
ATOM   740  C  CG2   . VAL C 3 23  ? 9.962   24.285 5.053   1.00 12.90 ? 319  VAL A CG2   1 
ATOM   741  N  N     . VAL C 3 24  ? 12.288  28.250 4.076   1.00 12.82 ? 320  VAL A N     1 
ATOM   742  C  CA    . VAL C 3 24  ? 13.408  29.024 3.549   1.00 13.32 ? 320  VAL A CA    1 
ATOM   743  C  C     . VAL C 3 24  ? 14.456  28.726 4.612   1.00 12.93 ? 320  VAL A C     1 
ATOM   744  O  O     . VAL C 3 24  ? 14.515  29.381 5.652   1.00 14.40 ? 320  VAL A O     1 
ATOM   745  C  CB    . VAL C 3 24  ? 13.080  30.529 3.493   1.00 12.20 ? 320  VAL A CB    1 
ATOM   746  C  CG1   . VAL C 3 24  ? 14.283  31.302 2.960   1.00 14.08 ? 320  VAL A CG1   1 
ATOM   747  C  CG2   . VAL C 3 24  ? 11.867  30.759 2.594   1.00 12.81 ? 320  VAL A CG2   1 
ATOM   748  N  N     . GLU C 3 25  ? 15.272  27.717 4.330   1.00 14.75 ? 321  GLU A N     1 
ATOM   749  C  CA    . GLU C 3 25  ? 16.266  27.212 5.265   1.00 13.20 ? 321  GLU A CA    1 
ATOM   750  C  C     . GLU C 3 25  ? 17.553  27.986 5.493   1.00 15.39 ? 321  GLU A C     1 
ATOM   751  O  O     . GLU C 3 25  ? 18.299  28.284 4.558   1.00 15.60 ? 321  GLU A O     1 
ATOM   752  C  CB    . GLU C 3 25  ? 16.622  25.767 4.876   1.00 15.40 ? 321  GLU A CB    1 
ATOM   753  C  CG    . GLU C 3 25  ? 17.338  24.974 5.968   1.00 16.87 ? 321  GLU A CG    1 
ATOM   754  C  CD    . GLU C 3 25  ? 16.375  24.352 6.968   1.00 18.04 ? 321  GLU A CD    1 
ATOM   755  O  OE1   . GLU C 3 25  ? 15.255  24.871 7.122   1.00 20.35 ? 321  GLU A OE1   1 
ATOM   756  O  OE2   . GLU C 3 25  ? 16.736  23.346 7.604   1.00 17.92 ? 321  GLU A OE2   1 
ATOM   757  N  N     . VAL C 3 26  ? 17.803  28.293 6.761   1.00 14.72 ? 322  VAL A N     1 
ATOM   758  C  CA    . VAL C 3 26  ? 19.016  28.979 7.186   1.00 16.40 ? 322  VAL A CA    1 
ATOM   759  C  C     . VAL C 3 26  ? 19.558  28.073 8.279   1.00 16.79 ? 322  VAL A C     1 
ATOM   760  O  O     . VAL C 3 26  ? 19.018  28.028 9.386   1.00 16.26 ? 322  VAL A O     1 
ATOM   761  C  CB    . VAL C 3 26  ? 18.723  30.370 7.778   1.00 16.10 ? 322  VAL A CB    1 
ATOM   762  C  CG1   . VAL C 3 26  ? 20.029  31.020 8.245   1.00 15.21 ? 322  VAL A CG1   1 
ATOM   763  C  CG2   . VAL C 3 26  ? 18.035  31.236 6.737   1.00 16.62 ? 322  VAL A CG2   1 
ATOM   764  N  N     . VAL C 3 27  ? 20.619  27.342 7.954   1.00 17.66 ? 323  VAL A N     1 
ATOM   765  C  CA    . VAL C 3 27  ? 21.223  26.397 8.885   1.00 19.14 ? 323  VAL A CA    1 
ATOM   766  C  C     . VAL C 3 27  ? 22.066  27.059 9.965   1.00 19.90 ? 323  VAL A C     1 
ATOM   767  O  O     . VAL C 3 27  ? 22.141  26.563 11.091  1.00 18.43 ? 323  VAL A O     1 
ATOM   768  C  CB    . VAL C 3 27  ? 22.068  25.346 8.113   1.00 19.86 ? 323  VAL A CB    1 
ATOM   769  C  CG1   . VAL C 3 27  ? 22.725  24.373 9.080   1.00 20.89 ? 323  VAL A CG1   1 
ATOM   770  C  CG2   . VAL C 3 27  ? 21.172  24.588 7.142   1.00 21.64 ? 323  VAL A CG2   1 
ATOM   771  N  N     . GLU C 3 28  ? 22.703  28.175 9.625   1.00 20.43 ? 324  GLU A N     1 
ATOM   772  C  CA    . GLU C 3 28  ? 23.519  28.903 10.588  1.00 21.77 ? 324  GLU A CA    1 
ATOM   773  C  C     . GLU C 3 28  ? 22.653  29.302 11.779  1.00 21.38 ? 324  GLU A C     1 
ATOM   774  O  O     . GLU C 3 28  ? 21.549  29.804 11.593  1.00 22.58 ? 324  GLU A O     1 
ATOM   775  C  CB    . GLU C 3 28  ? 24.095  30.166 9.946   1.00 24.39 ? 324  GLU A CB    1 
ATOM   776  C  CG    . GLU C 3 28  ? 25.166  29.910 8.911   1.00 31.69 ? 324  GLU A CG    1 
ATOM   777  C  CD    . GLU C 3 28  ? 26.379  29.243 9.512   1.00 36.23 ? 324  GLU A CD    1 
ATOM   778  O  OE1   . GLU C 3 28  ? 26.900  29.767 10.520  1.00 38.81 ? 324  GLU A OE1   1 
ATOM   779  O  OE2   . GLU C 3 28  ? 26.811  28.198 8.982   1.00 39.87 ? 324  GLU A OE2   1 
ATOM   780  N  N     . GLU C 3 29  ? 23.155  29.077 12.991  1.00 20.76 ? 325  GLU A N     1 
ATOM   781  C  CA    . GLU C 3 29  ? 22.432  29.423 14.217  1.00 22.99 ? 325  GLU A CA    1 
ATOM   782  C  C     . GLU C 3 29  ? 22.059  30.895 14.192  1.00 19.97 ? 325  GLU A C     1 
ATOM   783  O  O     . GLU C 3 29  ? 20.906  31.268 14.414  1.00 18.30 ? 325  GLU A O     1 
ATOM   784  C  CB    . GLU C 3 29  ? 23.308  29.151 15.442  1.00 27.70 ? 325  GLU A CB    1 
ATOM   785  C  CG    . GLU C 3 29  ? 23.479  27.682 15.772  1.00 36.55 ? 325  GLU A CG    1 
ATOM   786  C  CD    . GLU C 3 29  ? 22.416  27.187 16.726  1.00 40.81 ? 325  GLU A CD    1 
ATOM   787  O  OE1   . GLU C 3 29  ? 22.438  27.604 17.905  1.00 43.55 ? 325  GLU A OE1   1 
ATOM   788  O  OE2   . GLU C 3 29  ? 21.554  26.391 16.297  1.00 45.40 ? 325  GLU A OE2   1 
ATOM   789  N  N     . ASN C 3 30  ? 23.053  31.732 13.928  1.00 17.66 ? 326  ASN A N     1 
ATOM   790  C  CA    . ASN C 3 30  ? 22.832  33.166 13.850  1.00 15.23 ? 326  ASN A CA    1 
ATOM   791  C  C     . ASN C 3 30  ? 22.493  33.436 12.386  1.00 15.33 ? 326  ASN A C     1 
ATOM   792  O  O     . ASN C 3 30  ? 23.359  33.339 11.516  1.00 15.46 ? 326  ASN A O     1 
ATOM   793  C  CB    . ASN C 3 30  ? 24.100  33.915 14.253  1.00 17.69 ? 326  ASN A CB    1 
ATOM   794  C  CG    . ASN C 3 30  ? 23.884  35.408 14.337  1.00 18.15 ? 326  ASN A CG    1 
ATOM   795  O  OD1   . ASN C 3 30  ? 23.276  36.002 13.450  1.00 17.75 ? 326  ASN A OD1   1 
ATOM   796  N  ND2   . ASN C 3 30  ? 24.383  36.024 15.401  1.00 20.80 ? 326  ASN A ND2   1 
ATOM   797  N  N     . TYR C 3 31  ? 21.234  33.775 12.119  1.00 12.63 ? 327  TYR A N     1 
ATOM   798  C  CA    . TYR C 3 31  ? 20.772  33.998 10.751  1.00 12.54 ? 327  TYR A CA    1 
ATOM   799  C  C     . TYR C 3 31  ? 21.051  35.357 10.113  1.00 12.54 ? 327  TYR A C     1 
ATOM   800  O  O     . TYR C 3 31  ? 20.619  35.610 8.988   1.00 13.01 ? 327  TYR A O     1 
ATOM   801  C  CB    . TYR C 3 31  ? 19.272  33.704 10.674  1.00 12.06 ? 327  TYR A CB    1 
ATOM   802  C  CG    . TYR C 3 31  ? 18.438  34.382 11.746  1.00 11.08 ? 327  TYR A CG    1 
ATOM   803  C  CD1   . TYR C 3 31  ? 18.257  35.767 11.753  1.00 11.94 ? 327  TYR A CD1   1 
ATOM   804  C  CD2   . TYR C 3 31  ? 17.787  33.628 12.729  1.00 13.68 ? 327  TYR A CD2   1 
ATOM   805  C  CE1   . TYR C 3 31  ? 17.439  36.386 12.711  1.00 13.30 ? 327  TYR A CE1   1 
ATOM   806  C  CE2   . TYR C 3 31  ? 16.973  34.236 13.690  1.00 13.16 ? 327  TYR A CE2   1 
ATOM   807  C  CZ    . TYR C 3 31  ? 16.801  35.611 13.673  1.00 12.46 ? 327  TYR A CZ    1 
ATOM   808  O  OH    . TYR C 3 31  ? 15.985  36.208 14.612  1.00 12.57 ? 327  TYR A OH    1 
ATOM   809  N  N     . HIS C 3 32  ? 21.779  36.224 10.808  1.00 13.09 ? 328  HIS A N     1 
ATOM   810  C  CA    . HIS C 3 32  ? 22.066  37.538 10.257  1.00 13.20 ? 328  HIS A CA    1 
ATOM   811  C  C     . HIS C 3 32  ? 23.060  37.457 9.107   1.00 12.97 ? 328  HIS A C     1 
ATOM   812  O  O     . HIS C 3 32  ? 24.187  36.986 9.281   1.00 14.52 ? 328  HIS A O     1 
ATOM   813  C  CB    . HIS C 3 32  ? 22.571  38.478 11.354  1.00 13.48 ? 328  HIS A CB    1 
ATOM   814  C  CG    . HIS C 3 32  ? 21.483  38.992 12.248  1.00 13.68 ? 328  HIS A CG    1 
ATOM   815  N  ND1   . HIS C 3 32  ? 20.457  39.792 11.787  1.00 14.41 ? 328  HIS A ND1   1 
ATOM   816  C  CD2   . HIS C 3 32  ? 21.242  38.794 13.566  1.00 13.90 ? 328  HIS A CD2   1 
ATOM   817  C  CE1   . HIS C 3 32  ? 19.632  40.065 12.783  1.00 13.30 ? 328  HIS A CE1   1 
ATOM   818  N  NE2   . HIS C 3 32  ? 20.085  39.471 13.873  1.00 14.28 ? 328  HIS A NE2   1 
ATOM   819  N  N     . ASP C 3 33  ? 22.616  37.916 7.936   1.00 12.31 ? 329  ASP A N     1 
ATOM   820  C  CA    . ASP C 3 33  ? 23.415  37.919 6.711   1.00 14.00 ? 329  ASP A CA    1 
ATOM   821  C  C     . ASP C 3 33  ? 23.924  36.506 6.438   1.00 14.94 ? 329  ASP A C     1 
ATOM   822  O  O     . ASP C 3 33  ? 24.998  36.310 5.863   1.00 14.68 ? 329  ASP A O     1 
ATOM   823  C  CB    . ASP C 3 33  ? 24.588  38.900 6.852   1.00 14.34 ? 329  ASP A CB    1 
ATOM   824  C  CG    . ASP C 3 33  ? 24.961  39.566 5.531   1.00 14.33 ? 329  ASP A CG    1 
ATOM   825  O  OD1   . ASP C 3 33  ? 24.191  39.444 4.555   1.00 12.97 ? 329  ASP A OD1   1 
ATOM   826  O  OD2   . ASP C 3 33  ? 26.016  40.232 5.480   1.00 12.45 ? 329  ASP A OD2   1 
ATOM   827  N  N     . ALA C 3 34  ? 23.129  35.522 6.850   1.00 13.84 ? 330  ALA A N     1 
ATOM   828  C  CA    . ALA C 3 34  ? 23.485  34.120 6.672   1.00 13.61 ? 330  ALA A CA    1 
ATOM   829  C  C     . ALA C 3 34  ? 22.928  33.579 5.366   1.00 14.56 ? 330  ALA A C     1 
ATOM   830  O  O     . ALA C 3 34  ? 21.988  34.132 4.796   1.00 15.67 ? 330  ALA A O     1 
ATOM   831  C  CB    . ALA C 3 34  ? 22.963  33.296 7.848   1.00 12.60 ? 330  ALA A CB    1 
ATOM   832  N  N     . PRO C 3 35  ? 23.505  32.482 4.866   1.00 16.29 ? 331  PRO A N     1 
ATOM   833  C  CA    . PRO C 3 35  ? 22.958  31.975 3.612   1.00 16.59 ? 331  PRO A CA    1 
ATOM   834  C  C     . PRO C 3 35  ? 21.671  31.175 3.755   1.00 16.42 ? 331  PRO A C     1 
ATOM   835  O  O     . PRO C 3 35  ? 21.366  30.630 4.816   1.00 17.13 ? 331  PRO A O     1 
ATOM   836  C  CB    . PRO C 3 35  ? 24.110  31.154 3.033   1.00 20.21 ? 331  PRO A CB    1 
ATOM   837  C  CG    . PRO C 3 35  ? 24.823  30.665 4.238   1.00 20.04 ? 331  PRO A CG    1 
ATOM   838  C  CD    . PRO C 3 35  ? 24.793  31.842 5.191   1.00 16.92 ? 331  PRO A CD    1 
ATOM   839  N  N     . ILE C 3 36  ? 20.912  31.135 2.670   1.00 15.05 ? 332  ILE A N     1 
ATOM   840  C  CA    . ILE C 3 36  ? 19.686  30.360 2.607   1.00 16.47 ? 332  ILE A CA    1 
ATOM   841  C  C     . ILE C 3 36  ? 20.155  29.170 1.771   1.00 17.13 ? 332  ILE A C     1 
ATOM   842  O  O     . ILE C 3 36  ? 20.564  29.336 0.624   1.00 16.85 ? 332  ILE A O     1 
ATOM   843  C  CB    . ILE C 3 36  ? 18.581  31.170 1.912   1.00 17.56 ? 332  ILE A CB    1 
ATOM   844  C  CG1   . ILE C 3 36  ? 18.193  32.345 2.823   1.00 18.46 ? 332  ILE A CG1   1 
ATOM   845  C  CG2   . ILE C 3 36  ? 17.382  30.282 1.603   1.00 17.53 ? 332  ILE A CG2   1 
ATOM   846  C  CD1   . ILE C 3 36  ? 17.216  33.341 2.212   1.00 18.02 ? 332  ILE A CD1   1 
ATOM   847  N  N     . VAL C 3 37  ? 20.115  27.976 2.355   1.00 17.91 ? 333  VAL A N     1 
ATOM   848  C  CA    . VAL C 3 37  ? 20.613  26.776 1.681   1.00 19.68 ? 333  VAL A CA    1 
ATOM   849  C  C     . VAL C 3 37  ? 19.633  26.029 0.792   1.00 18.90 ? 333  VAL A C     1 
ATOM   850  O  O     . VAL C 3 37  ? 20.030  25.186 -0.013  1.00 19.79 ? 333  VAL A O     1 
ATOM   851  C  CB    . VAL C 3 37  ? 21.193  25.777 2.709   1.00 19.87 ? 333  VAL A CB    1 
ATOM   852  C  CG1   . VAL C 3 37  ? 22.198  26.485 3.606   1.00 21.37 ? 333  VAL A CG1   1 
ATOM   853  C  CG2   . VAL C 3 37  ? 20.077  25.163 3.536   1.00 17.74 ? 333  VAL A CG2   1 
ATOM   854  N  N     . GLY C 3 38  ? 18.353  26.333 0.934   1.00 18.80 ? 334  GLY A N     1 
ATOM   855  C  CA    . GLY C 3 38  ? 17.361  25.656 0.129   1.00 18.13 ? 334  GLY A CA    1 
ATOM   856  C  C     . GLY C 3 38  ? 15.976  26.162 0.442   1.00 16.97 ? 334  GLY A C     1 
ATOM   857  O  O     . GLY C 3 38  ? 15.753  26.800 1.475   1.00 17.33 ? 334  GLY A O     1 
ATOM   858  N  N     . ILE C 3 39  ? 15.043  25.862 -0.449  1.00 17.30 ? 335  ILE A N     1 
ATOM   859  C  CA    . ILE C 3 39  ? 13.667  26.291 -0.296  1.00 17.02 ? 335  ILE A CA    1 
ATOM   860  C  C     . ILE C 3 39  ? 12.717  25.152 -0.652  1.00 18.15 ? 335  ILE A C     1 
ATOM   861  O  O     . ILE C 3 39  ? 12.949  24.404 -1.604  1.00 17.64 ? 335  ILE A O     1 
ATOM   862  C  CB    . ILE C 3 39  ? 13.387  27.517 -1.205  1.00 18.01 ? 335  ILE A CB    1 
ATOM   863  C  CG1   . ILE C 3 39  ? 14.180  28.724 -0.690  1.00 19.38 ? 335  ILE A CG1   1 
ATOM   864  C  CG2   . ILE C 3 39  ? 11.891  27.820 -1.247  1.00 17.41 ? 335  ILE A CG2   1 
ATOM   865  C  CD1   . ILE C 3 39  ? 14.131  29.940 -1.592  1.00 18.65 ? 335  ILE A CD1   1 
ATOM   866  N  N     . ALA C 3 40  ? 11.649  25.016 0.124   1.00 16.90 ? 336  ALA A N     1 
ATOM   867  C  CA    . ALA C 3 40  ? 10.666  23.979 -0.139  1.00 14.54 ? 336  ALA A CA    1 
ATOM   868  C  C     . ALA C 3 40  ? 9.278   24.587 -0.065  1.00 16.38 ? 336  ALA A C     1 
ATOM   869  O  O     . ALA C 3 40  ? 9.002   25.441 0.781   1.00 13.34 ? 336  ALA A O     1 
ATOM   870  C  CB    . ALA C 3 40  ? 10.799  22.847 0.870   1.00 15.54 ? 336  ALA A CB    1 
ATOM   871  N  N     . VAL C 3 41  ? 8.413   24.147 -0.968  1.00 15.35 ? 337  VAL A N     1 
ATOM   872  C  CA    . VAL C 3 41  ? 7.043   24.624 -1.014  1.00 16.48 ? 337  VAL A CA    1 
ATOM   873  C  C     . VAL C 3 41  ? 6.114   23.430 -1.130  1.00 17.45 ? 337  VAL A C     1 
ATOM   874  O  O     . VAL C 3 41  ? 6.328   22.540 -1.953  1.00 17.53 ? 337  VAL A O     1 
ATOM   875  C  CB    . VAL C 3 41  ? 6.788   25.550 -2.240  1.00 17.18 ? 337  VAL A CB    1 
ATOM   876  C  CG1   . VAL C 3 41  ? 5.301   25.862 -2.354  1.00 17.68 ? 337  VAL A CG1   1 
ATOM   877  C  CG2   . VAL C 3 41  ? 7.577   26.841 -2.108  1.00 15.84 ? 337  VAL A CG2   1 
ATOM   878  N  N     . VAL C 3 42  ? 5.089   23.409 -0.290  1.00 17.66 ? 338  VAL A N     1 
ATOM   879  C  CA    . VAL C 3 42  ? 4.089   22.355 -0.336  1.00 16.79 ? 338  VAL A CA    1 
ATOM   880  C  C     . VAL C 3 42  ? 2.749   23.066 -0.402  1.00 17.35 ? 338  VAL A C     1 
ATOM   881  O  O     . VAL C 3 42  ? 2.429   23.878 0.465   1.00 16.67 ? 338  VAL A O     1 
ATOM   882  C  CB    . VAL C 3 42  ? 4.105   21.455 0.922   1.00 18.84 ? 338  VAL A CB    1 
ATOM   883  C  CG1   . VAL C 3 42  ? 2.867   20.547 0.919   1.00 18.26 ? 338  VAL A CG1   1 
ATOM   884  C  CG2   . VAL C 3 42  ? 5.357   20.607 0.947   1.00 16.24 ? 338  VAL A CG2   1 
ATOM   885  N  N     . ASN C 3 43  ? 1.971   22.776 -1.438  1.00 17.15 ? 339  ASN A N     1 
ATOM   886  C  CA    . ASN C 3 43  ? 0.657   23.387 -1.579  1.00 17.95 ? 339  ASN A CA    1 
ATOM   887  C  C     . ASN C 3 43  ? -0.293  22.379 -2.222  1.00 18.56 ? 339  ASN A C     1 
ATOM   888  O  O     . ASN C 3 43  ? 0.045   21.207 -2.360  1.00 18.67 ? 339  ASN A O     1 
ATOM   889  C  CB    . ASN C 3 43  ? 0.728   24.676 -2.415  1.00 17.47 ? 339  ASN A CB    1 
ATOM   890  C  CG    . ASN C 3 43  ? 1.316   24.452 -3.791  1.00 19.97 ? 339  ASN A CG    1 
ATOM   891  O  OD1   . ASN C 3 43  ? 1.113   23.400 -4.398  1.00 18.21 ? 339  ASN A OD1   1 
ATOM   892  N  ND2   . ASN C 3 43  ? 2.037   25.449 -4.300  1.00 18.88 ? 339  ASN A ND2   1 
ATOM   893  N  N     . GLU C 3 44  ? -1.477  22.837 -2.607  1.00 21.92 ? 340  GLU A N     1 
ATOM   894  C  CA    . GLU C 3 44  ? -2.479  21.966 -3.212  1.00 23.48 ? 340  GLU A CA    1 
ATOM   895  C  C     . GLU C 3 44  ? -1.983  21.228 -4.453  1.00 23.38 ? 340  GLU A C     1 
ATOM   896  O  O     . GLU C 3 44  ? -2.483  20.151 -4.778  1.00 23.22 ? 340  GLU A O     1 
ATOM   897  C  CB    . GLU C 3 44  ? -3.721  22.786 -3.574  1.00 27.41 ? 340  GLU A CB    1 
ATOM   898  C  CG    . GLU C 3 44  ? -3.444  23.896 -4.583  1.00 32.37 ? 340  GLU A CG    1 
ATOM   899  C  CD    . GLU C 3 44  ? -4.615  24.851 -4.754  1.00 36.78 ? 340  GLU A CD    1 
ATOM   900  O  OE1   . GLU C 3 44  ? -5.687  24.407 -5.217  1.00 38.01 ? 340  GLU A OE1   1 
ATOM   901  O  OE2   . GLU C 3 44  ? -4.461  26.047 -4.422  1.00 38.74 ? 340  GLU A OE2   1 
ATOM   902  N  N     . HIS C 3 45  ? -0.994  21.801 -5.133  1.00 22.03 ? 341  HIS A N     1 
ATOM   903  C  CA    . HIS C 3 45  ? -0.455  21.221 -6.359  1.00 24.21 ? 341  HIS A CA    1 
ATOM   904  C  C     . HIS C 3 45  ? 0.665   20.206 -6.174  1.00 23.81 ? 341  HIS A C     1 
ATOM   905  O  O     . HIS C 3 45  ? 1.033   19.509 -7.121  1.00 25.22 ? 341  HIS A O     1 
ATOM   906  C  CB    . HIS C 3 45  ? 0.030   22.337 -7.288  1.00 24.44 ? 341  HIS A CB    1 
ATOM   907  C  CG    . HIS C 3 45  ? -1.009  23.375 -7.576  1.00 25.93 ? 341  HIS A CG    1 
ATOM   908  N  ND1   . HIS C 3 45  ? -2.203  23.081 -8.198  1.00 26.22 ? 341  HIS A ND1   1 
ATOM   909  C  CD2   . HIS C 3 45  ? -1.040  24.703 -7.313  1.00 25.49 ? 341  HIS A CD2   1 
ATOM   910  C  CE1   . HIS C 3 45  ? -2.925  24.182 -8.304  1.00 27.43 ? 341  HIS A CE1   1 
ATOM   911  N  NE2   . HIS C 3 45  ? -2.242  25.181 -7.774  1.00 27.24 ? 341  HIS A NE2   1 
ATOM   912  N  N     . GLY C 3 46  ? 1.215   20.119 -4.969  1.00 22.91 ? 342  GLY A N     1 
ATOM   913  C  CA    . GLY C 3 46  ? 2.279   19.163 -4.735  1.00 21.42 ? 342  GLY A CA    1 
ATOM   914  C  C     . GLY C 3 46  ? 3.376   19.667 -3.824  1.00 20.60 ? 342  GLY A C     1 
ATOM   915  O  O     . GLY C 3 46  ? 3.188   20.631 -3.084  1.00 20.51 ? 342  GLY A O     1 
ATOM   916  N  N     . ARG C 3 47  ? 4.528   19.006 -3.881  1.00 19.01 ? 343  ARG A N     1 
ATOM   917  C  CA    . ARG C 3 47  ? 5.677   19.367 -3.059  1.00 19.23 ? 343  ARG A CA    1 
ATOM   918  C  C     . ARG C 3 47  ? 6.825   19.754 -3.981  1.00 20.09 ? 343  ARG A C     1 
ATOM   919  O  O     . ARG C 3 47  ? 7.082   19.067 -4.972  1.00 19.57 ? 343  ARG A O     1 
ATOM   920  C  CB    . ARG C 3 47  ? 6.095   18.179 -2.199  1.00 18.93 ? 343  ARG A CB    1 
ATOM   921  C  CG    . ARG C 3 47  ? 4.935   17.446 -1.548  1.00 19.46 ? 343  ARG A CG    1 
ATOM   922  C  CD    . ARG C 3 47  ? 5.429   16.521 -0.452  1.00 20.72 ? 343  ARG A CD    1 
ATOM   923  N  NE    . ARG C 3 47  ? 4.359   15.696 0.103   1.00 21.34 ? 343  ARG A NE    1 
ATOM   924  C  CZ    . ARG C 3 47  ? 3.985   14.519 -0.391  1.00 22.84 ? 343  ARG A CZ    1 
ATOM   925  N  NH1   . ARG C 3 47  ? 4.598   14.020 -1.456  1.00 22.02 ? 343  ARG A NH1   1 
ATOM   926  N  NH2   . ARG C 3 47  ? 3.000   13.839 0.183   1.00 22.26 ? 343  ARG A NH2   1 
ATOM   927  N  N     . PHE C 3 48  ? 7.518   20.842 -3.654  1.00 19.26 ? 344  PHE A N     1 
ATOM   928  C  CA    . PHE C 3 48  ? 8.617   21.305 -4.490  1.00 20.84 ? 344  PHE A CA    1 
ATOM   929  C  C     . PHE C 3 48  ? 9.856   21.734 -3.713  1.00 21.34 ? 344  PHE A C     1 
ATOM   930  O  O     . PHE C 3 48  ? 9.762   22.219 -2.586  1.00 21.06 ? 344  PHE A O     1 
ATOM   931  C  CB    . PHE C 3 48  ? 8.173   22.500 -5.347  1.00 19.89 ? 344  PHE A CB    1 
ATOM   932  C  CG    . PHE C 3 48  ? 6.829   22.327 -5.992  1.00 22.10 ? 344  PHE A CG    1 
ATOM   933  C  CD1   . PHE C 3 48  ? 5.663   22.602 -5.286  1.00 21.98 ? 344  PHE A CD1   1 
ATOM   934  C  CD2   . PHE C 3 48  ? 6.729   21.888 -7.309  1.00 21.57 ? 344  PHE A CD2   1 
ATOM   935  C  CE1   . PHE C 3 48  ? 4.416   22.445 -5.882  1.00 22.54 ? 344  PHE A CE1   1 
ATOM   936  C  CE2   . PHE C 3 48  ? 5.487   21.726 -7.915  1.00 22.59 ? 344  PHE A CE2   1 
ATOM   937  C  CZ    . PHE C 3 48  ? 4.327   22.005 -7.201  1.00 24.58 ? 344  PHE A CZ    1 
ATOM   938  N  N     . PHE C 3 49  ? 11.017  21.539 -4.329  1.00 19.90 ? 345  PHE A N     1 
ATOM   939  C  CA    . PHE C 3 49  ? 12.279  21.977 -3.751  1.00 20.62 ? 345  PHE A CA    1 
ATOM   940  C  C     . PHE C 3 49  ? 12.875  22.914 -4.794  1.00 20.99 ? 345  PHE A C     1 
ATOM   941  O  O     . PHE C 3 49  ? 12.875  22.603 -5.987  1.00 21.20 ? 345  PHE A O     1 
ATOM   942  C  CB    . PHE C 3 49  ? 13.259  20.825 -3.525  1.00 19.66 ? 345  PHE A CB    1 
ATOM   943  C  CG    . PHE C 3 49  ? 14.628  21.287 -3.088  1.00 20.22 ? 345  PHE A CG    1 
ATOM   944  C  CD1   . PHE C 3 49  ? 14.878  21.615 -1.759  1.00 19.29 ? 345  PHE A CD1   1 
ATOM   945  C  CD2   . PHE C 3 49  ? 15.658  21.427 -4.016  1.00 20.38 ? 345  PHE A CD2   1 
ATOM   946  C  CE1   . PHE C 3 49  ? 16.132  22.077 -1.355  1.00 21.01 ? 345  PHE A CE1   1 
ATOM   947  C  CE2   . PHE C 3 49  ? 16.918  21.890 -3.625  1.00 22.66 ? 345  PHE A CE2   1 
ATOM   948  C  CZ    . PHE C 3 49  ? 17.155  22.217 -2.292  1.00 21.26 ? 345  PHE A CZ    1 
ATOM   949  N  N     . LEU C 3 50  ? 13.375  24.058 -4.346  1.00 20.66 ? 346  LEU A N     1 
ATOM   950  C  CA    . LEU C 3 50  ? 13.981  25.036 -5.239  1.00 20.40 ? 346  LEU A CA    1 
ATOM   951  C  C     . LEU C 3 50  ? 15.339  25.447 -4.716  1.00 21.45 ? 346  LEU A C     1 
ATOM   952  O  O     . LEU C 3 50  ? 15.511  25.656 -3.517  1.00 20.24 ? 346  LEU A O     1 
ATOM   953  C  CB    . LEU C 3 50  ? 13.103  26.281 -5.349  1.00 22.29 ? 346  LEU A CB    1 
ATOM   954  C  CG    . LEU C 3 50  ? 11.822  26.179 -6.172  1.00 22.27 ? 346  LEU A CG    1 
ATOM   955  C  CD1   . LEU C 3 50  ? 10.943  27.394 -5.907  1.00 22.70 ? 346  LEU A CD1   1 
ATOM   956  C  CD2   . LEU C 3 50  ? 12.178  26.076 -7.647  1.00 23.36 ? 346  LEU A CD2   1 
ATOM   957  N  N     . ARG C 3 51  ? 16.310  25.555 -5.613  1.00 21.28 ? 347  ARG A N     1 
ATOM   958  C  CA    . ARG C 3 51  ? 17.636  25.988 -5.212  1.00 23.07 ? 347  ARG A CA    1 
ATOM   959  C  C     . ARG C 3 51  ? 17.481  27.475 -4.940  1.00 21.96 ? 347  ARG A C     1 
ATOM   960  O  O     . ARG C 3 51  ? 16.814  28.180 -5.690  1.00 21.64 ? 347  ARG A O     1 
ATOM   961  C  CB    . ARG C 3 51  ? 18.644  25.733 -6.335  1.00 24.32 ? 347  ARG A CB    1 
ATOM   962  C  CG    . ARG C 3 51  ? 18.795  24.253 -6.656  1.00 26.23 ? 347  ARG A CG    1 
ATOM   963  C  CD    . ARG C 3 51  ? 19.899  23.979 -7.668  1.00 29.92 ? 347  ARG A CD    1 
ATOM   964  N  NE    . ARG C 3 51  ? 20.000  22.548 -7.945  1.00 33.60 ? 347  ARG A NE    1 
ATOM   965  C  CZ    . ARG C 3 51  ? 19.162  21.873 -8.728  1.00 35.05 ? 347  ARG A CZ    1 
ATOM   966  N  NH1   . ARG C 3 51  ? 18.156  22.498 -9.327  1.00 37.15 ? 347  ARG A NH1   1 
ATOM   967  N  NH2   . ARG C 3 51  ? 19.323  20.568 -8.905  1.00 35.05 ? 347  ARG A NH2   1 
ATOM   968  N  N     . PRO C 3 52  ? 18.094  27.973 -3.859  1.00 23.87 ? 348  PRO A N     1 
ATOM   969  C  CA    . PRO C 3 52  ? 17.989  29.393 -3.514  1.00 25.30 ? 348  PRO A CA    1 
ATOM   970  C  C     . PRO C 3 52  ? 18.452  30.364 -4.594  1.00 26.40 ? 348  PRO A C     1 
ATOM   971  O  O     . PRO C 3 52  ? 17.793  31.373 -4.848  1.00 25.76 ? 348  PRO A O     1 
ATOM   972  C  CB    . PRO C 3 52  ? 18.799  29.497 -2.226  1.00 26.35 ? 348  PRO A CB    1 
ATOM   973  C  CG    . PRO C 3 52  ? 19.849  28.431 -2.409  1.00 27.20 ? 348  PRO A CG    1 
ATOM   974  C  CD    . PRO C 3 52  ? 19.044  27.281 -2.970  1.00 24.18 ? 348  PRO A CD    1 
ATOM   975  N  N     . GLU C 3 53  ? 19.576  30.060 -5.235  1.00 28.82 ? 349  GLU A N     1 
ATOM   976  C  CA    . GLU C 3 53  ? 20.091  30.948 -6.269  1.00 31.88 ? 349  GLU A CA    1 
ATOM   977  C  C     . GLU C 3 53  ? 19.078  31.170 -7.385  1.00 31.70 ? 349  GLU A C     1 
ATOM   978  O  O     . GLU C 3 53  ? 18.970  32.275 -7.913  1.00 33.70 ? 349  GLU A O     1 
ATOM   979  C  CB    . GLU C 3 53  ? 21.409  30.414 -6.852  1.00 34.11 ? 349  GLU A CB    1 
ATOM   980  C  CG    . GLU C 3 53  ? 21.353  29.009 -7.439  1.00 39.10 ? 349  GLU A CG    1 
ATOM   981  C  CD    . GLU C 3 53  ? 21.485  27.916 -6.390  1.00 41.47 ? 349  GLU A CD    1 
ATOM   982  O  OE1   . GLU C 3 53  ? 21.651  26.740 -6.783  1.00 44.01 ? 349  GLU A OE1   1 
ATOM   983  O  OE2   . GLU C 3 53  ? 21.424  28.224 -5.179  1.00 41.95 ? 349  GLU A OE2   1 
ATOM   984  N  N     . THR C 3 54  ? 18.324  30.132 -7.734  1.00 29.86 ? 350  THR A N     1 
ATOM   985  C  CA    . THR C 3 54  ? 17.336  30.264 -8.797  1.00 29.00 ? 350  THR A CA    1 
ATOM   986  C  C     . THR C 3 54  ? 16.048  30.911 -8.288  1.00 26.57 ? 350  THR A C     1 
ATOM   987  O  O     . THR C 3 54  ? 15.547  31.862 -8.884  1.00 26.16 ? 350  THR A O     1 
ATOM   988  C  CB    . THR C 3 54  ? 16.995  28.893 -9.432  1.00 30.12 ? 350  THR A CB    1 
ATOM   989  O  OG1   . THR C 3 54  ? 16.151  28.143 -8.551  1.00 35.31 ? 350  THR A OG1   1 
ATOM   990  C  CG2   . THR C 3 54  ? 18.262  28.099 -9.687  1.00 30.17 ? 350  THR A CG2   1 
ATOM   991  N  N     . ALA C 3 55  ? 15.523  30.409 -7.177  1.00 23.99 ? 351  ALA A N     1 
ATOM   992  C  CA    . ALA C 3 55  ? 14.290  30.947 -6.619  1.00 21.24 ? 351  ALA A CA    1 
ATOM   993  C  C     . ALA C 3 55  ? 14.385  32.425 -6.257  1.00 20.54 ? 351  ALA A C     1 
ATOM   994  O  O     . ALA C 3 55  ? 13.536  33.224 -6.644  1.00 19.40 ? 351  ALA A O     1 
ATOM   995  C  CB    . ALA C 3 55  ? 13.884  30.146 -5.396  1.00 21.73 ? 351  ALA A CB    1 
ATOM   996  N  N     . LEU C 3 56  ? 15.425  32.795 -5.520  1.00 20.08 ? 352  LEU A N     1 
ATOM   997  C  CA    . LEU C 3 56  ? 15.570  34.175 -5.094  1.00 21.70 ? 352  LEU A CA    1 
ATOM   998  C  C     . LEU C 3 56  ? 15.931  35.164 -6.197  1.00 24.28 ? 352  LEU A C     1 
ATOM   999  O  O     . LEU C 3 56  ? 15.949  36.371 -5.969  1.00 24.38 ? 352  LEU A O     1 
ATOM   1000 C  CB    . LEU C 3 56  ? 16.576  34.256 -3.948  1.00 21.83 ? 352  LEU A CB    1 
ATOM   1001 C  CG    . LEU C 3 56  ? 16.158  33.428 -2.725  1.00 23.43 ? 352  LEU A CG    1 
ATOM   1002 C  CD1   . LEU C 3 56  ? 17.129  33.677 -1.588  1.00 22.73 ? 352  LEU A CD1   1 
ATOM   1003 C  CD2   . LEU C 3 56  ? 14.743  33.803 -2.296  1.00 20.35 ? 352  LEU A CD2   1 
ATOM   1004 N  N     . ALA C 3 57  ? 16.209  34.656 -7.393  1.00 25.18 ? 353  ALA A N     1 
ATOM   1005 C  CA    . ALA C 3 57  ? 16.546  35.521 -8.516  1.00 27.40 ? 353  ALA A CA    1 
ATOM   1006 C  C     . ALA C 3 57  ? 15.343  35.642 -9.449  1.00 27.35 ? 353  ALA A C     1 
ATOM   1007 O  O     . ALA C 3 57  ? 15.339  36.457 -10.371 1.00 28.23 ? 353  ALA A O     1 
ATOM   1008 C  CB    . ALA C 3 57  ? 17.746  34.958 -9.273  1.00 28.14 ? 353  ALA A CB    1 
ATOM   1009 N  N     . ASP C 3 58  ? 14.321  34.830 -9.198  1.00 27.05 ? 354  ASP A N     1 
ATOM   1010 C  CA    . ASP C 3 58  ? 13.114  34.833 -10.015 1.00 26.42 ? 354  ASP A CA    1 
ATOM   1011 C  C     . ASP C 3 58  ? 12.122  35.901 -9.565  1.00 25.34 ? 354  ASP A C     1 
ATOM   1012 O  O     . ASP C 3 58  ? 11.604  35.855 -8.451  1.00 25.14 ? 354  ASP A O     1 
ATOM   1013 C  CB    . ASP C 3 58  ? 12.451  33.453 -9.972  1.00 27.57 ? 354  ASP A CB    1 
ATOM   1014 C  CG    . ASP C 3 58  ? 11.224  33.366 -10.858 1.00 27.77 ? 354  ASP A CG    1 
ATOM   1015 O  OD1   . ASP C 3 58  ? 10.192  33.986 -10.524 1.00 30.11 ? 354  ASP A OD1   1 
ATOM   1016 O  OD2   . ASP C 3 58  ? 11.295  32.678 -11.896 1.00 29.92 ? 354  ASP A OD2   1 
ATOM   1017 N  N     . PRO C 3 59  ? 11.840  36.880 -10.438 1.00 24.37 ? 355  PRO A N     1 
ATOM   1018 C  CA    . PRO C 3 59  ? 10.906  37.968 -10.133 1.00 24.24 ? 355  PRO A CA    1 
ATOM   1019 C  C     . PRO C 3 59  ? 9.534   37.503 -9.644  1.00 22.88 ? 355  PRO A C     1 
ATOM   1020 O  O     . PRO C 3 59  ? 8.954   38.112 -8.747  1.00 21.01 ? 355  PRO A O     1 
ATOM   1021 C  CB    . PRO C 3 59  ? 10.830  38.741 -11.447 1.00 25.53 ? 355  PRO A CB    1 
ATOM   1022 C  CG    . PRO C 3 59  ? 12.186  38.507 -12.049 1.00 25.33 ? 355  PRO A CG    1 
ATOM   1023 C  CD    . PRO C 3 59  ? 12.400  37.041 -11.792 1.00 24.94 ? 355  PRO A CD    1 
ATOM   1024 N  N     . GLN C 3 60  ? 9.019   36.430 -10.237 1.00 22.71 ? 356  GLN A N     1 
ATOM   1025 C  CA    . GLN C 3 60  ? 7.706   35.917 -9.855  1.00 23.25 ? 356  GLN A CA    1 
ATOM   1026 C  C     . GLN C 3 60  ? 7.706   35.357 -8.441  1.00 21.53 ? 356  GLN A C     1 
ATOM   1027 O  O     . GLN C 3 60  ? 6.794   35.630 -7.658  1.00 21.45 ? 356  GLN A O     1 
ATOM   1028 C  CB    . GLN C 3 60  ? 7.243   34.837 -10.838 1.00 26.76 ? 356  GLN A CB    1 
ATOM   1029 C  CG    . GLN C 3 60  ? 6.745   35.378 -12.174 1.00 32.32 ? 356  GLN A CG    1 
ATOM   1030 C  CD    . GLN C 3 60  ? 7.792   36.198 -12.900 1.00 35.37 ? 356  GLN A CD    1 
ATOM   1031 O  OE1   . GLN C 3 60  ? 8.875   35.703 -13.218 1.00 38.44 ? 356  GLN A OE1   1 
ATOM   1032 N  NE2   . GLN C 3 60  ? 7.476   37.464 -13.165 1.00 38.02 ? 356  GLN A NE2   1 
ATOM   1033 N  N     . PHE C 3 61  ? 8.729   34.574 -8.118  1.00 20.24 ? 357  PHE A N     1 
ATOM   1034 C  CA    . PHE C 3 61  ? 8.844   33.985 -6.791  1.00 20.54 ? 357  PHE A CA    1 
ATOM   1035 C  C     . PHE C 3 61  ? 9.013   35.082 -5.739  1.00 20.49 ? 357  PHE A C     1 
ATOM   1036 O  O     . PHE C 3 61  ? 8.333   35.082 -4.714  1.00 19.37 ? 357  PHE A O     1 
ATOM   1037 C  CB    . PHE C 3 61  ? 10.037  33.028 -6.731  1.00 20.48 ? 357  PHE A CB    1 
ATOM   1038 C  CG    . PHE C 3 61  ? 10.093  32.225 -5.466  1.00 20.98 ? 357  PHE A CG    1 
ATOM   1039 C  CD1   . PHE C 3 61  ? 9.234   31.144 -5.278  1.00 21.86 ? 357  PHE A CD1   1 
ATOM   1040 C  CD2   . PHE C 3 61  ? 10.978  32.566 -4.447  1.00 18.28 ? 357  PHE A CD2   1 
ATOM   1041 C  CE1   . PHE C 3 61  ? 9.253   30.414 -4.088  1.00 20.63 ? 357  PHE A CE1   1 
ATOM   1042 C  CE2   . PHE C 3 61  ? 11.003  31.843 -3.256  1.00 19.53 ? 357  PHE A CE2   1 
ATOM   1043 C  CZ    . PHE C 3 61  ? 10.138  30.767 -3.076  1.00 19.47 ? 357  PHE A CZ    1 
ATOM   1044 N  N     . VAL C 3 62  ? 9.922   36.016 -5.998  1.00 19.99 ? 358  VAL A N     1 
ATOM   1045 C  CA    . VAL C 3 62  ? 10.166  37.121 -5.075  1.00 19.79 ? 358  VAL A CA    1 
ATOM   1046 C  C     . VAL C 3 62  ? 8.887   37.927 -4.854  1.00 19.54 ? 358  VAL A C     1 
ATOM   1047 O  O     . VAL C 3 62  ? 8.580   38.326 -3.727  1.00 19.10 ? 358  VAL A O     1 
ATOM   1048 C  CB    . VAL C 3 62  ? 11.285  38.053 -5.610  1.00 20.52 ? 358  VAL A CB    1 
ATOM   1049 C  CG1   . VAL C 3 62  ? 11.391  39.310 -4.751  1.00 21.80 ? 358  VAL A CG1   1 
ATOM   1050 C  CG2   . VAL C 3 62  ? 12.616  37.308 -5.606  1.00 19.36 ? 358  VAL A CG2   1 
ATOM   1051 N  N     . ALA C 3 63  ? 8.136   38.158 -5.928  1.00 18.91 ? 359  ALA A N     1 
ATOM   1052 C  CA    . ALA C 3 63  ? 6.886   38.906 -5.830  1.00 18.34 ? 359  ALA A CA    1 
ATOM   1053 C  C     . ALA C 3 63  ? 5.906   38.120 -4.965  1.00 17.33 ? 359  ALA A C     1 
ATOM   1054 O  O     . ALA C 3 63  ? 5.198   38.690 -4.138  1.00 18.14 ? 359  ALA A O     1 
ATOM   1055 C  CB    . ALA C 3 63  ? 6.291   39.131 -7.222  1.00 19.12 ? 359  ALA A CB    1 
ATOM   1056 N  N     . TRP C 3 64  ? 5.875   36.806 -5.170  1.00 17.62 ? 360  TRP A N     1 
ATOM   1057 C  CA    . TRP C 3 64  ? 4.999   35.923 -4.406  1.00 18.17 ? 360  TRP A CA    1 
ATOM   1058 C  C     . TRP C 3 64  ? 5.377   36.014 -2.922  1.00 17.42 ? 360  TRP A C     1 
ATOM   1059 O  O     . TRP C 3 64  ? 4.510   36.134 -2.055  1.00 17.81 ? 360  TRP A O     1 
ATOM   1060 C  CB    . TRP C 3 64  ? 5.150   34.484 -4.911  1.00 17.24 ? 360  TRP A CB    1 
ATOM   1061 C  CG    . TRP C 3 64  ? 4.346   33.471 -4.151  1.00 18.50 ? 360  TRP A CG    1 
ATOM   1062 C  CD1   . TRP C 3 64  ? 3.013   33.205 -4.286  1.00 17.33 ? 360  TRP A CD1   1 
ATOM   1063 C  CD2   . TRP C 3 64  ? 4.832   32.591 -3.131  1.00 19.51 ? 360  TRP A CD2   1 
ATOM   1064 N  NE1   . TRP C 3 64  ? 2.638   32.206 -3.412  1.00 18.71 ? 360  TRP A NE1   1 
ATOM   1065 C  CE2   . TRP C 3 64  ? 3.735   31.813 -2.691  1.00 19.70 ? 360  TRP A CE2   1 
ATOM   1066 C  CE3   . TRP C 3 64  ? 6.091   32.383 -2.545  1.00 19.32 ? 360  TRP A CE3   1 
ATOM   1067 C  CZ2   . TRP C 3 64  ? 3.859   30.840 -1.689  1.00 20.50 ? 360  TRP A CZ2   1 
ATOM   1068 C  CZ3   . TRP C 3 64  ? 6.213   31.414 -1.547  1.00 20.81 ? 360  TRP A CZ3   1 
ATOM   1069 C  CH2   . TRP C 3 64  ? 5.101   30.656 -1.131  1.00 20.33 ? 360  TRP A CH2   1 
ATOM   1070 N  N     . LEU C 3 65  ? 6.675   35.959 -2.633  1.00 17.13 ? 361  LEU A N     1 
ATOM   1071 C  CA    . LEU C 3 65  ? 7.147   36.059 -1.256  1.00 16.24 ? 361  LEU A CA    1 
ATOM   1072 C  C     . LEU C 3 65  ? 6.645   37.333 -0.571  1.00 17.95 ? 361  LEU A C     1 
ATOM   1073 O  O     . LEU C 3 65  ? 6.249   37.305 0.595   1.00 17.15 ? 361  LEU A O     1 
ATOM   1074 C  CB    . LEU C 3 65  ? 8.683   36.042 -1.213  1.00 16.95 ? 361  LEU A CB    1 
ATOM   1075 C  CG    . LEU C 3 65  ? 9.412   34.711 -1.420  1.00 17.16 ? 361  LEU A CG    1 
ATOM   1076 C  CD1   . LEU C 3 65  ? 10.924  34.955 -1.430  1.00 15.28 ? 361  LEU A CD1   1 
ATOM   1077 C  CD2   . LEU C 3 65  ? 9.037   33.734 -0.297  1.00 14.51 ? 361  LEU A CD2   1 
ATOM   1078 N  N     . GLY C 3 66  ? 6.652   38.445 -1.303  1.00 16.49 ? 362  GLY A N     1 
ATOM   1079 C  CA    . GLY C 3 66  ? 6.227   39.712 -0.731  1.00 19.25 ? 362  GLY A CA    1 
ATOM   1080 C  C     . GLY C 3 66  ? 4.758   40.067 -0.864  1.00 20.20 ? 362  GLY A C     1 
ATOM   1081 O  O     . GLY C 3 66  ? 4.343   41.154 -0.456  1.00 21.74 ? 362  GLY A O     1 
ATOM   1082 N  N     . ASP C 3 67  ? 3.968   39.163 -1.432  1.00 19.38 ? 363  ASP A N     1 
ATOM   1083 C  CA    . ASP C 3 67  ? 2.537   39.397 -1.604  1.00 20.77 ? 363  ASP A CA    1 
ATOM   1084 C  C     . ASP C 3 67  ? 1.786   38.931 -0.353  1.00 20.98 ? 363  ASP A C     1 
ATOM   1085 O  O     . ASP C 3 67  ? 1.714   37.734 -0.067  1.00 19.67 ? 363  ASP A O     1 
ATOM   1086 C  CB    . ASP C 3 67  ? 2.027   38.626 -2.823  1.00 19.86 ? 363  ASP A CB    1 
ATOM   1087 C  CG    . ASP C 3 67  ? 0.622   39.028 -3.225  1.00 21.69 ? 363  ASP A CG    1 
ATOM   1088 O  OD1   . ASP C 3 67  ? -0.138  39.519 -2.362  1.00 20.57 ? 363  ASP A OD1   1 
ATOM   1089 O  OD2   . ASP C 3 67  ? 0.279   38.842 -4.413  1.00 24.08 ? 363  ASP A OD2   1 
ATOM   1090 N  N     . GLU C 3 68  ? 1.220   39.883 0.379   1.00 21.69 ? 364  GLU A N     1 
ATOM   1091 C  CA    . GLU C 3 68  ? 0.484   39.587 1.602   1.00 23.09 ? 364  GLU A CA    1 
ATOM   1092 C  C     . GLU C 3 68  ? -0.741  38.694 1.381   1.00 21.41 ? 364  GLU A C     1 
ATOM   1093 O  O     . GLU C 3 68  ? -1.195  38.022 2.309   1.00 20.44 ? 364  GLU A O     1 
ATOM   1094 C  CB    . GLU C 3 68  ? 0.066   40.902 2.272   1.00 27.64 ? 364  GLU A CB    1 
ATOM   1095 C  CG    . GLU C 3 68  ? -0.729  40.757 3.565   1.00 34.54 ? 364  GLU A CG    1 
ATOM   1096 C  CD    . GLU C 3 68  ? -0.004  39.944 4.623   1.00 39.22 ? 364  GLU A CD    1 
ATOM   1097 O  OE1   . GLU C 3 68  ? 1.192   40.211 4.875   1.00 41.68 ? 364  GLU A OE1   1 
ATOM   1098 O  OE2   . GLU C 3 68  ? -0.637  39.040 5.212   1.00 43.49 ? 364  GLU A OE2   1 
ATOM   1099 N  N     . THR C 3 69  ? -1.274  38.683 0.161   1.00 22.18 ? 365  THR A N     1 
ATOM   1100 C  CA    . THR C 3 69  ? -2.451  37.864 -0.138  1.00 21.37 ? 365  THR A CA    1 
ATOM   1101 C  C     . THR C 3 69  ? -2.109  36.403 -0.417  1.00 20.87 ? 365  THR A C     1 
ATOM   1102 O  O     . THR C 3 69  ? -2.998  35.552 -0.472  1.00 20.43 ? 365  THR A O     1 
ATOM   1103 C  CB    . THR C 3 69  ? -3.248  38.427 -1.332  1.00 20.96 ? 365  THR A CB    1 
ATOM   1104 O  OG1   . THR C 3 69  ? -2.496  38.267 -2.541  1.00 23.39 ? 365  THR A OG1   1 
ATOM   1105 C  CG2   . THR C 3 69  ? -3.538  39.900 -1.111  1.00 22.65 ? 365  THR A CG2   1 
ATOM   1106 N  N     . LYS C 3 70  ? -0.824  36.115 -0.606  1.00 18.20 ? 366  LYS A N     1 
ATOM   1107 C  CA    . LYS C 3 70  ? -0.377  34.741 -0.828  1.00 18.30 ? 366  LYS A CA    1 
ATOM   1108 C  C     . LYS C 3 70  ? 0.024   34.289 0.574   1.00 18.14 ? 366  LYS A C     1 
ATOM   1109 O  O     . LYS C 3 70  ? 1.049   34.718 1.107   1.00 17.32 ? 366  LYS A O     1 
ATOM   1110 C  CB    . LYS C 3 70  ? 0.826   34.702 -1.775  1.00 18.94 ? 366  LYS A CB    1 
ATOM   1111 C  CG    . LYS C 3 70  ? 0.575   35.381 -3.120  1.00 20.67 ? 366  LYS A CG    1 
ATOM   1112 C  CD    . LYS C 3 70  ? -0.631  34.788 -3.847  1.00 22.48 ? 366  LYS A CD    1 
ATOM   1113 C  CE    . LYS C 3 70  ? -0.958  35.592 -5.102  1.00 24.45 ? 366  LYS A CE    1 
ATOM   1114 N  NZ    . LYS C 3 70  ? -2.182  35.097 -5.790  1.00 27.94 ? 366  LYS A NZ    1 
ATOM   1115 N  N     . LYS C 3 71  ? -0.791  33.425 1.166   1.00 17.25 ? 367  LYS A N     1 
ATOM   1116 C  CA    . LYS C 3 71  ? -0.563  32.972 2.531   1.00 16.98 ? 367  LYS A CA    1 
ATOM   1117 C  C     . LYS C 3 71  ? 0.414   31.824 2.700   1.00 15.68 ? 367  LYS A C     1 
ATOM   1118 O  O     . LYS C 3 71  ? 0.317   30.810 2.023   1.00 16.54 ? 367  LYS A O     1 
ATOM   1119 C  CB    . LYS C 3 71  ? -1.905  32.603 3.166   1.00 16.83 ? 367  LYS A CB    1 
ATOM   1120 C  CG    . LYS C 3 71  ? -2.951  33.697 3.032   1.00 18.47 ? 367  LYS A CG    1 
ATOM   1121 C  CD    . LYS C 3 71  ? -2.501  34.993 3.700   1.00 20.79 ? 367  LYS A CD    1 
ATOM   1122 C  CE    . LYS C 3 71  ? -3.555  36.087 3.550   1.00 23.00 ? 367  LYS A CE    1 
ATOM   1123 N  NZ    . LYS C 3 71  ? -3.128  37.360 4.194   1.00 22.44 ? 367  LYS A NZ    1 
ATOM   1124 N  N     . LYS C 3 72  ? 1.348   31.997 3.631   1.00 16.22 ? 368  LYS A N     1 
ATOM   1125 C  CA    . LYS C 3 72  ? 2.349   30.981 3.912   1.00 15.49 ? 368  LYS A CA    1 
ATOM   1126 C  C     . LYS C 3 72  ? 2.302   30.506 5.361   1.00 14.38 ? 368  LYS A C     1 
ATOM   1127 O  O     . LYS C 3 72  ? 2.060   31.287 6.291   1.00 14.48 ? 368  LYS A O     1 
ATOM   1128 C  CB    . LYS C 3 72  ? 3.766   31.512 3.641   1.00 14.76 ? 368  LYS A CB    1 
ATOM   1129 C  CG    . LYS C 3 72  ? 4.023   32.035 2.237   1.00 16.76 ? 368  LYS A CG    1 
ATOM   1130 C  CD    . LYS C 3 72  ? 3.683   33.510 2.128   1.00 15.80 ? 368  LYS A CD    1 
ATOM   1131 C  CE    . LYS C 3 72  ? 3.984   34.045 0.733   1.00 17.17 ? 368  LYS A CE    1 
ATOM   1132 N  NZ    . LYS C 3 72  ? 3.554   35.470 0.609   1.00 13.70 ? 368  LYS A NZ    1 
ATOM   1133 N  N     . SER C 3 73  ? 2.534   29.214 5.540   1.00 14.65 ? 369  SER A N     1 
ATOM   1134 C  CA    . SER C 3 73  ? 2.593   28.615 6.863   1.00 13.65 ? 369  SER A CA    1 
ATOM   1135 C  C     . SER C 3 73  ? 4.053   28.207 6.983   1.00 12.28 ? 369  SER A C     1 
ATOM   1136 O  O     . SER C 3 73  ? 4.593   27.549 6.091   1.00 13.75 ? 369  SER A O     1 
ATOM   1137 C  CB    . SER C 3 73  ? 1.676   27.402 6.946   1.00 15.63 ? 369  SER A CB    1 
ATOM   1138 O  OG    . SER C 3 73  ? 0.324   27.816 6.851   1.00 15.42 ? 369  SER A OG    1 
ATOM   1139 N  N     . MET C 3 74  ? 4.694   28.596 8.078   1.00 13.05 ? 370  MET A N     1 
ATOM   1140 C  CA    . MET C 3 74  ? 6.111   28.304 8.256   1.00 12.42 ? 370  MET A CA    1 
ATOM   1141 C  C     . MET C 3 74  ? 6.461   27.915 9.689   1.00 13.25 ? 370  MET A C     1 
ATOM   1142 O  O     . MET C 3 74  ? 5.594   27.842 10.556  1.00 12.71 ? 370  MET A O     1 
ATOM   1143 C  CB    . MET C 3 74  ? 6.936   29.541 7.885   1.00 12.77 ? 370  MET A CB    1 
ATOM   1144 C  CG    . MET C 3 74  ? 6.562   30.215 6.566   1.00 12.71 ? 370  MET A CG    1 
ATOM   1145 S  SD    . MET C 3 74  ? 7.623   31.663 6.205   1.00 15.55 ? 370  MET A SD    1 
ATOM   1146 C  CE    . MET C 3 74  ? 9.201   30.846 5.884   1.00 14.63 ? 370  MET A CE    1 
ATOM   1147 N  N     . PHE C 3 75  ? 7.748   27.665 9.919   1.00 11.85 ? 371  PHE A N     1 
ATOM   1148 C  CA    . PHE C 3 75  ? 8.256   27.372 11.253  1.00 12.94 ? 371  PHE A CA    1 
ATOM   1149 C  C     . PHE C 3 75  ? 9.415   28.361 11.452  1.00 15.11 ? 371  PHE A C     1 
ATOM   1150 O  O     . PHE C 3 75  ? 10.401  28.322 10.717  1.00 14.29 ? 371  PHE A O     1 
ATOM   1151 C  CB    . PHE C 3 75  ? 8.754   25.926 11.359  1.00 14.25 ? 371  PHE A CB    1 
ATOM   1152 C  CG    . PHE C 3 75  ? 9.306   25.576 12.716  1.00 12.88 ? 371  PHE A CG    1 
ATOM   1153 C  CD1   . PHE C 3 75  ? 10.596  25.964 13.081  1.00 11.07 ? 371  PHE A CD1   1 
ATOM   1154 C  CD2   . PHE C 3 75  ? 8.530   24.876 13.641  1.00 11.54 ? 371  PHE A CD2   1 
ATOM   1155 C  CE1   . PHE C 3 75  ? 11.103  25.658 14.346  1.00 11.51 ? 371  PHE A CE1   1 
ATOM   1156 C  CE2   . PHE C 3 75  ? 9.027   24.567 14.908  1.00 12.56 ? 371  PHE A CE2   1 
ATOM   1157 C  CZ    . PHE C 3 75  ? 10.317  24.959 15.261  1.00 11.57 ? 371  PHE A CZ    1 
ATOM   1158 N  N     . ASP C 3 76  ? 9.282   29.246 12.439  1.00 14.73 ? 372  ASP A N     1 
ATOM   1159 C  CA    . ASP C 3 76  ? 10.295  30.268 12.728  1.00 14.58 ? 372  ASP A CA    1 
ATOM   1160 C  C     . ASP C 3 76  ? 10.413  31.217 11.532  1.00 14.92 ? 372  ASP A C     1 
ATOM   1161 O  O     . ASP C 3 76  ? 11.479  31.351 10.920  1.00 14.48 ? 372  ASP A O     1 
ATOM   1162 C  CB    . ASP C 3 76  ? 11.657  29.622 13.022  1.00 15.94 ? 372  ASP A CB    1 
ATOM   1163 C  CG    . ASP C 3 76  ? 12.672  30.618 13.577  1.00 18.90 ? 372  ASP A CG    1 
ATOM   1164 O  OD1   . ASP C 3 76  ? 12.311  31.800 13.780  1.00 18.04 ? 372  ASP A OD1   1 
ATOM   1165 O  OD2   . ASP C 3 76  ? 13.832  30.216 13.821  1.00 19.34 ? 372  ASP A OD2   1 
ATOM   1166 N  N     . SER C 3 77  ? 9.309   31.874 11.198  1.00 13.65 ? 373  SER A N     1 
ATOM   1167 C  CA    . SER C 3 77  ? 9.303   32.795 10.069  1.00 15.47 ? 373  SER A CA    1 
ATOM   1168 C  C     . SER C 3 77  ? 10.246  33.982 10.262  1.00 14.49 ? 373  SER A C     1 
ATOM   1169 O  O     . SER C 3 77  ? 10.725  34.550 9.284   1.00 15.53 ? 373  SER A O     1 
ATOM   1170 C  CB    . SER C 3 77  ? 7.879   33.291 9.786   1.00 14.44 ? 373  SER A CB    1 
ATOM   1171 O  OG    . SER C 3 77  ? 7.309   33.905 10.926  1.00 13.09 ? 373  SER A OG    1 
ATOM   1172 N  N     . LYS C 3 78  ? 10.535  34.346 11.511  1.00 13.85 ? 374  LYS A N     1 
ATOM   1173 C  CA    . LYS C 3 78  ? 11.437  35.472 11.762  1.00 12.88 ? 374  LYS A CA    1 
ATOM   1174 C  C     . LYS C 3 78  ? 12.826  35.200 11.193  1.00 12.71 ? 374  LYS A C     1 
ATOM   1175 O  O     . LYS C 3 78  ? 13.456  36.086 10.608  1.00 9.65  ? 374  LYS A O     1 
ATOM   1176 C  CB    . LYS C 3 78  ? 11.537  35.769 13.261  1.00 11.62 ? 374  LYS A CB    1 
ATOM   1177 C  CG    . LYS C 3 78  ? 12.496  36.919 13.597  1.00 10.04 ? 374  LYS A CG    1 
ATOM   1178 C  CD    . LYS C 3 78  ? 12.137  37.598 14.923  1.00 12.00 ? 374  LYS A CD    1 
ATOM   1179 C  CE    . LYS C 3 78  ? 12.322  36.662 16.115  1.00 11.43 ? 374  LYS A CE    1 
ATOM   1180 N  NZ    . LYS C 3 78  ? 13.771  36.328 16.343  1.00 10.23 ? 374  LYS A NZ    1 
ATOM   1181 N  N     . ARG C 3 79  ? 13.295  33.971 11.371  1.00 13.18 ? 375  ARG A N     1 
ATOM   1182 C  CA    . ARG C 3 79  ? 14.598  33.558 10.861  1.00 12.05 ? 375  ARG A CA    1 
ATOM   1183 C  C     . ARG C 3 79  ? 14.651  33.790 9.348   1.00 14.09 ? 375  ARG A C     1 
ATOM   1184 O  O     . ARG C 3 79  ? 15.577  34.414 8.838   1.00 12.08 ? 375  ARG A O     1 
ATOM   1185 C  CB    . ARG C 3 79  ? 14.816  32.076 11.199  1.00 13.97 ? 375  ARG A CB    1 
ATOM   1186 C  CG    . ARG C 3 79  ? 15.951  31.365 10.470  1.00 13.21 ? 375  ARG A CG    1 
ATOM   1187 C  CD    . ARG C 3 79  ? 16.100  29.941 11.031  1.00 14.05 ? 375  ARG A CD    1 
ATOM   1188 N  NE    . ARG C 3 79  ? 16.604  29.986 12.399  1.00 16.82 ? 375  ARG A NE    1 
ATOM   1189 C  CZ    . ARG C 3 79  ? 17.895  30.024 12.719  1.00 17.11 ? 375  ARG A CZ    1 
ATOM   1190 N  NH1   . ARG C 3 79  ? 18.822  30.001 11.768  1.00 17.32 ? 375  ARG A NH1   1 
ATOM   1191 N  NH2   . ARG C 3 79  ? 18.260  30.133 13.988  1.00 15.08 ? 375  ARG A NH2   1 
ATOM   1192 N  N     . ALA C 3 80  ? 13.644  33.296 8.636   1.00 12.97 ? 376  ALA A N     1 
ATOM   1193 C  CA    . ALA C 3 80  ? 13.584  33.457 7.188   1.00 13.89 ? 376  ALA A CA    1 
ATOM   1194 C  C     . ALA C 3 80  ? 13.391  34.918 6.799   1.00 14.84 ? 376  ALA A C     1 
ATOM   1195 O  O     . ALA C 3 80  ? 14.005  35.400 5.852   1.00 12.77 ? 376  ALA A O     1 
ATOM   1196 C  CB    . ALA C 3 80  ? 12.441  32.618 6.618   1.00 14.85 ? 376  ALA A CB    1 
ATOM   1197 N  N     . ALA C 3 81  ? 12.533  35.626 7.526   1.00 12.57 ? 377  ALA A N     1 
ATOM   1198 C  CA    . ALA C 3 81  ? 12.287  37.024 7.202   1.00 11.80 ? 377  ALA A CA    1 
ATOM   1199 C  C     . ALA C 3 81  ? 13.547  37.877 7.357   1.00 11.79 ? 377  ALA A C     1 
ATOM   1200 O  O     . ALA C 3 81  ? 13.818  38.746 6.528   1.00 13.55 ? 377  ALA A O     1 
ATOM   1201 C  CB    . ALA C 3 81  ? 11.152  37.576 8.065   1.00 13.00 ? 377  ALA A CB    1 
ATOM   1202 N  N     . VAL C 3 82  ? 14.329  37.628 8.401   1.00 11.93 ? 378  VAL A N     1 
ATOM   1203 C  CA    . VAL C 3 82  ? 15.547  38.407 8.597   1.00 13.14 ? 378  VAL A CA    1 
ATOM   1204 C  C     . VAL C 3 82  ? 16.611  38.015 7.572   1.00 12.52 ? 378  VAL A C     1 
ATOM   1205 O  O     . VAL C 3 82  ? 17.285  38.881 7.015   1.00 12.76 ? 378  VAL A O     1 
ATOM   1206 C  CB    . VAL C 3 82  ? 16.107  38.235 10.018  1.00 12.49 ? 378  VAL A CB    1 
ATOM   1207 C  CG1   . VAL C 3 82  ? 17.479  38.900 10.115  1.00 11.67 ? 378  VAL A CG1   1 
ATOM   1208 C  CG2   . VAL C 3 82  ? 15.144  38.866 11.034  1.00 12.56 ? 378  VAL A CG2   1 
ATOM   1209 N  N     . ALA C 3 83  ? 16.769  36.718 7.319   1.00 12.62 ? 379  ALA A N     1 
ATOM   1210 C  CA    . ALA C 3 83  ? 17.747  36.280 6.323   1.00 12.98 ? 379  ALA A CA    1 
ATOM   1211 C  C     . ALA C 3 83  ? 17.386  36.914 4.973   1.00 12.89 ? 379  ALA A C     1 
ATOM   1212 O  O     . ALA C 3 83  ? 18.262  37.305 4.199   1.00 14.16 ? 379  ALA A O     1 
ATOM   1213 C  CB    . ALA C 3 83  ? 17.753  34.756 6.209   1.00 11.78 ? 379  ALA A CB    1 
ATOM   1214 N  N     . LEU C 3 84  ? 16.094  37.017 4.686   1.00 13.05 ? 380  LEU A N     1 
ATOM   1215 C  CA    . LEU C 3 84  ? 15.672  37.619 3.431   1.00 12.74 ? 380  LEU A CA    1 
ATOM   1216 C  C     . LEU C 3 84  ? 15.885  39.134 3.426   1.00 12.77 ? 380  LEU A C     1 
ATOM   1217 O  O     . LEU C 3 84  ? 16.186  39.707 2.378   1.00 13.35 ? 380  LEU A O     1 
ATOM   1218 C  CB    . LEU C 3 84  ? 14.210  37.267 3.129   1.00 12.87 ? 380  LEU A CB    1 
ATOM   1219 C  CG    . LEU C 3 84  ? 14.018  35.797 2.712   1.00 13.64 ? 380  LEU A CG    1 
ATOM   1220 C  CD1   . LEU C 3 84  ? 12.541  35.436 2.698   1.00 13.30 ? 380  LEU A CD1   1 
ATOM   1221 C  CD2   . LEU C 3 84  ? 14.653  35.560 1.345   1.00 16.23 ? 380  LEU A CD2   1 
ATOM   1222 N  N     . LYS C 3 85  ? 15.744  39.780 4.585   1.00 13.22 ? 381  LYS A N     1 
ATOM   1223 C  CA    . LYS C 3 85  ? 15.958  41.225 4.682   1.00 13.39 ? 381  LYS A CA    1 
ATOM   1224 C  C     . LYS C 3 85  ? 17.399  41.564 4.305   1.00 14.64 ? 381  LYS A C     1 
ATOM   1225 O  O     . LYS C 3 85  ? 17.659  42.564 3.631   1.00 13.56 ? 381  LYS A O     1 
ATOM   1226 C  CB    . LYS C 3 85  ? 15.683  41.730 6.107   1.00 14.83 ? 381  LYS A CB    1 
ATOM   1227 C  CG    . LYS C 3 85  ? 14.202  41.893 6.466   1.00 13.60 ? 381  LYS A CG    1 
ATOM   1228 C  CD    . LYS C 3 85  ? 14.035  42.363 7.914   1.00 15.98 ? 381  LYS A CD    1 
ATOM   1229 C  CE    . LYS C 3 85  ? 12.569  42.420 8.353   1.00 16.41 ? 381  LYS A CE    1 
ATOM   1230 N  NZ    . LYS C 3 85  ? 11.790  43.456 7.624   1.00 15.90 ? 381  LYS A NZ    1 
ATOM   1231 N  N     . TRP C 3 86  ? 18.338  40.733 4.747   1.00 13.53 ? 382  TRP A N     1 
ATOM   1232 C  CA    . TRP C 3 86  ? 19.741  40.966 4.437   1.00 15.50 ? 382  TRP A CA    1 
ATOM   1233 C  C     . TRP C 3 86  ? 19.991  40.842 2.937   1.00 16.66 ? 382  TRP A C     1 
ATOM   1234 O  O     . TRP C 3 86  ? 20.999  41.332 2.423   1.00 15.95 ? 382  TRP A O     1 
ATOM   1235 C  CB    . TRP C 3 86  ? 20.638  39.993 5.215   1.00 12.16 ? 382  TRP A CB    1 
ATOM   1236 C  CG    . TRP C 3 86  ? 20.822  40.388 6.656   1.00 14.18 ? 382  TRP A CG    1 
ATOM   1237 C  CD1   . TRP C 3 86  ? 20.060  39.991 7.727   1.00 12.73 ? 382  TRP A CD1   1 
ATOM   1238 C  CD2   . TRP C 3 86  ? 21.826  41.267 7.183   1.00 12.89 ? 382  TRP A CD2   1 
ATOM   1239 N  NE1   . TRP C 3 86  ? 20.533  40.569 8.882   1.00 12.38 ? 382  TRP A NE1   1 
ATOM   1240 C  CE2   . TRP C 3 86  ? 21.614  41.357 8.580   1.00 12.88 ? 382  TRP A CE2   1 
ATOM   1241 C  CE3   . TRP C 3 86  ? 22.888  41.988 6.611   1.00 15.54 ? 382  TRP A CE3   1 
ATOM   1242 C  CZ2   . TRP C 3 86  ? 22.426  42.140 9.416   1.00 13.54 ? 382  TRP A CZ2   1 
ATOM   1243 C  CZ3   . TRP C 3 86  ? 23.697  42.769 7.444   1.00 12.41 ? 382  TRP A CZ3   1 
ATOM   1244 C  CH2   . TRP C 3 86  ? 23.458  42.836 8.832   1.00 13.97 ? 382  TRP A CH2   1 
ATOM   1245 N  N     . LYS C 3 87  ? 19.060  40.199 2.237   1.00 16.47 ? 383  LYS A N     1 
ATOM   1246 C  CA    . LYS C 3 87  ? 19.164  40.032 0.792   1.00 19.22 ? 383  LYS A CA    1 
ATOM   1247 C  C     . LYS C 3 87  ? 18.279  41.029 0.044   1.00 18.91 ? 383  LYS A C     1 
ATOM   1248 O  O     . LYS C 3 87  ? 18.163  40.962 -1.180  1.00 18.63 ? 383  LYS A O     1 
ATOM   1249 C  CB    . LYS C 3 87  ? 18.777  38.605 0.391   1.00 19.28 ? 383  LYS A CB    1 
ATOM   1250 C  CG    . LYS C 3 87  ? 19.800  37.555 0.786   1.00 20.72 ? 383  LYS A CG    1 
ATOM   1251 C  CD    . LYS C 3 87  ? 19.292  36.156 0.478   1.00 21.74 ? 383  LYS A CD    1 
ATOM   1252 C  CE    . LYS C 3 87  ? 20.318  35.097 0.840   1.00 23.51 ? 383  LYS A CE    1 
ATOM   1253 N  NZ    . LYS C 3 87  ? 21.548  35.221 0.016   1.00 24.52 ? 383  LYS A NZ    1 
ATOM   1254 N  N     . GLY C 3 88  ? 17.657  41.943 0.784   1.00 18.41 ? 384  GLY A N     1 
ATOM   1255 C  CA    . GLY C 3 88  ? 16.800  42.947 0.174   1.00 18.94 ? 384  GLY A CA    1 
ATOM   1256 C  C     . GLY C 3 88  ? 15.464  42.408 -0.304  1.00 19.94 ? 384  GLY A C     1 
ATOM   1257 O  O     . GLY C 3 88  ? 14.822  43.004 -1.170  1.00 20.38 ? 384  GLY A O     1 
ATOM   1258 N  N     . ILE C 3 89  ? 15.038  41.285 0.268   1.00 19.56 ? 385  ILE A N     1 
ATOM   1259 C  CA    . ILE C 3 89  ? 13.773  40.663 -0.106  1.00 17.37 ? 385  ILE A CA    1 
ATOM   1260 C  C     . ILE C 3 89  ? 12.795  40.687 1.065   1.00 18.96 ? 385  ILE A C     1 
ATOM   1261 O  O     . ILE C 3 89  ? 13.152  40.338 2.188   1.00 16.38 ? 385  ILE A O     1 
ATOM   1262 C  CB    . ILE C 3 89  ? 13.993  39.207 -0.546  1.00 19.33 ? 385  ILE A CB    1 
ATOM   1263 C  CG1   . ILE C 3 89  ? 14.913  39.179 -1.770  1.00 17.59 ? 385  ILE A CG1   1 
ATOM   1264 C  CG2   . ILE C 3 89  ? 12.653  38.537 -0.845  1.00 17.65 ? 385  ILE A CG2   1 
ATOM   1265 C  CD1   . ILE C 3 89  ? 15.286  37.790 -2.227  1.00 20.77 ? 385  ILE A CD1   1 
ATOM   1266 N  N     . GLU C 3 90  ? 11.561  41.103 0.793   1.00 17.68 ? 386  GLU A N     1 
ATOM   1267 C  CA    . GLU C 3 90  ? 10.536  41.172 1.825   1.00 19.76 ? 386  GLU A CA    1 
ATOM   1268 C  C     . GLU C 3 90  ? 9.642   39.936 1.840   1.00 19.37 ? 386  GLU A C     1 
ATOM   1269 O  O     . GLU C 3 90  ? 9.193   39.460 0.793   1.00 18.27 ? 386  GLU A O     1 
ATOM   1270 C  CB    . GLU C 3 90  ? 9.668   42.421 1.629   1.00 23.02 ? 386  GLU A CB    1 
ATOM   1271 C  CG    . GLU C 3 90  ? 8.565   42.575 2.669   1.00 29.49 ? 386  GLU A CG    1 
ATOM   1272 C  CD    . GLU C 3 90  ? 7.786   43.872 2.521   1.00 34.09 ? 386  GLU A CD    1 
ATOM   1273 O  OE1   . GLU C 3 90  ? 7.217   44.110 1.434   1.00 37.28 ? 386  GLU A OE1   1 
ATOM   1274 O  OE2   . GLU C 3 90  ? 7.740   44.654 3.495   1.00 36.95 ? 386  GLU A OE2   1 
ATOM   1275 N  N     . LEU C 3 91  ? 9.386   39.426 3.040   1.00 18.11 ? 387  LEU A N     1 
ATOM   1276 C  CA    . LEU C 3 91  ? 8.529   38.262 3.225   1.00 16.81 ? 387  LEU A CA    1 
ATOM   1277 C  C     . LEU C 3 91  ? 7.228   38.723 3.874   1.00 17.64 ? 387  LEU A C     1 
ATOM   1278 O  O     . LEU C 3 91  ? 7.239   39.278 4.969   1.00 17.86 ? 387  LEU A O     1 
ATOM   1279 C  CB    . LEU C 3 91  ? 9.218   37.230 4.126   1.00 16.35 ? 387  LEU A CB    1 
ATOM   1280 C  CG    . LEU C 3 91  ? 8.377   36.019 4.556   1.00 15.12 ? 387  LEU A CG    1 
ATOM   1281 C  CD1   . LEU C 3 91  ? 8.004   35.183 3.333   1.00 15.21 ? 387  LEU A CD1   1 
ATOM   1282 C  CD2   . LEU C 3 91  ? 9.172   35.173 5.545   1.00 15.23 ? 387  LEU A CD2   1 
ATOM   1283 N  N     . CYS C 3 92  ? 6.111   38.496 3.193   1.00 15.54 ? 388  CYS A N     1 
ATOM   1284 C  CA    . CYS C 3 92  ? 4.806   38.895 3.710   1.00 17.64 ? 388  CYS A CA    1 
ATOM   1285 C  C     . CYS C 3 92  ? 3.837   37.722 3.636   1.00 16.49 ? 388  CYS A C     1 
ATOM   1286 O  O     . CYS C 3 92  ? 4.132   36.699 3.021   1.00 16.11 ? 388  CYS A O     1 
ATOM   1287 C  CB    . CYS C 3 92  ? 4.229   40.054 2.883   1.00 18.32 ? 388  CYS A CB    1 
ATOM   1288 S  SG    . CYS C 3 92  ? 5.301   41.506 2.708   1.00 24.02 ? 388  CYS A SG    1 
ATOM   1289 N  N     . GLY C 3 93  ? 2.680   37.883 4.266   1.00 16.14 ? 389  GLY A N     1 
ATOM   1290 C  CA    . GLY C 3 93  ? 1.662   36.852 4.216   1.00 16.71 ? 389  GLY A CA    1 
ATOM   1291 C  C     . GLY C 3 93  ? 1.851   35.613 5.064   1.00 15.14 ? 389  GLY A C     1 
ATOM   1292 O  O     . GLY C 3 93  ? 1.231   34.588 4.791   1.00 14.62 ? 389  GLY A O     1 
ATOM   1293 N  N     . VAL C 3 94  ? 2.697   35.675 6.085   1.00 15.37 ? 390  VAL A N     1 
ATOM   1294 C  CA    . VAL C 3 94  ? 2.866   34.501 6.930   1.00 15.65 ? 390  VAL A CA    1 
ATOM   1295 C  C     . VAL C 3 94  ? 1.684   34.493 7.885   1.00 16.96 ? 390  VAL A C     1 
ATOM   1296 O  O     . VAL C 3 94  ? 1.620   35.295 8.815   1.00 19.65 ? 390  VAL A O     1 
ATOM   1297 C  CB    . VAL C 3 94  ? 4.178   34.549 7.726   1.00 15.58 ? 390  VAL A CB    1 
ATOM   1298 C  CG1   . VAL C 3 94  ? 4.275   33.319 8.624   1.00 15.48 ? 390  VAL A CG1   1 
ATOM   1299 C  CG2   . VAL C 3 94  ? 5.360   34.585 6.765   1.00 14.11 ? 390  VAL A CG2   1 
ATOM   1300 N  N     . SER C 3 95  ? 0.744   33.586 7.643   1.00 15.19 ? 391  SER A N     1 
ATOM   1301 C  CA    . SER C 3 95  ? -0.455  33.502 8.460   1.00 15.40 ? 391  SER A CA    1 
ATOM   1302 C  C     . SER C 3 95  ? -0.375  32.473 9.581   1.00 13.64 ? 391  SER A C     1 
ATOM   1303 O  O     . SER C 3 95  ? -1.236  32.448 10.456  1.00 14.04 ? 391  SER A O     1 
ATOM   1304 C  CB    . SER C 3 95  ? -1.669  33.203 7.568   1.00 14.15 ? 391  SER A CB    1 
ATOM   1305 O  OG    . SER C 3 95  ? -1.565  31.922 6.974   1.00 16.61 ? 391  SER A OG    1 
ATOM   1306 N  N     . PHE C 3 96  ? 0.652   31.629 9.557   1.00 13.70 ? 392  PHE A N     1 
ATOM   1307 C  CA    . PHE C 3 96  ? 0.822   30.601 10.583  1.00 13.25 ? 392  PHE A CA    1 
ATOM   1308 C  C     . PHE C 3 96  ? 2.293   30.265 10.796  1.00 12.41 ? 392  PHE A C     1 
ATOM   1309 O  O     . PHE C 3 96  ? 3.013   29.953 9.848   1.00 13.63 ? 392  PHE A O     1 
ATOM   1310 C  CB    . PHE C 3 96  ? 0.074   29.320 10.191  1.00 14.56 ? 392  PHE A CB    1 
ATOM   1311 C  CG    . PHE C 3 96  ? 0.219   28.200 11.191  1.00 14.47 ? 392  PHE A CG    1 
ATOM   1312 C  CD1   . PHE C 3 96  ? -0.450  28.247 12.415  1.00 14.63 ? 392  PHE A CD1   1 
ATOM   1313 C  CD2   . PHE C 3 96  ? 1.036   27.106 10.916  1.00 13.08 ? 392  PHE A CD2   1 
ATOM   1314 C  CE1   . PHE C 3 96  ? -0.309  27.221 13.352  1.00 15.08 ? 392  PHE A CE1   1 
ATOM   1315 C  CE2   . PHE C 3 96  ? 1.188   26.070 11.849  1.00 12.69 ? 392  PHE A CE2   1 
ATOM   1316 C  CZ    . PHE C 3 96  ? 0.512   26.131 13.071  1.00 13.58 ? 392  PHE A CZ    1 
ATOM   1317 N  N     . ASP C 3 97  ? 2.729   30.336 12.049  1.00 10.55 ? 393  ASP A N     1 
ATOM   1318 C  CA    . ASP C 3 97  ? 4.102   30.019 12.410  1.00 11.35 ? 393  ASP A CA    1 
ATOM   1319 C  C     . ASP C 3 97  ? 4.033   28.884 13.424  1.00 11.00 ? 393  ASP A C     1 
ATOM   1320 O  O     . ASP C 3 97  ? 3.632   29.085 14.573  1.00 11.38 ? 393  ASP A O     1 
ATOM   1321 C  CB    . ASP C 3 97  ? 4.790   31.240 13.026  1.00 12.23 ? 393  ASP A CB    1 
ATOM   1322 C  CG    . ASP C 3 97  ? 6.283   31.042 13.185  1.00 14.04 ? 393  ASP A CG    1 
ATOM   1323 O  OD1   . ASP C 3 97  ? 6.693   29.934 13.588  1.00 14.37 ? 393  ASP A OD1   1 
ATOM   1324 O  OD2   . ASP C 3 97  ? 7.046   31.992 12.911  1.00 14.26 ? 393  ASP A OD2   1 
ATOM   1325 N  N     . LEU C 3 98  ? 4.420   27.692 12.988  1.00 10.73 ? 394  LEU A N     1 
ATOM   1326 C  CA    . LEU C 3 98  ? 4.380   26.502 13.829  1.00 11.64 ? 394  LEU A CA    1 
ATOM   1327 C  C     . LEU C 3 98  ? 5.219   26.601 15.103  1.00 11.44 ? 394  LEU A C     1 
ATOM   1328 O  O     . LEU C 3 98  ? 4.836   26.056 16.136  1.00 11.89 ? 394  LEU A O     1 
ATOM   1329 C  CB    . LEU C 3 98  ? 4.811   25.281 13.011  1.00 12.31 ? 394  LEU A CB    1 
ATOM   1330 C  CG    . LEU C 3 98  ? 4.743   23.925 13.716  1.00 10.57 ? 394  LEU A CG    1 
ATOM   1331 C  CD1   . LEU C 3 98  ? 3.330   23.673 14.248  1.00 10.42 ? 394  LEU A CD1   1 
ATOM   1332 C  CD2   . LEU C 3 98  ? 5.151   22.843 12.741  1.00 12.52 ? 394  LEU A CD2   1 
ATOM   1333 N  N     . LEU C 3 99  ? 6.358   27.287 15.037  1.00 11.88 ? 395  LEU A N     1 
ATOM   1334 C  CA    . LEU C 3 99  ? 7.208   27.444 16.219  1.00 10.90 ? 395  LEU A CA    1 
ATOM   1335 C  C     . LEU C 3 99  ? 6.441   28.210 17.296  1.00 10.55 ? 395  LEU A C     1 
ATOM   1336 O  O     . LEU C 3 99  ? 6.381   27.791 18.452  1.00 12.35 ? 395  LEU A O     1 
ATOM   1337 C  CB    . LEU C 3 99  ? 8.490   28.210 15.870  1.00 12.83 ? 395  LEU A CB    1 
ATOM   1338 C  CG    . LEU C 3 99  ? 9.356   28.665 17.058  1.00 13.11 ? 395  LEU A CG    1 
ATOM   1339 C  CD1   . LEU C 3 99  ? 9.917   27.445 17.779  1.00 14.51 ? 395  LEU A CD1   1 
ATOM   1340 C  CD2   . LEU C 3 99  ? 10.497  29.556 16.566  1.00 15.04 ? 395  LEU A CD2   1 
ATOM   1341 N  N     . LEU C 3 100 ? 5.851   29.335 16.906  1.00 11.39 ? 396  LEU A N     1 
ATOM   1342 C  CA    . LEU C 3 100 ? 5.093   30.156 17.837  1.00 9.99  ? 396  LEU A CA    1 
ATOM   1343 C  C     . LEU C 3 100 ? 3.835   29.441 18.318  1.00 10.23 ? 396  LEU A C     1 
ATOM   1344 O  O     . LEU C 3 100 ? 3.437   29.589 19.476  1.00 10.70 ? 396  LEU A O     1 
ATOM   1345 C  CB    . LEU C 3 100 ? 4.735   31.496 17.183  1.00 12.17 ? 396  LEU A CB    1 
ATOM   1346 C  CG    . LEU C 3 100 ? 5.955   32.348 16.805  1.00 14.05 ? 396  LEU A CG    1 
ATOM   1347 C  CD1   . LEU C 3 100 ? 5.500   33.666 16.184  1.00 13.91 ? 396  LEU A CD1   1 
ATOM   1348 C  CD2   . LEU C 3 100 ? 6.797   32.616 18.051  1.00 14.85 ? 396  LEU A CD2   1 
ATOM   1349 N  N     . ALA C 3 101 ? 3.212   28.663 17.437  1.00 11.69 ? 397  ALA A N     1 
ATOM   1350 C  CA    . ALA C 3 101 ? 2.007   27.921 17.806  1.00 11.68 ? 397  ALA A CA    1 
ATOM   1351 C  C     . ALA C 3 101 ? 2.368   26.894 18.882  1.00 12.34 ? 397  ALA A C     1 
ATOM   1352 O  O     . ALA C 3 101 ? 1.679   26.774 19.899  1.00 10.08 ? 397  ALA A O     1 
ATOM   1353 C  CB    . ALA C 3 101 ? 1.416   27.218 16.577  1.00 12.59 ? 397  ALA A CB    1 
ATOM   1354 N  N     . ALA C 3 102 ? 3.461   26.170 18.654  1.00 12.21 ? 398  ALA A N     1 
ATOM   1355 C  CA    . ALA C 3 102 ? 3.930   25.156 19.596  1.00 13.74 ? 398  ALA A CA    1 
ATOM   1356 C  C     . ALA C 3 102 ? 4.266   25.796 20.939  1.00 14.01 ? 398  ALA A C     1 
ATOM   1357 O  O     . ALA C 3 102 ? 3.882   25.299 22.001  1.00 14.66 ? 398  ALA A O     1 
ATOM   1358 C  CB    . ALA C 3 102 ? 5.166   24.449 19.026  1.00 12.98 ? 398  ALA A CB    1 
ATOM   1359 N  N     . TYR C 3 103 ? 4.985   26.908 20.877  1.00 13.12 ? 399  TYR A N     1 
ATOM   1360 C  CA    . TYR C 3 103 ? 5.387   27.643 22.063  1.00 12.26 ? 399  TYR A CA    1 
ATOM   1361 C  C     . TYR C 3 103 ? 4.200   28.039 22.944  1.00 12.31 ? 399  TYR A C     1 
ATOM   1362 O  O     . TYR C 3 103 ? 4.244   27.892 24.162  1.00 12.69 ? 399  TYR A O     1 
ATOM   1363 C  CB    . TYR C 3 103 ? 6.146   28.895 21.637  1.00 13.13 ? 399  TYR A CB    1 
ATOM   1364 C  CG    . TYR C 3 103 ? 6.526   29.813 22.770  1.00 11.52 ? 399  TYR A CG    1 
ATOM   1365 C  CD1   . TYR C 3 103 ? 7.407   29.394 23.766  1.00 11.94 ? 399  TYR A CD1   1 
ATOM   1366 C  CD2   . TYR C 3 103 ? 6.046   31.121 22.815  1.00 11.67 ? 399  TYR A CD2   1 
ATOM   1367 C  CE1   . TYR C 3 103 ? 7.804   30.254 24.775  1.00 12.68 ? 399  TYR A CE1   1 
ATOM   1368 C  CE2   . TYR C 3 103 ? 6.437   31.994 23.822  1.00 12.89 ? 399  TYR A CE2   1 
ATOM   1369 C  CZ    . TYR C 3 103 ? 7.318   31.554 24.796  1.00 12.32 ? 399  TYR A CZ    1 
ATOM   1370 O  OH    . TYR C 3 103 ? 7.723   32.420 25.778  1.00 12.71 ? 399  TYR A OH    1 
ATOM   1371 N  N     . LEU C 3 104 ? 3.141   28.545 22.326  1.00 12.30 ? 400  LEU A N     1 
ATOM   1372 C  CA    . LEU C 3 104 ? 1.967   28.957 23.080  1.00 11.41 ? 400  LEU A CA    1 
ATOM   1373 C  C     . LEU C 3 104 ? 1.246   27.757 23.689  1.00 13.14 ? 400  LEU A C     1 
ATOM   1374 O  O     . LEU C 3 104 ? 0.738   27.837 24.803  1.00 14.14 ? 400  LEU A O     1 
ATOM   1375 C  CB    . LEU C 3 104 ? 1.010   29.744 22.180  1.00 11.86 ? 400  LEU A CB    1 
ATOM   1376 C  CG    . LEU C 3 104 ? 1.495   31.110 21.679  1.00 10.92 ? 400  LEU A CG    1 
ATOM   1377 C  CD1   . LEU C 3 104 ? 0.408   31.759 20.816  1.00 14.15 ? 400  LEU A CD1   1 
ATOM   1378 C  CD2   . LEU C 3 104 ? 1.849   32.005 22.863  1.00 12.92 ? 400  LEU A CD2   1 
ATOM   1379 N  N     . LEU C 3 105 ? 1.198   26.644 22.964  1.00 13.13 ? 401  LEU A N     1 
ATOM   1380 C  CA    . LEU C 3 105 ? 0.523   25.459 23.480  1.00 13.64 ? 401  LEU A CA    1 
ATOM   1381 C  C     . LEU C 3 105 ? 1.229   24.894 24.704  1.00 14.84 ? 401  LEU A C     1 
ATOM   1382 O  O     . LEU C 3 105 ? 0.585   24.457 25.657  1.00 15.24 ? 401  LEU A O     1 
ATOM   1383 C  CB    . LEU C 3 105 ? 0.413   24.387 22.396  1.00 11.99 ? 401  LEU A CB    1 
ATOM   1384 C  CG    . LEU C 3 105 ? -0.617  24.698 21.309  1.00 13.41 ? 401  LEU A CG    1 
ATOM   1385 C  CD1   . LEU C 3 105 ? -0.622  23.574 20.279  1.00 15.56 ? 401  LEU A CD1   1 
ATOM   1386 C  CD2   . LEU C 3 105 ? -1.997  24.849 21.943  1.00 14.01 ? 401  LEU A CD2   1 
ATOM   1387 N  N     . ASP C 3 106 ? 2.554   24.903 24.681  1.00 14.95 ? 402  ASP A N     1 
ATOM   1388 C  CA    . ASP C 3 106 ? 3.318   24.402 25.812  1.00 16.58 ? 402  ASP A CA    1 
ATOM   1389 C  C     . ASP C 3 106 ? 4.768   24.856 25.736  1.00 16.46 ? 402  ASP A C     1 
ATOM   1390 O  O     . ASP C 3 106 ? 5.617   24.190 25.136  1.00 16.04 ? 402  ASP A O     1 
ATOM   1391 C  CB    . ASP C 3 106 ? 3.254   22.876 25.876  1.00 15.59 ? 402  ASP A CB    1 
ATOM   1392 C  CG    . ASP C 3 106 ? 3.932   22.322 27.114  1.00 18.63 ? 402  ASP A CG    1 
ATOM   1393 O  OD1   . ASP C 3 106 ? 4.356   23.127 27.974  1.00 18.50 ? 402  ASP A OD1   1 
ATOM   1394 O  OD2   . ASP C 3 106 ? 4.038   21.084 27.230  1.00 20.59 ? 402  ASP A OD2   1 
ATOM   1395 N  N     . PRO C 3 107 ? 5.071   26.003 26.353  1.00 15.85 ? 403  PRO A N     1 
ATOM   1396 C  CA    . PRO C 3 107 ? 6.442   26.517 26.330  1.00 17.66 ? 403  PRO A CA    1 
ATOM   1397 C  C     . PRO C 3 107 ? 7.469   25.573 26.957  1.00 18.32 ? 403  PRO A C     1 
ATOM   1398 O  O     . PRO C 3 107 ? 8.664   25.668 26.668  1.00 18.09 ? 403  PRO A O     1 
ATOM   1399 C  CB    . PRO C 3 107 ? 6.323   27.862 27.049  1.00 17.58 ? 403  PRO A CB    1 
ATOM   1400 C  CG    . PRO C 3 107 ? 5.155   27.675 27.959  1.00 19.20 ? 403  PRO A CG    1 
ATOM   1401 C  CD    . PRO C 3 107 ? 4.178   26.894 27.114  1.00 16.45 ? 403  PRO A CD    1 
ATOM   1402 N  N     . ALA C 3 108 ? 7.003   24.646 27.789  1.00 18.02 ? 404  ALA A N     1 
ATOM   1403 C  CA    . ALA C 3 108 ? 7.903   23.701 28.454  1.00 21.33 ? 404  ALA A CA    1 
ATOM   1404 C  C     . ALA C 3 108 ? 8.467   22.615 27.540  1.00 23.14 ? 404  ALA A C     1 
ATOM   1405 O  O     . ALA C 3 108 ? 9.468   21.979 27.875  1.00 22.78 ? 404  ALA A O     1 
ATOM   1406 C  CB    . ALA C 3 108 ? 7.193   23.050 29.641  1.00 20.58 ? 404  ALA A CB    1 
ATOM   1407 N  N     . GLN C 3 109 ? 7.835   22.392 26.393  1.00 24.35 ? 405  GLN A N     1 
ATOM   1408 C  CA    . GLN C 3 109 ? 8.319   21.362 25.482  1.00 26.41 ? 405  GLN A CA    1 
ATOM   1409 C  C     . GLN C 3 109 ? 9.671   21.704 24.870  1.00 26.29 ? 405  GLN A C     1 
ATOM   1410 O  O     . GLN C 3 109 ? 10.399  20.819 24.420  1.00 26.34 ? 405  GLN A O     1 
ATOM   1411 C  CB    . GLN C 3 109 ? 7.293   21.106 24.377  1.00 30.15 ? 405  GLN A CB    1 
ATOM   1412 C  CG    . GLN C 3 109 ? 6.073   20.356 24.867  1.00 34.93 ? 405  GLN A CG    1 
ATOM   1413 C  CD    . GLN C 3 109 ? 6.445   19.076 25.593  1.00 36.85 ? 405  GLN A CD    1 
ATOM   1414 O  OE1   . GLN C 3 109 ? 7.077   18.188 25.023  1.00 37.66 ? 405  GLN A OE1   1 
ATOM   1415 N  NE2   . GLN C 3 109 ? 6.059   18.979 26.861  1.00 40.00 ? 405  GLN A NE2   1 
ATOM   1416 N  N     . GLY C 3 110 ? 10.008  22.988 24.861  1.00 25.80 ? 406  GLY A N     1 
ATOM   1417 C  CA    . GLY C 3 110 ? 11.278  23.412 24.302  1.00 26.16 ? 406  GLY A CA    1 
ATOM   1418 C  C     . GLY C 3 110 ? 11.393  23.108 22.820  1.00 26.54 ? 406  GLY A C     1 
ATOM   1419 O  O     . GLY C 3 110 ? 12.471  22.783 22.324  1.00 26.02 ? 406  GLY A O     1 
ATOM   1420 N  N     . VAL C 3 111 ? 10.275  23.214 22.112  1.00 24.92 ? 407  VAL A N     1 
ATOM   1421 C  CA    . VAL C 3 111 ? 10.248  22.955 20.678  1.00 24.18 ? 407  VAL A CA    1 
ATOM   1422 C  C     . VAL C 3 111 ? 11.202  23.884 19.935  1.00 24.37 ? 407  VAL A C     1 
ATOM   1423 O  O     . VAL C 3 111 ? 10.997  25.101 19.918  1.00 25.56 ? 407  VAL A O     1 
ATOM   1424 C  CB    . VAL C 3 111 ? 8.821   23.146 20.116  1.00 22.46 ? 407  VAL A CB    1 
ATOM   1425 C  CG1   . VAL C 3 111 ? 8.848   23.141 18.586  1.00 21.12 ? 407  VAL A CG1   1 
ATOM   1426 C  CG2   . VAL C 3 111 ? 7.915   22.037 20.639  1.00 22.18 ? 407  VAL A CG2   1 
ATOM   1427 N  N     . ASP C 3 112 ? 12.242  23.315 19.329  1.00 23.78 ? 408  ASP A N     1 
ATOM   1428 C  CA    . ASP C 3 112 ? 13.209  24.115 18.585  1.00 24.56 ? 408  ASP A CA    1 
ATOM   1429 C  C     . ASP C 3 112 ? 13.365  23.685 17.128  1.00 22.09 ? 408  ASP A C     1 
ATOM   1430 O  O     . ASP C 3 112 ? 14.259  24.148 16.429  1.00 20.55 ? 408  ASP A O     1 
ATOM   1431 C  CB    . ASP C 3 112 ? 14.578  24.119 19.276  1.00 29.30 ? 408  ASP A CB    1 
ATOM   1432 C  CG    . ASP C 3 112 ? 15.120  22.732 19.509  1.00 32.69 ? 408  ASP A CG    1 
ATOM   1433 O  OD1   . ASP C 3 112 ? 14.876  21.848 18.665  1.00 35.25 ? 408  ASP A OD1   1 
ATOM   1434 O  OD2   . ASP C 3 112 ? 15.804  22.529 20.537  1.00 38.43 ? 408  ASP A OD2   1 
ATOM   1435 N  N     . ASP C 3 113 ? 12.502  22.784 16.676  1.00 19.43 ? 409  ASP A N     1 
ATOM   1436 C  CA    . ASP C 3 113 ? 12.515  22.381 15.281  1.00 18.11 ? 409  ASP A CA    1 
ATOM   1437 C  C     . ASP C 3 113 ? 11.180  21.775 14.901  1.00 17.18 ? 409  ASP A C     1 
ATOM   1438 O  O     . ASP C 3 113 ? 10.360  21.439 15.772  1.00 13.08 ? 409  ASP A O     1 
ATOM   1439 C  CB    . ASP C 3 113 ? 13.695  21.445 14.937  1.00 17.85 ? 409  ASP A CB    1 
ATOM   1440 C  CG    . ASP C 3 113 ? 13.592  20.066 15.561  1.00 20.16 ? 409  ASP A CG    1 
ATOM   1441 O  OD1   . ASP C 3 113 ? 12.616  19.763 16.281  1.00 22.64 ? 409  ASP A OD1   1 
ATOM   1442 O  OD2   . ASP C 3 113 ? 14.526  19.270 15.315  1.00 19.00 ? 409  ASP A OD2   1 
ATOM   1443 N  N     . VAL C 3 114 ? 10.955  21.662 13.599  1.00 16.05 ? 410  VAL A N     1 
ATOM   1444 C  CA    . VAL C 3 114 ? 9.705   21.116 13.097  1.00 14.83 ? 410  VAL A CA    1 
ATOM   1445 C  C     . VAL C 3 114 ? 9.430   19.735 13.678  1.00 14.15 ? 410  VAL A C     1 
ATOM   1446 O  O     . VAL C 3 114 ? 8.306   19.446 14.082  1.00 13.75 ? 410  VAL A O     1 
ATOM   1447 C  CB    . VAL C 3 114 ? 9.714   21.062 11.553  1.00 14.72 ? 410  VAL A CB    1 
ATOM   1448 C  CG1   . VAL C 3 114 ? 8.486   20.321 11.042  1.00 13.51 ? 410  VAL A CG1   1 
ATOM   1449 C  CG2   . VAL C 3 114 ? 9.722   22.486 10.996  1.00 14.60 ? 410  VAL A CG2   1 
ATOM   1450 N  N     . ALA C 3 115 ? 10.460  18.894 13.740  1.00 14.03 ? 411  ALA A N     1 
ATOM   1451 C  CA    . ALA C 3 115 ? 10.307  17.543 14.279  1.00 14.82 ? 411  ALA A CA    1 
ATOM   1452 C  C     . ALA C 3 115 ? 9.734   17.522 15.696  1.00 14.81 ? 411  ALA A C     1 
ATOM   1453 O  O     . ALA C 3 115 ? 8.840   16.725 16.001  1.00 15.66 ? 411  ALA A O     1 
ATOM   1454 C  CB    . ALA C 3 115 ? 11.651  16.812 14.250  1.00 16.74 ? 411  ALA A CB    1 
ATOM   1455 N  N     . ALA C 3 116 ? 10.241  18.396 16.563  1.00 13.44 ? 412  ALA A N     1 
ATOM   1456 C  CA    . ALA C 3 116 ? 9.767   18.445 17.940  1.00 14.69 ? 412  ALA A CA    1 
ATOM   1457 C  C     . ALA C 3 116 ? 8.309   18.886 18.016  1.00 13.74 ? 412  ALA A C     1 
ATOM   1458 O  O     . ALA C 3 116 ? 7.540   18.364 18.820  1.00 13.80 ? 412  ALA A O     1 
ATOM   1459 C  CB    . ALA C 3 116 ? 10.645  19.375 18.773  1.00 16.49 ? 412  ALA A CB    1 
ATOM   1460 N  N     . ALA C 3 117 ? 7.928   19.848 17.185  1.00 14.10 ? 413  ALA A N     1 
ATOM   1461 C  CA    . ALA C 3 117 ? 6.548   20.325 17.177  1.00 13.98 ? 413  ALA A CA    1 
ATOM   1462 C  C     . ALA C 3 117 ? 5.620   19.240 16.634  1.00 13.59 ? 413  ALA A C     1 
ATOM   1463 O  O     . ALA C 3 117 ? 4.521   19.030 17.148  1.00 14.18 ? 413  ALA A O     1 
ATOM   1464 C  CB    . ALA C 3 117 ? 6.430   21.584 16.325  1.00 13.18 ? 413  ALA A CB    1 
ATOM   1465 N  N     . ALA C 3 118 ? 6.069   18.546 15.596  1.00 13.60 ? 414  ALA A N     1 
ATOM   1466 C  CA    . ALA C 3 118 ? 5.257   17.499 14.987  1.00 15.14 ? 414  ALA A CA    1 
ATOM   1467 C  C     . ALA C 3 118 ? 5.048   16.329 15.938  1.00 14.33 ? 414  ALA A C     1 
ATOM   1468 O  O     . ALA C 3 118 ? 3.993   15.696 15.931  1.00 16.23 ? 414  ALA A O     1 
ATOM   1469 C  CB    . ALA C 3 118 ? 5.909   17.009 13.685  1.00 14.10 ? 414  ALA A CB    1 
ATOM   1470 N  N     . LYS C 3 119 ? 6.047   16.050 16.766  1.00 15.70 ? 415  LYS A N     1 
ATOM   1471 C  CA    . LYS C 3 119 ? 5.946   14.935 17.696  1.00 18.01 ? 415  LYS A CA    1 
ATOM   1472 C  C     . LYS C 3 119 ? 4.815   15.178 18.698  1.00 19.80 ? 415  LYS A C     1 
ATOM   1473 O  O     . LYS C 3 119 ? 4.253   14.229 19.242  1.00 20.30 ? 415  LYS A O     1 
ATOM   1474 C  CB    . LYS C 3 119 ? 7.284   14.729 18.416  1.00 19.94 ? 415  LYS A CB    1 
ATOM   1475 C  CG    . LYS C 3 119 ? 7.455   13.345 19.030  1.00 23.69 ? 415  LYS A CG    1 
ATOM   1476 C  CD    . LYS C 3 119 ? 8.870   13.153 19.555  1.00 28.19 ? 415  LYS A CD    1 
ATOM   1477 C  CE    . LYS C 3 119 ? 9.052   11.784 20.195  1.00 30.07 ? 415  LYS A CE    1 
ATOM   1478 N  NZ    . LYS C 3 119 ? 8.874   10.670 19.225  1.00 32.33 ? 415  LYS A NZ    1 
ATOM   1479 N  N     . MET C 3 120 ? 4.473   16.447 18.923  1.00 20.42 ? 416  MET A N     1 
ATOM   1480 C  CA    . MET C 3 120 ? 3.392   16.799 19.847  1.00 21.77 ? 416  MET A CA    1 
ATOM   1481 C  C     . MET C 3 120 ? 2.057   16.233 19.368  1.00 22.05 ? 416  MET A C     1 
ATOM   1482 O  O     . MET C 3 120 ? 1.161   15.976 20.176  1.00 23.26 ? 416  MET A O     1 
ATOM   1483 C  CB    . MET C 3 120 ? 3.244   18.319 19.969  1.00 23.97 ? 416  MET A CB    1 
ATOM   1484 C  CG    . MET C 3 120 ? 4.350   19.035 20.726  1.00 26.64 ? 416  MET A CG    1 
ATOM   1485 S  SD    . MET C 3 120 ? 4.149   20.834 20.596  1.00 30.12 ? 416  MET A SD    1 
ATOM   1486 C  CE    . MET C 3 120 ? 2.812   21.137 21.741  1.00 30.18 ? 416  MET A CE    1 
ATOM   1487 N  N     . LYS C 3 121 ? 1.930   16.051 18.056  1.00 19.68 ? 417  LYS A N     1 
ATOM   1488 C  CA    . LYS C 3 121 ? 0.705   15.529 17.455  1.00 18.87 ? 417  LYS A CA    1 
ATOM   1489 C  C     . LYS C 3 121 ? 0.909   14.147 16.827  1.00 17.89 ? 417  LYS A C     1 
ATOM   1490 O  O     . LYS C 3 121 ? 0.219   13.779 15.882  1.00 17.11 ? 417  LYS A O     1 
ATOM   1491 C  CB    . LYS C 3 121 ? 0.184   16.498 16.391  1.00 19.49 ? 417  LYS A CB    1 
ATOM   1492 C  CG    . LYS C 3 121 ? -0.259  17.862 16.924  1.00 22.13 ? 417  LYS A CG    1 
ATOM   1493 C  CD    . LYS C 3 121 ? -1.497  17.749 17.790  1.00 21.58 ? 417  LYS A CD    1 
ATOM   1494 C  CE    . LYS C 3 121 ? -1.956  19.114 18.281  1.00 22.26 ? 417  LYS A CE    1 
ATOM   1495 N  NZ    . LYS C 3 121 ? -3.095  18.984 19.232  1.00 22.03 ? 417  LYS A NZ    1 
ATOM   1496 N  N     . GLN C 3 122 ? 1.866   13.398 17.358  1.00 18.25 ? 418  GLN A N     1 
ATOM   1497 C  CA    . GLN C 3 122 ? 2.163   12.045 16.891  1.00 19.03 ? 418  GLN A CA    1 
ATOM   1498 C  C     . GLN C 3 122 ? 2.538   11.961 15.412  1.00 18.46 ? 418  GLN A C     1 
ATOM   1499 O  O     . GLN C 3 122 ? 2.294   10.950 14.756  1.00 20.09 ? 418  GLN A O     1 
ATOM   1500 C  CB    . GLN C 3 122 ? 0.974   11.118 17.182  1.00 20.06 ? 418  GLN A CB    1 
ATOM   1501 C  CG    . GLN C 3 122 ? 0.444   11.219 18.617  1.00 23.44 ? 418  GLN A CG    1 
ATOM   1502 C  CD    . GLN C 3 122 ? 1.524   11.013 19.674  1.00 26.66 ? 418  GLN A CD    1 
ATOM   1503 O  OE1   . GLN C 3 122 ? 1.986   9.891  19.910  1.00 27.91 ? 418  GLN A OE1   1 
ATOM   1504 N  NE2   . GLN C 3 122 ? 1.935   12.104 20.313  1.00 27.13 ? 418  GLN A NE2   1 
ATOM   1505 N  N     . TYR C 3 123 ? 3.124   13.031 14.888  1.00 17.64 ? 419  TYR A N     1 
ATOM   1506 C  CA    . TYR C 3 123 ? 3.569   13.058 13.501  1.00 16.57 ? 419  TYR A CA    1 
ATOM   1507 C  C     . TYR C 3 123 ? 5.082   12.920 13.595  1.00 17.61 ? 419  TYR A C     1 
ATOM   1508 O  O     . TYR C 3 123 ? 5.750   13.746 14.215  1.00 16.81 ? 419  TYR A O     1 
ATOM   1509 C  CB    . TYR C 3 123 ? 3.190   14.386 12.836  1.00 17.14 ? 419  TYR A CB    1 
ATOM   1510 C  CG    . TYR C 3 123 ? 3.544   14.468 11.366  1.00 14.96 ? 419  TYR A CG    1 
ATOM   1511 C  CD1   . TYR C 3 123 ? 4.870   14.594 10.950  1.00 15.70 ? 419  TYR A CD1   1 
ATOM   1512 C  CD2   . TYR C 3 123 ? 2.548   14.409 10.387  1.00 16.06 ? 419  TYR A CD2   1 
ATOM   1513 C  CE1   . TYR C 3 123 ? 5.198   14.661 9.590   1.00 16.37 ? 419  TYR A CE1   1 
ATOM   1514 C  CE2   . TYR C 3 123 ? 2.864   14.474 9.033   1.00 16.18 ? 419  TYR A CE2   1 
ATOM   1515 C  CZ    . TYR C 3 123 ? 4.187   14.600 8.643   1.00 16.31 ? 419  TYR A CZ    1 
ATOM   1516 O  OH    . TYR C 3 123 ? 4.490   14.673 7.306   1.00 16.75 ? 419  TYR A OH    1 
ATOM   1517 N  N     . GLU C 3 124 ? 5.626   11.872 12.988  1.00 16.65 ? 420  GLU A N     1 
ATOM   1518 C  CA    . GLU C 3 124 ? 7.061   11.650 13.061  1.00 16.87 ? 420  GLU A CA    1 
ATOM   1519 C  C     . GLU C 3 124 ? 7.726   11.378 11.722  1.00 15.80 ? 420  GLU A C     1 
ATOM   1520 O  O     . GLU C 3 124 ? 8.836   10.850 11.677  1.00 16.27 ? 420  GLU A O     1 
ATOM   1521 C  CB    . GLU C 3 124 ? 7.351   10.502 14.031  1.00 18.78 ? 420  GLU A CB    1 
ATOM   1522 C  CG    . GLU C 3 124 ? 7.215   10.897 15.495  1.00 21.32 ? 420  GLU A CG    1 
ATOM   1523 C  CD    . GLU C 3 124 ? 7.334   9.721  16.444  1.00 25.31 ? 420  GLU A CD    1 
ATOM   1524 O  OE1   . GLU C 3 124 ? 8.145   8.808  16.165  1.00 25.27 ? 420  GLU A OE1   1 
ATOM   1525 O  OE2   . GLU C 3 124 ? 6.628   9.721  17.477  1.00 22.77 ? 420  GLU A OE2   1 
ATOM   1526 N  N     . ALA C 3 125 ? 7.059   11.754 10.636  1.00 14.64 ? 421  ALA A N     1 
ATOM   1527 C  CA    . ALA C 3 125 ? 7.599   11.544 9.293   1.00 15.62 ? 421  ALA A CA    1 
ATOM   1528 C  C     . ALA C 3 125 ? 8.524   12.689 8.885   1.00 15.25 ? 421  ALA A C     1 
ATOM   1529 O  O     . ALA C 3 125 ? 8.516   13.141 7.737   1.00 14.02 ? 421  ALA A O     1 
ATOM   1530 C  CB    . ALA C 3 125 ? 6.467   11.406 8.290   1.00 15.87 ? 421  ALA A CB    1 
ATOM   1531 N  N     . VAL C 3 126 ? 9.320   13.154 9.840   1.00 15.28 ? 422  VAL A N     1 
ATOM   1532 C  CA    . VAL C 3 126 ? 10.272  14.228 9.593   1.00 14.80 ? 422  VAL A CA    1 
ATOM   1533 C  C     . VAL C 3 126 ? 11.405  14.056 10.603  1.00 15.12 ? 422  VAL A C     1 
ATOM   1534 O  O     . VAL C 3 126 ? 11.172  13.694 11.754  1.00 15.90 ? 422  VAL A O     1 
ATOM   1535 C  CB    . VAL C 3 126 ? 9.595   15.619 9.738   1.00 15.97 ? 422  VAL A CB    1 
ATOM   1536 C  CG1   . VAL C 3 126 ? 9.069   15.804 11.154  1.00 16.01 ? 422  VAL A CG1   1 
ATOM   1537 C  CG2   . VAL C 3 126 ? 10.576  16.723 9.354   1.00 15.21 ? 422  VAL A CG2   1 
ATOM   1538 N  N     . ARG C 3 127 ? 12.634  14.303 10.167  1.00 14.70 ? 423  ARG A N     1 
ATOM   1539 C  CA    . ARG C 3 127 ? 13.798  14.147 11.036  1.00 17.38 ? 423  ARG A CA    1 
ATOM   1540 C  C     . ARG C 3 127 ? 14.138  15.433 11.779  1.00 17.01 ? 423  ARG A C     1 
ATOM   1541 O  O     . ARG C 3 127 ? 13.858  16.530 11.299  1.00 16.70 ? 423  ARG A O     1 
ATOM   1542 C  CB    . ARG C 3 127 ? 15.019  13.735 10.210  1.00 19.11 ? 423  ARG A CB    1 
ATOM   1543 C  CG    . ARG C 3 127 ? 14.816  12.519 9.323   1.00 22.09 ? 423  ARG A CG    1 
ATOM   1544 C  CD    . ARG C 3 127 ? 15.933  12.432 8.284   1.00 26.88 ? 423  ARG A CD    1 
ATOM   1545 N  NE    . ARG C 3 127 ? 17.229  12.135 8.885   1.00 30.65 ? 423  ARG A NE    1 
ATOM   1546 C  CZ    . ARG C 3 127 ? 18.395  12.279 8.261   1.00 30.16 ? 423  ARG A CZ    1 
ATOM   1547 N  NH1   . ARG C 3 127 ? 18.438  12.723 7.010   1.00 29.33 ? 423  ARG A NH1   1 
ATOM   1548 N  NH2   . ARG C 3 127 ? 19.520  11.972 8.889   1.00 29.49 ? 423  ARG A NH2   1 
ATOM   1549 N  N     . PRO C 3 128 ? 14.740  15.313 12.970  1.00 19.42 ? 424  PRO A N     1 
ATOM   1550 C  CA    . PRO C 3 128 ? 15.101  16.524 13.712  1.00 18.45 ? 424  PRO A CA    1 
ATOM   1551 C  C     . PRO C 3 128 ? 16.275  17.160 12.965  1.00 19.54 ? 424  PRO A C     1 
ATOM   1552 O  O     . PRO C 3 128 ? 17.107  16.447 12.397  1.00 19.02 ? 424  PRO A O     1 
ATOM   1553 C  CB    . PRO C 3 128 ? 15.459  15.997 15.097  1.00 20.30 ? 424  PRO A CB    1 
ATOM   1554 C  CG    . PRO C 3 128 ? 15.925  14.600 14.833  1.00 23.93 ? 424  PRO A CG    1 
ATOM   1555 C  CD    . PRO C 3 128 ? 14.963  14.103 13.782  1.00 21.09 ? 424  PRO A CD    1 
ATOM   1556 N  N     . ASP C 3 129 ? 16.346  18.486 12.954  1.00 17.79 ? 425  ASP A N     1 
ATOM   1557 C  CA    . ASP C 3 129 ? 17.425  19.163 12.240  1.00 18.36 ? 425  ASP A CA    1 
ATOM   1558 C  C     . ASP C 3 129 ? 18.813  18.679 12.655  1.00 18.18 ? 425  ASP A C     1 
ATOM   1559 O  O     . ASP C 3 129 ? 19.693  18.508 11.814  1.00 17.88 ? 425  ASP A O     1 
ATOM   1560 C  CB    . ASP C 3 129 ? 17.341  20.682 12.437  1.00 17.75 ? 425  ASP A CB    1 
ATOM   1561 C  CG    . ASP C 3 129 ? 16.099  21.291 11.802  1.00 19.42 ? 425  ASP A CG    1 
ATOM   1562 O  OD1   . ASP C 3 129 ? 15.614  20.749 10.791  1.00 19.24 ? 425  ASP A OD1   1 
ATOM   1563 O  OD2   . ASP C 3 129 ? 15.611  22.322 12.309  1.00 20.17 ? 425  ASP A OD2   1 
ATOM   1564 N  N     . GLU C 3 130 ? 19.009  18.457 13.948  1.00 20.19 ? 426  GLU A N     1 
ATOM   1565 C  CA    . GLU C 3 130 ? 20.304  18.007 14.447  1.00 22.61 ? 426  GLU A CA    1 
ATOM   1566 C  C     . GLU C 3 130 ? 20.750  16.700 13.793  1.00 23.84 ? 426  GLU A C     1 
ATOM   1567 O  O     . GLU C 3 130 ? 21.939  16.502 13.524  1.00 23.94 ? 426  GLU A O     1 
ATOM   1568 C  CB    . GLU C 3 130 ? 20.249  17.841 15.967  1.00 26.82 ? 426  GLU A CB    1 
ATOM   1569 C  CG    . GLU C 3 130 ? 21.584  17.477 16.601  1.00 30.63 ? 426  GLU A CG    1 
ATOM   1570 C  CD    . GLU C 3 130 ? 21.534  17.510 18.116  1.00 33.13 ? 426  GLU A CD    1 
ATOM   1571 O  OE1   . GLU C 3 130 ? 21.238  18.586 18.680  1.00 35.27 ? 426  GLU A OE1   1 
ATOM   1572 O  OE2   . GLU C 3 130 ? 21.791  16.460 18.744  1.00 36.76 ? 426  GLU A OE2   1 
ATOM   1573 N  N     . ALA C 3 131 ? 19.798  15.810 13.530  1.00 22.67 ? 427  ALA A N     1 
ATOM   1574 C  CA    . ALA C 3 131 ? 20.115  14.532 12.906  1.00 22.49 ? 427  ALA A CA    1 
ATOM   1575 C  C     . ALA C 3 131 ? 20.558  14.728 11.460  1.00 22.49 ? 427  ALA A C     1 
ATOM   1576 O  O     . ALA C 3 131 ? 21.373  13.969 10.940  1.00 22.24 ? 427  ALA A O     1 
ATOM   1577 C  CB    . ALA C 3 131 ? 18.901  13.604 12.962  1.00 23.55 ? 427  ALA A CB    1 
ATOM   1578 N  N     . VAL C 3 132 ? 20.031  15.758 10.812  1.00 22.23 ? 428  VAL A N     1 
ATOM   1579 C  CA    . VAL C 3 132 ? 20.374  16.016 9.422   1.00 23.38 ? 428  VAL A CA    1 
ATOM   1580 C  C     . VAL C 3 132 ? 21.633  16.858 9.257   1.00 24.92 ? 428  VAL A C     1 
ATOM   1581 O  O     . VAL C 3 132 ? 22.500  16.539 8.437   1.00 23.78 ? 428  VAL A O     1 
ATOM   1582 C  CB    . VAL C 3 132 ? 19.204  16.712 8.694   1.00 23.63 ? 428  VAL A CB    1 
ATOM   1583 C  CG1   . VAL C 3 132 ? 19.582  17.014 7.249   1.00 23.64 ? 428  VAL A CG1   1 
ATOM   1584 C  CG2   . VAL C 3 132 ? 17.969  15.827 8.746   1.00 24.36 ? 428  VAL A CG2   1 
ATOM   1585 N  N     . TYR C 3 133 ? 21.738  17.921 10.047  1.00 24.61 ? 429  TYR A N     1 
ATOM   1586 C  CA    . TYR C 3 133 ? 22.873  18.834 9.961   1.00 26.00 ? 429  TYR A CA    1 
ATOM   1587 C  C     . TYR C 3 133 ? 24.030  18.540 10.899  1.00 28.08 ? 429  TYR A C     1 
ATOM   1588 O  O     . TYR C 3 133 ? 25.125  19.061 10.709  1.00 27.65 ? 429  TYR A O     1 
ATOM   1589 C  CB    . TYR C 3 133 ? 22.394  20.265 10.200  1.00 23.29 ? 429  TYR A CB    1 
ATOM   1590 C  CG    . TYR C 3 133 ? 21.301  20.687 9.249   1.00 22.03 ? 429  TYR A CG    1 
ATOM   1591 C  CD1   . TYR C 3 133 ? 21.509  20.665 7.871   1.00 21.86 ? 429  TYR A CD1   1 
ATOM   1592 C  CD2   . TYR C 3 133 ? 20.055  21.092 9.722   1.00 22.80 ? 429  TYR A CD2   1 
ATOM   1593 C  CE1   . TYR C 3 133 ? 20.501  21.036 6.985   1.00 22.95 ? 429  TYR A CE1   1 
ATOM   1594 C  CE2   . TYR C 3 133 ? 19.039  21.466 8.845   1.00 20.69 ? 429  TYR A CE2   1 
ATOM   1595 C  CZ    . TYR C 3 133 ? 19.271  21.433 7.479   1.00 21.51 ? 429  TYR A CZ    1 
ATOM   1596 O  OH    . TYR C 3 133 ? 18.272  21.791 6.606   1.00 19.96 ? 429  TYR A OH    1 
ATOM   1597 N  N     . GLY C 3 134 ? 23.794  17.708 11.906  1.00 30.90 ? 430  GLY A N     1 
ATOM   1598 C  CA    . GLY C 3 134 ? 24.848  17.407 12.855  1.00 34.27 ? 430  GLY A CA    1 
ATOM   1599 C  C     . GLY C 3 134 ? 24.914  18.545 13.851  1.00 37.49 ? 430  GLY A C     1 
ATOM   1600 O  O     . GLY C 3 134 ? 24.084  19.453 13.805  1.00 37.61 ? 430  GLY A O     1 
ATOM   1601 N  N     . LYS C 3 135 ? 25.902  18.517 14.740  1.00 41.43 ? 431  LYS A N     1 
ATOM   1602 C  CA    . LYS C 3 135 ? 26.032  19.560 15.751  1.00 44.47 ? 431  LYS A CA    1 
ATOM   1603 C  C     . LYS C 3 135 ? 27.450  20.111 15.892  1.00 45.84 ? 431  LYS A C     1 
ATOM   1604 O  O     . LYS C 3 135 ? 28.428  19.364 15.859  1.00 45.93 ? 431  LYS A O     1 
ATOM   1605 C  CB    . LYS C 3 135 ? 25.555  19.021 17.103  1.00 46.22 ? 431  LYS A CB    1 
ATOM   1606 C  CG    . LYS C 3 135 ? 25.674  20.002 18.262  1.00 48.77 ? 431  LYS A CG    1 
ATOM   1607 C  CD    . LYS C 3 135 ? 24.781  21.223 18.078  1.00 50.75 ? 431  LYS A CD    1 
ATOM   1608 C  CE    . LYS C 3 135 ? 24.863  22.143 19.292  1.00 51.52 ? 431  LYS A CE    1 
ATOM   1609 N  NZ    . LYS C 3 135 ? 23.982  23.339 19.164  1.00 52.93 ? 431  LYS A NZ    1 
ATOM   1610 N  N     . GLY C 3 136 ? 27.542  21.430 16.047  1.00 46.71 ? 432  GLY A N     1 
ATOM   1611 C  CA    . GLY C 3 136 ? 28.825  22.091 16.218  1.00 48.17 ? 432  GLY A CA    1 
ATOM   1612 C  C     . GLY C 3 136 ? 29.873  21.873 15.142  1.00 49.04 ? 432  GLY A C     1 
ATOM   1613 O  O     . GLY C 3 136 ? 29.625  22.087 13.955  1.00 49.05 ? 432  GLY A O     1 
ATOM   1614 N  N     . ALA C 3 137 ? 31.058  21.449 15.568  1.00 49.65 ? 433  ALA A N     1 
ATOM   1615 C  CA    . ALA C 3 137 ? 32.172  21.205 14.659  1.00 50.15 ? 433  ALA A CA    1 
ATOM   1616 C  C     . ALA C 3 137 ? 31.783  20.309 13.490  1.00 50.14 ? 433  ALA A C     1 
ATOM   1617 O  O     . ALA C 3 137 ? 32.279  20.482 12.378  1.00 51.29 ? 433  ALA A O     1 
ATOM   1618 C  CB    . ALA C 3 137 ? 33.339  20.585 15.422  1.00 49.66 ? 433  ALA A CB    1 
ATOM   1619 N  N     . LYS C 3 138 ? 30.896  19.353 13.743  1.00 49.79 ? 434  LYS A N     1 
ATOM   1620 C  CA    . LYS C 3 138 ? 30.459  18.427 12.706  1.00 48.88 ? 434  LYS A CA    1 
ATOM   1621 C  C     . LYS C 3 138 ? 29.236  18.935 11.947  1.00 47.95 ? 434  LYS A C     1 
ATOM   1622 O  O     . LYS C 3 138 ? 28.772  18.295 11.003  1.00 47.41 ? 434  LYS A O     1 
ATOM   1623 C  CB    . LYS C 3 138 ? 30.154  17.059 13.323  1.00 50.02 ? 434  LYS A CB    1 
ATOM   1624 C  CG    . LYS C 3 138 ? 31.337  16.432 14.048  1.00 51.12 ? 434  LYS A CG    1 
ATOM   1625 C  CD    . LYS C 3 138 ? 30.976  15.078 14.638  1.00 52.57 ? 434  LYS A CD    1 
ATOM   1626 C  CE    . LYS C 3 138 ? 32.143  14.483 15.412  1.00 53.23 ? 434  LYS A CE    1 
ATOM   1627 N  NZ    . LYS C 3 138 ? 32.574  15.365 16.534  1.00 54.21 ? 434  LYS A NZ    1 
ATOM   1628 N  N     . ARG C 3 139 ? 28.719  20.089 12.358  1.00 46.38 ? 435  ARG A N     1 
ATOM   1629 C  CA    . ARG C 3 139 ? 27.553  20.674 11.708  1.00 45.28 ? 435  ARG A CA    1 
ATOM   1630 C  C     . ARG C 3 139 ? 27.886  20.988 10.255  1.00 44.81 ? 435  ARG A C     1 
ATOM   1631 O  O     . ARG C 3 139 ? 28.952  21.534 9.961   1.00 45.48 ? 435  ARG A O     1 
ATOM   1632 C  CB    . ARG C 3 139 ? 27.132  21.956 12.426  1.00 45.13 ? 435  ARG A CB    1 
ATOM   1633 C  CG    . ARG C 3 139 ? 25.804  22.527 11.959  1.00 46.45 ? 435  ARG A CG    1 
ATOM   1634 C  CD    . ARG C 3 139 ? 25.486  23.827 12.680  1.00 47.69 ? 435  ARG A CD    1 
ATOM   1635 N  NE    . ARG C 3 139 ? 24.121  24.282 12.430  1.00 47.45 ? 435  ARG A NE    1 
ATOM   1636 C  CZ    . ARG C 3 139 ? 23.032  23.628 12.821  1.00 48.25 ? 435  ARG A CZ    1 
ATOM   1637 N  NH1   . ARG C 3 139 ? 23.143  22.484 13.484  1.00 49.23 ? 435  ARG A NH1   1 
ATOM   1638 N  NH2   . ARG C 3 139 ? 21.829  24.118 12.552  1.00 47.56 ? 435  ARG A NH2   1 
ATOM   1639 N  N     . ALA C 3 140 ? 26.976  20.646 9.348   1.00 42.07 ? 436  ALA A N     1 
ATOM   1640 C  CA    . ALA C 3 140 ? 27.197  20.896 7.930   1.00 39.77 ? 436  ALA A CA    1 
ATOM   1641 C  C     . ALA C 3 140 ? 25.960  20.595 7.095   1.00 37.90 ? 436  ALA A C     1 
ATOM   1642 O  O     . ALA C 3 140 ? 25.148  19.741 7.452   1.00 37.00 ? 436  ALA A O     1 
ATOM   1643 C  CB    . ALA C 3 140 ? 28.368  20.057 7.434   1.00 39.71 ? 436  ALA A CB    1 
ATOM   1644 N  N     . VAL C 3 141 ? 25.825  21.306 5.981   1.00 35.29 ? 437  VAL A N     1 
ATOM   1645 C  CA    . VAL C 3 141 ? 24.701  21.107 5.078   1.00 34.29 ? 437  VAL A CA    1 
ATOM   1646 C  C     . VAL C 3 141 ? 24.973  19.847 4.266   1.00 33.68 ? 437  VAL A C     1 
ATOM   1647 O  O     . VAL C 3 141 ? 26.019  19.727 3.627   1.00 33.56 ? 437  VAL A O     1 
ATOM   1648 C  CB    . VAL C 3 141 ? 24.544  22.292 4.105   1.00 34.16 ? 437  VAL A CB    1 
ATOM   1649 C  CG1   . VAL C 3 141 ? 23.323  22.087 3.228   1.00 32.96 ? 437  VAL A CG1   1 
ATOM   1650 C  CG2   . VAL C 3 141 ? 24.434  23.592 4.883   1.00 34.63 ? 437  VAL A CG2   1 
ATOM   1651 N  N     . PRO C 3 142 ? 24.037  18.886 4.282   1.00 33.41 ? 438  PRO A N     1 
ATOM   1652 C  CA    . PRO C 3 142 ? 24.224  17.644 3.526   1.00 33.10 ? 438  PRO A CA    1 
ATOM   1653 C  C     . PRO C 3 142 ? 24.066  17.848 2.022   1.00 32.87 ? 438  PRO A C     1 
ATOM   1654 O  O     . PRO C 3 142 ? 23.682  18.926 1.571   1.00 31.84 ? 438  PRO A O     1 
ATOM   1655 C  CB    . PRO C 3 142 ? 23.171  16.717 4.121   1.00 33.70 ? 438  PRO A CB    1 
ATOM   1656 C  CG    . PRO C 3 142 ? 22.052  17.668 4.438   1.00 33.62 ? 438  PRO A CG    1 
ATOM   1657 C  CD    . PRO C 3 142 ? 22.781  18.849 5.054   1.00 33.60 ? 438  PRO A CD    1 
ATOM   1658 N  N     . ASP C 3 143 ? 24.367  16.805 1.253   1.00 33.45 ? 439  ASP A N     1 
ATOM   1659 C  CA    . ASP C 3 143 ? 24.249  16.859 -0.198  1.00 32.51 ? 439  ASP A CA    1 
ATOM   1660 C  C     . ASP C 3 143 ? 22.804  17.162 -0.574  1.00 31.56 ? 439  ASP A C     1 
ATOM   1661 O  O     . ASP C 3 143 ? 21.879  16.826 0.167   1.00 30.21 ? 439  ASP A O     1 
ATOM   1662 C  CB    . ASP C 3 143 ? 24.702  15.530 -0.810  1.00 35.29 ? 439  ASP A CB    1 
ATOM   1663 C  CG    . ASP C 3 143 ? 26.210  15.338 -0.733  1.00 38.30 ? 439  ASP A CG    1 
ATOM   1664 O  OD1   . ASP C 3 143 ? 26.686  14.211 -0.988  1.00 40.89 ? 439  ASP A OD1   1 
ATOM   1665 O  OD2   . ASP C 3 143 ? 26.924  16.318 -0.426  1.00 39.18 ? 439  ASP A OD2   1 
ATOM   1666 N  N     . GLU C 3 144 ? 22.616  17.798 -1.724  1.00 30.46 ? 440  GLU A N     1 
ATOM   1667 C  CA    . GLU C 3 144 ? 21.288  18.182 -2.185  1.00 30.35 ? 440  GLU A CA    1 
ATOM   1668 C  C     . GLU C 3 144 ? 20.191  17.136 -1.999  1.00 30.82 ? 440  GLU A C     1 
ATOM   1669 O  O     . GLU C 3 144 ? 19.111  17.454 -1.507  1.00 29.35 ? 440  GLU A O     1 
ATOM   1670 C  CB    . GLU C 3 144 ? 21.340  18.607 -3.651  1.00 31.43 ? 440  GLU A CB    1 
ATOM   1671 C  CG    . GLU C 3 144 ? 20.072  19.297 -4.120  1.00 31.96 ? 440  GLU A CG    1 
ATOM   1672 C  CD    . GLU C 3 144 ? 20.210  19.879 -5.509  1.00 32.22 ? 440  GLU A CD    1 
ATOM   1673 O  OE1   . GLU C 3 144 ? 20.280  19.096 -6.480  1.00 34.15 ? 440  GLU A OE1   1 
ATOM   1674 O  OE2   . GLU C 3 144 ? 20.253  21.121 -5.627  1.00 30.17 ? 440  GLU A OE2   1 
ATOM   1675 N  N     . PRO C 3 145 ? 20.447  15.877 -2.395  1.00 30.70 ? 441  PRO A N     1 
ATOM   1676 C  CA    . PRO C 3 145 ? 19.421  14.842 -2.236  1.00 29.65 ? 441  PRO A CA    1 
ATOM   1677 C  C     . PRO C 3 145 ? 18.863  14.770 -0.815  1.00 28.00 ? 441  PRO A C     1 
ATOM   1678 O  O     . PRO C 3 145 ? 17.648  14.772 -0.609  1.00 27.26 ? 441  PRO A O     1 
ATOM   1679 C  CB    . PRO C 3 145 ? 20.146  13.568 -2.656  1.00 31.27 ? 441  PRO A CB    1 
ATOM   1680 C  CG    . PRO C 3 145 ? 21.102  14.065 -3.696  1.00 30.57 ? 441  PRO A CG    1 
ATOM   1681 C  CD    . PRO C 3 145 ? 21.641  15.330 -3.066  1.00 31.06 ? 441  PRO A CD    1 
ATOM   1682 N  N     . VAL C 3 146 ? 19.762  14.707 0.160   1.00 25.70 ? 442  VAL A N     1 
ATOM   1683 C  CA    . VAL C 3 146 ? 19.378  14.630 1.561   1.00 24.54 ? 442  VAL A CA    1 
ATOM   1684 C  C     . VAL C 3 146 ? 18.755  15.944 2.030   1.00 23.01 ? 442  VAL A C     1 
ATOM   1685 O  O     . VAL C 3 146 ? 17.731  15.941 2.716   1.00 21.36 ? 442  VAL A O     1 
ATOM   1686 C  CB    . VAL C 3 146 ? 20.600  14.281 2.440   1.00 25.72 ? 442  VAL A CB    1 
ATOM   1687 C  CG1   . VAL C 3 146 ? 20.223  14.300 3.911   1.00 24.63 ? 442  VAL A CG1   1 
ATOM   1688 C  CG2   . VAL C 3 146 ? 21.130  12.908 2.053   1.00 27.70 ? 442  VAL A CG2   1 
ATOM   1689 N  N     . LEU C 3 147 ? 19.365  17.062 1.650   1.00 19.51 ? 443  LEU A N     1 
ATOM   1690 C  CA    . LEU C 3 147 ? 18.851  18.372 2.036   1.00 19.33 ? 443  LEU A CA    1 
ATOM   1691 C  C     . LEU C 3 147 ? 17.437  18.576 1.502   1.00 19.81 ? 443  LEU A C     1 
ATOM   1692 O  O     . LEU C 3 147 ? 16.534  18.964 2.243   1.00 19.61 ? 443  LEU A O     1 
ATOM   1693 C  CB    . LEU C 3 147 ? 19.757  19.486 1.498   1.00 20.27 ? 443  LEU A CB    1 
ATOM   1694 C  CG    . LEU C 3 147 ? 19.260  20.923 1.703   1.00 19.84 ? 443  LEU A CG    1 
ATOM   1695 C  CD1   . LEU C 3 147 ? 19.239  21.267 3.185   1.00 19.48 ? 443  LEU A CD1   1 
ATOM   1696 C  CD2   . LEU C 3 147 ? 20.172  21.885 0.953   1.00 20.73 ? 443  LEU A CD2   1 
ATOM   1697 N  N     . ALA C 3 148 ? 17.255  18.312 0.212   1.00 18.93 ? 444  ALA A N     1 
ATOM   1698 C  CA    . ALA C 3 148 ? 15.958  18.476 -0.436  1.00 19.48 ? 444  ALA A CA    1 
ATOM   1699 C  C     . ALA C 3 148 ? 14.851  17.679 0.243   1.00 19.47 ? 444  ALA A C     1 
ATOM   1700 O  O     . ALA C 3 148 ? 13.783  18.219 0.530   1.00 20.05 ? 444  ALA A O     1 
ATOM   1701 C  CB    . ALA C 3 148 ? 16.053  18.084 -1.910  1.00 18.58 ? 444  ALA A CB    1 
ATOM   1702 N  N     . GLU C 3 149 ? 15.093  16.398 0.499   1.00 18.96 ? 445  GLU A N     1 
ATOM   1703 C  CA    . GLU C 3 149 ? 14.074  15.586 1.147   1.00 21.54 ? 445  GLU A CA    1 
ATOM   1704 C  C     . GLU C 3 149 ? 13.732  16.099 2.542   1.00 19.50 ? 445  GLU A C     1 
ATOM   1705 O  O     . GLU C 3 149 ? 12.579  16.045 2.961   1.00 19.96 ? 445  GLU A O     1 
ATOM   1706 C  CB    . GLU C 3 149 ? 14.504  14.119 1.234   1.00 25.09 ? 445  GLU A CB    1 
ATOM   1707 C  CG    . GLU C 3 149 ? 13.671  13.320 2.235   1.00 28.91 ? 445  GLU A CG    1 
ATOM   1708 C  CD    . GLU C 3 149 ? 13.549  11.854 1.882   1.00 33.48 ? 445  GLU A CD    1 
ATOM   1709 O  OE1   . GLU C 3 149 ? 14.574  11.240 1.516   1.00 34.49 ? 445  GLU A OE1   1 
ATOM   1710 O  OE2   . GLU C 3 149 ? 12.425  11.314 1.982   1.00 33.46 ? 445  GLU A OE2   1 
ATOM   1711 N  N     . HIS C 3 150 ? 14.732  16.598 3.263   1.00 18.89 ? 446  HIS A N     1 
ATOM   1712 C  CA    . HIS C 3 150 ? 14.493  17.104 4.603   1.00 18.09 ? 446  HIS A CA    1 
ATOM   1713 C  C     . HIS C 3 150 ? 13.610  18.349 4.585   1.00 17.04 ? 446  HIS A C     1 
ATOM   1714 O  O     . HIS C 3 150 ? 12.639  18.431 5.335   1.00 16.39 ? 446  HIS A O     1 
ATOM   1715 C  CB    . HIS C 3 150 ? 15.820  17.407 5.307   1.00 17.78 ? 446  HIS A CB    1 
ATOM   1716 C  CG    . HIS C 3 150 ? 15.659  17.916 6.707   1.00 18.32 ? 446  HIS A CG    1 
ATOM   1717 N  ND1   . HIS C 3 150 ? 14.886  17.271 7.649   1.00 15.36 ? 446  HIS A ND1   1 
ATOM   1718 C  CD2   . HIS C 3 150 ? 16.177  19.004 7.326   1.00 17.66 ? 446  HIS A CD2   1 
ATOM   1719 C  CE1   . HIS C 3 150 ? 14.934  17.941 8.788   1.00 17.54 ? 446  HIS A CE1   1 
ATOM   1720 N  NE2   . HIS C 3 150 ? 15.710  18.996 8.618   1.00 18.20 ? 446  HIS A NE2   1 
ATOM   1721 N  N     . LEU C 3 151 ? 13.931  19.313 3.724   1.00 16.07 ? 447  LEU A N     1 
ATOM   1722 C  CA    . LEU C 3 151 ? 13.134  20.537 3.653   1.00 14.94 ? 447  LEU A CA    1 
ATOM   1723 C  C     . LEU C 3 151 ? 11.712  20.231 3.212   1.00 15.13 ? 447  LEU A C     1 
ATOM   1724 O  O     . LEU C 3 151 ? 10.753  20.833 3.703   1.00 15.72 ? 447  LEU A O     1 
ATOM   1725 C  CB    . LEU C 3 151 ? 13.763  21.546 2.687   1.00 16.00 ? 447  LEU A CB    1 
ATOM   1726 C  CG    . LEU C 3 151 ? 15.197  21.996 2.979   1.00 15.70 ? 447  LEU A CG    1 
ATOM   1727 C  CD1   . LEU C 3 151 ? 15.501  23.251 2.170   1.00 15.71 ? 447  LEU A CD1   1 
ATOM   1728 C  CD2   . LEU C 3 151 ? 15.369  22.272 4.471   1.00 15.27 ? 447  LEU A CD2   1 
ATOM   1729 N  N     . VAL C 3 152 ? 11.571  19.294 2.282   1.00 15.54 ? 448  VAL A N     1 
ATOM   1730 C  CA    . VAL C 3 152 ? 10.247  18.924 1.799   1.00 14.30 ? 448  VAL A CA    1 
ATOM   1731 C  C     . VAL C 3 152 ? 9.445   18.273 2.922   1.00 13.67 ? 448  VAL A C     1 
ATOM   1732 O  O     . VAL C 3 152 ? 8.262   18.569 3.091   1.00 14.16 ? 448  VAL A O     1 
ATOM   1733 C  CB    . VAL C 3 152 ? 10.339  17.969 0.584   1.00 15.27 ? 448  VAL A CB    1 
ATOM   1734 C  CG1   . VAL C 3 152 ? 8.983   17.340 0.301   1.00 15.61 ? 448  VAL A CG1   1 
ATOM   1735 C  CG2   . VAL C 3 152 ? 10.803  18.753 -0.648  1.00 16.34 ? 448  VAL A CG2   1 
ATOM   1736 N  N     . ARG C 3 153 ? 10.087  17.397 3.693   1.00 14.66 ? 449  ARG A N     1 
ATOM   1737 C  CA    . ARG C 3 153 ? 9.407   16.744 4.809   1.00 14.44 ? 449  ARG A CA    1 
ATOM   1738 C  C     . ARG C 3 153 ? 8.997   17.756 5.876   1.00 14.95 ? 449  ARG A C     1 
ATOM   1739 O  O     . ARG C 3 153 ? 7.953   17.603 6.509   1.00 15.59 ? 449  ARG A O     1 
ATOM   1740 C  CB    . ARG C 3 153 ? 10.290  15.651 5.427   1.00 15.62 ? 449  ARG A CB    1 
ATOM   1741 C  CG    . ARG C 3 153 ? 10.261  14.332 4.644   1.00 17.51 ? 449  ARG A CG    1 
ATOM   1742 C  CD    . ARG C 3 153 ? 11.119  13.250 5.285   1.00 15.68 ? 449  ARG A CD    1 
ATOM   1743 N  NE    . ARG C 3 153 ? 11.023  11.986 4.554   1.00 17.50 ? 449  ARG A NE    1 
ATOM   1744 C  CZ    . ARG C 3 153 ? 9.988   11.155 4.625   1.00 19.55 ? 449  ARG A CZ    1 
ATOM   1745 N  NH1   . ARG C 3 153 ? 8.951   11.446 5.402   1.00 17.42 ? 449  ARG A NH1   1 
ATOM   1746 N  NH2   . ARG C 3 153 ? 9.982   10.036 3.907   1.00 17.94 ? 449  ARG A NH2   1 
ATOM   1747 N  N     . LYS C 3 154 ? 9.804   18.796 6.079   1.00 13.94 ? 450  LYS A N     1 
ATOM   1748 C  CA    . LYS C 3 154 ? 9.446   19.807 7.068   1.00 12.93 ? 450  LYS A CA    1 
ATOM   1749 C  C     . LYS C 3 154 ? 8.239   20.598 6.563   1.00 12.85 ? 450  LYS A C     1 
ATOM   1750 O  O     . LYS C 3 154 ? 7.299   20.855 7.315   1.00 13.57 ? 450  LYS A O     1 
ATOM   1751 C  CB    . LYS C 3 154 ? 10.634  20.744 7.357   1.00 13.65 ? 450  LYS A CB    1 
ATOM   1752 C  CG    . LYS C 3 154 ? 11.771  20.049 8.100   1.00 12.13 ? 450  LYS A CG    1 
ATOM   1753 C  CD    . LYS C 3 154 ? 12.584  20.989 8.996   1.00 16.06 ? 450  LYS A CD    1 
ATOM   1754 C  CE    . LYS C 3 154 ? 13.371  22.027 8.214   1.00 18.57 ? 450  LYS A CE    1 
ATOM   1755 N  NZ    . LYS C 3 154 ? 14.281  22.815 9.114   1.00 14.39 ? 450  LYS A NZ    1 
ATOM   1756 N  N     . ALA C 3 155 ? 8.260   20.970 5.285   1.00 14.12 ? 451  ALA A N     1 
ATOM   1757 C  CA    . ALA C 3 155 ? 7.151   21.709 4.693   1.00 13.00 ? 451  ALA A CA    1 
ATOM   1758 C  C     . ALA C 3 155 ? 5.889   20.848 4.730   1.00 12.79 ? 451  ALA A C     1 
ATOM   1759 O  O     . ALA C 3 155 ? 4.790   21.336 5.010   1.00 12.43 ? 451  ALA A O     1 
ATOM   1760 C  CB    . ALA C 3 155 ? 7.488   22.096 3.255   1.00 15.67 ? 451  ALA A CB    1 
ATOM   1761 N  N     . ALA C 3 156 ? 6.055   19.558 4.450   1.00 12.05 ? 452  ALA A N     1 
ATOM   1762 C  CA    . ALA C 3 156 ? 4.931   18.637 4.462   1.00 12.77 ? 452  ALA A CA    1 
ATOM   1763 C  C     . ALA C 3 156 ? 4.337   18.559 5.863   1.00 12.57 ? 452  ALA A C     1 
ATOM   1764 O  O     . ALA C 3 156 ? 3.120   18.536 6.022   1.00 14.19 ? 452  ALA A O     1 
ATOM   1765 C  CB    . ALA C 3 156 ? 5.375   17.248 3.997   1.00 11.15 ? 452  ALA A CB    1 
ATOM   1766 N  N     . ALA C 3 157 ? 5.196   18.527 6.879   1.00 13.59 ? 453  ALA A N     1 
ATOM   1767 C  CA    . ALA C 3 157 ? 4.723   18.455 8.261   1.00 14.18 ? 453  ALA A CA    1 
ATOM   1768 C  C     . ALA C 3 157 ? 3.938   19.716 8.601   1.00 14.47 ? 453  ALA A C     1 
ATOM   1769 O  O     . ALA C 3 157 ? 2.846   19.648 9.162   1.00 13.21 ? 453  ALA A O     1 
ATOM   1770 C  CB    . ALA C 3 157 ? 5.903   18.296 9.220   1.00 13.67 ? 453  ALA A CB    1 
ATOM   1771 N  N     . ILE C 3 158 ? 4.499   20.870 8.250   1.00 14.81 ? 454  ILE A N     1 
ATOM   1772 C  CA    . ILE C 3 158 ? 3.838   22.146 8.511   1.00 14.81 ? 454  ILE A CA    1 
ATOM   1773 C  C     . ILE C 3 158 ? 2.460   22.179 7.834   1.00 15.44 ? 454  ILE A C     1 
ATOM   1774 O  O     . ILE C 3 158 ? 1.462   22.593 8.437   1.00 12.93 ? 454  ILE A O     1 
ATOM   1775 C  CB    . ILE C 3 158 ? 4.706   23.322 7.992   1.00 13.74 ? 454  ILE A CB    1 
ATOM   1776 C  CG1   . ILE C 3 158 ? 6.011   23.398 8.794   1.00 15.90 ? 454  ILE A CG1   1 
ATOM   1777 C  CG2   . ILE C 3 158 ? 3.940   24.632 8.094   1.00 14.92 ? 454  ILE A CG2   1 
ATOM   1778 C  CD1   . ILE C 3 158 ? 7.078   24.304 8.160   1.00 12.08 ? 454  ILE A CD1   1 
ATOM   1779 N  N     . TRP C 3 159 ? 2.413   21.721 6.587   1.00 14.70 ? 455  TRP A N     1 
ATOM   1780 C  CA    . TRP C 3 159 ? 1.182   21.687 5.795   1.00 16.07 ? 455  TRP A CA    1 
ATOM   1781 C  C     . TRP C 3 159 ? 0.105   20.861 6.495   1.00 16.73 ? 455  TRP A C     1 
ATOM   1782 O  O     . TRP C 3 159 ? -1.069  21.251 6.556   1.00 16.67 ? 455  TRP A O     1 
ATOM   1783 C  CB    . TRP C 3 159 ? 1.497   21.094 4.411   1.00 16.50 ? 455  TRP A CB    1 
ATOM   1784 C  CG    . TRP C 3 159 ? 0.342   21.075 3.443   1.00 17.26 ? 455  TRP A CG    1 
ATOM   1785 C  CD1   . TRP C 3 159 ? -0.320  19.974 2.978   1.00 19.62 ? 455  TRP A CD1   1 
ATOM   1786 C  CD2   . TRP C 3 159 ? -0.266  22.208 2.808   1.00 15.94 ? 455  TRP A CD2   1 
ATOM   1787 N  NE1   . TRP C 3 159 ? -1.302  20.350 2.088   1.00 17.83 ? 455  TRP A NE1   1 
ATOM   1788 C  CE2   . TRP C 3 159 ? -1.290  21.716 1.965   1.00 18.74 ? 455  TRP A CE2   1 
ATOM   1789 C  CE3   . TRP C 3 159 ? -0.044  23.592 2.867   1.00 16.92 ? 455  TRP A CE3   1 
ATOM   1790 C  CZ2   . TRP C 3 159 ? -2.092  22.561 1.185   1.00 18.04 ? 455  TRP A CZ2   1 
ATOM   1791 C  CZ3   . TRP C 3 159 ? -0.842  24.434 2.090   1.00 18.22 ? 455  TRP A CZ3   1 
ATOM   1792 C  CH2   . TRP C 3 159 ? -1.853  23.913 1.261   1.00 18.05 ? 455  TRP A CH2   1 
ATOM   1793 N  N     . GLU C 3 160 ? 0.526   19.727 7.038   1.00 16.59 ? 456  GLU A N     1 
ATOM   1794 C  CA    . GLU C 3 160 ? -0.359  18.809 7.740   1.00 17.08 ? 456  GLU A CA    1 
ATOM   1795 C  C     . GLU C 3 160 ? -0.746  19.243 9.151   1.00 17.75 ? 456  GLU A C     1 
ATOM   1796 O  O     . GLU C 3 160 ? -1.873  19.007 9.588   1.00 17.57 ? 456  GLU A O     1 
ATOM   1797 C  CB    . GLU C 3 160 ? 0.305   17.433 7.821   1.00 20.74 ? 456  GLU A CB    1 
ATOM   1798 C  CG    . GLU C 3 160 ? -0.439  16.417 8.662   1.00 27.68 ? 456  GLU A CG    1 
ATOM   1799 C  CD    . GLU C 3 160 ? -1.842  16.163 8.148   1.00 31.35 ? 456  GLU A CD    1 
ATOM   1800 O  OE1   . GLU C 3 160 ? -1.993  15.947 6.926   1.00 31.89 ? 456  GLU A OE1   1 
ATOM   1801 O  OE2   . GLU C 3 160 ? -2.790  16.172 8.964   1.00 36.04 ? 456  GLU A OE2   1 
ATOM   1802 N  N     . LEU C 3 161 ? 0.184   19.886 9.851   1.00 15.41 ? 457  LEU A N     1 
ATOM   1803 C  CA    . LEU C 3 161 ? -0.029  20.281 11.241  1.00 16.12 ? 457  LEU A CA    1 
ATOM   1804 C  C     . LEU C 3 161 ? -0.741  21.594 11.536  1.00 16.07 ? 457  LEU A C     1 
ATOM   1805 O  O     . LEU C 3 161 ? -1.226  21.791 12.648  1.00 14.94 ? 457  LEU A O     1 
ATOM   1806 C  CB    . LEU C 3 161 ? 1.316   20.262 11.967  1.00 16.66 ? 457  LEU A CB    1 
ATOM   1807 C  CG    . LEU C 3 161 ? 1.994   18.889 11.978  1.00 17.73 ? 457  LEU A CG    1 
ATOM   1808 C  CD1   . LEU C 3 161 ? 3.462   19.038 12.360  1.00 19.41 ? 457  LEU A CD1   1 
ATOM   1809 C  CD2   . LEU C 3 161 ? 1.267   17.974 12.946  1.00 18.60 ? 457  LEU A CD2   1 
ATOM   1810 N  N     . GLU C 3 162 ? -0.809  22.486 10.557  1.00 15.38 ? 458  GLU A N     1 
ATOM   1811 C  CA    . GLU C 3 162 ? -1.468  23.770 10.757  1.00 15.96 ? 458  GLU A CA    1 
ATOM   1812 C  C     . GLU C 3 162 ? -2.870  23.624 11.357  1.00 16.07 ? 458  GLU A C     1 
ATOM   1813 O  O     . GLU C 3 162 ? -3.173  24.223 12.384  1.00 13.52 ? 458  GLU A O     1 
ATOM   1814 C  CB    . GLU C 3 162 ? -1.564  24.525 9.431   1.00 16.98 ? 458  GLU A CB    1 
ATOM   1815 C  CG    . GLU C 3 162 ? -2.194  25.902 9.569   1.00 19.77 ? 458  GLU A CG    1 
ATOM   1816 C  CD    . GLU C 3 162 ? -2.332  26.623 8.244   1.00 21.31 ? 458  GLU A CD    1 
ATOM   1817 O  OE1   . GLU C 3 162 ? -1.569  26.300 7.308   1.00 20.22 ? 458  GLU A OE1   1 
ATOM   1818 O  OE2   . GLU C 3 162 ? -3.201  27.517 8.143   1.00 21.16 ? 458  GLU A OE2   1 
ATOM   1819 N  N     . ARG C 3 163 ? -3.721  22.829 10.716  1.00 18.12 ? 459  ARG A N     1 
ATOM   1820 C  CA    . ARG C 3 163 ? -5.090  22.638 11.196  1.00 18.81 ? 459  ARG A CA    1 
ATOM   1821 C  C     . ARG C 3 163 ? -5.189  22.190 12.659  1.00 17.12 ? 459  ARG A C     1 
ATOM   1822 O  O     . ARG C 3 163 ? -5.823  22.863 13.469  1.00 15.57 ? 459  ARG A O     1 
ATOM   1823 C  CB    . ARG C 3 163 ? -5.830  21.642 10.300  1.00 25.14 ? 459  ARG A CB    1 
ATOM   1824 C  CG    . ARG C 3 163 ? -7.299  21.440 10.661  1.00 33.38 ? 459  ARG A CG    1 
ATOM   1825 C  CD    . ARG C 3 163 ? -8.136  22.668 10.324  1.00 39.45 ? 459  ARG A CD    1 
ATOM   1826 N  NE    . ARG C 3 163 ? -7.846  23.804 11.195  1.00 45.65 ? 459  ARG A NE    1 
ATOM   1827 C  CZ    . ARG C 3 163 ? -8.312  25.034 10.998  1.00 47.38 ? 459  ARG A CZ    1 
ATOM   1828 N  NH1   . ARG C 3 163 ? -9.092  25.292 9.957   1.00 49.33 ? 459  ARG A NH1   1 
ATOM   1829 N  NH2   . ARG C 3 163 ? -8.002  26.008 11.845  1.00 49.15 ? 459  ARG A NH2   1 
ATOM   1830 N  N     . PRO C 3 164 ? -4.571  21.048 13.015  1.00 16.98 ? 460  PRO A N     1 
ATOM   1831 C  CA    . PRO C 3 164 ? -4.637  20.580 14.403  1.00 16.78 ? 460  PRO A CA    1 
ATOM   1832 C  C     . PRO C 3 164 ? -4.082  21.566 15.427  1.00 15.48 ? 460  PRO A C     1 
ATOM   1833 O  O     . PRO C 3 164 ? -4.652  21.718 16.506  1.00 15.40 ? 460  PRO A O     1 
ATOM   1834 C  CB    . PRO C 3 164 ? -3.874  19.253 14.372  1.00 19.38 ? 460  PRO A CB    1 
ATOM   1835 C  CG    . PRO C 3 164 ? -2.951  19.404 13.190  1.00 20.51 ? 460  PRO A CG    1 
ATOM   1836 C  CD    . PRO C 3 164 ? -3.840  20.083 12.178  1.00 18.60 ? 460  PRO A CD    1 
ATOM   1837 N  N     . PHE C 3 165 ? -2.979  22.236 15.100  1.00 13.59 ? 461  PHE A N     1 
ATOM   1838 C  CA    . PHE C 3 165 ? -2.418  23.212 16.034  1.00 13.78 ? 461  PHE A CA    1 
ATOM   1839 C  C     . PHE C 3 165 ? -3.385  24.381 16.225  1.00 13.78 ? 461  PHE A C     1 
ATOM   1840 O  O     . PHE C 3 165 ? -3.629  24.812 17.356  1.00 15.68 ? 461  PHE A O     1 
ATOM   1841 C  CB    . PHE C 3 165 ? -1.042  23.714 15.555  1.00 9.77  ? 461  PHE A CB    1 
ATOM   1842 C  CG    . PHE C 3 165 ? 0.115   22.877 16.050  1.00 13.43 ? 461  PHE A CG    1 
ATOM   1843 C  CD1   . PHE C 3 165 ? 0.387   21.629 15.494  1.00 12.98 ? 461  PHE A CD1   1 
ATOM   1844 C  CD2   . PHE C 3 165 ? 0.919   23.332 17.092  1.00 12.15 ? 461  PHE A CD2   1 
ATOM   1845 C  CE1   . PHE C 3 165 ? 1.443   20.843 15.970  1.00 13.71 ? 461  PHE A CE1   1 
ATOM   1846 C  CE2   . PHE C 3 165 ? 1.979   22.555 17.579  1.00 12.84 ? 461  PHE A CE2   1 
ATOM   1847 C  CZ    . PHE C 3 165 ? 2.241   21.305 17.015  1.00 11.43 ? 461  PHE A CZ    1 
ATOM   1848 N  N     . LEU C 3 166 ? -3.950  24.884 15.129  1.00 13.96 ? 462  LEU A N     1 
ATOM   1849 C  CA    . LEU C 3 166 ? -4.900  25.988 15.215  1.00 14.92 ? 462  LEU A CA    1 
ATOM   1850 C  C     . LEU C 3 166 ? -6.147  25.575 15.987  1.00 15.29 ? 462  LEU A C     1 
ATOM   1851 O  O     . LEU C 3 166 ? -6.685  26.367 16.755  1.00 15.83 ? 462  LEU A O     1 
ATOM   1852 C  CB    . LEU C 3 166 ? -5.304  26.478 13.822  1.00 14.09 ? 462  LEU A CB    1 
ATOM   1853 C  CG    . LEU C 3 166 ? -4.271  27.332 13.076  1.00 14.68 ? 462  LEU A CG    1 
ATOM   1854 C  CD1   . LEU C 3 166 ? -4.818  27.723 11.698  1.00 14.59 ? 462  LEU A CD1   1 
ATOM   1855 C  CD2   . LEU C 3 166 ? -3.957  28.589 13.901  1.00 15.86 ? 462  LEU A CD2   1 
ATOM   1856 N  N     . ASP C 3 167 ? -6.609  24.344 15.781  1.00 14.84 ? 463  ASP A N     1 
ATOM   1857 C  CA    . ASP C 3 167 ? -7.792  23.859 16.490  1.00 16.43 ? 463  ASP A CA    1 
ATOM   1858 C  C     . ASP C 3 167 ? -7.544  23.803 17.989  1.00 15.93 ? 463  ASP A C     1 
ATOM   1859 O  O     . ASP C 3 167 ? -8.415  24.170 18.778  1.00 16.15 ? 463  ASP A O     1 
ATOM   1860 C  CB    . ASP C 3 167 ? -8.210  22.467 16.006  1.00 18.53 ? 463  ASP A CB    1 
ATOM   1861 C  CG    . ASP C 3 167 ? -8.864  22.493 14.635  1.00 21.38 ? 463  ASP A CG    1 
ATOM   1862 O  OD1   . ASP C 3 167 ? -9.320  23.574 14.211  1.00 24.99 ? 463  ASP A OD1   1 
ATOM   1863 O  OD2   . ASP C 3 167 ? -8.926  21.426 13.984  1.00 25.32 ? 463  ASP A OD2   1 
ATOM   1864 N  N     . GLU C 3 168 ? -6.364  23.341 18.394  1.00 14.16 ? 464  GLU A N     1 
ATOM   1865 C  CA    . GLU C 3 168 ? -6.081  23.270 19.817  1.00 15.39 ? 464  GLU A CA    1 
ATOM   1866 C  C     . GLU C 3 168 ? -5.921  24.672 20.395  1.00 14.20 ? 464  GLU A C     1 
ATOM   1867 O  O     . GLU C 3 168 ? -6.395  24.954 21.495  1.00 13.59 ? 464  GLU A O     1 
ATOM   1868 C  CB    . GLU C 3 168 ? -4.829  22.442 20.101  1.00 15.72 ? 464  GLU A CB    1 
ATOM   1869 C  CG    . GLU C 3 168 ? -4.532  22.359 21.588  1.00 15.52 ? 464  GLU A CG    1 
ATOM   1870 C  CD    . GLU C 3 168 ? -3.402  21.411 21.932  1.00 18.81 ? 464  GLU A CD    1 
ATOM   1871 O  OE1   . GLU C 3 168 ? -2.682  20.965 21.014  1.00 19.86 ? 464  GLU A OE1   1 
ATOM   1872 O  OE2   . GLU C 3 168 ? -3.229  21.125 23.134  1.00 19.30 ? 464  GLU A OE2   1 
ATOM   1873 N  N     . LEU C 3 169 ? -5.259  25.555 19.657  1.00 12.53 ? 465  LEU A N     1 
ATOM   1874 C  CA    . LEU C 3 169 ? -5.092  26.916 20.144  1.00 13.73 ? 465  LEU A CA    1 
ATOM   1875 C  C     . LEU C 3 169 ? -6.472  27.535 20.363  1.00 13.28 ? 465  LEU A C     1 
ATOM   1876 O  O     . LEU C 3 169 ? -6.689  28.248 21.338  1.00 12.76 ? 465  LEU A O     1 
ATOM   1877 C  CB    . LEU C 3 169 ? -4.286  27.754 19.148  1.00 12.90 ? 465  LEU A CB    1 
ATOM   1878 C  CG    . LEU C 3 169 ? -2.784  27.455 19.068  1.00 13.63 ? 465  LEU A CG    1 
ATOM   1879 C  CD1   . LEU C 3 169 ? -2.210  28.080 17.808  1.00 13.48 ? 465  LEU A CD1   1 
ATOM   1880 C  CD2   . LEU C 3 169 ? -2.080  27.995 20.315  1.00 13.49 ? 465  LEU A CD2   1 
ATOM   1881 N  N     . ARG C 3 170 ? -7.408  27.251 19.461  1.00 15.29 ? 466  ARG A N     1 
ATOM   1882 C  CA    . ARG C 3 170 ? -8.752  27.800 19.591  1.00 17.02 ? 466  ARG A CA    1 
ATOM   1883 C  C     . ARG C 3 170 ? -9.457  27.261 20.837  1.00 15.85 ? 466  ARG A C     1 
ATOM   1884 O  O     . ARG C 3 170 ? -10.110 28.015 21.562  1.00 16.25 ? 466  ARG A O     1 
ATOM   1885 C  CB    . ARG C 3 170 ? -9.583  27.489 18.341  1.00 21.52 ? 466  ARG A CB    1 
ATOM   1886 C  CG    . ARG C 3 170 ? -11.011 28.021 18.406  1.00 30.15 ? 466  ARG A CG    1 
ATOM   1887 C  CD    . ARG C 3 170 ? -11.701 27.929 17.050  1.00 36.32 ? 466  ARG A CD    1 
ATOM   1888 N  NE    . ARG C 3 170 ? -11.049 28.783 16.057  1.00 42.08 ? 466  ARG A NE    1 
ATOM   1889 C  CZ    . ARG C 3 170 ? -11.051 30.113 16.094  1.00 45.07 ? 466  ARG A CZ    1 
ATOM   1890 N  NH1   . ARG C 3 170 ? -11.677 30.754 17.075  1.00 46.90 ? 466  ARG A NH1   1 
ATOM   1891 N  NH2   . ARG C 3 170 ? -10.418 30.807 15.155  1.00 46.55 ? 466  ARG A NH2   1 
ATOM   1892 N  N     . ARG C 3 171 ? -9.328  25.965 21.100  1.00 14.68 ? 467  ARG A N     1 
ATOM   1893 C  CA    . ARG C 3 171 ? -9.975  25.411 22.282  1.00 17.05 ? 467  ARG A CA    1 
ATOM   1894 C  C     . ARG C 3 171 ? -9.335  26.001 23.539  1.00 15.98 ? 467  ARG A C     1 
ATOM   1895 O  O     . ARG C 3 171 ? -9.989  26.138 24.570  1.00 15.78 ? 467  ARG A O     1 
ATOM   1896 C  CB    . ARG C 3 171 ? -9.902  23.875 22.283  1.00 20.09 ? 467  ARG A CB    1 
ATOM   1897 C  CG    . ARG C 3 171 ? -8.526  23.272 22.441  1.00 27.12 ? 467  ARG A CG    1 
ATOM   1898 C  CD    . ARG C 3 171 ? -8.590  21.747 22.299  1.00 31.48 ? 467  ARG A CD    1 
ATOM   1899 N  NE    . ARG C 3 171 ? -9.160  21.358 21.014  1.00 31.66 ? 467  ARG A NE    1 
ATOM   1900 C  CZ    . ARG C 3 171 ? -8.533  20.627 20.097  1.00 30.94 ? 467  ARG A CZ    1 
ATOM   1901 N  NH1   . ARG C 3 171 ? -7.299  20.183 20.310  1.00 29.87 ? 467  ARG A NH1   1 
ATOM   1902 N  NH2   . ARG C 3 171 ? -9.141  20.348 18.957  1.00 30.11 ? 467  ARG A NH2   1 
ATOM   1903 N  N     . ASN C 3 172 ? -8.059  26.370 23.440  1.00 14.48 ? 468  ASN A N     1 
ATOM   1904 C  CA    . ASN C 3 172 ? -7.337  26.975 24.562  1.00 14.62 ? 468  ASN A CA    1 
ATOM   1905 C  C     . ASN C 3 172 ? -7.623  28.476 24.635  1.00 13.98 ? 468  ASN A C     1 
ATOM   1906 O  O     . ASN C 3 172 ? -7.148  29.152 25.541  1.00 15.41 ? 468  ASN A O     1 
ATOM   1907 C  CB    . ASN C 3 172 ? -5.823  26.806 24.396  1.00 14.80 ? 468  ASN A CB    1 
ATOM   1908 C  CG    . ASN C 3 172 ? -5.329  25.422 24.762  1.00 14.96 ? 468  ASN A CG    1 
ATOM   1909 O  OD1   . ASN C 3 172 ? -6.108  24.515 25.048  1.00 17.63 ? 468  ASN A OD1   1 
ATOM   1910 N  ND2   . ASN C 3 172 ? -4.011  25.257 24.749  1.00 16.39 ? 468  ASN A ND2   1 
ATOM   1911 N  N     . GLU C 3 173 ? -8.388  28.992 23.677  1.00 14.43 ? 469  GLU A N     1 
ATOM   1912 C  CA    . GLU C 3 173 ? -8.690  30.423 23.614  1.00 16.10 ? 469  GLU A CA    1 
ATOM   1913 C  C     . GLU C 3 173 ? -7.397  31.213 23.416  1.00 15.91 ? 469  GLU A C     1 
ATOM   1914 O  O     . GLU C 3 173 ? -7.243  32.325 23.921  1.00 15.05 ? 469  GLU A O     1 
ATOM   1915 C  CB    . GLU C 3 173 ? -9.406  30.887 24.886  1.00 19.70 ? 469  GLU A CB    1 
ATOM   1916 C  CG    . GLU C 3 173 ? -10.778 30.263 25.061  1.00 26.49 ? 469  GLU A CG    1 
ATOM   1917 C  CD    . GLU C 3 173 ? -11.528 30.832 26.248  1.00 32.68 ? 469  GLU A CD    1 
ATOM   1918 O  OE1   . GLU C 3 173 ? -11.843 32.043 26.231  1.00 33.84 ? 469  GLU A OE1   1 
ATOM   1919 O  OE2   . GLU C 3 173 ? -11.800 30.067 27.198  1.00 37.21 ? 469  GLU A OE2   1 
ATOM   1920 N  N     . GLN C 3 174 ? -6.471  30.618 22.670  1.00 14.67 ? 470  GLN A N     1 
ATOM   1921 C  CA    . GLN C 3 174 ? -5.181  31.232 22.375  1.00 15.08 ? 470  GLN A CA    1 
ATOM   1922 C  C     . GLN C 3 174 ? -5.044  31.556 20.892  1.00 15.19 ? 470  GLN A C     1 
ATOM   1923 O  O     . GLN C 3 174 ? -3.961  31.922 20.439  1.00 14.46 ? 470  GLN A O     1 
ATOM   1924 C  CB    . GLN C 3 174 ? -4.036  30.292 22.757  1.00 15.13 ? 470  GLN A CB    1 
ATOM   1925 C  CG    . GLN C 3 174 ? -3.923  29.967 24.227  1.00 14.59 ? 470  GLN A CG    1 
ATOM   1926 C  CD    . GLN C 3 174 ? -2.836  28.952 24.484  1.00 15.86 ? 470  GLN A CD    1 
ATOM   1927 O  OE1   . GLN C 3 174 ? -2.879  27.845 23.955  1.00 15.96 ? 470  GLN A OE1   1 
ATOM   1928 N  NE2   . GLN C 3 174 ? -1.845  29.327 25.286  1.00 17.20 ? 470  GLN A NE2   1 
ATOM   1929 N  N     . ASP C 3 175 ? -6.126  31.418 20.131  1.00 15.39 ? 471  ASP A N     1 
ATOM   1930 C  CA    . ASP C 3 175 ? -6.056  31.694 18.701  1.00 17.03 ? 471  ASP A CA    1 
ATOM   1931 C  C     . ASP C 3 175 ? -5.707  33.152 18.412  1.00 16.33 ? 471  ASP A C     1 
ATOM   1932 O  O     . ASP C 3 175 ? -4.884  33.429 17.538  1.00 15.11 ? 471  ASP A O     1 
ATOM   1933 C  CB    . ASP C 3 175 ? -7.369  31.296 18.004  1.00 20.22 ? 471  ASP A CB    1 
ATOM   1934 C  CG    . ASP C 3 175 ? -8.593  31.892 18.663  1.00 23.67 ? 471  ASP A CG    1 
ATOM   1935 O  OD1   . ASP C 3 175 ? -8.770  31.705 19.886  1.00 24.59 ? 471  ASP A OD1   1 
ATOM   1936 O  OD2   . ASP C 3 175 ? -9.385  32.544 17.950  1.00 27.86 ? 471  ASP A OD2   1 
ATOM   1937 N  N     . ARG C 3 176 ? -6.319  34.080 19.145  1.00 14.93 ? 472  ARG A N     1 
ATOM   1938 C  CA    . ARG C 3 176 ? -6.028  35.496 18.951  1.00 15.34 ? 472  ARG A CA    1 
ATOM   1939 C  C     . ARG C 3 176 ? -4.624  35.814 19.460  1.00 13.94 ? 472  ARG A C     1 
ATOM   1940 O  O     . ARG C 3 176 ? -3.944  36.684 18.916  1.00 14.97 ? 472  ARG A O     1 
ATOM   1941 C  CB    . ARG C 3 176 ? -7.056  36.373 19.672  1.00 17.69 ? 472  ARG A CB    1 
ATOM   1942 C  CG    . ARG C 3 176 ? -8.472  36.232 19.127  1.00 22.75 ? 472  ARG A CG    1 
ATOM   1943 C  CD    . ARG C 3 176 ? -9.419  37.202 19.816  1.00 28.85 ? 472  ARG A CD    1 
ATOM   1944 N  NE    . ARG C 3 176 ? -9.100  38.590 19.492  1.00 32.33 ? 472  ARG A NE    1 
ATOM   1945 C  CZ    . ARG C 3 176 ? -9.649  39.646 20.087  1.00 33.87 ? 472  ARG A CZ    1 
ATOM   1946 N  NH1   . ARG C 3 176 ? -10.550 39.479 21.047  1.00 33.50 ? 472  ARG A NH1   1 
ATOM   1947 N  NH2   . ARG C 3 176 ? -9.297  40.872 19.720  1.00 34.91 ? 472  ARG A NH2   1 
ATOM   1948 N  N     . LEU C 3 177 ? -4.186  35.106 20.498  1.00 11.23 ? 473  LEU A N     1 
ATOM   1949 C  CA    . LEU C 3 177 ? -2.845  35.323 21.039  1.00 10.92 ? 473  LEU A CA    1 
ATOM   1950 C  C     . LEU C 3 177 ? -1.799  35.061 19.956  1.00 12.41 ? 473  LEU A C     1 
ATOM   1951 O  O     . LEU C 3 177 ? -0.814  35.793 19.841  1.00 10.43 ? 473  LEU A O     1 
ATOM   1952 C  CB    . LEU C 3 177 ? -2.594  34.397 22.234  1.00 12.02 ? 473  LEU A CB    1 
ATOM   1953 C  CG    . LEU C 3 177 ? -1.261  34.503 22.993  1.00 12.34 ? 473  LEU A CG    1 
ATOM   1954 C  CD1   . LEU C 3 177 ? -1.048  35.924 23.518  1.00 12.89 ? 473  LEU A CD1   1 
ATOM   1955 C  CD2   . LEU C 3 177 ? -1.284  33.506 24.148  1.00 13.15 ? 473  LEU A CD2   1 
ATOM   1956 N  N     . LEU C 3 178 ? -2.010  34.016 19.162  1.00 10.84 ? 474  LEU A N     1 
ATOM   1957 C  CA    . LEU C 3 178 ? -1.067  33.694 18.092  1.00 13.18 ? 474  LEU A CA    1 
ATOM   1958 C  C     . LEU C 3 178 ? -1.181  34.666 16.921  1.00 13.65 ? 474  LEU A C     1 
ATOM   1959 O  O     . LEU C 3 178 ? -0.198  35.276 16.502  1.00 13.46 ? 474  LEU A O     1 
ATOM   1960 C  CB    . LEU C 3 178 ? -1.312  32.273 17.563  1.00 12.64 ? 474  LEU A CB    1 
ATOM   1961 C  CG    . LEU C 3 178 ? -0.458  31.888 16.346  1.00 14.28 ? 474  LEU A CG    1 
ATOM   1962 C  CD1   . LEU C 3 178 ? 0.974   31.659 16.802  1.00 13.49 ? 474  LEU A CD1   1 
ATOM   1963 C  CD2   . LEU C 3 178 ? -1.000  30.623 15.682  1.00 13.85 ? 474  LEU A CD2   1 
ATOM   1964 N  N     . VAL C 3 179 ? -2.398  34.798 16.403  1.00 14.72 ? 475  VAL A N     1 
ATOM   1965 C  CA    . VAL C 3 179 ? -2.673  35.634 15.240  1.00 15.70 ? 475  VAL A CA    1 
ATOM   1966 C  C     . VAL C 3 179 ? -2.578  37.143 15.418  1.00 13.87 ? 475  VAL A C     1 
ATOM   1967 O  O     . VAL C 3 179 ? -2.105  37.836 14.526  1.00 16.15 ? 475  VAL A O     1 
ATOM   1968 C  CB    . VAL C 3 179 ? -4.064  35.286 14.649  1.00 15.61 ? 475  VAL A CB    1 
ATOM   1969 C  CG1   . VAL C 3 179 ? -4.371  36.170 13.447  1.00 17.57 ? 475  VAL A CG1   1 
ATOM   1970 C  CG2   . VAL C 3 179 ? -4.085  33.818 14.234  1.00 18.52 ? 475  VAL A CG2   1 
ATOM   1971 N  N     . GLU C 3 180 ? -3.014  37.649 16.564  1.00 13.12 ? 476  GLU A N     1 
ATOM   1972 C  CA    . GLU C 3 180 ? -2.993  39.082 16.809  1.00 13.07 ? 476  GLU A CA    1 
ATOM   1973 C  C     . GLU C 3 180 ? -1.837  39.590 17.668  1.00 13.67 ? 476  GLU A C     1 
ATOM   1974 O  O     . GLU C 3 180 ? -1.564  40.791 17.683  1.00 13.00 ? 476  GLU A O     1 
ATOM   1975 C  CB    . GLU C 3 180 ? -4.322  39.504 17.431  1.00 15.17 ? 476  GLU A CB    1 
ATOM   1976 C  CG    . GLU C 3 180 ? -5.506  39.329 16.501  1.00 18.99 ? 476  GLU A CG    1 
ATOM   1977 C  CD    . GLU C 3 180 ? -6.823  39.631 17.181  1.00 23.10 ? 476  GLU A CD    1 
ATOM   1978 O  OE1   . GLU C 3 180 ? -6.887  40.618 17.944  1.00 25.29 ? 476  GLU A OE1   1 
ATOM   1979 O  OE2   . GLU C 3 180 ? -7.797  38.886 16.945  1.00 25.62 ? 476  GLU A OE2   1 
ATOM   1980 N  N     . LEU C 3 181 ? -1.159  38.695 18.383  1.00 12.81 ? 477  LEU A N     1 
ATOM   1981 C  CA    . LEU C 3 181 ? -0.048  39.135 19.223  1.00 12.94 ? 477  LEU A CA    1 
ATOM   1982 C  C     . LEU C 3 181 ? 1.319   38.592 18.803  1.00 10.80 ? 477  LEU A C     1 
ATOM   1983 O  O     . LEU C 3 181 ? 2.141   39.332 18.276  1.00 12.18 ? 477  LEU A O     1 
ATOM   1984 C  CB    . LEU C 3 181 ? -0.293  38.780 20.694  1.00 12.75 ? 477  LEU A CB    1 
ATOM   1985 C  CG    . LEU C 3 181 ? 0.698   39.475 21.645  1.00 12.91 ? 477  LEU A CG    1 
ATOM   1986 C  CD1   . LEU C 3 181 ? 0.179   40.866 21.965  1.00 16.02 ? 477  LEU A CD1   1 
ATOM   1987 C  CD2   . LEU C 3 181 ? 0.877   38.684 22.929  1.00 17.92 ? 477  LEU A CD2   1 
ATOM   1988 N  N     . GLU C 3 182 ? 1.562   37.302 19.014  1.00 12.03 ? 478  GLU A N     1 
ATOM   1989 C  CA    . GLU C 3 182 ? 2.874   36.737 18.692  1.00 10.50 ? 478  GLU A CA    1 
ATOM   1990 C  C     . GLU C 3 182 ? 3.332   36.826 17.237  1.00 10.48 ? 478  GLU A C     1 
ATOM   1991 O  O     . GLU C 3 182 ? 4.473   37.197 16.983  1.00 10.08 ? 478  GLU A O     1 
ATOM   1992 C  CB    . GLU C 3 182 ? 2.970   35.283 19.164  1.00 10.52 ? 478  GLU A CB    1 
ATOM   1993 C  CG    . GLU C 3 182 ? 2.783   35.084 20.670  1.00 13.40 ? 478  GLU A CG    1 
ATOM   1994 C  CD    . GLU C 3 182 ? 3.833   35.792 21.525  1.00 14.64 ? 478  GLU A CD    1 
ATOM   1995 O  OE1   . GLU C 3 182 ? 4.817   36.328 20.972  1.00 15.61 ? 478  GLU A OE1   1 
ATOM   1996 O  OE2   . GLU C 3 182 ? 3.668   35.807 22.760  1.00 14.03 ? 478  GLU A OE2   1 
ATOM   1997 N  N     . GLN C 3 183 ? 2.472   36.487 16.280  1.00 10.71 ? 479  GLN A N     1 
ATOM   1998 C  CA    . GLN C 3 183 ? 2.882   36.562 14.884  1.00 10.70 ? 479  GLN A CA    1 
ATOM   1999 C  C     . GLN C 3 183 ? 3.177   38.001 14.449  1.00 13.45 ? 479  GLN A C     1 
ATOM   2000 O  O     . GLN C 3 183 ? 4.199   38.254 13.814  1.00 11.07 ? 479  GLN A O     1 
ATOM   2001 C  CB    . GLN C 3 183 ? 1.849   35.865 13.982  1.00 11.13 ? 479  GLN A CB    1 
ATOM   2002 C  CG    . GLN C 3 183 ? 1.914   34.343 14.204  1.00 12.12 ? 479  GLN A CG    1 
ATOM   2003 C  CD    . GLN C 3 183 ? 0.975   33.516 13.345  1.00 12.70 ? 479  GLN A CD    1 
ATOM   2004 O  OE1   . GLN C 3 183 ? 1.103   32.291 13.297  1.00 12.84 ? 479  GLN A OE1   1 
ATOM   2005 N  NE2   . GLN C 3 183 ? 0.024   34.166 12.678  1.00 13.49 ? 479  GLN A NE2   1 
ATOM   2006 N  N     . PRO C 3 184 ? 2.300   38.965 14.789  1.00 12.29 ? 480  PRO A N     1 
ATOM   2007 C  CA    . PRO C 3 184 ? 2.605   40.341 14.378  1.00 14.13 ? 480  PRO A CA    1 
ATOM   2008 C  C     . PRO C 3 184 ? 3.888   40.816 15.064  1.00 13.76 ? 480  PRO A C     1 
ATOM   2009 O  O     . PRO C 3 184 ? 4.691   41.546 14.475  1.00 13.89 ? 480  PRO A O     1 
ATOM   2010 C  CB    . PRO C 3 184 ? 1.371   41.123 14.816  1.00 15.36 ? 480  PRO A CB    1 
ATOM   2011 C  CG    . PRO C 3 184 ? 0.277   40.104 14.698  1.00 14.73 ? 480  PRO A CG    1 
ATOM   2012 C  CD    . PRO C 3 184 ? 0.921   38.867 15.296  1.00 13.43 ? 480  PRO A CD    1 
ATOM   2013 N  N     . LEU C 3 185 ? 4.081   40.388 16.308  1.00 13.20 ? 481  LEU A N     1 
ATOM   2014 C  CA    . LEU C 3 185 ? 5.279   40.772 17.051  1.00 11.68 ? 481  LEU A CA    1 
ATOM   2015 C  C     . LEU C 3 185 ? 6.534   40.211 16.386  1.00 12.63 ? 481  LEU A C     1 
ATOM   2016 O  O     . LEU C 3 185 ? 7.578   40.853 16.384  1.00 10.79 ? 481  LEU A O     1 
ATOM   2017 C  CB    . LEU C 3 185 ? 5.210   40.271 18.495  1.00 11.80 ? 481  LEU A CB    1 
ATOM   2018 C  CG    . LEU C 3 185 ? 6.464   40.559 19.328  1.00 11.66 ? 481  LEU A CG    1 
ATOM   2019 C  CD1   . LEU C 3 185 ? 6.618   42.072 19.523  1.00 14.63 ? 481  LEU A CD1   1 
ATOM   2020 C  CD2   . LEU C 3 185 ? 6.360   39.859 20.681  1.00 13.33 ? 481  LEU A CD2   1 
ATOM   2021 N  N     . SER C 3 186 ? 6.426   39.010 15.823  1.00 12.05 ? 482  SER A N     1 
ATOM   2022 C  CA    . SER C 3 186 ? 7.563   38.379 15.160  1.00 12.67 ? 482  SER A CA    1 
ATOM   2023 C  C     . SER C 3 186 ? 8.144   39.278 14.071  1.00 13.01 ? 482  SER A C     1 
ATOM   2024 O  O     . SER C 3 186 ? 9.366   39.389 13.922  1.00 12.23 ? 482  SER A O     1 
ATOM   2025 C  CB    . SER C 3 186 ? 7.133   37.040 14.551  1.00 15.10 ? 482  SER A CB    1 
ATOM   2026 O  OG    . SER C 3 186 ? 8.226   36.406 13.922  1.00 19.36 ? 482  SER A OG    1 
ATOM   2027 N  N     . SER C 3 187 ? 7.259   39.914 13.310  1.00 12.56 ? 483  SER A N     1 
ATOM   2028 C  CA    . SER C 3 187 ? 7.652   40.810 12.230  1.00 13.42 ? 483  SER A CA    1 
ATOM   2029 C  C     . SER C 3 187 ? 8.344   42.052 12.784  1.00 13.41 ? 483  SER A C     1 
ATOM   2030 O  O     . SER C 3 187 ? 9.299   42.565 12.191  1.00 11.90 ? 483  SER A O     1 
ATOM   2031 C  CB    . SER C 3 187 ? 6.414   41.232 11.423  1.00 14.40 ? 483  SER A CB    1 
ATOM   2032 O  OG    . SER C 3 187 ? 5.763   40.101 10.883  1.00 18.62 ? 483  SER A OG    1 
ATOM   2033 N  N     . ILE C 3 188 ? 7.860   42.530 13.926  1.00 11.98 ? 484  ILE A N     1 
ATOM   2034 C  CA    . ILE C 3 188 ? 8.438   43.703 14.556  1.00 11.72 ? 484  ILE A CA    1 
ATOM   2035 C  C     . ILE C 3 188 ? 9.828   43.375 15.097  1.00 11.61 ? 484  ILE A C     1 
ATOM   2036 O  O     . ILE C 3 188 ? 10.762  44.171 14.965  1.00 10.97 ? 484  ILE A O     1 
ATOM   2037 C  CB    . ILE C 3 188 ? 7.520   44.224 15.685  1.00 13.28 ? 484  ILE A CB    1 
ATOM   2038 C  CG1   . ILE C 3 188 ? 6.223   44.771 15.067  1.00 12.92 ? 484  ILE A CG1   1 
ATOM   2039 C  CG2   . ILE C 3 188 ? 8.235   45.301 16.486  1.00 12.80 ? 484  ILE A CG2   1 
ATOM   2040 C  CD1   . ILE C 3 188 ? 5.145   45.124 16.077  1.00 13.47 ? 484  ILE A CD1   1 
ATOM   2041 N  N     . LEU C 3 189 ? 9.972   42.192 15.688  1.00 10.74 ? 485  LEU A N     1 
ATOM   2042 C  CA    . LEU C 3 189 ? 11.267  41.778 16.211  1.00 11.55 ? 485  LEU A CA    1 
ATOM   2043 C  C     . LEU C 3 189 ? 12.236  41.625 15.045  1.00 11.33 ? 485  LEU A C     1 
ATOM   2044 O  O     . LEU C 3 189 ? 13.408  41.959 15.167  1.00 9.92  ? 485  LEU A O     1 
ATOM   2045 C  CB    . LEU C 3 189 ? 11.142  40.454 16.976  1.00 10.64 ? 485  LEU A CB    1 
ATOM   2046 C  CG    . LEU C 3 189 ? 10.311  40.554 18.265  1.00 10.45 ? 485  LEU A CG    1 
ATOM   2047 C  CD1   . LEU C 3 189 ? 10.114  39.170 18.858  1.00 10.98 ? 485  LEU A CD1   1 
ATOM   2048 C  CD2   . LEU C 3 189 ? 11.023  41.476 19.259  1.00 11.57 ? 485  LEU A CD2   1 
ATOM   2049 N  N     . ALA C 3 190 ? 11.738  41.131 13.914  1.00 10.01 ? 486  ALA A N     1 
ATOM   2050 C  CA    . ALA C 3 190 ? 12.572  40.956 12.729  1.00 11.67 ? 486  ALA A CA    1 
ATOM   2051 C  C     . ALA C 3 190 ? 13.140  42.307 12.288  1.00 12.12 ? 486  ALA A C     1 
ATOM   2052 O  O     . ALA C 3 190 ? 14.319  42.413 11.953  1.00 11.20 ? 486  ALA A O     1 
ATOM   2053 C  CB    . ALA C 3 190 ? 11.758  40.337 11.596  1.00 11.87 ? 486  ALA A CB    1 
ATOM   2054 N  N     . GLU C 3 191 ? 12.301  43.336 12.288  1.00 10.97 ? 487  GLU A N     1 
ATOM   2055 C  CA    . GLU C 3 191 ? 12.757  44.665 11.891  1.00 14.50 ? 487  GLU A CA    1 
ATOM   2056 C  C     . GLU C 3 191 ? 13.813  45.183 12.875  1.00 13.62 ? 487  GLU A C     1 
ATOM   2057 O  O     . GLU C 3 191 ? 14.840  45.732 12.469  1.00 13.93 ? 487  GLU A O     1 
ATOM   2058 C  CB    . GLU C 3 191 ? 11.581  45.645 11.847  1.00 15.24 ? 487  GLU A CB    1 
ATOM   2059 C  CG    . GLU C 3 191 ? 10.460  45.228 10.902  1.00 20.52 ? 487  GLU A CG    1 
ATOM   2060 C  CD    . GLU C 3 191 ? 9.339   46.257 10.808  1.00 26.16 ? 487  GLU A CD    1 
ATOM   2061 O  OE1   . GLU C 3 191 ? 9.109   47.002 11.788  1.00 25.25 ? 487  GLU A OE1   1 
ATOM   2062 O  OE2   . GLU C 3 191 ? 8.677   46.315 9.748   1.00 27.79 ? 487  GLU A OE2   1 
ATOM   2063 N  N     . MET C 3 192 ? 13.549  45.001 14.165  1.00 11.77 ? 488  MET A N     1 
ATOM   2064 C  CA    . MET C 3 192 ? 14.458  45.458 15.220  1.00 12.91 ? 488  MET A CA    1 
ATOM   2065 C  C     . MET C 3 192 ? 15.837  44.819 15.115  1.00 12.79 ? 488  MET A C     1 
ATOM   2066 O  O     . MET C 3 192 ? 16.858  45.507 15.205  1.00 13.21 ? 488  MET A O     1 
ATOM   2067 C  CB    . MET C 3 192 ? 13.858  45.159 16.601  1.00 11.85 ? 488  MET A CB    1 
ATOM   2068 C  CG    . MET C 3 192 ? 12.648  46.018 16.962  1.00 11.40 ? 488  MET A CG    1 
ATOM   2069 S  SD    . MET C 3 192 ? 11.689  45.342 18.341  1.00 11.57 ? 488  MET A SD    1 
ATOM   2070 C  CE    . MET C 3 192 ? 12.852  45.583 19.728  1.00 8.02  ? 488  MET A CE    1 
ATOM   2071 N  N     . GLU C 3 193 ? 15.865  43.504 14.926  1.00 11.70 ? 489  GLU A N     1 
ATOM   2072 C  CA    . GLU C 3 193 ? 17.124  42.775 14.823  1.00 12.43 ? 489  GLU A CA    1 
ATOM   2073 C  C     . GLU C 3 193 ? 17.891  43.220 13.580  1.00 12.14 ? 489  GLU A C     1 
ATOM   2074 O  O     . GLU C 3 193 ? 19.108  43.411 13.621  1.00 13.73 ? 489  GLU A O     1 
ATOM   2075 C  CB    . GLU C 3 193 ? 16.857  41.268 14.749  1.00 10.81 ? 489  GLU A CB    1 
ATOM   2076 C  CG    . GLU C 3 193 ? 16.002  40.719 15.900  1.00 11.43 ? 489  GLU A CG    1 
ATOM   2077 C  CD    . GLU C 3 193 ? 15.696  39.243 15.741  1.00 12.45 ? 489  GLU A CD    1 
ATOM   2078 O  OE1   . GLU C 3 193 ? 15.965  38.700 14.647  1.00 15.04 ? 489  GLU A OE1   1 
ATOM   2079 O  OE2   . GLU C 3 193 ? 15.184  38.624 16.701  1.00 12.79 ? 489  GLU A OE2   1 
ATOM   2080 N  N     . PHE C 3 194 ? 17.170  43.381 12.476  1.00 12.78 ? 490  PHE A N     1 
ATOM   2081 C  CA    . PHE C 3 194 ? 17.787  43.801 11.222  1.00 13.65 ? 490  PHE A CA    1 
ATOM   2082 C  C     . PHE C 3 194 ? 18.360  45.211 11.347  1.00 14.08 ? 490  PHE A C     1 
ATOM   2083 O  O     . PHE C 3 194 ? 19.481  45.469 10.902  1.00 12.87 ? 490  PHE A O     1 
ATOM   2084 C  CB    . PHE C 3 194 ? 16.759  43.749 10.088  1.00 14.22 ? 490  PHE A CB    1 
ATOM   2085 C  CG    . PHE C 3 194 ? 17.325  44.095 8.741   1.00 13.98 ? 490  PHE A CG    1 
ATOM   2086 C  CD1   . PHE C 3 194 ? 18.324  43.309 8.166   1.00 14.96 ? 490  PHE A CD1   1 
ATOM   2087 C  CD2   . PHE C 3 194 ? 16.859  45.209 8.047   1.00 14.11 ? 490  PHE A CD2   1 
ATOM   2088 C  CE1   . PHE C 3 194 ? 18.855  43.626 6.912   1.00 12.30 ? 490  PHE A CE1   1 
ATOM   2089 C  CE2   . PHE C 3 194 ? 17.379  45.542 6.792   1.00 14.61 ? 490  PHE A CE2   1 
ATOM   2090 C  CZ    . PHE C 3 194 ? 18.378  44.749 6.223   1.00 14.94 ? 490  PHE A CZ    1 
ATOM   2091 N  N     . ALA C 3 195 ? 17.598  46.118 11.955  1.00 11.86 ? 491  ALA A N     1 
ATOM   2092 C  CA    . ALA C 3 195 ? 18.057  47.492 12.133  1.00 11.73 ? 491  ALA A CA    1 
ATOM   2093 C  C     . ALA C 3 195 ? 19.347  47.510 12.950  1.00 13.81 ? 491  ALA A C     1 
ATOM   2094 O  O     . ALA C 3 195 ? 20.300  48.217 12.609  1.00 13.83 ? 491  ALA A O     1 
ATOM   2095 C  CB    . ALA C 3 195 ? 16.988  48.322 12.842  1.00 11.47 ? 491  ALA A CB    1 
ATOM   2096 N  N     . GLY C 3 196 ? 19.361  46.731 14.027  1.00 12.72 ? 492  GLY A N     1 
ATOM   2097 C  CA    . GLY C 3 196 ? 20.532  46.662 14.890  1.00 12.57 ? 492  GLY A CA    1 
ATOM   2098 C  C     . GLY C 3 196 ? 20.748  47.923 15.706  1.00 12.85 ? 492  GLY A C     1 
ATOM   2099 O  O     . GLY C 3 196 ? 19.983  48.885 15.592  1.00 12.73 ? 492  GLY A O     1 
ATOM   2100 N  N     . VAL C 3 197 ? 21.791  47.923 16.534  1.00 13.41 ? 493  VAL A N     1 
ATOM   2101 C  CA    . VAL C 3 197 ? 22.115  49.081 17.363  1.00 13.43 ? 493  VAL A CA    1 
ATOM   2102 C  C     . VAL C 3 197 ? 23.570  49.463 17.114  1.00 13.85 ? 493  VAL A C     1 
ATOM   2103 O  O     . VAL C 3 197 ? 24.462  48.621 17.184  1.00 13.05 ? 493  VAL A O     1 
ATOM   2104 C  CB    . VAL C 3 197 ? 21.925  48.785 18.871  1.00 14.60 ? 493  VAL A CB    1 
ATOM   2105 C  CG1   . VAL C 3 197 ? 22.167  50.057 19.690  1.00 14.33 ? 493  VAL A CG1   1 
ATOM   2106 C  CG2   . VAL C 3 197 ? 20.519  48.256 19.124  1.00 14.61 ? 493  VAL A CG2   1 
ATOM   2107 N  N     . LYS C 3 198 ? 23.789  50.739 16.825  1.00 13.94 ? 494  LYS A N     1 
ATOM   2108 C  CA    . LYS C 3 198 ? 25.119  51.264 16.536  1.00 14.68 ? 494  LYS A CA    1 
ATOM   2109 C  C     . LYS C 3 198 ? 25.983  51.264 17.790  1.00 13.53 ? 494  LYS A C     1 
ATOM   2110 O  O     . LYS C 3 198 ? 25.533  51.658 18.864  1.00 14.91 ? 494  LYS A O     1 
ATOM   2111 C  CB    . LYS C 3 198 ? 25.001  52.694 16.004  1.00 17.39 ? 494  LYS A CB    1 
ATOM   2112 C  CG    . LYS C 3 198 ? 26.224  53.219 15.263  1.00 21.95 ? 494  LYS A CG    1 
ATOM   2113 C  CD    . LYS C 3 198 ? 26.272  52.652 13.855  1.00 26.65 ? 494  LYS A CD    1 
ATOM   2114 C  CE    . LYS C 3 198 ? 27.256  53.408 12.981  1.00 30.91 ? 494  LYS A CE    1 
ATOM   2115 N  NZ    . LYS C 3 198 ? 28.642  53.330 13.515  1.00 34.48 ? 494  LYS A NZ    1 
ATOM   2116 N  N     . VAL C 3 199 ? 27.226  50.819 17.647  1.00 14.23 ? 495  VAL A N     1 
ATOM   2117 C  CA    . VAL C 3 199 ? 28.154  50.790 18.770  1.00 13.68 ? 495  VAL A CA    1 
ATOM   2118 C  C     . VAL C 3 199 ? 29.343  51.691 18.465  1.00 15.01 ? 495  VAL A C     1 
ATOM   2119 O  O     . VAL C 3 199 ? 29.852  51.696 17.345  1.00 15.95 ? 495  VAL A O     1 
ATOM   2120 C  CB    . VAL C 3 199 ? 28.683  49.361 19.033  1.00 15.15 ? 495  VAL A CB    1 
ATOM   2121 C  CG1   . VAL C 3 199 ? 29.800  49.399 20.093  1.00 14.59 ? 495  VAL A CG1   1 
ATOM   2122 C  CG2   . VAL C 3 199 ? 27.549  48.464 19.504  1.00 17.78 ? 495  VAL A CG2   1 
ATOM   2123 N  N     . ASP C 3 200 ? 29.771  52.453 19.470  1.00 16.72 ? 496  ASP A N     1 
ATOM   2124 C  CA    . ASP C 3 200 ? 30.926  53.344 19.358  1.00 17.28 ? 496  ASP A CA    1 
ATOM   2125 C  C     . ASP C 3 200 ? 32.088  52.461 19.802  1.00 17.86 ? 496  ASP A C     1 
ATOM   2126 O  O     . ASP C 3 200 ? 32.446  52.433 20.981  1.00 18.65 ? 496  ASP A O     1 
ATOM   2127 C  CB    . ASP C 3 200 ? 30.773  54.533 20.313  1.00 18.57 ? 496  ASP A CB    1 
ATOM   2128 C  CG    . ASP C 3 200 ? 31.889  55.557 20.170  1.00 21.33 ? 496  ASP A CG    1 
ATOM   2129 O  OD1   . ASP C 3 200 ? 32.980  55.201 19.680  1.00 21.74 ? 496  ASP A OD1   1 
ATOM   2130 O  OD2   . ASP C 3 200 ? 31.674  56.722 20.560  1.00 22.34 ? 496  ASP A OD2   1 
ATOM   2131 N  N     . THR C 3 201 ? 32.665  51.730 18.856  1.00 18.73 ? 497  THR A N     1 
ATOM   2132 C  CA    . THR C 3 201 ? 33.757  50.821 19.171  1.00 21.13 ? 497  THR A CA    1 
ATOM   2133 C  C     . THR C 3 201 ? 35.001  51.522 19.703  1.00 22.24 ? 497  THR A C     1 
ATOM   2134 O  O     . THR C 3 201 ? 35.695  50.984 20.561  1.00 22.30 ? 497  THR A O     1 
ATOM   2135 C  CB    . THR C 3 201 ? 34.126  49.957 17.945  1.00 22.14 ? 497  THR A CB    1 
ATOM   2136 O  OG1   . THR C 3 201 ? 34.378  50.802 16.818  1.00 21.35 ? 497  THR A OG1   1 
ATOM   2137 C  CG2   . THR C 3 201 ? 32.982  49.002 17.611  1.00 20.86 ? 497  THR A CG2   1 
ATOM   2138 N  N     . LYS C 3 202 ? 35.288  52.719 19.203  1.00 24.38 ? 498  LYS A N     1 
ATOM   2139 C  CA    . LYS C 3 202 ? 36.456  53.443 19.685  1.00 25.03 ? 498  LYS A CA    1 
ATOM   2140 C  C     . LYS C 3 202 ? 36.293  53.740 21.172  1.00 24.55 ? 498  LYS A C     1 
ATOM   2141 O  O     . LYS C 3 202 ? 37.253  53.653 21.942  1.00 22.92 ? 498  LYS A O     1 
ATOM   2142 C  CB    . LYS C 3 202 ? 36.647  54.741 18.900  1.00 27.82 ? 498  LYS A CB    1 
ATOM   2143 C  CG    . LYS C 3 202 ? 37.046  54.508 17.453  1.00 32.45 ? 498  LYS A CG    1 
ATOM   2144 C  CD    . LYS C 3 202 ? 37.338  55.809 16.727  1.00 37.43 ? 498  LYS A CD    1 
ATOM   2145 C  CE    . LYS C 3 202 ? 37.774  55.541 15.290  1.00 39.75 ? 498  LYS A CE    1 
ATOM   2146 N  NZ    . LYS C 3 202 ? 38.989  54.676 15.229  1.00 42.87 ? 498  LYS A NZ    1 
ATOM   2147 N  N     . ARG C 3 203 ? 35.074  54.078 21.582  1.00 24.45 ? 499  ARG A N     1 
ATOM   2148 C  CA    . ARG C 3 203 ? 34.823  54.371 22.985  1.00 24.95 ? 499  ARG A CA    1 
ATOM   2149 C  C     . ARG C 3 203 ? 34.948  53.105 23.824  1.00 24.10 ? 499  ARG A C     1 
ATOM   2150 O  O     . ARG C 3 203 ? 35.494  53.140 24.926  1.00 23.00 ? 499  ARG A O     1 
ATOM   2151 C  CB    . ARG C 3 203 ? 33.436  54.990 23.177  1.00 26.71 ? 499  ARG A CB    1 
ATOM   2152 C  CG    . ARG C 3 203 ? 33.232  55.543 24.579  1.00 31.37 ? 499  ARG A CG    1 
ATOM   2153 C  CD    . ARG C 3 203 ? 32.304  56.742 24.576  1.00 35.59 ? 499  ARG A CD    1 
ATOM   2154 N  NE    . ARG C 3 203 ? 32.445  57.529 25.799  1.00 39.47 ? 499  ARG A NE    1 
ATOM   2155 C  CZ    . ARG C 3 203 ? 31.807  58.672 26.032  1.00 40.67 ? 499  ARG A CZ    1 
ATOM   2156 N  NH1   . ARG C 3 203 ? 30.976  59.171 25.124  1.00 41.32 ? 499  ARG A NH1   1 
ATOM   2157 N  NH2   . ARG C 3 203 ? 32.004  59.321 27.173  1.00 41.60 ? 499  ARG A NH2   1 
ATOM   2158 N  N     . LEU C 3 204 ? 34.445  51.990 23.300  1.00 22.56 ? 500  LEU A N     1 
ATOM   2159 C  CA    . LEU C 3 204 ? 34.530  50.714 24.007  1.00 23.40 ? 500  LEU A CA    1 
ATOM   2160 C  C     . LEU C 3 204 ? 35.987  50.299 24.182  1.00 23.34 ? 500  LEU A C     1 
ATOM   2161 O  O     . LEU C 3 204 ? 36.394  49.866 25.257  1.00 22.45 ? 500  LEU A O     1 
ATOM   2162 C  CB    . LEU C 3 204 ? 33.799  49.607 23.240  1.00 24.36 ? 500  LEU A CB    1 
ATOM   2163 C  CG    . LEU C 3 204 ? 32.315  49.368 23.511  1.00 25.56 ? 500  LEU A CG    1 
ATOM   2164 C  CD1   . LEU C 3 204 ? 31.840  48.179 22.692  1.00 24.59 ? 500  LEU A CD1   1 
ATOM   2165 C  CD2   . LEU C 3 204 ? 32.095  49.104 24.997  1.00 25.21 ? 500  LEU A CD2   1 
ATOM   2166 N  N     . GLU C 3 205 ? 36.769  50.430 23.118  1.00 23.33 ? 501  GLU A N     1 
ATOM   2167 C  CA    . GLU C 3 205 ? 38.174  50.053 23.176  1.00 24.99 ? 501  GLU A CA    1 
ATOM   2168 C  C     . GLU C 3 205 ? 38.933  50.913 24.177  1.00 25.32 ? 501  GLU A C     1 
ATOM   2169 O  O     . GLU C 3 205 ? 39.843  50.436 24.853  1.00 25.64 ? 501  GLU A O     1 
ATOM   2170 C  CB    . GLU C 3 205 ? 38.805  50.165 21.788  1.00 25.62 ? 501  GLU A CB    1 
ATOM   2171 C  CG    . GLU C 3 205 ? 38.122  49.290 20.747  1.00 30.92 ? 501  GLU A CG    1 
ATOM   2172 C  CD    . GLU C 3 205 ? 38.720  49.449 19.366  1.00 33.38 ? 501  GLU A CD    1 
ATOM   2173 O  OE1   . GLU C 3 205 ? 38.916  50.605 18.935  1.00 34.62 ? 501  GLU A OE1   1 
ATOM   2174 O  OE2   . GLU C 3 205 ? 38.990  48.422 18.710  1.00 36.18 ? 501  GLU A OE2   1 
ATOM   2175 N  N     . GLN C 3 206 ? 38.554  52.181 24.280  1.00 25.82 ? 502  GLN A N     1 
ATOM   2176 C  CA    . GLN C 3 206 ? 39.212  53.077 25.218  1.00 27.18 ? 502  GLN A CA    1 
ATOM   2177 C  C     . GLN C 3 206 ? 38.849  52.676 26.644  1.00 27.56 ? 502  GLN A C     1 
ATOM   2178 O  O     . GLN C 3 206 ? 39.694  52.708 27.542  1.00 25.52 ? 502  GLN A O     1 
ATOM   2179 C  CB    . GLN C 3 206 ? 38.799  54.524 24.958  1.00 29.23 ? 502  GLN A CB    1 
ATOM   2180 C  CG    . GLN C 3 206 ? 39.518  55.522 25.856  1.00 35.12 ? 502  GLN A CG    1 
ATOM   2181 C  CD    . GLN C 3 206 ? 41.023  55.296 25.892  1.00 38.09 ? 502  GLN A CD    1 
ATOM   2182 O  OE1   . GLN C 3 206 ? 41.699  55.346 24.862  1.00 40.86 ? 502  GLN A OE1   1 
ATOM   2183 N  NE2   . GLN C 3 206 ? 41.554  55.041 27.085  1.00 39.37 ? 502  GLN A NE2   1 
ATOM   2184 N  N     . MET C 3 207 ? 37.590  52.298 26.851  1.00 26.14 ? 503  MET A N     1 
ATOM   2185 C  CA    . MET C 3 207 ? 37.152  51.871 28.171  1.00 26.88 ? 503  MET A CA    1 
ATOM   2186 C  C     . MET C 3 207 ? 37.907  50.594 28.518  1.00 26.38 ? 503  MET A C     1 
ATOM   2187 O  O     . MET C 3 207 ? 38.278  50.373 29.667  1.00 26.13 ? 503  MET A O     1 
ATOM   2188 C  CB    . MET C 3 207 ? 35.642  51.597 28.184  1.00 27.17 ? 503  MET A CB    1 
ATOM   2189 C  CG    . MET C 3 207 ? 34.767  52.832 28.049  1.00 28.68 ? 503  MET A CG    1 
ATOM   2190 S  SD    . MET C 3 207 ? 33.002  52.423 28.084  1.00 34.59 ? 503  MET A SD    1 
ATOM   2191 C  CE    . MET C 3 207 ? 32.551  52.649 26.371  1.00 32.61 ? 503  MET A CE    1 
ATOM   2192 N  N     . GLY C 3 208 ? 38.134  49.760 27.508  1.00 27.18 ? 504  GLY A N     1 
ATOM   2193 C  CA    . GLY C 3 208 ? 38.845  48.511 27.712  1.00 29.05 ? 504  GLY A CA    1 
ATOM   2194 C  C     . GLY C 3 208 ? 40.287  48.715 28.138  1.00 30.70 ? 504  GLY A C     1 
ATOM   2195 O  O     . GLY C 3 208 ? 40.804  47.983 28.984  1.00 29.77 ? 504  GLY A O     1 
ATOM   2196 N  N     . LYS C 3 209 ? 40.944  49.711 27.551  1.00 31.85 ? 505  LYS A N     1 
ATOM   2197 C  CA    . LYS C 3 209 ? 42.333  50.000 27.891  1.00 33.32 ? 505  LYS A CA    1 
ATOM   2198 C  C     . LYS C 3 209 ? 42.431  50.460 29.340  1.00 33.21 ? 505  LYS A C     1 
ATOM   2199 O  O     . LYS C 3 209 ? 43.322  50.035 30.076  1.00 32.20 ? 505  LYS A O     1 
ATOM   2200 C  CB    . LYS C 3 209 ? 42.897  51.078 26.961  1.00 35.00 ? 505  LYS A CB    1 
ATOM   2201 C  CG    . LYS C 3 209 ? 43.046  50.626 25.518  1.00 38.96 ? 505  LYS A CG    1 
ATOM   2202 C  CD    . LYS C 3 209 ? 43.618  51.733 24.640  1.00 41.41 ? 505  LYS A CD    1 
ATOM   2203 C  CE    . LYS C 3 209 ? 43.784  51.265 23.199  1.00 42.56 ? 505  LYS A CE    1 
ATOM   2204 N  NZ    . LYS C 3 209 ? 44.335  52.334 22.319  1.00 43.62 ? 505  LYS A NZ    1 
ATOM   2205 N  N     . GLU C 3 210 ? 41.510  51.329 29.744  1.00 32.66 ? 506  GLU A N     1 
ATOM   2206 C  CA    . GLU C 3 210 ? 41.489  51.837 31.109  1.00 33.51 ? 506  GLU A CA    1 
ATOM   2207 C  C     . GLU C 3 210 ? 41.163  50.720 32.094  1.00 33.76 ? 506  GLU A C     1 
ATOM   2208 O  O     . GLU C 3 210 ? 41.736  50.659 33.186  1.00 33.62 ? 506  GLU A O     1 
ATOM   2209 C  CB    . GLU C 3 210 ? 40.465  52.964 31.239  1.00 35.20 ? 506  GLU A CB    1 
ATOM   2210 C  CG    . GLU C 3 210 ? 40.825  54.205 30.442  1.00 39.41 ? 506  GLU A CG    1 
ATOM   2211 C  CD    . GLU C 3 210 ? 39.792  55.301 30.574  1.00 42.00 ? 506  GLU A CD    1 
ATOM   2212 O  OE1   . GLU C 3 210 ? 39.521  55.725 31.717  1.00 44.16 ? 506  GLU A OE1   1 
ATOM   2213 O  OE2   . GLU C 3 210 ? 39.253  55.740 29.536  1.00 44.16 ? 506  GLU A OE2   1 
ATOM   2214 N  N     . LEU C 3 211 ? 40.241  49.841 31.710  1.00 31.44 ? 507  LEU A N     1 
ATOM   2215 C  CA    . LEU C 3 211 ? 39.862  48.719 32.560  1.00 31.13 ? 507  LEU A CA    1 
ATOM   2216 C  C     . LEU C 3 211 ? 41.063  47.808 32.766  1.00 29.76 ? 507  LEU A C     1 
ATOM   2217 O  O     . LEU C 3 211 ? 41.341  47.375 33.882  1.00 29.31 ? 507  LEU A O     1 
ATOM   2218 C  CB    . LEU C 3 211 ? 38.726  47.913 31.923  1.00 31.38 ? 507  LEU A CB    1 
ATOM   2219 C  CG    . LEU C 3 211 ? 37.287  48.308 32.259  1.00 33.89 ? 507  LEU A CG    1 
ATOM   2220 C  CD1   . LEU C 3 211 ? 36.320  47.486 31.419  1.00 33.89 ? 507  LEU A CD1   1 
ATOM   2221 C  CD2   . LEU C 3 211 ? 37.030  48.075 33.741  1.00 33.95 ? 507  LEU A CD2   1 
ATOM   2222 N  N     . ALA C 3 212 ? 41.768  47.517 31.677  1.00 28.32 ? 508  ALA A N     1 
ATOM   2223 C  CA    . ALA C 3 212 ? 42.941  46.657 31.732  1.00 28.93 ? 508  ALA A CA    1 
ATOM   2224 C  C     . ALA C 3 212 ? 43.979  47.234 32.688  1.00 28.88 ? 508  ALA A C     1 
ATOM   2225 O  O     . ALA C 3 212 ? 44.696  46.495 33.359  1.00 26.55 ? 508  ALA A O     1 
ATOM   2226 C  CB    . ALA C 3 212 ? 43.539  46.498 30.341  1.00 29.10 ? 508  ALA A CB    1 
ATOM   2227 N  N     . GLU C 3 213 ? 44.053  48.560 32.743  1.00 29.96 ? 509  GLU A N     1 
ATOM   2228 C  CA    . GLU C 3 213 ? 45.001  49.230 33.623  1.00 31.83 ? 509  GLU A CA    1 
ATOM   2229 C  C     . GLU C 3 213 ? 44.587  49.031 35.078  1.00 31.17 ? 509  GLU A C     1 
ATOM   2230 O  O     . GLU C 3 213 ? 45.408  48.676 35.925  1.00 29.05 ? 509  GLU A O     1 
ATOM   2231 C  CB    . GLU C 3 213 ? 45.062  50.724 33.291  1.00 34.72 ? 509  GLU A CB    1 
ATOM   2232 C  CG    . GLU C 3 213 ? 45.999  51.525 34.181  1.00 41.37 ? 509  GLU A CG    1 
ATOM   2233 C  CD    . GLU C 3 213 ? 46.247  52.931 33.657  1.00 44.86 ? 509  GLU A CD    1 
ATOM   2234 O  OE1   . GLU C 3 213 ? 45.268  53.687 33.466  1.00 46.98 ? 509  GLU A OE1   1 
ATOM   2235 O  OE2   . GLU C 3 213 ? 47.427  53.280 33.436  1.00 48.08 ? 509  GLU A OE2   1 
ATOM   2236 N  N     . GLN C 3 214 ? 43.307  49.249 35.358  1.00 30.32 ? 510  GLN A N     1 
ATOM   2237 C  CA    . GLN C 3 214 ? 42.789  49.093 36.712  1.00 31.27 ? 510  GLN A CA    1 
ATOM   2238 C  C     . GLN C 3 214 ? 42.827  47.639 37.168  1.00 30.43 ? 510  GLN A C     1 
ATOM   2239 O  O     . GLN C 3 214 ? 43.142  47.357 38.326  1.00 30.21 ? 510  GLN A O     1 
ATOM   2240 C  CB    . GLN C 3 214 ? 41.365  49.638 36.794  1.00 32.42 ? 510  GLN A CB    1 
ATOM   2241 C  CG    . GLN C 3 214 ? 41.298  51.151 36.679  1.00 36.02 ? 510  GLN A CG    1 
ATOM   2242 C  CD    . GLN C 3 214 ? 39.880  51.680 36.730  1.00 38.69 ? 510  GLN A CD    1 
ATOM   2243 O  OE1   . GLN C 3 214 ? 39.115  51.355 37.640  1.00 39.96 ? 510  GLN A OE1   1 
ATOM   2244 N  NE2   . GLN C 3 214 ? 39.523  52.506 35.752  1.00 39.42 ? 510  GLN A NE2   1 
ATOM   2245 N  N     . LEU C 3 215 ? 42.508  46.718 36.264  1.00 29.55 ? 511  LEU A N     1 
ATOM   2246 C  CA    . LEU C 3 215 ? 42.538  45.300 36.599  1.00 28.53 ? 511  LEU A CA    1 
ATOM   2247 C  C     . LEU C 3 215 ? 43.956  44.904 36.987  1.00 29.09 ? 511  LEU A C     1 
ATOM   2248 O  O     . LEU C 3 215 ? 44.164  44.158 37.944  1.00 27.24 ? 511  LEU A O     1 
ATOM   2249 C  CB    . LEU C 3 215 ? 42.084  44.449 35.411  1.00 30.25 ? 511  LEU A CB    1 
ATOM   2250 C  CG    . LEU C 3 215 ? 40.580  44.275 35.196  1.00 31.81 ? 511  LEU A CG    1 
ATOM   2251 C  CD1   . LEU C 3 215 ? 40.330  43.570 33.868  1.00 33.03 ? 511  LEU A CD1   1 
ATOM   2252 C  CD2   . LEU C 3 215 ? 39.991  43.476 36.350  1.00 30.97 ? 511  LEU A CD2   1 
ATOM   2253 N  N     . GLY C 3 216 ? 44.929  45.411 36.234  1.00 28.49 ? 512  GLY A N     1 
ATOM   2254 C  CA    . GLY C 3 216 ? 46.317  45.097 36.513  1.00 28.40 ? 512  GLY A CA    1 
ATOM   2255 C  C     . GLY C 3 216 ? 46.719  45.496 37.918  1.00 28.60 ? 512  GLY A C     1 
ATOM   2256 O  O     . GLY C 3 216 ? 47.410  44.752 38.615  1.00 28.44 ? 512  GLY A O     1 
ATOM   2257 N  N     . THR C 3 217 ? 46.275  46.675 38.335  1.00 28.29 ? 513  THR A N     1 
ATOM   2258 C  CA    . THR C 3 217 ? 46.587  47.192 39.659  1.00 29.35 ? 513  THR A CA    1 
ATOM   2259 C  C     . THR C 3 217 ? 45.919  46.366 40.756  1.00 29.44 ? 513  THR A C     1 
ATOM   2260 O  O     . THR C 3 217 ? 46.568  45.966 41.724  1.00 28.40 ? 513  THR A O     1 
ATOM   2261 C  CB    . THR C 3 217 ? 46.149  48.664 39.780  1.00 30.69 ? 513  THR A CB    1 
ATOM   2262 O  OG1   . THR C 3 217 ? 46.870  49.446 38.820  1.00 30.53 ? 513  THR A OG1   1 
ATOM   2263 C  CG2   . THR C 3 217 ? 46.422  49.198 41.177  1.00 30.50 ? 513  THR A CG2   1 
ATOM   2264 N  N     . VAL C 3 218 ? 44.623  46.110 40.606  1.00 27.95 ? 514  VAL A N     1 
ATOM   2265 C  CA    . VAL C 3 218 ? 43.904  45.320 41.596  1.00 27.04 ? 514  VAL A CA    1 
ATOM   2266 C  C     . VAL C 3 218 ? 44.452  43.895 41.612  1.00 26.19 ? 514  VAL A C     1 
ATOM   2267 O  O     . VAL C 3 218 ? 44.556  43.271 42.668  1.00 26.55 ? 514  VAL A O     1 
ATOM   2268 C  CB    . VAL C 3 218 ? 42.391  45.271 41.292  1.00 26.07 ? 514  VAL A CB    1 
ATOM   2269 C  CG1   . VAL C 3 218 ? 41.671  44.473 42.372  1.00 26.96 ? 514  VAL A CG1   1 
ATOM   2270 C  CG2   . VAL C 3 218 ? 41.833  46.680 41.220  1.00 27.66 ? 514  VAL A CG2   1 
ATOM   2271 N  N     . GLU C 3 219 ? 44.812  43.386 40.438  1.00 26.01 ? 515  GLU A N     1 
ATOM   2272 C  CA    . GLU C 3 219 ? 45.349  42.034 40.325  1.00 27.53 ? 515  GLU A CA    1 
ATOM   2273 C  C     . GLU C 3 219 ? 46.613  41.900 41.171  1.00 28.30 ? 515  GLU A C     1 
ATOM   2274 O  O     . GLU C 3 219 ? 46.762  40.952 41.944  1.00 27.90 ? 515  GLU A O     1 
ATOM   2275 C  CB    . GLU C 3 219 ? 45.680  41.717 38.864  1.00 27.42 ? 515  GLU A CB    1 
ATOM   2276 C  CG    . GLU C 3 219 ? 45.951  40.247 38.584  1.00 30.87 ? 515  GLU A CG    1 
ATOM   2277 C  CD    . GLU C 3 219 ? 46.667  40.022 37.259  1.00 33.91 ? 515  GLU A CD    1 
ATOM   2278 O  OE1   . GLU C 3 219 ? 46.372  40.744 36.284  1.00 32.88 ? 515  GLU A OE1   1 
ATOM   2279 O  OE2   . GLU C 3 219 ? 47.526  39.114 37.192  1.00 36.41 ? 515  GLU A OE2   1 
ATOM   2280 N  N     . GLN C 3 220 ? 47.524  42.855 41.018  1.00 29.38 ? 516  GLN A N     1 
ATOM   2281 C  CA    . GLN C 3 220 ? 48.774  42.838 41.765  1.00 30.29 ? 516  GLN A CA    1 
ATOM   2282 C  C     . GLN C 3 220 ? 48.536  43.002 43.259  1.00 29.43 ? 516  GLN A C     1 
ATOM   2283 O  O     . GLN C 3 220 ? 49.185  42.341 44.066  1.00 30.70 ? 516  GLN A O     1 
ATOM   2284 C  CB    . GLN C 3 220 ? 49.709  43.940 41.262  1.00 32.77 ? 516  GLN A CB    1 
ATOM   2285 C  CG    . GLN C 3 220 ? 50.239  43.698 39.855  1.00 36.13 ? 516  GLN A CG    1 
ATOM   2286 C  CD    . GLN C 3 220 ? 50.830  42.307 39.690  1.00 37.11 ? 516  GLN A CD    1 
ATOM   2287 O  OE1   . GLN C 3 220 ? 51.684  41.886 40.472  1.00 39.94 ? 516  GLN A OE1   1 
ATOM   2288 N  NE2   . GLN C 3 220 ? 50.377  41.588 38.670  1.00 37.45 ? 516  GLN A NE2   1 
ATOM   2289 N  N     . ARG C 3 221 ? 47.607  43.883 43.620  1.00 28.02 ? 517  ARG A N     1 
ATOM   2290 C  CA    . ARG C 3 221 ? 47.278  44.124 45.021  1.00 27.37 ? 517  ARG A CA    1 
ATOM   2291 C  C     . ARG C 3 221 ? 46.769  42.837 45.667  1.00 26.89 ? 517  ARG A C     1 
ATOM   2292 O  O     . ARG C 3 221 ? 47.036  42.569 46.839  1.00 27.55 ? 517  ARG A O     1 
ATOM   2293 C  CB    . ARG C 3 221 ? 46.215  45.224 45.134  1.00 28.50 ? 517  ARG A CB    1 
ATOM   2294 C  CG    . ARG C 3 221 ? 45.773  45.536 46.561  1.00 30.92 ? 517  ARG A CG    1 
ATOM   2295 C  CD    . ARG C 3 221 ? 46.959  45.906 47.445  1.00 33.32 ? 517  ARG A CD    1 
ATOM   2296 N  NE    . ARG C 3 221 ? 46.557  46.206 48.816  1.00 36.89 ? 517  ARG A NE    1 
ATOM   2297 C  CZ    . ARG C 3 221 ? 47.407  46.387 49.822  1.00 38.05 ? 517  ARG A CZ    1 
ATOM   2298 N  NH1   . ARG C 3 221 ? 48.714  46.298 49.614  1.00 39.14 ? 517  ARG A NH1   1 
ATOM   2299 N  NH2   . ARG C 3 221 ? 46.952  46.658 51.039  1.00 39.03 ? 517  ARG A NH2   1 
ATOM   2300 N  N     . ILE C 3 222 ? 46.039  42.041 44.893  1.00 23.61 ? 518  ILE A N     1 
ATOM   2301 C  CA    . ILE C 3 222 ? 45.506  40.778 45.387  1.00 22.92 ? 518  ILE A CA    1 
ATOM   2302 C  C     . ILE C 3 222 ? 46.626  39.769 45.651  1.00 23.51 ? 518  ILE A C     1 
ATOM   2303 O  O     . ILE C 3 222 ? 46.633  39.106 46.688  1.00 22.80 ? 518  ILE A O     1 
ATOM   2304 C  CB    . ILE C 3 222 ? 44.487  40.176 44.387  1.00 20.58 ? 518  ILE A CB    1 
ATOM   2305 C  CG1   . ILE C 3 222 ? 43.214  41.030 44.381  1.00 20.51 ? 518  ILE A CG1   1 
ATOM   2306 C  CG2   . ILE C 3 222 ? 44.161  38.738 44.765  1.00 21.12 ? 518  ILE A CG2   1 
ATOM   2307 C  CD1   . ILE C 3 222 ? 42.195  40.623 43.337  1.00 20.06 ? 518  ILE A CD1   1 
ATOM   2308 N  N     . TYR C 3 223 ? 47.572  39.649 44.724  1.00 24.64 ? 519  TYR A N     1 
ATOM   2309 C  CA    . TYR C 3 223 ? 48.674  38.709 44.921  1.00 26.33 ? 519  TYR A CA    1 
ATOM   2310 C  C     . TYR C 3 223 ? 49.485  39.146 46.131  1.00 27.85 ? 519  TYR A C     1 
ATOM   2311 O  O     . TYR C 3 223 ? 49.956  38.317 46.911  1.00 27.82 ? 519  TYR A O     1 
ATOM   2312 C  CB    . TYR C 3 223 ? 49.586  38.655 43.691  1.00 26.21 ? 519  TYR A CB    1 
ATOM   2313 C  CG    . TYR C 3 223 ? 48.892  38.228 42.420  1.00 25.90 ? 519  TYR A CG    1 
ATOM   2314 C  CD1   . TYR C 3 223 ? 47.866  37.283 42.446  1.00 25.43 ? 519  TYR A CD1   1 
ATOM   2315 C  CD2   . TYR C 3 223 ? 49.268  38.761 41.186  1.00 25.54 ? 519  TYR A CD2   1 
ATOM   2316 C  CE1   . TYR C 3 223 ? 47.228  36.880 41.274  1.00 25.52 ? 519  TYR A CE1   1 
ATOM   2317 C  CE2   . TYR C 3 223 ? 48.638  38.364 40.006  1.00 25.33 ? 519  TYR A CE2   1 
ATOM   2318 C  CZ    . TYR C 3 223 ? 47.618  37.425 40.059  1.00 25.20 ? 519  TYR A CZ    1 
ATOM   2319 O  OH    . TYR C 3 223 ? 46.984  37.035 38.902  1.00 25.09 ? 519  TYR A OH    1 
ATOM   2320 N  N     . GLU C 3 224 ? 49.639  40.458 46.278  1.00 29.18 ? 520  GLU A N     1 
ATOM   2321 C  CA    . GLU C 3 224 ? 50.382  41.033 47.391  1.00 30.02 ? 520  GLU A CA    1 
ATOM   2322 C  C     . GLU C 3 224 ? 49.722  40.662 48.717  1.00 28.80 ? 520  GLU A C     1 
ATOM   2323 O  O     . GLU C 3 224 ? 50.384  40.194 49.642  1.00 28.71 ? 520  GLU A O     1 
ATOM   2324 C  CB    . GLU C 3 224 ? 50.446  42.558 47.233  1.00 33.82 ? 520  GLU A CB    1 
ATOM   2325 C  CG    . GLU C 3 224 ? 50.972  43.309 48.446  1.00 39.60 ? 520  GLU A CG    1 
ATOM   2326 C  CD    . GLU C 3 224 ? 51.198  44.788 48.168  1.00 43.40 ? 520  GLU A CD    1 
ATOM   2327 O  OE1   . GLU C 3 224 ? 50.288  45.446 47.614  1.00 45.08 ? 520  GLU A OE1   1 
ATOM   2328 O  OE2   . GLU C 3 224 ? 52.288  45.297 48.509  1.00 46.77 ? 520  GLU A OE2   1 
ATOM   2329 N  N     . LEU C 3 225 ? 48.413  40.865 48.803  1.00 26.20 ? 521  LEU A N     1 
ATOM   2330 C  CA    . LEU C 3 225 ? 47.673  40.548 50.020  1.00 25.88 ? 521  LEU A CA    1 
ATOM   2331 C  C     . LEU C 3 225 ? 47.593  39.047 50.294  1.00 25.73 ? 521  LEU A C     1 
ATOM   2332 O  O     . LEU C 3 225 ? 47.490  38.626 51.446  1.00 25.41 ? 521  LEU A O     1 
ATOM   2333 C  CB    . LEU C 3 225 ? 46.263  41.143 49.941  1.00 24.81 ? 521  LEU A CB    1 
ATOM   2334 C  CG    . LEU C 3 225 ? 46.222  42.670 50.023  1.00 24.63 ? 521  LEU A CG    1 
ATOM   2335 C  CD1   . LEU C 3 225 ? 44.807  43.178 49.771  1.00 23.60 ? 521  LEU A CD1   1 
ATOM   2336 C  CD2   . LEU C 3 225 ? 46.720  43.108 51.395  1.00 25.41 ? 521  LEU A CD2   1 
ATOM   2337 N  N     . ALA C 3 226 ? 47.648  38.242 49.237  1.00 25.72 ? 522  ALA A N     1 
ATOM   2338 C  CA    . ALA C 3 226 ? 47.573  36.791 49.378  1.00 26.60 ? 522  ALA A CA    1 
ATOM   2339 C  C     . ALA C 3 226 ? 48.946  36.184 49.642  1.00 28.13 ? 522  ALA A C     1 
ATOM   2340 O  O     . ALA C 3 226 ? 49.053  35.084 50.184  1.00 27.55 ? 522  ALA A O     1 
ATOM   2341 C  CB    . ALA C 3 226 ? 46.969  36.174 48.123  1.00 25.59 ? 522  ALA A CB    1 
ATOM   2342 N  N     . GLY C 3 227 ? 49.994  36.903 49.253  1.00 30.23 ? 523  GLY A N     1 
ATOM   2343 C  CA    . GLY C 3 227 ? 51.343  36.410 49.457  1.00 32.30 ? 523  GLY A CA    1 
ATOM   2344 C  C     . GLY C 3 227 ? 51.803  35.480 48.352  1.00 33.54 ? 523  GLY A C     1 
ATOM   2345 O  O     . GLY C 3 227 ? 52.839  34.826 48.472  1.00 34.34 ? 523  GLY A O     1 
ATOM   2346 N  N     . GLN C 3 228 ? 51.034  35.414 47.270  1.00 33.97 ? 524  GLN A N     1 
ATOM   2347 C  CA    . GLN C 3 228 ? 51.389  34.559 46.141  1.00 33.91 ? 524  GLN A CA    1 
ATOM   2348 C  C     . GLN C 3 228 ? 50.441  34.791 44.972  1.00 33.72 ? 524  GLN A C     1 
ATOM   2349 O  O     . GLN C 3 228 ? 49.334  35.298 45.148  1.00 32.09 ? 524  GLN A O     1 
ATOM   2350 C  CB    . GLN C 3 228 ? 51.335  33.084 46.543  1.00 34.73 ? 524  GLN A CB    1 
ATOM   2351 C  CG    . GLN C 3 228 ? 49.925  32.542 46.731  1.00 35.41 ? 524  GLN A CG    1 
ATOM   2352 C  CD    . GLN C 3 228 ? 49.908  31.092 47.174  1.00 36.41 ? 524  GLN A CD    1 
ATOM   2353 O  OE1   . GLN C 3 228 ? 50.339  30.766 48.279  1.00 38.62 ? 524  GLN A OE1   1 
ATOM   2354 N  NE2   . GLN C 3 228 ? 49.410  30.213 46.312  1.00 36.05 ? 524  GLN A NE2   1 
ATOM   2355 N  N     . GLU C 3 229 ? 50.883  34.416 43.778  1.00 33.21 ? 525  GLU A N     1 
ATOM   2356 C  CA    . GLU C 3 229 ? 50.058  34.573 42.594  1.00 33.05 ? 525  GLU A CA    1 
ATOM   2357 C  C     . GLU C 3 229 ? 49.230  33.315 42.381  1.00 31.07 ? 525  GLU A C     1 
ATOM   2358 O  O     . GLU C 3 229 ? 49.661  32.211 42.707  1.00 31.51 ? 525  GLU A O     1 
ATOM   2359 C  CB    . GLU C 3 229 ? 50.927  34.839 41.362  1.00 35.19 ? 525  GLU A CB    1 
ATOM   2360 C  CG    . GLU C 3 229 ? 51.722  36.133 41.442  1.00 39.40 ? 525  GLU A CG    1 
ATOM   2361 C  CD    . GLU C 3 229 ? 52.386  36.501 40.125  1.00 42.44 ? 525  GLU A CD    1 
ATOM   2362 O  OE1   . GLU C 3 229 ? 53.135  37.502 40.100  1.00 43.61 ? 525  GLU A OE1   1 
ATOM   2363 O  OE2   . GLU C 3 229 ? 52.158  35.793 39.119  1.00 42.89 ? 525  GLU A OE2   1 
ATOM   2364 N  N     . PHE C 3 230 ? 48.033  33.494 41.837  1.00 28.02 ? 526  PHE A N     1 
ATOM   2365 C  CA    . PHE C 3 230 ? 47.136  32.384 41.560  1.00 26.08 ? 526  PHE A CA    1 
ATOM   2366 C  C     . PHE C 3 230 ? 46.079  32.882 40.587  1.00 25.27 ? 526  PHE A C     1 
ATOM   2367 O  O     . PHE C 3 230 ? 46.004  34.080 40.315  1.00 24.50 ? 526  PHE A O     1 
ATOM   2368 C  CB    . PHE C 3 230 ? 46.465  31.897 42.846  1.00 24.85 ? 526  PHE A CB    1 
ATOM   2369 C  CG    . PHE C 3 230 ? 45.642  32.946 43.537  1.00 23.31 ? 526  PHE A CG    1 
ATOM   2370 C  CD1   . PHE C 3 230 ? 46.252  33.992 44.220  1.00 23.04 ? 526  PHE A CD1   1 
ATOM   2371 C  CD2   . PHE C 3 230 ? 44.251  32.891 43.498  1.00 23.90 ? 526  PHE A CD2   1 
ATOM   2372 C  CE1   . PHE C 3 230 ? 45.486  34.974 44.857  1.00 23.04 ? 526  PHE A CE1   1 
ATOM   2373 C  CE2   . PHE C 3 230 ? 43.477  33.863 44.130  1.00 23.68 ? 526  PHE A CE2   1 
ATOM   2374 C  CZ    . PHE C 3 230 ? 44.097  34.907 44.810  1.00 23.41 ? 526  PHE A CZ    1 
ATOM   2375 N  N     . ASN C 3 231 ? 45.264  31.971 40.066  1.00 25.14 ? 527  ASN A N     1 
ATOM   2376 C  CA    . ASN C 3 231 ? 44.215  32.368 39.134  1.00 25.52 ? 527  ASN A CA    1 
ATOM   2377 C  C     . ASN C 3 231 ? 43.010  32.863 39.920  1.00 24.74 ? 527  ASN A C     1 
ATOM   2378 O  O     . ASN C 3 231 ? 42.187  32.074 40.386  1.00 24.95 ? 527  ASN A O     1 
ATOM   2379 C  CB    . ASN C 3 231 ? 43.795  31.197 38.248  1.00 25.79 ? 527  ASN A CB    1 
ATOM   2380 C  CG    . ASN C 3 231 ? 42.865  31.629 37.125  1.00 28.16 ? 527  ASN A CG    1 
ATOM   2381 O  OD1   . ASN C 3 231 ? 41.906  32.369 37.349  1.00 30.16 ? 527  ASN A OD1   1 
ATOM   2382 N  ND2   . ASN C 3 231 ? 43.144  31.169 35.915  1.00 26.66 ? 527  ASN A ND2   1 
ATOM   2383 N  N     . ILE C 3 232 ? 42.915  34.177 40.064  1.00 24.85 ? 528  ILE A N     1 
ATOM   2384 C  CA    . ILE C 3 232 ? 41.821  34.791 40.801  1.00 25.45 ? 528  ILE A CA    1 
ATOM   2385 C  C     . ILE C 3 232 ? 40.470  34.356 40.241  1.00 25.36 ? 528  ILE A C     1 
ATOM   2386 O  O     . ILE C 3 232 ? 39.498  34.227 40.984  1.00 26.03 ? 528  ILE A O     1 
ATOM   2387 C  CB    . ILE C 3 232 ? 41.943  36.326 40.752  1.00 25.07 ? 528  ILE A CB    1 
ATOM   2388 C  CG1   . ILE C 3 232 ? 43.335  36.738 41.244  1.00 25.38 ? 528  ILE A CG1   1 
ATOM   2389 C  CG2   . ILE C 3 232 ? 40.871  36.970 41.618  1.00 25.32 ? 528  ILE A CG2   1 
ATOM   2390 C  CD1   . ILE C 3 232 ? 43.694  38.177 40.958  1.00 26.33 ? 528  ILE A CD1   1 
ATOM   2391 N  N     . ASN C 3 233 ? 40.417  34.114 38.933  1.00 27.03 ? 529  ASN A N     1 
ATOM   2392 C  CA    . ASN C 3 233 ? 39.177  33.694 38.283  1.00 27.34 ? 529  ASN A CA    1 
ATOM   2393 C  C     . ASN C 3 233 ? 38.870  32.211 38.428  1.00 27.58 ? 529  ASN A C     1 
ATOM   2394 O  O     . ASN C 3 233 ? 37.947  31.691 37.799  1.00 27.50 ? 529  ASN A O     1 
ATOM   2395 C  CB    . ASN C 3 233 ? 39.193  34.073 36.801  1.00 29.82 ? 529  ASN A CB    1 
ATOM   2396 C  CG    . ASN C 3 233 ? 38.914  35.544 36.582  1.00 31.83 ? 529  ASN A CG    1 
ATOM   2397 O  OD1   . ASN C 3 233 ? 38.001  36.106 37.189  1.00 33.73 ? 529  ASN A OD1   1 
ATOM   2398 N  ND2   . ASN C 3 233 ? 39.691  36.177 35.714  1.00 31.70 ? 529  ASN A ND2   1 
ATOM   2399 N  N     . SER C 3 234 ? 39.649  31.529 39.257  1.00 26.59 ? 530  SER A N     1 
ATOM   2400 C  CA    . SER C 3 234 ? 39.424  30.116 39.504  1.00 26.98 ? 530  SER A CA    1 
ATOM   2401 C  C     . SER C 3 234 ? 38.819  29.977 40.897  1.00 28.55 ? 530  SER A C     1 
ATOM   2402 O  O     . SER C 3 234 ? 39.515  30.130 41.902  1.00 26.75 ? 530  SER A O     1 
ATOM   2403 C  CB    . SER C 3 234 ? 40.737  29.338 39.442  1.00 25.85 ? 530  SER A CB    1 
ATOM   2404 O  OG    . SER C 3 234 ? 40.537  28.013 39.899  1.00 25.61 ? 530  SER A OG    1 
ATOM   2405 N  N     . PRO C 3 235 ? 37.511  29.693 40.977  1.00 29.89 ? 531  PRO A N     1 
ATOM   2406 C  CA    . PRO C 3 235 ? 36.859  29.543 42.283  1.00 30.20 ? 531  PRO A CA    1 
ATOM   2407 C  C     . PRO C 3 235 ? 37.590  28.527 43.162  1.00 30.49 ? 531  PRO A C     1 
ATOM   2408 O  O     . PRO C 3 235 ? 37.617  28.647 44.389  1.00 29.67 ? 531  PRO A O     1 
ATOM   2409 C  CB    . PRO C 3 235 ? 35.443  29.109 41.916  1.00 30.63 ? 531  PRO A CB    1 
ATOM   2410 C  CG    . PRO C 3 235 ? 35.219  29.800 40.600  1.00 30.92 ? 531  PRO A CG    1 
ATOM   2411 C  CD    . PRO C 3 235 ? 36.530  29.572 39.882  1.00 29.90 ? 531  PRO A CD    1 
ATOM   2412 N  N     . LYS C 3 236 ? 38.192  27.532 42.518  1.00 30.02 ? 532  LYS A N     1 
ATOM   2413 C  CA    . LYS C 3 236 ? 38.919  26.490 43.226  1.00 30.30 ? 532  LYS A CA    1 
ATOM   2414 C  C     . LYS C 3 236 ? 40.205  27.034 43.840  1.00 28.43 ? 532  LYS A C     1 
ATOM   2415 O  O     . LYS C 3 236 ? 40.451  26.858 45.032  1.00 27.83 ? 532  LYS A O     1 
ATOM   2416 C  CB    . LYS C 3 236 ? 39.244  25.341 42.269  1.00 32.28 ? 532  LYS A CB    1 
ATOM   2417 C  CG    . LYS C 3 236 ? 39.829  24.118 42.950  1.00 35.55 ? 532  LYS A CG    1 
ATOM   2418 C  CD    . LYS C 3 236 ? 40.170  23.034 41.941  1.00 38.65 ? 532  LYS A CD    1 
ATOM   2419 C  CE    . LYS C 3 236 ? 40.682  21.788 42.640  1.00 41.04 ? 532  LYS A CE    1 
ATOM   2420 N  NZ    . LYS C 3 236 ? 41.839  22.101 43.526  1.00 42.82 ? 532  LYS A NZ    1 
ATOM   2421 N  N     . GLN C 3 237 ? 41.021  27.694 43.021  1.00 27.72 ? 533  GLN A N     1 
ATOM   2422 C  CA    . GLN C 3 237 ? 42.282  28.265 43.486  1.00 26.14 ? 533  GLN A CA    1 
ATOM   2423 C  C     . GLN C 3 237 ? 42.054  29.386 44.496  1.00 25.02 ? 533  GLN A C     1 
ATOM   2424 O  O     . GLN C 3 237 ? 42.774  29.500 45.492  1.00 23.36 ? 533  GLN A O     1 
ATOM   2425 C  CB    . GLN C 3 237 ? 43.086  28.810 42.306  1.00 25.97 ? 533  GLN A CB    1 
ATOM   2426 C  CG    . GLN C 3 237 ? 43.593  27.751 41.348  1.00 27.26 ? 533  GLN A CG    1 
ATOM   2427 C  CD    . GLN C 3 237 ? 44.550  28.325 40.325  1.00 26.09 ? 533  GLN A CD    1 
ATOM   2428 O  OE1   . GLN C 3 237 ? 45.467  29.067 40.672  1.00 26.00 ? 533  GLN A OE1   1 
ATOM   2429 N  NE2   . GLN C 3 237 ? 44.347  27.979 39.057  1.00 28.58 ? 533  GLN A NE2   1 
ATOM   2430 N  N     . LEU C 3 238 ? 41.054  30.218 44.227  1.00 22.92 ? 534  LEU A N     1 
ATOM   2431 C  CA    . LEU C 3 238 ? 40.726  31.319 45.118  1.00 21.50 ? 534  LEU A CA    1 
ATOM   2432 C  C     . LEU C 3 238 ? 40.285  30.754 46.467  1.00 21.75 ? 534  LEU A C     1 
ATOM   2433 O  O     . LEU C 3 238 ? 40.653  31.277 47.519  1.00 20.97 ? 534  LEU A O     1 
ATOM   2434 C  CB    . LEU C 3 238 ? 39.604  32.171 44.516  1.00 21.70 ? 534  LEU A CB    1 
ATOM   2435 C  CG    . LEU C 3 238 ? 39.079  33.302 45.406  1.00 21.56 ? 534  LEU A CG    1 
ATOM   2436 C  CD1   . LEU C 3 238 ? 40.213  34.264 45.724  1.00 21.29 ? 534  LEU A CD1   1 
ATOM   2437 C  CD2   . LEU C 3 238 ? 37.936  34.031 44.705  1.00 22.16 ? 534  LEU A CD2   1 
ATOM   2438 N  N     . GLY C 3 239 ? 39.496  29.683 46.427  1.00 22.07 ? 535  GLY A N     1 
ATOM   2439 C  CA    . GLY C 3 239 ? 39.028  29.061 47.653  1.00 23.05 ? 535  GLY A CA    1 
ATOM   2440 C  C     . GLY C 3 239 ? 40.182  28.608 48.534  1.00 23.45 ? 535  GLY A C     1 
ATOM   2441 O  O     . GLY C 3 239 ? 40.141  28.755 49.756  1.00 23.00 ? 535  GLY A O     1 
ATOM   2442 N  N     . VAL C 3 240 ? 41.219  28.052 47.919  1.00 24.08 ? 536  VAL A N     1 
ATOM   2443 C  CA    . VAL C 3 240 ? 42.380  27.602 48.679  1.00 23.83 ? 536  VAL A CA    1 
ATOM   2444 C  C     . VAL C 3 240 ? 43.024  28.791 49.387  1.00 23.90 ? 536  VAL A C     1 
ATOM   2445 O  O     . VAL C 3 240 ? 43.349  28.725 50.574  1.00 23.44 ? 536  VAL A O     1 
ATOM   2446 C  CB    . VAL C 3 240 ? 43.431  26.936 47.760  1.00 24.95 ? 536  VAL A CB    1 
ATOM   2447 C  CG1   . VAL C 3 240 ? 44.737  26.734 48.520  1.00 25.24 ? 536  VAL A CG1   1 
ATOM   2448 C  CG2   . VAL C 3 240 ? 42.903  25.598 47.261  1.00 26.68 ? 536  VAL A CG2   1 
ATOM   2449 N  N     . ILE C 3 241 ? 43.198  29.886 48.658  1.00 22.73 ? 537  ILE A N     1 
ATOM   2450 C  CA    . ILE C 3 241 ? 43.809  31.074 49.233  1.00 22.88 ? 537  ILE A CA    1 
ATOM   2451 C  C     . ILE C 3 241 ? 42.968  31.645 50.371  1.00 22.04 ? 537  ILE A C     1 
ATOM   2452 O  O     . ILE C 3 241 ? 43.473  31.903 51.460  1.00 21.97 ? 537  ILE A O     1 
ATOM   2453 C  CB    . ILE C 3 241 ? 44.007  32.176 48.160  1.00 23.10 ? 537  ILE A CB    1 
ATOM   2454 C  CG1   . ILE C 3 241 ? 45.036  31.716 47.119  1.00 23.45 ? 537  ILE A CG1   1 
ATOM   2455 C  CG2   . ILE C 3 241 ? 44.429  33.481 48.817  1.00 22.79 ? 537  ILE A CG2   1 
ATOM   2456 C  CD1   . ILE C 3 241 ? 46.419  31.403 47.689  1.00 25.14 ? 537  ILE A CD1   1 
ATOM   2457 N  N     . LEU C 3 242 ? 41.679  31.825 50.125  1.00 20.45 ? 538  LEU A N     1 
ATOM   2458 C  CA    . LEU C 3 242 ? 40.800  32.407 51.129  1.00 21.79 ? 538  LEU A CA    1 
ATOM   2459 C  C     . LEU C 3 242 ? 40.534  31.561 52.367  1.00 21.51 ? 538  LEU A C     1 
ATOM   2460 O  O     . LEU C 3 242 ? 40.714  32.023 53.496  1.00 21.29 ? 538  LEU A O     1 
ATOM   2461 C  CB    . LEU C 3 242 ? 39.451  32.775 50.498  1.00 22.27 ? 538  LEU A CB    1 
ATOM   2462 C  CG    . LEU C 3 242 ? 39.465  33.776 49.336  1.00 24.23 ? 538  LEU A CG    1 
ATOM   2463 C  CD1   . LEU C 3 242 ? 38.033  34.036 48.881  1.00 22.94 ? 538  LEU A CD1   1 
ATOM   2464 C  CD2   . LEU C 3 242 ? 40.141  35.075 49.765  1.00 22.10 ? 538  LEU A CD2   1 
ATOM   2465 N  N     . PHE C 3 243 ? 40.117  30.321 52.150  1.00 21.75 ? 539  PHE A N     1 
ATOM   2466 C  CA    . PHE C 3 243 ? 39.746  29.444 53.249  1.00 22.24 ? 539  PHE A CA    1 
ATOM   2467 C  C     . PHE C 3 243 ? 40.809  28.530 53.830  1.00 23.02 ? 539  PHE A C     1 
ATOM   2468 O  O     . PHE C 3 243 ? 40.598  27.920 54.880  1.00 22.27 ? 539  PHE A O     1 
ATOM   2469 C  CB    . PHE C 3 243 ? 38.523  28.648 52.818  1.00 22.20 ? 539  PHE A CB    1 
ATOM   2470 C  CG    . PHE C 3 243 ? 37.429  29.517 52.272  1.00 23.82 ? 539  PHE A CG    1 
ATOM   2471 C  CD1   . PHE C 3 243 ? 36.861  30.510 53.065  1.00 23.10 ? 539  PHE A CD1   1 
ATOM   2472 C  CD2   . PHE C 3 243 ? 37.012  29.392 50.954  1.00 23.00 ? 539  PHE A CD2   1 
ATOM   2473 C  CE1   . PHE C 3 243 ? 35.891  31.370 52.548  1.00 23.90 ? 539  PHE A CE1   1 
ATOM   2474 C  CE2   . PHE C 3 243 ? 36.045  30.244 50.427  1.00 22.68 ? 539  PHE A CE2   1 
ATOM   2475 C  CZ    . PHE C 3 243 ? 35.484  31.236 51.227  1.00 23.87 ? 539  PHE A CZ    1 
ATOM   2476 N  N     . GLU C 3 244 ? 41.950  28.434 53.160  1.00 22.51 ? 540  GLU A N     1 
ATOM   2477 C  CA    . GLU C 3 244 ? 43.024  27.601 53.667  1.00 22.99 ? 540  GLU A CA    1 
ATOM   2478 C  C     . GLU C 3 244 ? 44.215  28.462 54.059  1.00 23.74 ? 540  GLU A C     1 
ATOM   2479 O  O     . GLU C 3 244 ? 44.593  28.497 55.233  1.00 24.39 ? 540  GLU A O     1 
ATOM   2480 C  CB    . GLU C 3 244 ? 43.409  26.540 52.630  1.00 24.40 ? 540  GLU A CB    1 
ATOM   2481 C  CG    . GLU C 3 244 ? 42.352  25.448 52.507  1.00 26.20 ? 540  GLU A CG    1 
ATOM   2482 C  CD    . GLU C 3 244 ? 42.690  24.381 51.482  1.00 27.46 ? 540  GLU A CD    1 
ATOM   2483 O  OE1   . GLU C 3 244 ? 43.876  24.014 51.365  1.00 28.10 ? 540  GLU A OE1   1 
ATOM   2484 O  OE2   . GLU C 3 244 ? 41.758  23.897 50.805  1.00 30.59 ? 540  GLU A OE2   1 
ATOM   2485 N  N     . LYS C 3 245 ? 44.792  29.184 53.102  1.00 21.05 ? 541  LYS A N     1 
ATOM   2486 C  CA    . LYS C 3 245 ? 45.943  30.018 53.428  1.00 21.83 ? 541  LYS A CA    1 
ATOM   2487 C  C     . LYS C 3 245 ? 45.599  31.168 54.372  1.00 20.96 ? 541  LYS A C     1 
ATOM   2488 O  O     . LYS C 3 245 ? 46.311  31.402 55.348  1.00 20.45 ? 541  LYS A O     1 
ATOM   2489 C  CB    . LYS C 3 245 ? 46.593  30.589 52.164  1.00 22.42 ? 541  LYS A CB    1 
ATOM   2490 C  CG    . LYS C 3 245 ? 47.834  31.415 52.472  1.00 24.88 ? 541  LYS A CG    1 
ATOM   2491 C  CD    . LYS C 3 245 ? 48.592  31.840 51.225  1.00 28.81 ? 541  LYS A CD    1 
ATOM   2492 C  CE    . LYS C 3 245 ? 49.862  32.601 51.608  1.00 29.45 ? 541  LYS A CE    1 
ATOM   2493 N  NZ    . LYS C 3 245 ? 50.677  32.975 50.420  1.00 34.21 ? 541  LYS A NZ    1 
ATOM   2494 N  N     . LEU C 3 246 ? 44.508  31.876 54.093  1.00 18.60 ? 542  LEU A N     1 
ATOM   2495 C  CA    . LEU C 3 246 ? 44.125  33.011 54.925  1.00 17.60 ? 542  LEU A CA    1 
ATOM   2496 C  C     . LEU C 3 246 ? 43.164  32.665 56.061  1.00 17.75 ? 542  LEU A C     1 
ATOM   2497 O  O     . LEU C 3 246 ? 42.805  33.530 56.864  1.00 16.52 ? 542  LEU A O     1 
ATOM   2498 C  CB    . LEU C 3 246 ? 43.543  34.130 54.052  1.00 18.89 ? 542  LEU A CB    1 
ATOM   2499 C  CG    . LEU C 3 246 ? 44.513  34.692 53.003  1.00 20.01 ? 542  LEU A CG    1 
ATOM   2500 C  CD1   . LEU C 3 246 ? 43.825  35.788 52.202  1.00 18.70 ? 542  LEU A CD1   1 
ATOM   2501 C  CD2   . LEU C 3 246 ? 45.757  35.250 53.686  1.00 18.44 ? 542  LEU A CD2   1 
ATOM   2502 N  N     . GLN C 3 247 ? 42.746  31.405 56.123  1.00 17.34 ? 543  GLN A N     1 
ATOM   2503 C  CA    . GLN C 3 247 ? 41.874  30.943 57.196  1.00 18.35 ? 543  GLN A CA    1 
ATOM   2504 C  C     . GLN C 3 247 ? 40.552  31.682 57.361  1.00 20.26 ? 543  GLN A C     1 
ATOM   2505 O  O     . GLN C 3 247 ? 40.031  31.766 58.473  1.00 21.14 ? 543  GLN A O     1 
ATOM   2506 C  CB    . GLN C 3 247 ? 42.634  30.999 58.526  1.00 19.84 ? 543  GLN A CB    1 
ATOM   2507 C  CG    . GLN C 3 247 ? 43.767  29.992 58.635  1.00 22.62 ? 543  GLN A CG    1 
ATOM   2508 C  CD    . GLN C 3 247 ? 43.253  28.574 58.709  1.00 22.67 ? 543  GLN A CD    1 
ATOM   2509 O  OE1   . GLN C 3 247 ? 42.561  28.207 59.655  1.00 25.08 ? 543  GLN A OE1   1 
ATOM   2510 N  NE2   . GLN C 3 247 ? 43.580  27.768 57.706  1.00 24.89 ? 543  GLN A NE2   1 
ATOM   2511 N  N     . LEU C 3 248 ? 39.994  32.215 56.281  1.00 19.36 ? 544  LEU A N     1 
ATOM   2512 C  CA    . LEU C 3 248 ? 38.722  32.908 56.419  1.00 18.26 ? 544  LEU A CA    1 
ATOM   2513 C  C     . LEU C 3 248 ? 37.636  31.883 56.737  1.00 19.69 ? 544  LEU A C     1 
ATOM   2514 O  O     . LEU C 3 248 ? 37.742  30.715 56.367  1.00 19.75 ? 544  LEU A O     1 
ATOM   2515 C  CB    . LEU C 3 248 ? 38.382  33.676 55.139  1.00 17.40 ? 544  LEU A CB    1 
ATOM   2516 C  CG    . LEU C 3 248 ? 39.417  34.726 54.716  1.00 19.17 ? 544  LEU A CG    1 
ATOM   2517 C  CD1   . LEU C 3 248 ? 38.868  35.548 53.551  1.00 18.39 ? 544  LEU A CD1   1 
ATOM   2518 C  CD2   . LEU C 3 248 ? 39.748  35.634 55.891  1.00 18.58 ? 544  LEU A CD2   1 
ATOM   2519 N  N     . PRO C 3 249 ? 36.577  32.309 57.437  1.00 21.22 ? 545  PRO A N     1 
ATOM   2520 C  CA    . PRO C 3 249 ? 35.480  31.406 57.798  1.00 23.35 ? 545  PRO A CA    1 
ATOM   2521 C  C     . PRO C 3 249 ? 34.756  30.845 56.575  1.00 24.68 ? 545  PRO A C     1 
ATOM   2522 O  O     . PRO C 3 249 ? 34.527  31.558 55.598  1.00 23.82 ? 545  PRO A O     1 
ATOM   2523 C  CB    . PRO C 3 249 ? 34.568  32.278 58.660  1.00 22.73 ? 545  PRO A CB    1 
ATOM   2524 C  CG    . PRO C 3 249 ? 35.474  33.365 59.163  1.00 25.04 ? 545  PRO A CG    1 
ATOM   2525 C  CD    . PRO C 3 249 ? 36.340  33.658 57.975  1.00 21.34 ? 545  PRO A CD    1 
ATOM   2526 N  N     . VAL C 3 250 ? 34.408  29.566 56.636  1.00 25.61 ? 546  VAL A N     1 
ATOM   2527 C  CA    . VAL C 3 250 ? 33.673  28.920 55.557  1.00 28.88 ? 546  VAL A CA    1 
ATOM   2528 C  C     . VAL C 3 250 ? 32.206  28.993 55.965  1.00 31.01 ? 546  VAL A C     1 
ATOM   2529 O  O     . VAL C 3 250 ? 31.738  28.203 56.784  1.00 32.10 ? 546  VAL A O     1 
ATOM   2530 C  CB    . VAL C 3 250 ? 34.088  27.442 55.393  1.00 28.21 ? 546  VAL A CB    1 
ATOM   2531 C  CG1   . VAL C 3 250 ? 33.200  26.762 54.363  1.00 28.97 ? 546  VAL A CG1   1 
ATOM   2532 C  CG2   . VAL C 3 250 ? 35.543  27.359 54.962  1.00 27.79 ? 546  VAL A CG2   1 
ATOM   2533 N  N     . LEU C 3 251 ? 31.487  29.953 55.395  1.00 33.02 ? 547  LEU A N     1 
ATOM   2534 C  CA    . LEU C 3 251 ? 30.080  30.149 55.717  1.00 36.57 ? 547  LEU A CA    1 
ATOM   2535 C  C     . LEU C 3 251 ? 29.174  29.480 54.696  1.00 38.73 ? 547  LEU A C     1 
ATOM   2536 O  O     . LEU C 3 251 ? 27.974  29.329 54.924  1.00 38.58 ? 547  LEU A O     1 
ATOM   2537 C  CB    . LEU C 3 251 ? 29.764  31.645 55.774  1.00 36.79 ? 547  LEU A CB    1 
ATOM   2538 C  CG    . LEU C 3 251 ? 30.626  32.483 56.720  1.00 38.58 ? 547  LEU A CG    1 
ATOM   2539 C  CD1   . LEU C 3 251 ? 30.276  33.953 56.559  1.00 39.57 ? 547  LEU A CD1   1 
ATOM   2540 C  CD2   . LEU C 3 251 ? 30.411  32.028 58.156  1.00 38.88 ? 547  LEU A CD2   1 
ATOM   2541 N  N     . LYS C 3 252 ? 29.752  29.079 53.571  1.00 41.57 ? 548  LYS A N     1 
ATOM   2542 C  CA    . LYS C 3 252 ? 28.987  28.435 52.513  1.00 44.91 ? 548  LYS A CA    1 
ATOM   2543 C  C     . LYS C 3 252 ? 29.890  27.632 51.587  1.00 46.48 ? 548  LYS A C     1 
ATOM   2544 O  O     . LYS C 3 252 ? 30.982  28.069 51.228  1.00 45.77 ? 548  LYS A O     1 
ATOM   2545 C  CB    . LYS C 3 252 ? 28.225  29.488 51.706  1.00 45.74 ? 548  LYS A CB    1 
ATOM   2546 C  CG    . LYS C 3 252 ? 27.360  28.919 50.594  1.00 48.49 ? 548  LYS A CG    1 
ATOM   2547 C  CD    . LYS C 3 252 ? 26.637  30.024 49.837  1.00 50.83 ? 548  LYS A CD    1 
ATOM   2548 C  CE    . LYS C 3 252 ? 25.708  30.809 50.750  1.00 51.88 ? 548  LYS A CE    1 
ATOM   2549 N  NZ    . LYS C 3 252 ? 24.996  31.891 50.013  1.00 53.48 ? 548  LYS A NZ    1 
ATOM   2550 N  N     . LYS C 3 253 ? 29.423  26.452 51.201  1.00 48.89 ? 549  LYS A N     1 
ATOM   2551 C  CA    . LYS C 3 253 ? 30.186  25.585 50.318  1.00 51.57 ? 549  LYS A CA    1 
ATOM   2552 C  C     . LYS C 3 253 ? 29.321  25.103 49.162  1.00 52.39 ? 549  LYS A C     1 
ATOM   2553 O  O     . LYS C 3 253 ? 28.161  24.738 49.351  1.00 53.49 ? 549  LYS A O     1 
ATOM   2554 C  CB    . LYS C 3 253 ? 30.732  24.391 51.106  1.00 53.08 ? 549  LYS A CB    1 
ATOM   2555 C  CG    . LYS C 3 253 ? 29.683  23.667 51.937  1.00 55.23 ? 549  LYS A CG    1 
ATOM   2556 C  CD    . LYS C 3 253 ? 30.316  22.620 52.843  1.00 56.25 ? 549  LYS A CD    1 
ATOM   2557 C  CE    . LYS C 3 253 ? 29.268  21.930 53.704  1.00 56.74 ? 549  LYS A CE    1 
ATOM   2558 N  NZ    . LYS C 3 253 ? 28.514  22.903 54.545  1.00 57.65 ? 549  LYS A NZ    1 
ATOM   2559 N  N     . THR C 3 254 ? 29.889  25.114 47.962  1.00 52.75 ? 550  THR A N     1 
ATOM   2560 C  CA    . THR C 3 254 ? 29.169  24.668 46.778  1.00 53.05 ? 550  THR A CA    1 
ATOM   2561 C  C     . THR C 3 254 ? 29.116  23.147 46.787  1.00 53.44 ? 550  THR A C     1 
ATOM   2562 O  O     . THR C 3 254 ? 29.623  22.507 47.708  1.00 53.57 ? 550  THR A O     1 
ATOM   2563 C  CB    . THR C 3 254 ? 29.873  25.132 45.491  1.00 52.97 ? 550  THR A CB    1 
ATOM   2564 O  OG1   . THR C 3 254 ? 31.192  24.573 45.440  1.00 52.51 ? 550  THR A OG1   1 
ATOM   2565 C  CG2   . THR C 3 254 ? 29.966  26.652 45.455  1.00 52.17 ? 550  THR A CG2   1 
ATOM   2566 N  N     . LYS C 3 255 ? 28.504  22.571 45.760  1.00 53.90 ? 551  LYS A N     1 
ATOM   2567 C  CA    . LYS C 3 255 ? 28.391  21.123 45.664  1.00 54.01 ? 551  LYS A CA    1 
ATOM   2568 C  C     . LYS C 3 255 ? 29.762  20.468 45.527  1.00 53.15 ? 551  LYS A C     1 
ATOM   2569 O  O     . LYS C 3 255 ? 29.945  19.317 45.921  1.00 53.47 ? 551  LYS A O     1 
ATOM   2570 C  CB    . LYS C 3 255 ? 27.525  20.738 44.461  1.00 56.00 ? 551  LYS A CB    1 
ATOM   2571 C  CG    . LYS C 3 255 ? 26.102  21.279 44.505  1.00 57.94 ? 551  LYS A CG    1 
ATOM   2572 C  CD    . LYS C 3 255 ? 25.340  20.923 43.233  1.00 59.64 ? 551  LYS A CD    1 
ATOM   2573 C  CE    . LYS C 3 255 ? 26.011  21.523 42.001  1.00 61.00 ? 551  LYS A CE    1 
ATOM   2574 N  NZ    . LYS C 3 255 ? 25.313  21.173 40.732  1.00 61.91 ? 551  LYS A NZ    1 
ATOM   2575 N  N     . THR C 3 256 ? 30.726  21.203 44.980  1.00 51.52 ? 552  THR A N     1 
ATOM   2576 C  CA    . THR C 3 256 ? 32.062  20.652 44.781  1.00 50.06 ? 552  THR A CA    1 
ATOM   2577 C  C     . THR C 3 256 ? 33.196  21.351 45.529  1.00 48.84 ? 552  THR A C     1 
ATOM   2578 O  O     . THR C 3 256 ? 34.366  21.026 45.320  1.00 48.82 ? 552  THR A O     1 
ATOM   2579 C  CB    . THR C 3 256 ? 32.427  20.628 43.282  1.00 50.42 ? 552  THR A CB    1 
ATOM   2580 O  OG1   . THR C 3 256 ? 33.684  19.962 43.107  1.00 51.50 ? 552  THR A OG1   1 
ATOM   2581 C  CG2   . THR C 3 256 ? 32.529  22.045 42.734  1.00 49.46 ? 552  THR A CG2   1 
ATOM   2582 N  N     . GLY C 3 257 ? 32.870  22.306 46.395  1.00 47.31 ? 553  GLY A N     1 
ATOM   2583 C  CA    . GLY C 3 257 ? 33.925  22.987 47.127  1.00 44.58 ? 553  GLY A CA    1 
ATOM   2584 C  C     . GLY C 3 257 ? 33.497  24.208 47.916  1.00 42.65 ? 553  GLY A C     1 
ATOM   2585 O  O     . GLY C 3 257 ? 32.357  24.301 48.371  1.00 42.67 ? 553  GLY A O     1 
ATOM   2586 N  N     . TYR C 3 258 ? 34.424  25.148 48.081  1.00 39.40 ? 554  TYR A N     1 
ATOM   2587 C  CA    . TYR C 3 258 ? 34.146  26.376 48.818  1.00 36.68 ? 554  TYR A CA    1 
ATOM   2588 C  C     . TYR C 3 258 ? 33.378  27.355 47.938  1.00 34.73 ? 554  TYR A C     1 
ATOM   2589 O  O     . TYR C 3 258 ? 33.651  27.475 46.743  1.00 32.70 ? 554  TYR A O     1 
ATOM   2590 C  CB    . TYR C 3 258 ? 35.443  27.060 49.254  1.00 36.78 ? 554  TYR A CB    1 
ATOM   2591 C  CG    . TYR C 3 258 ? 36.422  26.208 50.030  1.00 37.44 ? 554  TYR A CG    1 
ATOM   2592 C  CD1   . TYR C 3 258 ? 36.081  25.652 51.264  1.00 36.87 ? 554  TYR A CD1   1 
ATOM   2593 C  CD2   . TYR C 3 258 ? 37.707  25.981 49.537  1.00 36.98 ? 554  TYR A CD2   1 
ATOM   2594 C  CE1   . TYR C 3 258 ? 37.005  24.890 51.989  1.00 38.06 ? 554  TYR A CE1   1 
ATOM   2595 C  CE2   . TYR C 3 258 ? 38.633  25.229 50.249  1.00 37.63 ? 554  TYR A CE2   1 
ATOM   2596 C  CZ    . TYR C 3 258 ? 38.279  24.687 51.471  1.00 37.19 ? 554  TYR A CZ    1 
ATOM   2597 O  OH    . TYR C 3 258 ? 39.207  23.946 52.167  1.00 39.23 ? 554  TYR A OH    1 
ATOM   2598 N  N     . SER C 3 259 ? 32.421  28.058 48.530  1.00 32.05 ? 555  SER A N     1 
ATOM   2599 C  CA    . SER C 3 259 ? 31.658  29.049 47.784  1.00 31.16 ? 555  SER A CA    1 
ATOM   2600 C  C     . SER C 3 259 ? 32.417  30.371 47.840  1.00 28.94 ? 555  SER A C     1 
ATOM   2601 O  O     . SER C 3 259 ? 32.908  30.762 48.898  1.00 26.03 ? 555  SER A O     1 
ATOM   2602 C  CB    . SER C 3 259 ? 30.271  29.233 48.399  1.00 32.66 ? 555  SER A CB    1 
ATOM   2603 O  OG    . SER C 3 259 ? 29.624  30.367 47.845  1.00 35.34 ? 555  SER A OG    1 
ATOM   2604 N  N     . THR C 3 260 ? 32.526  31.052 46.703  1.00 25.89 ? 556  THR A N     1 
ATOM   2605 C  CA    . THR C 3 260 ? 33.212  32.338 46.664  1.00 24.59 ? 556  THR A CA    1 
ATOM   2606 C  C     . THR C 3 260 ? 32.308  33.371 46.003  1.00 25.34 ? 556  THR A C     1 
ATOM   2607 O  O     . THR C 3 260 ? 32.784  34.344 45.410  1.00 23.90 ? 556  THR A O     1 
ATOM   2608 C  CB    . THR C 3 260 ? 34.550  32.260 45.891  1.00 23.65 ? 556  THR A CB    1 
ATOM   2609 O  OG1   . THR C 3 260 ? 34.297  32.021 44.502  1.00 22.19 ? 556  THR A OG1   1 
ATOM   2610 C  CG2   . THR C 3 260 ? 35.428  31.141 46.454  1.00 20.14 ? 556  THR A CG2   1 
ATOM   2611 N  N     . SER C 3 261 ? 31.000  33.146 46.111  1.00 24.95 ? 557  SER A N     1 
ATOM   2612 C  CA    . SER C 3 261 ? 30.006  34.050 45.543  1.00 26.50 ? 557  SER A CA    1 
ATOM   2613 C  C     . SER C 3 261 ? 30.155  35.422 46.183  1.00 25.08 ? 557  SER A C     1 
ATOM   2614 O  O     . SER C 3 261 ? 30.683  35.541 47.285  1.00 23.66 ? 557  SER A O     1 
ATOM   2615 C  CB    . SER C 3 261 ? 28.592  33.524 45.811  1.00 27.65 ? 557  SER A CB    1 
ATOM   2616 O  OG    . SER C 3 261 ? 28.429  32.214 45.303  1.00 36.97 ? 557  SER A OG    1 
ATOM   2617 N  N     . ALA C 3 262 ? 29.673  36.456 45.499  1.00 24.59 ? 558  ALA A N     1 
ATOM   2618 C  CA    . ALA C 3 262 ? 29.767  37.812 46.021  1.00 25.11 ? 558  ALA A CA    1 
ATOM   2619 C  C     . ALA C 3 262 ? 29.035  37.957 47.357  1.00 25.75 ? 558  ALA A C     1 
ATOM   2620 O  O     . ALA C 3 262 ? 29.493  38.676 48.246  1.00 24.00 ? 558  ALA A O     1 
ATOM   2621 C  CB    . ALA C 3 262 ? 29.203  38.808 45.004  1.00 25.98 ? 558  ALA A CB    1 
ATOM   2622 N  N     . ASP C 3 263 ? 27.902  37.276 47.500  1.00 26.44 ? 559  ASP A N     1 
ATOM   2623 C  CA    . ASP C 3 263 ? 27.141  37.366 48.739  1.00 29.08 ? 559  ASP A CA    1 
ATOM   2624 C  C     . ASP C 3 263 ? 27.941  36.771 49.894  1.00 28.74 ? 559  ASP A C     1 
ATOM   2625 O  O     . ASP C 3 263 ? 27.821  37.215 51.036  1.00 28.65 ? 559  ASP A O     1 
ATOM   2626 C  CB    . ASP C 3 263 ? 25.788  36.658 48.594  1.00 32.72 ? 559  ASP A CB    1 
ATOM   2627 C  CG    . ASP C 3 263 ? 25.927  35.174 48.347  1.00 37.15 ? 559  ASP A CG    1 
ATOM   2628 O  OD1   . ASP C 3 263 ? 26.710  34.790 47.455  1.00 39.07 ? 559  ASP A OD1   1 
ATOM   2629 O  OD2   . ASP C 3 263 ? 25.250  34.388 49.043  1.00 40.07 ? 559  ASP A OD2   1 
ATOM   2630 N  N     . VAL C 3 264 ? 28.766  35.772 49.593  1.00 27.64 ? 560  VAL A N     1 
ATOM   2631 C  CA    . VAL C 3 264 ? 29.597  35.145 50.614  1.00 28.61 ? 560  VAL A CA    1 
ATOM   2632 C  C     . VAL C 3 264 ? 30.766  36.069 50.935  1.00 27.42 ? 560  VAL A C     1 
ATOM   2633 O  O     . VAL C 3 264 ? 31.087  36.304 52.101  1.00 27.57 ? 560  VAL A O     1 
ATOM   2634 C  CB    . VAL C 3 264 ? 30.152  33.783 50.134  1.00 29.39 ? 560  VAL A CB    1 
ATOM   2635 C  CG1   . VAL C 3 264 ? 31.166  33.245 51.140  1.00 29.36 ? 560  VAL A CG1   1 
ATOM   2636 C  CG2   . VAL C 3 264 ? 29.010  32.792 49.961  1.00 30.35 ? 560  VAL A CG2   1 
ATOM   2637 N  N     . LEU C 3 265 ? 31.397  36.598 49.891  1.00 26.51 ? 561  LEU A N     1 
ATOM   2638 C  CA    . LEU C 3 265 ? 32.534  37.495 50.062  1.00 26.06 ? 561  LEU A CA    1 
ATOM   2639 C  C     . LEU C 3 265 ? 32.163  38.732 50.870  1.00 27.07 ? 561  LEU A C     1 
ATOM   2640 O  O     . LEU C 3 265 ? 32.941  39.199 51.703  1.00 25.16 ? 561  LEU A O     1 
ATOM   2641 C  CB    . LEU C 3 265 ? 33.072  37.925 48.699  1.00 26.40 ? 561  LEU A CB    1 
ATOM   2642 C  CG    . LEU C 3 265 ? 33.646  36.801 47.834  1.00 27.32 ? 561  LEU A CG    1 
ATOM   2643 C  CD1   . LEU C 3 265 ? 34.044  37.352 46.474  1.00 29.07 ? 561  LEU A CD1   1 
ATOM   2644 C  CD2   . LEU C 3 265 ? 34.843  36.181 48.535  1.00 27.12 ? 561  LEU A CD2   1 
ATOM   2645 N  N     . GLU C 3 266 ? 30.970  39.257 50.614  1.00 27.96 ? 562  GLU A N     1 
ATOM   2646 C  CA    . GLU C 3 266 ? 30.484  40.447 51.299  1.00 30.53 ? 562  GLU A CA    1 
ATOM   2647 C  C     . GLU C 3 266 ? 30.520  40.257 52.815  1.00 29.64 ? 562  GLU A C     1 
ATOM   2648 O  O     . GLU C 3 266 ? 30.756  41.203 53.565  1.00 29.36 ? 562  GLU A O     1 
ATOM   2649 C  CB    . GLU C 3 266 ? 29.053  40.755 50.849  1.00 33.65 ? 562  GLU A CB    1 
ATOM   2650 C  CG    . GLU C 3 266 ? 28.678  42.223 50.933  1.00 40.58 ? 562  GLU A CG    1 
ATOM   2651 C  CD    . GLU C 3 266 ? 29.450  43.076 49.938  1.00 44.47 ? 562  GLU A CD    1 
ATOM   2652 O  OE1   . GLU C 3 266 ? 29.307  42.841 48.718  1.00 47.52 ? 562  GLU A OE1   1 
ATOM   2653 O  OE2   . GLU C 3 266 ? 30.198  43.980 50.375  1.00 46.00 ? 562  GLU A OE2   1 
ATOM   2654 N  N     . LYS C 3 267 ? 30.291  39.027 53.259  1.00 29.23 ? 563  LYS A N     1 
ATOM   2655 C  CA    . LYS C 3 267 ? 30.298  38.724 54.683  1.00 29.29 ? 563  LYS A CA    1 
ATOM   2656 C  C     . LYS C 3 267 ? 31.711  38.553 55.239  1.00 28.66 ? 563  LYS A C     1 
ATOM   2657 O  O     . LYS C 3 267 ? 31.951  38.790 56.423  1.00 29.35 ? 563  LYS A O     1 
ATOM   2658 C  CB    . LYS C 3 267 ? 29.473  37.462 54.949  1.00 29.97 ? 563  LYS A CB    1 
ATOM   2659 C  CG    . LYS C 3 267 ? 27.985  37.620 54.655  1.00 33.41 ? 563  LYS A CG    1 
ATOM   2660 C  CD    . LYS C 3 267 ? 27.225  36.333 54.950  1.00 34.64 ? 563  LYS A CD    1 
ATOM   2661 C  CE    . LYS C 3 267 ? 25.714  36.515 54.828  1.00 36.59 ? 563  LYS A CE    1 
ATOM   2662 N  NZ    . LYS C 3 267 ? 25.278  36.872 53.451  1.00 36.61 ? 563  LYS A NZ    1 
ATOM   2663 N  N     . LEU C 3 268 ? 32.645  38.157 54.380  1.00 25.94 ? 564  LEU A N     1 
ATOM   2664 C  CA    . LEU C 3 268 ? 34.031  37.944 54.786  1.00 23.60 ? 564  LEU A CA    1 
ATOM   2665 C  C     . LEU C 3 268 ? 34.877  39.216 54.732  1.00 23.82 ? 564  LEU A C     1 
ATOM   2666 O  O     . LEU C 3 268 ? 35.969  39.270 55.297  1.00 22.46 ? 564  LEU A O     1 
ATOM   2667 C  CB    . LEU C 3 268 ? 34.671  36.882 53.889  1.00 23.77 ? 564  LEU A CB    1 
ATOM   2668 C  CG    . LEU C 3 268 ? 33.951  35.534 53.801  1.00 23.49 ? 564  LEU A CG    1 
ATOM   2669 C  CD1   . LEU C 3 268 ? 34.660  34.643 52.790  1.00 23.09 ? 564  LEU A CD1   1 
ATOM   2670 C  CD2   . LEU C 3 268 ? 33.921  34.878 55.177  1.00 23.12 ? 564  LEU A CD2   1 
ATOM   2671 N  N     . ALA C 3 269 ? 34.367  40.232 54.046  1.00 24.28 ? 565  ALA A N     1 
ATOM   2672 C  CA    . ALA C 3 269 ? 35.073  41.499 53.894  1.00 24.15 ? 565  ALA A CA    1 
ATOM   2673 C  C     . ALA C 3 269 ? 35.708  42.036 55.179  1.00 24.88 ? 565  ALA A C     1 
ATOM   2674 O  O     . ALA C 3 269 ? 36.861  42.455 55.175  1.00 22.02 ? 565  ALA A O     1 
ATOM   2675 C  CB    . ALA C 3 269 ? 34.125  42.551 53.301  1.00 25.83 ? 565  ALA A CB    1 
ATOM   2676 N  N     . PRO C 3 270 ? 34.965  42.028 56.296  1.00 26.30 ? 566  PRO A N     1 
ATOM   2677 C  CA    . PRO C 3 270 ? 35.515  42.537 57.559  1.00 26.25 ? 566  PRO A CA    1 
ATOM   2678 C  C     . PRO C 3 270 ? 36.780  41.838 58.061  1.00 26.18 ? 566  PRO A C     1 
ATOM   2679 O  O     . PRO C 3 270 ? 37.559  42.423 58.818  1.00 23.67 ? 566  PRO A O     1 
ATOM   2680 C  CB    . PRO C 3 270 ? 34.347  42.394 58.533  1.00 28.85 ? 566  PRO A CB    1 
ATOM   2681 C  CG    . PRO C 3 270 ? 33.135  42.486 57.640  1.00 28.09 ? 566  PRO A CG    1 
ATOM   2682 C  CD    . PRO C 3 270 ? 33.549  41.652 56.456  1.00 26.64 ? 566  PRO A CD    1 
ATOM   2683 N  N     . TYR C 3 271 ? 36.989  40.597 57.624  1.00 24.82 ? 567  TYR A N     1 
ATOM   2684 C  CA    . TYR C 3 271 ? 38.132  39.799 58.069  1.00 23.96 ? 567  TYR A CA    1 
ATOM   2685 C  C     . TYR C 3 271 ? 39.466  40.034 57.384  1.00 23.36 ? 567  TYR A C     1 
ATOM   2686 O  O     . TYR C 3 271 ? 40.517  39.889 58.007  1.00 21.59 ? 567  TYR A O     1 
ATOM   2687 C  CB    . TYR C 3 271 ? 37.793  38.311 57.960  1.00 25.17 ? 567  TYR A CB    1 
ATOM   2688 C  CG    . TYR C 3 271 ? 36.696  37.873 58.895  1.00 27.41 ? 567  TYR A CG    1 
ATOM   2689 C  CD1   . TYR C 3 271 ? 36.920  37.787 60.269  1.00 26.46 ? 567  TYR A CD1   1 
ATOM   2690 C  CD2   . TYR C 3 271 ? 35.425  37.570 58.412  1.00 27.69 ? 567  TYR A CD2   1 
ATOM   2691 C  CE1   . TYR C 3 271 ? 35.906  37.412 61.138  1.00 28.03 ? 567  TYR A CE1   1 
ATOM   2692 C  CE2   . TYR C 3 271 ? 34.404  37.193 59.272  1.00 30.53 ? 567  TYR A CE2   1 
ATOM   2693 C  CZ    . TYR C 3 271 ? 34.651  37.116 60.634  1.00 28.76 ? 567  TYR A CZ    1 
ATOM   2694 O  OH    . TYR C 3 271 ? 33.642  36.746 61.488  1.00 30.21 ? 567  TYR A OH    1 
ATOM   2695 N  N     . HIS C 3 272 ? 39.439  40.390 56.106  1.00 23.33 ? 568  HIS A N     1 
ATOM   2696 C  CA    . HIS C 3 272 ? 40.689  40.589 55.390  1.00 22.17 ? 568  HIS A CA    1 
ATOM   2697 C  C     . HIS C 3 272 ? 40.517  41.550 54.220  1.00 22.79 ? 568  HIS A C     1 
ATOM   2698 O  O     . HIS C 3 272 ? 39.501  41.520 53.520  1.00 20.77 ? 568  HIS A O     1 
ATOM   2699 C  CB    . HIS C 3 272 ? 41.204  39.231 54.899  1.00 21.69 ? 568  HIS A CB    1 
ATOM   2700 C  CG    . HIS C 3 272 ? 42.672  39.205 54.608  1.00 23.50 ? 568  HIS A CG    1 
ATOM   2701 N  ND1   . HIS C 3 272 ? 43.236  39.889 53.553  1.00 22.28 ? 568  HIS A ND1   1 
ATOM   2702 C  CD2   . HIS C 3 272 ? 43.694  38.589 55.248  1.00 24.04 ? 568  HIS A CD2   1 
ATOM   2703 C  CE1   . HIS C 3 272 ? 44.543  39.696 53.556  1.00 23.13 ? 568  HIS A CE1   1 
ATOM   2704 N  NE2   . HIS C 3 272 ? 44.847  38.911 54.574  1.00 24.55 ? 568  HIS A NE2   1 
ATOM   2705 N  N     . GLU C 3 273 ? 41.526  42.393 54.028  1.00 22.54 ? 569  GLU A N     1 
ATOM   2706 C  CA    . GLU C 3 273 ? 41.548  43.398 52.972  1.00 23.28 ? 569  GLU A CA    1 
ATOM   2707 C  C     . GLU C 3 273 ? 41.521  42.803 51.565  1.00 23.54 ? 569  GLU A C     1 
ATOM   2708 O  O     . GLU C 3 273 ? 41.123  43.472 50.614  1.00 25.51 ? 569  GLU A O     1 
ATOM   2709 C  CB    . GLU C 3 273 ? 42.797  44.276 53.136  1.00 25.08 ? 569  GLU A CB    1 
ATOM   2710 C  CG    . GLU C 3 273 ? 42.935  45.401 52.116  1.00 28.30 ? 569  GLU A CG    1 
ATOM   2711 C  CD    . GLU C 3 273 ? 44.142  46.287 52.384  1.00 30.03 ? 569  GLU A CD    1 
ATOM   2712 O  OE1   . GLU C 3 273 ? 44.411  47.194 51.569  1.00 29.11 ? 569  GLU A OE1   1 
ATOM   2713 O  OE2   . GLU C 3 273 ? 44.819  46.078 53.414  1.00 31.00 ? 569  GLU A OE2   1 
ATOM   2714 N  N     . ILE C 3 274 ? 41.943  41.551 51.423  1.00 21.92 ? 570  ILE A N     1 
ATOM   2715 C  CA    . ILE C 3 274 ? 41.953  40.929 50.105  1.00 19.91 ? 570  ILE A CA    1 
ATOM   2716 C  C     . ILE C 3 274 ? 40.540  40.792 49.541  1.00 20.31 ? 570  ILE A C     1 
ATOM   2717 O  O     . ILE C 3 274 ? 40.338  40.898 48.336  1.00 19.98 ? 570  ILE A O     1 
ATOM   2718 C  CB    . ILE C 3 274 ? 42.613  39.525 50.142  1.00 20.50 ? 570  ILE A CB    1 
ATOM   2719 C  CG1   . ILE C 3 274 ? 42.916  39.051 48.717  1.00 21.48 ? 570  ILE A CG1   1 
ATOM   2720 C  CG2   . ILE C 3 274 ? 41.693  38.528 50.824  1.00 20.57 ? 570  ILE A CG2   1 
ATOM   2721 C  CD1   . ILE C 3 274 ? 43.591  37.690 48.647  1.00 21.57 ? 570  ILE A CD1   1 
ATOM   2722 N  N     . VAL C 3 275 ? 39.562  40.577 50.415  1.00 19.33 ? 571  VAL A N     1 
ATOM   2723 C  CA    . VAL C 3 275 ? 38.185  40.393 49.976  1.00 19.65 ? 571  VAL A CA    1 
ATOM   2724 C  C     . VAL C 3 275 ? 37.607  41.545 49.156  1.00 21.44 ? 571  VAL A C     1 
ATOM   2725 O  O     . VAL C 3 275 ? 37.053  41.317 48.079  1.00 19.21 ? 571  VAL A O     1 
ATOM   2726 C  CB    . VAL C 3 275 ? 37.249  40.110 51.169  1.00 20.56 ? 571  VAL A CB    1 
ATOM   2727 C  CG1   . VAL C 3 275 ? 35.841  39.824 50.661  1.00 18.92 ? 571  VAL A CG1   1 
ATOM   2728 C  CG2   . VAL C 3 275 ? 37.769  38.913 51.968  1.00 20.57 ? 571  VAL A CG2   1 
ATOM   2729 N  N     . GLU C 3 276 ? 37.729  42.774 49.653  1.00 20.75 ? 572  GLU A N     1 
ATOM   2730 C  CA    . GLU C 3 276 ? 37.207  43.927 48.925  1.00 23.41 ? 572  GLU A CA    1 
ATOM   2731 C  C     . GLU C 3 276 ? 37.854  44.019 47.540  1.00 22.64 ? 572  GLU A C     1 
ATOM   2732 O  O     . GLU C 3 276 ? 37.206  44.411 46.564  1.00 22.30 ? 572  GLU A O     1 
ATOM   2733 C  CB    . GLU C 3 276 ? 37.465  45.222 49.708  1.00 26.70 ? 572  GLU A CB    1 
ATOM   2734 C  CG    . GLU C 3 276 ? 38.935  45.556 49.923  1.00 30.73 ? 572  GLU A CG    1 
ATOM   2735 C  CD    . GLU C 3 276 ? 39.135  46.899 50.612  1.00 36.14 ? 572  GLU A CD    1 
ATOM   2736 O  OE1   . GLU C 3 276 ? 38.676  47.058 51.762  1.00 37.87 ? 572  GLU A OE1   1 
ATOM   2737 O  OE2   . GLU C 3 276 ? 39.753  47.800 50.002  1.00 39.06 ? 572  GLU A OE2   1 
ATOM   2738 N  N     . ASN C 3 277 ? 39.131  43.654 47.461  1.00 21.10 ? 573  ASN A N     1 
ATOM   2739 C  CA    . ASN C 3 277 ? 39.866  43.691 46.198  1.00 21.51 ? 573  ASN A CA    1 
ATOM   2740 C  C     . ASN C 3 277 ? 39.384  42.623 45.219  1.00 20.39 ? 573  ASN A C     1 
ATOM   2741 O  O     . ASN C 3 277 ? 39.336  42.855 44.008  1.00 19.78 ? 573  ASN A O     1 
ATOM   2742 C  CB    . ASN C 3 277 ? 41.366  43.533 46.460  1.00 21.65 ? 573  ASN A CB    1 
ATOM   2743 C  CG    . ASN C 3 277 ? 42.001  44.813 46.981  1.00 25.13 ? 573  ASN A CG    1 
ATOM   2744 O  OD1   . ASN C 3 277 ? 42.187  45.772 46.233  1.00 25.67 ? 573  ASN A OD1   1 
ATOM   2745 N  ND2   . ASN C 3 277 ? 42.322  44.839 48.271  1.00 23.44 ? 573  ASN A ND2   1 
ATOM   2746 N  N     . ILE C 3 278 ? 39.029  41.454 45.742  1.00 19.33 ? 574  ILE A N     1 
ATOM   2747 C  CA    . ILE C 3 278 ? 38.523  40.375 44.900  1.00 18.62 ? 574  ILE A CA    1 
ATOM   2748 C  C     . ILE C 3 278 ? 37.166  40.795 44.342  1.00 17.88 ? 574  ILE A C     1 
ATOM   2749 O  O     . ILE C 3 278 ? 36.855  40.540 43.184  1.00 18.41 ? 574  ILE A O     1 
ATOM   2750 C  CB    . ILE C 3 278 ? 38.382  39.060 45.699  1.00 18.28 ? 574  ILE A CB    1 
ATOM   2751 C  CG1   . ILE C 3 278 ? 39.775  38.538 46.063  1.00 20.02 ? 574  ILE A CG1   1 
ATOM   2752 C  CG2   . ILE C 3 278 ? 37.624  38.014 44.886  1.00 17.21 ? 574  ILE A CG2   1 
ATOM   2753 C  CD1   . ILE C 3 278 ? 39.758  37.358 47.016  1.00 22.24 ? 574  ILE A CD1   1 
ATOM   2754 N  N     . LEU C 3 279 ? 36.362  41.455 45.167  1.00 18.15 ? 575  LEU A N     1 
ATOM   2755 C  CA    . LEU C 3 279 ? 35.057  41.909 44.710  1.00 18.75 ? 575  LEU A CA    1 
ATOM   2756 C  C     . LEU C 3 279 ? 35.215  42.951 43.605  1.00 17.53 ? 575  LEU A C     1 
ATOM   2757 O  O     . LEU C 3 279 ? 34.479  42.938 42.618  1.00 19.15 ? 575  LEU A O     1 
ATOM   2758 C  CB    . LEU C 3 279 ? 34.261  42.491 45.881  1.00 20.00 ? 575  LEU A CB    1 
ATOM   2759 C  CG    . LEU C 3 279 ? 33.663  41.444 46.821  1.00 20.32 ? 575  LEU A CG    1 
ATOM   2760 C  CD1   . LEU C 3 279 ? 33.170  42.109 48.101  1.00 22.28 ? 575  LEU A CD1   1 
ATOM   2761 C  CD2   . LEU C 3 279 ? 32.527  40.721 46.096  1.00 20.46 ? 575  LEU A CD2   1 
ATOM   2762 N  N     . HIS C 3 280 ? 36.184  43.843 43.771  1.00 17.99 ? 576  HIS A N     1 
ATOM   2763 C  CA    . HIS C 3 280 ? 36.443  44.891 42.792  1.00 20.12 ? 576  HIS A CA    1 
ATOM   2764 C  C     . HIS C 3 280 ? 36.965  44.249 41.508  1.00 19.58 ? 576  HIS A C     1 
ATOM   2765 O  O     . HIS C 3 280 ? 36.561  44.618 40.404  1.00 18.44 ? 576  HIS A O     1 
ATOM   2766 C  CB    . HIS C 3 280 ? 37.461  45.883 43.367  1.00 23.35 ? 576  HIS A CB    1 
ATOM   2767 C  CG    . HIS C 3 280 ? 37.656  47.110 42.532  1.00 26.34 ? 576  HIS A CG    1 
ATOM   2768 N  ND1   . HIS C 3 280 ? 36.639  47.680 41.794  1.00 27.30 ? 576  HIS A ND1   1 
ATOM   2769 C  CD2   . HIS C 3 280 ? 38.742  47.897 42.346  1.00 26.19 ? 576  HIS A CD2   1 
ATOM   2770 C  CE1   . HIS C 3 280 ? 37.092  48.763 41.188  1.00 27.35 ? 576  HIS A CE1   1 
ATOM   2771 N  NE2   . HIS C 3 280 ? 38.365  48.917 41.506  1.00 27.06 ? 576  HIS A NE2   1 
ATOM   2772 N  N     . TYR C 3 281 ? 37.857  43.276 41.662  1.00 18.91 ? 577  TYR A N     1 
ATOM   2773 C  CA    . TYR C 3 281 ? 38.418  42.560 40.522  1.00 19.51 ? 577  TYR A CA    1 
ATOM   2774 C  C     . TYR C 3 281 ? 37.294  41.852 39.759  1.00 19.44 ? 577  TYR A C     1 
ATOM   2775 O  O     . TYR C 3 281 ? 37.285  41.833 38.529  1.00 18.54 ? 577  TYR A O     1 
ATOM   2776 C  CB    . TYR C 3 281 ? 39.439  41.528 41.003  1.00 19.51 ? 577  TYR A CB    1 
ATOM   2777 C  CG    . TYR C 3 281 ? 40.072  40.718 39.896  1.00 21.49 ? 577  TYR A CG    1 
ATOM   2778 C  CD1   . TYR C 3 281 ? 41.180  41.198 39.192  1.00 22.44 ? 577  TYR A CD1   1 
ATOM   2779 C  CD2   . TYR C 3 281 ? 39.558  39.472 39.543  1.00 23.26 ? 577  TYR A CD2   1 
ATOM   2780 C  CE1   . TYR C 3 281 ? 41.757  40.452 38.165  1.00 22.79 ? 577  TYR A CE1   1 
ATOM   2781 C  CE2   . TYR C 3 281 ? 40.124  38.722 38.521  1.00 24.79 ? 577  TYR A CE2   1 
ATOM   2782 C  CZ    . TYR C 3 281 ? 41.221  39.216 37.835  1.00 24.60 ? 577  TYR A CZ    1 
ATOM   2783 O  OH    . TYR C 3 281 ? 41.768  38.472 36.814  1.00 27.55 ? 577  TYR A OH    1 
ATOM   2784 N  N     . ARG C 3 282 ? 36.354  41.270 40.502  1.00 18.19 ? 578  ARG A N     1 
ATOM   2785 C  CA    . ARG C 3 282 ? 35.220  40.564 39.909  1.00 19.41 ? 578  ARG A CA    1 
ATOM   2786 C  C     . ARG C 3 282 ? 34.376  41.521 39.068  1.00 19.78 ? 578  ARG A C     1 
ATOM   2787 O  O     . ARG C 3 282 ? 33.985  41.192 37.951  1.00 20.40 ? 578  ARG A O     1 
ATOM   2788 C  CB    . ARG C 3 282 ? 34.336  39.948 41.002  1.00 19.24 ? 578  ARG A CB    1 
ATOM   2789 C  CG    . ARG C 3 282 ? 34.869  38.668 41.636  1.00 22.55 ? 578  ARG A CG    1 
ATOM   2790 C  CD    . ARG C 3 282 ? 34.433  37.438 40.858  1.00 22.32 ? 578  ARG A CD    1 
ATOM   2791 N  NE    . ARG C 3 282 ? 34.984  36.196 41.401  1.00 20.17 ? 578  ARG A NE    1 
ATOM   2792 C  CZ    . ARG C 3 282 ? 34.514  35.546 42.463  1.00 19.74 ? 578  ARG A CZ    1 
ATOM   2793 N  NH1   . ARG C 3 282 ? 33.463  36.004 43.127  1.00 18.96 ? 578  ARG A NH1   1 
ATOM   2794 N  NH2   . ARG C 3 282 ? 35.104  34.423 42.858  1.00 19.63 ? 578  ARG A NH2   1 
ATOM   2795 N  N     . GLN C 3 283 ? 34.092  42.702 39.609  1.00 19.43 ? 579  GLN A N     1 
ATOM   2796 C  CA    . GLN C 3 283 ? 33.291  43.683 38.880  1.00 20.81 ? 579  GLN A CA    1 
ATOM   2797 C  C     . GLN C 3 283 ? 33.964  44.131 37.584  1.00 20.28 ? 579  GLN A C     1 
ATOM   2798 O  O     . GLN C 3 283 ? 33.347  44.114 36.521  1.00 18.90 ? 579  GLN A O     1 
ATOM   2799 C  CB    . GLN C 3 283 ? 33.011  44.923 39.738  1.00 22.29 ? 579  GLN A CB    1 
ATOM   2800 C  CG    . GLN C 3 283 ? 32.455  46.086 38.909  1.00 25.77 ? 579  GLN A CG    1 
ATOM   2801 C  CD    . GLN C 3 283 ? 32.275  47.368 39.697  1.00 27.98 ? 579  GLN A CD    1 
ATOM   2802 O  OE1   . GLN C 3 283 ? 33.114  47.728 40.520  1.00 31.18 ? 579  GLN A OE1   1 
ATOM   2803 N  NE2   . GLN C 3 283 ? 31.183  48.080 39.428  1.00 29.63 ? 579  GLN A NE2   1 
ATOM   2804 N  N     . LEU C 3 284 ? 35.226  44.536 37.677  1.00 19.75 ? 580  LEU A N     1 
ATOM   2805 C  CA    . LEU C 3 284 ? 35.955  45.003 36.502  1.00 20.45 ? 580  LEU A CA    1 
ATOM   2806 C  C     . LEU C 3 284 ? 36.148  43.893 35.481  1.00 20.04 ? 580  LEU A C     1 
ATOM   2807 O  O     . LEU C 3 284 ? 35.992  44.108 34.274  1.00 19.57 ? 580  LEU A O     1 
ATOM   2808 C  CB    . LEU C 3 284 ? 37.318  45.570 36.910  1.00 23.67 ? 580  LEU A CB    1 
ATOM   2809 C  CG    . LEU C 3 284 ? 37.335  46.797 37.827  1.00 26.29 ? 580  LEU A CG    1 
ATOM   2810 C  CD1   . LEU C 3 284 ? 38.776  47.230 38.067  1.00 28.48 ? 580  LEU A CD1   1 
ATOM   2811 C  CD2   . LEU C 3 284 ? 36.544  47.931 37.198  1.00 28.36 ? 580  LEU A CD2   1 
ATOM   2812 N  N     . GLY C 3 285 ? 36.484  42.704 35.973  1.00 18.95 ? 581  GLY A N     1 
ATOM   2813 C  CA    . GLY C 3 285 ? 36.703  41.567 35.100  1.00 19.07 ? 581  GLY A CA    1 
ATOM   2814 C  C     . GLY C 3 285 ? 35.456  41.191 34.330  1.00 18.68 ? 581  GLY A C     1 
ATOM   2815 O  O     . GLY C 3 285 ? 35.532  40.774 33.176  1.00 17.36 ? 581  GLY A O     1 
ATOM   2816 N  N     . LYS C 3 286 ? 34.306  41.335 34.977  1.00 18.09 ? 582  LYS A N     1 
ATOM   2817 C  CA    . LYS C 3 286 ? 33.030  41.023 34.353  1.00 18.11 ? 582  LYS A CA    1 
ATOM   2818 C  C     . LYS C 3 286 ? 32.804  42.000 33.205  1.00 17.93 ? 582  LYS A C     1 
ATOM   2819 O  O     . LYS C 3 286 ? 32.407  41.608 32.110  1.00 19.61 ? 582  LYS A O     1 
ATOM   2820 C  CB    . LYS C 3 286 ? 31.903  41.162 35.382  1.00 19.32 ? 582  LYS A CB    1 
ATOM   2821 C  CG    . LYS C 3 286 ? 30.515  40.836 34.853  1.00 20.62 ? 582  LYS A CG    1 
ATOM   2822 C  CD    . LYS C 3 286 ? 30.361  39.345 34.595  1.00 22.22 ? 582  LYS A CD    1 
ATOM   2823 C  CE    . LYS C 3 286 ? 28.898  38.963 34.426  1.00 22.59 ? 582  LYS A CE    1 
ATOM   2824 N  NZ    . LYS C 3 286 ? 28.729  37.493 34.268  1.00 18.87 ? 582  LYS A NZ    1 
ATOM   2825 N  N     . LEU C 3 287 ? 33.057  43.278 33.462  1.00 18.12 ? 583  LEU A N     1 
ATOM   2826 C  CA    . LEU C 3 287 ? 32.881  44.299 32.440  1.00 18.33 ? 583  LEU A CA    1 
ATOM   2827 C  C     . LEU C 3 287 ? 33.830  44.059 31.270  1.00 19.66 ? 583  LEU A C     1 
ATOM   2828 O  O     . LEU C 3 287 ? 33.430  44.129 30.107  1.00 19.00 ? 583  LEU A O     1 
ATOM   2829 C  CB    . LEU C 3 287 ? 33.129  45.692 33.026  1.00 18.82 ? 583  LEU A CB    1 
ATOM   2830 C  CG    . LEU C 3 287 ? 32.194  46.126 34.159  1.00 18.81 ? 583  LEU A CG    1 
ATOM   2831 C  CD1   . LEU C 3 287 ? 32.617  47.503 34.666  1.00 19.22 ? 583  LEU A CD1   1 
ATOM   2832 C  CD2   . LEU C 3 287 ? 30.750  46.157 33.657  1.00 19.37 ? 583  LEU A CD2   1 
ATOM   2833 N  N     . GLN C 3 288 ? 35.085  43.761 31.585  1.00 20.15 ? 584  GLN A N     1 
ATOM   2834 C  CA    . GLN C 3 288 ? 36.091  43.532 30.556  1.00 20.61 ? 584  GLN A CA    1 
ATOM   2835 C  C     . GLN C 3 288 ? 35.785  42.341 29.653  1.00 21.33 ? 584  GLN A C     1 
ATOM   2836 O  O     . GLN C 3 288 ? 35.672  42.487 28.435  1.00 21.64 ? 584  GLN A O     1 
ATOM   2837 C  CB    . GLN C 3 288 ? 37.467  43.330 31.200  1.00 23.05 ? 584  GLN A CB    1 
ATOM   2838 C  CG    . GLN C 3 288 ? 38.616  43.230 30.200  1.00 26.09 ? 584  GLN A CG    1 
ATOM   2839 C  CD    . GLN C 3 288 ? 38.916  44.558 29.512  1.00 29.32 ? 584  GLN A CD    1 
ATOM   2840 O  OE1   . GLN C 3 288 ? 38.071  45.116 28.814  1.00 29.97 ? 584  GLN A OE1   1 
ATOM   2841 N  NE2   . GLN C 3 288 ? 40.129  45.068 29.713  1.00 29.34 ? 584  GLN A NE2   1 
ATOM   2842 N  N     . SER C 3 289 ? 35.645  41.163 30.252  1.00 21.03 ? 585  SER A N     1 
ATOM   2843 C  CA    . SER C 3 289 ? 35.397  39.945 29.486  1.00 22.63 ? 585  SER A CA    1 
ATOM   2844 C  C     . SER C 3 289 ? 34.053  39.850 28.768  1.00 22.69 ? 585  SER A C     1 
ATOM   2845 O  O     . SER C 3 289 ? 33.985  39.399 27.623  1.00 22.78 ? 585  SER A O     1 
ATOM   2846 C  CB    . SER C 3 289 ? 35.573  38.722 30.393  1.00 24.95 ? 585  SER A CB    1 
ATOM   2847 O  OG    . SER C 3 289 ? 36.908  38.637 30.873  1.00 30.03 ? 585  SER A OG    1 
ATOM   2848 N  N     . THR C 3 290 ? 32.986  40.278 29.429  1.00 21.62 ? 586  THR A N     1 
ATOM   2849 C  CA    . THR C 3 290 ? 31.655  40.186 28.839  1.00 22.95 ? 586  THR A CA    1 
ATOM   2850 C  C     . THR C 3 290 ? 31.132  41.422 28.111  1.00 22.31 ? 586  THR A C     1 
ATOM   2851 O  O     . THR C 3 290 ? 30.524  41.304 27.047  1.00 23.63 ? 586  THR A O     1 
ATOM   2852 C  CB    . THR C 3 290 ? 30.609  39.802 29.911  1.00 22.98 ? 586  THR A CB    1 
ATOM   2853 O  OG1   . THR C 3 290 ? 30.958  38.542 30.494  1.00 23.74 ? 586  THR A OG1   1 
ATOM   2854 C  CG2   . THR C 3 290 ? 29.223  39.698 29.293  1.00 22.76 ? 586  THR A CG2   1 
ATOM   2855 N  N     . TYR C 3 291 ? 31.364  42.603 28.673  1.00 21.18 ? 587  TYR A N     1 
ATOM   2856 C  CA    . TYR C 3 291 ? 30.842  43.823 28.069  1.00 21.31 ? 587  TYR A CA    1 
ATOM   2857 C  C     . TYR C 3 291 ? 31.785  44.672 27.231  1.00 22.72 ? 587  TYR A C     1 
ATOM   2858 O  O     . TYR C 3 291 ? 31.363  45.662 26.626  1.00 25.23 ? 587  TYR A O     1 
ATOM   2859 C  CB    . TYR C 3 291 ? 30.190  44.660 29.159  1.00 19.97 ? 587  TYR A CB    1 
ATOM   2860 C  CG    . TYR C 3 291 ? 29.054  43.910 29.803  1.00 18.45 ? 587  TYR A CG    1 
ATOM   2861 C  CD1   . TYR C 3 291 ? 27.859  43.688 29.110  1.00 18.88 ? 587  TYR A CD1   1 
ATOM   2862 C  CD2   . TYR C 3 291 ? 29.190  43.365 31.078  1.00 17.86 ? 587  TYR A CD2   1 
ATOM   2863 C  CE1   . TYR C 3 291 ? 26.824  42.935 29.677  1.00 16.64 ? 587  TYR A CE1   1 
ATOM   2864 C  CE2   . TYR C 3 291 ? 28.164  42.613 31.653  1.00 19.87 ? 587  TYR A CE2   1 
ATOM   2865 C  CZ    . TYR C 3 291 ? 26.988  42.404 30.947  1.00 16.93 ? 587  TYR A CZ    1 
ATOM   2866 O  OH    . TYR C 3 291 ? 25.980  41.669 31.519  1.00 18.11 ? 587  TYR A OH    1 
ATOM   2867 N  N     . ILE C 3 292 ? 33.056  44.303 27.191  1.00 21.06 ? 588  ILE A N     1 
ATOM   2868 C  CA    . ILE C 3 292 ? 33.996  45.041 26.364  1.00 22.09 ? 588  ILE A CA    1 
ATOM   2869 C  C     . ILE C 3 292 ? 34.459  44.097 25.263  1.00 23.01 ? 588  ILE A C     1 
ATOM   2870 O  O     . ILE C 3 292 ? 34.170  44.311 24.085  1.00 21.50 ? 588  ILE A O     1 
ATOM   2871 C  CB    . ILE C 3 292 ? 35.216  45.542 27.171  1.00 23.19 ? 588  ILE A CB    1 
ATOM   2872 C  CG1   . ILE C 3 292 ? 34.766  46.563 28.219  1.00 24.03 ? 588  ILE A CG1   1 
ATOM   2873 C  CG2   . ILE C 3 292 ? 36.241  46.180 26.233  1.00 23.44 ? 588  ILE A CG2   1 
ATOM   2874 C  CD1   . ILE C 3 292 ? 34.107  47.795 27.635  1.00 27.10 ? 588  ILE A CD1   1 
ATOM   2875 N  N     . GLU C 3 293 ? 35.148  43.030 25.654  1.00 23.41 ? 589  GLU A N     1 
ATOM   2876 C  CA    . GLU C 3 293 ? 35.655  42.061 24.693  1.00 23.88 ? 589  GLU A CA    1 
ATOM   2877 C  C     . GLU C 3 293 ? 34.526  41.262 24.043  1.00 23.29 ? 589  GLU A C     1 
ATOM   2878 O  O     . GLU C 3 293 ? 34.513  41.073 22.826  1.00 22.61 ? 589  GLU A O     1 
ATOM   2879 C  CB    . GLU C 3 293 ? 36.642  41.119 25.383  1.00 25.58 ? 589  GLU A CB    1 
ATOM   2880 C  CG    . GLU C 3 293 ? 37.685  41.853 26.224  1.00 29.58 ? 589  GLU A CG    1 
ATOM   2881 C  CD    . GLU C 3 293 ? 38.710  40.923 26.841  1.00 31.66 ? 589  GLU A CD    1 
ATOM   2882 O  OE1   . GLU C 3 293 ? 38.321  39.832 27.310  1.00 33.91 ? 589  GLU A OE1   1 
ATOM   2883 O  OE2   . GLU C 3 293 ? 39.904  41.288 26.864  1.00 33.93 ? 589  GLU A OE2   1 
ATOM   2884 N  N     . GLY C 3 294 ? 33.580  40.802 24.855  1.00 22.69 ? 590  GLY A N     1 
ATOM   2885 C  CA    . GLY C 3 294 ? 32.468  40.030 24.329  1.00 22.94 ? 590  GLY A CA    1 
ATOM   2886 C  C     . GLY C 3 294 ? 31.617  40.818 23.352  1.00 23.03 ? 590  GLY A C     1 
ATOM   2887 O  O     . GLY C 3 294 ? 31.184  40.300 22.320  1.00 23.24 ? 590  GLY A O     1 
ATOM   2888 N  N     . LEU C 3 295 ? 31.375  42.079 23.680  1.00 22.30 ? 591  LEU A N     1 
ATOM   2889 C  CA    . LEU C 3 295 ? 30.573  42.950 22.835  1.00 22.92 ? 591  LEU A CA    1 
ATOM   2890 C  C     . LEU C 3 295 ? 31.310  43.232 21.527  1.00 22.04 ? 591  LEU A C     1 
ATOM   2891 O  O     . LEU C 3 295 ? 30.753  43.089 20.439  1.00 21.20 ? 591  LEU A O     1 
ATOM   2892 C  CB    . LEU C 3 295 ? 30.295  44.257 23.575  1.00 24.80 ? 591  LEU A CB    1 
ATOM   2893 C  CG    . LEU C 3 295 ? 29.184  45.161 23.051  1.00 26.99 ? 591  LEU A CG    1 
ATOM   2894 C  CD1   . LEU C 3 295 ? 27.902  44.361 22.866  1.00 27.54 ? 591  LEU A CD1   1 
ATOM   2895 C  CD2   . LEU C 3 295 ? 28.969  46.297 24.041  1.00 27.31 ? 591  LEU A CD2   1 
ATOM   2896 N  N     . LEU C 3 296 ? 32.573  43.626 21.644  1.00 20.85 ? 592  LEU A N     1 
ATOM   2897 C  CA    . LEU C 3 296 ? 33.387  43.929 20.477  1.00 20.51 ? 592  LEU A CA    1 
ATOM   2898 C  C     . LEU C 3 296 ? 33.457  42.762 19.493  1.00 21.22 ? 592  LEU A C     1 
ATOM   2899 O  O     . LEU C 3 296 ? 33.564  42.971 18.285  1.00 21.63 ? 592  LEU A O     1 
ATOM   2900 C  CB    . LEU C 3 296 ? 34.797  44.331 20.918  1.00 19.42 ? 592  LEU A CB    1 
ATOM   2901 C  CG    . LEU C 3 296 ? 34.907  45.717 21.564  1.00 18.39 ? 592  LEU A CG    1 
ATOM   2902 C  CD1   . LEU C 3 296 ? 36.315  45.943 22.116  1.00 19.36 ? 592  LEU A CD1   1 
ATOM   2903 C  CD2   . LEU C 3 296 ? 34.562  46.773 20.533  1.00 21.07 ? 592  LEU A CD2   1 
ATOM   2904 N  N     . LYS C 3 297 ? 33.393  41.537 20.005  1.00 21.14 ? 593  LYS A N     1 
ATOM   2905 C  CA    . LYS C 3 297 ? 33.454  40.355 19.149  1.00 22.08 ? 593  LYS A CA    1 
ATOM   2906 C  C     . LYS C 3 297 ? 32.258  40.199 18.217  1.00 20.82 ? 593  LYS A C     1 
ATOM   2907 O  O     . LYS C 3 297 ? 32.384  39.608 17.147  1.00 22.09 ? 593  LYS A O     1 
ATOM   2908 C  CB    . LYS C 3 297 ? 33.570  39.075 19.984  1.00 23.37 ? 593  LYS A CB    1 
ATOM   2909 C  CG    . LYS C 3 297 ? 34.924  38.826 20.620  1.00 30.10 ? 593  LYS A CG    1 
ATOM   2910 C  CD    . LYS C 3 297 ? 34.918  37.486 21.352  1.00 33.99 ? 593  LYS A CD    1 
ATOM   2911 C  CE    . LYS C 3 297 ? 36.265  37.190 21.993  1.00 37.55 ? 593  LYS A CE    1 
ATOM   2912 N  NZ    . LYS C 3 297 ? 37.362  37.140 20.982  1.00 40.03 ? 593  LYS A NZ    1 
ATOM   2913 N  N     . VAL C 3 298 ? 31.102  40.718 18.610  1.00 19.67 ? 594  VAL A N     1 
ATOM   2914 C  CA    . VAL C 3 298 ? 29.917  40.565 17.776  1.00 18.70 ? 594  VAL A CA    1 
ATOM   2915 C  C     . VAL C 3 298 ? 29.469  41.814 17.027  1.00 20.11 ? 594  VAL A C     1 
ATOM   2916 O  O     . VAL C 3 298 ? 28.400  41.821 16.416  1.00 20.45 ? 594  VAL A O     1 
ATOM   2917 C  CB    . VAL C 3 298 ? 28.723  40.015 18.596  1.00 18.99 ? 594  VAL A CB    1 
ATOM   2918 C  CG1   . VAL C 3 298 ? 29.037  38.600 19.070  1.00 20.22 ? 594  VAL A CG1   1 
ATOM   2919 C  CG2   . VAL C 3 298 ? 28.430  40.925 19.775  1.00 19.14 ? 594  VAL A CG2   1 
ATOM   2920 N  N     . VAL C 3 299 ? 30.273  42.870 17.069  1.00 19.64 ? 595  VAL A N     1 
ATOM   2921 C  CA    . VAL C 3 299 ? 29.927  44.084 16.336  1.00 20.75 ? 595  VAL A CA    1 
ATOM   2922 C  C     . VAL C 3 299 ? 30.273  43.835 14.868  1.00 21.26 ? 595  VAL A C     1 
ATOM   2923 O  O     . VAL C 3 299 ? 31.366  43.363 14.564  1.00 20.34 ? 595  VAL A O     1 
ATOM   2924 C  CB    . VAL C 3 299 ? 30.741  45.308 16.822  1.00 19.96 ? 595  VAL A CB    1 
ATOM   2925 C  CG1   . VAL C 3 299 ? 30.487  46.499 15.896  1.00 21.17 ? 595  VAL A CG1   1 
ATOM   2926 C  CG2   . VAL C 3 299 ? 30.354  45.668 18.250  1.00 20.01 ? 595  VAL A CG2   1 
ATOM   2927 N  N     . ARG C 3 300 ? 29.345  44.137 13.964  1.00 21.58 ? 596  ARG A N     1 
ATOM   2928 C  CA    . ARG C 3 300 ? 29.593  43.959 12.531  1.00 24.23 ? 596  ARG A CA    1 
ATOM   2929 C  C     . ARG C 3 300 ? 30.553  45.076 12.118  1.00 25.37 ? 596  ARG A C     1 
ATOM   2930 O  O     . ARG C 3 300 ? 30.201  46.249 12.177  1.00 26.23 ? 596  ARG A O     1 
ATOM   2931 C  CB    . ARG C 3 300 ? 28.282  44.075 11.749  1.00 24.31 ? 596  ARG A CB    1 
ATOM   2932 C  CG    . ARG C 3 300 ? 27.196  43.119 12.221  1.00 26.98 ? 596  ARG A CG    1 
ATOM   2933 C  CD    . ARG C 3 300 ? 27.020  41.958 11.266  1.00 28.42 ? 596  ARG A CD    1 
ATOM   2934 N  NE    . ARG C 3 300 ? 26.392  40.811 11.914  1.00 28.90 ? 596  ARG A NE    1 
ATOM   2935 C  CZ    . ARG C 3 300 ? 26.215  39.632 11.328  1.00 26.26 ? 596  ARG A CZ    1 
ATOM   2936 N  NH1   . ARG C 3 300 ? 26.610  39.447 10.077  1.00 25.24 ? 596  ARG A NH1   1 
ATOM   2937 N  NH2   . ARG C 3 300 ? 25.673  38.630 12.002  1.00 27.70 ? 596  ARG A NH2   1 
ATOM   2938 N  N     . PRO C 3 301 ? 31.775  44.719 11.688  1.00 27.26 ? 597  PRO A N     1 
ATOM   2939 C  CA    . PRO C 3 301 ? 32.835  45.643 11.262  1.00 29.71 ? 597  PRO A CA    1 
ATOM   2940 C  C     . PRO C 3 301 ? 32.471  46.672 10.202  1.00 31.70 ? 597  PRO A C     1 
ATOM   2941 O  O     . PRO C 3 301 ? 33.026  47.774 10.176  1.00 33.45 ? 597  PRO A O     1 
ATOM   2942 C  CB    . PRO C 3 301 ? 33.949  44.707 10.794  1.00 29.58 ? 597  PRO A CB    1 
ATOM   2943 C  CG    . PRO C 3 301 ? 33.714  43.467 11.579  1.00 29.67 ? 597  PRO A CG    1 
ATOM   2944 C  CD    . PRO C 3 301 ? 32.217  43.326 11.514  1.00 28.14 ? 597  PRO A CD    1 
ATOM   2945 N  N     . ASP C 3 302 ? 31.543  46.315 9.326   1.00 32.29 ? 598  ASP A N     1 
ATOM   2946 C  CA    . ASP C 3 302 ? 31.148  47.213 8.257   1.00 35.06 ? 598  ASP A CA    1 
ATOM   2947 C  C     . ASP C 3 302 ? 30.090  48.237 8.651   1.00 36.14 ? 598  ASP A C     1 
ATOM   2948 O  O     . ASP C 3 302 ? 30.165  49.396 8.240   1.00 37.92 ? 598  ASP A O     1 
ATOM   2949 C  CB    . ASP C 3 302 ? 30.676  46.395 7.056   1.00 35.26 ? 598  ASP A CB    1 
ATOM   2950 C  CG    . ASP C 3 302 ? 29.573  45.423 7.408   1.00 36.44 ? 598  ASP A CG    1 
ATOM   2951 O  OD1   . ASP C 3 302 ? 29.723  44.666 8.391   1.00 38.83 ? 598  ASP A OD1   1 
ATOM   2952 O  OD2   . ASP C 3 302 ? 28.553  45.414 6.694   1.00 38.73 ? 598  ASP A OD2   1 
ATOM   2953 N  N     . THR C 3 303 ? 29.112  47.818 9.446   1.00 34.92 ? 599  THR A N     1 
ATOM   2954 C  CA    . THR C 3 303 ? 28.050  48.725 9.871   1.00 33.52 ? 599  THR A CA    1 
ATOM   2955 C  C     . THR C 3 303 ? 28.225  49.211 11.300  1.00 30.60 ? 599  THR A C     1 
ATOM   2956 O  O     . THR C 3 303 ? 27.483  50.079 11.758  1.00 31.99 ? 599  THR A O     1 
ATOM   2957 C  CB    . THR C 3 303 ? 26.683  48.058 9.766   1.00 33.70 ? 599  THR A CB    1 
ATOM   2958 O  OG1   . THR C 3 303 ? 26.614  46.968 10.693  1.00 34.56 ? 599  THR A OG1   1 
ATOM   2959 C  CG2   . THR C 3 303 ? 26.456  47.549 8.352   1.00 34.98 ? 599  THR A CG2   1 
ATOM   2960 N  N     . LYS C 3 304 ? 29.204  48.647 11.997  1.00 26.64 ? 600  LYS A N     1 
ATOM   2961 C  CA    . LYS C 3 304 ? 29.488  49.015 13.377  1.00 26.08 ? 600  LYS A CA    1 
ATOM   2962 C  C     . LYS C 3 304 ? 28.258  48.879 14.262  1.00 22.40 ? 600  LYS A C     1 
ATOM   2963 O  O     . LYS C 3 304 ? 28.057  49.660 15.188  1.00 21.47 ? 600  LYS A O     1 
ATOM   2964 C  CB    . LYS C 3 304 ? 30.023  50.447 13.448  1.00 30.44 ? 600  LYS A CB    1 
ATOM   2965 C  CG    . LYS C 3 304 ? 31.285  50.677 12.623  1.00 35.13 ? 600  LYS A CG    1 
ATOM   2966 C  CD    . LYS C 3 304 ? 32.430  49.773 13.071  1.00 38.14 ? 600  LYS A CD    1 
ATOM   2967 C  CE    . LYS C 3 304 ? 33.650  49.945 12.168  1.00 40.88 ? 600  LYS A CE    1 
ATOM   2968 N  NZ    . LYS C 3 304 ? 34.765  49.025 12.538  1.00 41.73 ? 600  LYS A NZ    1 
ATOM   2969 N  N     . LYS C 3 305 ? 27.434  47.881 13.970  1.00 18.25 ? 601  LYS A N     1 
ATOM   2970 C  CA    . LYS C 3 305 ? 26.237  47.636 14.763  1.00 17.39 ? 601  LYS A CA    1 
ATOM   2971 C  C     . LYS C 3 305 ? 26.235  46.214 15.303  1.00 15.98 ? 601  LYS A C     1 
ATOM   2972 O  O     . LYS C 3 305 ? 26.948  45.351 14.802  1.00 17.53 ? 601  LYS A O     1 
ATOM   2973 C  CB    . LYS C 3 305 ? 24.976  47.807 13.919  1.00 17.32 ? 601  LYS A CB    1 
ATOM   2974 C  CG    . LYS C 3 305 ? 24.692  49.202 13.412  1.00 17.25 ? 601  LYS A CG    1 
ATOM   2975 C  CD    . LYS C 3 305 ? 23.449  49.150 12.534  1.00 21.25 ? 601  LYS A CD    1 
ATOM   2976 C  CE    . LYS C 3 305 ? 23.009  50.519 12.078  1.00 22.34 ? 601  LYS A CE    1 
ATOM   2977 N  NZ    . LYS C 3 305 ? 21.747  50.418 11.297  1.00 21.33 ? 601  LYS A NZ    1 
ATOM   2978 N  N     . VAL C 3 306 ? 25.431  45.987 16.335  1.00 16.56 ? 602  VAL A N     1 
ATOM   2979 C  CA    . VAL C 3 306 ? 25.259  44.648 16.884  1.00 16.97 ? 602  VAL A CA    1 
ATOM   2980 C  C     . VAL C 3 306 ? 23.830  44.291 16.498  1.00 15.34 ? 602  VAL A C     1 
ATOM   2981 O  O     . VAL C 3 306 ? 22.930  45.126 16.596  1.00 16.20 ? 602  VAL A O     1 
ATOM   2982 C  CB    . VAL C 3 306 ? 25.411  44.587 18.427  1.00 17.78 ? 602  VAL A CB    1 
ATOM   2983 C  CG1   . VAL C 3 306 ? 26.880  44.654 18.802  1.00 17.82 ? 602  VAL A CG1   1 
ATOM   2984 C  CG2   . VAL C 3 306 ? 24.634  45.715 19.094  1.00 16.46 ? 602  VAL A CG2   1 
ATOM   2985 N  N     . HIS C 3 307 ? 23.628  43.063 16.041  1.00 12.88 ? 603  HIS A N     1 
ATOM   2986 C  CA    . HIS C 3 307 ? 22.307  42.607 15.634  1.00 13.58 ? 603  HIS A CA    1 
ATOM   2987 C  C     . HIS C 3 307 ? 21.944  41.409 16.490  1.00 11.98 ? 603  HIS A C     1 
ATOM   2988 O  O     . HIS C 3 307 ? 22.268  40.266 16.160  1.00 12.28 ? 603  HIS A O     1 
ATOM   2989 C  CB    . HIS C 3 307 ? 22.314  42.217 14.155  1.00 11.87 ? 603  HIS A CB    1 
ATOM   2990 C  CG    . HIS C 3 307 ? 22.646  43.352 13.236  1.00 15.83 ? 603  HIS A CG    1 
ATOM   2991 N  ND1   . HIS C 3 307 ? 21.680  44.140 12.647  1.00 14.04 ? 603  HIS A ND1   1 
ATOM   2992 C  CD2   . HIS C 3 307 ? 23.838  43.851 12.830  1.00 15.77 ? 603  HIS A CD2   1 
ATOM   2993 C  CE1   . HIS C 3 307 ? 22.263  45.075 11.917  1.00 17.38 ? 603  HIS A CE1   1 
ATOM   2994 N  NE2   . HIS C 3 307 ? 23.573  44.922 12.011  1.00 18.59 ? 603  HIS A NE2   1 
ATOM   2995 N  N     . THR C 3 308 ? 21.273  41.679 17.599  1.00 11.54 ? 604  THR A N     1 
ATOM   2996 C  CA    . THR C 3 308 ? 20.879  40.620 18.506  1.00 11.94 ? 604  THR A CA    1 
ATOM   2997 C  C     . THR C 3 308 ? 19.817  39.756 17.847  1.00 13.05 ? 604  THR A C     1 
ATOM   2998 O  O     . THR C 3 308 ? 19.300  40.085 16.782  1.00 11.91 ? 604  THR A O     1 
ATOM   2999 C  CB    . THR C 3 308 ? 20.288  41.198 19.815  1.00 11.07 ? 604  THR A CB    1 
ATOM   3000 O  OG1   . THR C 3 308 ? 20.122  40.146 20.773  1.00 12.00 ? 604  THR A OG1   1 
ATOM   3001 C  CG2   . THR C 3 308 ? 18.922  41.844 19.552  1.00 12.76 ? 604  THR A CG2   1 
ATOM   3002 N  N     . ILE C 3 309 ? 19.506  38.637 18.486  1.00 11.99 ? 605  ILE A N     1 
ATOM   3003 C  CA    . ILE C 3 309 ? 18.447  37.775 18.007  1.00 12.49 ? 605  ILE A CA    1 
ATOM   3004 C  C     . ILE C 3 309 ? 17.558  37.581 19.222  1.00 12.60 ? 605  ILE A C     1 
ATOM   3005 O  O     . ILE C 3 309 ? 18.009  37.103 20.266  1.00 11.12 ? 605  ILE A O     1 
ATOM   3006 C  CB    . ILE C 3 309 ? 18.975  36.423 17.493  1.00 14.14 ? 605  ILE A CB    1 
ATOM   3007 C  CG1   . ILE C 3 309 ? 19.741  36.645 16.178  1.00 13.11 ? 605  ILE A CG1   1 
ATOM   3008 C  CG2   . ILE C 3 309 ? 17.819  35.458 17.282  1.00 15.15 ? 605  ILE A CG2   1 
ATOM   3009 C  CD1   . ILE C 3 309 ? 20.258  35.373 15.533  1.00 15.58 ? 605  ILE A CD1   1 
ATOM   3010 N  N     . PHE C 3 310 ? 16.301  37.988 19.090  1.00 10.44 ? 606  PHE A N     1 
ATOM   3011 C  CA    . PHE C 3 310 ? 15.341  37.850 20.175  1.00 13.12 ? 606  PHE A CA    1 
ATOM   3012 C  C     . PHE C 3 310 ? 14.689  36.487 20.066  1.00 13.47 ? 606  PHE A C     1 
ATOM   3013 O  O     . PHE C 3 310 ? 14.022  36.199 19.076  1.00 14.37 ? 606  PHE A O     1 
ATOM   3014 C  CB    . PHE C 3 310 ? 14.257  38.929 20.082  1.00 11.91 ? 606  PHE A CB    1 
ATOM   3015 C  CG    . PHE C 3 310 ? 14.737  40.302 20.437  1.00 13.85 ? 606  PHE A CG    1 
ATOM   3016 C  CD1   . PHE C 3 310 ? 15.016  40.633 21.760  1.00 14.79 ? 606  PHE A CD1   1 
ATOM   3017 C  CD2   . PHE C 3 310 ? 14.916  41.271 19.450  1.00 14.59 ? 606  PHE A CD2   1 
ATOM   3018 C  CE1   . PHE C 3 310 ? 15.467  41.907 22.101  1.00 15.27 ? 606  PHE A CE1   1 
ATOM   3019 C  CE2   . PHE C 3 310 ? 15.367  42.547 19.782  1.00 14.35 ? 606  PHE A CE2   1 
ATOM   3020 C  CZ    . PHE C 3 310 ? 15.643  42.866 21.108  1.00 13.58 ? 606  PHE A CZ    1 
ATOM   3021 N  N     . ASN C 3 311 ? 14.886  35.643 21.071  1.00 13.54 ? 607  ASN A N     1 
ATOM   3022 C  CA    . ASN C 3 311 ? 14.260  34.332 21.044  1.00 13.09 ? 607  ASN A CA    1 
ATOM   3023 C  C     . ASN C 3 311 ? 12.860  34.562 21.584  1.00 13.06 ? 607  ASN A C     1 
ATOM   3024 O  O     . ASN C 3 311 ? 12.673  34.837 22.768  1.00 13.22 ? 607  ASN A O     1 
ATOM   3025 C  CB    . ASN C 3 311 ? 14.998  33.334 21.928  1.00 15.11 ? 607  ASN A CB    1 
ATOM   3026 C  CG    . ASN C 3 311 ? 14.550  31.909 21.674  1.00 17.39 ? 607  ASN A CG    1 
ATOM   3027 O  OD1   . ASN C 3 311 ? 13.379  31.664 21.356  1.00 15.13 ? 607  ASN A OD1   1 
ATOM   3028 N  ND2   . ASN C 3 311 ? 15.470  30.960 21.811  1.00 15.51 ? 607  ASN A ND2   1 
ATOM   3029 N  N     . GLN C 3 312 ? 11.881  34.448 20.699  1.00 11.96 ? 608  GLN A N     1 
ATOM   3030 C  CA    . GLN C 3 312 ? 10.485  34.682 21.041  1.00 12.84 ? 608  GLN A CA    1 
ATOM   3031 C  C     . GLN C 3 312 ? 9.771   33.416 21.517  1.00 12.21 ? 608  GLN A C     1 
ATOM   3032 O  O     . GLN C 3 312 ? 8.628   33.476 21.974  1.00 13.93 ? 608  GLN A O     1 
ATOM   3033 C  CB    . GLN C 3 312 ? 9.782   35.262 19.804  1.00 12.65 ? 608  GLN A CB    1 
ATOM   3034 C  CG    . GLN C 3 312 ? 8.325   35.659 19.999  1.00 14.41 ? 608  GLN A CG    1 
ATOM   3035 C  CD    . GLN C 3 312 ? 7.696   36.186 18.718  1.00 14.27 ? 608  GLN A CD    1 
ATOM   3036 O  OE1   . GLN C 3 312 ? 8.337   36.220 17.667  1.00 12.14 ? 608  GLN A OE1   1 
ATOM   3037 N  NE2   . GLN C 3 312 ? 6.436   36.601 18.801  1.00 10.78 ? 608  GLN A NE2   1 
ATOM   3038 N  N     . ALA C 3 313 ? 10.449  32.276 21.432  1.00 12.17 ? 609  ALA A N     1 
ATOM   3039 C  CA    . ALA C 3 313 ? 9.840   31.005 21.817  1.00 11.27 ? 609  ALA A CA    1 
ATOM   3040 C  C     . ALA C 3 313 ? 10.664  30.209 22.816  1.00 14.25 ? 609  ALA A C     1 
ATOM   3041 O  O     . ALA C 3 313 ? 10.845  28.997 22.653  1.00 12.94 ? 609  ALA A O     1 
ATOM   3042 C  CB    . ALA C 3 313 ? 9.593   30.160 20.563  1.00 12.62 ? 609  ALA A CB    1 
ATOM   3043 N  N     . LEU C 3 314 ? 11.149  30.876 23.858  1.00 12.07 ? 610  LEU A N     1 
ATOM   3044 C  CA    . LEU C 3 314 ? 11.964  30.193 24.852  1.00 15.45 ? 610  LEU A CA    1 
ATOM   3045 C  C     . LEU C 3 314 ? 11.473  30.229 26.300  1.00 15.42 ? 610  LEU A C     1 
ATOM   3046 O  O     . LEU C 3 314 ? 11.259  29.180 26.903  1.00 17.26 ? 610  LEU A O     1 
ATOM   3047 C  CB    . LEU C 3 314 ? 13.397  30.728 24.814  1.00 15.61 ? 610  LEU A CB    1 
ATOM   3048 C  CG    . LEU C 3 314 ? 14.285  30.150 25.919  1.00 19.70 ? 610  LEU A CG    1 
ATOM   3049 C  CD1   . LEU C 3 314 ? 14.647  28.717 25.595  1.00 23.53 ? 610  LEU A CD1   1 
ATOM   3050 C  CD2   . LEU C 3 314 ? 15.531  30.980 26.052  1.00 23.88 ? 610  LEU A CD2   1 
ATOM   3051 N  N     . THR C 3 315 ? 11.297  31.423 26.861  1.00 15.19 ? 611  THR A N     1 
ATOM   3052 C  CA    . THR C 3 315 ? 10.883  31.540 28.257  1.00 14.59 ? 611  THR A CA    1 
ATOM   3053 C  C     . THR C 3 315 ? 9.534   30.928 28.591  1.00 14.88 ? 611  THR A C     1 
ATOM   3054 O  O     . THR C 3 315 ? 8.597   30.938 27.788  1.00 15.57 ? 611  THR A O     1 
ATOM   3055 C  CB    . THR C 3 315 ? 10.881  33.008 28.735  1.00 13.64 ? 611  THR A CB    1 
ATOM   3056 O  OG1   . THR C 3 315 ? 9.704   33.667 28.254  1.00 14.40 ? 611  THR A OG1   1 
ATOM   3057 C  CG2   . THR C 3 315 ? 12.125  33.729 28.224  1.00 15.01 ? 611  THR A CG2   1 
ATOM   3058 N  N     . GLN C 3 316 ? 9.447   30.408 29.808  1.00 14.99 ? 612  GLN A N     1 
ATOM   3059 C  CA    . GLN C 3 316 ? 8.241   29.757 30.293  1.00 17.94 ? 612  GLN A CA    1 
ATOM   3060 C  C     . GLN C 3 316 ? 7.159   30.742 30.698  1.00 16.93 ? 612  GLN A C     1 
ATOM   3061 O  O     . GLN C 3 316 ? 6.016   30.352 30.921  1.00 20.22 ? 612  GLN A O     1 
ATOM   3062 C  CB    . GLN C 3 316 ? 8.595   28.863 31.481  1.00 17.90 ? 612  GLN A CB    1 
ATOM   3063 C  CG    . GLN C 3 316 ? 9.732   27.892 31.179  1.00 21.54 ? 612  GLN A CG    1 
ATOM   3064 C  CD    . GLN C 3 316 ? 9.412   26.985 30.007  1.00 22.24 ? 612  GLN A CD    1 
ATOM   3065 O  OE1   . GLN C 3 316 ? 8.451   26.216 30.049  1.00 23.31 ? 612  GLN A OE1   1 
ATOM   3066 N  NE2   . GLN C 3 316 ? 10.213  27.074 28.951  1.00 23.49 ? 612  GLN A NE2   1 
ATOM   3067 N  N     . THR C 3 317 ? 7.519   32.020 30.779  1.00 17.28 ? 613  THR A N     1 
ATOM   3068 C  CA    . THR C 3 317 ? 6.576   33.055 31.180  1.00 15.86 ? 613  THR A CA    1 
ATOM   3069 C  C     . THR C 3 317 ? 6.048   33.935 30.054  1.00 15.31 ? 613  THR A C     1 
ATOM   3070 O  O     . THR C 3 317 ? 5.082   34.668 30.255  1.00 17.22 ? 613  THR A O     1 
ATOM   3071 C  CB    . THR C 3 317 ? 7.197   33.989 32.222  1.00 17.81 ? 613  THR A CB    1 
ATOM   3072 O  OG1   . THR C 3 317 ? 8.416   34.534 31.694  1.00 16.06 ? 613  THR A OG1   1 
ATOM   3073 C  CG2   . THR C 3 317 ? 7.473   33.238 33.514  1.00 16.07 ? 613  THR A CG2   1 
ATOM   3074 N  N     . GLY C 3 318 ? 6.675   33.876 28.883  1.00 12.92 ? 614  GLY A N     1 
ATOM   3075 C  CA    . GLY C 3 318 ? 6.220   34.698 27.774  1.00 13.49 ? 614  GLY A CA    1 
ATOM   3076 C  C     . GLY C 3 318 ? 7.166   35.848 27.486  1.00 12.30 ? 614  GLY A C     1 
ATOM   3077 O  O     . GLY C 3 318 ? 6.969   36.616 26.544  1.00 11.20 ? 614  GLY A O     1 
ATOM   3078 N  N     . ARG C 3 319 ? 8.199   35.982 28.307  1.00 12.60 ? 615  ARG A N     1 
ATOM   3079 C  CA    . ARG C 3 319 ? 9.180   37.032 28.081  1.00 12.72 ? 615  ARG A CA    1 
ATOM   3080 C  C     . ARG C 3 319 ? 10.031  36.650 26.886  1.00 12.54 ? 615  ARG A C     1 
ATOM   3081 O  O     . ARG C 3 319 ? 10.072  35.488 26.480  1.00 12.65 ? 615  ARG A O     1 
ATOM   3082 C  CB    . ARG C 3 319 ? 10.113  37.185 29.279  1.00 14.37 ? 615  ARG A CB    1 
ATOM   3083 C  CG    . ARG C 3 319 ? 9.590   38.031 30.404  1.00 14.92 ? 615  ARG A CG    1 
ATOM   3084 C  CD    . ARG C 3 319 ? 10.710  38.205 31.403  1.00 16.64 ? 615  ARG A CD    1 
ATOM   3085 N  NE    . ARG C 3 319 ? 10.368  39.115 32.481  1.00 17.92 ? 615  ARG A NE    1 
ATOM   3086 C  CZ    . ARG C 3 319 ? 11.234  39.514 33.405  1.00 21.14 ? 615  ARG A CZ    1 
ATOM   3087 N  NH1   . ARG C 3 319 ? 12.492  39.082 33.375  1.00 18.66 ? 615  ARG A NH1   1 
ATOM   3088 N  NH2   . ARG C 3 319 ? 10.842  40.339 34.358  1.00 21.05 ? 615  ARG A NH2   1 
ATOM   3089 N  N     . LEU C 3 320 ? 10.712  37.640 26.328  1.00 11.57 ? 616  LEU A N     1 
ATOM   3090 C  CA    . LEU C 3 320 ? 11.615  37.406 25.213  1.00 10.31 ? 616  LEU A CA    1 
ATOM   3091 C  C     . LEU C 3 320 ? 12.969  37.185 25.880  1.00 11.39 ? 616  LEU A C     1 
ATOM   3092 O  O     . LEU C 3 320 ? 13.118  37.466 27.067  1.00 11.32 ? 616  LEU A O     1 
ATOM   3093 C  CB    . LEU C 3 320 ? 11.713  38.654 24.325  1.00 11.21 ? 616  LEU A CB    1 
ATOM   3094 C  CG    . LEU C 3 320 ? 10.452  39.198 23.655  1.00 12.00 ? 616  LEU A CG    1 
ATOM   3095 C  CD1   . LEU C 3 320 ? 10.773  40.506 22.945  1.00 12.74 ? 616  LEU A CD1   1 
ATOM   3096 C  CD2   . LEU C 3 320 ? 9.924   38.168 22.666  1.00 9.63  ? 616  LEU A CD2   1 
ATOM   3097 N  N     . SER C 3 321 ? 13.939  36.670 25.129  1.00 11.31 ? 617  SER A N     1 
ATOM   3098 C  CA    . SER C 3 321 ? 15.303  36.540 25.635  1.00 12.25 ? 617  SER A CA    1 
ATOM   3099 C  C     . SER C 3 321 ? 16.125  37.128 24.487  1.00 12.35 ? 617  SER A C     1 
ATOM   3100 O  O     . SER C 3 321 ? 15.609  37.281 23.373  1.00 11.18 ? 617  SER A O     1 
ATOM   3101 C  CB    . SER C 3 321 ? 15.696  35.085 25.939  1.00 12.35 ? 617  SER A CB    1 
ATOM   3102 O  OG    . SER C 3 321 ? 15.967  34.348 24.773  1.00 14.42 ? 617  SER A OG    1 
ATOM   3103 N  N     . SER C 3 322 ? 17.383  37.461 24.749  1.00 11.97 ? 618  SER A N     1 
ATOM   3104 C  CA    . SER C 3 322 ? 18.243  38.095 23.749  1.00 12.69 ? 618  SER A CA    1 
ATOM   3105 C  C     . SER C 3 322 ? 19.622  37.434 23.713  1.00 13.91 ? 618  SER A C     1 
ATOM   3106 O  O     . SER C 3 322 ? 20.186  37.122 24.759  1.00 13.78 ? 618  SER A O     1 
ATOM   3107 C  CB    . SER C 3 322 ? 18.359  39.586 24.100  1.00 12.31 ? 618  SER A CB    1 
ATOM   3108 O  OG    . SER C 3 322 ? 19.302  40.280 23.303  1.00 14.39 ? 618  SER A OG    1 
ATOM   3109 N  N     . THR C 3 323 ? 20.162  37.228 22.512  1.00 15.29 ? 619  THR A N     1 
ATOM   3110 C  CA    . THR C 3 323 ? 21.466  36.582 22.370  1.00 15.69 ? 619  THR A CA    1 
ATOM   3111 C  C     . THR C 3 323 ? 22.352  37.167 21.268  1.00 16.04 ? 619  THR A C     1 
ATOM   3112 O  O     . THR C 3 323 ? 21.867  37.777 20.321  1.00 13.93 ? 619  THR A O     1 
ATOM   3113 C  CB    . THR C 3 323 ? 21.318  35.070 22.056  1.00 16.71 ? 619  THR A CB    1 
ATOM   3114 O  OG1   . THR C 3 323 ? 20.755  34.911 20.747  1.00 18.27 ? 619  THR A OG1   1 
ATOM   3115 C  CG2   . THR C 3 323 ? 20.407  34.387 23.069  1.00 18.50 ? 619  THR A CG2   1 
ATOM   3116 N  N     . GLU C 3 324 ? 23.658  36.963 21.418  1.00 17.93 ? 620  GLU A N     1 
ATOM   3117 C  CA    . GLU C 3 324 ? 24.659  37.387 20.436  1.00 19.98 ? 620  GLU A CA    1 
ATOM   3118 C  C     . GLU C 3 324 ? 24.512  38.778 19.833  1.00 18.51 ? 620  GLU A C     1 
ATOM   3119 O  O     . GLU C 3 324 ? 24.360  38.913 18.623  1.00 19.71 ? 620  GLU A O     1 
ATOM   3120 C  CB    . GLU C 3 324 ? 24.696  36.391 19.280  1.00 25.12 ? 620  GLU A CB    1 
ATOM   3121 C  CG    . GLU C 3 324 ? 25.180  35.009 19.625  1.00 31.53 ? 620  GLU A CG    1 
ATOM   3122 C  CD    . GLU C 3 324 ? 25.256  34.124 18.395  1.00 35.59 ? 620  GLU A CD    1 
ATOM   3123 O  OE1   . GLU C 3 324 ? 24.193  33.686 17.903  1.00 37.37 ? 620  GLU A OE1   1 
ATOM   3124 O  OE2   . GLU C 3 324 ? 26.381  33.880 17.910  1.00 37.85 ? 620  GLU A OE2   1 
ATOM   3125 N  N     . PRO C 3 325 ? 24.593  39.830 20.655  1.00 17.32 ? 621  PRO A N     1 
ATOM   3126 C  CA    . PRO C 3 325 ? 24.811  39.787 22.098  1.00 16.06 ? 621  PRO A CA    1 
ATOM   3127 C  C     . PRO C 3 325 ? 23.494  39.849 22.853  1.00 15.38 ? 621  PRO A C     1 
ATOM   3128 O  O     . PRO C 3 325 ? 22.441  40.091 22.262  1.00 14.60 ? 621  PRO A O     1 
ATOM   3129 C  CB    . PRO C 3 325 ? 25.662  41.016 22.340  1.00 16.92 ? 621  PRO A CB    1 
ATOM   3130 C  CG    . PRO C 3 325 ? 24.972  42.015 21.441  1.00 17.32 ? 621  PRO A CG    1 
ATOM   3131 C  CD    . PRO C 3 325 ? 24.740  41.212 20.154  1.00 17.69 ? 621  PRO A CD    1 
ATOM   3132 N  N     . ASN C 3 326 ? 23.561  39.626 24.159  1.00 14.27 ? 622  ASN A N     1 
ATOM   3133 C  CA    . ASN C 3 326 ? 22.379  39.736 24.995  1.00 13.73 ? 622  ASN A CA    1 
ATOM   3134 C  C     . ASN C 3 326 ? 22.310  41.230 25.294  1.00 14.36 ? 622  ASN A C     1 
ATOM   3135 O  O     . ASN C 3 326 ? 23.171  41.768 25.987  1.00 16.18 ? 622  ASN A O     1 
ATOM   3136 C  CB    . ASN C 3 326 ? 22.552  38.953 26.297  1.00 13.59 ? 622  ASN A CB    1 
ATOM   3137 C  CG    . ASN C 3 326 ? 21.347  39.087 27.225  1.00 13.28 ? 622  ASN A CG    1 
ATOM   3138 O  OD1   . ASN C 3 326 ? 20.423  39.855 26.957  1.00 14.20 ? 622  ASN A OD1   1 
ATOM   3139 N  ND2   . ASN C 3 326 ? 21.357  38.338 28.320  1.00 12.35 ? 622  ASN A ND2   1 
ATOM   3140 N  N     . LEU C 3 327 ? 21.299  41.907 24.766  1.00 13.22 ? 623  LEU A N     1 
ATOM   3141 C  CA    . LEU C 3 327 ? 21.172  43.335 25.006  1.00 14.54 ? 623  LEU A CA    1 
ATOM   3142 C  C     . LEU C 3 327 ? 20.163  43.643 26.104  1.00 13.90 ? 623  LEU A C     1 
ATOM   3143 O  O     . LEU C 3 327 ? 19.783  44.794 26.306  1.00 14.75 ? 623  LEU A O     1 
ATOM   3144 C  CB    . LEU C 3 327 ? 20.791  44.058 23.713  1.00 15.69 ? 623  LEU A CB    1 
ATOM   3145 C  CG    . LEU C 3 327 ? 21.880  43.996 22.634  1.00 21.48 ? 623  LEU A CG    1 
ATOM   3146 C  CD1   . LEU C 3 327 ? 21.406  44.717 21.385  1.00 21.94 ? 623  LEU A CD1   1 
ATOM   3147 C  CD2   . LEU C 3 327 ? 23.173  44.622 23.172  1.00 17.91 ? 623  LEU A CD2   1 
ATOM   3148 N  N     . GLN C 3 328 ? 19.745  42.607 26.821  1.00 13.37 ? 624  GLN A N     1 
ATOM   3149 C  CA    . GLN C 3 328 ? 18.797  42.773 27.910  1.00 13.35 ? 624  GLN A CA    1 
ATOM   3150 C  C     . GLN C 3 328 ? 19.480  42.722 29.272  1.00 14.37 ? 624  GLN A C     1 
ATOM   3151 O  O     . GLN C 3 328 ? 18.817  42.715 30.307  1.00 14.84 ? 624  GLN A O     1 
ATOM   3152 C  CB    . GLN C 3 328 ? 17.711  41.699 27.839  1.00 12.67 ? 624  GLN A CB    1 
ATOM   3153 C  CG    . GLN C 3 328 ? 16.931  41.721 26.545  1.00 14.04 ? 624  GLN A CG    1 
ATOM   3154 C  CD    . GLN C 3 328 ? 15.780  40.744 26.552  1.00 15.10 ? 624  GLN A CD    1 
ATOM   3155 O  OE1   . GLN C 3 328 ? 15.950  39.565 26.874  1.00 13.35 ? 624  GLN A OE1   1 
ATOM   3156 N  NE2   . GLN C 3 328 ? 14.595  41.226 26.189  1.00 13.00 ? 624  GLN A NE2   1 
ATOM   3157 N  N     . ASN C 3 329 ? 20.807  42.684 29.278  1.00 17.26 ? 625  ASN A N     1 
ATOM   3158 C  CA    . ASN C 3 329 ? 21.521  42.665 30.544  1.00 17.03 ? 625  ASN A CA    1 
ATOM   3159 C  C     . ASN C 3 329 ? 22.778  43.536 30.534  1.00 17.76 ? 625  ASN A C     1 
ATOM   3160 O  O     . ASN C 3 329 ? 23.797  43.197 31.138  1.00 18.19 ? 625  ASN A O     1 
ATOM   3161 C  CB    . ASN C 3 329 ? 21.828  41.214 30.968  1.00 16.36 ? 625  ASN A CB    1 
ATOM   3162 C  CG    . ASN C 3 329 ? 22.997  40.599 30.222  1.00 17.59 ? 625  ASN A CG    1 
ATOM   3163 O  OD1   . ASN C 3 329 ? 23.333  41.000 29.112  1.00 16.37 ? 625  ASN A OD1   1 
ATOM   3164 N  ND2   . ASN C 3 329 ? 23.622  39.597 30.842  1.00 15.55 ? 625  ASN A ND2   1 
ATOM   3165 N  N     . ILE C 3 330 ? 22.688  44.673 29.845  1.00 17.19 ? 626  ILE A N     1 
ATOM   3166 C  CA    . ILE C 3 330 ? 23.793  45.627 29.787  1.00 16.42 ? 626  ILE A CA    1 
ATOM   3167 C  C     . ILE C 3 330 ? 23.793  46.314 31.156  1.00 16.94 ? 626  ILE A C     1 
ATOM   3168 O  O     . ILE C 3 330 ? 22.740  46.724 31.652  1.00 15.04 ? 626  ILE A O     1 
ATOM   3169 C  CB    . ILE C 3 330 ? 23.568  46.679 28.670  1.00 16.49 ? 626  ILE A CB    1 
ATOM   3170 C  CG1   . ILE C 3 330 ? 23.392  45.974 27.320  1.00 15.32 ? 626  ILE A CG1   1 
ATOM   3171 C  CG2   . ILE C 3 330 ? 24.751  47.649 28.610  1.00 16.40 ? 626  ILE A CG2   1 
ATOM   3172 C  CD1   . ILE C 3 330 ? 24.584  45.103 26.906  1.00 16.30 ? 626  ILE A CD1   1 
ATOM   3173 N  N     . PRO C 3 331 ? 24.973  46.450 31.786  1.00 16.04 ? 627  PRO A N     1 
ATOM   3174 C  CA    . PRO C 3 331 ? 25.094  47.079 33.105  1.00 16.84 ? 627  PRO A CA    1 
ATOM   3175 C  C     . PRO C 3 331 ? 24.400  48.425 33.278  1.00 16.67 ? 627  PRO A C     1 
ATOM   3176 O  O     . PRO C 3 331 ? 24.321  49.222 32.341  1.00 16.78 ? 627  PRO A O     1 
ATOM   3177 C  CB    . PRO C 3 331 ? 26.608  47.168 33.311  1.00 15.95 ? 627  PRO A CB    1 
ATOM   3178 C  CG    . PRO C 3 331 ? 27.116  45.984 32.558  1.00 15.44 ? 627  PRO A CG    1 
ATOM   3179 C  CD    . PRO C 3 331 ? 26.298  46.043 31.284  1.00 16.71 ? 627  PRO A CD    1 
ATOM   3180 N  N     . ILE C 3 332 ? 23.903  48.669 34.488  1.00 19.08 ? 628  ILE A N     1 
ATOM   3181 C  CA    . ILE C 3 332 ? 23.238  49.928 34.800  1.00 19.66 ? 628  ILE A CA    1 
ATOM   3182 C  C     . ILE C 3 332 ? 23.205  50.234 36.300  1.00 20.16 ? 628  ILE A C     1 
ATOM   3183 O  O     . ILE C 3 332 ? 23.195  51.399 36.694  1.00 19.70 ? 628  ILE A O     1 
ATOM   3184 C  CB    . ILE C 3 332 ? 21.786  49.945 34.255  1.00 18.69 ? 628  ILE A CB    1 
ATOM   3185 C  CG1   . ILE C 3 332 ? 21.216  51.363 34.342  1.00 20.48 ? 628  ILE A CG1   1 
ATOM   3186 C  CG2   . ILE C 3 332 ? 20.912  48.983 35.051  1.00 19.19 ? 628  ILE A CG2   1 
ATOM   3187 C  CD1   . ILE C 3 332 ? 19.887  51.537 33.622  1.00 19.43 ? 628  ILE A CD1   1 
ATOM   3188 N  N     . ARG C 3 333 ? 23.205  49.189 37.127  1.00 21.93 ? 629  ARG A N     1 
ATOM   3189 C  CA    . ARG C 3 333 ? 23.137  49.342 38.582  1.00 23.62 ? 629  ARG A CA    1 
ATOM   3190 C  C     . ARG C 3 333 ? 24.339  50.027 39.227  1.00 24.34 ? 629  ARG A C     1 
ATOM   3191 O  O     . ARG C 3 333 ? 24.178  50.819 40.157  1.00 25.80 ? 629  ARG A O     1 
ATOM   3192 C  CB    . ARG C 3 333 ? 22.897  47.977 39.236  1.00 25.71 ? 629  ARG A CB    1 
ATOM   3193 C  CG    . ARG C 3 333 ? 21.574  47.349 38.818  1.00 26.90 ? 629  ARG A CG    1 
ATOM   3194 C  CD    . ARG C 3 333 ? 21.375  45.953 39.385  1.00 28.44 ? 629  ARG A CD    1 
ATOM   3195 N  NE    . ARG C 3 333 ? 20.224  45.303 38.762  1.00 30.58 ? 629  ARG A NE    1 
ATOM   3196 C  CZ    . ARG C 3 333 ? 19.822  44.063 39.021  1.00 32.43 ? 629  ARG A CZ    1 
ATOM   3197 N  NH1   . ARG C 3 333 ? 20.473  43.317 39.904  1.00 31.46 ? 629  ARG A NH1   1 
ATOM   3198 N  NH2   . ARG C 3 333 ? 18.766  43.565 38.389  1.00 33.11 ? 629  ARG A NH2   1 
ATOM   3199 N  N     . LEU C 3 334 ? 25.538  49.721 38.746  1.00 22.92 ? 630  LEU A N     1 
ATOM   3200 C  CA    . LEU C 3 334 ? 26.744  50.339 39.283  1.00 23.16 ? 630  LEU A CA    1 
ATOM   3201 C  C     . LEU C 3 334 ? 27.265  51.306 38.227  1.00 22.79 ? 630  LEU A C     1 
ATOM   3202 O  O     . LEU C 3 334 ? 27.362  50.957 37.053  1.00 21.69 ? 630  LEU A O     1 
ATOM   3203 C  CB    . LEU C 3 334 ? 27.796  49.273 39.607  1.00 21.67 ? 630  LEU A CB    1 
ATOM   3204 C  CG    . LEU C 3 334 ? 27.353  48.214 40.619  1.00 23.29 ? 630  LEU A CG    1 
ATOM   3205 C  CD1   . LEU C 3 334 ? 28.482  47.216 40.852  1.00 23.40 ? 630  LEU A CD1   1 
ATOM   3206 C  CD2   . LEU C 3 334 ? 26.951  48.887 41.923  1.00 23.27 ? 630  LEU A CD2   1 
ATOM   3207 N  N     . GLU C 3 335 ? 27.596  52.521 38.650  1.00 24.28 ? 631  GLU A N     1 
ATOM   3208 C  CA    . GLU C 3 335 ? 28.071  53.554 37.735  1.00 24.61 ? 631  GLU A CA    1 
ATOM   3209 C  C     . GLU C 3 335 ? 29.163  53.130 36.760  1.00 24.61 ? 631  GLU A C     1 
ATOM   3210 O  O     . GLU C 3 335 ? 29.050  53.383 35.563  1.00 23.67 ? 631  GLU A O     1 
ATOM   3211 C  CB    . GLU C 3 335 ? 28.534  54.782 38.526  1.00 27.02 ? 631  GLU A CB    1 
ATOM   3212 C  CG    . GLU C 3 335 ? 29.005  55.953 37.663  1.00 27.86 ? 631  GLU A CG    1 
ATOM   3213 C  CD    . GLU C 3 335 ? 28.007  56.340 36.576  1.00 29.70 ? 631  GLU A CD    1 
ATOM   3214 O  OE1   . GLU C 3 335 ? 26.789  56.364 36.853  1.00 30.40 ? 631  GLU A OE1   1 
ATOM   3215 O  OE2   . GLU C 3 335 ? 28.446  56.636 35.445  1.00 28.98 ? 631  GLU A OE2   1 
ATOM   3216 N  N     . GLU C 3 336 ? 30.213  52.483 37.258  1.00 24.46 ? 632  GLU A N     1 
ATOM   3217 C  CA    . GLU C 3 336 ? 31.310  52.064 36.391  1.00 25.39 ? 632  GLU A CA    1 
ATOM   3218 C  C     . GLU C 3 336 ? 30.848  51.170 35.246  1.00 23.99 ? 632  GLU A C     1 
ATOM   3219 O  O     . GLU C 3 336 ? 31.348  51.278 34.126  1.00 25.53 ? 632  GLU A O     1 
ATOM   3220 C  CB    . GLU C 3 336 ? 32.384  51.346 37.205  1.00 29.01 ? 632  GLU A CB    1 
ATOM   3221 C  CG    . GLU C 3 336 ? 32.966  52.196 38.319  1.00 35.68 ? 632  GLU A CG    1 
ATOM   3222 C  CD    . GLU C 3 336 ? 34.067  51.482 39.069  1.00 39.56 ? 632  GLU A CD    1 
ATOM   3223 O  OE1   . GLU C 3 336 ? 35.162  51.320 38.489  1.00 41.26 ? 632  GLU A OE1   1 
ATOM   3224 O  OE2   . GLU C 3 336 ? 33.836  51.079 40.232  1.00 41.14 ? 632  GLU A OE2   1 
ATOM   3225 N  N     . GLY C 3 337 ? 29.895  50.289 35.528  1.00 21.12 ? 633  GLY A N     1 
ATOM   3226 C  CA    . GLY C 3 337 ? 29.386  49.405 34.495  1.00 20.09 ? 633  GLY A CA    1 
ATOM   3227 C  C     . GLY C 3 337 ? 28.407  50.137 33.598  1.00 18.12 ? 633  GLY A C     1 
ATOM   3228 O  O     . GLY C 3 337 ? 28.380  49.927 32.389  1.00 18.31 ? 633  GLY A O     1 
ATOM   3229 N  N     . ARG C 3 338 ? 27.604  51.004 34.206  1.00 16.97 ? 634  ARG A N     1 
ATOM   3230 C  CA    . ARG C 3 338 ? 26.605  51.789 33.490  1.00 17.26 ? 634  ARG A CA    1 
ATOM   3231 C  C     . ARG C 3 338 ? 27.235  52.557 32.333  1.00 18.43 ? 634  ARG A C     1 
ATOM   3232 O  O     . ARG C 3 338 ? 26.596  52.791 31.308  1.00 16.99 ? 634  ARG A O     1 
ATOM   3233 C  CB    . ARG C 3 338 ? 25.935  52.768 34.456  1.00 18.16 ? 634  ARG A CB    1 
ATOM   3234 C  CG    . ARG C 3 338 ? 24.760  53.542 33.874  1.00 22.80 ? 634  ARG A CG    1 
ATOM   3235 C  CD    . ARG C 3 338 ? 24.062  54.336 34.968  1.00 25.57 ? 634  ARG A CD    1 
ATOM   3236 N  NE    . ARG C 3 338 ? 22.760  54.838 34.541  1.00 34.25 ? 634  ARG A NE    1 
ATOM   3237 C  CZ    . ARG C 3 338 ? 21.839  55.329 35.368  1.00 37.07 ? 634  ARG A CZ    1 
ATOM   3238 N  NH1   . ARG C 3 338 ? 22.075  55.385 36.675  1.00 37.94 ? 634  ARG A NH1   1 
ATOM   3239 N  NH2   . ARG C 3 338 ? 20.680  55.761 34.888  1.00 38.60 ? 634  ARG A NH2   1 
ATOM   3240 N  N     . LYS C 3 339 ? 28.492  52.950 32.504  1.00 17.92 ? 635  LYS A N     1 
ATOM   3241 C  CA    . LYS C 3 339 ? 29.195  53.688 31.467  1.00 19.72 ? 635  LYS A CA    1 
ATOM   3242 C  C     . LYS C 3 339 ? 29.292  52.918 30.157  1.00 19.07 ? 635  LYS A C     1 
ATOM   3243 O  O     . LYS C 3 339 ? 29.491  53.515 29.102  1.00 18.42 ? 635  LYS A O     1 
ATOM   3244 C  CB    . LYS C 3 339 ? 30.593  54.078 31.950  1.00 21.72 ? 635  LYS A CB    1 
ATOM   3245 C  CG    . LYS C 3 339 ? 30.578  55.265 32.898  1.00 25.31 ? 635  LYS A CG    1 
ATOM   3246 C  CD    . LYS C 3 339 ? 31.977  55.653 33.343  1.00 30.50 ? 635  LYS A CD    1 
ATOM   3247 C  CE    . LYS C 3 339 ? 31.998  57.067 33.915  1.00 34.03 ? 635  LYS A CE    1 
ATOM   3248 N  NZ    . LYS C 3 339 ? 31.021  57.263 35.026  1.00 35.88 ? 635  LYS A NZ    1 
ATOM   3249 N  N     . ILE C 3 340 ? 29.161  51.596 30.226  1.00 17.90 ? 636  ILE A N     1 
ATOM   3250 C  CA    . ILE C 3 340 ? 29.212  50.767 29.025  1.00 18.24 ? 636  ILE A CA    1 
ATOM   3251 C  C     . ILE C 3 340 ? 28.160  51.273 28.040  1.00 16.88 ? 636  ILE A C     1 
ATOM   3252 O  O     . ILE C 3 340 ? 28.352  51.229 26.823  1.00 16.18 ? 636  ILE A O     1 
ATOM   3253 C  CB    . ILE C 3 340 ? 28.909  49.279 29.349  1.00 20.80 ? 636  ILE A CB    1 
ATOM   3254 C  CG1   . ILE C 3 340 ? 30.072  48.658 30.128  1.00 22.11 ? 636  ILE A CG1   1 
ATOM   3255 C  CG2   . ILE C 3 340 ? 28.663  48.502 28.066  1.00 21.69 ? 636  ILE A CG2   1 
ATOM   3256 C  CD1   . ILE C 3 340 ? 31.379  48.635 29.359  1.00 25.27 ? 636  ILE A CD1   1 
ATOM   3257 N  N     . ARG C 3 341 ? 27.054  51.776 28.580  1.00 15.26 ? 637  ARG A N     1 
ATOM   3258 C  CA    . ARG C 3 341 ? 25.965  52.272 27.749  1.00 15.77 ? 637  ARG A CA    1 
ATOM   3259 C  C     . ARG C 3 341 ? 26.292  53.512 26.931  1.00 15.89 ? 637  ARG A C     1 
ATOM   3260 O  O     . ARG C 3 341 ? 25.547  53.868 26.017  1.00 15.89 ? 637  ARG A O     1 
ATOM   3261 C  CB    . ARG C 3 341 ? 24.726  52.510 28.613  1.00 15.87 ? 637  ARG A CB    1 
ATOM   3262 C  CG    . ARG C 3 341 ? 24.199  51.217 29.220  1.00 14.31 ? 637  ARG A CG    1 
ATOM   3263 C  CD    . ARG C 3 341 ? 22.878  51.418 29.945  1.00 17.05 ? 637  ARG A CD    1 
ATOM   3264 N  NE    . ARG C 3 341 ? 22.354  50.146 30.436  1.00 16.85 ? 637  ARG A NE    1 
ATOM   3265 C  CZ    . ARG C 3 341 ? 21.060  49.863 30.540  1.00 16.44 ? 637  ARG A CZ    1 
ATOM   3266 N  NH1   . ARG C 3 341 ? 20.151  50.763 30.185  1.00 16.03 ? 637  ARG A NH1   1 
ATOM   3267 N  NH2   . ARG C 3 341 ? 20.678  48.678 30.993  1.00 16.05 ? 637  ARG A NH2   1 
ATOM   3268 N  N     . GLN C 3 342 ? 27.404  54.169 27.246  1.00 17.50 ? 638  GLN A N     1 
ATOM   3269 C  CA    . GLN C 3 342 ? 27.807  55.348 26.487  1.00 17.26 ? 638  GLN A CA    1 
ATOM   3270 C  C     . GLN C 3 342 ? 28.276  54.880 25.108  1.00 17.73 ? 638  GLN A C     1 
ATOM   3271 O  O     . GLN C 3 342 ? 28.390  55.680 24.178  1.00 18.56 ? 638  GLN A O     1 
ATOM   3272 C  CB    . GLN C 3 342 ? 28.955  56.086 27.183  1.00 20.30 ? 638  GLN A CB    1 
ATOM   3273 C  CG    . GLN C 3 342 ? 28.689  56.481 28.619  1.00 22.92 ? 638  GLN A CG    1 
ATOM   3274 C  CD    . GLN C 3 342 ? 29.844  57.261 29.224  1.00 25.46 ? 638  GLN A CD    1 
ATOM   3275 O  OE1   . GLN C 3 342 ? 31.010  56.907 29.042  1.00 27.18 ? 638  GLN A OE1   1 
ATOM   3276 N  NE2   . GLN C 3 342 ? 29.525  58.325 29.951  1.00 27.13 ? 638  GLN A NE2   1 
ATOM   3277 N  N     . ALA C 3 343 ? 28.545  53.582 24.986  1.00 16.66 ? 639  ALA A N     1 
ATOM   3278 C  CA    . ALA C 3 343 ? 29.005  53.003 23.723  1.00 18.08 ? 639  ALA A CA    1 
ATOM   3279 C  C     . ALA C 3 343 ? 27.870  52.679 22.753  1.00 17.80 ? 639  ALA A C     1 
ATOM   3280 O  O     . ALA C 3 343 ? 28.122  52.394 21.586  1.00 16.85 ? 639  ALA A O     1 
ATOM   3281 C  CB    . ALA C 3 343 ? 29.821  51.744 23.986  1.00 19.89 ? 639  ALA A CB    1 
ATOM   3282 N  N     . PHE C 3 344 ? 26.630  52.707 23.233  1.00 16.07 ? 640  PHE A N     1 
ATOM   3283 C  CA    . PHE C 3 344 ? 25.488  52.436 22.363  1.00 16.43 ? 640  PHE A CA    1 
ATOM   3284 C  C     . PHE C 3 344 ? 24.941  53.786 21.946  1.00 14.78 ? 640  PHE A C     1 
ATOM   3285 O  O     . PHE C 3 344 ? 24.435  54.552 22.767  1.00 15.35 ? 640  PHE A O     1 
ATOM   3286 C  CB    . PHE C 3 344 ? 24.437  51.599 23.093  1.00 15.45 ? 640  PHE A CB    1 
ATOM   3287 C  CG    . PHE C 3 344 ? 24.898  50.200 23.395  1.00 17.42 ? 640  PHE A CG    1 
ATOM   3288 C  CD1   . PHE C 3 344 ? 25.690  49.937 24.509  1.00 19.00 ? 640  PHE A CD1   1 
ATOM   3289 C  CD2   . PHE C 3 344 ? 24.557  49.149 22.555  1.00 17.97 ? 640  PHE A CD2   1 
ATOM   3290 C  CE1   . PHE C 3 344 ? 26.136  48.641 24.781  1.00 18.91 ? 640  PHE A CE1   1 
ATOM   3291 C  CE2   . PHE C 3 344 ? 24.998  47.851 22.817  1.00 19.93 ? 640  PHE A CE2   1 
ATOM   3292 C  CZ    . PHE C 3 344 ? 25.789  47.598 23.932  1.00 18.71 ? 640  PHE A CZ    1 
ATOM   3293 N  N     . VAL C 3 345 ? 25.040  54.059 20.652  1.00 15.01 ? 641  VAL A N     1 
ATOM   3294 C  CA    . VAL C 3 345 ? 24.656  55.346 20.099  1.00 13.93 ? 641  VAL A CA    1 
ATOM   3295 C  C     . VAL C 3 345 ? 23.649  55.268 18.960  1.00 13.58 ? 641  VAL A C     1 
ATOM   3296 O  O     . VAL C 3 345 ? 23.381  54.190 18.435  1.00 14.93 ? 641  VAL A O     1 
ATOM   3297 C  CB    . VAL C 3 345 ? 25.925  56.062 19.595  1.00 14.94 ? 641  VAL A CB    1 
ATOM   3298 C  CG1   . VAL C 3 345 ? 26.957  56.134 20.717  1.00 16.39 ? 641  VAL A CG1   1 
ATOM   3299 C  CG2   . VAL C 3 345 ? 26.516  55.297 18.423  1.00 15.49 ? 641  VAL A CG2   1 
ATOM   3300 N  N     . PRO C 3 346 ? 23.075  56.421 18.564  1.00 15.06 ? 642  PRO A N     1 
ATOM   3301 C  CA    . PRO C 3 346 ? 22.098  56.466 17.470  1.00 15.65 ? 642  PRO A CA    1 
ATOM   3302 C  C     . PRO C 3 346 ? 22.782  56.035 16.171  1.00 16.98 ? 642  PRO A C     1 
ATOM   3303 O  O     . PRO C 3 346 ? 23.984  56.257 16.000  1.00 17.19 ? 642  PRO A O     1 
ATOM   3304 C  CB    . PRO C 3 346 ? 21.651  57.928 17.454  1.00 16.64 ? 642  PRO A CB    1 
ATOM   3305 C  CG    . PRO C 3 346 ? 21.836  58.360 18.861  1.00 15.80 ? 642  PRO A CG    1 
ATOM   3306 C  CD    . PRO C 3 346 ? 23.175  57.740 19.212  1.00 13.57 ? 642  PRO A CD    1 
ATOM   3307 N  N     . SER C 3 347 ? 22.026  55.437 15.255  1.00 17.44 ? 643  SER A N     1 
ATOM   3308 C  CA    . SER C 3 347 ? 22.603  54.961 14.001  1.00 18.99 ? 643  SER A CA    1 
ATOM   3309 C  C     . SER C 3 347 ? 22.816  56.060 12.966  1.00 19.92 ? 643  SER A C     1 
ATOM   3310 O  O     . SER C 3 347 ? 23.492  55.847 11.961  1.00 19.97 ? 643  SER A O     1 
ATOM   3311 C  CB    . SER C 3 347 ? 21.731  53.850 13.404  1.00 18.03 ? 643  SER A CB    1 
ATOM   3312 O  OG    . SER C 3 347 ? 20.451  54.340 13.044  1.00 19.62 ? 643  SER A OG    1 
ATOM   3313 N  N     . GLU C 3 348 ? 22.248  57.234 13.211  1.00 20.65 ? 644  GLU A N     1 
ATOM   3314 C  CA    . GLU C 3 348 ? 22.402  58.341 12.280  1.00 24.69 ? 644  GLU A CA    1 
ATOM   3315 C  C     . GLU C 3 348 ? 22.758  59.642 12.975  1.00 24.45 ? 644  GLU A C     1 
ATOM   3316 O  O     . GLU C 3 348 ? 22.508  59.822 14.170  1.00 22.63 ? 644  GLU A O     1 
ATOM   3317 C  CB    . GLU C 3 348 ? 21.123  58.528 11.460  1.00 26.93 ? 644  GLU A CB    1 
ATOM   3318 C  CG    . GLU C 3 348 ? 20.870  57.409 10.465  1.00 34.15 ? 644  GLU A CG    1 
ATOM   3319 C  CD    . GLU C 3 348 ? 19.612  57.625 9.653   1.00 35.81 ? 644  GLU A CD    1 
ATOM   3320 O  OE1   . GLU C 3 348 ? 19.469  58.713 9.057   1.00 39.65 ? 644  GLU A OE1   1 
ATOM   3321 O  OE2   . GLU C 3 348 ? 18.769  56.704 9.604   1.00 38.16 ? 644  GLU A OE2   1 
ATOM   3322 N  N     . SER C 3 349 ? 23.353  60.551 12.213  1.00 25.10 ? 645  SER A N     1 
ATOM   3323 C  CA    . SER C 3 349 ? 23.738  61.839 12.752  1.00 25.63 ? 645  SER A CA    1 
ATOM   3324 C  C     . SER C 3 349 ? 22.480  62.598 13.146  1.00 23.11 ? 645  SER A C     1 
ATOM   3325 O  O     . SER C 3 349 ? 21.459  62.520 12.463  1.00 24.40 ? 645  SER A O     1 
ATOM   3326 C  CB    . SER C 3 349 ? 24.517  62.644 11.706  1.00 28.10 ? 645  SER A CB    1 
ATOM   3327 O  OG    . SER C 3 349 ? 25.669  61.942 11.276  1.00 33.66 ? 645  SER A OG    1 
ATOM   3328 N  N     . ASP C 3 350 ? 22.565  63.324 14.252  1.00 22.95 ? 646  ASP A N     1 
ATOM   3329 C  CA    . ASP C 3 350 ? 21.454  64.130 14.738  1.00 22.69 ? 646  ASP A CA    1 
ATOM   3330 C  C     . ASP C 3 350 ? 20.241  63.324 15.178  1.00 20.63 ? 646  ASP A C     1 
ATOM   3331 O  O     . ASP C 3 350 ? 19.123  63.837 15.212  1.00 19.97 ? 646  ASP A O     1 
ATOM   3332 C  CB    . ASP C 3 350 ? 21.052  65.149 13.670  1.00 26.24 ? 646  ASP A CB    1 
ATOM   3333 C  CG    . ASP C 3 350 ? 22.210  66.044 13.266  1.00 30.06 ? 646  ASP A CG    1 
ATOM   3334 O  OD1   . ASP C 3 350 ? 22.794  66.696 14.160  1.00 32.35 ? 646  ASP A OD1   1 
ATOM   3335 O  OD2   . ASP C 3 350 ? 22.538  66.094 12.062  1.00 33.96 ? 646  ASP A OD2   1 
ATOM   3336 N  N     . TRP C 3 351 ? 20.467  62.057 15.506  1.00 17.93 ? 647  TRP A N     1 
ATOM   3337 C  CA    . TRP C 3 351 ? 19.398  61.197 15.997  1.00 17.96 ? 647  TRP A CA    1 
ATOM   3338 C  C     . TRP C 3 351 ? 19.678  61.035 17.484  1.00 16.34 ? 647  TRP A C     1 
ATOM   3339 O  O     . TRP C 3 351 ? 20.778  61.347 17.946  1.00 16.80 ? 647  TRP A O     1 
ATOM   3340 C  CB    . TRP C 3 351 ? 19.417  59.839 15.285  1.00 16.41 ? 647  TRP A CB    1 
ATOM   3341 C  CG    . TRP C 3 351 ? 18.684  59.837 13.970  1.00 15.97 ? 647  TRP A CG    1 
ATOM   3342 C  CD1   . TRP C 3 351 ? 18.754  60.789 12.987  1.00 15.71 ? 647  TRP A CD1   1 
ATOM   3343 C  CD2   . TRP C 3 351 ? 17.773  58.836 13.493  1.00 16.79 ? 647  TRP A CD2   1 
ATOM   3344 N  NE1   . TRP C 3 351 ? 17.943  60.441 11.933  1.00 16.90 ? 647  TRP A NE1   1 
ATOM   3345 C  CE2   . TRP C 3 351 ? 17.329  59.249 12.217  1.00 17.82 ? 647  TRP A CE2   1 
ATOM   3346 C  CE3   . TRP C 3 351 ? 17.289  57.630 14.022  1.00 18.31 ? 647  TRP A CE3   1 
ATOM   3347 C  CZ2   . TRP C 3 351 ? 16.419  58.497 11.456  1.00 17.86 ? 647  TRP A CZ2   1 
ATOM   3348 C  CZ3   . TRP C 3 351 ? 16.384  56.880 13.268  1.00 19.18 ? 647  TRP A CZ3   1 
ATOM   3349 C  CH2   . TRP C 3 351 ? 15.959  57.320 11.997  1.00 19.46 ? 647  TRP A CH2   1 
ATOM   3350 N  N     . LEU C 3 352 ? 18.693  60.556 18.235  1.00 14.86 ? 648  LEU A N     1 
ATOM   3351 C  CA    . LEU C 3 352 ? 18.851  60.375 19.674  1.00 13.79 ? 648  LEU A CA    1 
ATOM   3352 C  C     . LEU C 3 352 ? 18.210  59.075 20.138  1.00 14.08 ? 648  LEU A C     1 
ATOM   3353 O  O     . LEU C 3 352 ? 17.321  58.545 19.470  1.00 14.52 ? 648  LEU A O     1 
ATOM   3354 C  CB    . LEU C 3 352 ? 18.201  61.542 20.425  1.00 13.40 ? 648  LEU A CB    1 
ATOM   3355 C  CG    . LEU C 3 352 ? 18.774  62.933 20.138  1.00 14.36 ? 648  LEU A CG    1 
ATOM   3356 C  CD1   . LEU C 3 352 ? 17.922  63.998 20.813  1.00 18.39 ? 648  LEU A CD1   1 
ATOM   3357 C  CD2   . LEU C 3 352 ? 20.209  63.001 20.634  1.00 17.48 ? 648  LEU A CD2   1 
ATOM   3358 N  N     . ILE C 3 353 ? 18.669  58.572 21.281  1.00 14.57 ? 649  ILE A N     1 
ATOM   3359 C  CA    . ILE C 3 353 ? 18.130  57.350 21.874  1.00 13.02 ? 649  ILE A CA    1 
ATOM   3360 C  C     . ILE C 3 353 ? 16.997  57.774 22.811  1.00 14.05 ? 649  ILE A C     1 
ATOM   3361 O  O     . ILE C 3 353 ? 17.159  58.709 23.588  1.00 15.25 ? 649  ILE A O     1 
ATOM   3362 C  CB    . ILE C 3 353 ? 19.198  56.604 22.705  1.00 14.26 ? 649  ILE A CB    1 
ATOM   3363 C  CG1   . ILE C 3 353 ? 20.398  56.242 21.820  1.00 15.51 ? 649  ILE A CG1   1 
ATOM   3364 C  CG2   . ILE C 3 353 ? 18.594  55.352 23.331  1.00 13.18 ? 649  ILE A CG2   1 
ATOM   3365 C  CD1   . ILE C 3 353 ? 20.042  55.421 20.601  1.00 15.99 ? 649  ILE A CD1   1 
ATOM   3366 N  N     . PHE C 3 354 ? 15.861  57.085 22.725  1.00 13.72 ? 650  PHE A N     1 
ATOM   3367 C  CA    . PHE C 3 354 ? 14.686  57.375 23.553  1.00 13.22 ? 650  PHE A CA    1 
ATOM   3368 C  C     . PHE C 3 354 ? 14.324  56.078 24.275  1.00 13.24 ? 650  PHE A C     1 
ATOM   3369 O  O     . PHE C 3 354 ? 14.195  55.030 23.640  1.00 14.49 ? 650  PHE A O     1 
ATOM   3370 C  CB    . PHE C 3 354 ? 13.524  57.846 22.654  1.00 13.44 ? 650  PHE A CB    1 
ATOM   3371 C  CG    . PHE C 3 354 ? 12.249  58.170 23.397  1.00 13.42 ? 650  PHE A CG    1 
ATOM   3372 C  CD1   . PHE C 3 354 ? 11.402  57.156 23.843  1.00 14.59 ? 650  PHE A CD1   1 
ATOM   3373 C  CD2   . PHE C 3 354 ? 11.893  59.497 23.644  1.00 14.91 ? 650  PHE A CD2   1 
ATOM   3374 C  CE1   . PHE C 3 354 ? 10.209  57.462 24.528  1.00 15.58 ? 650  PHE A CE1   1 
ATOM   3375 C  CE2   . PHE C 3 354 ? 10.713  59.813 24.323  1.00 16.97 ? 650  PHE A CE2   1 
ATOM   3376 C  CZ    . PHE C 3 354 ? 9.868   58.795 24.766  1.00 16.01 ? 650  PHE A CZ    1 
ATOM   3377 N  N     . ALA C 3 355 ? 14.170  56.150 25.595  1.00 12.08 ? 651  ALA A N     1 
ATOM   3378 C  CA    . ALA C 3 355 ? 13.834  54.971 26.388  1.00 12.54 ? 651  ALA A CA    1 
ATOM   3379 C  C     . ALA C 3 355 ? 12.612  55.226 27.260  1.00 13.93 ? 651  ALA A C     1 
ATOM   3380 O  O     . ALA C 3 355 ? 12.544  56.229 27.971  1.00 15.29 ? 651  ALA A O     1 
ATOM   3381 C  CB    . ALA C 3 355 ? 15.021  54.574 27.263  1.00 12.47 ? 651  ALA A CB    1 
ATOM   3382 N  N     . ALA C 3 356 ? 11.645  54.316 27.199  1.00 12.28 ? 652  ALA A N     1 
ATOM   3383 C  CA    . ALA C 3 356 ? 10.431  54.439 28.001  1.00 13.64 ? 652  ALA A CA    1 
ATOM   3384 C  C     . ALA C 3 356 ? 10.246  53.145 28.771  1.00 13.45 ? 652  ALA A C     1 
ATOM   3385 O  O     . ALA C 3 356 ? 10.329  52.061 28.193  1.00 13.55 ? 652  ALA A O     1 
ATOM   3386 C  CB    . ALA C 3 356 ? 9.223   54.694 27.110  1.00 13.16 ? 652  ALA A CB    1 
ATOM   3387 N  N     . ASP C 3 357 ? 9.998   53.255 30.072  1.00 13.00 ? 653  ASP A N     1 
ATOM   3388 C  CA    . ASP C 3 357 ? 9.817   52.064 30.893  1.00 13.88 ? 653  ASP A CA    1 
ATOM   3389 C  C     . ASP C 3 357 ? 8.573   52.141 31.769  1.00 12.43 ? 653  ASP A C     1 
ATOM   3390 O  O     . ASP C 3 357 ? 8.203   53.213 32.239  1.00 13.91 ? 653  ASP A O     1 
ATOM   3391 C  CB    . ASP C 3 357 ? 11.033  51.855 31.800  1.00 15.17 ? 653  ASP A CB    1 
ATOM   3392 C  CG    . ASP C 3 357 ? 11.169  52.946 32.853  1.00 21.09 ? 653  ASP A CG    1 
ATOM   3393 O  OD1   . ASP C 3 357 ? 11.453  54.107 32.483  1.00 21.33 ? 653  ASP A OD1   1 
ATOM   3394 O  OD2   . ASP C 3 357 ? 10.983  52.643 34.052  1.00 21.46 ? 653  ASP A OD2   1 
ATOM   3395 N  N     . TYR C 3 358 ? 7.934   50.995 31.977  1.00 12.53 ? 654  TYR A N     1 
ATOM   3396 C  CA    . TYR C 3 358 ? 6.761   50.925 32.846  1.00 12.48 ? 654  TYR A CA    1 
ATOM   3397 C  C     . TYR C 3 358 ? 7.260   51.053 34.277  1.00 14.18 ? 654  TYR A C     1 
ATOM   3398 O  O     . TYR C 3 358 ? 8.310   50.507 34.621  1.00 13.88 ? 654  TYR A O     1 
ATOM   3399 C  CB    . TYR C 3 358 ? 6.059   49.576 32.713  1.00 13.63 ? 654  TYR A CB    1 
ATOM   3400 C  CG    . TYR C 3 358 ? 5.228   49.409 31.472  1.00 12.55 ? 654  TYR A CG    1 
ATOM   3401 C  CD1   . TYR C 3 358 ? 4.018   50.084 31.331  1.00 11.61 ? 654  TYR A CD1   1 
ATOM   3402 C  CD2   . TYR C 3 358 ? 5.643   48.570 30.444  1.00 10.92 ? 654  TYR A CD2   1 
ATOM   3403 C  CE1   . TYR C 3 358 ? 3.239   49.927 30.197  1.00 11.97 ? 654  TYR A CE1   1 
ATOM   3404 C  CE2   . TYR C 3 358 ? 4.868   48.403 29.297  1.00 12.96 ? 654  TYR A CE2   1 
ATOM   3405 C  CZ    . TYR C 3 358 ? 3.668   49.085 29.183  1.00 12.13 ? 654  TYR A CZ    1 
ATOM   3406 O  OH    . TYR C 3 358 ? 2.892   48.932 28.054  1.00 11.48 ? 654  TYR A OH    1 
ATOM   3407 N  N     . SER C 3 359 ? 6.512   51.772 35.105  1.00 13.81 ? 655  SER A N     1 
ATOM   3408 C  CA    . SER C 3 359 ? 6.880   51.920 36.502  1.00 14.99 ? 655  SER A CA    1 
ATOM   3409 C  C     . SER C 3 359 ? 6.117   50.852 37.286  1.00 14.26 ? 655  SER A C     1 
ATOM   3410 O  O     . SER C 3 359 ? 4.887   50.878 37.342  1.00 14.81 ? 655  SER A O     1 
ATOM   3411 C  CB    . SER C 3 359 ? 6.512   53.319 37.009  1.00 16.60 ? 655  SER A CB    1 
ATOM   3412 O  OG    . SER C 3 359 ? 6.767   53.435 38.401  1.00 18.28 ? 655  SER A OG    1 
ATOM   3413 N  N     . GLN C 3 360 ? 6.852   49.908 37.867  1.00 12.24 ? 656  GLN A N     1 
ATOM   3414 C  CA    . GLN C 3 360 ? 6.261   48.832 38.666  1.00 12.90 ? 656  GLN A CA    1 
ATOM   3415 C  C     . GLN C 3 360 ? 5.121   48.103 37.958  1.00 12.91 ? 656  GLN A C     1 
ATOM   3416 O  O     . GLN C 3 360 ? 4.057   47.913 38.544  1.00 12.63 ? 656  GLN A O     1 
ATOM   3417 C  CB    . GLN C 3 360 ? 5.718   49.392 39.986  1.00 13.25 ? 656  GLN A CB    1 
ATOM   3418 C  CG    . GLN C 3 360 ? 6.719   50.140 40.851  1.00 17.80 ? 656  GLN A CG    1 
ATOM   3419 C  CD    . GLN C 3 360 ? 7.845   49.261 41.354  1.00 21.98 ? 656  GLN A CD    1 
ATOM   3420 O  OE1   . GLN C 3 360 ? 7.671   48.059 41.552  1.00 23.85 ? 656  GLN A OE1   1 
ATOM   3421 N  NE2   . GLN C 3 360 ? 9.009   49.861 41.575  1.00 24.26 ? 656  GLN A NE2   1 
ATOM   3422 N  N     . ILE C 3 361 ? 5.324   47.679 36.717  1.00 12.76 ? 657  ILE A N     1 
ATOM   3423 C  CA    . ILE C 3 361 ? 4.236   47.004 36.020  1.00 12.55 ? 657  ILE A CA    1 
ATOM   3424 C  C     . ILE C 3 361 ? 3.826   45.687 36.692  1.00 12.59 ? 657  ILE A C     1 
ATOM   3425 O  O     . ILE C 3 361 ? 2.643   45.367 36.748  1.00 11.87 ? 657  ILE A O     1 
ATOM   3426 C  CB    . ILE C 3 361 ? 4.568   46.758 34.510  1.00 13.57 ? 657  ILE A CB    1 
ATOM   3427 C  CG1   . ILE C 3 361 ? 3.322   46.232 33.786  1.00 13.39 ? 657  ILE A CG1   1 
ATOM   3428 C  CG2   . ILE C 3 361 ? 5.719   45.777 34.359  1.00 13.91 ? 657  ILE A CG2   1 
ATOM   3429 C  CD1   . ILE C 3 361 ? 3.479   46.146 32.266  1.00 14.25 ? 657  ILE A CD1   1 
ATOM   3430 N  N     . GLU C 3 362 ? 4.784   44.933 37.219  1.00 12.96 ? 658  GLU A N     1 
ATOM   3431 C  CA    . GLU C 3 362 ? 4.446   43.664 37.854  1.00 13.05 ? 658  GLU A CA    1 
ATOM   3432 C  C     . GLU C 3 362 ? 3.557   43.829 39.087  1.00 12.13 ? 658  GLU A C     1 
ATOM   3433 O  O     . GLU C 3 362 ? 2.594   43.088 39.253  1.00 12.44 ? 658  GLU A O     1 
ATOM   3434 C  CB    . GLU C 3 362 ? 5.718   42.885 38.204  1.00 16.50 ? 658  GLU A CB    1 
ATOM   3435 C  CG    . GLU C 3 362 ? 6.391   42.273 36.980  1.00 22.01 ? 658  GLU A CG    1 
ATOM   3436 C  CD    . GLU C 3 362 ? 7.610   41.440 37.329  1.00 27.21 ? 658  GLU A CD    1 
ATOM   3437 O  OE1   . GLU C 3 362 ? 8.034   40.623 36.484  1.00 29.50 ? 658  GLU A OE1   1 
ATOM   3438 O  OE2   . GLU C 3 362 ? 8.148   41.602 38.443  1.00 32.78 ? 658  GLU A OE2   1 
ATOM   3439 N  N     . LEU C 3 363 ? 3.862   44.800 39.943  1.00 11.97 ? 659  LEU A N     1 
ATOM   3440 C  CA    . LEU C 3 363 ? 3.038   45.020 41.130  1.00 12.61 ? 659  LEU A CA    1 
ATOM   3441 C  C     . LEU C 3 363 ? 1.668   45.581 40.760  1.00 10.84 ? 659  LEU A C     1 
ATOM   3442 O  O     . LEU C 3 363 ? 0.676   45.315 41.450  1.00 11.00 ? 659  LEU A O     1 
ATOM   3443 C  CB    . LEU C 3 363 ? 3.753   45.951 42.121  1.00 12.79 ? 659  LEU A CB    1 
ATOM   3444 C  CG    . LEU C 3 363 ? 4.834   45.265 42.973  1.00 14.70 ? 659  LEU A CG    1 
ATOM   3445 C  CD1   . LEU C 3 363 ? 5.584   46.296 43.795  1.00 16.94 ? 659  LEU A CD1   1 
ATOM   3446 C  CD2   . LEU C 3 363 ? 4.190   44.226 43.885  1.00 15.27 ? 659  LEU A CD2   1 
ATOM   3447 N  N     . ARG C 3 364 ? 1.614   46.357 39.678  1.00 11.18 ? 660  ARG A N     1 
ATOM   3448 C  CA    . ARG C 3 364 ? 0.349   46.925 39.206  1.00 10.99 ? 660  ARG A CA    1 
ATOM   3449 C  C     . ARG C 3 364 ? -0.496  45.789 38.641  1.00 12.65 ? 660  ARG A C     1 
ATOM   3450 O  O     . ARG C 3 364 ? -1.709  45.744 38.850  1.00 10.04 ? 660  ARG A O     1 
ATOM   3451 C  CB    . ARG C 3 364 ? 0.592   47.993 38.127  1.00 11.20 ? 660  ARG A CB    1 
ATOM   3452 C  CG    . ARG C 3 364 ? 1.102   49.324 38.692  1.00 12.35 ? 660  ARG A CG    1 
ATOM   3453 C  CD    . ARG C 3 364 ? 1.533   50.305 37.606  1.00 10.63 ? 660  ARG A CD    1 
ATOM   3454 N  NE    . ARG C 3 364 ? 2.160   51.498 38.182  1.00 14.80 ? 660  ARG A NE    1 
ATOM   3455 C  CZ    . ARG C 3 364 ? 1.519   52.621 38.504  1.00 16.34 ? 660  ARG A CZ    1 
ATOM   3456 N  NH1   . ARG C 3 364 ? 0.210   52.738 38.305  1.00 14.62 ? 660  ARG A NH1   1 
ATOM   3457 N  NH2   . ARG C 3 364 ? 2.190   53.631 39.042  1.00 16.08 ? 660  ARG A NH2   1 
ATOM   3458 N  N     . VAL C 3 365 ? 0.148   44.869 37.925  1.00 9.93  ? 661  VAL A N     1 
ATOM   3459 C  CA    . VAL C 3 365 ? -0.562  43.722 37.372  1.00 11.85 ? 661  VAL A CA    1 
ATOM   3460 C  C     . VAL C 3 365 ? -1.136  42.886 38.518  1.00 11.42 ? 661  VAL A C     1 
ATOM   3461 O  O     . VAL C 3 365 ? -2.276  42.426 38.452  1.00 12.57 ? 661  VAL A O     1 
ATOM   3462 C  CB    . VAL C 3 365 ? 0.379   42.850 36.506  1.00 11.46 ? 661  VAL A CB    1 
ATOM   3463 C  CG1   . VAL C 3 365 ? -0.229  41.461 36.286  1.00 10.78 ? 661  VAL A CG1   1 
ATOM   3464 C  CG2   . VAL C 3 365 ? 0.615   43.536 35.171  1.00 10.79 ? 661  VAL A CG2   1 
ATOM   3465 N  N     . LEU C 3 366 ? -0.341  42.707 39.570  1.00 10.63 ? 662  LEU A N     1 
ATOM   3466 C  CA    . LEU C 3 366 ? -0.766  41.940 40.740  1.00 13.10 ? 662  LEU A CA    1 
ATOM   3467 C  C     . LEU C 3 366 ? -1.964  42.611 41.414  1.00 12.61 ? 662  LEU A C     1 
ATOM   3468 O  O     . LEU C 3 366 ? -2.910  41.941 41.829  1.00 13.37 ? 662  LEU A O     1 
ATOM   3469 C  CB    . LEU C 3 366 ? 0.384   41.819 41.744  1.00 12.85 ? 662  LEU A CB    1 
ATOM   3470 C  CG    . LEU C 3 366 ? 0.031   41.214 43.110  1.00 14.05 ? 662  LEU A CG    1 
ATOM   3471 C  CD1   . LEU C 3 366 ? -0.549  39.810 42.935  1.00 13.66 ? 662  LEU A CD1   1 
ATOM   3472 C  CD2   . LEU C 3 366 ? 1.281   41.177 43.980  1.00 14.53 ? 662  LEU A CD2   1 
ATOM   3473 N  N     . ALA C 3 367 ? -1.920  43.936 41.517  1.00 12.67 ? 663  ALA A N     1 
ATOM   3474 C  CA    . ALA C 3 367 ? -3.012  44.684 42.128  1.00 12.36 ? 663  ALA A CA    1 
ATOM   3475 C  C     . ALA C 3 367 ? -4.279  44.416 41.332  1.00 13.00 ? 663  ALA A C     1 
ATOM   3476 O  O     . ALA C 3 367 ? -5.352  44.216 41.895  1.00 12.37 ? 663  ALA A O     1 
ATOM   3477 C  CB    . ALA C 3 367 ? -2.702  46.174 42.117  1.00 12.55 ? 663  ALA A CB    1 
ATOM   3478 N  N     . HIS C 3 368 ? -4.138  44.408 40.014  1.00 13.69 ? 664  HIS A N     1 
ATOM   3479 C  CA    . HIS C 3 368 ? -5.261  44.166 39.127  1.00 13.88 ? 664  HIS A CA    1 
ATOM   3480 C  C     . HIS C 3 368 ? -5.839  42.756 39.254  1.00 14.62 ? 664  HIS A C     1 
ATOM   3481 O  O     . HIS C 3 368 ? -7.039  42.584 39.454  1.00 15.29 ? 664  HIS A O     1 
ATOM   3482 C  CB    . HIS C 3 368 ? -4.837  44.392 37.676  1.00 13.86 ? 664  HIS A CB    1 
ATOM   3483 C  CG    . HIS C 3 368 ? -5.862  43.950 36.681  1.00 13.78 ? 664  HIS A CG    1 
ATOM   3484 N  ND1   . HIS C 3 368 ? -6.918  44.747 36.296  1.00 15.18 ? 664  HIS A ND1   1 
ATOM   3485 C  CD2   . HIS C 3 368 ? -6.010  42.780 36.016  1.00 14.93 ? 664  HIS A CD2   1 
ATOM   3486 C  CE1   . HIS C 3 368 ? -7.674  44.086 35.437  1.00 15.25 ? 664  HIS A CE1   1 
ATOM   3487 N  NE2   . HIS C 3 368 ? -7.145  42.889 35.250  1.00 15.58 ? 664  HIS A NE2   1 
ATOM   3488 N  N     . ILE C 3 369 ? -4.982  41.750 39.126  1.00 15.44 ? 665  ILE A N     1 
ATOM   3489 C  CA    . ILE C 3 369 ? -5.428  40.363 39.186  1.00 15.60 ? 665  ILE A CA    1 
ATOM   3490 C  C     . ILE C 3 369 ? -5.953  39.923 40.547  1.00 15.94 ? 665  ILE A C     1 
ATOM   3491 O  O     . ILE C 3 369 ? -6.947  39.202 40.623  1.00 13.42 ? 665  ILE A O     1 
ATOM   3492 C  CB    . ILE C 3 369 ? -4.301  39.394 38.742  1.00 18.20 ? 665  ILE A CB    1 
ATOM   3493 C  CG1   . ILE C 3 369 ? -3.089  39.537 39.659  1.00 22.81 ? 665  ILE A CG1   1 
ATOM   3494 C  CG2   . ILE C 3 369 ? -3.902  39.684 37.305  1.00 16.92 ? 665  ILE A CG2   1 
ATOM   3495 C  CD1   . ILE C 3 369 ? -1.936  38.616 39.288  1.00 25.89 ? 665  ILE A CD1   1 
ATOM   3496 N  N     . ALA C 3 370 ? -5.296  40.357 41.619  1.00 15.28 ? 666  ALA A N     1 
ATOM   3497 C  CA    . ALA C 3 370 ? -5.709  39.991 42.970  1.00 16.68 ? 666  ALA A CA    1 
ATOM   3498 C  C     . ALA C 3 370 ? -6.853  40.865 43.467  1.00 18.00 ? 666  ALA A C     1 
ATOM   3499 O  O     . ALA C 3 370 ? -7.573  40.489 44.397  1.00 18.76 ? 666  ALA A O     1 
ATOM   3500 C  CB    . ALA C 3 370 ? -4.521  40.102 43.931  1.00 15.59 ? 666  ALA A CB    1 
ATOM   3501 N  N     . GLU C 3 371 ? -7.020  42.026 42.840  1.00 17.48 ? 667  GLU A N     1 
ATOM   3502 C  CA    . GLU C 3 371 ? -8.055  42.975 43.232  1.00 19.14 ? 667  GLU A CA    1 
ATOM   3503 C  C     . GLU C 3 371 ? -7.900  43.319 44.712  1.00 19.60 ? 667  GLU A C     1 
ATOM   3504 O  O     . GLU C 3 371 ? -8.875  43.363 45.466  1.00 19.32 ? 667  GLU A O     1 
ATOM   3505 C  CB    . GLU C 3 371 ? -9.450  42.400 42.958  1.00 21.97 ? 667  GLU A CB    1 
ATOM   3506 C  CG    . GLU C 3 371 ? -9.776  42.288 41.478  1.00 23.16 ? 667  GLU A CG    1 
ATOM   3507 C  CD    . GLU C 3 371 ? -11.169 41.746 41.227  1.00 28.44 ? 667  GLU A CD    1 
ATOM   3508 O  OE1   . GLU C 3 371 ? -11.323 40.509 41.124  1.00 28.46 ? 667  GLU A OE1   1 
ATOM   3509 O  OE2   . GLU C 3 371 ? -12.111 42.562 41.144  1.00 28.88 ? 667  GLU A OE2   1 
ATOM   3510 N  N     . ASP C 3 372 ? -6.657  43.555 45.124  1.00 17.83 ? 668  ASP A N     1 
ATOM   3511 C  CA    . ASP C 3 372 ? -6.374  43.909 46.507  1.00 17.08 ? 668  ASP A CA    1 
ATOM   3512 C  C     . ASP C 3 372 ? -6.699  45.392 46.658  1.00 16.15 ? 668  ASP A C     1 
ATOM   3513 O  O     . ASP C 3 372 ? -6.081  46.236 46.013  1.00 12.73 ? 668  ASP A O     1 
ATOM   3514 C  CB    . ASP C 3 372 ? -4.904  43.644 46.822  1.00 17.13 ? 668  ASP A CB    1 
ATOM   3515 C  CG    . ASP C 3 372 ? -4.574  43.866 48.277  1.00 18.71 ? 668  ASP A CG    1 
ATOM   3516 O  OD1   . ASP C 3 372 ? -4.498  45.035 48.702  1.00 17.73 ? 668  ASP A OD1   1 
ATOM   3517 O  OD2   . ASP C 3 372 ? -4.400  42.866 49.002  1.00 21.28 ? 668  ASP A OD2   1 
ATOM   3518 N  N     . ASP C 3 373 ? -7.673  45.712 47.502  1.00 13.91 ? 669  ASP A N     1 
ATOM   3519 C  CA    . ASP C 3 373 ? -8.073  47.106 47.674  1.00 15.98 ? 669  ASP A CA    1 
ATOM   3520 C  C     . ASP C 3 373 ? -6.953  48.050 48.083  1.00 14.71 ? 669  ASP A C     1 
ATOM   3521 O  O     . ASP C 3 373 ? -6.838  49.152 47.544  1.00 14.00 ? 669  ASP A O     1 
ATOM   3522 C  CB    . ASP C 3 373 ? -9.213  47.218 48.687  1.00 19.62 ? 669  ASP A CB    1 
ATOM   3523 C  CG    . ASP C 3 373 ? -10.481 46.533 48.213  1.00 23.97 ? 669  ASP A CG    1 
ATOM   3524 O  OD1   . ASP C 3 373 ? -10.756 46.570 46.999  1.00 25.31 ? 669  ASP A OD1   1 
ATOM   3525 O  OD2   . ASP C 3 373 ? -11.204 45.965 49.055  1.00 28.43 ? 669  ASP A OD2   1 
ATOM   3526 N  N     . ASN C 3 374 ? -6.127  47.621 49.030  1.00 14.03 ? 670  ASN A N     1 
ATOM   3527 C  CA    . ASN C 3 374 ? -5.038  48.462 49.511  1.00 14.81 ? 670  ASN A CA    1 
ATOM   3528 C  C     . ASN C 3 374 ? -3.997  48.703 48.423  1.00 14.68 ? 670  ASN A C     1 
ATOM   3529 O  O     . ASN C 3 374 ? -3.556  49.833 48.216  1.00 13.92 ? 670  ASN A O     1 
ATOM   3530 C  CB    . ASN C 3 374 ? -4.395  47.815 50.744  1.00 16.06 ? 670  ASN A CB    1 
ATOM   3531 C  CG    . ASN C 3 374 ? -3.419  48.734 51.457  1.00 17.81 ? 670  ASN A CG    1 
ATOM   3532 O  OD1   . ASN C 3 374 ? -3.605  49.952 51.505  1.00 21.15 ? 670  ASN A OD1   1 
ATOM   3533 N  ND2   . ASN C 3 374 ? -2.381  48.148 52.041  1.00 20.49 ? 670  ASN A ND2   1 
ATOM   3534 N  N     . LEU C 3 375 ? -3.614  47.645 47.719  1.00 12.95 ? 671  LEU A N     1 
ATOM   3535 C  CA    . LEU C 3 375 ? -2.623  47.780 46.661  1.00 12.14 ? 671  LEU A CA    1 
ATOM   3536 C  C     . LEU C 3 375 ? -3.181  48.604 45.499  1.00 11.41 ? 671  LEU A C     1 
ATOM   3537 O  O     . LEU C 3 375 ? -2.475  49.429 44.931  1.00 11.27 ? 671  LEU A O     1 
ATOM   3538 C  CB    . LEU C 3 375 ? -2.171  46.398 46.169  1.00 12.54 ? 671  LEU A CB    1 
ATOM   3539 C  CG    . LEU C 3 375 ? -0.884  46.392 45.327  1.00 13.56 ? 671  LEU A CG    1 
ATOM   3540 C  CD1   . LEU C 3 375 ? 0.265   46.981 46.145  1.00 15.26 ? 671  LEU A CD1   1 
ATOM   3541 C  CD2   . LEU C 3 375 ? -0.543  44.958 44.907  1.00 15.67 ? 671  LEU A CD2   1 
ATOM   3542 N  N     . MET C 3 376 ? -4.448  48.396 45.147  1.00 11.45 ? 672  MET A N     1 
ATOM   3543 C  CA    . MET C 3 376 ? -5.041  49.167 44.055  1.00 13.43 ? 672  MET A CA    1 
ATOM   3544 C  C     . MET C 3 376 ? -5.128  50.649 44.401  1.00 13.33 ? 672  MET A C     1 
ATOM   3545 O  O     . MET C 3 376 ? -4.885  51.503 43.546  1.00 13.96 ? 672  MET A O     1 
ATOM   3546 C  CB    . MET C 3 376 ? -6.436  48.642 43.703  1.00 13.18 ? 672  MET A CB    1 
ATOM   3547 C  CG    . MET C 3 376 ? -6.427  47.279 43.046  1.00 14.47 ? 672  MET A CG    1 
ATOM   3548 S  SD    . MET C 3 376 ? -8.048  46.831 42.395  1.00 17.35 ? 672  MET A SD    1 
ATOM   3549 C  CE    . MET C 3 376 ? -8.962  46.691 43.867  1.00 13.38 ? 672  MET A CE    1 
ATOM   3550 N  N     . GLU C 3 377 ? -5.475  50.956 45.649  1.00 13.85 ? 673  GLU A N     1 
ATOM   3551 C  CA    . GLU C 3 377 ? -5.563  52.352 46.081  1.00 13.42 ? 673  GLU A CA    1 
ATOM   3552 C  C     . GLU C 3 377 ? -4.165  52.978 46.051  1.00 14.23 ? 673  GLU A C     1 
ATOM   3553 O  O     . GLU C 3 377 ? -3.989  54.134 45.654  1.00 13.02 ? 673  GLU A O     1 
ATOM   3554 C  CB    . GLU C 3 377 ? -6.140  52.434 47.498  1.00 13.64 ? 673  GLU A CB    1 
ATOM   3555 C  CG    . GLU C 3 377 ? -6.133  53.837 48.122  1.00 14.96 ? 673  GLU A CG    1 
ATOM   3556 C  CD    . GLU C 3 377 ? -7.096  54.815 47.462  1.00 15.98 ? 673  GLU A CD    1 
ATOM   3557 O  OE1   . GLU C 3 377 ? -7.845  54.417 46.546  1.00 18.12 ? 673  GLU A OE1   1 
ATOM   3558 O  OE2   . GLU C 3 377 ? -7.104  55.997 47.873  1.00 17.26 ? 673  GLU A OE2   1 
ATOM   3559 N  N     . ALA C 3 378 ? -3.169  52.206 46.468  1.00 13.19 ? 674  ALA A N     1 
ATOM   3560 C  CA    . ALA C 3 378 ? -1.794  52.693 46.476  1.00 14.12 ? 674  ALA A CA    1 
ATOM   3561 C  C     . ALA C 3 378 ? -1.369  53.148 45.082  1.00 13.86 ? 674  ALA A C     1 
ATOM   3562 O  O     . ALA C 3 378 ? -0.806  54.227 44.918  1.00 12.74 ? 674  ALA A O     1 
ATOM   3563 C  CB    . ALA C 3 378 ? -0.850  51.603 46.984  1.00 14.12 ? 674  ALA A CB    1 
ATOM   3564 N  N     . PHE C 3 379 ? -1.639  52.328 44.071  1.00 13.56 ? 675  PHE A N     1 
ATOM   3565 C  CA    . PHE C 3 379 ? -1.264  52.703 42.719  1.00 13.26 ? 675  PHE A CA    1 
ATOM   3566 C  C     . PHE C 3 379 ? -2.177  53.790 42.157  1.00 14.04 ? 675  PHE A C     1 
ATOM   3567 O  O     . PHE C 3 379 ? -1.757  54.591 41.325  1.00 14.83 ? 675  PHE A O     1 
ATOM   3568 C  CB    . PHE C 3 379 ? -1.236  51.467 41.816  1.00 12.57 ? 675  PHE A CB    1 
ATOM   3569 C  CG    . PHE C 3 379 ? -0.003  50.629 42.002  1.00 11.60 ? 675  PHE A CG    1 
ATOM   3570 C  CD1   . PHE C 3 379 ? 1.262   51.179 41.787  1.00 12.38 ? 675  PHE A CD1   1 
ATOM   3571 C  CD2   . PHE C 3 379 ? -0.097  49.308 42.425  1.00 11.03 ? 675  PHE A CD2   1 
ATOM   3572 C  CE1   . PHE C 3 379 ? 2.414   50.422 41.995  1.00 14.61 ? 675  PHE A CE1   1 
ATOM   3573 C  CE2   . PHE C 3 379 ? 1.045   48.543 42.635  1.00 12.37 ? 675  PHE A CE2   1 
ATOM   3574 C  CZ    . PHE C 3 379 ? 2.305   49.101 42.420  1.00 13.65 ? 675  PHE A CZ    1 
ATOM   3575 N  N     . ARG C 3 380 ? -3.421  53.838 42.620  1.00 12.68 ? 676  ARG A N     1 
ATOM   3576 C  CA    . ARG C 3 380 ? -4.323  54.880 42.148  1.00 14.52 ? 676  ARG A CA    1 
ATOM   3577 C  C     . ARG C 3 380 ? -3.832  56.239 42.646  1.00 14.17 ? 676  ARG A C     1 
ATOM   3578 O  O     . ARG C 3 380 ? -4.063  57.264 42.004  1.00 14.83 ? 676  ARG A O     1 
ATOM   3579 C  CB    . ARG C 3 380 ? -5.755  54.595 42.613  1.00 14.94 ? 676  ARG A CB    1 
ATOM   3580 C  CG    . ARG C 3 380 ? -6.406  53.513 41.769  1.00 16.21 ? 676  ARG A CG    1 
ATOM   3581 C  CD    . ARG C 3 380 ? -7.698  52.964 42.359  1.00 20.30 ? 676  ARG A CD    1 
ATOM   3582 N  NE    . ARG C 3 380 ? -8.273  51.971 41.458  1.00 20.85 ? 676  ARG A NE    1 
ATOM   3583 C  CZ    . ARG C 3 380 ? -9.232  51.109 41.787  1.00 25.54 ? 676  ARG A CZ    1 
ATOM   3584 N  NH1   . ARG C 3 380 ? -9.736  51.104 43.014  1.00 23.76 ? 676  ARG A NH1   1 
ATOM   3585 N  NH2   . ARG C 3 380 ? -9.694  50.256 40.878  1.00 24.00 ? 676  ARG A NH2   1 
ATOM   3586 N  N     . ARG C 3 381 ? -3.136  56.238 43.779  1.00 14.52 ? 677  ARG A N     1 
ATOM   3587 C  CA    . ARG C 3 381 ? -2.576  57.463 44.346  1.00 14.91 ? 677  ARG A CA    1 
ATOM   3588 C  C     . ARG C 3 381 ? -1.151  57.637 43.824  1.00 15.22 ? 677  ARG A C     1 
ATOM   3589 O  O     . ARG C 3 381 ? -0.463  58.592 44.189  1.00 15.63 ? 677  ARG A O     1 
ATOM   3590 C  CB    . ARG C 3 381 ? -2.512  57.392 45.876  1.00 16.50 ? 677  ARG A CB    1 
ATOM   3591 C  CG    . ARG C 3 381 ? -3.840  57.278 46.600  1.00 17.02 ? 677  ARG A CG    1 
ATOM   3592 C  CD    . ARG C 3 381 ? -3.624  57.295 48.112  1.00 16.99 ? 677  ARG A CD    1 
ATOM   3593 N  NE    . ARG C 3 381 ? -4.842  56.963 48.847  1.00 19.70 ? 677  ARG A NE    1 
ATOM   3594 C  CZ    . ARG C 3 381 ? -4.932  56.941 50.174  1.00 20.19 ? 677  ARG A CZ    1 
ATOM   3595 N  NH1   . ARG C 3 381 ? -3.874  57.239 50.919  1.00 20.59 ? 677  ARG A NH1   1 
ATOM   3596 N  NH2   . ARG C 3 381 ? -6.077  56.615 50.758  1.00 19.76 ? 677  ARG A NH2   1 
ATOM   3597 N  N     . ASP C 3 382 ? -0.722  56.708 42.974  1.00 15.14 ? 678  ASP A N     1 
ATOM   3598 C  CA    . ASP C 3 382 ? 0.630   56.703 42.414  1.00 17.31 ? 678  ASP A CA    1 
ATOM   3599 C  C     . ASP C 3 382 ? 1.666   56.925 43.513  1.00 17.83 ? 678  ASP A C     1 
ATOM   3600 O  O     . ASP C 3 382 ? 2.586   57.726 43.368  1.00 19.77 ? 678  ASP A O     1 
ATOM   3601 C  CB    . ASP C 3 382 ? 0.790   57.767 41.321  1.00 18.26 ? 678  ASP A CB    1 
ATOM   3602 C  CG    . ASP C 3 382 ? 2.118   57.639 40.575  1.00 20.57 ? 678  ASP A CG    1 
ATOM   3603 O  OD1   . ASP C 3 382 ? 2.579   56.495 40.380  1.00 18.98 ? 678  ASP A OD1   1 
ATOM   3604 O  OD2   . ASP C 3 382 ? 2.697   58.671 40.172  1.00 22.00 ? 678  ASP A OD2   1 
ATOM   3605 N  N     . LEU C 3 383 ? 1.507   56.195 44.611  1.00 18.28 ? 679  LEU A N     1 
ATOM   3606 C  CA    . LEU C 3 383 ? 2.414   56.292 45.751  1.00 19.14 ? 679  LEU A CA    1 
ATOM   3607 C  C     . LEU C 3 383 ? 3.721   55.545 45.522  1.00 18.80 ? 679  LEU A C     1 
ATOM   3608 O  O     . LEU C 3 383 ? 3.818   54.693 44.637  1.00 18.59 ? 679  LEU A O     1 
ATOM   3609 C  CB    . LEU C 3 383 ? 1.769   55.701 47.006  1.00 20.21 ? 679  LEU A CB    1 
ATOM   3610 C  CG    . LEU C 3 383 ? 0.437   56.222 47.531  1.00 21.41 ? 679  LEU A CG    1 
ATOM   3611 C  CD1   . LEU C 3 383 ? 0.040   55.400 48.751  1.00 23.44 ? 679  LEU A CD1   1 
ATOM   3612 C  CD2   . LEU C 3 383 ? 0.557   57.692 47.887  1.00 22.51 ? 679  LEU A CD2   1 
ATOM   3613 N  N     . ASP C 3 384 ? 4.727   55.873 46.328  1.00 17.52 ? 680  ASP A N     1 
ATOM   3614 C  CA    . ASP C 3 384 ? 6.002   55.168 46.267  1.00 17.90 ? 680  ASP A CA    1 
ATOM   3615 C  C     . ASP C 3 384 ? 5.579   53.847 46.904  1.00 16.76 ? 680  ASP A C     1 
ATOM   3616 O  O     . ASP C 3 384 ? 5.313   53.792 48.105  1.00 16.31 ? 680  ASP A O     1 
ATOM   3617 C  CB    . ASP C 3 384 ? 7.048   55.857 47.139  1.00 18.83 ? 680  ASP A CB    1 
ATOM   3618 C  CG    . ASP C 3 384 ? 8.384   55.150 47.107  1.00 23.43 ? 680  ASP A CG    1 
ATOM   3619 O  OD1   . ASP C 3 384 ? 8.415   53.927 47.356  1.00 21.90 ? 680  ASP A OD1   1 
ATOM   3620 O  OD2   . ASP C 3 384 ? 9.405   55.817 46.832  1.00 28.60 ? 680  ASP A OD2   1 
ATOM   3621 N  N     . ILE C 3 385 ? 5.510   52.788 46.109  1.00 17.06 ? 681  ILE A N     1 
ATOM   3622 C  CA    . ILE C 3 385 ? 5.032   51.512 46.621  1.00 15.62 ? 681  ILE A CA    1 
ATOM   3623 C  C     . ILE C 3 385 ? 5.878   50.874 47.717  1.00 16.03 ? 681  ILE A C     1 
ATOM   3624 O  O     . ILE C 3 385 ? 5.353   50.167 48.574  1.00 14.52 ? 681  ILE A O     1 
ATOM   3625 C  CB    . ILE C 3 385 ? 4.819   50.499 45.462  1.00 15.98 ? 681  ILE A CB    1 
ATOM   3626 C  CG1   . ILE C 3 385 ? 3.976   49.324 45.954  1.00 17.32 ? 681  ILE A CG1   1 
ATOM   3627 C  CG2   . ILE C 3 385 ? 6.162   50.000 44.934  1.00 16.91 ? 681  ILE A CG2   1 
ATOM   3628 C  CD1   . ILE C 3 385 ? 2.622   49.738 46.523  1.00 21.37 ? 681  ILE A CD1   1 
ATOM   3629 N  N     . HIS C 3 386 ? 7.181   51.124 47.712  1.00 15.96 ? 682  HIS A N     1 
ATOM   3630 C  CA    . HIS C 3 386 ? 8.024   50.526 48.735  1.00 16.88 ? 682  HIS A CA    1 
ATOM   3631 C  C     . HIS C 3 386 ? 7.848   51.236 50.074  1.00 14.96 ? 682  HIS A C     1 
ATOM   3632 O  O     . HIS C 3 386 ? 7.805   50.597 51.121  1.00 15.30 ? 682  HIS A O     1 
ATOM   3633 C  CB    . HIS C 3 386 ? 9.484   50.550 48.293  1.00 17.35 ? 682  HIS A CB    1 
ATOM   3634 C  CG    . HIS C 3 386 ? 9.716   49.896 46.969  1.00 17.68 ? 682  HIS A CG    1 
ATOM   3635 N  ND1   . HIS C 3 386 ? 9.216   48.651 46.658  1.00 19.23 ? 682  HIS A ND1   1 
ATOM   3636 C  CD2   . HIS C 3 386 ? 10.382  50.319 45.869  1.00 18.05 ? 682  HIS A CD2   1 
ATOM   3637 C  CE1   . HIS C 3 386 ? 9.563   48.335 45.423  1.00 17.49 ? 682  HIS A CE1   1 
ATOM   3638 N  NE2   . HIS C 3 386 ? 10.270  49.331 44.922  1.00 17.43 ? 682  HIS A NE2   1 
ATOM   3639 N  N     . THR C 3 387 ? 7.732   52.559 50.035  1.00 15.90 ? 683  THR A N     1 
ATOM   3640 C  CA    . THR C 3 387 ? 7.535   53.331 51.255  1.00 14.97 ? 683  THR A CA    1 
ATOM   3641 C  C     . THR C 3 387 ? 6.159   52.976 51.815  1.00 15.37 ? 683  THR A C     1 
ATOM   3642 O  O     . THR C 3 387 ? 5.994   52.795 53.019  1.00 15.01 ? 683  THR A O     1 
ATOM   3643 C  CB    . THR C 3 387 ? 7.623   54.846 50.966  1.00 15.78 ? 683  THR A CB    1 
ATOM   3644 O  OG1   . THR C 3 387 ? 8.956   55.165 50.553  1.00 17.37 ? 683  THR A OG1   1 
ATOM   3645 C  CG2   . THR C 3 387 ? 7.264   55.666 52.202  1.00 14.51 ? 683  THR A CG2   1 
ATOM   3646 N  N     . LYS C 3 388 ? 5.174   52.854 50.931  1.00 16.69 ? 684  LYS A N     1 
ATOM   3647 C  CA    . LYS C 3 388 ? 3.819   52.508 51.349  1.00 16.37 ? 684  LYS A CA    1 
ATOM   3648 C  C     . LYS C 3 388 ? 3.761   51.122 51.994  1.00 15.89 ? 684  LYS A C     1 
ATOM   3649 O  O     . LYS C 3 388 ? 3.101   50.928 53.019  1.00 18.27 ? 684  LYS A O     1 
ATOM   3650 C  CB    . LYS C 3 388 ? 2.882   52.576 50.139  1.00 18.89 ? 684  LYS A CB    1 
ATOM   3651 C  CG    . LYS C 3 388 ? 1.593   51.786 50.275  1.00 20.67 ? 684  LYS A CG    1 
ATOM   3652 C  CD    . LYS C 3 388 ? 0.691   52.310 51.377  1.00 23.29 ? 684  LYS A CD    1 
ATOM   3653 C  CE    . LYS C 3 388 ? -0.623  51.540 51.380  1.00 24.43 ? 684  LYS A CE    1 
ATOM   3654 N  NZ    . LYS C 3 388 ? -1.498  51.908 52.517  1.00 23.29 ? 684  LYS A NZ    1 
ATOM   3655 N  N     . THR C 3 389 ? 4.452   50.161 51.391  1.00 15.90 ? 685  THR A N     1 
ATOM   3656 C  CA    . THR C 3 389 ? 4.486   48.802 51.915  1.00 16.42 ? 685  THR A CA    1 
ATOM   3657 C  C     . THR C 3 389 ? 5.137   48.809 53.296  1.00 17.42 ? 685  THR A C     1 
ATOM   3658 O  O     . THR C 3 389 ? 4.688   48.106 54.201  1.00 17.06 ? 685  THR A O     1 
ATOM   3659 C  CB    . THR C 3 389 ? 5.269   47.862 50.971  1.00 16.60 ? 685  THR A CB    1 
ATOM   3660 O  OG1   . THR C 3 389 ? 4.580   47.769 49.717  1.00 17.72 ? 685  THR A OG1   1 
ATOM   3661 C  CG2   . THR C 3 389 ? 5.388   46.468 51.568  1.00 15.34 ? 685  THR A CG2   1 
ATOM   3662 N  N     . ALA C 3 390 ? 6.190   49.612 53.449  1.00 17.81 ? 686  ALA A N     1 
ATOM   3663 C  CA    . ALA C 3 390 ? 6.898   49.727 54.724  1.00 17.78 ? 686  ALA A CA    1 
ATOM   3664 C  C     . ALA C 3 390 ? 5.967   50.314 55.783  1.00 19.99 ? 686  ALA A C     1 
ATOM   3665 O  O     . ALA C 3 390 ? 5.959   49.870 56.931  1.00 20.48 ? 686  ALA A O     1 
ATOM   3666 C  CB    . ALA C 3 390 ? 8.133   50.618 54.565  1.00 18.02 ? 686  ALA A CB    1 
ATOM   3667 N  N     . MET C 3 391 ? 5.185   51.317 55.394  1.00 20.98 ? 687  MET A N     1 
ATOM   3668 C  CA    . MET C 3 391 ? 4.244   51.950 56.313  1.00 22.36 ? 687  MET A CA    1 
ATOM   3669 C  C     . MET C 3 391 ? 3.242   50.946 56.869  1.00 23.48 ? 687  MET A C     1 
ATOM   3670 O  O     . MET C 3 391 ? 2.918   50.978 58.059  1.00 22.17 ? 687  MET A O     1 
ATOM   3671 C  CB    . MET C 3 391 ? 3.485   53.077 55.611  1.00 22.92 ? 687  MET A CB    1 
ATOM   3672 C  CG    . MET C 3 391 ? 4.307   54.327 55.378  1.00 23.74 ? 687  MET A CG    1 
ATOM   3673 S  SD    . MET C 3 391 ? 3.470   55.516 54.314  1.00 26.96 ? 687  MET A SD    1 
ATOM   3674 C  CE    . MET C 3 391 ? 2.160   56.102 55.404  1.00 26.81 ? 687  MET A CE    1 
ATOM   3675 N  N     . ASP C 3 392 ? 2.754   50.055 56.008  1.00 22.65 ? 688  ASP A N     1 
ATOM   3676 C  CA    . ASP C 3 392 ? 1.775   49.058 56.426  1.00 24.66 ? 688  ASP A CA    1 
ATOM   3677 C  C     . ASP C 3 392 ? 2.366   47.905 57.226  1.00 24.93 ? 688  ASP A C     1 
ATOM   3678 O  O     . ASP C 3 392 ? 1.794   47.489 58.228  1.00 25.73 ? 688  ASP A O     1 
ATOM   3679 C  CB    . ASP C 3 392 ? 1.026   48.486 55.215  1.00 25.06 ? 688  ASP A CB    1 
ATOM   3680 C  CG    . ASP C 3 392 ? 0.198   49.529 54.489  1.00 26.47 ? 688  ASP A CG    1 
ATOM   3681 O  OD1   . ASP C 3 392 ? -0.251  50.496 55.134  1.00 26.50 ? 688  ASP A OD1   1 
ATOM   3682 O  OD2   . ASP C 3 392 ? -0.010  49.376 53.268  1.00 30.24 ? 688  ASP A OD2   1 
ATOM   3683 N  N     . ILE C 3 393 ? 3.505   47.385 56.781  1.00 25.68 ? 689  ILE A N     1 
ATOM   3684 C  CA    . ILE C 3 393 ? 4.146   46.269 57.469  1.00 27.89 ? 689  ILE A CA    1 
ATOM   3685 C  C     . ILE C 3 393 ? 4.626   46.654 58.862  1.00 29.64 ? 689  ILE A C     1 
ATOM   3686 O  O     . ILE C 3 393 ? 4.512   45.871 59.805  1.00 30.43 ? 689  ILE A O     1 
ATOM   3687 C  CB    . ILE C 3 393 ? 5.358   45.735 56.670  1.00 28.12 ? 689  ILE A CB    1 
ATOM   3688 C  CG1   . ILE C 3 393 ? 4.880   45.006 55.416  1.00 27.86 ? 689  ILE A CG1   1 
ATOM   3689 C  CG2   . ILE C 3 393 ? 6.191   44.795 57.540  1.00 30.78 ? 689  ILE A CG2   1 
ATOM   3690 C  CD1   . ILE C 3 393 ? 6.013   44.499 54.551  1.00 29.01 ? 689  ILE A CD1   1 
ATOM   3691 N  N     . PHE C 3 394 ? 5.160   47.863 58.989  1.00 29.86 ? 690  PHE A N     1 
ATOM   3692 C  CA    . PHE C 3 394 ? 5.680   48.326 60.267  1.00 31.12 ? 690  PHE A CA    1 
ATOM   3693 C  C     . PHE C 3 394 ? 4.708   49.196 61.056  1.00 32.18 ? 690  PHE A C     1 
ATOM   3694 O  O     . PHE C 3 394 ? 4.994   49.583 62.189  1.00 32.43 ? 690  PHE A O     1 
ATOM   3695 C  CB    . PHE C 3 394 ? 6.997   49.069 60.038  1.00 30.51 ? 690  PHE A CB    1 
ATOM   3696 C  CG    . PHE C 3 394 ? 8.048   48.232 59.363  1.00 31.36 ? 690  PHE A CG    1 
ATOM   3697 C  CD1   . PHE C 3 394 ? 8.504   47.059 59.954  1.00 33.54 ? 690  PHE A CD1   1 
ATOM   3698 C  CD2   . PHE C 3 394 ? 8.569   48.604 58.128  1.00 31.31 ? 690  PHE A CD2   1 
ATOM   3699 C  CE1   . PHE C 3 394 ? 9.464   46.267 59.323  1.00 33.63 ? 690  PHE A CE1   1 
ATOM   3700 C  CE2   . PHE C 3 394 ? 9.528   47.822 57.491  1.00 31.86 ? 690  PHE A CE2   1 
ATOM   3701 C  CZ    . PHE C 3 394 ? 9.976   46.652 58.088  1.00 33.85 ? 690  PHE A CZ    1 
ATOM   3702 N  N     . GLN C 3 395 ? 3.562   49.503 60.459  1.00 32.45 ? 691  GLN A N     1 
ATOM   3703 C  CA    . GLN C 3 395 ? 2.550   50.313 61.130  1.00 33.59 ? 691  GLN A CA    1 
ATOM   3704 C  C     . GLN C 3 395 ? 3.070   51.693 61.526  1.00 33.71 ? 691  GLN A C     1 
ATOM   3705 O  O     . GLN C 3 395 ? 2.840   52.146 62.649  1.00 34.38 ? 691  GLN A O     1 
ATOM   3706 C  CB    . GLN C 3 395 ? 2.063   49.596 62.388  1.00 35.23 ? 691  GLN A CB    1 
ATOM   3707 C  CG    . GLN C 3 395 ? 1.437   48.236 62.158  1.00 38.82 ? 691  GLN A CG    1 
ATOM   3708 C  CD    . GLN C 3 395 ? 1.651   47.309 63.344  1.00 41.89 ? 691  GLN A CD    1 
ATOM   3709 O  OE1   . GLN C 3 395 ? 1.504   47.715 64.500  1.00 44.22 ? 691  GLN A OE1   1 
ATOM   3710 N  NE2   . GLN C 3 395 ? 1.997   46.055 63.063  1.00 42.14 ? 691  GLN A NE2   1 
ATOM   3711 N  N     . VAL C 3 396 ? 3.767   52.362 60.615  1.00 31.88 ? 692  VAL A N     1 
ATOM   3712 C  CA    . VAL C 3 396 ? 4.295   53.690 60.903  1.00 30.21 ? 692  VAL A CA    1 
ATOM   3713 C  C     . VAL C 3 396 ? 3.825   54.702 59.867  1.00 30.92 ? 692  VAL A C     1 
ATOM   3714 O  O     . VAL C 3 396 ? 3.368   54.331 58.783  1.00 30.78 ? 692  VAL A O     1 
ATOM   3715 C  CB    . VAL C 3 396 ? 5.844   53.696 60.927  1.00 29.89 ? 692  VAL A CB    1 
ATOM   3716 C  CG1   . VAL C 3 396 ? 6.356   52.733 61.981  1.00 28.39 ? 692  VAL A CG1   1 
ATOM   3717 C  CG2   . VAL C 3 396 ? 6.389   53.330 59.559  1.00 29.19 ? 692  VAL A CG2   1 
ATOM   3718 N  N     . SER C 3 397 ? 3.935   55.982 60.206  1.00 29.69 ? 693  SER A N     1 
ATOM   3719 C  CA    . SER C 3 397 ? 3.538   57.041 59.290  1.00 30.69 ? 693  SER A CA    1 
ATOM   3720 C  C     . SER C 3 397 ? 4.636   57.162 58.241  1.00 30.92 ? 693  SER A C     1 
ATOM   3721 O  O     . SER C 3 397 ? 5.713   56.591 58.405  1.00 28.80 ? 693  SER A O     1 
ATOM   3722 C  CB    . SER C 3 397 ? 3.389   58.366 60.036  1.00 31.11 ? 693  SER A CB    1 
ATOM   3723 O  OG    . SER C 3 397 ? 4.645   58.823 60.509  1.00 33.23 ? 693  SER A OG    1 
ATOM   3724 N  N     . GLU C 3 398 ? 4.371   57.899 57.168  1.00 30.16 ? 694  GLU A N     1 
ATOM   3725 C  CA    . GLU C 3 398 ? 5.367   58.062 56.117  1.00 31.97 ? 694  GLU A CA    1 
ATOM   3726 C  C     . GLU C 3 398 ? 6.654   58.681 56.655  1.00 32.16 ? 694  GLU A C     1 
ATOM   3727 O  O     . GLU C 3 398 ? 7.754   58.306 56.243  1.00 31.05 ? 694  GLU A O     1 
ATOM   3728 C  CB    . GLU C 3 398 ? 4.823   58.932 54.983  1.00 33.64 ? 694  GLU A CB    1 
ATOM   3729 C  CG    . GLU C 3 398 ? 5.750   58.984 53.778  1.00 35.78 ? 694  GLU A CG    1 
ATOM   3730 C  CD    . GLU C 3 398 ? 5.139   59.699 52.592  1.00 38.24 ? 694  GLU A CD    1 
ATOM   3731 O  OE1   . GLU C 3 398 ? 3.985   59.382 52.234  1.00 41.64 ? 694  GLU A OE1   1 
ATOM   3732 O  OE2   . GLU C 3 398 ? 5.813   60.574 52.012  1.00 39.41 ? 694  GLU A OE2   1 
ATOM   3733 N  N     . ASP C 3 399 ? 6.509   59.630 57.575  1.00 32.80 ? 695  ASP A N     1 
ATOM   3734 C  CA    . ASP C 3 399 ? 7.656   60.306 58.171  1.00 33.48 ? 695  ASP A CA    1 
ATOM   3735 C  C     . ASP C 3 399 ? 8.498   59.368 59.026  1.00 32.20 ? 695  ASP A C     1 
ATOM   3736 O  O     . ASP C 3 399 ? 9.695   59.591 59.204  1.00 33.31 ? 695  ASP A O     1 
ATOM   3737 C  CB    . ASP C 3 399 ? 7.188   61.483 59.030  1.00 36.92 ? 695  ASP A CB    1 
ATOM   3738 C  CG    . ASP C 3 399 ? 6.632   62.626 58.204  1.00 41.04 ? 695  ASP A CG    1 
ATOM   3739 O  OD1   . ASP C 3 399 ? 6.177   63.625 58.803  1.00 43.65 ? 695  ASP A OD1   1 
ATOM   3740 O  OD2   . ASP C 3 399 ? 6.654   62.530 56.956  1.00 43.08 ? 695  ASP A OD2   1 
ATOM   3741 N  N     . GLU C 3 400 ? 7.871   58.320 59.548  1.00 29.80 ? 696  GLU A N     1 
ATOM   3742 C  CA    . GLU C 3 400 ? 8.563   57.362 60.403  1.00 28.62 ? 696  GLU A CA    1 
ATOM   3743 C  C     . GLU C 3 400 ? 9.259   56.232 59.649  1.00 26.37 ? 696  GLU A C     1 
ATOM   3744 O  O     . GLU C 3 400 ? 9.923   55.395 60.261  1.00 25.50 ? 696  GLU A O     1 
ATOM   3745 C  CB    . GLU C 3 400 ? 7.582   56.766 61.413  1.00 31.91 ? 696  GLU A CB    1 
ATOM   3746 C  CG    . GLU C 3 400 ? 6.969   57.792 62.352  1.00 36.21 ? 696  GLU A CG    1 
ATOM   3747 C  CD    . GLU C 3 400 ? 5.933   57.186 63.280  1.00 39.47 ? 696  GLU A CD    1 
ATOM   3748 O  OE1   . GLU C 3 400 ? 4.899   56.694 62.781  1.00 41.08 ? 696  GLU A OE1   1 
ATOM   3749 O  OE2   . GLU C 3 400 ? 6.153   57.199 64.509  1.00 42.57 ? 696  GLU A OE2   1 
ATOM   3750 N  N     . VAL C 3 401 ? 9.110   56.200 58.328  1.00 21.67 ? 697  VAL A N     1 
ATOM   3751 C  CA    . VAL C 3 401 ? 9.752   55.155 57.539  1.00 20.39 ? 697  VAL A CA    1 
ATOM   3752 C  C     . VAL C 3 401 ? 11.234  55.456 57.368  1.00 18.95 ? 697  VAL A C     1 
ATOM   3753 O  O     . VAL C 3 401 ? 11.610  56.457 56.763  1.00 19.41 ? 697  VAL A O     1 
ATOM   3754 C  CB    . VAL C 3 401 ? 9.113   55.015 56.139  1.00 19.55 ? 697  VAL A CB    1 
ATOM   3755 C  CG1   . VAL C 3 401 ? 9.905   54.020 55.302  1.00 18.19 ? 697  VAL A CG1   1 
ATOM   3756 C  CG2   . VAL C 3 401 ? 7.669   54.551 56.272  1.00 17.10 ? 697  VAL A CG2   1 
ATOM   3757 N  N     . THR C 3 402 ? 12.072  54.580 57.909  1.00 18.87 ? 698  THR A N     1 
ATOM   3758 C  CA    . THR C 3 402 ? 13.510  54.750 57.810  1.00 17.76 ? 698  THR A CA    1 
ATOM   3759 C  C     . THR C 3 402 ? 14.018  54.100 56.532  1.00 17.13 ? 698  THR A C     1 
ATOM   3760 O  O     . THR C 3 402 ? 13.329  53.284 55.919  1.00 18.53 ? 698  THR A O     1 
ATOM   3761 C  CB    . THR C 3 402 ? 14.240  54.093 59.003  1.00 18.49 ? 698  THR A CB    1 
ATOM   3762 O  OG1   . THR C 3 402 ? 13.979  52.683 59.001  1.00 19.26 ? 698  THR A OG1   1 
ATOM   3763 C  CG2   . THR C 3 402 ? 13.765  54.686 60.317  1.00 18.85 ? 698  THR A CG2   1 
ATOM   3764 N  N     . PRO C 3 403 ? 15.234  54.461 56.106  1.00 16.96 ? 699  PRO A N     1 
ATOM   3765 C  CA    . PRO C 3 403 ? 15.812  53.884 54.893  1.00 16.01 ? 699  PRO A CA    1 
ATOM   3766 C  C     . PRO C 3 403 ? 15.852  52.351 54.939  1.00 16.64 ? 699  PRO A C     1 
ATOM   3767 O  O     . PRO C 3 403 ? 15.559  51.687 53.946  1.00 14.97 ? 699  PRO A O     1 
ATOM   3768 C  CB    . PRO C 3 403 ? 17.200  54.515 54.839  1.00 17.52 ? 699  PRO A CB    1 
ATOM   3769 C  CG    . PRO C 3 403 ? 16.955  55.877 55.418  1.00 16.74 ? 699  PRO A CG    1 
ATOM   3770 C  CD    . PRO C 3 403 ? 16.050  55.588 56.597  1.00 17.89 ? 699  PRO A CD    1 
ATOM   3771 N  N     . ASN C 3 404 ? 16.200  51.787 56.094  1.00 15.84 ? 700  ASN A N     1 
ATOM   3772 C  CA    . ASN C 3 404 ? 16.281  50.336 56.200  1.00 16.13 ? 700  ASN A CA    1 
ATOM   3773 C  C     . ASN C 3 404 ? 14.907  49.692 56.119  1.00 17.06 ? 700  ASN A C     1 
ATOM   3774 O  O     . ASN C 3 404 ? 14.757  48.607 55.553  1.00 15.27 ? 700  ASN A O     1 
ATOM   3775 C  CB    . ASN C 3 404 ? 16.982  49.920 57.495  1.00 16.35 ? 700  ASN A CB    1 
ATOM   3776 C  CG    . ASN C 3 404 ? 17.432  48.473 57.464  1.00 17.70 ? 700  ASN A CG    1 
ATOM   3777 O  OD1   . ASN C 3 404 ? 17.929  47.994 56.448  1.00 18.53 ? 700  ASN A OD1   1 
ATOM   3778 N  ND2   . ASN C 3 404 ? 17.274  47.773 58.580  1.00 18.68 ? 700  ASN A ND2   1 
ATOM   3779 N  N     . MET C 3 405 ? 13.906  50.359 56.688  1.00 16.81 ? 701  MET A N     1 
ATOM   3780 C  CA    . MET C 3 405 ? 12.539  49.855 56.632  1.00 18.80 ? 701  MET A CA    1 
ATOM   3781 C  C     . MET C 3 405 ? 12.108  49.758 55.169  1.00 18.24 ? 701  MET A C     1 
ATOM   3782 O  O     . MET C 3 405 ? 11.542  48.750 54.747  1.00 18.50 ? 701  MET A O     1 
ATOM   3783 C  CB    . MET C 3 405 ? 11.589  50.792 57.380  1.00 21.01 ? 701  MET A CB    1 
ATOM   3784 C  CG    . MET C 3 405 ? 11.581  50.598 58.882  1.00 25.28 ? 701  MET A CG    1 
ATOM   3785 S  SD    . MET C 3 405 ? 10.630  51.876 59.717  1.00 29.19 ? 701  MET A SD    1 
ATOM   3786 C  CE    . MET C 3 405 ? 9.033   51.499 59.210  1.00 32.40 ? 701  MET A CE    1 
ATOM   3787 N  N     . ARG C 3 406 ? 12.380  50.807 54.397  1.00 17.54 ? 702  ARG A N     1 
ATOM   3788 C  CA    . ARG C 3 406 ? 12.014  50.819 52.981  1.00 17.78 ? 702  ARG A CA    1 
ATOM   3789 C  C     . ARG C 3 406 ? 12.792  49.756 52.218  1.00 17.61 ? 702  ARG A C     1 
ATOM   3790 O  O     . ARG C 3 406 ? 12.239  49.087 51.349  1.00 17.28 ? 702  ARG A O     1 
ATOM   3791 C  CB    . ARG C 3 406 ? 12.280  52.194 52.356  1.00 18.62 ? 702  ARG A CB    1 
ATOM   3792 C  CG    . ARG C 3 406 ? 11.829  52.308 50.893  1.00 19.35 ? 702  ARG A CG    1 
ATOM   3793 C  CD    . ARG C 3 406 ? 11.969  53.743 50.382  1.00 22.61 ? 702  ARG A CD    1 
ATOM   3794 N  NE    . ARG C 3 406 ? 11.428  53.936 49.036  1.00 22.27 ? 702  ARG A NE    1 
ATOM   3795 C  CZ    . ARG C 3 406 ? 12.012  53.507 47.921  1.00 23.81 ? 702  ARG A CZ    1 
ATOM   3796 N  NH1   . ARG C 3 406 ? 13.165  52.854 47.977  1.00 24.88 ? 702  ARG A NH1   1 
ATOM   3797 N  NH2   . ARG C 3 406 ? 11.444  53.736 46.746  1.00 24.09 ? 702  ARG A NH2   1 
ATOM   3798 N  N     . ARG C 3 407 ? 14.072  49.597 52.544  1.00 17.92 ? 703  ARG A N     1 
ATOM   3799 C  CA    . ARG C 3 407 ? 14.899  48.594 51.876  1.00 18.70 ? 703  ARG A CA    1 
ATOM   3800 C  C     . ARG C 3 407 ? 14.308  47.198 52.053  1.00 18.40 ? 703  ARG A C     1 
ATOM   3801 O  O     . ARG C 3 407 ? 14.283  46.403 51.113  1.00 18.55 ? 703  ARG A O     1 
ATOM   3802 C  CB    . ARG C 3 407 ? 16.327  48.602 52.428  1.00 21.33 ? 703  ARG A CB    1 
ATOM   3803 C  CG    . ARG C 3 407 ? 17.245  47.566 51.763  1.00 24.67 ? 703  ARG A CG    1 
ATOM   3804 C  CD    . ARG C 3 407 ? 18.641  47.574 52.388  1.00 24.27 ? 703  ARG A CD    1 
ATOM   3805 N  NE    . ARG C 3 407 ? 18.607  47.076 53.761  1.00 28.93 ? 703  ARG A NE    1 
ATOM   3806 C  CZ    . ARG C 3 407 ? 18.624  45.789 54.097  1.00 30.23 ? 703  ARG A CZ    1 
ATOM   3807 N  NH1   . ARG C 3 407 ? 18.690  44.850 53.160  1.00 29.13 ? 703  ARG A NH1   1 
ATOM   3808 N  NH2   . ARG C 3 407 ? 18.562  45.438 55.375  1.00 29.89 ? 703  ARG A NH2   1 
ATOM   3809 N  N     . GLN C 3 408 ? 13.835  46.898 53.259  1.00 19.12 ? 704  GLN A N     1 
ATOM   3810 C  CA    . GLN C 3 408 ? 13.247  45.592 53.517  1.00 19.47 ? 704  GLN A CA    1 
ATOM   3811 C  C     . GLN C 3 408 ? 11.871  45.461 52.868  1.00 19.63 ? 704  GLN A C     1 
ATOM   3812 O  O     . GLN C 3 408 ? 11.501  44.381 52.412  1.00 19.46 ? 704  GLN A O     1 
ATOM   3813 C  CB    . GLN C 3 408 ? 13.167  45.335 55.022  1.00 22.19 ? 704  GLN A CB    1 
ATOM   3814 C  CG    . GLN C 3 408 ? 14.548  45.327 55.676  1.00 26.18 ? 704  GLN A CG    1 
ATOM   3815 C  CD    . GLN C 3 408 ? 14.521  44.951 57.142  1.00 28.78 ? 704  GLN A CD    1 
ATOM   3816 O  OE1   . GLN C 3 408 ? 14.393  43.779 57.497  1.00 30.82 ? 704  GLN A OE1   1 
ATOM   3817 N  NE2   . GLN C 3 408 ? 14.642  45.948 58.005  1.00 32.16 ? 704  GLN A NE2   1 
ATOM   3818 N  N     . ALA C 3 409 ? 11.116  46.555 52.820  1.00 18.99 ? 705  ALA A N     1 
ATOM   3819 C  CA    . ALA C 3 409 ? 9.798   46.516 52.191  1.00 19.66 ? 705  ALA A CA    1 
ATOM   3820 C  C     . ALA C 3 409 ? 9.993   46.291 50.692  1.00 20.28 ? 705  ALA A C     1 
ATOM   3821 O  O     . ALA C 3 409 ? 9.209   45.593 50.046  1.00 19.87 ? 705  ALA A O     1 
ATOM   3822 C  CB    . ALA C 3 409 ? 9.048   47.821 52.436  1.00 19.14 ? 705  ALA A CB    1 
ATOM   3823 N  N     . LYS C 3 410 ? 11.047  46.891 50.148  1.00 18.83 ? 706  LYS A N     1 
ATOM   3824 C  CA    . LYS C 3 410 ? 11.375  46.749 48.735  1.00 20.18 ? 706  LYS A CA    1 
ATOM   3825 C  C     . LYS C 3 410 ? 11.710  45.293 48.426  1.00 22.15 ? 706  LYS A C     1 
ATOM   3826 O  O     . LYS C 3 410 ? 11.277  44.753 47.405  1.00 22.23 ? 706  LYS A O     1 
ATOM   3827 C  CB    . LYS C 3 410 ? 12.567  47.641 48.376  1.00 20.03 ? 706  LYS A CB    1 
ATOM   3828 C  CG    . LYS C 3 410 ? 12.959  47.593 46.904  1.00 21.71 ? 706  LYS A CG    1 
ATOM   3829 C  CD    . LYS C 3 410 ? 14.083  48.564 46.598  1.00 24.67 ? 706  LYS A CD    1 
ATOM   3830 C  CE    . LYS C 3 410 ? 14.459  48.512 45.124  1.00 26.32 ? 706  LYS A CE    1 
ATOM   3831 N  NZ    . LYS C 3 410 ? 15.457  49.554 44.780  1.00 28.08 ? 706  LYS A NZ    1 
ATOM   3832 N  N     . ALA C 3 411 ? 12.477  44.663 49.313  1.00 19.07 ? 707  ALA A N     1 
ATOM   3833 C  CA    . ALA C 3 411 ? 12.866  43.267 49.146  1.00 20.85 ? 707  ALA A CA    1 
ATOM   3834 C  C     . ALA C 3 411 ? 11.643  42.354 49.191  1.00 22.67 ? 707  ALA A C     1 
ATOM   3835 O  O     . ALA C 3 411 ? 11.566  41.368 48.457  1.00 23.27 ? 707  ALA A O     1 
ATOM   3836 C  CB    . ALA C 3 411 ? 13.855  42.866 50.235  1.00 21.55 ? 707  ALA A CB    1 
ATOM   3837 N  N     . VAL C 3 412 ? 10.691  42.681 50.057  1.00 22.05 ? 708  VAL A N     1 
ATOM   3838 C  CA    . VAL C 3 412 ? 9.474   41.890 50.169  1.00 22.92 ? 708  VAL A CA    1 
ATOM   3839 C  C     . VAL C 3 412 ? 8.663   42.041 48.882  1.00 24.46 ? 708  VAL A C     1 
ATOM   3840 O  O     . VAL C 3 412 ? 8.077   41.073 48.397  1.00 27.10 ? 708  VAL A O     1 
ATOM   3841 C  CB    . VAL C 3 412 ? 8.614   42.340 51.378  1.00 23.01 ? 708  VAL A CB    1 
ATOM   3842 C  CG1   . VAL C 3 412 ? 7.317   41.548 51.424  1.00 26.03 ? 708  VAL A CG1   1 
ATOM   3843 C  CG2   . VAL C 3 412 ? 9.391   42.138 52.670  1.00 24.46 ? 708  VAL A CG2   1 
ATOM   3844 N  N     . ASN C 3 413 ? 8.636   43.251 48.327  1.00 24.07 ? 709  ASN A N     1 
ATOM   3845 C  CA    . ASN C 3 413 ? 7.899   43.492 47.089  1.00 25.44 ? 709  ASN A CA    1 
ATOM   3846 C  C     . ASN C 3 413 ? 8.550   42.797 45.900  1.00 28.84 ? 709  ASN A C     1 
ATOM   3847 O  O     . ASN C 3 413 ? 7.861   42.229 45.052  1.00 30.13 ? 709  ASN A O     1 
ATOM   3848 C  CB    . ASN C 3 413 ? 7.790   44.989 46.792  1.00 23.52 ? 709  ASN A CB    1 
ATOM   3849 C  CG    . ASN C 3 413 ? 6.688   45.658 47.581  1.00 20.74 ? 709  ASN A CG    1 
ATOM   3850 O  OD1   . ASN C 3 413 ? 5.666   45.040 47.884  1.00 23.62 ? 709  ASN A OD1   1 
ATOM   3851 N  ND2   . ASN C 3 413 ? 6.880   46.928 47.909  1.00 19.08 ? 709  ASN A ND2   1 
ATOM   3852 N  N     . PHE C 3 414 ? 9.875   42.843 45.829  1.00 30.38 ? 710  PHE A N     1 
ATOM   3853 C  CA    . PHE C 3 414 ? 10.570  42.190 44.728  1.00 33.62 ? 710  PHE A CA    1 
ATOM   3854 C  C     . PHE C 3 414 ? 10.330  40.687 44.763  1.00 33.25 ? 710  PHE A C     1 
ATOM   3855 O  O     . PHE C 3 414 ? 10.297  40.031 43.721  1.00 33.38 ? 710  PHE A O     1 
ATOM   3856 C  CB    . PHE C 3 414 ? 12.073  42.473 44.786  1.00 36.22 ? 710  PHE A CB    1 
ATOM   3857 C  CG    . PHE C 3 414 ? 12.526  43.517 43.806  1.00 43.57 ? 710  PHE A CG    1 
ATOM   3858 C  CD1   . PHE C 3 414 ? 12.118  44.844 43.939  1.00 44.52 ? 710  PHE A CD1   1 
ATOM   3859 C  CD2   . PHE C 3 414 ? 13.353  43.172 42.737  1.00 44.70 ? 710  PHE A CD2   1 
ATOM   3860 C  CE1   . PHE C 3 414 ? 12.524  45.814 43.021  1.00 46.33 ? 710  PHE A CE1   1 
ATOM   3861 C  CE2   . PHE C 3 414 ? 13.765  44.135 41.813  1.00 46.65 ? 710  PHE A CE2   1 
ATOM   3862 C  CZ    . PHE C 3 414 ? 13.350  45.459 41.956  1.00 46.72 ? 710  PHE A CZ    1 
ATOM   3863 N  N     . GLY C 3 415 ? 10.148  40.147 45.964  1.00 32.55 ? 711  GLY A N     1 
ATOM   3864 C  CA    . GLY C 3 415 ? 9.920   38.721 46.101  1.00 32.81 ? 711  GLY A CA    1 
ATOM   3865 C  C     . GLY C 3 415 ? 8.464   38.297 46.089  1.00 34.71 ? 711  GLY A C     1 
ATOM   3866 O  O     . GLY C 3 415 ? 8.136   37.201 45.626  1.00 34.02 ? 711  GLY A O     1 
ATOM   3867 N  N     . ILE C 3 416 ? 7.588   39.158 46.599  1.00 33.83 ? 712  ILE A N     1 
ATOM   3868 C  CA    . ILE C 3 416 ? 6.162   38.854 46.645  1.00 33.93 ? 712  ILE A CA    1 
ATOM   3869 C  C     . ILE C 3 416 ? 5.707   38.479 45.237  1.00 34.70 ? 712  ILE A C     1 
ATOM   3870 O  O     . ILE C 3 416 ? 4.794   37.675 45.056  1.00 32.68 ? 712  ILE A O     1 
ATOM   3871 C  CB    . ILE C 3 416 ? 5.350   40.070 47.148  1.00 32.29 ? 712  ILE A CB    1 
ATOM   3872 C  CG1   . ILE C 3 416 ? 3.966   39.619 47.614  1.00 33.05 ? 712  ILE A CG1   1 
ATOM   3873 C  CG2   . ILE C 3 416 ? 5.223   41.106 46.048  1.00 34.81 ? 712  ILE A CG2   1 
ATOM   3874 C  CD1   . ILE C 3 416 ? 3.992   38.811 48.896  1.00 31.47 ? 712  ILE A CD1   1 
ATOM   3875 N  N     . VAL C 3 417 ? 6.369   39.061 44.244  1.00 36.13 ? 713  VAL A N     1 
ATOM   3876 C  CA    . VAL C 3 417 ? 6.058   38.797 42.847  1.00 38.91 ? 713  VAL A CA    1 
ATOM   3877 C  C     . VAL C 3 417 ? 6.509   37.396 42.425  1.00 41.06 ? 713  VAL A C     1 
ATOM   3878 O  O     . VAL C 3 417 ? 5.845   36.737 41.622  1.00 41.03 ? 713  VAL A O     1 
ATOM   3879 C  CB    . VAL C 3 417 ? 6.743   39.838 41.933  1.00 39.59 ? 713  VAL A CB    1 
ATOM   3880 C  CG1   . VAL C 3 417 ? 6.574   39.449 40.475  1.00 40.89 ? 713  VAL A CG1   1 
ATOM   3881 C  CG2   . VAL C 3 417 ? 6.145   41.217 42.185  1.00 40.79 ? 713  VAL A CG2   1 
ATOM   3882 N  N     . TYR C 3 418 ? 7.634   36.946 42.973  1.00 44.24 ? 714  TYR A N     1 
ATOM   3883 C  CA    . TYR C 3 418 ? 8.182   35.632 42.636  1.00 47.27 ? 714  TYR A CA    1 
ATOM   3884 C  C     . TYR C 3 418 ? 7.602   34.499 43.478  1.00 48.80 ? 714  TYR A C     1 
ATOM   3885 O  O     . TYR C 3 418 ? 8.048   33.356 43.373  1.00 49.70 ? 714  TYR A O     1 
ATOM   3886 C  CB    . TYR C 3 418 ? 9.704   35.629 42.804  1.00 49.00 ? 714  TYR A CB    1 
ATOM   3887 C  CG    . TYR C 3 418 ? 10.419  36.798 42.166  1.00 50.86 ? 714  TYR A CG    1 
ATOM   3888 C  CD1   . TYR C 3 418 ? 9.978   37.341 40.960  1.00 52.07 ? 714  TYR A CD1   1 
ATOM   3889 C  CD2   . TYR C 3 418 ? 11.552  37.353 42.763  1.00 52.33 ? 714  TYR A CD2   1 
ATOM   3890 C  CE1   . TYR C 3 418 ? 10.646  38.408 40.360  1.00 53.20 ? 714  TYR A CE1   1 
ATOM   3891 C  CE2   . TYR C 3 418 ? 12.232  38.420 42.170  1.00 53.58 ? 714  TYR A CE2   1 
ATOM   3892 C  CZ    . TYR C 3 418 ? 11.772  38.941 40.969  1.00 54.13 ? 714  TYR A CZ    1 
ATOM   3893 O  OH    . TYR C 3 418 ? 12.435  39.993 40.376  1.00 55.42 ? 714  TYR A OH    1 
ATOM   3894 N  N     . GLY C 3 419 ? 6.615   34.814 44.310  1.00 49.85 ? 715  GLY A N     1 
ATOM   3895 C  CA    . GLY C 3 419 ? 6.016   33.797 45.155  1.00 51.67 ? 715  GLY A CA    1 
ATOM   3896 C  C     . GLY C 3 419 ? 6.724   33.698 46.493  1.00 52.65 ? 715  GLY A C     1 
ATOM   3897 O  O     . GLY C 3 419 ? 7.868   33.251 46.569  1.00 53.46 ? 715  GLY A O     1 
ATOM   3898 N  N     . ILE C 3 420 ? 6.037   34.119 47.549  1.00 53.95 ? 716  ILE A N     1 
ATOM   3899 C  CA    . ILE C 3 420 ? 6.574   34.103 48.909  1.00 55.05 ? 716  ILE A CA    1 
ATOM   3900 C  C     . ILE C 3 420 ? 7.441   32.890 49.238  1.00 54.83 ? 716  ILE A C     1 
ATOM   3901 O  O     . ILE C 3 420 ? 7.212   31.787 48.737  1.00 55.95 ? 716  ILE A O     1 
ATOM   3902 C  CB    . ILE C 3 420 ? 5.439   34.163 49.951  1.00 55.69 ? 716  ILE A CB    1 
ATOM   3903 C  CG1   . ILE C 3 420 ? 4.491   32.974 49.753  1.00 56.77 ? 716  ILE A CG1   1 
ATOM   3904 C  CG2   . ILE C 3 420 ? 4.698   35.482 49.830  1.00 56.17 ? 716  ILE A CG2   1 
ATOM   3905 C  CD1   . ILE C 3 420 ? 3.403   32.859 50.804  1.00 57.81 ? 716  ILE A CD1   1 
ATOM   3906 N  N     . SER C 3 421 ? 8.434   33.110 50.095  1.00 53.76 ? 717  SER A N     1 
ATOM   3907 C  CA    . SER C 3 421 ? 9.349   32.058 50.527  1.00 52.79 ? 717  SER A CA    1 
ATOM   3908 C  C     . SER C 3 421 ? 10.251  32.588 51.634  1.00 52.08 ? 717  SER A C     1 
ATOM   3909 O  O     . SER C 3 421 ? 11.204  33.318 51.366  1.00 51.68 ? 717  SER A O     1 
ATOM   3910 C  CB    . SER C 3 421 ? 10.211  31.579 49.357  1.00 52.80 ? 717  SER A CB    1 
ATOM   3911 O  OG    . SER C 3 421 ? 11.211  30.676 49.799  1.00 51.07 ? 717  SER A OG    1 
ATOM   3912 N  N     . ASP C 3 422 ? 9.949   32.221 52.876  1.00 51.32 ? 718  ASP A N     1 
ATOM   3913 C  CA    . ASP C 3 422 ? 10.748  32.674 54.007  1.00 51.82 ? 718  ASP A CA    1 
ATOM   3914 C  C     . ASP C 3 422 ? 12.242  32.458 53.766  1.00 51.28 ? 718  ASP A C     1 
ATOM   3915 O  O     . ASP C 3 422 ? 13.061  33.310 54.111  1.00 51.45 ? 718  ASP A O     1 
ATOM   3916 C  CB    . ASP C 3 422 ? 10.313  31.960 55.292  1.00 52.30 ? 718  ASP A CB    1 
ATOM   3917 C  CG    . ASP C 3 422 ? 10.006  30.490 55.073  1.00 53.75 ? 718  ASP A CG    1 
ATOM   3918 O  OD1   . ASP C 3 422 ? 10.801  29.801 54.400  1.00 54.55 ? 718  ASP A OD1   1 
ATOM   3919 O  OD2   . ASP C 3 422 ? 8.969   30.020 55.587  1.00 54.94 ? 718  ASP A OD2   1 
ATOM   3920 N  N     . TYR C 3 423 ? 12.589  31.324 53.164  1.00 50.48 ? 719  TYR A N     1 
ATOM   3921 C  CA    . TYR C 3 423 ? 13.983  31.004 52.873  1.00 49.19 ? 719  TYR A CA    1 
ATOM   3922 C  C     . TYR C 3 423 ? 14.582  31.993 51.881  1.00 46.86 ? 719  TYR A C     1 
ATOM   3923 O  O     . TYR C 3 423 ? 15.697  32.483 52.072  1.00 46.23 ? 719  TYR A O     1 
ATOM   3924 C  CB    . TYR C 3 423 ? 14.096  29.583 52.307  1.00 52.36 ? 719  TYR A CB    1 
ATOM   3925 C  CG    . TYR C 3 423 ? 15.449  29.264 51.702  1.00 55.10 ? 719  TYR A CG    1 
ATOM   3926 C  CD1   . TYR C 3 423 ? 16.603  29.249 52.487  1.00 56.64 ? 719  TYR A CD1   1 
ATOM   3927 C  CD2   . TYR C 3 423 ? 15.576  28.987 50.340  1.00 56.17 ? 719  TYR A CD2   1 
ATOM   3928 C  CE1   . TYR C 3 423 ? 17.851  28.966 51.929  1.00 57.57 ? 719  TYR A CE1   1 
ATOM   3929 C  CE2   . TYR C 3 423 ? 16.817  28.705 49.773  1.00 57.69 ? 719  TYR A CE2   1 
ATOM   3930 C  CZ    . TYR C 3 423 ? 17.949  28.697 50.572  1.00 58.08 ? 719  TYR A CZ    1 
ATOM   3931 O  OH    . TYR C 3 423 ? 19.178  28.429 50.012  1.00 59.01 ? 719  TYR A OH    1 
ATOM   3932 N  N     . GLY C 3 424 ? 13.836  32.281 50.820  1.00 44.00 ? 720  GLY A N     1 
ATOM   3933 C  CA    . GLY C 3 424 ? 14.314  33.204 49.807  1.00 41.26 ? 720  GLY A CA    1 
ATOM   3934 C  C     . GLY C 3 424 ? 14.443  34.630 50.305  1.00 39.23 ? 720  GLY A C     1 
ATOM   3935 O  O     . GLY C 3 424 ? 15.424  35.314 50.007  1.00 38.44 ? 720  GLY A O     1 
ATOM   3936 N  N     . LEU C 3 425 ? 13.450  35.080 51.063  1.00 37.98 ? 721  LEU A N     1 
ATOM   3937 C  CA    . LEU C 3 425 ? 13.461  36.432 51.608  1.00 36.93 ? 721  LEU A CA    1 
ATOM   3938 C  C     . LEU C 3 425 ? 14.587  36.560 52.631  1.00 36.93 ? 721  LEU A C     1 
ATOM   3939 O  O     . LEU C 3 425 ? 15.301  37.563 52.661  1.00 35.51 ? 721  LEU A O     1 
ATOM   3940 C  CB    . LEU C 3 425 ? 12.113  36.744 52.266  1.00 36.10 ? 721  LEU A CB    1 
ATOM   3941 C  CG    . LEU C 3 425 ? 11.918  38.135 52.877  1.00 35.67 ? 721  LEU A CG    1 
ATOM   3942 C  CD1   . LEU C 3 425 ? 12.085  39.207 51.813  1.00 35.24 ? 721  LEU A CD1   1 
ATOM   3943 C  CD2   . LEU C 3 425 ? 10.535  38.217 53.506  1.00 35.57 ? 721  LEU A CD2   1 
ATOM   3944 N  N     . ALA C 3 426 ? 14.742  35.531 53.461  1.00 37.74 ? 722  ALA A N     1 
ATOM   3945 C  CA    . ALA C 3 426 ? 15.780  35.511 54.488  1.00 39.27 ? 722  ALA A CA    1 
ATOM   3946 C  C     . ALA C 3 426 ? 17.155  35.723 53.862  1.00 39.53 ? 722  ALA A C     1 
ATOM   3947 O  O     . ALA C 3 426 ? 17.973  36.487 54.374  1.00 38.83 ? 722  ALA A O     1 
ATOM   3948 C  CB    . ALA C 3 426 ? 15.743  34.184 55.238  1.00 38.85 ? 722  ALA A CB    1 
ATOM   3949 N  N     . GLN C 3 427 ? 17.403  35.042 52.748  1.00 40.87 ? 723  GLN A N     1 
ATOM   3950 C  CA    . GLN C 3 427 ? 18.674  35.163 52.046  1.00 41.26 ? 723  GLN A CA    1 
ATOM   3951 C  C     . GLN C 3 427 ? 18.929  36.596 51.597  1.00 40.90 ? 723  GLN A C     1 
ATOM   3952 O  O     . GLN C 3 427 ? 20.009  37.143 51.822  1.00 39.16 ? 723  GLN A O     1 
ATOM   3953 C  CB    . GLN C 3 427 ? 18.691  34.243 50.823  1.00 44.72 ? 723  GLN A CB    1 
ATOM   3954 C  CG    . GLN C 3 427 ? 18.930  32.781 51.147  1.00 48.67 ? 723  GLN A CG    1 
ATOM   3955 C  CD    . GLN C 3 427 ? 20.307  32.545 51.738  1.00 51.44 ? 723  GLN A CD    1 
ATOM   3956 O  OE1   . GLN C 3 427 ? 21.322  32.905 51.137  1.00 52.64 ? 723  GLN A OE1   1 
ATOM   3957 N  NE2   . GLN C 3 427 ? 20.350  31.939 52.920  1.00 52.48 ? 723  GLN A NE2   1 
ATOM   3958 N  N     . ASN C 3 428 ? 17.930  37.201 50.961  1.00 39.87 ? 724  ASN A N     1 
ATOM   3959 C  CA    . ASN C 3 428 ? 18.059  38.565 50.467  1.00 39.46 ? 724  ASN A CA    1 
ATOM   3960 C  C     . ASN C 3 428 ? 18.201  39.613 51.559  1.00 38.00 ? 724  ASN A C     1 
ATOM   3961 O  O     . ASN C 3 428 ? 18.922  40.594 51.387  1.00 38.69 ? 724  ASN A O     1 
ATOM   3962 C  CB    . ASN C 3 428 ? 16.867  38.923 49.577  1.00 40.07 ? 724  ASN A CB    1 
ATOM   3963 C  CG    . ASN C 3 428 ? 16.959  38.295 48.204  1.00 41.22 ? 724  ASN A CG    1 
ATOM   3964 O  OD1   . ASN C 3 428 ? 16.086  38.493 47.364  1.00 41.90 ? 724  ASN A OD1   1 
ATOM   3965 N  ND2   . ASN C 3 428 ? 18.023  37.535 47.966  1.00 41.66 ? 724  ASN A ND2   1 
ATOM   3966 N  N     . LEU C 3 429 ? 17.514  39.411 52.677  1.00 36.88 ? 725  LEU A N     1 
ATOM   3967 C  CA    . LEU C 3 429 ? 17.577  40.364 53.780  1.00 36.20 ? 725  LEU A CA    1 
ATOM   3968 C  C     . LEU C 3 429 ? 18.567  39.933 54.854  1.00 36.89 ? 725  LEU A C     1 
ATOM   3969 O  O     . LEU C 3 429 ? 18.732  40.611 55.868  1.00 37.62 ? 725  LEU A O     1 
ATOM   3970 C  CB    . LEU C 3 429 ? 16.189  40.546 54.396  1.00 34.38 ? 725  LEU A CB    1 
ATOM   3971 C  CG    . LEU C 3 429 ? 15.178  41.247 53.486  1.00 33.77 ? 725  LEU A CG    1 
ATOM   3972 C  CD1   . LEU C 3 429 ? 13.831  41.337 54.181  1.00 34.25 ? 725  LEU A CD1   1 
ATOM   3973 C  CD2   . LEU C 3 429 ? 15.692  42.635 53.133  1.00 33.85 ? 725  LEU A CD2   1 
ATOM   3974 N  N     . ASN C 3 430 ? 19.227  38.806 54.618  1.00 37.33 ? 726  ASN A N     1 
ATOM   3975 C  CA    . ASN C 3 430 ? 20.200  38.273 55.559  1.00 37.99 ? 726  ASN A CA    1 
ATOM   3976 C  C     . ASN C 3 430 ? 19.608  38.232 56.969  1.00 37.48 ? 726  ASN A C     1 
ATOM   3977 O  O     . ASN C 3 430 ? 20.143  38.835 57.900  1.00 36.32 ? 726  ASN A O     1 
ATOM   3978 C  CB    . ASN C 3 430 ? 21.473  39.127 55.530  1.00 39.60 ? 726  ASN A CB    1 
ATOM   3979 C  CG    . ASN C 3 430 ? 22.620  38.489 56.286  1.00 42.18 ? 726  ASN A CG    1 
ATOM   3980 O  OD1   . ASN C 3 430 ? 22.868  37.287 56.162  1.00 43.32 ? 726  ASN A OD1   1 
ATOM   3981 N  ND2   . ASN C 3 430 ? 23.336  39.292 57.066  1.00 42.90 ? 726  ASN A ND2   1 
ATOM   3982 N  N     . ILE C 3 431 ? 18.494  37.515 57.105  1.00 36.86 ? 727  ILE A N     1 
ATOM   3983 C  CA    . ILE C 3 431 ? 17.804  37.359 58.382  1.00 37.84 ? 727  ILE A CA    1 
ATOM   3984 C  C     . ILE C 3 431 ? 17.399  35.898 58.557  1.00 38.35 ? 727  ILE A C     1 
ATOM   3985 O  O     . ILE C 3 431 ? 17.683  35.067 57.695  1.00 38.71 ? 727  ILE A O     1 
ATOM   3986 C  CB    . ILE C 3 431 ? 16.534  38.236 58.454  1.00 37.73 ? 727  ILE A CB    1 
ATOM   3987 C  CG1   . ILE C 3 431 ? 15.595  37.890 57.294  1.00 38.34 ? 727  ILE A CG1   1 
ATOM   3988 C  CG2   . ILE C 3 431 ? 16.916  39.707 58.432  1.00 36.77 ? 727  ILE A CG2   1 
ATOM   3989 C  CD1   . ILE C 3 431 ? 14.288  38.657 57.308  1.00 39.71 ? 727  ILE A CD1   1 
ATOM   3990 N  N     . SER C 3 432 ? 16.735  35.583 59.666  1.00 39.21 ? 728  SER A N     1 
ATOM   3991 C  CA    . SER C 3 432 ? 16.314  34.208 59.921  1.00 40.21 ? 728  SER A CA    1 
ATOM   3992 C  C     . SER C 3 432 ? 15.017  33.890 59.188  1.00 41.74 ? 728  SER A C     1 
ATOM   3993 O  O     . SER C 3 432 ? 14.231  34.785 58.880  1.00 40.38 ? 728  SER A O     1 
ATOM   3994 C  CB    . SER C 3 432 ? 16.115  33.974 61.420  1.00 40.50 ? 728  SER A CB    1 
ATOM   3995 O  OG    . SER C 3 432 ? 14.948  34.628 61.887  1.00 40.11 ? 728  SER A OG    1 
ATOM   3996 N  N     . ARG C 3 433 ? 14.802  32.608 58.912  1.00 43.71 ? 729  ARG A N     1 
ATOM   3997 C  CA    . ARG C 3 433 ? 13.600  32.158 58.221  1.00 45.26 ? 729  ARG A CA    1 
ATOM   3998 C  C     . ARG C 3 433 ? 12.358  32.521 59.033  1.00 45.47 ? 729  ARG A C     1 
ATOM   3999 O  O     . ARG C 3 433 ? 11.331  32.905 58.471  1.00 45.54 ? 729  ARG A O     1 
ATOM   4000 C  CB    . ARG C 3 433 ? 13.674  30.643 57.988  1.00 47.66 ? 729  ARG A CB    1 
ATOM   4001 C  CG    . ARG C 3 433 ? 12.451  30.034 57.316  1.00 51.63 ? 729  ARG A CG    1 
ATOM   4002 C  CD    . ARG C 3 433 ? 11.422  29.577 58.340  1.00 54.91 ? 729  ARG A CD    1 
ATOM   4003 N  NE    . ARG C 3 433 ? 11.952  28.517 59.195  1.00 57.66 ? 729  ARG A NE    1 
ATOM   4004 C  CZ    . ARG C 3 433 ? 11.267  27.922 60.167  1.00 58.93 ? 729  ARG A CZ    1 
ATOM   4005 N  NH1   . ARG C 3 433 ? 10.014  28.280 60.416  1.00 59.70 ? 729  ARG A NH1   1 
ATOM   4006 N  NH2   . ARG C 3 433 ? 11.835  26.965 60.890  1.00 59.71 ? 729  ARG A NH2   1 
ATOM   4007 N  N     . LYS C 3 434 ? 12.457  32.406 60.354  1.00 45.53 ? 730  LYS A N     1 
ATOM   4008 C  CA    . LYS C 3 434 ? 11.339  32.738 61.230  1.00 45.86 ? 730  LYS A CA    1 
ATOM   4009 C  C     . LYS C 3 434 ? 10.955  34.203 61.056  1.00 45.52 ? 730  LYS A C     1 
ATOM   4010 O  O     . LYS C 3 434 ? 9.773   34.539 60.954  1.00 44.88 ? 730  LYS A O     1 
ATOM   4011 C  CB    . LYS C 3 434 ? 11.708  32.486 62.694  1.00 47.50 ? 730  LYS A CB    1 
ATOM   4012 C  CG    . LYS C 3 434 ? 10.629  32.926 63.682  1.00 49.61 ? 730  LYS A CG    1 
ATOM   4013 C  CD    . LYS C 3 434 ? 11.078  32.768 65.131  1.00 51.78 ? 730  LYS A CD    1 
ATOM   4014 C  CE    . LYS C 3 434 ? 11.294  31.308 65.498  1.00 52.86 ? 730  LYS A CE    1 
ATOM   4015 N  NZ    . LYS C 3 434 ? 10.047  30.505 65.334  1.00 53.61 ? 730  LYS A NZ    1 
ATOM   4016 N  N     . GLU C 3 435 ? 11.962  35.071 61.025  1.00 44.32 ? 731  GLU A N     1 
ATOM   4017 C  CA    . GLU C 3 435 ? 11.738  36.501 60.865  1.00 43.55 ? 731  GLU A CA    1 
ATOM   4018 C  C     . GLU C 3 435 ? 11.161  36.817 59.492  1.00 42.45 ? 731  GLU A C     1 
ATOM   4019 O  O     . GLU C 3 435 ? 10.227  37.609 59.374  1.00 42.23 ? 731  GLU A O     1 
ATOM   4020 C  CB    . GLU C 3 435 ? 13.047  37.265 61.064  1.00 44.01 ? 731  GLU A CB    1 
ATOM   4021 C  CG    . GLU C 3 435 ? 13.569  37.216 62.485  1.00 46.18 ? 731  GLU A CG    1 
ATOM   4022 C  CD    . GLU C 3 435 ? 14.887  37.943 62.642  1.00 47.46 ? 731  GLU A CD    1 
ATOM   4023 O  OE1   . GLU C 3 435 ? 15.880  37.524 62.009  1.00 47.25 ? 731  GLU A OE1   1 
ATOM   4024 O  OE2   . GLU C 3 435 ? 14.928  38.935 63.399  1.00 49.17 ? 731  GLU A OE2   1 
ATOM   4025 N  N     . ALA C 3 436 ? 11.721  36.197 58.457  1.00 40.88 ? 732  ALA A N     1 
ATOM   4026 C  CA    . ALA C 3 436 ? 11.243  36.415 57.099  1.00 40.29 ? 732  ALA A CA    1 
ATOM   4027 C  C     . ALA C 3 436 ? 9.761   36.059 57.024  1.00 40.00 ? 732  ALA A C     1 
ATOM   4028 O  O     . ALA C 3 436 ? 8.966   36.786 56.425  1.00 38.84 ? 732  ALA A O     1 
ATOM   4029 C  CB    . ALA C 3 436 ? 12.043  35.566 56.118  1.00 40.13 ? 732  ALA A CB    1 
ATOM   4030 N  N     . ALA C 3 437 ? 9.395   34.941 57.644  1.00 39.09 ? 733  ALA A N     1 
ATOM   4031 C  CA    . ALA C 3 437 ? 8.011   34.491 57.654  1.00 39.09 ? 733  ALA A CA    1 
ATOM   4032 C  C     . ALA C 3 437 ? 7.128   35.530 58.336  1.00 39.38 ? 733  ALA A C     1 
ATOM   4033 O  O     . ALA C 3 437 ? 5.988   35.755 57.925  1.00 39.14 ? 733  ALA A O     1 
ATOM   4034 C  CB    . ALA C 3 437 ? 7.900   33.153 58.374  1.00 39.93 ? 733  ALA A CB    1 
ATOM   4035 N  N     . GLU C 3 438 ? 7.661   36.159 59.379  1.00 38.47 ? 734  GLU A N     1 
ATOM   4036 C  CA    . GLU C 3 438 ? 6.924   37.179 60.115  1.00 39.68 ? 734  GLU A CA    1 
ATOM   4037 C  C     . GLU C 3 438 ? 6.646   38.376 59.210  1.00 38.24 ? 734  GLU A C     1 
ATOM   4038 O  O     . GLU C 3 438 ? 5.581   38.988 59.293  1.00 37.88 ? 734  GLU A O     1 
ATOM   4039 C  CB    . GLU C 3 438 ? 7.718   37.627 61.346  1.00 41.62 ? 734  GLU A CB    1 
ATOM   4040 C  CG    . GLU C 3 438 ? 8.016   36.505 62.330  1.00 45.98 ? 734  GLU A CG    1 
ATOM   4041 C  CD    . GLU C 3 438 ? 8.810   36.973 63.539  1.00 47.63 ? 734  GLU A CD    1 
ATOM   4042 O  OE1   . GLU C 3 438 ? 9.166   36.121 64.382  1.00 48.96 ? 734  GLU A OE1   1 
ATOM   4043 O  OE2   . GLU C 3 438 ? 9.077   38.189 63.649  1.00 48.26 ? 734  GLU A OE2   1 
ATOM   4044 N  N     . PHE C 3 439 ? 7.610   38.708 58.354  1.00 37.45 ? 735  PHE A N     1 
ATOM   4045 C  CA    . PHE C 3 439 ? 7.454   39.822 57.420  1.00 37.32 ? 735  PHE A CA    1 
ATOM   4046 C  C     . PHE C 3 439 ? 6.353   39.503 56.420  1.00 35.56 ? 735  PHE A C     1 
ATOM   4047 O  O     . PHE C 3 439 ? 5.497   40.340 56.128  1.00 34.79 ? 735  PHE A O     1 
ATOM   4048 C  CB    . PHE C 3 439 ? 8.755   40.079 56.656  1.00 40.10 ? 735  PHE A CB    1 
ATOM   4049 C  CG    . PHE C 3 439 ? 9.700   41.003 57.359  1.00 43.63 ? 735  PHE A CG    1 
ATOM   4050 C  CD1   . PHE C 3 439 ? 10.282  40.640 58.570  1.00 45.64 ? 735  PHE A CD1   1 
ATOM   4051 C  CD2   . PHE C 3 439 ? 10.013  42.241 56.809  1.00 45.68 ? 735  PHE A CD2   1 
ATOM   4052 C  CE1   . PHE C 3 439 ? 11.167  41.497 59.223  1.00 46.63 ? 735  PHE A CE1   1 
ATOM   4053 C  CE2   . PHE C 3 439 ? 10.896  43.106 57.453  1.00 46.72 ? 735  PHE A CE2   1 
ATOM   4054 C  CZ    . PHE C 3 439 ? 11.475  42.732 58.664  1.00 46.47 ? 735  PHE A CZ    1 
ATOM   4055 N  N     . ILE C 3 440 ? 6.393   38.283 55.898  1.00 33.76 ? 736  ILE A N     1 
ATOM   4056 C  CA    . ILE C 3 440 ? 5.408   37.817 54.933  1.00 33.08 ? 736  ILE A CA    1 
ATOM   4057 C  C     . ILE C 3 440 ? 4.020   37.866 55.562  1.00 32.75 ? 736  ILE A C     1 
ATOM   4058 O  O     . ILE C 3 440 ? 3.067   38.355 54.955  1.00 32.05 ? 736  ILE A O     1 
ATOM   4059 C  CB    . ILE C 3 440 ? 5.706   36.366 54.501  1.00 33.10 ? 736  ILE A CB    1 
ATOM   4060 C  CG1   . ILE C 3 440 ? 7.122   36.268 53.929  1.00 32.03 ? 736  ILE A CG1   1 
ATOM   4061 C  CG2   . ILE C 3 440 ? 4.692   35.912 53.465  1.00 33.41 ? 736  ILE A CG2   1 
ATOM   4062 C  CD1   . ILE C 3 440 ? 7.338   37.079 52.669  1.00 34.82 ? 736  ILE A CD1   1 
ATOM   4063 N  N     . GLU C 3 441 ? 3.915   37.354 56.783  1.00 32.07 ? 737  GLU A N     1 
ATOM   4064 C  CA    . GLU C 3 441 ? 2.648   37.347 57.498  1.00 33.69 ? 737  GLU A CA    1 
ATOM   4065 C  C     . GLU C 3 441 ? 2.108   38.767 57.613  1.00 32.48 ? 737  GLU A C     1 
ATOM   4066 O  O     . GLU C 3 441 ? 0.926   39.009 57.377  1.00 31.23 ? 737  GLU A O     1 
ATOM   4067 C  CB    . GLU C 3 441 ? 2.831   36.746 58.893  1.00 36.64 ? 737  GLU A CB    1 
ATOM   4068 C  CG    . GLU C 3 441 ? 1.601   36.850 59.781  1.00 41.65 ? 737  GLU A CG    1 
ATOM   4069 C  CD    . GLU C 3 441 ? 1.828   36.262 61.162  1.00 45.57 ? 737  GLU A CD    1 
ATOM   4070 O  OE1   . GLU C 3 441 ? 2.804   36.671 61.829  1.00 47.41 ? 737  GLU A OE1   1 
ATOM   4071 O  OE2   . GLU C 3 441 ? 1.030   35.393 61.581  1.00 47.09 ? 737  GLU A OE2   1 
ATOM   4072 N  N     . ARG C 3 442 ? 2.980   39.704 57.973  1.00 31.24 ? 738  ARG A N     1 
ATOM   4073 C  CA    . ARG C 3 442 ? 2.574   41.099 58.106  1.00 30.95 ? 738  ARG A CA    1 
ATOM   4074 C  C     . ARG C 3 442 ? 2.136   41.676 56.766  1.00 27.58 ? 738  ARG A C     1 
ATOM   4075 O  O     . ARG C 3 442 ? 1.170   42.433 56.699  1.00 27.81 ? 738  ARG A O     1 
ATOM   4076 C  CB    . ARG C 3 442 ? 3.715   41.939 58.684  1.00 33.76 ? 738  ARG A CB    1 
ATOM   4077 C  CG    . ARG C 3 442 ? 3.883   41.799 60.188  1.00 39.85 ? 738  ARG A CG    1 
ATOM   4078 C  CD    . ARG C 3 442 ? 2.596   42.185 60.910  1.00 43.93 ? 738  ARG A CD    1 
ATOM   4079 N  NE    . ARG C 3 442 ? 2.739   42.155 62.362  1.00 48.31 ? 738  ARG A NE    1 
ATOM   4080 C  CZ    . ARG C 3 442 ? 3.496   42.997 63.059  1.00 50.19 ? 738  ARG A CZ    1 
ATOM   4081 N  NH1   . ARG C 3 442 ? 4.185   43.948 62.439  1.00 51.25 ? 738  ARG A NH1   1 
ATOM   4082 N  NH2   . ARG C 3 442 ? 3.564   42.888 64.379  1.00 51.55 ? 738  ARG A NH2   1 
ATOM   4083 N  N     . TYR C 3 443 ? 2.846   41.318 55.700  1.00 25.24 ? 739  TYR A N     1 
ATOM   4084 C  CA    . TYR C 3 443 ? 2.496   41.809 54.375  1.00 24.69 ? 739  TYR A CA    1 
ATOM   4085 C  C     . TYR C 3 443 ? 1.081   41.365 54.025  1.00 23.68 ? 739  TYR A C     1 
ATOM   4086 O  O     . TYR C 3 443 ? 0.257   42.172 53.593  1.00 24.18 ? 739  TYR A O     1 
ATOM   4087 C  CB    . TYR C 3 443 ? 3.483   41.287 53.319  1.00 23.89 ? 739  TYR A CB    1 
ATOM   4088 C  CG    . TYR C 3 443 ? 3.135   41.717 51.910  1.00 23.24 ? 739  TYR A CG    1 
ATOM   4089 C  CD1   . TYR C 3 443 ? 2.165   41.035 51.165  1.00 22.55 ? 739  TYR A CD1   1 
ATOM   4090 C  CD2   . TYR C 3 443 ? 3.718   42.847 51.346  1.00 21.22 ? 739  TYR A CD2   1 
ATOM   4091 C  CE1   . TYR C 3 443 ? 1.785   41.475 49.898  1.00 21.40 ? 739  TYR A CE1   1 
ATOM   4092 C  CE2   . TYR C 3 443 ? 3.348   43.294 50.082  1.00 21.37 ? 739  TYR A CE2   1 
ATOM   4093 C  CZ    . TYR C 3 443 ? 2.381   42.607 49.365  1.00 21.76 ? 739  TYR A CZ    1 
ATOM   4094 O  OH    . TYR C 3 443 ? 2.010   43.066 48.126  1.00 20.66 ? 739  TYR A OH    1 
ATOM   4095 N  N     . PHE C 3 444 ? 0.796   40.082 54.226  1.00 23.67 ? 740  PHE A N     1 
ATOM   4096 C  CA    . PHE C 3 444 ? -0.524  39.552 53.912  1.00 23.51 ? 740  PHE A CA    1 
ATOM   4097 C  C     . PHE C 3 444 ? -1.625  40.174 54.759  1.00 23.37 ? 740  PHE A C     1 
ATOM   4098 O  O     . PHE C 3 444 ? -2.765  40.274 54.316  1.00 22.70 ? 740  PHE A O     1 
ATOM   4099 C  CB    . PHE C 3 444 ? -0.543  38.028 54.057  1.00 23.34 ? 740  PHE A CB    1 
ATOM   4100 C  CG    . PHE C 3 444 ? 0.213   37.310 52.974  1.00 24.10 ? 740  PHE A CG    1 
ATOM   4101 C  CD1   . PHE C 3 444 ? 0.099   37.711 51.645  1.00 24.38 ? 740  PHE A CD1   1 
ATOM   4102 C  CD2   . PHE C 3 444 ? 1.029   36.227 53.276  1.00 26.64 ? 740  PHE A CD2   1 
ATOM   4103 C  CE1   . PHE C 3 444 ? 0.786   37.043 50.633  1.00 25.87 ? 740  PHE A CE1   1 
ATOM   4104 C  CE2   . PHE C 3 444 ? 1.720   35.552 52.270  1.00 26.68 ? 740  PHE A CE2   1 
ATOM   4105 C  CZ    . PHE C 3 444 ? 1.598   35.961 50.948  1.00 27.36 ? 740  PHE A CZ    1 
ATOM   4106 N  N     . GLU C 3 445 ? -1.287  40.589 55.975  1.00 23.56 ? 741  GLU A N     1 
ATOM   4107 C  CA    . GLU C 3 445 ? -2.272  41.223 56.841  1.00 24.75 ? 741  GLU A CA    1 
ATOM   4108 C  C     . GLU C 3 445 ? -2.645  42.578 56.245  1.00 24.17 ? 741  GLU A C     1 
ATOM   4109 O  O     . GLU C 3 445 ? -3.794  43.008 56.333  1.00 23.90 ? 741  GLU A O     1 
ATOM   4110 C  CB    . GLU C 3 445 ? -1.710  41.406 58.256  1.00 28.41 ? 741  GLU A CB    1 
ATOM   4111 C  CG    . GLU C 3 445 ? -1.465  40.096 58.992  1.00 34.37 ? 741  GLU A CG    1 
ATOM   4112 C  CD    . GLU C 3 445 ? -0.792  40.291 60.343  1.00 37.77 ? 741  GLU A CD    1 
ATOM   4113 O  OE1   . GLU C 3 445 ? -0.552  39.280 61.036  1.00 39.41 ? 741  GLU A OE1   1 
ATOM   4114 O  OE2   . GLU C 3 445 ? -0.502  41.451 60.710  1.00 40.91 ? 741  GLU A OE2   1 
ATOM   4115 N  N     . SER C 3 446 ? -1.670  43.239 55.624  1.00 24.01 ? 742  SER A N     1 
ATOM   4116 C  CA    . SER C 3 446 ? -1.894  44.541 55.003  1.00 22.94 ? 742  SER A CA    1 
ATOM   4117 C  C     . SER C 3 446 ? -2.471  44.414 53.592  1.00 20.61 ? 742  SER A C     1 
ATOM   4118 O  O     . SER C 3 446 ? -3.167  45.315 53.114  1.00 19.30 ? 742  SER A O     1 
ATOM   4119 C  CB    . SER C 3 446 ? -0.583  45.325 54.934  1.00 25.30 ? 742  SER A CB    1 
ATOM   4120 O  OG    . SER C 3 446 ? -0.018  45.487 56.220  1.00 30.18 ? 742  SER A OG    1 
ATOM   4121 N  N     . PHE C 3 447 ? -2.176  43.297 52.931  1.00 18.04 ? 743  PHE A N     1 
ATOM   4122 C  CA    . PHE C 3 447 ? -2.646  43.047 51.572  1.00 17.49 ? 743  PHE A CA    1 
ATOM   4123 C  C     . PHE C 3 447 ? -3.358  41.692 51.487  1.00 18.44 ? 743  PHE A C     1 
ATOM   4124 O  O     . PHE C 3 447 ? -2.887  40.767 50.822  1.00 17.77 ? 743  PHE A O     1 
ATOM   4125 C  CB    . PHE C 3 447 ? -1.453  43.084 50.610  1.00 18.73 ? 743  PHE A CB    1 
ATOM   4126 C  CG    . PHE C 3 447 ? -0.732  44.409 50.594  1.00 18.02 ? 743  PHE A CG    1 
ATOM   4127 C  CD1   . PHE C 3 447 ? -1.282  45.506 49.935  1.00 18.95 ? 743  PHE A CD1   1 
ATOM   4128 C  CD2   . PHE C 3 447 ? 0.483   44.566 51.257  1.00 18.58 ? 743  PHE A CD2   1 
ATOM   4129 C  CE1   . PHE C 3 447 ? -0.633  46.743 49.935  1.00 20.11 ? 743  PHE A CE1   1 
ATOM   4130 C  CE2   . PHE C 3 447 ? 1.141   45.798 51.263  1.00 19.20 ? 743  PHE A CE2   1 
ATOM   4131 C  CZ    . PHE C 3 447 ? 0.582   46.889 50.601  1.00 18.15 ? 743  PHE A CZ    1 
ATOM   4132 N  N     . PRO C 3 448 ? -4.513  41.565 52.160  1.00 16.89 ? 744  PRO A N     1 
ATOM   4133 C  CA    . PRO C 3 448 ? -5.299  40.326 52.171  1.00 17.38 ? 744  PRO A CA    1 
ATOM   4134 C  C     . PRO C 3 448 ? -5.703  39.825 50.788  1.00 16.46 ? 744  PRO A C     1 
ATOM   4135 O  O     . PRO C 3 448 ? -5.783  38.617 50.561  1.00 16.06 ? 744  PRO A O     1 
ATOM   4136 C  CB    . PRO C 3 448 ? -6.497  40.675 53.061  1.00 16.64 ? 744  PRO A CB    1 
ATOM   4137 C  CG    . PRO C 3 448 ? -6.624  42.171 52.894  1.00 17.48 ? 744  PRO A CG    1 
ATOM   4138 C  CD    . PRO C 3 448 ? -5.186  42.619 52.938  1.00 16.77 ? 744  PRO A CD    1 
ATOM   4139 N  N     . GLY C 3 449 ? -5.960  40.756 49.872  1.00 15.31 ? 745  GLY A N     1 
ATOM   4140 C  CA    . GLY C 3 449 ? -6.327  40.385 48.517  1.00 16.32 ? 745  GLY A CA    1 
ATOM   4141 C  C     . GLY C 3 449 ? -5.195  39.625 47.847  1.00 14.93 ? 745  GLY A C     1 
ATOM   4142 O  O     . GLY C 3 449 ? -5.424  38.660 47.115  1.00 15.16 ? 745  GLY A O     1 
ATOM   4143 N  N     . VAL C 3 450 ? -3.963  40.055 48.097  1.00 14.22 ? 746  VAL A N     1 
ATOM   4144 C  CA    . VAL C 3 450 ? -2.810  39.380 47.518  1.00 15.60 ? 746  VAL A CA    1 
ATOM   4145 C  C     . VAL C 3 450 ? -2.701  37.974 48.110  1.00 16.04 ? 746  VAL A C     1 
ATOM   4146 O  O     . VAL C 3 450 ? -2.430  37.011 47.396  1.00 14.94 ? 746  VAL A O     1 
ATOM   4147 C  CB    . VAL C 3 450 ? -1.513  40.168 47.788  1.00 13.73 ? 746  VAL A CB    1 
ATOM   4148 C  CG1   . VAL C 3 450 ? -0.299  39.358 47.349  1.00 15.73 ? 746  VAL A CG1   1 
ATOM   4149 C  CG2   . VAL C 3 450 ? -1.552  41.484 47.032  1.00 14.24 ? 746  VAL A CG2   1 
ATOM   4150 N  N     . LYS C 3 451 ? -2.925  37.854 49.416  1.00 16.90 ? 747  LYS A N     1 
ATOM   4151 C  CA    . LYS C 3 451 ? -2.858  36.546 50.061  1.00 16.92 ? 747  LYS A CA    1 
ATOM   4152 C  C     . LYS C 3 451 ? -3.886  35.611 49.427  1.00 15.86 ? 747  LYS A C     1 
ATOM   4153 O  O     . LYS C 3 451 ? -3.584  34.455 49.130  1.00 13.62 ? 747  LYS A O     1 
ATOM   4154 C  CB    . LYS C 3 451 ? -3.136  36.659 51.563  1.00 20.26 ? 747  LYS A CB    1 
ATOM   4155 C  CG    . LYS C 3 451 ? -2.977  35.332 52.296  1.00 21.80 ? 747  LYS A CG    1 
ATOM   4156 C  CD    . LYS C 3 451 ? -3.402  35.430 53.751  1.00 26.58 ? 747  LYS A CD    1 
ATOM   4157 C  CE    . LYS C 3 451 ? -3.146  34.115 54.476  1.00 28.11 ? 747  LYS A CE    1 
ATOM   4158 N  NZ    . LYS C 3 451 ? -3.625  34.156 55.883  1.00 31.12 ? 747  LYS A NZ    1 
ATOM   4159 N  N     . ARG C 3 452 ? -5.100  36.120 49.226  1.00 16.19 ? 748  ARG A N     1 
ATOM   4160 C  CA    . ARG C 3 452 ? -6.178  35.341 48.621  1.00 18.01 ? 748  ARG A CA    1 
ATOM   4161 C  C     . ARG C 3 452 ? -5.794  34.882 47.213  1.00 18.02 ? 748  ARG A C     1 
ATOM   4162 O  O     . ARG C 3 452 ? -6.052  33.737 46.831  1.00 16.63 ? 748  ARG A O     1 
ATOM   4163 C  CB    . ARG C 3 452 ? -7.468  36.168 48.558  1.00 20.45 ? 748  ARG A CB    1 
ATOM   4164 C  CG    . ARG C 3 452 ? -8.627  35.451 47.866  1.00 26.79 ? 748  ARG A CG    1 
ATOM   4165 C  CD    . ARG C 3 452 ? -9.904  36.291 47.814  1.00 32.14 ? 748  ARG A CD    1 
ATOM   4166 N  NE    . ARG C 3 452 ? -9.738  37.529 47.053  1.00 34.95 ? 748  ARG A NE    1 
ATOM   4167 C  CZ    . ARG C 3 452 ? -9.621  38.737 47.598  1.00 36.61 ? 748  ARG A CZ    1 
ATOM   4168 N  NH1   . ARG C 3 452 ? -9.653  38.879 48.919  1.00 37.88 ? 748  ARG A NH1   1 
ATOM   4169 N  NH2   . ARG C 3 452 ? -9.467  39.805 46.823  1.00 37.97 ? 748  ARG A NH2   1 
ATOM   4170 N  N     . TYR C 3 453 ? -5.188  35.779 46.443  1.00 15.84 ? 749  TYR A N     1 
ATOM   4171 C  CA    . TYR C 3 453 ? -4.755  35.448 45.086  1.00 16.17 ? 749  TYR A CA    1 
ATOM   4172 C  C     . TYR C 3 453 ? -3.755  34.298 45.110  1.00 15.88 ? 749  TYR A C     1 
ATOM   4173 O  O     . TYR C 3 453 ? -3.870  33.342 44.339  1.00 16.74 ? 749  TYR A O     1 
ATOM   4174 C  CB    . TYR C 3 453 ? -4.099  36.662 44.411  1.00 15.34 ? 749  TYR A CB    1 
ATOM   4175 C  CG    . TYR C 3 453 ? -3.199  36.285 43.244  1.00 14.56 ? 749  TYR A CG    1 
ATOM   4176 C  CD1   . TYR C 3 453 ? -3.733  35.862 42.026  1.00 15.31 ? 749  TYR A CD1   1 
ATOM   4177 C  CD2   . TYR C 3 453 ? -1.809  36.316 43.377  1.00 16.21 ? 749  TYR A CD2   1 
ATOM   4178 C  CE1   . TYR C 3 453 ? -2.907  35.474 40.966  1.00 16.20 ? 749  TYR A CE1   1 
ATOM   4179 C  CE2   . TYR C 3 453 ? -0.971  35.925 42.322  1.00 16.71 ? 749  TYR A CE2   1 
ATOM   4180 C  CZ    . TYR C 3 453 ? -1.530  35.505 41.123  1.00 16.78 ? 749  TYR A CZ    1 
ATOM   4181 O  OH    . TYR C 3 453 ? -0.707  35.106 40.089  1.00 18.71 ? 749  TYR A OH    1 
ATOM   4182 N  N     . MET C 3 454 ? -2.769  34.396 45.993  1.00 15.48 ? 750  MET A N     1 
ATOM   4183 C  CA    . MET C 3 454 ? -1.741  33.366 46.096  1.00 17.24 ? 750  MET A CA    1 
ATOM   4184 C  C     . MET C 3 454 ? -2.343  31.998 46.405  1.00 17.12 ? 750  MET A C     1 
ATOM   4185 O  O     . MET C 3 454 ? -1.939  30.989 45.829  1.00 17.45 ? 750  MET A O     1 
ATOM   4186 C  CB    . MET C 3 454 ? -0.727  33.735 47.178  1.00 18.02 ? 750  MET A CB    1 
ATOM   4187 C  CG    . MET C 3 454 ? 0.022   35.042 46.928  1.00 24.38 ? 750  MET A CG    1 
ATOM   4188 S  SD    . MET C 3 454 ? 1.059   35.032 45.440  1.00 28.73 ? 750  MET A SD    1 
ATOM   4189 C  CE    . MET C 3 454 ? 1.507   36.786 45.333  1.00 28.21 ? 750  MET A CE    1 
ATOM   4190 N  N     . GLU C 3 455 ? -3.311  31.964 47.317  1.00 15.63 ? 751  GLU A N     1 
ATOM   4191 C  CA    . GLU C 3 455 ? -3.951  30.707 47.676  1.00 15.20 ? 751  GLU A CA    1 
ATOM   4192 C  C     . GLU C 3 455 ? -4.805  30.234 46.504  1.00 14.88 ? 751  GLU A C     1 
ATOM   4193 O  O     . GLU C 3 455 ? -4.751  29.072 46.110  1.00 14.58 ? 751  GLU A O     1 
ATOM   4194 C  CB    . GLU C 3 455 ? -4.830  30.895 48.921  1.00 18.07 ? 751  GLU A CB    1 
ATOM   4195 C  CG    . GLU C 3 455 ? -4.095  31.506 50.108  1.00 17.44 ? 751  GLU A CG    1 
ATOM   4196 C  CD    . GLU C 3 455 ? -5.023  31.863 51.262  1.00 22.32 ? 751  GLU A CD    1 
ATOM   4197 O  OE1   . GLU C 3 455 ? -6.177  32.266 50.998  1.00 22.84 ? 751  GLU A OE1   1 
ATOM   4198 O  OE2   . GLU C 3 455 ? -4.595  31.749 52.429  1.00 21.47 ? 751  GLU A OE2   1 
ATOM   4199 N  N     . ASN C 3 456 ? -5.584  31.149 45.940  1.00 15.12 ? 752  ASN A N     1 
ATOM   4200 C  CA    . ASN C 3 456 ? -6.457  30.811 44.828  1.00 16.27 ? 752  ASN A CA    1 
ATOM   4201 C  C     . ASN C 3 456 ? -5.754  30.346 43.566  1.00 15.73 ? 752  ASN A C     1 
ATOM   4202 O  O     . ASN C 3 456 ? -6.231  29.426 42.904  1.00 16.09 ? 752  ASN A O     1 
ATOM   4203 C  CB    . ASN C 3 456 ? -7.365  31.990 44.484  1.00 19.23 ? 752  ASN A CB    1 
ATOM   4204 C  CG    . ASN C 3 456 ? -8.478  32.170 45.491  1.00 21.37 ? 752  ASN A CG    1 
ATOM   4205 O  OD1   . ASN C 3 456 ? -8.747  31.281 46.296  1.00 22.98 ? 752  ASN A OD1   1 
ATOM   4206 N  ND2   . ASN C 3 456 ? -9.134  33.320 45.449  1.00 23.95 ? 752  ASN A ND2   1 
ATOM   4207 N  N     . ILE C 3 457 ? -4.631  30.973 43.229  1.00 15.10 ? 753  ILE A N     1 
ATOM   4208 C  CA    . ILE C 3 457 ? -3.912  30.597 42.018  1.00 14.88 ? 753  ILE A CA    1 
ATOM   4209 C  C     . ILE C 3 457 ? -3.261  29.222 42.153  1.00 14.59 ? 753  ILE A C     1 
ATOM   4210 O  O     . ILE C 3 457 ? -3.184  28.469 41.178  1.00 14.23 ? 753  ILE A O     1 
ATOM   4211 C  CB    . ILE C 3 457 ? -2.847  31.672 41.636  1.00 14.10 ? 753  ILE A CB    1 
ATOM   4212 C  CG1   . ILE C 3 457 ? -2.341  31.420 40.214  1.00 15.26 ? 753  ILE A CG1   1 
ATOM   4213 C  CG2   . ILE C 3 457 ? -1.684  31.655 42.620  1.00 13.89 ? 753  ILE A CG2   1 
ATOM   4214 C  CD1   . ILE C 3 457 ? -3.405  31.598 39.141  1.00 16.80 ? 753  ILE A CD1   1 
ATOM   4215 N  N     . VAL C 3 458 ? -2.791  28.892 43.354  1.00 13.39 ? 754  VAL A N     1 
ATOM   4216 C  CA    . VAL C 3 458 ? -2.184  27.588 43.583  1.00 14.06 ? 754  VAL A CA    1 
ATOM   4217 C  C     . VAL C 3 458 ? -3.272  26.527 43.449  1.00 15.73 ? 754  VAL A C     1 
ATOM   4218 O  O     . VAL C 3 458 ? -3.050  25.460 42.880  1.00 15.53 ? 754  VAL A O     1 
ATOM   4219 C  CB    . VAL C 3 458 ? -1.539  27.498 44.983  1.00 16.51 ? 754  VAL A CB    1 
ATOM   4220 C  CG1   . VAL C 3 458 ? -1.123  26.061 45.287  1.00 15.85 ? 754  VAL A CG1   1 
ATOM   4221 C  CG2   . VAL C 3 458 ? -0.335  28.408 45.039  1.00 16.89 ? 754  VAL A CG2   1 
ATOM   4222 N  N     . GLN C 3 459 ? -4.453  26.832 43.973  1.00 16.21 ? 755  GLN A N     1 
ATOM   4223 C  CA    . GLN C 3 459 ? -5.578  25.911 43.889  1.00 18.85 ? 755  GLN A CA    1 
ATOM   4224 C  C     . GLN C 3 459 ? -6.007  25.733 42.431  1.00 18.50 ? 755  GLN A C     1 
ATOM   4225 O  O     . GLN C 3 459 ? -6.330  24.626 41.999  1.00 16.52 ? 755  GLN A O     1 
ATOM   4226 C  CB    . GLN C 3 459 ? -6.756  26.441 44.713  1.00 22.57 ? 755  GLN A CB    1 
ATOM   4227 C  CG    . GLN C 3 459 ? -8.093  25.814 44.340  1.00 31.63 ? 755  GLN A CG    1 
ATOM   4228 C  CD    . GLN C 3 459 ? -9.232  26.288 45.220  1.00 36.59 ? 755  GLN A CD    1 
ATOM   4229 O  OE1   . GLN C 3 459 ? -9.446  27.494 45.393  1.00 40.27 ? 755  GLN A OE1   1 
ATOM   4230 N  NE2   . GLN C 3 459 ? -9.979  25.340 45.781  1.00 39.07 ? 755  GLN A NE2   1 
ATOM   4231 N  N     . GLU C 3 460 ? -6.002  26.819 41.664  1.00 17.61 ? 756  GLU A N     1 
ATOM   4232 C  CA    . GLU C 3 460 ? -6.402  26.722 40.269  1.00 18.88 ? 756  GLU A CA    1 
ATOM   4233 C  C     . GLU C 3 460 ? -5.389  25.925 39.455  1.00 17.30 ? 756  GLU A C     1 
ATOM   4234 O  O     . GLU C 3 460 ? -5.761  25.165 38.557  1.00 15.50 ? 756  GLU A O     1 
ATOM   4235 C  CB    . GLU C 3 460 ? -6.586  28.107 39.648  1.00 22.79 ? 756  GLU A CB    1 
ATOM   4236 C  CG    . GLU C 3 460 ? -7.160  28.018 38.244  1.00 30.96 ? 756  GLU A CG    1 
ATOM   4237 C  CD    . GLU C 3 460 ? -7.679  29.333 37.726  1.00 34.93 ? 756  GLU A CD    1 
ATOM   4238 O  OE1   . GLU C 3 460 ? -8.291  29.327 36.637  1.00 39.31 ? 756  GLU A OE1   1 
ATOM   4239 O  OE2   . GLU C 3 460 ? -7.478  30.367 38.399  1.00 37.95 ? 756  GLU A OE2   1 
ATOM   4240 N  N     . ALA C 3 461 ? -4.110  26.097 39.773  1.00 15.06 ? 757  ALA A N     1 
ATOM   4241 C  CA    . ALA C 3 461 ? -3.055  25.377 39.073  1.00 15.30 ? 757  ALA A CA    1 
ATOM   4242 C  C     . ALA C 3 461 ? -3.230  23.879 39.316  1.00 15.73 ? 757  ALA A C     1 
ATOM   4243 O  O     . ALA C 3 461 ? -3.006  23.064 38.426  1.00 11.73 ? 757  ALA A O     1 
ATOM   4244 C  CB    . ALA C 3 461 ? -1.689  25.830 39.575  1.00 14.92 ? 757  ALA A CB    1 
ATOM   4245 N  N     . LYS C 3 462 ? -3.634  23.518 40.529  1.00 14.94 ? 758  LYS A N     1 
ATOM   4246 C  CA    . LYS C 3 462 ? -3.830  22.109 40.849  1.00 17.19 ? 758  LYS A CA    1 
ATOM   4247 C  C     . LYS C 3 462 ? -5.061  21.557 40.137  1.00 17.21 ? 758  LYS A C     1 
ATOM   4248 O  O     . LYS C 3 462 ? -5.033  20.450 39.593  1.00 17.48 ? 758  LYS A O     1 
ATOM   4249 C  CB    . LYS C 3 462 ? -3.987  21.908 42.358  1.00 19.56 ? 758  LYS A CB    1 
ATOM   4250 C  CG    . LYS C 3 462 ? -4.386  20.479 42.725  1.00 24.05 ? 758  LYS A CG    1 
ATOM   4251 C  CD    . LYS C 3 462 ? -4.489  20.255 44.228  1.00 26.94 ? 758  LYS A CD    1 
ATOM   4252 C  CE    . LYS C 3 462 ? -3.120  20.207 44.881  1.00 27.69 ? 758  LYS A CE    1 
ATOM   4253 N  NZ    . LYS C 3 462 ? -3.224  19.736 46.291  1.00 26.56 ? 758  LYS A NZ    1 
ATOM   4254 N  N     . GLN C 3 463 ? -6.136  22.338 40.139  1.00 15.19 ? 759  GLN A N     1 
ATOM   4255 C  CA    . GLN C 3 463 ? -7.387  21.923 39.516  1.00 17.06 ? 759  GLN A CA    1 
ATOM   4256 C  C     . GLN C 3 463 ? -7.297  21.792 38.001  1.00 17.05 ? 759  GLN A C     1 
ATOM   4257 O  O     . GLN C 3 463 ? -7.659  20.757 37.442  1.00 17.55 ? 759  GLN A O     1 
ATOM   4258 C  CB    . GLN C 3 463 ? -8.510  22.904 39.885  1.00 17.89 ? 759  GLN A CB    1 
ATOM   4259 C  CG    . GLN C 3 463 ? -9.897  22.541 39.331  1.00 19.74 ? 759  GLN A CG    1 
ATOM   4260 C  CD    . GLN C 3 463 ? -10.253 23.294 38.051  1.00 22.41 ? 759  GLN A CD    1 
ATOM   4261 O  OE1   . GLN C 3 463 ? -10.256 24.525 38.029  1.00 24.87 ? 759  GLN A OE1   1 
ATOM   4262 N  NE2   . GLN C 3 463 ? -10.559 22.555 36.981  1.00 19.72 ? 759  GLN A NE2   1 
ATOM   4263 N  N     . LYS C 3 464 ? -6.796  22.829 37.340  1.00 14.94 ? 760  LYS A N     1 
ATOM   4264 C  CA    . LYS C 3 464 ? -6.703  22.827 35.887  1.00 15.43 ? 760  LYS A CA    1 
ATOM   4265 C  C     . LYS C 3 464 ? -5.421  22.232 35.312  1.00 14.44 ? 760  LYS A C     1 
ATOM   4266 O  O     . LYS C 3 464 ? -5.422  21.734 34.188  1.00 14.03 ? 760  LYS A O     1 
ATOM   4267 C  CB    . LYS C 3 464 ? -6.902  24.250 35.359  1.00 17.73 ? 760  LYS A CB    1 
ATOM   4268 C  CG    . LYS C 3 464 ? -8.318  24.761 35.585  1.00 21.79 ? 760  LYS A CG    1 
ATOM   4269 C  CD    . LYS C 3 464 ? -8.558  26.116 34.958  1.00 25.08 ? 760  LYS A CD    1 
ATOM   4270 C  CE    . LYS C 3 464 ? -9.935  26.644 35.353  1.00 27.17 ? 760  LYS A CE    1 
ATOM   4271 N  NZ    . LYS C 3 464 ? -10.171 28.017 34.837  1.00 30.36 ? 760  LYS A NZ    1 
ATOM   4272 N  N     . GLY C 3 465 ? -4.341  22.280 36.084  1.00 14.16 ? 761  GLY A N     1 
ATOM   4273 C  CA    . GLY C 3 465 ? -3.069  21.743 35.624  1.00 12.02 ? 761  GLY A CA    1 
ATOM   4274 C  C     . GLY C 3 465 ? -2.168  22.813 35.033  1.00 12.07 ? 761  GLY A C     1 
ATOM   4275 O  O     . GLY C 3 465 ? -1.031  22.531 34.636  1.00 12.40 ? 761  GLY A O     1 
ATOM   4276 N  N     . TYR C 3 466 ? -2.673  24.042 34.983  1.00 12.16 ? 762  TYR A N     1 
ATOM   4277 C  CA    . TYR C 3 466 ? -1.922  25.168 34.431  1.00 11.92 ? 762  TYR A CA    1 
ATOM   4278 C  C     . TYR C 3 466 ? -2.457  26.491 34.955  1.00 13.55 ? 762  TYR A C     1 
ATOM   4279 O  O     . TYR C 3 466 ? -3.538  26.548 35.550  1.00 12.64 ? 762  TYR A O     1 
ATOM   4280 C  CB    . TYR C 3 466 ? -2.023  25.193 32.898  1.00 11.38 ? 762  TYR A CB    1 
ATOM   4281 C  CG    . TYR C 3 466 ? -3.444  25.358 32.386  1.00 12.44 ? 762  TYR A CG    1 
ATOM   4282 C  CD1   . TYR C 3 466 ? -4.286  24.254 32.239  1.00 13.57 ? 762  TYR A CD1   1 
ATOM   4283 C  CD2   . TYR C 3 466 ? -3.960  26.622 32.091  1.00 12.17 ? 762  TYR A CD2   1 
ATOM   4284 C  CE1   . TYR C 3 466 ? -5.611  24.406 31.810  1.00 14.02 ? 762  TYR A CE1   1 
ATOM   4285 C  CE2   . TYR C 3 466 ? -5.282  26.785 31.663  1.00 13.35 ? 762  TYR A CE2   1 
ATOM   4286 C  CZ    . TYR C 3 466 ? -6.100  25.671 31.527  1.00 15.69 ? 762  TYR A CZ    1 
ATOM   4287 O  OH    . TYR C 3 466 ? -7.407  25.823 31.110  1.00 14.37 ? 762  TYR A OH    1 
ATOM   4288 N  N     . VAL C 3 467 ? -1.691  27.556 34.732  1.00 12.05 ? 763  VAL A N     1 
ATOM   4289 C  CA    . VAL C 3 467 ? -2.116  28.895 35.119  1.00 12.39 ? 763  VAL A CA    1 
ATOM   4290 C  C     . VAL C 3 467 ? -2.069  29.708 33.832  1.00 13.47 ? 763  VAL A C     1 
ATOM   4291 O  O     . VAL C 3 467 ? -1.399  29.316 32.870  1.00 12.13 ? 763  VAL A O     1 
ATOM   4292 C  CB    . VAL C 3 467 ? -1.194  29.539 36.195  1.00 13.63 ? 763  VAL A CB    1 
ATOM   4293 C  CG1   . VAL C 3 467 ? -1.332  28.780 37.516  1.00 13.45 ? 763  VAL A CG1   1 
ATOM   4294 C  CG2   . VAL C 3 467 ? 0.254   29.541 35.721  1.00 11.60 ? 763  VAL A CG2   1 
ATOM   4295 N  N     . THR C 3 468 ? -2.776  30.831 33.806  1.00 12.44 ? 764  THR A N     1 
ATOM   4296 C  CA    . THR C 3 468 ? -2.821  31.652 32.603  1.00 14.04 ? 764  THR A CA    1 
ATOM   4297 C  C     . THR C 3 468 ? -2.513  33.120 32.862  1.00 13.29 ? 764  THR A C     1 
ATOM   4298 O  O     . THR C 3 468 ? -2.511  33.575 34.007  1.00 14.96 ? 764  THR A O     1 
ATOM   4299 C  CB    . THR C 3 468 ? -4.208  31.571 31.951  1.00 14.27 ? 764  THR A CB    1 
ATOM   4300 O  OG1   . THR C 3 468 ? -5.177  32.151 32.832  1.00 17.95 ? 764  THR A OG1   1 
ATOM   4301 C  CG2   . THR C 3 468 ? -4.588  30.118 31.682  1.00 14.57 ? 764  THR A CG2   1 
ATOM   4302 N  N     . THR C 3 469 ? -2.263  33.854 31.782  1.00 12.80 ? 765  THR A N     1 
ATOM   4303 C  CA    . THR C 3 469 ? -1.977  35.285 31.854  1.00 13.03 ? 765  THR A CA    1 
ATOM   4304 C  C     . THR C 3 469 ? -3.174  36.058 31.304  1.00 13.15 ? 765  THR A C     1 
ATOM   4305 O  O     . THR C 3 469 ? -4.111  35.469 30.770  1.00 13.77 ? 765  THR A O     1 
ATOM   4306 C  CB    . THR C 3 469 ? -0.747  35.663 31.007  1.00 11.68 ? 765  THR A CB    1 
ATOM   4307 O  OG1   . THR C 3 469 ? -1.045  35.439 29.625  1.00 11.91 ? 765  THR A OG1   1 
ATOM   4308 C  CG2   . THR C 3 469 ? 0.458   34.823 31.402  1.00 11.56 ? 765  THR A CG2   1 
ATOM   4309 N  N     . LEU C 3 470 ? -3.131  37.380 31.426  1.00 12.07 ? 766  LEU A N     1 
ATOM   4310 C  CA    . LEU C 3 470 ? -4.209  38.233 30.940  1.00 14.97 ? 766  LEU A CA    1 
ATOM   4311 C  C     . LEU C 3 470 ? -4.616  37.981 29.491  1.00 14.50 ? 766  LEU A C     1 
ATOM   4312 O  O     . LEU C 3 470 ? -5.801  38.038 29.166  1.00 14.34 ? 766  LEU A O     1 
ATOM   4313 C  CB    . LEU C 3 470 ? -3.824  39.704 31.106  1.00 19.64 ? 766  LEU A CB    1 
ATOM   4314 C  CG    . LEU C 3 470 ? -4.176  40.384 32.432  1.00 25.43 ? 766  LEU A CG    1 
ATOM   4315 C  CD1   . LEU C 3 470 ? -3.740  39.529 33.607  1.00 28.79 ? 766  LEU A CD1   1 
ATOM   4316 C  CD2   . LEU C 3 470 ? -3.513  41.751 32.475  1.00 25.98 ? 766  LEU A CD2   1 
ATOM   4317 N  N     . LEU C 3 471 ? -3.646  37.709 28.620  1.00 12.98 ? 767  LEU A N     1 
ATOM   4318 C  CA    . LEU C 3 471 ? -3.963  37.467 27.217  1.00 13.92 ? 767  LEU A CA    1 
ATOM   4319 C  C     . LEU C 3 471 ? -4.045  35.983 26.836  1.00 14.20 ? 767  LEU A C     1 
ATOM   4320 O  O     . LEU C 3 471 ? -3.940  35.621 25.662  1.00 13.47 ? 767  LEU A O     1 
ATOM   4321 C  CB    . LEU C 3 471 ? -2.972  38.214 26.312  1.00 13.94 ? 767  LEU A CB    1 
ATOM   4322 C  CG    . LEU C 3 471 ? -3.005  39.742 26.475  1.00 15.63 ? 767  LEU A CG    1 
ATOM   4323 C  CD1   . LEU C 3 471 ? -2.340  40.406 25.272  1.00 17.71 ? 767  LEU A CD1   1 
ATOM   4324 C  CD2   . LEU C 3 471 ? -4.445  40.230 26.597  1.00 19.43 ? 767  LEU A CD2   1 
ATOM   4325 N  N     . HIS C 3 472 ? -4.232  35.138 27.849  1.00 13.67 ? 768  HIS A N     1 
ATOM   4326 C  CA    . HIS C 3 472 ? -4.401  33.693 27.685  1.00 13.87 ? 768  HIS A CA    1 
ATOM   4327 C  C     . HIS C 3 472 ? -3.177  32.826 27.426  1.00 15.23 ? 768  HIS A C     1 
ATOM   4328 O  O     . HIS C 3 472 ? -3.295  31.711 26.916  1.00 12.71 ? 768  HIS A O     1 
ATOM   4329 C  CB    . HIS C 3 472 ? -5.461  33.415 26.614  1.00 17.19 ? 768  HIS A CB    1 
ATOM   4330 C  CG    . HIS C 3 472 ? -6.737  34.167 26.825  1.00 22.40 ? 768  HIS A CG    1 
ATOM   4331 N  ND1   . HIS C 3 472 ? -7.449  34.109 28.004  1.00 27.21 ? 768  HIS A ND1   1 
ATOM   4332 C  CD2   . HIS C 3 472 ? -7.412  35.022 26.021  1.00 26.76 ? 768  HIS A CD2   1 
ATOM   4333 C  CE1   . HIS C 3 472 ? -8.506  34.897 27.918  1.00 27.76 ? 768  HIS A CE1   1 
ATOM   4334 N  NE2   . HIS C 3 472 ? -8.506  35.463 26.724  1.00 27.98 ? 768  HIS A NE2   1 
ATOM   4335 N  N     . ARG C 3 473 ? -1.998  33.328 27.771  1.00 13.59 ? 769  ARG A N     1 
ATOM   4336 C  CA    . ARG C 3 473 ? -0.794  32.532 27.627  1.00 14.44 ? 769  ARG A CA    1 
ATOM   4337 C  C     . ARG C 3 473 ? -0.944  31.495 28.744  1.00 13.88 ? 769  ARG A C     1 
ATOM   4338 O  O     . ARG C 3 473 ? -1.601  31.764 29.750  1.00 13.30 ? 769  ARG A O     1 
ATOM   4339 C  CB    . ARG C 3 473 ? 0.440   33.391 27.883  1.00 14.27 ? 769  ARG A CB    1 
ATOM   4340 C  CG    . ARG C 3 473 ? 1.759   32.721 27.541  1.00 14.76 ? 769  ARG A CG    1 
ATOM   4341 C  CD    . ARG C 3 473 ? 2.908   33.649 27.889  1.00 13.58 ? 769  ARG A CD    1 
ATOM   4342 N  NE    . ARG C 3 473 ? 2.775   34.936 27.209  1.00 13.17 ? 769  ARG A NE    1 
ATOM   4343 C  CZ    . ARG C 3 473 ? 3.064   35.137 25.928  1.00 11.45 ? 769  ARG A CZ    1 
ATOM   4344 N  NH1   . ARG C 3 473 ? 3.515   34.136 25.181  1.00 11.25 ? 769  ARG A NH1   1 
ATOM   4345 N  NH2   . ARG C 3 473 ? 2.885   36.336 25.389  1.00 13.19 ? 769  ARG A NH2   1 
ATOM   4346 N  N     . ARG C 3 474 ? -0.368  30.311 28.588  1.00 13.30 ? 770  ARG A N     1 
ATOM   4347 C  CA    . ARG C 3 474 ? -0.488  29.342 29.668  1.00 15.12 ? 770  ARG A CA    1 
ATOM   4348 C  C     . ARG C 3 474 ? 0.813   28.636 29.982  1.00 14.05 ? 770  ARG A C     1 
ATOM   4349 O  O     . ARG C 3 474 ? 1.753   28.602 29.175  1.00 14.43 ? 770  ARG A O     1 
ATOM   4350 C  CB    . ARG C 3 474 ? -1.604  28.310 29.397  1.00 17.91 ? 770  ARG A CB    1 
ATOM   4351 C  CG    . ARG C 3 474 ? -1.358  27.313 28.278  1.00 20.56 ? 770  ARG A CG    1 
ATOM   4352 C  CD    . ARG C 3 474 ? -2.404  26.166 28.316  1.00 18.99 ? 770  ARG A CD    1 
ATOM   4353 N  NE    . ARG C 3 474 ? -3.781  26.650 28.211  1.00 20.33 ? 770  ARG A NE    1 
ATOM   4354 C  CZ    . ARG C 3 474 ? -4.864  25.873 28.220  1.00 19.40 ? 770  ARG A CZ    1 
ATOM   4355 N  NH1   . ARG C 3 474 ? -4.751  24.551 28.328  1.00 16.03 ? 770  ARG A NH1   1 
ATOM   4356 N  NH2   . ARG C 3 474 ? -6.070  26.422 28.127  1.00 17.20 ? 770  ARG A NH2   1 
ATOM   4357 N  N     . ARG C 3 475 ? 0.863   28.080 31.183  1.00 13.22 ? 771  ARG A N     1 
ATOM   4358 C  CA    . ARG C 3 475 ? 2.030   27.351 31.639  1.00 13.52 ? 771  ARG A CA    1 
ATOM   4359 C  C     . ARG C 3 475 ? 1.539   26.181 32.471  1.00 12.01 ? 771  ARG A C     1 
ATOM   4360 O  O     . ARG C 3 475 ? 0.848   26.368 33.478  1.00 12.10 ? 771  ARG A O     1 
ATOM   4361 C  CB    . ARG C 3 475 ? 2.930   28.244 32.490  1.00 14.00 ? 771  ARG A CB    1 
ATOM   4362 C  CG    . ARG C 3 475 ? 4.223   27.557 32.902  1.00 15.46 ? 771  ARG A CG    1 
ATOM   4363 C  CD    . ARG C 3 475 ? 5.101   28.479 33.729  1.00 19.39 ? 771  ARG A CD    1 
ATOM   4364 N  NE    . ARG C 3 475 ? 6.393   27.872 34.033  1.00 17.45 ? 771  ARG A NE    1 
ATOM   4365 C  CZ    . ARG C 3 475 ? 7.358   28.483 34.714  1.00 18.04 ? 771  ARG A CZ    1 
ATOM   4366 N  NH1   . ARG C 3 475 ? 7.165   29.713 35.159  1.00 14.98 ? 771  ARG A NH1   1 
ATOM   4367 N  NH2   . ARG C 3 475 ? 8.512   27.871 34.944  1.00 14.17 ? 771  ARG A NH2   1 
ATOM   4368 N  N     . TYR C 3 476 ? 1.887   24.976 32.039  1.00 11.49 ? 772  TYR A N     1 
ATOM   4369 C  CA    . TYR C 3 476 ? 1.495   23.769 32.751  1.00 12.08 ? 772  TYR A CA    1 
ATOM   4370 C  C     . TYR C 3 476 ? 2.420   23.574 33.933  1.00 13.66 ? 772  TYR A C     1 
ATOM   4371 O  O     . TYR C 3 476 ? 3.627   23.797 33.829  1.00 13.13 ? 772  TYR A O     1 
ATOM   4372 C  CB    . TYR C 3 476 ? 1.578   22.564 31.816  1.00 12.98 ? 772  TYR A CB    1 
ATOM   4373 C  CG    . TYR C 3 476 ? 0.493   22.576 30.773  1.00 13.52 ? 772  TYR A CG    1 
ATOM   4374 C  CD1   . TYR C 3 476 ? -0.812  22.227 31.106  1.00 15.45 ? 772  TYR A CD1   1 
ATOM   4375 C  CD2   . TYR C 3 476 ? 0.757   22.985 29.467  1.00 14.67 ? 772  TYR A CD2   1 
ATOM   4376 C  CE1   . TYR C 3 476 ? -1.836  22.284 30.165  1.00 14.44 ? 772  TYR A CE1   1 
ATOM   4377 C  CE2   . TYR C 3 476 ? -0.258  23.046 28.511  1.00 13.73 ? 772  TYR A CE2   1 
ATOM   4378 C  CZ    . TYR C 3 476 ? -1.555  22.694 28.872  1.00 16.28 ? 772  TYR A CZ    1 
ATOM   4379 O  OH    . TYR C 3 476 ? -2.573  22.759 27.945  1.00 14.04 ? 772  TYR A OH    1 
ATOM   4380 N  N     . LEU C 3 477 ? 1.854   23.159 35.059  1.00 12.72 ? 773  LEU A N     1 
ATOM   4381 C  CA    . LEU C 3 477 ? 2.643   22.947 36.264  1.00 14.21 ? 773  LEU A CA    1 
ATOM   4382 C  C     . LEU C 3 477 ? 2.367   21.576 36.866  1.00 15.18 ? 773  LEU A C     1 
ATOM   4383 O  O     . LEU C 3 477 ? 1.707   21.459 37.902  1.00 14.33 ? 773  LEU A O     1 
ATOM   4384 C  CB    . LEU C 3 477 ? 2.331   24.039 37.285  1.00 13.95 ? 773  LEU A CB    1 
ATOM   4385 C  CG    . LEU C 3 477 ? 2.712   25.449 36.827  1.00 14.73 ? 773  LEU A CG    1 
ATOM   4386 C  CD1   . LEU C 3 477 ? 2.151   26.474 37.797  1.00 16.97 ? 773  LEU A CD1   1 
ATOM   4387 C  CD2   . LEU C 3 477 ? 4.233   25.566 36.728  1.00 15.13 ? 773  LEU A CD2   1 
ATOM   4388 N  N     . PRO C 3 478 ? 2.878   20.517 36.223  1.00 15.47 ? 774  PRO A N     1 
ATOM   4389 C  CA    . PRO C 3 478 ? 2.654   19.164 36.740  1.00 16.82 ? 774  PRO A CA    1 
ATOM   4390 C  C     . PRO C 3 478 ? 3.225   18.911 38.139  1.00 16.68 ? 774  PRO A C     1 
ATOM   4391 O  O     . PRO C 3 478 ? 2.701   18.079 38.880  1.00 16.31 ? 774  PRO A O     1 
ATOM   4392 C  CB    . PRO C 3 478 ? 3.277   18.275 35.665  1.00 17.43 ? 774  PRO A CB    1 
ATOM   4393 C  CG    . PRO C 3 478 ? 4.378   19.141 35.102  1.00 15.94 ? 774  PRO A CG    1 
ATOM   4394 C  CD    . PRO C 3 478 ? 3.695   20.486 34.995  1.00 14.47 ? 774  PRO A CD    1 
ATOM   4395 N  N     . ASP C 3 479 ? 4.289   19.627 38.501  1.00 16.63 ? 775  ASP A N     1 
ATOM   4396 C  CA    . ASP C 3 479 ? 4.908   19.450 39.818  1.00 17.05 ? 775  ASP A CA    1 
ATOM   4397 C  C     . ASP C 3 479 ? 4.077   20.021 40.968  1.00 17.30 ? 775  ASP A C     1 
ATOM   4398 O  O     . ASP C 3 479 ? 4.419   19.835 42.137  1.00 16.28 ? 775  ASP A O     1 
ATOM   4399 C  CB    . ASP C 3 479 ? 6.299   20.091 39.859  1.00 19.79 ? 775  ASP A CB    1 
ATOM   4400 C  CG    . ASP C 3 479 ? 7.309   19.366 38.991  1.00 23.07 ? 775  ASP A CG    1 
ATOM   4401 O  OD1   . ASP C 3 479 ? 7.015   18.242 38.534  1.00 23.33 ? 775  ASP A OD1   1 
ATOM   4402 O  OD2   . ASP C 3 479 ? 8.405   19.923 38.771  1.00 25.57 ? 775  ASP A OD2   1 
ATOM   4403 N  N     . ILE C 3 480 ? 2.993   20.716 40.641  1.00 14.80 ? 776  ILE A N     1 
ATOM   4404 C  CA    . ILE C 3 480 ? 2.129   21.304 41.660  1.00 16.92 ? 776  ILE A CA    1 
ATOM   4405 C  C     . ILE C 3 480 ? 1.510   20.198 42.529  1.00 16.42 ? 776  ILE A C     1 
ATOM   4406 O  O     . ILE C 3 480 ? 1.064   20.450 43.648  1.00 16.85 ? 776  ILE A O     1 
ATOM   4407 C  CB    . ILE C 3 480 ? 0.991   22.148 41.000  1.00 18.57 ? 776  ILE A CB    1 
ATOM   4408 C  CG1   . ILE C 3 480 ? 0.394   23.133 42.005  1.00 21.70 ? 776  ILE A CG1   1 
ATOM   4409 C  CG2   . ILE C 3 480 ? -0.106  21.233 40.475  1.00 21.62 ? 776  ILE A CG2   1 
ATOM   4410 C  CD1   . ILE C 3 480 ? 1.243   24.359 42.239  1.00 19.19 ? 776  ILE A CD1   1 
ATOM   4411 N  N     . THR C 3 481 ? 1.497   18.972 42.017  1.00 16.99 ? 777  THR A N     1 
ATOM   4412 C  CA    . THR C 3 481 ? 0.918   17.843 42.748  1.00 19.40 ? 777  THR A CA    1 
ATOM   4413 C  C     . THR C 3 481 ? 1.956   16.915 43.376  1.00 20.62 ? 777  THR A C     1 
ATOM   4414 O  O     . THR C 3 481 ? 1.605   15.887 43.957  1.00 20.44 ? 777  THR A O     1 
ATOM   4415 C  CB    . THR C 3 481 ? 0.034   16.994 41.829  1.00 19.96 ? 777  THR A CB    1 
ATOM   4416 O  OG1   . THR C 3 481 ? 0.827   16.477 40.753  1.00 19.75 ? 777  THR A OG1   1 
ATOM   4417 C  CG2   . THR C 3 481 ? -1.094  17.836 41.257  1.00 22.03 ? 777  THR A CG2   1 
ATOM   4418 N  N     . SER C 3 482 ? 3.228   17.279 43.261  1.00 19.43 ? 778  SER A N     1 
ATOM   4419 C  CA    . SER C 3 482 ? 4.305   16.464 43.811  1.00 20.97 ? 778  SER A CA    1 
ATOM   4420 C  C     . SER C 3 482 ? 4.230   16.290 45.326  1.00 20.36 ? 778  SER A C     1 
ATOM   4421 O  O     . SER C 3 482 ? 3.827   17.200 46.047  1.00 18.79 ? 778  SER A O     1 
ATOM   4422 C  CB    . SER C 3 482 ? 5.659   17.080 43.442  1.00 21.59 ? 778  SER A CB    1 
ATOM   4423 O  OG    . SER C 3 482 ? 6.722   16.418 44.102  1.00 22.97 ? 778  SER A OG    1 
ATOM   4424 N  N     . ARG C 3 483 ? 4.617   15.110 45.807  1.00 22.46 ? 779  ARG A N     1 
ATOM   4425 C  CA    . ARG C 3 483 ? 4.617   14.853 47.241  1.00 23.74 ? 779  ARG A CA    1 
ATOM   4426 C  C     . ARG C 3 483 ? 5.976   15.206 47.833  1.00 24.30 ? 779  ARG A C     1 
ATOM   4427 O  O     . ARG C 3 483 ? 6.277   14.865 48.978  1.00 25.76 ? 779  ARG A O     1 
ATOM   4428 C  CB    . ARG C 3 483 ? 4.265   13.395 47.547  1.00 24.05 ? 779  ARG A CB    1 
ATOM   4429 C  CG    . ARG C 3 483 ? 2.761   13.134 47.610  1.00 25.09 ? 779  ARG A CG    1 
ATOM   4430 C  CD    . ARG C 3 483 ? 2.145   13.163 46.226  1.00 25.17 ? 779  ARG A CD    1 
ATOM   4431 N  NE    . ARG C 3 483 ? 2.548   11.992 45.456  1.00 24.73 ? 779  ARG A NE    1 
ATOM   4432 C  CZ    . ARG C 3 483 ? 2.687   11.970 44.136  1.00 25.26 ? 779  ARG A CZ    1 
ATOM   4433 N  NH1   . ARG C 3 483 ? 2.458   13.065 43.420  1.00 22.04 ? 779  ARG A NH1   1 
ATOM   4434 N  NH2   . ARG C 3 483 ? 3.062   10.849 43.532  1.00 23.30 ? 779  ARG A NH2   1 
ATOM   4435 N  N     . ASN C 3 484 ? 6.796   15.888 47.038  1.00 25.20 ? 780  ASN A N     1 
ATOM   4436 C  CA    . ASN C 3 484 ? 8.112   16.340 47.486  1.00 25.10 ? 780  ASN A CA    1 
ATOM   4437 C  C     . ASN C 3 484 ? 7.950   17.831 47.757  1.00 25.79 ? 780  ASN A C     1 
ATOM   4438 O  O     . ASN C 3 484 ? 7.661   18.607 46.844  1.00 25.19 ? 780  ASN A O     1 
ATOM   4439 C  CB    . ASN C 3 484 ? 9.172   16.109 46.402  1.00 26.97 ? 780  ASN A CB    1 
ATOM   4440 C  CG    . ASN C 3 484 ? 10.542  16.639 46.801  1.00 29.39 ? 780  ASN A CG    1 
ATOM   4441 O  OD1   . ASN C 3 484 ? 10.755  17.850 46.885  1.00 29.70 ? 780  ASN A OD1   1 
ATOM   4442 N  ND2   . ASN C 3 484 ? 11.476  15.731 47.056  1.00 29.78 ? 780  ASN A ND2   1 
ATOM   4443 N  N     . PHE C 3 485 ? 8.131   18.226 49.013  1.00 25.24 ? 781  PHE A N     1 
ATOM   4444 C  CA    . PHE C 3 485 ? 7.964   19.618 49.406  1.00 25.35 ? 781  PHE A CA    1 
ATOM   4445 C  C     . PHE C 3 485 ? 8.679   20.634 48.523  1.00 24.94 ? 781  PHE A C     1 
ATOM   4446 O  O     . PHE C 3 485 ? 8.056   21.560 48.006  1.00 24.48 ? 781  PHE A O     1 
ATOM   4447 C  CB    . PHE C 3 485 ? 8.413   19.832 50.851  1.00 24.87 ? 781  PHE A CB    1 
ATOM   4448 C  CG    . PHE C 3 485 ? 8.183   21.232 51.343  1.00 26.68 ? 781  PHE A CG    1 
ATOM   4449 C  CD1   . PHE C 3 485 ? 6.897   21.674 51.643  1.00 26.10 ? 781  PHE A CD1   1 
ATOM   4450 C  CD2   . PHE C 3 485 ? 9.245   22.117 51.483  1.00 25.72 ? 781  PHE A CD2   1 
ATOM   4451 C  CE1   . PHE C 3 485 ? 6.672   22.979 52.073  1.00 28.31 ? 781  PHE A CE1   1 
ATOM   4452 C  CE2   . PHE C 3 485 ? 9.032   23.424 51.911  1.00 27.44 ? 781  PHE A CE2   1 
ATOM   4453 C  CZ    . PHE C 3 485 ? 7.742   23.857 52.207  1.00 27.87 ? 781  PHE A CZ    1 
ATOM   4454 N  N     . ASN C 3 486 ? 9.984   20.468 48.355  1.00 24.93 ? 782  ASN A N     1 
ATOM   4455 C  CA    . ASN C 3 486 ? 10.754  21.405 47.547  1.00 26.11 ? 782  ASN A CA    1 
ATOM   4456 C  C     . ASN C 3 486 ? 10.267  21.499 46.107  1.00 25.16 ? 782  ASN A C     1 
ATOM   4457 O  O     . ASN C 3 486 ? 10.115  22.598 45.566  1.00 23.63 ? 782  ASN A O     1 
ATOM   4458 C  CB    . ASN C 3 486 ? 12.238  21.032 47.568  1.00 28.75 ? 782  ASN A CB    1 
ATOM   4459 C  CG    . ASN C 3 486 ? 12.840  21.132 48.956  1.00 30.29 ? 782  ASN A CG    1 
ATOM   4460 O  OD1   . ASN C 3 486 ? 12.469  22.005 49.739  1.00 32.39 ? 782  ASN A OD1   1 
ATOM   4461 N  ND2   . ASN C 3 486 ? 13.781  20.241 49.266  1.00 34.12 ? 782  ASN A ND2   1 
ATOM   4462 N  N     . VAL C 3 487 ? 10.025  20.351 45.486  1.00 23.26 ? 783  VAL A N     1 
ATOM   4463 C  CA    . VAL C 3 487 ? 9.555   20.337 44.107  1.00 22.47 ? 783  VAL A CA    1 
ATOM   4464 C  C     . VAL C 3 487 ? 8.172   20.969 43.999  1.00 20.99 ? 783  VAL A C     1 
ATOM   4465 O  O     . VAL C 3 487 ? 7.911   21.749 43.083  1.00 20.91 ? 783  VAL A O     1 
ATOM   4466 C  CB    . VAL C 3 487 ? 9.507   18.901 43.544  1.00 22.76 ? 783  VAL A CB    1 
ATOM   4467 C  CG1   . VAL C 3 487 ? 8.818   18.894 42.179  1.00 22.58 ? 783  VAL A CG1   1 
ATOM   4468 C  CG2   . VAL C 3 487 ? 10.921  18.351 43.417  1.00 25.08 ? 783  VAL A CG2   1 
ATOM   4469 N  N     . ARG C 3 488 ? 7.288   20.639 44.935  1.00 19.37 ? 784  ARG A N     1 
ATOM   4470 C  CA    . ARG C 3 488 ? 5.942   21.192 44.914  1.00 18.09 ? 784  ARG A CA    1 
ATOM   4471 C  C     . ARG C 3 488 ? 5.964   22.697 45.175  1.00 16.85 ? 784  ARG A C     1 
ATOM   4472 O  O     . ARG C 3 488 ? 5.258   23.459 44.516  1.00 16.54 ? 784  ARG A O     1 
ATOM   4473 C  CB    . ARG C 3 488 ? 5.048   20.503 45.959  1.00 16.40 ? 784  ARG A CB    1 
ATOM   4474 C  CG    . ARG C 3 488 ? 3.612   21.008 45.923  1.00 17.66 ? 784  ARG A CG    1 
ATOM   4475 C  CD    . ARG C 3 488 ? 2.680   20.297 46.903  1.00 18.78 ? 784  ARG A CD    1 
ATOM   4476 N  NE    . ARG C 3 488 ? 3.056   20.513 48.297  1.00 20.26 ? 784  ARG A NE    1 
ATOM   4477 C  CZ    . ARG C 3 488 ? 3.728   19.637 49.038  1.00 20.90 ? 784  ARG A CZ    1 
ATOM   4478 N  NH1   . ARG C 3 488 ? 4.099   18.469 48.523  1.00 21.54 ? 784  ARG A NH1   1 
ATOM   4479 N  NH2   . ARG C 3 488 ? 4.039   19.935 50.292  1.00 21.94 ? 784  ARG A NH2   1 
ATOM   4480 N  N     . SER C 3 489 ? 6.781   23.119 46.137  1.00 18.06 ? 785  SER A N     1 
ATOM   4481 C  CA    . SER C 3 489 ? 6.890   24.534 46.486  1.00 18.52 ? 785  SER A CA    1 
ATOM   4482 C  C     . SER C 3 489 ? 7.382   25.378 45.318  1.00 17.76 ? 785  SER A C     1 
ATOM   4483 O  O     . SER C 3 489 ? 6.946   26.510 45.134  1.00 18.91 ? 785  SER A O     1 
ATOM   4484 C  CB    . SER C 3 489 ? 7.830   24.716 47.683  1.00 20.08 ? 785  SER A CB    1 
ATOM   4485 O  OG    . SER C 3 489 ? 7.249   24.182 48.865  1.00 22.13 ? 785  SER A OG    1 
ATOM   4486 N  N     . PHE C 3 490 ? 8.293   24.822 44.533  1.00 19.76 ? 786  PHE A N     1 
ATOM   4487 C  CA    . PHE C 3 490 ? 8.829   25.530 43.379  1.00 19.73 ? 786  PHE A CA    1 
ATOM   4488 C  C     . PHE C 3 490 ? 7.686   25.758 42.387  1.00 18.25 ? 786  PHE A C     1 
ATOM   4489 O  O     . PHE C 3 490 ? 7.513   26.862 41.866  1.00 16.64 ? 786  PHE A O     1 
ATOM   4490 C  CB    . PHE C 3 490 ? 9.955   24.699 42.747  1.00 23.37 ? 786  PHE A CB    1 
ATOM   4491 C  CG    . PHE C 3 490 ? 10.748  25.428 41.689  1.00 28.40 ? 786  PHE A CG    1 
ATOM   4492 C  CD1   . PHE C 3 490 ? 10.754  26.821 41.625  1.00 30.55 ? 786  PHE A CD1   1 
ATOM   4493 C  CD2   . PHE C 3 490 ? 11.524  24.714 40.777  1.00 30.80 ? 786  PHE A CD2   1 
ATOM   4494 C  CE1   . PHE C 3 490 ? 11.521  27.492 40.669  1.00 30.82 ? 786  PHE A CE1   1 
ATOM   4495 C  CE2   . PHE C 3 490 ? 12.295  25.375 39.819  1.00 32.85 ? 786  PHE A CE2   1 
ATOM   4496 C  CZ    . PHE C 3 490 ? 12.293  26.770 39.765  1.00 32.79 ? 786  PHE A CZ    1 
ATOM   4497 N  N     . ALA C 3 491 ? 6.896   24.716 42.147  1.00 15.86 ? 787  ALA A N     1 
ATOM   4498 C  CA    . ALA C 3 491 ? 5.759   24.808 41.235  1.00 15.49 ? 787  ALA A CA    1 
ATOM   4499 C  C     . ALA C 3 491 ? 4.723   25.817 41.731  1.00 14.10 ? 787  ALA A C     1 
ATOM   4500 O  O     . ALA C 3 491 ? 4.112   26.531 40.934  1.00 15.70 ? 787  ALA A O     1 
ATOM   4501 C  CB    . ALA C 3 491 ? 5.108   23.435 41.066  1.00 14.57 ? 787  ALA A CB    1 
ATOM   4502 N  N     . GLU C 3 492 ? 4.518   25.874 43.045  1.00 14.20 ? 788  GLU A N     1 
ATOM   4503 C  CA    . GLU C 3 492 ? 3.549   26.806 43.611  1.00 14.80 ? 788  GLU A CA    1 
ATOM   4504 C  C     . GLU C 3 492 ? 3.997   28.246 43.378  1.00 14.94 ? 788  GLU A C     1 
ATOM   4505 O  O     . GLU C 3 492 ? 3.189   29.113 43.048  1.00 14.45 ? 788  GLU A O     1 
ATOM   4506 C  CB    . GLU C 3 492 ? 3.357   26.535 45.110  1.00 16.75 ? 788  GLU A CB    1 
ATOM   4507 C  CG    . GLU C 3 492 ? 2.918   25.095 45.403  1.00 18.25 ? 788  GLU A CG    1 
ATOM   4508 C  CD    . GLU C 3 492 ? 2.545   24.861 46.858  1.00 22.10 ? 788  GLU A CD    1 
ATOM   4509 O  OE1   . GLU C 3 492 ? 3.200   25.443 47.747  1.00 21.40 ? 788  GLU A OE1   1 
ATOM   4510 O  OE2   . GLU C 3 492 ? 1.596   24.084 47.111  1.00 22.37 ? 788  GLU A OE2   1 
ATOM   4511 N  N     . ARG C 3 493 ? 5.287   28.503 43.543  1.00 14.92 ? 789  ARG A N     1 
ATOM   4512 C  CA    . ARG C 3 493 ? 5.796   29.847 43.320  1.00 16.37 ? 789  ARG A CA    1 
ATOM   4513 C  C     . ARG C 3 493 ? 5.673   30.201 41.836  1.00 14.98 ? 789  ARG A C     1 
ATOM   4514 O  O     . ARG C 3 493 ? 5.428   31.354 41.490  1.00 13.31 ? 789  ARG A O     1 
ATOM   4515 C  CB    . ARG C 3 493 ? 7.245   29.958 43.806  1.00 17.63 ? 789  ARG A CB    1 
ATOM   4516 C  CG    . ARG C 3 493 ? 7.374   29.826 45.332  1.00 20.87 ? 789  ARG A CG    1 
ATOM   4517 C  CD    . ARG C 3 493 ? 8.731   30.317 45.841  1.00 22.65 ? 789  ARG A CD    1 
ATOM   4518 N  NE    . ARG C 3 493 ? 9.843   29.508 45.357  1.00 25.58 ? 789  ARG A NE    1 
ATOM   4519 C  CZ    . ARG C 3 493 ? 10.194  28.331 45.864  1.00 28.04 ? 789  ARG A CZ    1 
ATOM   4520 N  NH1   . ARG C 3 493 ? 9.522   27.812 46.883  1.00 28.13 ? 789  ARG A NH1   1 
ATOM   4521 N  NH2   . ARG C 3 493 ? 11.220  27.669 45.349  1.00 29.02 ? 789  ARG A NH2   1 
ATOM   4522 N  N     . MET C 3 494 ? 5.816   29.208 40.962  1.00 14.66 ? 790  MET A N     1 
ATOM   4523 C  CA    . MET C 3 494 ? 5.682   29.451 39.529  1.00 13.94 ? 790  MET A CA    1 
ATOM   4524 C  C     . MET C 3 494 ? 4.222   29.799 39.251  1.00 12.92 ? 790  MET A C     1 
ATOM   4525 O  O     . MET C 3 494 ? 3.922   30.653 38.416  1.00 13.13 ? 790  MET A O     1 
ATOM   4526 C  CB    . MET C 3 494 ? 6.074   28.208 38.713  1.00 13.62 ? 790  MET A CB    1 
ATOM   4527 C  CG    . MET C 3 494 ? 7.565   27.869 38.728  1.00 16.47 ? 790  MET A CG    1 
ATOM   4528 S  SD    . MET C 3 494 ? 7.924   26.400 37.711  1.00 23.66 ? 790  MET A SD    1 
ATOM   4529 C  CE    . MET C 3 494 ? 9.614   26.097 38.140  1.00 22.43 ? 790  MET A CE    1 
ATOM   4530 N  N     . ALA C 3 495 ? 3.315   29.136 39.962  1.00 11.43 ? 791  ALA A N     1 
ATOM   4531 C  CA    . ALA C 3 495 ? 1.888   29.388 39.785  1.00 12.15 ? 791  ALA A CA    1 
ATOM   4532 C  C     . ALA C 3 495 ? 1.540   30.816 40.202  1.00 13.71 ? 791  ALA A C     1 
ATOM   4533 O  O     . ALA C 3 495 ? 0.705   31.479 39.585  1.00 13.60 ? 791  ALA A O     1 
ATOM   4534 C  CB    . ALA C 3 495 ? 1.072   28.394 40.608  1.00 12.41 ? 791  ALA A CB    1 
ATOM   4535 N  N     . MET C 3 496 ? 2.187   31.282 41.260  1.00 13.67 ? 792  MET A N     1 
ATOM   4536 C  CA    . MET C 3 496 ? 1.949   32.626 41.761  1.00 14.39 ? 792  MET A CA    1 
ATOM   4537 C  C     . MET C 3 496 ? 2.585   33.680 40.855  1.00 13.62 ? 792  MET A C     1 
ATOM   4538 O  O     . MET C 3 496 ? 1.976   34.709 40.568  1.00 15.57 ? 792  MET A O     1 
ATOM   4539 C  CB    . MET C 3 496 ? 2.534   32.765 43.171  1.00 15.45 ? 792  MET A CB    1 
ATOM   4540 C  CG    . MET C 3 496 ? 1.838   31.929 44.232  1.00 19.28 ? 792  MET A CG    1 
ATOM   4541 S  SD    . MET C 3 496 ? 2.677   32.013 45.828  1.00 21.82 ? 792  MET A SD    1 
ATOM   4542 C  CE    . MET C 3 496 ? 3.362   30.383 45.924  1.00 24.96 ? 792  MET A CE    1 
ATOM   4543 N  N     . ASN C 3 497 ? 3.806   33.405 40.409  1.00 13.86 ? 793  ASN A N     1 
ATOM   4544 C  CA    . ASN C 3 497 ? 4.580   34.336 39.584  1.00 15.08 ? 793  ASN A CA    1 
ATOM   4545 C  C     . ASN C 3 497 ? 4.252   34.436 38.094  1.00 15.67 ? 793  ASN A C     1 
ATOM   4546 O  O     . ASN C 3 497 ? 4.239   35.531 37.527  1.00 13.70 ? 793  ASN A O     1 
ATOM   4547 C  CB    . ASN C 3 497 ? 6.075   34.022 39.749  1.00 16.95 ? 793  ASN A CB    1 
ATOM   4548 C  CG    . ASN C 3 497 ? 6.961   34.826 38.800  1.00 19.02 ? 793  ASN A CG    1 
ATOM   4549 O  OD1   . ASN C 3 497 ? 7.412   34.322 37.773  1.00 20.96 ? 793  ASN A OD1   1 
ATOM   4550 N  ND2   . ASN C 3 497 ? 7.205   36.081 39.143  1.00 18.43 ? 793  ASN A ND2   1 
ATOM   4551 N  N     . THR C 3 498 ? 3.983   33.306 37.456  1.00 14.68 ? 794  THR A N     1 
ATOM   4552 C  CA    . THR C 3 498 ? 3.717   33.321 36.022  1.00 14.73 ? 794  THR A CA    1 
ATOM   4553 C  C     . THR C 3 498 ? 2.619   34.275 35.535  1.00 14.91 ? 794  THR A C     1 
ATOM   4554 O  O     . THR C 3 498 ? 2.815   34.981 34.545  1.00 15.64 ? 794  THR A O     1 
ATOM   4555 C  CB    . THR C 3 498 ? 3.464   31.892 35.514  1.00 14.88 ? 794  THR A CB    1 
ATOM   4556 O  OG1   . THR C 3 498 ? 4.654   31.118 35.718  1.00 17.75 ? 794  THR A OG1   1 
ATOM   4557 C  CG2   . THR C 3 498 ? 3.126   31.894 34.027  1.00 16.17 ? 794  THR A CG2   1 
ATOM   4558 N  N     . PRO C 3 499 ? 1.458   34.314 36.211  1.00 14.82 ? 795  PRO A N     1 
ATOM   4559 C  CA    . PRO C 3 499 ? 0.396   35.225 35.764  1.00 15.03 ? 795  PRO A CA    1 
ATOM   4560 C  C     . PRO C 3 499 ? 0.835   36.685 35.872  1.00 15.24 ? 795  PRO A C     1 
ATOM   4561 O  O     . PRO C 3 499 ? 0.334   37.554 35.156  1.00 14.79 ? 795  PRO A O     1 
ATOM   4562 C  CB    . PRO C 3 499 ? -0.769  34.892 36.690  1.00 15.80 ? 795  PRO A CB    1 
ATOM   4563 C  CG    . PRO C 3 499 ? -0.542  33.448 37.005  1.00 14.05 ? 795  PRO A CG    1 
ATOM   4564 C  CD    . PRO C 3 499 ? 0.952   33.398 37.245  1.00 15.69 ? 795  PRO A CD    1 
ATOM   4565 N  N     . ILE C 3 500 ? 1.774   36.948 36.777  1.00 13.00 ? 796  ILE A N     1 
ATOM   4566 C  CA    . ILE C 3 500 ? 2.274   38.304 36.980  1.00 13.31 ? 796  ILE A CA    1 
ATOM   4567 C  C     . ILE C 3 500 ? 3.328   38.666 35.935  1.00 12.50 ? 796  ILE A C     1 
ATOM   4568 O  O     . ILE C 3 500 ? 3.133   39.599 35.157  1.00 12.94 ? 796  ILE A O     1 
ATOM   4569 C  CB    . ILE C 3 500 ? 2.883   38.470 38.399  1.00 11.92 ? 796  ILE A CB    1 
ATOM   4570 C  CG1   . ILE C 3 500 ? 1.820   38.153 39.458  1.00 12.79 ? 796  ILE A CG1   1 
ATOM   4571 C  CG2   . ILE C 3 500 ? 3.388   39.895 38.585  1.00 11.50 ? 796  ILE A CG2   1 
ATOM   4572 C  CD1   . ILE C 3 500 ? 2.316   38.285 40.895  1.00 19.33 ? 796  ILE A CD1   1 
ATOM   4573 N  N     . GLN C 3 501 ? 4.441   37.934 35.923  1.00 12.13 ? 797  GLN A N     1 
ATOM   4574 C  CA    . GLN C 3 501 ? 5.513   38.186 34.956  1.00 13.34 ? 797  GLN A CA    1 
ATOM   4575 C  C     . GLN C 3 501 ? 4.986   38.001 33.532  1.00 13.31 ? 797  GLN A C     1 
ATOM   4576 O  O     . GLN C 3 501 ? 5.312   38.782 32.631  1.00 12.58 ? 797  GLN A O     1 
ATOM   4577 C  CB    . GLN C 3 501 ? 6.700   37.235 35.199  1.00 13.79 ? 797  GLN A CB    1 
ATOM   4578 C  CG    . GLN C 3 501 ? 7.864   37.412 34.206  1.00 17.14 ? 797  GLN A CG    1 
ATOM   4579 C  CD    . GLN C 3 501 ? 9.052   36.494 34.488  1.00 20.79 ? 797  GLN A CD    1 
ATOM   4580 O  OE1   . GLN C 3 501 ? 9.604   35.871 33.573  1.00 23.19 ? 797  GLN A OE1   1 
ATOM   4581 N  NE2   . GLN C 3 501 ? 9.454   36.412 35.750  1.00 19.68 ? 797  GLN A NE2   1 
ATOM   4582 N  N     . GLY C 3 502 ? 4.163   36.969 33.346  1.00 12.90 ? 798  GLY A N     1 
ATOM   4583 C  CA    . GLY C 3 502 ? 3.587   36.678 32.044  1.00 12.42 ? 798  GLY A CA    1 
ATOM   4584 C  C     . GLY C 3 502 ? 2.620   37.727 31.529  1.00 12.60 ? 798  GLY A C     1 
ATOM   4585 O  O     . GLY C 3 502 ? 2.659   38.083 30.353  1.00 11.40 ? 798  GLY A O     1 
ATOM   4586 N  N     . SER C 3 503 ? 1.738   38.227 32.390  1.00 12.66 ? 799  SER A N     1 
ATOM   4587 C  CA    . SER C 3 503 ? 0.800   39.250 31.947  1.00 10.27 ? 799  SER A CA    1 
ATOM   4588 C  C     . SER C 3 503 ? 1.557   40.547 31.642  1.00 11.88 ? 799  SER A C     1 
ATOM   4589 O  O     . SER C 3 503 ? 1.175   41.287 30.742  1.00 8.64  ? 799  SER A O     1 
ATOM   4590 C  CB    . SER C 3 503 ? -0.283  39.490 33.004  1.00 9.49  ? 799  SER A CB    1 
ATOM   4591 O  OG    . SER C 3 503 ? -1.070  38.322 33.180  1.00 11.49 ? 799  SER A OG    1 
ATOM   4592 N  N     . ALA C 3 504 ? 2.634   40.814 32.381  1.00 8.94  ? 800  ALA A N     1 
ATOM   4593 C  CA    . ALA C 3 504 ? 3.430   42.018 32.133  1.00 11.16 ? 800  ALA A CA    1 
ATOM   4594 C  C     . ALA C 3 504 ? 4.104   41.855 30.763  1.00 10.99 ? 800  ALA A C     1 
ATOM   4595 O  O     . ALA C 3 504 ? 4.305   42.829 30.039  1.00 10.70 ? 800  ALA A O     1 
ATOM   4596 C  CB    . ALA C 3 504 ? 4.491   42.209 33.242  1.00 8.61  ? 800  ALA A CB    1 
ATOM   4597 N  N     . ALA C 3 505 ? 4.436   40.616 30.407  1.00 11.06 ? 801  ALA A N     1 
ATOM   4598 C  CA    . ALA C 3 505 ? 5.047   40.341 29.110  1.00 10.53 ? 801  ALA A CA    1 
ATOM   4599 C  C     . ALA C 3 505 ? 3.997   40.557 28.012  1.00 11.27 ? 801  ALA A C     1 
ATOM   4600 O  O     . ALA C 3 505 ? 4.292   41.147 26.966  1.00 11.69 ? 801  ALA A O     1 
ATOM   4601 C  CB    . ALA C 3 505 ? 5.576   38.904 29.064  1.00 10.03 ? 801  ALA A CB    1 
ATOM   4602 N  N     . ASP C 3 506 ? 2.775   40.088 28.257  1.00 11.11 ? 802  ASP A N     1 
ATOM   4603 C  CA    . ASP C 3 506 ? 1.685   40.240 27.290  1.00 10.83 ? 802  ASP A CA    1 
ATOM   4604 C  C     . ASP C 3 506 ? 1.459   41.721 26.978  1.00 11.60 ? 802  ASP A C     1 
ATOM   4605 O  O     . ASP C 3 506 ? 1.328   42.114 25.814  1.00 12.16 ? 802  ASP A O     1 
ATOM   4606 C  CB    . ASP C 3 506 ? 0.362   39.685 27.836  1.00 12.73 ? 802  ASP A CB    1 
ATOM   4607 C  CG    . ASP C 3 506 ? 0.333   38.169 27.943  1.00 13.73 ? 802  ASP A CG    1 
ATOM   4608 O  OD1   . ASP C 3 506 ? 1.193   37.482 27.356  1.00 13.50 ? 802  ASP A OD1   1 
ATOM   4609 O  OD2   . ASP C 3 506 ? -0.584  37.664 28.625  1.00 15.16 ? 802  ASP A OD2   1 
ATOM   4610 N  N     . ILE C 3 507 ? 1.408   42.531 28.032  1.00 10.43 ? 803  ILE A N     1 
ATOM   4611 C  CA    . ILE C 3 507 ? 1.169   43.964 27.902  1.00 10.82 ? 803  ILE A CA    1 
ATOM   4612 C  C     . ILE C 3 507 ? 2.210   44.696 27.071  1.00 10.99 ? 803  ILE A C     1 
ATOM   4613 O  O     . ILE C 3 507 ? 1.861   45.443 26.156  1.00 9.32  ? 803  ILE A O     1 
ATOM   4614 C  CB    . ILE C 3 507 ? 1.076   44.643 29.291  1.00 11.91 ? 803  ILE A CB    1 
ATOM   4615 C  CG1   . ILE C 3 507 ? -0.111  44.067 30.065  1.00 13.07 ? 803  ILE A CG1   1 
ATOM   4616 C  CG2   . ILE C 3 507 ? 0.899   46.168 29.127  1.00 11.78 ? 803  ILE A CG2   1 
ATOM   4617 C  CD1   . ILE C 3 507 ? -0.166  44.488 31.526  1.00 12.81 ? 803  ILE A CD1   1 
ATOM   4618 N  N     . ILE C 3 508 ? 3.487   44.490 27.372  1.00 9.65  ? 804  ILE A N     1 
ATOM   4619 C  CA    . ILE C 3 508 ? 4.497   45.202 26.607  1.00 10.65 ? 804  ILE A CA    1 
ATOM   4620 C  C     . ILE C 3 508 ? 4.583   44.712 25.165  1.00 9.58  ? 804  ILE A C     1 
ATOM   4621 O  O     . ILE C 3 508 ? 4.912   45.490 24.273  1.00 10.51 ? 804  ILE A O     1 
ATOM   4622 C  CB    . ILE C 3 508 ? 5.884   45.163 27.306  1.00 10.94 ? 804  ILE A CB    1 
ATOM   4623 C  CG1   . ILE C 3 508 ? 6.821   46.170 26.626  1.00 13.10 ? 804  ILE A CG1   1 
ATOM   4624 C  CG2   . ILE C 3 508 ? 6.460   43.758 27.286  1.00 10.41 ? 804  ILE A CG2   1 
ATOM   4625 C  CD1   . ILE C 3 508 ? 8.074   46.481 27.432  1.00 12.18 ? 804  ILE A CD1   1 
ATOM   4626 N  N     . LYS C 3 509 ? 4.277   43.439 24.925  1.00 9.53  ? 805  LYS A N     1 
ATOM   4627 C  CA    . LYS C 3 509 ? 4.295   42.929 23.556  1.00 10.76 ? 805  LYS A CA    1 
ATOM   4628 C  C     . LYS C 3 509 ? 3.200   43.640 22.768  1.00 10.52 ? 805  LYS A C     1 
ATOM   4629 O  O     . LYS C 3 509 ? 3.415   44.060 21.636  1.00 10.58 ? 805  LYS A O     1 
ATOM   4630 C  CB    . LYS C 3 509 ? 4.053   41.417 23.520  1.00 9.34  ? 805  LYS A CB    1 
ATOM   4631 C  CG    . LYS C 3 509 ? 5.242   40.583 23.950  1.00 11.35 ? 805  LYS A CG    1 
ATOM   4632 C  CD    . LYS C 3 509 ? 4.920   39.090 23.855  1.00 12.23 ? 805  LYS A CD    1 
ATOM   4633 C  CE    . LYS C 3 509 ? 6.195   38.254 23.959  1.00 14.03 ? 805  LYS A CE    1 
ATOM   4634 N  NZ    . LYS C 3 509 ? 5.911   36.784 23.937  1.00 11.09 ? 805  LYS A NZ    1 
ATOM   4635 N  N     . LYS C 3 510 ? 2.029   43.779 23.384  1.00 9.34  ? 806  LYS A N     1 
ATOM   4636 C  CA    . LYS C 3 510 ? 0.895   44.451 22.758  1.00 11.27 ? 806  LYS A CA    1 
ATOM   4637 C  C     . LYS C 3 510 ? 1.230   45.926 22.540  1.00 11.88 ? 806  LYS A C     1 
ATOM   4638 O  O     . LYS C 3 510 ? 0.839   46.521 21.534  1.00 12.03 ? 806  LYS A O     1 
ATOM   4639 C  CB    . LYS C 3 510 ? -0.341  44.310 23.655  1.00 11.97 ? 806  LYS A CB    1 
ATOM   4640 C  CG    . LYS C 3 510 ? -1.491  45.281 23.384  1.00 16.97 ? 806  LYS A CG    1 
ATOM   4641 C  CD    . LYS C 3 510 ? -2.296  44.946 22.154  1.00 20.00 ? 806  LYS A CD    1 
ATOM   4642 C  CE    . LYS C 3 510 ? -3.755  45.436 22.301  1.00 20.23 ? 806  LYS A CE    1 
ATOM   4643 N  NZ    . LYS C 3 510 ? -3.868  46.907 22.561  1.00 17.59 ? 806  LYS A NZ    1 
ATOM   4644 N  N     . ALA C 3 511 ? 1.965   46.506 23.483  1.00 12.50 ? 807  ALA A N     1 
ATOM   4645 C  CA    . ALA C 3 511 ? 2.357   47.909 23.383  1.00 10.84 ? 807  ALA A CA    1 
ATOM   4646 C  C     . ALA C 3 511 ? 3.262   48.100 22.173  1.00 9.86  ? 807  ALA A C     1 
ATOM   4647 O  O     . ALA C 3 511 ? 3.149   49.095 21.469  1.00 10.04 ? 807  ALA A O     1 
ATOM   4648 C  CB    . ALA C 3 511 ? 3.082   48.362 24.663  1.00 10.82 ? 807  ALA A CB    1 
ATOM   4649 N  N     . MET C 3 512 ? 4.153   47.141 21.935  1.00 9.80  ? 808  MET A N     1 
ATOM   4650 C  CA    . MET C 3 512 ? 5.069   47.217 20.797  1.00 9.50  ? 808  MET A CA    1 
ATOM   4651 C  C     . MET C 3 512 ? 4.295   47.224 19.481  1.00 9.84  ? 808  MET A C     1 
ATOM   4652 O  O     . MET C 3 512 ? 4.586   48.010 18.578  1.00 9.56  ? 808  MET A O     1 
ATOM   4653 C  CB    . MET C 3 512 ? 6.037   46.034 20.832  1.00 9.61  ? 808  MET A CB    1 
ATOM   4654 C  CG    . MET C 3 512 ? 7.026   46.121 21.990  1.00 10.82 ? 808  MET A CG    1 
ATOM   4655 S  SD    . MET C 3 512 ? 7.991   44.629 22.223  1.00 11.77 ? 808  MET A SD    1 
ATOM   4656 C  CE    . MET C 3 512 ? 9.211   44.777 20.911  1.00 9.92  ? 808  MET A CE    1 
ATOM   4657 N  N     . ILE C 3 513 ? 3.307   46.341 19.382  1.00 8.87  ? 809  ILE A N     1 
ATOM   4658 C  CA    . ILE C 3 513 ? 2.480   46.261 18.186  1.00 9.80  ? 809  ILE A CA    1 
ATOM   4659 C  C     . ILE C 3 513 ? 1.709   47.575 18.012  1.00 10.01 ? 809  ILE A C     1 
ATOM   4660 O  O     . ILE C 3 513 ? 1.692   48.152 16.922  1.00 11.14 ? 809  ILE A O     1 
ATOM   4661 C  CB    . ILE C 3 513 ? 1.488   45.075 18.283  1.00 11.52 ? 809  ILE A CB    1 
ATOM   4662 C  CG1   . ILE C 3 513 ? 2.267   43.753 18.316  1.00 13.80 ? 809  ILE A CG1   1 
ATOM   4663 C  CG2   . ILE C 3 513 ? 0.521   45.098 17.097  1.00 12.18 ? 809  ILE A CG2   1 
ATOM   4664 C  CD1   . ILE C 3 513 ? 1.422   42.550 18.707  1.00 17.01 ? 809  ILE A CD1   1 
ATOM   4665 N  N     . ASP C 3 514 ? 1.084   48.060 19.084  1.00 10.66 ? 810  ASP A N     1 
ATOM   4666 C  CA    . ASP C 3 514 ? 0.330   49.314 19.001  1.00 10.96 ? 810  ASP A CA    1 
ATOM   4667 C  C     . ASP C 3 514 ? 1.253   50.482 18.643  1.00 11.38 ? 810  ASP A C     1 
ATOM   4668 O  O     . ASP C 3 514 ? 0.898   51.352 17.843  1.00 11.35 ? 810  ASP A O     1 
ATOM   4669 C  CB    . ASP C 3 514 ? -0.374  49.625 20.327  1.00 11.49 ? 810  ASP A CB    1 
ATOM   4670 C  CG    . ASP C 3 514 ? -1.477  48.646 20.655  1.00 14.76 ? 810  ASP A CG    1 
ATOM   4671 O  OD1   . ASP C 3 514 ? -1.912  47.894 19.757  1.00 16.57 ? 810  ASP A OD1   1 
ATOM   4672 O  OD2   . ASP C 3 514 ? -1.917  48.639 21.824  1.00 17.12 ? 810  ASP A OD2   1 
ATOM   4673 N  N     . LEU C 3 515 ? 2.438   50.506 19.237  1.00 12.84 ? 811  LEU A N     1 
ATOM   4674 C  CA    . LEU C 3 515 ? 3.385   51.576 18.957  1.00 12.66 ? 811  LEU A CA    1 
ATOM   4675 C  C     . LEU C 3 515 ? 3.761   51.636 17.484  1.00 13.43 ? 811  LEU A C     1 
ATOM   4676 O  O     . LEU C 3 515 ? 3.684   52.694 16.855  1.00 11.59 ? 811  LEU A O     1 
ATOM   4677 C  CB    . LEU C 3 515 ? 4.653   51.396 19.790  1.00 13.85 ? 811  LEU A CB    1 
ATOM   4678 C  CG    . LEU C 3 515 ? 5.751   52.427 19.547  1.00 14.89 ? 811  LEU A CG    1 
ATOM   4679 C  CD1   . LEU C 3 515 ? 5.217   53.826 19.818  1.00 12.70 ? 811  LEU A CD1   1 
ATOM   4680 C  CD2   . LEU C 3 515 ? 6.946   52.109 20.452  1.00 14.78 ? 811  LEU A CD2   1 
ATOM   4681 N  N     . ASN C 3 516 ? 4.173   50.502 16.925  1.00 13.32 ? 812  ASN A N     1 
ATOM   4682 C  CA    . ASN C 3 516 ? 4.551   50.475 15.522  1.00 13.98 ? 812  ASN A CA    1 
ATOM   4683 C  C     . ASN C 3 516 ? 3.427   50.928 14.603  1.00 14.32 ? 812  ASN A C     1 
ATOM   4684 O  O     . ASN C 3 516 ? 3.675   51.579 13.594  1.00 12.87 ? 812  ASN A O     1 
ATOM   4685 C  CB    . ASN C 3 516 ? 5.038   49.083 15.126  1.00 16.43 ? 812  ASN A CB    1 
ATOM   4686 C  CG    . ASN C 3 516 ? 6.542   48.965 15.223  1.00 21.39 ? 812  ASN A CG    1 
ATOM   4687 O  OD1   . ASN C 3 516 ? 7.152   49.501 16.146  1.00 24.07 ? 812  ASN A OD1   1 
ATOM   4688 N  ND2   . ASN C 3 516 ? 7.149   48.266 14.273  1.00 20.32 ? 812  ASN A ND2   1 
ATOM   4689 N  N     . ALA C 3 517 ? 2.190   50.598 14.952  1.00 12.33 ? 813  ALA A N     1 
ATOM   4690 C  CA    . ALA C 3 517 ? 1.072   51.027 14.124  1.00 13.07 ? 813  ALA A CA    1 
ATOM   4691 C  C     . ALA C 3 517 ? 0.982   52.555 14.190  1.00 13.44 ? 813  ALA A C     1 
ATOM   4692 O  O     . ALA C 3 517 ? 0.752   53.217 13.172  1.00 12.68 ? 813  ALA A O     1 
ATOM   4693 C  CB    . ALA C 3 517 ? -0.227  50.386 14.613  1.00 13.62 ? 813  ALA A CB    1 
ATOM   4694 N  N     . ARG C 3 518 ? 1.188   53.119 15.379  1.00 13.35 ? 814  ARG A N     1 
ATOM   4695 C  CA    . ARG C 3 518 ? 1.128   54.568 15.539  1.00 14.39 ? 814  ARG A CA    1 
ATOM   4696 C  C     . ARG C 3 518 ? 2.294   55.262 14.830  1.00 14.67 ? 814  ARG A C     1 
ATOM   4697 O  O     . ARG C 3 518 ? 2.106   56.290 14.181  1.00 13.13 ? 814  ARG A O     1 
ATOM   4698 C  CB    . ARG C 3 518 ? 1.128   54.957 17.024  1.00 16.10 ? 814  ARG A CB    1 
ATOM   4699 C  CG    . ARG C 3 518 ? -0.117  54.540 17.801  1.00 19.36 ? 814  ARG A CG    1 
ATOM   4700 C  CD    . ARG C 3 518 ? -1.390  55.153 17.217  1.00 25.78 ? 814  ARG A CD    1 
ATOM   4701 N  NE    . ARG C 3 518 ? -1.275  56.596 17.018  1.00 30.54 ? 814  ARG A NE    1 
ATOM   4702 C  CZ    . ARG C 3 518 ? -1.182  57.492 17.993  1.00 33.25 ? 814  ARG A CZ    1 
ATOM   4703 N  NH1   . ARG C 3 518 ? -1.193  57.107 19.263  1.00 36.88 ? 814  ARG A NH1   1 
ATOM   4704 N  NH2   . ARG C 3 518 ? -1.067  58.782 17.695  1.00 34.62 ? 814  ARG A NH2   1 
ATOM   4705 N  N     . LEU C 3 519 ? 3.496   54.705 14.954  1.00 13.56 ? 815  LEU A N     1 
ATOM   4706 C  CA    . LEU C 3 519 ? 4.660   55.299 14.305  1.00 13.93 ? 815  LEU A CA    1 
ATOM   4707 C  C     . LEU C 3 519 ? 4.443   55.368 12.796  1.00 14.22 ? 815  LEU A C     1 
ATOM   4708 O  O     . LEU C 3 519 ? 4.820   56.343 12.148  1.00 14.50 ? 815  LEU A O     1 
ATOM   4709 C  CB    . LEU C 3 519 ? 5.921   54.488 14.621  1.00 14.20 ? 815  LEU A CB    1 
ATOM   4710 C  CG    . LEU C 3 519 ? 6.413   54.552 16.072  1.00 12.07 ? 815  LEU A CG    1 
ATOM   4711 C  CD1   . LEU C 3 519 ? 7.572   53.585 16.264  1.00 14.07 ? 815  LEU A CD1   1 
ATOM   4712 C  CD2   . LEU C 3 519 ? 6.837   55.986 16.412  1.00 14.02 ? 815  LEU A CD2   1 
ATOM   4713 N  N     . LYS C 3 520 ? 3.814   54.339 12.244  1.00 13.81 ? 816  LYS A N     1 
ATOM   4714 C  CA    . LYS C 3 520 ? 3.550   54.291 10.813  1.00 15.47 ? 816  LYS A CA    1 
ATOM   4715 C  C     . LYS C 3 520 ? 2.468   55.296 10.397  1.00 15.77 ? 816  LYS A C     1 
ATOM   4716 O  O     . LYS C 3 520 ? 2.613   55.979 9.382   1.00 15.40 ? 816  LYS A O     1 
ATOM   4717 C  CB    . LYS C 3 520 ? 3.149   52.871 10.409  1.00 15.86 ? 816  LYS A CB    1 
ATOM   4718 C  CG    . LYS C 3 520 ? 3.037   52.646 8.910   1.00 20.84 ? 816  LYS A CG    1 
ATOM   4719 C  CD    . LYS C 3 520 ? 2.712   51.188 8.620   1.00 24.62 ? 816  LYS A CD    1 
ATOM   4720 C  CE    . LYS C 3 520 ? 2.649   50.904 7.131   1.00 28.77 ? 816  LYS A CE    1 
ATOM   4721 N  NZ    . LYS C 3 520 ? 2.347   49.465 6.873   1.00 29.17 ? 816  LYS A NZ    1 
ATOM   4722 N  N     . GLU C 3 521 ? 1.390   55.392 11.178  1.00 14.39 ? 817  GLU A N     1 
ATOM   4723 C  CA    . GLU C 3 521 ? 0.319   56.332 10.862  1.00 16.45 ? 817  GLU A CA    1 
ATOM   4724 C  C     . GLU C 3 521 ? 0.849   57.764 10.852  1.00 15.37 ? 817  GLU A C     1 
ATOM   4725 O  O     . GLU C 3 521 ? 0.414   58.586 10.048  1.00 14.63 ? 817  GLU A O     1 
ATOM   4726 C  CB    . GLU C 3 521 ? -0.814  56.243 11.890  1.00 16.95 ? 817  GLU A CB    1 
ATOM   4727 C  CG    . GLU C 3 521 ? -1.400  54.859 12.077  1.00 22.35 ? 817  GLU A CG    1 
ATOM   4728 C  CD    . GLU C 3 521 ? -2.511  54.832 13.117  1.00 25.18 ? 817  GLU A CD    1 
ATOM   4729 O  OE1   . GLU C 3 521 ? -2.412  55.563 14.127  1.00 24.87 ? 817  GLU A OE1   1 
ATOM   4730 O  OE2   . GLU C 3 521 ? -3.484  54.071 12.927  1.00 27.55 ? 817  GLU A OE2   1 
ATOM   4731 N  N     . GLU C 3 522 ? 1.786   58.051 11.753  1.00 14.79 ? 818  GLU A N     1 
ATOM   4732 C  CA    . GLU C 3 522 ? 2.369   59.387 11.872  1.00 15.56 ? 818  GLU A CA    1 
ATOM   4733 C  C     . GLU C 3 522 ? 3.571   59.594 10.950  1.00 16.92 ? 818  GLU A C     1 
ATOM   4734 O  O     . GLU C 3 522 ? 4.155   60.677 10.918  1.00 15.90 ? 818  GLU A O     1 
ATOM   4735 C  CB    . GLU C 3 522 ? 2.805   59.645 13.321  1.00 16.62 ? 818  GLU A CB    1 
ATOM   4736 C  CG    . GLU C 3 522 ? 1.690   59.580 14.348  1.00 20.10 ? 818  GLU A CG    1 
ATOM   4737 C  CD    . GLU C 3 522 ? 0.571   60.560 14.057  1.00 24.68 ? 818  GLU A CD    1 
ATOM   4738 O  OE1   . GLU C 3 522 ? 0.874   61.717 13.698  1.00 25.40 ? 818  GLU A OE1   1 
ATOM   4739 O  OE2   . GLU C 3 522 ? -0.613  60.174 14.192  1.00 25.13 ? 818  GLU A OE2   1 
ATOM   4740 N  N     . ARG C 3 523 ? 3.934   58.553 10.210  1.00 17.36 ? 819  ARG A N     1 
ATOM   4741 C  CA    . ARG C 3 523 ? 5.065   58.603 9.290   1.00 18.54 ? 819  ARG A CA    1 
ATOM   4742 C  C     . ARG C 3 523 ? 6.345   59.050 9.997   1.00 17.25 ? 819  ARG A C     1 
ATOM   4743 O  O     . ARG C 3 523 ? 7.169   59.745 9.404   1.00 17.59 ? 819  ARG A O     1 
ATOM   4744 C  CB    . ARG C 3 523 ? 4.796   59.570 8.125   1.00 20.93 ? 819  ARG A CB    1 
ATOM   4745 C  CG    . ARG C 3 523 ? 3.352   59.651 7.627   1.00 25.08 ? 819  ARG A CG    1 
ATOM   4746 C  CD    . ARG C 3 523 ? 2.804   58.296 7.296   1.00 23.73 ? 819  ARG A CD    1 
ATOM   4747 N  NE    . ARG C 3 523 ? 1.715   58.327 6.320   1.00 20.55 ? 819  ARG A NE    1 
ATOM   4748 C  CZ    . ARG C 3 523 ? 0.814   57.356 6.210   1.00 21.12 ? 819  ARG A CZ    1 
ATOM   4749 N  NH1   . ARG C 3 523 ? 0.881   56.312 7.024   1.00 18.53 ? 819  ARG A NH1   1 
ATOM   4750 N  NH2   . ARG C 3 523 ? -0.138  57.413 5.284   1.00 20.35 ? 819  ARG A NH2   1 
ATOM   4751 N  N     . LEU C 3 524 ? 6.515   58.666 11.258  1.00 15.76 ? 820  LEU A N     1 
ATOM   4752 C  CA    . LEU C 3 524 ? 7.723   59.038 11.985  1.00 14.54 ? 820  LEU A CA    1 
ATOM   4753 C  C     . LEU C 3 524 ? 8.864   58.118 11.569  1.00 16.45 ? 820  LEU A C     1 
ATOM   4754 O  O     . LEU C 3 524 ? 8.639   56.961 11.215  1.00 16.88 ? 820  LEU A O     1 
ATOM   4755 C  CB    . LEU C 3 524 ? 7.500   58.930 13.495  1.00 14.77 ? 820  LEU A CB    1 
ATOM   4756 C  CG    . LEU C 3 524 ? 6.532   59.948 14.113  1.00 14.47 ? 820  LEU A CG    1 
ATOM   4757 C  CD1   . LEU C 3 524 ? 6.221   59.554 15.546  1.00 15.96 ? 820  LEU A CD1   1 
ATOM   4758 C  CD2   . LEU C 3 524 ? 7.140   61.338 14.057  1.00 16.58 ? 820  LEU A CD2   1 
ATOM   4759 N  N     . GLN C 3 525 ? 10.088  58.635 11.608  1.00 14.27 ? 821  GLN A N     1 
ATOM   4760 C  CA    . GLN C 3 525 ? 11.250  57.840 11.249  1.00 16.47 ? 821  GLN A CA    1 
ATOM   4761 C  C     . GLN C 3 525 ? 11.733  57.045 12.454  1.00 15.63 ? 821  GLN A C     1 
ATOM   4762 O  O     . GLN C 3 525 ? 12.538  56.126 12.323  1.00 15.67 ? 821  GLN A O     1 
ATOM   4763 C  CB    . GLN C 3 525 ? 12.364  58.743 10.739  1.00 18.12 ? 821  GLN A CB    1 
ATOM   4764 C  CG    . GLN C 3 525 ? 12.088  59.302 9.353   1.00 22.92 ? 821  GLN A CG    1 
ATOM   4765 C  CD    . GLN C 3 525 ? 13.196  60.205 8.870   1.00 25.73 ? 821  GLN A CD    1 
ATOM   4766 O  OE1   . GLN C 3 525 ? 13.179  61.414 9.110   1.00 30.79 ? 821  GLN A OE1   1 
ATOM   4767 N  NE2   . GLN C 3 525 ? 14.179  59.623 8.199   1.00 28.07 ? 821  GLN A NE2   1 
ATOM   4768 N  N     . ALA C 3 526 ? 11.226  57.411 13.626  1.00 14.81 ? 822  ALA A N     1 
ATOM   4769 C  CA    . ALA C 3 526 ? 11.581  56.739 14.868  1.00 13.41 ? 822  ALA A CA    1 
ATOM   4770 C  C     . ALA C 3 526 ? 11.268  55.261 14.731  1.00 14.57 ? 822  ALA A C     1 
ATOM   4771 O  O     . ALA C 3 526 ? 10.300  54.877 14.074  1.00 11.31 ? 822  ALA A O     1 
ATOM   4772 C  CB    . ALA C 3 526 ? 10.778  57.328 16.033  1.00 13.54 ? 822  ALA A CB    1 
ATOM   4773 N  N     . HIS C 3 527 ? 12.092  54.426 15.346  1.00 12.70 ? 823  HIS A N     1 
ATOM   4774 C  CA    . HIS C 3 527 ? 11.855  52.996 15.294  1.00 14.32 ? 823  HIS A CA    1 
ATOM   4775 C  C     . HIS C 3 527 ? 12.429  52.291 16.505  1.00 13.97 ? 823  HIS A C     1 
ATOM   4776 O  O     . HIS C 3 527 ? 13.391  52.757 17.121  1.00 11.99 ? 823  HIS A O     1 
ATOM   4777 C  CB    . HIS C 3 527 ? 12.421  52.385 14.003  1.00 16.21 ? 823  HIS A CB    1 
ATOM   4778 C  CG    . HIS C 3 527 ? 13.893  52.588 13.816  1.00 21.37 ? 823  HIS A CG    1 
ATOM   4779 N  ND1   . HIS C 3 527 ? 14.425  53.161 12.681  1.00 24.02 ? 823  HIS A ND1   1 
ATOM   4780 C  CD2   . HIS C 3 527 ? 14.946  52.284 14.611  1.00 23.98 ? 823  HIS A CD2   1 
ATOM   4781 C  CE1   . HIS C 3 527 ? 15.741  53.201 12.784  1.00 25.08 ? 823  HIS A CE1   1 
ATOM   4782 N  NE2   . HIS C 3 527 ? 16.084  52.674 13.945  1.00 21.98 ? 823  HIS A NE2   1 
ATOM   4783 N  N     . LEU C 3 528 ? 11.814  51.164 16.838  1.00 12.83 ? 824  LEU A N     1 
ATOM   4784 C  CA    . LEU C 3 528 ? 12.232  50.347 17.960  1.00 12.94 ? 824  LEU A CA    1 
ATOM   4785 C  C     . LEU C 3 528 ? 13.586  49.715 17.710  1.00 12.03 ? 824  LEU A C     1 
ATOM   4786 O  O     . LEU C 3 528 ? 13.883  49.284 16.599  1.00 12.70 ? 824  LEU A O     1 
ATOM   4787 C  CB    . LEU C 3 528 ? 11.209  49.236 18.207  1.00 11.79 ? 824  LEU A CB    1 
ATOM   4788 C  CG    . LEU C 3 528 ? 9.908   49.614 18.911  1.00 13.55 ? 824  LEU A CG    1 
ATOM   4789 C  CD1   . LEU C 3 528 ? 8.875   48.511 18.715  1.00 13.96 ? 824  LEU A CD1   1 
ATOM   4790 C  CD2   . LEU C 3 528 ? 10.183  49.840 20.388  1.00 14.80 ? 824  LEU A CD2   1 
ATOM   4791 N  N     . LEU C 3 529 ? 14.399  49.669 18.759  1.00 11.01 ? 825  LEU A N     1 
ATOM   4792 C  CA    . LEU C 3 529 ? 15.712  49.050 18.706  1.00 12.91 ? 825  LEU A CA    1 
ATOM   4793 C  C     . LEU C 3 529 ? 15.732  47.856 19.663  1.00 12.00 ? 825  LEU A C     1 
ATOM   4794 O  O     . LEU C 3 529 ? 16.188  46.771 19.306  1.00 13.14 ? 825  LEU A O     1 
ATOM   4795 C  CB    . LEU C 3 529 ? 16.795  50.043 19.121  1.00 13.25 ? 825  LEU A CB    1 
ATOM   4796 C  CG    . LEU C 3 529 ? 17.048  51.236 18.198  1.00 14.17 ? 825  LEU A CG    1 
ATOM   4797 C  CD1   . LEU C 3 529 ? 18.149  52.088 18.798  1.00 15.12 ? 825  LEU A CD1   1 
ATOM   4798 C  CD2   . LEU C 3 529 ? 17.438  50.760 16.806  1.00 16.51 ? 825  LEU A CD2   1 
ATOM   4799 N  N     . LEU C 3 530 ? 15.213  48.054 20.873  1.00 12.95 ? 826  LEU A N     1 
ATOM   4800 C  CA    . LEU C 3 530 ? 15.223  46.988 21.865  1.00 11.79 ? 826  LEU A CA    1 
ATOM   4801 C  C     . LEU C 3 530 ? 14.033  46.969 22.808  1.00 11.27 ? 826  LEU A C     1 
ATOM   4802 O  O     . LEU C 3 530 ? 13.327  47.956 22.970  1.00 11.95 ? 826  LEU A O     1 
ATOM   4803 C  CB    . LEU C 3 530 ? 16.480  47.092 22.731  1.00 12.35 ? 826  LEU A CB    1 
ATOM   4804 C  CG    . LEU C 3 530 ? 17.870  47.123 22.097  1.00 17.31 ? 826  LEU A CG    1 
ATOM   4805 C  CD1   . LEU C 3 530 ? 18.896  47.450 23.180  1.00 18.30 ? 826  LEU A CD1   1 
ATOM   4806 C  CD2   . LEU C 3 530 ? 18.189  45.784 21.451  1.00 19.47 ? 826  LEU A CD2   1 
ATOM   4807 N  N     . GLN C 3 531 ? 13.843  45.814 23.434  1.00 10.17 ? 827  GLN A N     1 
ATOM   4808 C  CA    . GLN C 3 531 ? 12.811  45.627 24.444  1.00 12.54 ? 827  GLN A CA    1 
ATOM   4809 C  C     . GLN C 3 531 ? 13.573  44.959 25.580  1.00 12.23 ? 827  GLN A C     1 
ATOM   4810 O  O     . GLN C 3 531 ? 14.304  43.989 25.355  1.00 14.06 ? 827  GLN A O     1 
ATOM   4811 C  CB    . GLN C 3 531 ? 11.701  44.703 23.946  1.00 10.90 ? 827  GLN A CB    1 
ATOM   4812 C  CG    . GLN C 3 531 ? 10.535  44.595 24.916  1.00 14.28 ? 827  GLN A CG    1 
ATOM   4813 C  CD    . GLN C 3 531 ? 10.444  43.238 25.580  1.00 17.22 ? 827  GLN A CD    1 
ATOM   4814 O  OE1   . GLN C 3 531 ? 11.421  42.736 26.133  1.00 14.61 ? 827  GLN A OE1   1 
ATOM   4815 N  NE2   . GLN C 3 531 ? 9.262   42.638 25.531  1.00 19.76 ? 827  GLN A NE2   1 
ATOM   4816 N  N     . VAL C 3 532 ? 13.436  45.490 26.789  1.00 11.09 ? 828  VAL A N     1 
ATOM   4817 C  CA    . VAL C 3 532 ? 14.103  44.906 27.942  1.00 12.19 ? 828  VAL A CA    1 
ATOM   4818 C  C     . VAL C 3 532 ? 13.084  44.601 29.039  1.00 13.87 ? 828  VAL A C     1 
ATOM   4819 O  O     . VAL C 3 532 ? 13.134  45.157 30.136  1.00 15.30 ? 828  VAL A O     1 
ATOM   4820 C  CB    . VAL C 3 532 ? 15.223  45.825 28.500  1.00 14.34 ? 828  VAL A CB    1 
ATOM   4821 C  CG1   . VAL C 3 532 ? 16.050  45.063 29.531  1.00 13.94 ? 828  VAL A CG1   1 
ATOM   4822 C  CG2   . VAL C 3 532 ? 16.122  46.299 27.372  1.00 13.99 ? 828  VAL A CG2   1 
ATOM   4823 N  N     . HIS C 3 533 ? 12.151  43.716 28.700  1.00 13.15 ? 829  HIS A N     1 
ATOM   4824 C  CA    . HIS C 3 533 ? 11.110  43.225 29.599  1.00 13.52 ? 829  HIS A CA    1 
ATOM   4825 C  C     . HIS C 3 533 ? 10.035  44.224 30.001  1.00 13.47 ? 829  HIS A C     1 
ATOM   4826 O  O     . HIS C 3 533 ? 8.846   43.958 29.817  1.00 14.71 ? 829  HIS A O     1 
ATOM   4827 C  CB    . HIS C 3 533 ? 11.776  42.600 30.829  1.00 12.83 ? 829  HIS A CB    1 
ATOM   4828 C  CG    . HIS C 3 533 ? 12.857  41.625 30.479  1.00 14.26 ? 829  HIS A CG    1 
ATOM   4829 N  ND1   . HIS C 3 533 ? 12.653  40.573 29.612  1.00 13.98 ? 829  HIS A ND1   1 
ATOM   4830 C  CD2   . HIS C 3 533 ? 14.158  41.559 30.850  1.00 14.79 ? 829  HIS A CD2   1 
ATOM   4831 C  CE1   . HIS C 3 533 ? 13.780  39.901 29.464  1.00 15.35 ? 829  HIS A CE1   1 
ATOM   4832 N  NE2   . HIS C 3 533 ? 14.709  40.479 30.205  1.00 16.41 ? 829  HIS A NE2   1 
ATOM   4833 N  N     . ASP C 3 534 ? 10.432  45.370 30.544  1.00 13.22 ? 830  ASP A N     1 
ATOM   4834 C  CA    . ASP C 3 534 ? 9.442   46.368 30.927  1.00 12.65 ? 830  ASP A CA    1 
ATOM   4835 C  C     . ASP C 3 534 ? 9.768   47.723 30.325  1.00 12.14 ? 830  ASP A C     1 
ATOM   4836 O  O     . ASP C 3 534 ? 9.231   48.744 30.739  1.00 12.50 ? 830  ASP A O     1 
ATOM   4837 C  CB    . ASP C 3 534 ? 9.323   46.465 32.456  1.00 15.51 ? 830  ASP A CB    1 
ATOM   4838 C  CG    . ASP C 3 534 ? 10.536  47.104 33.112  1.00 18.86 ? 830  ASP A CG    1 
ATOM   4839 O  OD1   . ASP C 3 534 ? 11.617  47.145 32.481  1.00 17.43 ? 830  ASP A OD1   1 
ATOM   4840 O  OD2   . ASP C 3 534 ? 10.400  47.562 34.271  1.00 19.47 ? 830  ASP A OD2   1 
ATOM   4841 N  N     . GLU C 3 535 ? 10.650  47.733 29.334  1.00 13.46 ? 831  GLU A N     1 
ATOM   4842 C  CA    . GLU C 3 535 ? 10.995  48.990 28.689  1.00 15.80 ? 831  GLU A CA    1 
ATOM   4843 C  C     . GLU C 3 535 ? 11.264  48.823 27.208  1.00 14.39 ? 831  GLU A C     1 
ATOM   4844 O  O     . GLU C 3 535 ? 11.635  47.741 26.740  1.00 12.63 ? 831  GLU A O     1 
ATOM   4845 C  CB    . GLU C 3 535 ? 12.207  49.644 29.363  1.00 18.82 ? 831  GLU A CB    1 
ATOM   4846 C  CG    . GLU C 3 535 ? 13.508  48.882 29.238  1.00 25.64 ? 831  GLU A CG    1 
ATOM   4847 C  CD    . GLU C 3 535 ? 14.708  49.715 29.674  1.00 29.03 ? 831  GLU A CD    1 
ATOM   4848 O  OE1   . GLU C 3 535 ? 15.821  49.157 29.753  1.00 30.27 ? 831  GLU A OE1   1 
ATOM   4849 O  OE2   . GLU C 3 535 ? 14.541  50.930 29.928  1.00 32.79 ? 831  GLU A OE2   1 
ATOM   4850 N  N     . LEU C 3 536 ? 11.065  49.917 26.481  1.00 13.87 ? 832  LEU A N     1 
ATOM   4851 C  CA    . LEU C 3 536 ? 11.278  49.955 25.047  1.00 12.91 ? 832  LEU A CA    1 
ATOM   4852 C  C     . LEU C 3 536 ? 12.313  51.025 24.736  1.00 12.96 ? 832  LEU A C     1 
ATOM   4853 O  O     . LEU C 3 536 ? 12.246  52.140 25.259  1.00 12.90 ? 832  LEU A O     1 
ATOM   4854 C  CB    . LEU C 3 536 ? 9.964   50.276 24.324  1.00 12.56 ? 832  LEU A CB    1 
ATOM   4855 C  CG    . LEU C 3 536 ? 8.853   49.235 24.491  1.00 13.55 ? 832  LEU A CG    1 
ATOM   4856 C  CD1   . LEU C 3 536 ? 7.619   49.672 23.704  1.00 11.99 ? 832  LEU A CD1   1 
ATOM   4857 C  CD2   . LEU C 3 536 ? 9.350   47.869 24.006  1.00 11.43 ? 832  LEU A CD2   1 
ATOM   4858 N  N     . ILE C 3 537 ? 13.272  50.674 23.887  1.00 13.06 ? 833  ILE A N     1 
ATOM   4859 C  CA    . ILE C 3 537 ? 14.322  51.593 23.494  1.00 14.20 ? 833  ILE A CA    1 
ATOM   4860 C  C     . ILE C 3 537 ? 14.175  51.860 22.007  1.00 13.74 ? 833  ILE A C     1 
ATOM   4861 O  O     . ILE C 3 537 ? 14.126  50.926 21.198  1.00 12.92 ? 833  ILE A O     1 
ATOM   4862 C  CB    . ILE C 3 537 ? 15.727  50.998 23.730  1.00 14.94 ? 833  ILE A CB    1 
ATOM   4863 C  CG1   . ILE C 3 537 ? 15.833  50.416 25.144  1.00 18.52 ? 833  ILE A CG1   1 
ATOM   4864 C  CG2   . ILE C 3 537 ? 16.779  52.076 23.512  1.00 16.43 ? 833  ILE A CG2   1 
ATOM   4865 C  CD1   . ILE C 3 537 ? 15.643  51.428 26.248  1.00 20.18 ? 833  ILE A CD1   1 
ATOM   4866 N  N     . LEU C 3 538 ? 14.098  53.135 21.654  1.00 12.63 ? 834  LEU A N     1 
ATOM   4867 C  CA    . LEU C 3 538 ? 13.969  53.539 20.261  1.00 13.86 ? 834  LEU A CA    1 
ATOM   4868 C  C     . LEU C 3 538 ? 15.063  54.544 19.930  1.00 13.15 ? 834  LEU A C     1 
ATOM   4869 O  O     . LEU C 3 538 ? 15.782  55.015 20.816  1.00 13.88 ? 834  LEU A O     1 
ATOM   4870 C  CB    . LEU C 3 538 ? 12.616  54.219 20.011  1.00 13.75 ? 834  LEU A CB    1 
ATOM   4871 C  CG    . LEU C 3 538 ? 11.285  53.493 20.217  1.00 14.00 ? 834  LEU A CG    1 
ATOM   4872 C  CD1   . LEU C 3 538 ? 10.904  53.490 21.697  1.00 14.21 ? 834  LEU A CD1   1 
ATOM   4873 C  CD2   . LEU C 3 538 ? 10.211  54.212 19.402  1.00 17.39 ? 834  LEU A CD2   1 
ATOM   4874 N  N     . GLU C 3 539 ? 15.202  54.853 18.649  1.00 12.64 ? 835  GLU A N     1 
ATOM   4875 C  CA    . GLU C 3 539 ? 16.132  55.891 18.224  1.00 13.17 ? 835  GLU A CA    1 
ATOM   4876 C  C     . GLU C 3 539 ? 15.308  56.691 17.225  1.00 12.76 ? 835  GLU A C     1 
ATOM   4877 O  O     . GLU C 3 539 ? 14.412  56.147 16.569  1.00 12.79 ? 835  GLU A O     1 
ATOM   4878 C  CB    . GLU C 3 539 ? 17.407  55.325 17.576  1.00 13.42 ? 835  GLU A CB    1 
ATOM   4879 C  CG    . GLU C 3 539 ? 17.221  54.614 16.264  1.00 13.38 ? 835  GLU A CG    1 
ATOM   4880 C  CD    . GLU C 3 539 ? 18.543  54.177 15.657  1.00 14.42 ? 835  GLU A CD    1 
ATOM   4881 O  OE1   . GLU C 3 539 ? 19.605  54.478 16.247  1.00 14.36 ? 835  GLU A OE1   1 
ATOM   4882 O  OE2   . GLU C 3 539 ? 18.517  53.532 14.591  1.00 14.75 ? 835  GLU A OE2   1 
ATOM   4883 N  N     . ALA C 3 540 ? 15.588  57.983 17.114  1.00 12.28 ? 836  ALA A N     1 
ATOM   4884 C  CA    . ALA C 3 540 ? 14.832  58.820 16.201  1.00 13.44 ? 836  ALA A CA    1 
ATOM   4885 C  C     . ALA C 3 540 ? 15.520  60.154 15.993  1.00 13.21 ? 836  ALA A C     1 
ATOM   4886 O  O     . ALA C 3 540 ? 16.388  60.540 16.774  1.00 14.08 ? 836  ALA A O     1 
ATOM   4887 C  CB    . ALA C 3 540 ? 13.435  59.053 16.759  1.00 14.89 ? 836  ALA A CB    1 
ATOM   4888 N  N     . PRO C 3 541 ? 15.147  60.871 14.924  1.00 14.30 ? 837  PRO A N     1 
ATOM   4889 C  CA    . PRO C 3 541 ? 15.746  62.182 14.652  1.00 15.03 ? 837  PRO A CA    1 
ATOM   4890 C  C     . PRO C 3 541 ? 15.477  63.047 15.879  1.00 16.99 ? 837  PRO A C     1 
ATOM   4891 O  O     . PRO C 3 541 ? 14.437  62.893 16.528  1.00 14.91 ? 837  PRO A O     1 
ATOM   4892 C  CB    . PRO C 3 541 ? 14.993  62.664 13.420  1.00 16.09 ? 837  PRO A CB    1 
ATOM   4893 C  CG    . PRO C 3 541 ? 14.656  61.392 12.703  1.00 16.21 ? 837  PRO A CG    1 
ATOM   4894 C  CD    . PRO C 3 541 ? 14.239  60.470 13.836  1.00 15.72 ? 837  PRO A CD    1 
ATOM   4895 N  N     . LYS C 3 542 ? 16.395  63.946 16.211  1.00 16.12 ? 838  LYS A N     1 
ATOM   4896 C  CA    . LYS C 3 542 ? 16.185  64.807 17.367  1.00 18.22 ? 838  LYS A CA    1 
ATOM   4897 C  C     . LYS C 3 542 ? 14.887  65.593 17.194  1.00 17.45 ? 838  LYS A C     1 
ATOM   4898 O  O     . LYS C 3 542 ? 14.220  65.935 18.176  1.00 15.23 ? 838  LYS A O     1 
ATOM   4899 C  CB    . LYS C 3 542 ? 17.368  65.767 17.543  1.00 21.94 ? 838  LYS A CB    1 
ATOM   4900 C  CG    . LYS C 3 542 ? 17.626  66.685 16.360  1.00 25.73 ? 838  LYS A CG    1 
ATOM   4901 C  CD    . LYS C 3 542 ? 18.904  67.488 16.574  1.00 30.86 ? 838  LYS A CD    1 
ATOM   4902 C  CE    . LYS C 3 542 ? 19.173  68.444 15.415  1.00 33.49 ? 838  LYS A CE    1 
ATOM   4903 N  NZ    . LYS C 3 542 ? 19.322  67.718 14.121  1.00 38.26 ? 838  LYS A NZ    1 
ATOM   4904 N  N     . GLU C 3 543 ? 14.529  65.857 15.938  1.00 16.41 ? 839  GLU A N     1 
ATOM   4905 C  CA    . GLU C 3 543 ? 13.318  66.598 15.610  1.00 18.24 ? 839  GLU A CA    1 
ATOM   4906 C  C     . GLU C 3 543 ? 12.019  65.870 15.962  1.00 17.34 ? 839  GLU A C     1 
ATOM   4907 O  O     . GLU C 3 543 ? 10.942  66.469 15.912  1.00 16.98 ? 839  GLU A O     1 
ATOM   4908 C  CB    . GLU C 3 543 ? 13.297  66.950 14.121  1.00 19.87 ? 839  GLU A CB    1 
ATOM   4909 C  CG    . GLU C 3 543 ? 14.360  67.944 13.692  1.00 24.05 ? 839  GLU A CG    1 
ATOM   4910 C  CD    . GLU C 3 543 ? 15.698  67.297 13.371  1.00 27.17 ? 839  GLU A CD    1 
ATOM   4911 O  OE1   . GLU C 3 543 ? 15.841  66.065 13.550  1.00 20.28 ? 839  GLU A OE1   1 
ATOM   4912 O  OE2   . GLU C 3 543 ? 16.610  68.036 12.935  1.00 27.07 ? 839  GLU A OE2   1 
ATOM   4913 N  N     . GLU C 3 544 ? 12.110  64.589 16.312  1.00 14.65 ? 840  GLU A N     1 
ATOM   4914 C  CA    . GLU C 3 544 ? 10.913  63.825 16.666  1.00 13.83 ? 840  GLU A CA    1 
ATOM   4915 C  C     . GLU C 3 544 ? 10.784  63.583 18.166  1.00 12.53 ? 840  GLU A C     1 
ATOM   4916 O  O     . GLU C 3 544 ? 9.808   62.990 18.614  1.00 11.77 ? 840  GLU A O     1 
ATOM   4917 C  CB    . GLU C 3 544 ? 10.898  62.469 15.939  1.00 14.33 ? 840  GLU A CB    1 
ATOM   4918 C  CG    . GLU C 3 544 ? 10.972  62.562 14.418  1.00 13.33 ? 840  GLU A CG    1 
ATOM   4919 C  CD    . GLU C 3 544 ? 10.724  61.229 13.726  1.00 15.07 ? 840  GLU A CD    1 
ATOM   4920 O  OE1   . GLU C 3 544 ? 10.736  60.185 14.410  1.00 13.67 ? 840  GLU A OE1   1 
ATOM   4921 O  OE2   . GLU C 3 544 ? 10.517  61.225 12.494  1.00 15.91 ? 840  GLU A OE2   1 
ATOM   4922 N  N     . MET C 3 545 ? 11.759  64.035 18.949  1.00 11.25 ? 841  MET A N     1 
ATOM   4923 C  CA    . MET C 3 545 ? 11.712  63.802 20.389  1.00 12.76 ? 841  MET A CA    1 
ATOM   4924 C  C     . MET C 3 545 ? 10.446  64.301 21.085  1.00 13.63 ? 841  MET A C     1 
ATOM   4925 O  O     . MET C 3 545 ? 9.826   63.564 21.856  1.00 12.65 ? 841  MET A O     1 
ATOM   4926 C  CB    . MET C 3 545 ? 12.934  64.415 21.078  1.00 16.54 ? 841  MET A CB    1 
ATOM   4927 C  CG    . MET C 3 545 ? 14.243  63.722 20.750  1.00 16.73 ? 841  MET A CG    1 
ATOM   4928 S  SD    . MET C 3 545 ? 14.257  61.969 21.209  1.00 19.44 ? 841  MET A SD    1 
ATOM   4929 C  CE    . MET C 3 545 ? 13.948  61.231 19.624  1.00 19.77 ? 841  MET A CE    1 
ATOM   4930 N  N     . GLU C 3 546 ? 10.060  65.547 20.824  1.00 12.83 ? 842  GLU A N     1 
ATOM   4931 C  CA    . GLU C 3 546 ? 8.877   66.078 21.480  1.00 13.72 ? 842  GLU A CA    1 
ATOM   4932 C  C     . GLU C 3 546 ? 7.644   65.239 21.181  1.00 14.28 ? 842  GLU A C     1 
ATOM   4933 O  O     . GLU C 3 546 ? 6.850   64.960 22.082  1.00 12.55 ? 842  GLU A O     1 
ATOM   4934 C  CB    . GLU C 3 546 ? 8.662   67.541 21.094  1.00 14.63 ? 842  GLU A CB    1 
ATOM   4935 C  CG    . GLU C 3 546 ? 9.789   68.429 21.598  1.00 16.50 ? 842  GLU A CG    1 
ATOM   4936 C  CD    . GLU C 3 546 ? 9.438   69.897 21.563  1.00 17.95 ? 842  GLU A CD    1 
ATOM   4937 O  OE1   . GLU C 3 546 ? 8.598   70.325 22.381  1.00 20.28 ? 842  GLU A OE1   1 
ATOM   4938 O  OE2   . GLU C 3 546 ? 10.001  70.619 20.716  1.00 19.98 ? 842  GLU A OE2   1 
ATOM   4939 N  N     . ARG C 3 547 ? 7.486   64.818 19.931  1.00 14.58 ? 843  ARG A N     1 
ATOM   4940 C  CA    . ARG C 3 547 ? 6.339   63.988 19.583  1.00 14.57 ? 843  ARG A CA    1 
ATOM   4941 C  C     . ARG C 3 547 ? 6.423   62.629 20.286  1.00 14.65 ? 843  ARG A C     1 
ATOM   4942 O  O     . ARG C 3 547 ? 5.418   62.123 20.790  1.00 13.96 ? 843  ARG A O     1 
ATOM   4943 C  CB    . ARG C 3 547 ? 6.249   63.802 18.066  1.00 17.27 ? 843  ARG A CB    1 
ATOM   4944 C  CG    . ARG C 3 547 ? 5.486   64.925 17.360  1.00 21.52 ? 843  ARG A CG    1 
ATOM   4945 C  CD    . ARG C 3 547 ? 5.487   64.733 15.856  1.00 24.07 ? 843  ARG A CD    1 
ATOM   4946 N  NE    . ARG C 3 547 ? 6.825   64.946 15.307  1.00 30.98 ? 843  ARG A NE    1 
ATOM   4947 C  CZ    . ARG C 3 547 ? 7.153   64.778 14.030  1.00 31.20 ? 843  ARG A CZ    1 
ATOM   4948 N  NH1   . ARG C 3 547 ? 6.236   64.386 13.151  1.00 33.17 ? 843  ARG A NH1   1 
ATOM   4949 N  NH2   . ARG C 3 547 ? 8.399   65.011 13.630  1.00 29.35 ? 843  ARG A NH2   1 
ATOM   4950 N  N     . LEU C 3 548 ? 7.619   62.047 20.342  1.00 12.61 ? 844  LEU A N     1 
ATOM   4951 C  CA    . LEU C 3 548 ? 7.788   60.750 21.000  1.00 13.31 ? 844  LEU A CA    1 
ATOM   4952 C  C     . LEU C 3 548 ? 7.485   60.814 22.493  1.00 14.63 ? 844  LEU A C     1 
ATOM   4953 O  O     . LEU C 3 548 ? 6.949   59.861 23.062  1.00 13.28 ? 844  LEU A O     1 
ATOM   4954 C  CB    . LEU C 3 548 ? 9.209   60.213 20.800  1.00 14.71 ? 844  LEU A CB    1 
ATOM   4955 C  CG    . LEU C 3 548 ? 9.581   59.707 19.408  1.00 16.94 ? 844  LEU A CG    1 
ATOM   4956 C  CD1   . LEU C 3 548 ? 10.971  59.081 19.459  1.00 18.71 ? 844  LEU A CD1   1 
ATOM   4957 C  CD2   . LEU C 3 548 ? 8.560   58.674 18.940  1.00 16.51 ? 844  LEU A CD2   1 
ATOM   4958 N  N     . CYS C 3 549 ? 7.830   61.934 23.128  1.00 13.80 ? 845  CYS A N     1 
ATOM   4959 C  CA    . CYS C 3 549 ? 7.586   62.106 24.557  1.00 14.36 ? 845  CYS A CA    1 
ATOM   4960 C  C     . CYS C 3 549 ? 6.112   61.963 24.894  1.00 16.28 ? 845  CYS A C     1 
ATOM   4961 O  O     . CYS C 3 549 ? 5.760   61.511 25.981  1.00 17.06 ? 845  CYS A O     1 
ATOM   4962 C  CB    . CYS C 3 549 ? 8.091   63.475 25.034  1.00 15.42 ? 845  CYS A CB    1 
ATOM   4963 S  SG    . CYS C 3 549 ? 9.893   63.566 25.160  1.00 20.41 ? 845  CYS A SG    1 
ATOM   4964 N  N     . ARG C 3 550 ? 5.249   62.346 23.965  1.00 14.91 ? 846  ARG A N     1 
ATOM   4965 C  CA    . ARG C 3 550 ? 3.820   62.235 24.203  1.00 16.12 ? 846  ARG A CA    1 
ATOM   4966 C  C     . ARG C 3 550 ? 3.257   60.924 23.679  1.00 14.89 ? 846  ARG A C     1 
ATOM   4967 O  O     . ARG C 3 550 ? 2.419   60.304 24.321  1.00 15.86 ? 846  ARG A O     1 
ATOM   4968 C  CB    . ARG C 3 550 ? 3.078   63.399 23.544  1.00 18.89 ? 846  ARG A CB    1 
ATOM   4969 C  CG    . ARG C 3 550 ? 3.174   64.708 24.308  1.00 23.90 ? 846  ARG A CG    1 
ATOM   4970 C  CD    . ARG C 3 550 ? 2.504   65.837 23.538  1.00 25.59 ? 846  ARG A CD    1 
ATOM   4971 N  NE    . ARG C 3 550 ? 1.118   65.544 23.158  1.00 27.87 ? 846  ARG A NE    1 
ATOM   4972 C  CZ    . ARG C 3 550 ? 0.062   65.686 23.956  1.00 31.42 ? 846  ARG A CZ    1 
ATOM   4973 N  NH1   . ARG C 3 550 ? 0.208   66.118 25.202  1.00 31.91 ? 846  ARG A NH1   1 
ATOM   4974 N  NH2   . ARG C 3 550 ? -1.152  65.412 23.499  1.00 31.55 ? 846  ARG A NH2   1 
ATOM   4975 N  N     . LEU C 3 551 ? 3.734   60.504 22.515  1.00 13.15 ? 847  LEU A N     1 
ATOM   4976 C  CA    . LEU C 3 551 ? 3.245   59.291 21.881  1.00 14.59 ? 847  LEU A CA    1 
ATOM   4977 C  C     . LEU C 3 551 ? 3.626   57.964 22.531  1.00 14.53 ? 847  LEU A C     1 
ATOM   4978 O  O     . LEU C 3 551 ? 2.758   57.127 22.786  1.00 14.30 ? 847  LEU A O     1 
ATOM   4979 C  CB    . LEU C 3 551 ? 3.672   59.282 20.404  1.00 17.12 ? 847  LEU A CB    1 
ATOM   4980 C  CG    . LEU C 3 551 ? 3.117   58.205 19.458  1.00 20.70 ? 847  LEU A CG    1 
ATOM   4981 C  CD1   . LEU C 3 551 ? 3.612   58.497 18.044  1.00 21.68 ? 847  LEU A CD1   1 
ATOM   4982 C  CD2   . LEU C 3 551 ? 3.556   56.817 19.879  1.00 24.36 ? 847  LEU A CD2   1 
ATOM   4983 N  N     . VAL C 3 552 ? 4.909   57.759 22.802  1.00 14.18 ? 848  VAL A N     1 
ATOM   4984 C  CA    . VAL C 3 552 ? 5.336   56.486 23.370  1.00 13.05 ? 848  VAL A CA    1 
ATOM   4985 C  C     . VAL C 3 552 ? 4.713   56.133 24.728  1.00 12.83 ? 848  VAL A C     1 
ATOM   4986 O  O     . VAL C 3 552 ? 4.226   55.020 24.908  1.00 12.93 ? 848  VAL A O     1 
ATOM   4987 C  CB    . VAL C 3 552 ? 6.874   56.409 23.459  1.00 14.21 ? 848  VAL A CB    1 
ATOM   4988 C  CG1   . VAL C 3 552 ? 7.295   55.056 24.025  1.00 15.46 ? 848  VAL A CG1   1 
ATOM   4989 C  CG2   . VAL C 3 552 ? 7.481   56.606 22.060  1.00 14.56 ? 848  VAL A CG2   1 
ATOM   4990 N  N     . PRO C 3 553 ? 4.724   57.063 25.695  1.00 12.96 ? 849  PRO A N     1 
ATOM   4991 C  CA    . PRO C 3 553 ? 4.129   56.742 26.999  1.00 13.74 ? 849  PRO A CA    1 
ATOM   4992 C  C     . PRO C 3 553 ? 2.633   56.442 26.891  1.00 14.24 ? 849  PRO A C     1 
ATOM   4993 O  O     . PRO C 3 553 ? 2.128   55.510 27.523  1.00 14.24 ? 849  PRO A O     1 
ATOM   4994 C  CB    . PRO C 3 553 ? 4.430   57.981 27.839  1.00 14.43 ? 849  PRO A CB    1 
ATOM   4995 C  CG    . PRO C 3 553 ? 5.701   58.510 27.213  1.00 16.81 ? 849  PRO A CG    1 
ATOM   4996 C  CD    . PRO C 3 553 ? 5.428   58.359 25.745  1.00 13.33 ? 849  PRO A CD    1 
ATOM   4997 N  N     . GLU C 3 554 ? 1.931   57.232 26.083  1.00 13.25 ? 850  GLU A N     1 
ATOM   4998 C  CA    . GLU C 3 554 ? 0.494   57.043 25.901  1.00 15.30 ? 850  GLU A CA    1 
ATOM   4999 C  C     . GLU C 3 554 ? 0.169   55.654 25.355  1.00 13.93 ? 850  GLU A C     1 
ATOM   5000 O  O     . GLU C 3 554 ? -0.670  54.944 25.914  1.00 12.63 ? 850  GLU A O     1 
ATOM   5001 C  CB    . GLU C 3 554 ? -0.063  58.113 24.959  1.00 18.18 ? 850  GLU A CB    1 
ATOM   5002 C  CG    . GLU C 3 554 ? -1.549  57.984 24.652  1.00 23.94 ? 850  GLU A CG    1 
ATOM   5003 C  CD    . GLU C 3 554 ? -2.432  58.103 25.887  1.00 29.73 ? 850  GLU A CD    1 
ATOM   5004 O  OE1   . GLU C 3 554 ? -1.952  58.585 26.936  1.00 32.39 ? 850  GLU A OE1   1 
ATOM   5005 O  OE2   . GLU C 3 554 ? -3.622  57.725 25.805  1.00 32.86 ? 850  GLU A OE2   1 
ATOM   5006 N  N     . VAL C 3 555 ? 0.829   55.273 24.264  1.00 13.61 ? 851  VAL A N     1 
ATOM   5007 C  CA    . VAL C 3 555 ? 0.607   53.964 23.654  1.00 12.62 ? 851  VAL A CA    1 
ATOM   5008 C  C     . VAL C 3 555 ? 0.904   52.852 24.656  1.00 12.59 ? 851  VAL A C     1 
ATOM   5009 O  O     . VAL C 3 555 ? 0.135   51.895 24.787  1.00 13.06 ? 851  VAL A O     1 
ATOM   5010 C  CB    . VAL C 3 555 ? 1.500   53.764 22.399  1.00 14.30 ? 851  VAL A CB    1 
ATOM   5011 C  CG1   . VAL C 3 555 ? 1.327   52.354 21.856  1.00 16.71 ? 851  VAL A CG1   1 
ATOM   5012 C  CG2   . VAL C 3 555 ? 1.121   54.768 21.332  1.00 18.19 ? 851  VAL A CG2   1 
ATOM   5013 N  N     . MET C 3 556 ? 2.025   52.969 25.363  1.00 9.01  ? 852  MET A N     1 
ATOM   5014 C  CA    . MET C 3 556 ? 2.376   51.966 26.358  1.00 11.68 ? 852  MET A CA    1 
ATOM   5015 C  C     . MET C 3 556 ? 1.380   51.925 27.526  1.00 12.83 ? 852  MET A C     1 
ATOM   5016 O  O     . MET C 3 556 ? 0.997   50.850 27.981  1.00 11.91 ? 852  MET A O     1 
ATOM   5017 C  CB    . MET C 3 556 ? 3.790   52.222 26.889  1.00 12.65 ? 852  MET A CB    1 
ATOM   5018 C  CG    . MET C 3 556 ? 4.877   51.953 25.848  1.00 12.29 ? 852  MET A CG    1 
ATOM   5019 S  SD    . MET C 3 556 ? 6.535   52.329 26.445  1.00 15.12 ? 852  MET A SD    1 
ATOM   5020 C  CE    . MET C 3 556 ? 6.795   50.984 27.611  1.00 13.62 ? 852  MET A CE    1 
ATOM   5021 N  N     . GLU C 3 557 ? 0.955   53.091 28.003  1.00 12.14 ? 853  GLU A N     1 
ATOM   5022 C  CA    . GLU C 3 557 ? 0.023   53.142 29.124  1.00 13.83 ? 853  GLU A CA    1 
ATOM   5023 C  C     . GLU C 3 557 ? -1.372  52.676 28.746  1.00 15.16 ? 853  GLU A C     1 
ATOM   5024 O  O     . GLU C 3 557 ? -2.133  52.218 29.602  1.00 15.64 ? 853  GLU A O     1 
ATOM   5025 C  CB    . GLU C 3 557 ? -0.052  54.562 29.694  1.00 15.16 ? 853  GLU A CB    1 
ATOM   5026 C  CG    . GLU C 3 557 ? 1.266   55.047 30.294  1.00 15.47 ? 853  GLU A CG    1 
ATOM   5027 C  CD    . GLU C 3 557 ? 1.228   56.501 30.724  1.00 19.78 ? 853  GLU A CD    1 
ATOM   5028 O  OE1   . GLU C 3 557 ? 0.366   57.253 30.218  1.00 17.57 ? 853  GLU A OE1   1 
ATOM   5029 O  OE2   . GLU C 3 557 ? 2.071   56.892 31.566  1.00 20.61 ? 853  GLU A OE2   1 
ATOM   5030 N  N     . GLN C 3 558 ? -1.707  52.783 27.466  1.00 13.87 ? 854  GLN A N     1 
ATOM   5031 C  CA    . GLN C 3 558 ? -3.031  52.389 27.010  1.00 15.84 ? 854  GLN A CA    1 
ATOM   5032 C  C     . GLN C 3 558 ? -3.112  51.024 26.331  1.00 16.19 ? 854  GLN A C     1 
ATOM   5033 O  O     . GLN C 3 558 ? -4.169  50.661 25.818  1.00 15.99 ? 854  GLN A O     1 
ATOM   5034 C  CB    . GLN C 3 558 ? -3.587  53.458 26.069  1.00 16.28 ? 854  GLN A CB    1 
ATOM   5035 C  CG    . GLN C 3 558 ? -3.805  54.809 26.738  1.00 21.46 ? 854  GLN A CG    1 
ATOM   5036 C  CD    . GLN C 3 558 ? -4.741  54.711 27.924  1.00 21.52 ? 854  GLN A CD    1 
ATOM   5037 O  OE1   . GLN C 3 558 ? -5.791  54.072 27.842  1.00 23.90 ? 854  GLN A OE1   1 
ATOM   5038 N  NE2   . GLN C 3 558 ? -4.370  55.344 29.034  1.00 24.18 ? 854  GLN A NE2   1 
ATOM   5039 N  N     . ALA C 3 559 ? -2.009  50.276 26.332  1.00 16.31 ? 855  ALA A N     1 
ATOM   5040 C  CA    . ALA C 3 559 ? -1.969  48.953 25.698  1.00 15.88 ? 855  ALA A CA    1 
ATOM   5041 C  C     . ALA C 3 559 ? -3.108  48.061 26.192  1.00 16.52 ? 855  ALA A C     1 
ATOM   5042 O  O     . ALA C 3 559 ? -3.760  47.371 25.404  1.00 14.77 ? 855  ALA A O     1 
ATOM   5043 C  CB    . ALA C 3 559 ? -0.622  48.288 25.964  1.00 17.05 ? 855  ALA A CB    1 
ATOM   5044 N  N     . VAL C 3 560 ? -3.336  48.074 27.501  1.00 17.22 ? 856  VAL A N     1 
ATOM   5045 C  CA    . VAL C 3 560 ? -4.421  47.310 28.106  1.00 18.71 ? 856  VAL A CA    1 
ATOM   5046 C  C     . VAL C 3 560 ? -5.036  48.207 29.170  1.00 20.47 ? 856  VAL A C     1 
ATOM   5047 O  O     . VAL C 3 560 ? -4.404  49.164 29.621  1.00 23.52 ? 856  VAL A O     1 
ATOM   5048 C  CB    . VAL C 3 560 ? -3.928  46.007 28.791  1.00 18.47 ? 856  VAL A CB    1 
ATOM   5049 C  CG1   . VAL C 3 560 ? -3.241  45.102 27.778  1.00 17.70 ? 856  VAL A CG1   1 
ATOM   5050 C  CG2   . VAL C 3 560 ? -2.998  46.346 29.950  1.00 21.68 ? 856  VAL A CG2   1 
ATOM   5051 N  N     . THR C 3 561 ? -6.268  47.914 29.566  1.00 19.77 ? 857  THR A N     1 
ATOM   5052 C  CA    . THR C 3 561 ? -6.923  48.706 30.598  1.00 19.11 ? 857  THR A CA    1 
ATOM   5053 C  C     . THR C 3 561 ? -7.059  47.824 31.830  1.00 18.48 ? 857  THR A C     1 
ATOM   5054 O  O     . THR C 3 561 ? -7.727  46.794 31.787  1.00 18.96 ? 857  THR A O     1 
ATOM   5055 C  CB    . THR C 3 561 ? -8.323  49.176 30.153  1.00 20.63 ? 857  THR A CB    1 
ATOM   5056 O  OG1   . THR C 3 561 ? -8.195  50.058 29.030  1.00 21.70 ? 857  THR A OG1   1 
ATOM   5057 C  CG2   . THR C 3 561 ? -9.028  49.918 31.293  1.00 21.77 ? 857  THR A CG2   1 
ATOM   5058 N  N     . LEU C 3 562 ? -6.412  48.225 32.921  1.00 16.33 ? 858  LEU A N     1 
ATOM   5059 C  CA    . LEU C 3 562 ? -6.462  47.466 34.166  1.00 15.25 ? 858  LEU A CA    1 
ATOM   5060 C  C     . LEU C 3 562 ? -7.271  48.228 35.210  1.00 15.66 ? 858  LEU A C     1 
ATOM   5061 O  O     . LEU C 3 562 ? -7.714  49.354 34.960  1.00 16.23 ? 858  LEU A O     1 
ATOM   5062 C  CB    . LEU C 3 562 ? -5.042  47.220 34.697  1.00 14.09 ? 858  LEU A CB    1 
ATOM   5063 C  CG    . LEU C 3 562 ? -4.071  46.490 33.756  1.00 14.12 ? 858  LEU A CG    1 
ATOM   5064 C  CD1   . LEU C 3 562 ? -2.685  46.406 34.395  1.00 16.27 ? 858  LEU A CD1   1 
ATOM   5065 C  CD2   . LEU C 3 562 ? -4.602  45.094 33.448  1.00 15.48 ? 858  LEU A CD2   1 
ATOM   5066 N  N     . ARG C 3 563 ? -7.458  47.612 36.375  1.00 15.06 ? 859  ARG A N     1 
ATOM   5067 C  CA    . ARG C 3 563 ? -8.197  48.231 37.472  1.00 16.35 ? 859  ARG A CA    1 
ATOM   5068 C  C     . ARG C 3 563 ? -7.381  49.356 38.107  1.00 15.77 ? 859  ARG A C     1 
ATOM   5069 O  O     . ARG C 3 563 ? -7.885  50.115 38.934  1.00 15.76 ? 859  ARG A O     1 
ATOM   5070 C  CB    . ARG C 3 563 ? -8.567  47.173 38.516  1.00 17.43 ? 859  ARG A CB    1 
ATOM   5071 C  CG    . ARG C 3 563 ? -9.510  46.118 37.960  1.00 21.07 ? 859  ARG A CG    1 
ATOM   5072 C  CD    . ARG C 3 563 ? -9.930  45.075 38.991  1.00 23.61 ? 859  ARG A CD    1 
ATOM   5073 N  NE    . ARG C 3 563 ? -10.895 44.144 38.408  1.00 27.90 ? 859  ARG A NE    1 
ATOM   5074 C  CZ    . ARG C 3 563 ? -10.586 42.989 37.822  1.00 29.42 ? 859  ARG A CZ    1 
ATOM   5075 N  NH1   . ARG C 3 563 ? -9.324  42.585 37.742  1.00 28.48 ? 859  ARG A NH1   1 
ATOM   5076 N  NH2   . ARG C 3 563 ? -11.548 42.240 37.298  1.00 30.91 ? 859  ARG A NH2   1 
ATOM   5077 N  N     . VAL C 3 564 ? -6.113  49.451 37.718  1.00 14.55 ? 860  VAL A N     1 
ATOM   5078 C  CA    . VAL C 3 564 ? -5.232  50.509 38.197  1.00 14.09 ? 860  VAL A CA    1 
ATOM   5079 C  C     . VAL C 3 564 ? -4.579  51.094 36.957  1.00 14.15 ? 860  VAL A C     1 
ATOM   5080 O  O     . VAL C 3 564 ? -4.497  50.435 35.926  1.00 14.36 ? 860  VAL A O     1 
ATOM   5081 C  CB    . VAL C 3 564 ? -4.121  49.992 39.155  1.00 13.72 ? 860  VAL A CB    1 
ATOM   5082 C  CG1   . VAL C 3 564 ? -4.753  49.402 40.407  1.00 14.00 ? 860  VAL A CG1   1 
ATOM   5083 C  CG2   . VAL C 3 564 ? -3.237  48.961 38.449  1.00 14.04 ? 860  VAL A CG2   1 
ATOM   5084 N  N     . PRO C 3 565 ? -4.114  52.344 37.036  1.00 15.55 ? 861  PRO A N     1 
ATOM   5085 C  CA    . PRO C 3 565 ? -3.477  52.938 35.860  1.00 15.94 ? 861  PRO A CA    1 
ATOM   5086 C  C     . PRO C 3 565 ? -2.111  52.311 35.613  1.00 16.36 ? 861  PRO A C     1 
ATOM   5087 O  O     . PRO C 3 565 ? -1.529  51.705 36.512  1.00 16.56 ? 861  PRO A O     1 
ATOM   5088 C  CB    . PRO C 3 565 ? -3.366  54.419 36.221  1.00 18.63 ? 861  PRO A CB    1 
ATOM   5089 C  CG    . PRO C 3 565 ? -4.397  54.617 37.322  1.00 18.53 ? 861  PRO A CG    1 
ATOM   5090 C  CD    . PRO C 3 565 ? -4.270  53.338 38.109  1.00 16.40 ? 861  PRO A CD    1 
ATOM   5091 N  N     . LEU C 3 566 ? -1.613  52.447 34.391  1.00 14.82 ? 862  LEU A N     1 
ATOM   5092 C  CA    . LEU C 3 566 ? -0.273  51.981 34.073  1.00 16.49 ? 862  LEU A CA    1 
ATOM   5093 C  C     . LEU C 3 566 ? 0.492   53.298 33.953  1.00 17.68 ? 862  LEU A C     1 
ATOM   5094 O  O     . LEU C 3 566 ? -0.053  54.294 33.469  1.00 18.51 ? 862  LEU A O     1 
ATOM   5095 C  CB    . LEU C 3 566 ? -0.237  51.205 32.750  1.00 15.78 ? 862  LEU A CB    1 
ATOM   5096 C  CG    . LEU C 3 566 ? -0.677  49.739 32.861  1.00 16.71 ? 862  LEU A CG    1 
ATOM   5097 C  CD1   . LEU C 3 566 ? -0.615  49.063 31.496  1.00 17.92 ? 862  LEU A CD1   1 
ATOM   5098 C  CD2   . LEU C 3 566 ? 0.235   49.017 33.850  1.00 20.50 ? 862  LEU A CD2   1 
ATOM   5099 N  N     . LYS C 3 567 ? 1.739   53.306 34.401  1.00 16.58 ? 863  LYS A N     1 
ATOM   5100 C  CA    . LYS C 3 567 ? 2.552   54.516 34.365  1.00 17.43 ? 863  LYS A CA    1 
ATOM   5101 C  C     . LYS C 3 567 ? 3.858   54.251 33.632  1.00 14.50 ? 863  LYS A C     1 
ATOM   5102 O  O     . LYS C 3 567 ? 4.511   53.234 33.860  1.00 15.32 ? 863  LYS A O     1 
ATOM   5103 C  CB    . LYS C 3 567 ? 2.846   54.977 35.794  1.00 19.01 ? 863  LYS A CB    1 
ATOM   5104 C  CG    . LYS C 3 567 ? 3.631   56.275 35.897  1.00 22.38 ? 863  LYS A CG    1 
ATOM   5105 C  CD    . LYS C 3 567 ? 3.918   56.594 37.355  1.00 27.07 ? 863  LYS A CD    1 
ATOM   5106 C  CE    . LYS C 3 567 ? 4.694   57.887 37.516  1.00 27.65 ? 863  LYS A CE    1 
ATOM   5107 N  NZ    . LYS C 3 567 ? 5.039   58.124 38.946  1.00 30.66 ? 863  LYS A NZ    1 
ATOM   5108 N  N     . VAL C 3 568 ? 4.236   55.178 32.761  1.00 14.39 ? 864  VAL A N     1 
ATOM   5109 C  CA    . VAL C 3 568 ? 5.458   55.041 31.980  1.00 14.72 ? 864  VAL A CA    1 
ATOM   5110 C  C     . VAL C 3 568 ? 6.369   56.257 32.116  1.00 15.94 ? 864  VAL A C     1 
ATOM   5111 O  O     . VAL C 3 568 ? 5.944   57.396 31.926  1.00 17.40 ? 864  VAL A O     1 
ATOM   5112 C  CB    . VAL C 3 568 ? 5.114   54.823 30.484  1.00 14.77 ? 864  VAL A CB    1 
ATOM   5113 C  CG1   . VAL C 3 568 ? 6.371   54.891 29.622  1.00 15.86 ? 864  VAL A CG1   1 
ATOM   5114 C  CG2   . VAL C 3 568 ? 4.432   53.474 30.307  1.00 13.96 ? 864  VAL A CG2   1 
ATOM   5115 N  N     . ASP C 3 569 ? 7.626   56.010 32.457  1.00 15.38 ? 865  ASP A N     1 
ATOM   5116 C  CA    . ASP C 3 569 ? 8.590   57.089 32.572  1.00 17.69 ? 865  ASP A CA    1 
ATOM   5117 C  C     . ASP C 3 569 ? 9.414   57.032 31.299  1.00 15.51 ? 865  ASP A C     1 
ATOM   5118 O  O     . ASP C 3 569 ? 9.482   55.992 30.650  1.00 15.74 ? 865  ASP A O     1 
ATOM   5119 C  CB    . ASP C 3 569 ? 9.477   56.906 33.804  1.00 18.10 ? 865  ASP A CB    1 
ATOM   5120 C  CG    . ASP C 3 569 ? 8.694   57.017 35.100  1.00 20.89 ? 865  ASP A CG    1 
ATOM   5121 O  OD1   . ASP C 3 569 ? 7.824   57.910 35.199  1.00 21.00 ? 865  ASP A OD1   1 
ATOM   5122 O  OD2   . ASP C 3 569 ? 8.950   56.215 36.019  1.00 24.07 ? 865  ASP A OD2   1 
ATOM   5123 N  N     . TYR C 3 570 ? 10.033  58.145 30.928  1.00 15.66 ? 866  TYR A N     1 
ATOM   5124 C  CA    . TYR C 3 570 ? 10.813  58.168 29.699  1.00 15.42 ? 866  TYR A CA    1 
ATOM   5125 C  C     . TYR C 3 570 ? 11.947  59.172 29.777  1.00 15.48 ? 866  TYR A C     1 
ATOM   5126 O  O     . TYR C 3 570 ? 11.891  60.144 30.536  1.00 16.17 ? 866  TYR A O     1 
ATOM   5127 C  CB    . TYR C 3 570 ? 9.899   58.497 28.518  1.00 17.24 ? 866  TYR A CB    1 
ATOM   5128 C  CG    . TYR C 3 570 ? 9.129   59.777 28.720  1.00 21.64 ? 866  TYR A CG    1 
ATOM   5129 C  CD1   . TYR C 3 570 ? 9.615   60.995 28.245  1.00 23.64 ? 866  TYR A CD1   1 
ATOM   5130 C  CD2   . TYR C 3 570 ? 7.921   59.773 29.414  1.00 23.39 ? 866  TYR A CD2   1 
ATOM   5131 C  CE1   . TYR C 3 570 ? 8.911   62.181 28.460  1.00 25.77 ? 866  TYR A CE1   1 
ATOM   5132 C  CE2   . TYR C 3 570 ? 7.214   60.947 29.635  1.00 25.21 ? 866  TYR A CE2   1 
ATOM   5133 C  CZ    . TYR C 3 570 ? 7.710   62.144 29.157  1.00 24.90 ? 866  TYR A CZ    1 
ATOM   5134 O  OH    . TYR C 3 570 ? 6.998   63.303 29.377  1.00 27.76 ? 866  TYR A OH    1 
ATOM   5135 N  N     . HIS C 3 571 ? 12.979  58.924 28.981  1.00 14.84 ? 867  HIS A N     1 
ATOM   5136 C  CA    . HIS C 3 571 ? 14.153  59.782 28.952  1.00 15.52 ? 867  HIS A CA    1 
ATOM   5137 C  C     . HIS C 3 571 ? 14.785  59.639 27.580  1.00 15.89 ? 867  HIS A C     1 
ATOM   5138 O  O     . HIS C 3 571 ? 14.541  58.656 26.880  1.00 14.25 ? 867  HIS A O     1 
ATOM   5139 C  CB    . HIS C 3 571 ? 15.163  59.333 30.010  1.00 18.31 ? 867  HIS A CB    1 
ATOM   5140 C  CG    . HIS C 3 571 ? 14.564  59.100 31.361  1.00 19.72 ? 867  HIS A CG    1 
ATOM   5141 N  ND1   . HIS C 3 571 ? 14.320  60.120 32.255  1.00 23.21 ? 867  HIS A ND1   1 
ATOM   5142 C  CD2   . HIS C 3 571 ? 14.132  57.964 31.960  1.00 20.31 ? 867  HIS A CD2   1 
ATOM   5143 C  CE1   . HIS C 3 571 ? 13.764  59.623 33.346  1.00 21.46 ? 867  HIS A CE1   1 
ATOM   5144 N  NE2   . HIS C 3 571 ? 13.639  58.317 33.192  1.00 22.21 ? 867  HIS A NE2   1 
ATOM   5145 N  N     . TYR C 3 572 ? 15.594  60.615 27.190  1.00 14.20 ? 868  TYR A N     1 
ATOM   5146 C  CA    . TYR C 3 572 ? 16.266  60.535 25.904  1.00 15.23 ? 868  TYR A CA    1 
ATOM   5147 C  C     . TYR C 3 572 ? 17.601  61.253 25.976  1.00 14.38 ? 868  TYR A C     1 
ATOM   5148 O  O     . TYR C 3 572 ? 17.814  62.086 26.855  1.00 15.18 ? 868  TYR A O     1 
ATOM   5149 C  CB    . TYR C 3 572 ? 15.379  61.105 24.792  1.00 17.22 ? 868  TYR A CB    1 
ATOM   5150 C  CG    . TYR C 3 572 ? 15.120  62.590 24.854  1.00 20.22 ? 868  TYR A CG    1 
ATOM   5151 C  CD1   . TYR C 3 572 ? 16.057  63.501 24.373  1.00 23.23 ? 868  TYR A CD1   1 
ATOM   5152 C  CD2   . TYR C 3 572 ? 13.918  63.084 25.357  1.00 23.72 ? 868  TYR A CD2   1 
ATOM   5153 C  CE1   . TYR C 3 572 ? 15.802  64.873 24.384  1.00 25.45 ? 868  TYR A CE1   1 
ATOM   5154 C  CE2   . TYR C 3 572 ? 13.652  64.452 25.377  1.00 25.56 ? 868  TYR A CE2   1 
ATOM   5155 C  CZ    . TYR C 3 572 ? 14.597  65.339 24.886  1.00 25.72 ? 868  TYR A CZ    1 
ATOM   5156 O  OH    . TYR C 3 572 ? 14.336  66.689 24.888  1.00 27.54 ? 868  TYR A OH    1 
ATOM   5157 N  N     . GLY C 3 573 ? 18.504  60.919 25.061  1.00 15.06 ? 869  GLY A N     1 
ATOM   5158 C  CA    . GLY C 3 573 ? 19.813  61.545 25.073  1.00 15.90 ? 869  GLY A CA    1 
ATOM   5159 C  C     . GLY C 3 573 ? 20.694  61.107 23.919  1.00 15.72 ? 869  GLY A C     1 
ATOM   5160 O  O     . GLY C 3 573 ? 20.264  60.350 23.045  1.00 14.31 ? 869  GLY A O     1 
ATOM   5161 N  N     . SER C 3 574 ? 21.938  61.578 23.935  1.00 16.20 ? 870  SER A N     1 
ATOM   5162 C  CA    . SER C 3 574 ? 22.911  61.285 22.886  1.00 17.06 ? 870  SER A CA    1 
ATOM   5163 C  C     . SER C 3 574 ? 23.379  59.835 22.825  1.00 16.77 ? 870  SER A C     1 
ATOM   5164 O  O     . SER C 3 574 ? 23.851  59.375 21.786  1.00 16.11 ? 870  SER A O     1 
ATOM   5165 C  CB    . SER C 3 574 ? 24.129  62.199 23.051  1.00 20.25 ? 870  SER A CB    1 
ATOM   5166 O  OG    . SER C 3 574 ? 23.744  63.560 22.967  1.00 26.85 ? 870  SER A OG    1 
ATOM   5167 N  N     . THR C 3 575 ? 23.269  59.125 23.942  1.00 15.30 ? 871  THR A N     1 
ATOM   5168 C  CA    . THR C 3 575 ? 23.662  57.722 24.000  1.00 16.06 ? 871  THR A CA    1 
ATOM   5169 C  C     . THR C 3 575 ? 22.662  57.017 24.899  1.00 16.32 ? 871  THR A C     1 
ATOM   5170 O  O     . THR C 3 575 ? 21.846  57.663 25.556  1.00 15.36 ? 871  THR A O     1 
ATOM   5171 C  CB    . THR C 3 575 ? 25.074  57.521 24.609  1.00 17.55 ? 871  THR A CB    1 
ATOM   5172 O  OG1   . THR C 3 575 ? 25.044  57.838 26.004  1.00 19.17 ? 871  THR A OG1   1 
ATOM   5173 C  CG2   . THR C 3 575 ? 26.099  58.411 23.909  1.00 18.47 ? 871  THR A CG2   1 
ATOM   5174 N  N     . TRP C 3 576 ? 22.725  55.693 24.927  1.00 15.94 ? 872  TRP A N     1 
ATOM   5175 C  CA    . TRP C 3 576 ? 21.823  54.919 25.763  1.00 15.98 ? 872  TRP A CA    1 
ATOM   5176 C  C     . TRP C 3 576 ? 22.055  55.323 27.222  1.00 16.35 ? 872  TRP A C     1 
ATOM   5177 O  O     . TRP C 3 576 ? 21.124  55.395 28.019  1.00 15.89 ? 872  TRP A O     1 
ATOM   5178 C  CB    . TRP C 3 576 ? 22.096  53.423 25.563  1.00 14.57 ? 872  TRP A CB    1 
ATOM   5179 C  CG    . TRP C 3 576 ? 21.051  52.516 26.145  1.00 15.08 ? 872  TRP A CG    1 
ATOM   5180 C  CD1   . TRP C 3 576 ? 19.904  52.882 26.796  1.00 15.70 ? 872  TRP A CD1   1 
ATOM   5181 C  CD2   . TRP C 3 576 ? 21.057  51.085 26.117  1.00 14.34 ? 872  TRP A CD2   1 
ATOM   5182 N  NE1   . TRP C 3 576 ? 19.197  51.762 27.175  1.00 13.73 ? 872  TRP A NE1   1 
ATOM   5183 C  CE2   . TRP C 3 576 ? 19.882  50.648 26.769  1.00 15.01 ? 872  TRP A CE2   1 
ATOM   5184 C  CE3   . TRP C 3 576 ? 21.942  50.129 25.604  1.00 15.51 ? 872  TRP A CE3   1 
ATOM   5185 C  CZ2   . TRP C 3 576 ? 19.570  49.291 26.922  1.00 16.80 ? 872  TRP A CZ2   1 
ATOM   5186 C  CZ3   . TRP C 3 576 ? 21.631  48.778 25.757  1.00 16.32 ? 872  TRP A CZ3   1 
ATOM   5187 C  CH2   . TRP C 3 576 ? 20.454  48.375 26.411  1.00 16.48 ? 872  TRP A CH2   1 
ATOM   5188 N  N     . TYR C 3 577 ? 23.308  55.597 27.569  1.00 18.14 ? 873  TYR A N     1 
ATOM   5189 C  CA    . TYR C 3 577 ? 23.641  56.003 28.928  1.00 19.46 ? 873  TYR A CA    1 
ATOM   5190 C  C     . TYR C 3 577 ? 22.914  57.294 29.304  1.00 20.96 ? 873  TYR A C     1 
ATOM   5191 O  O     . TYR C 3 577 ? 22.438  57.438 30.429  1.00 21.66 ? 873  TYR A O     1 
ATOM   5192 C  CB    . TYR C 3 577 ? 25.160  56.188 29.052  1.00 19.72 ? 873  TYR A CB    1 
ATOM   5193 C  CG    . TYR C 3 577 ? 25.645  56.823 30.345  1.00 19.19 ? 873  TYR A CG    1 
ATOM   5194 C  CD1   . TYR C 3 577 ? 25.635  58.208 30.514  1.00 21.69 ? 873  TYR A CD1   1 
ATOM   5195 C  CD2   . TYR C 3 577 ? 26.138  56.038 31.389  1.00 19.32 ? 873  TYR A CD2   1 
ATOM   5196 C  CE1   . TYR C 3 577 ? 26.108  58.798 31.690  1.00 22.97 ? 873  TYR A CE1   1 
ATOM   5197 C  CE2   . TYR C 3 577 ? 26.615  56.616 32.568  1.00 21.21 ? 873  TYR A CE2   1 
ATOM   5198 C  CZ    . TYR C 3 577 ? 26.598  57.998 32.710  1.00 22.65 ? 873  TYR A CZ    1 
ATOM   5199 O  OH    . TYR C 3 577 ? 27.083  58.582 33.860  1.00 22.99 ? 873  TYR A OH    1 
ATOM   5200 N  N     . ASP C 3 578 ? 22.808  58.214 28.349  1.00 22.40 ? 874  ASP A N     1 
ATOM   5201 C  CA    . ASP C 3 578 ? 22.163  59.503 28.583  1.00 24.83 ? 874  ASP A CA    1 
ATOM   5202 C  C     . ASP C 3 578 ? 20.644  59.443 28.603  1.00 26.45 ? 874  ASP A C     1 
ATOM   5203 O  O     . ASP C 3 578 ? 19.990  60.390 29.049  1.00 26.92 ? 874  ASP A O     1 
ATOM   5204 C  CB    . ASP C 3 578 ? 22.618  60.517 27.530  1.00 26.72 ? 874  ASP A CB    1 
ATOM   5205 C  CG    . ASP C 3 578 ? 24.102  60.791 27.592  1.00 30.73 ? 874  ASP A CG    1 
ATOM   5206 O  OD1   . ASP C 3 578 ? 24.575  61.274 28.644  1.00 31.76 ? 874  ASP A OD1   1 
ATOM   5207 O  OD2   . ASP C 3 578 ? 24.799  60.520 26.590  1.00 34.25 ? 874  ASP A OD2   1 
ATOM   5208 N  N     . ALA C 3 579 ? 20.084  58.339 28.119  1.00 26.34 ? 875  ALA A N     1 
ATOM   5209 C  CA    . ALA C 3 579 ? 18.638  58.172 28.104  1.00 27.92 ? 875  ALA A CA    1 
ATOM   5210 C  C     . ALA C 3 579 ? 18.204  57.830 29.523  1.00 29.54 ? 875  ALA A C     1 
ATOM   5211 O  O     . ALA C 3 579 ? 17.580  56.795 29.769  1.00 28.59 ? 875  ALA A O     1 
ATOM   5212 C  CB    . ALA C 3 579 ? 18.245  57.059 27.137  1.00 26.48 ? 875  ALA A CB    1 
ATOM   5213 N  N     . LYS C 3 580 ? 18.550  58.721 30.449  1.00 32.62 ? 876  LYS A N     1 
ATOM   5214 C  CA    . LYS C 3 580 ? 18.240  58.569 31.868  1.00 35.75 ? 876  LYS A CA    1 
ATOM   5215 C  C     . LYS C 3 580 ? 17.746  59.889 32.452  1.00 37.32 ? 876  LYS A C     1 
ATOM   5216 O  O     . LYS C 3 580 ? 16.863  59.849 33.335  1.00 38.47 ? 876  LYS A O     1 
ATOM   5217 C  CB    . LYS C 3 580 ? 19.484  58.111 32.634  1.00 36.48 ? 876  LYS A CB    1 
ATOM   5218 C  CG    . LYS C 3 580 ? 20.650  59.093 32.584  1.00 36.90 ? 876  LYS A CG    1 
ATOM   5219 C  CD    . LYS C 3 580 ? 21.854  58.558 33.345  1.00 38.84 ? 876  LYS A CD    1 
ATOM   5220 C  CE    . LYS C 3 580 ? 23.039  59.508 33.263  1.00 38.40 ? 876  LYS A CE    1 
ATOM   5221 N  NZ    . LYS C 3 580 ? 22.733  60.831 33.867  1.00 38.11 ? 876  LYS A NZ    1 
ATOM   5222 O  OXT   . LYS C 3 580 ? 18.257  60.949 32.028  1.00 38.76 ? 876  LYS A OXT   1 
HETATM 5223 C  C1    . SUC D 4 .   ? 18.214  28.701 17.488  1.00 32.49 ? 901  SUC A C1    1 
HETATM 5224 C  C2    . SUC D 4 .   ? 19.360  27.911 18.179  1.00 33.02 ? 901  SUC A C2    1 
HETATM 5225 C  C3    . SUC D 4 .   ? 19.665  28.710 19.608  1.00 32.88 ? 901  SUC A C3    1 
HETATM 5226 C  C4    . SUC D 4 .   ? 20.127  30.167 19.289  1.00 32.71 ? 901  SUC A C4    1 
HETATM 5227 C  C5    . SUC D 4 .   ? 19.068  30.911 18.386  1.00 32.27 ? 901  SUC A C5    1 
HETATM 5228 C  C6    . SUC D 4 .   ? 19.557  32.263 17.828  1.00 32.00 ? 901  SUC A C6    1 
HETATM 5229 O  O1    . SUC D 4 .   ? 17.020  28.736 18.347  1.00 30.63 ? 901  SUC A O1    1 
HETATM 5230 O  O2    . SUC D 4 .   ? 18.941  26.583 18.489  1.00 34.65 ? 901  SUC A O2    1 
HETATM 5231 O  O3    . SUC D 4 .   ? 20.724  27.997 20.238  1.00 33.00 ? 901  SUC A O3    1 
HETATM 5232 O  O4    . SUC D 4 .   ? 20.343  30.841 20.533  1.00 32.16 ? 901  SUC A O4    1 
HETATM 5233 O  O5    . SUC D 4 .   ? 18.700  30.074 17.220  1.00 31.96 ? 901  SUC A O5    1 
HETATM 5234 O  O6    . SUC D 4 .   ? 20.755  32.101 17.066  1.00 27.42 ? 901  SUC A O6    1 
HETATM 5235 C  "C1'" . SUC D 4 .   ? 15.600  26.950 17.310  1.00 30.16 ? 901  SUC A "C1'" 1 
HETATM 5236 C  "C2'" . SUC D 4 .   ? 15.678  28.417 17.831  1.00 29.62 ? 901  SUC A "C2'" 1 
HETATM 5237 C  "C3'" . SUC D 4 .   ? 14.530  28.820 18.773  1.00 28.67 ? 901  SUC A "C3'" 1 
HETATM 5238 C  "C4'" . SUC D 4 .   ? 14.360  30.317 18.480  1.00 27.38 ? 901  SUC A "C4'" 1 
HETATM 5239 C  "C5'" . SUC D 4 .   ? 14.735  30.427 16.980  1.00 27.91 ? 901  SUC A "C5'" 1 
HETATM 5240 C  "C6'" . SUC D 4 .   ? 15.563  31.648 16.551  1.00 25.49 ? 901  SUC A "C6'" 1 
HETATM 5241 O  "O1'" . SUC D 4 .   ? 14.366  26.668 16.638  1.00 30.76 ? 901  SUC A "O1'" 1 
HETATM 5242 O  "O2'" . SUC D 4 .   ? 15.498  29.240 16.663  1.00 28.90 ? 901  SUC A "O2'" 1 
HETATM 5243 O  "O3'" . SUC D 4 .   ? 14.795  28.568 20.159  1.00 29.78 ? 901  SUC A "O3'" 1 
HETATM 5244 O  "O4'" . SUC D 4 .   ? 13.036  30.752 18.781  1.00 24.22 ? 901  SUC A "O4'" 1 
HETATM 5245 O  "O6'" . SUC D 4 .   ? 15.776  31.584 15.144  1.00 21.81 ? 901  SUC A "O6'" 1 
HETATM 5246 C  C1    . SUC E 4 .   ? 45.603  35.684 35.923  1.00 50.97 ? 902  SUC A C1    1 
HETATM 5247 C  C2    . SUC E 4 .   ? 44.396  36.016 36.849  1.00 50.37 ? 902  SUC A C2    1 
HETATM 5248 C  C3    . SUC E 4 .   ? 43.096  35.208 36.195  1.00 50.21 ? 902  SUC A C3    1 
HETATM 5249 C  C4    . SUC E 4 .   ? 42.837  35.738 34.748  1.00 50.24 ? 902  SUC A C4    1 
HETATM 5250 C  C5    . SUC E 4 .   ? 44.133  35.619 33.864  1.00 51.39 ? 902  SUC A C5    1 
HETATM 5251 C  C6    . SUC E 4 .   ? 44.027  36.338 32.500  1.00 52.18 ? 902  SUC A C6    1 
HETATM 5252 O  O1    . SUC E 4 .   ? 45.849  34.232 35.864  1.00 51.95 ? 902  SUC A O1    1 
HETATM 5253 O  O2    . SUC E 4 .   ? 44.616  35.521 38.171  1.00 48.03 ? 902  SUC A O2    1 
HETATM 5254 O  O3    . SUC E 4 .   ? 41.988  35.517 37.029  1.00 50.09 ? 902  SUC A O3    1 
HETATM 5255 O  O4    . SUC E 4 .   ? 41.744  34.998 34.195  1.00 48.30 ? 902  SUC A O4    1 
HETATM 5256 O  O5    . SUC E 4 .   ? 45.298  36.199 34.574  1.00 51.16 ? 902  SUC A O5    1 
HETATM 5257 O  O6    . SUC E 4 .   ? 44.134  37.754 32.652  1.00 53.90 ? 902  SUC A O6    1 
HETATM 5258 C  "C1'" . SUC E 4 .   ? 47.739  33.592 37.361  1.00 53.70 ? 902  SUC A "C1'" 1 
HETATM 5259 C  "C2'" . SUC E 4 .   ? 47.211  33.666 35.893  1.00 53.56 ? 902  SUC A "C2'" 1 
HETATM 5260 C  "C3'" . SUC E 4 .   ? 47.363  32.354 35.091  1.00 53.93 ? 902  SUC A "C3'" 1 
HETATM 5261 C  "C4'" . SUC E 4 .   ? 47.623  32.852 33.668  1.00 54.68 ? 902  SUC A "C4'" 1 
HETATM 5262 C  "C5'" . SUC E 4 .   ? 48.434  34.151 33.890  1.00 54.59 ? 902  SUC A "C5'" 1 
HETATM 5263 C  "C6'" . SUC E 4 .   ? 48.192  35.294 32.878  1.00 55.19 ? 902  SUC A "C6'" 1 
HETATM 5264 O  "O1'" . SUC E 4 .   ? 49.170  33.593 37.457  1.00 53.99 ? 902  SUC A "O1'" 1 
HETATM 5265 O  "O2'" . SUC E 4 .   ? 48.068  34.620 35.213  1.00 53.86 ? 902  SUC A "O2'" 1 
HETATM 5266 O  "O3'" . SUC E 4 .   ? 46.220  31.495 35.138  1.00 53.37 ? 902  SUC A "O3'" 1 
HETATM 5267 O  "O4'" . SUC E 4 .   ? 48.287  31.862 32.885  1.00 55.00 ? 902  SUC A "O4'" 1 
HETATM 5268 O  "O6'" . SUC E 4 .   ? 49.074  36.379 33.154  1.00 55.78 ? 902  SUC A "O6'" 1 
HETATM 5269 C  C1    . SUC F 4 .   ? -0.767  23.455 50.690  1.00 35.09 ? 903  SUC A C1    1 
HETATM 5270 C  C2    . SUC F 4 .   ? -0.231  22.349 49.729  1.00 34.56 ? 903  SUC A C2    1 
HETATM 5271 C  C3    . SUC F 4 .   ? -1.283  22.332 48.433  1.00 34.42 ? 903  SUC A C3    1 
HETATM 5272 C  C4    . SUC F 4 .   ? -2.710  21.963 48.936  1.00 35.12 ? 903  SUC A C4    1 
HETATM 5273 C  C5    . SUC F 4 .   ? -3.169  22.935 50.080  1.00 36.04 ? 903  SUC A C5    1 
HETATM 5274 C  C6    . SUC F 4 .   ? -4.458  22.485 50.786  1.00 36.16 ? 903  SUC A C6    1 
HETATM 5275 O  O1    . SUC F 4 .   ? -0.828  24.767 50.021  1.00 35.69 ? 903  SUC A O1    1 
HETATM 5276 O  O2    . SUC F 4 .   ? 1.071   22.684 49.252  1.00 29.56 ? 903  SUC A O2    1 
HETATM 5277 O  O3    . SUC F 4 .   ? -0.815  21.318 47.557  1.00 34.72 ? 903  SUC A O3    1 
HETATM 5278 O  O4    . SUC F 4 .   ? -3.599  21.999 47.813  1.00 34.69 ? 903  SUC A O4    1 
HETATM 5279 O  O5    . SUC F 4 .   ? -2.119  23.052 51.122  1.00 36.29 ? 903  SUC A O5    1 
HETATM 5280 O  O6    . SUC F 4 .   ? -5.121  23.606 51.366  1.00 37.94 ? 903  SUC A O6    1 
HETATM 5281 C  "C1'" . SUC F 4 .   ? 1.141   26.206 50.527  1.00 37.92 ? 903  SUC A "C1'" 1 
HETATM 5282 C  "C2'" . SUC F 4 .   ? -0.401  26.018 50.676  1.00 37.57 ? 903  SUC A "C2'" 1 
HETATM 5283 C  "C3'" . SUC F 4 .   ? -1.247  27.253 50.284  1.00 37.77 ? 903  SUC A "C3'" 1 
HETATM 5284 C  "C4'" . SUC F 4 .   ? -2.443  27.138 51.229  1.00 38.24 ? 903  SUC A "C4'" 1 
HETATM 5285 C  "C5'" . SUC F 4 .   ? -1.796  26.610 52.530  1.00 38.73 ? 903  SUC A "C5'" 1 
HETATM 5286 C  "C6'" . SUC F 4 .   ? -2.677  25.707 53.419  1.00 39.63 ? 903  SUC A "C6'" 1 
HETATM 5287 O  "O1'" . SUC F 4 .   ? 1.611   27.466 51.022  1.00 40.00 ? 903  SUC A "O1'" 1 
HETATM 5288 O  "O2'" . SUC F 4 .   ? -0.637  25.847 52.100  1.00 37.78 ? 903  SUC A "O2'" 1 
HETATM 5289 O  "O3'" . SUC F 4 .   ? -1.665  27.279 48.914  1.00 34.60 ? 903  SUC A "O3'" 1 
HETATM 5290 O  "O4'" . SUC F 4 .   ? -3.119  28.383 51.364  1.00 39.39 ? 903  SUC A "O4'" 1 
HETATM 5291 O  "O6'" . SUC F 4 .   ? -2.013  25.457 54.657  1.00 41.86 ? 903  SUC A "O6'" 1 
HETATM 5292 S  S     . SO4 G 5 .   ? 4.338   9.921  -1.377  1.00 39.30 ? 904  SO4 A S     1 
HETATM 5293 O  O1    . SO4 G 5 .   ? 5.398   10.784 -0.824  1.00 40.19 ? 904  SO4 A O1    1 
HETATM 5294 O  O2    . SO4 G 5 .   ? 3.918   8.937  -0.361  1.00 42.06 ? 904  SO4 A O2    1 
HETATM 5295 O  O3    . SO4 G 5 .   ? 3.177   10.743 -1.771  1.00 40.09 ? 904  SO4 A O3    1 
HETATM 5296 O  O4    . SO4 G 5 .   ? 4.864   9.201  -2.552  1.00 41.88 ? 904  SO4 A O4    1 
HETATM 5297 S  S     . SO4 H 5 .   ? 13.649  52.630 44.017  1.00 52.13 ? 905  SO4 A S     1 
HETATM 5298 O  O1    . SO4 H 5 .   ? 12.182  52.653 44.185  1.00 51.05 ? 905  SO4 A O1    1 
HETATM 5299 O  O2    . SO4 H 5 .   ? 14.134  53.985 43.697  1.00 51.37 ? 905  SO4 A O2    1 
HETATM 5300 O  O3    . SO4 H 5 .   ? 14.282  52.166 45.266  1.00 51.94 ? 905  SO4 A O3    1 
HETATM 5301 O  O4    . SO4 H 5 .   ? 13.998  51.708 42.919  1.00 52.26 ? 905  SO4 A O4    1 
HETATM 5302 S  S     . SO4 I 5 .   ? -2.600  55.059 6.438   1.00 29.56 ? 906  SO4 A S     1 
HETATM 5303 O  O1    . SO4 I 5 .   ? -3.508  53.971 6.018   1.00 31.64 ? 906  SO4 A O1    1 
HETATM 5304 O  O2    . SO4 I 5 .   ? -2.449  55.034 7.904   1.00 29.62 ? 906  SO4 A O2    1 
HETATM 5305 O  O3    . SO4 I 5 .   ? -3.162  56.360 6.025   1.00 31.73 ? 906  SO4 A O3    1 
HETATM 5306 O  O4    . SO4 I 5 .   ? -1.285  54.872 5.796   1.00 31.84 ? 906  SO4 A O4    1 
HETATM 5307 MG MG    . MG  J 6 .   ? 11.048  50.310 35.201  1.00 35.67 ? 920  MG  A MG    1 
HETATM 5308 O  O     . HOH K 7 .   ? 30.894  40.084 41.786  1.00 23.45 ? 3020 HOH B O     1 
HETATM 5309 O  O     . HOH K 7 .   ? 31.339  40.853 39.064  1.00 23.99 ? 3032 HOH B O     1 
HETATM 5310 O  O     . HOH K 7 .   ? 26.515  35.277 42.211  1.00 30.34 ? 3033 HOH B O     1 
HETATM 5311 O  O     . HOH K 7 .   ? 29.904  43.783 40.743  1.00 29.07 ? 3066 HOH B O     1 
HETATM 5312 O  O     . HOH K 7 .   ? 17.564  40.459 31.206  1.00 17.71 ? 3079 HOH B O     1 
HETATM 5313 O  O     . HOH K 7 .   ? 22.588  32.071 39.406  1.00 35.68 ? 3162 HOH B O     1 
HETATM 5314 O  O     . HOH K 7 .   ? 17.802  48.185 32.088  1.00 40.93 ? 3183 HOH B O     1 
HETATM 5315 O  O     . HOH K 7 .   ? 25.388  45.220 39.373  1.00 30.14 ? 3351 HOH B O     1 
HETATM 5316 O  O     . HOH K 7 .   ? 26.274  46.988 37.459  1.00 25.09 ? 3397 HOH B O     1 
HETATM 5317 O  O     . HOH K 7 .   ? 30.364  44.315 36.646  1.00 20.07 ? 3412 HOH B O     1 
HETATM 5318 O  O     . HOH K 7 .   ? 11.209  41.020 37.507  1.00 34.24 ? 3433 HOH B O     1 
HETATM 5319 O  O     . HOH K 7 .   ? 23.271  37.582 39.528  1.00 26.46 ? 3443 HOH B O     1 
HETATM 5320 O  O     . HOH K 7 .   ? 27.935  40.779 42.364  1.00 34.94 ? 3464 HOH B O     1 
HETATM 5321 O  O     . HOH K 7 .   ? 24.846  40.747 40.577  1.00 40.07 ? 3476 HOH B O     1 
HETATM 5322 O  O     . HOH K 7 .   ? 15.060  48.630 35.687  1.00 35.27 ? 3511 HOH B O     1 
HETATM 5323 O  O     . HOH K 7 .   ? 30.633  35.744 35.300  1.00 42.05 ? 3519 HOH B O     1 
HETATM 5324 O  O     . HOH K 7 .   ? 33.477  31.116 37.962  1.00 33.17 ? 3553 HOH B O     1 
HETATM 5325 O  O     . HOH K 7 .   ? 25.752  27.882 33.412  1.00 38.95 ? 3561 HOH B O     1 
HETATM 5326 O  O     . HOH K 7 .   ? 25.611  26.837 36.059  1.00 33.63 ? 3562 HOH B O     1 
HETATM 5327 O  O     . HOH K 7 .   ? 9.696   43.975 35.054  1.00 34.56 ? 3595 HOH B O     1 
HETATM 5328 O  O     . HOH K 7 .   ? 26.598  26.527 40.215  1.00 33.65 ? 3601 HOH B O     1 
HETATM 5329 O  O     . HOH K 7 .   ? 23.476  29.436 36.301  1.00 34.54 ? 3615 HOH B O     1 
HETATM 5330 O  O     . HOH K 7 .   ? 26.384  24.528 44.304  1.00 41.66 ? 3625 HOH B O     1 
HETATM 5331 O  O     . HOH L 7 .   ? 24.608  37.260 29.391  1.00 18.04 ? 1050 HOH C O     1 
HETATM 5332 O  O     . HOH L 7 .   ? 26.600  38.761 31.858  1.00 21.57 ? 2734 HOH C O     1 
HETATM 5333 O  O     . HOH L 7 .   ? 14.561  30.756 37.028  1.00 37.94 ? 2795 HOH C O     1 
HETATM 5334 O  O     . HOH L 7 .   ? 25.776  31.379 26.094  1.00 28.88 ? 3152 HOH C O     1 
HETATM 5335 O  O     . HOH L 7 .   ? 26.783  29.011 29.270  1.00 42.33 ? 3210 HOH C O     1 
HETATM 5336 O  O     . HOH L 7 .   ? 44.179  32.044 33.126  1.00 31.70 ? 3287 HOH C O     1 
HETATM 5337 O  O     . HOH L 7 .   ? 27.776  37.813 22.614  1.00 40.45 ? 3288 HOH C O     1 
HETATM 5338 O  O     . HOH L 7 .   ? 19.153  38.225 30.148  1.00 18.58 ? 3297 HOH C O     1 
HETATM 5339 O  O     . HOH L 7 .   ? 14.044  37.223 31.518  1.00 25.68 ? 3302 HOH C O     1 
HETATM 5340 O  O     . HOH L 7 .   ? 30.976  32.211 26.417  1.00 26.54 ? 3312 HOH C O     1 
HETATM 5341 O  O     . HOH L 7 .   ? 21.204  30.267 27.941  1.00 30.81 ? 3315 HOH C O     1 
HETATM 5342 O  O     . HOH L 7 .   ? 18.961  24.604 34.034  1.00 49.80 ? 3348 HOH C O     1 
HETATM 5343 O  O     . HOH L 7 .   ? 26.852  35.363 22.805  1.00 26.63 ? 3369 HOH C O     1 
HETATM 5344 O  O     . HOH L 7 .   ? 13.106  27.990 29.319  1.00 24.63 ? 3419 HOH C O     1 
HETATM 5345 O  O     . HOH L 7 .   ? 36.057  28.559 27.819  1.00 30.35 ? 3434 HOH C O     1 
HETATM 5346 O  O     . HOH L 7 .   ? 22.018  31.211 24.552  1.00 24.41 ? 3445 HOH C O     1 
HETATM 5347 O  O     . HOH L 7 .   ? 17.778  29.011 29.545  1.00 49.58 ? 3463 HOH C O     1 
HETATM 5348 O  O     . HOH L 7 .   ? 34.457  33.394 25.518  1.00 32.63 ? 3486 HOH C O     1 
HETATM 5349 O  O     . HOH L 7 .   ? 19.378  31.141 24.328  1.00 26.07 ? 3512 HOH C O     1 
HETATM 5350 O  O     . HOH L 7 .   ? 37.845  26.591 27.926  1.00 30.03 ? 3526 HOH C O     1 
HETATM 5351 O  O     . HOH L 7 .   ? 20.088  32.842 38.414  1.00 29.57 ? 3547 HOH C O     1 
HETATM 5352 O  O     . HOH L 7 .   ? 37.132  31.107 28.025  1.00 30.59 ? 3549 HOH C O     1 
HETATM 5353 O  O     . HOH L 7 .   ? 15.774  27.524 29.022  1.00 36.90 ? 3577 HOH C O     1 
HETATM 5354 O  O     . HOH L 7 .   ? 24.751  32.120 22.199  1.00 35.57 ? 3614 HOH C O     1 
HETATM 5355 O  O     . HOH L 7 .   ? 35.509  29.820 36.694  1.00 39.17 ? 3638 HOH C O     1 
HETATM 5356 O  O     . HOH L 7 .   ? 44.623  28.467 35.889  1.00 44.27 ? 3646 HOH C O     1 
HETATM 5357 O  O     . HOH L 7 .   ? 42.876  24.405 39.783  1.00 35.81 ? 3650 HOH C O     1 
HETATM 5358 O  O     . HOH L 7 .   ? 17.233  33.678 40.011  1.00 32.52 ? 3665 HOH C O     1 
HETATM 5359 O  O     . HOH M 7 .   ? 8.198   35.261 23.865  1.00 13.19 ? 1004 HOH A O     1 
HETATM 5360 O  O     . HOH M 7 .   ? 9.363   27.150 7.573   1.00 13.99 ? 1008 HOH A O     1 
HETATM 5361 O  O     . HOH M 7 .   ? 17.478  37.634 27.820  1.00 14.29 ? 1009 HOH A O     1 
HETATM 5362 O  O     . HOH M 7 .   ? 3.308   50.944 34.921  1.00 15.09 ? 1016 HOH A O     1 
HETATM 5363 O  O     . HOH M 7 .   ? -4.939  50.564 33.185  1.00 18.32 ? 1017 HOH A O     1 
HETATM 5364 O  O     . HOH M 7 .   ? 29.226  46.885 37.041  1.00 21.87 ? 1018 HOH A O     1 
HETATM 5365 O  O     . HOH M 7 .   ? 18.185  45.807 17.591  1.00 12.88 ? 1030 HOH A O     1 
HETATM 5366 O  O     . HOH M 7 .   ? 13.704  33.676 15.156  1.00 16.54 ? 1031 HOH A O     1 
HETATM 5367 O  O     . HOH M 7 .   ? 10.067  34.184 16.550  1.00 15.25 ? 1032 HOH A O     1 
HETATM 5368 O  O     . HOH M 7 .   ? 9.053   33.608 13.994  1.00 12.92 ? 1033 HOH A O     1 
HETATM 5369 O  O     . HOH M 7 .   ? 11.223  33.598 24.732  1.00 14.94 ? 1039 HOH A O     1 
HETATM 5370 O  O     . HOH M 7 .   ? 3.840   31.081 25.796  1.00 18.80 ? 1040 HOH A O     1 
HETATM 5371 O  O     . HOH M 7 .   ? 1.498   29.697 26.501  1.00 15.57 ? 1041 HOH A O     1 
HETATM 5372 O  O     . HOH M 7 .   ? 4.014   24.878 30.211  1.00 16.84 ? 1042 HOH A O     1 
HETATM 5373 O  O     . HOH M 7 .   ? 12.239  33.459 18.026  1.00 12.07 ? 1045 HOH A O     1 
HETATM 5374 O  O     . HOH M 7 .   ? 15.992  25.212 -8.399  1.00 32.13 ? 2001 HOH A O     1 
HETATM 5375 O  O     . HOH M 7 .   ? 2.447   28.178 -3.259  1.00 19.46 ? 2002 HOH A O     1 
HETATM 5376 O  O     . HOH M 7 .   ? 9.264   40.052 -1.829  1.00 23.13 ? 2003 HOH A O     1 
HETATM 5377 O  O     . HOH M 7 .   ? 26.077  34.526 4.029   1.00 27.04 ? 2005 HOH A O     1 
HETATM 5378 O  O     . HOH M 7 .   ? 2.487   14.394 5.223   1.00 18.96 ? 2006 HOH A O     1 
HETATM 5379 O  O     . HOH M 7 .   ? 21.077  36.554 4.577   1.00 17.22 ? 2007 HOH A O     1 
HETATM 5380 O  O     . HOH M 7 .   ? 11.915  39.585 4.562   1.00 14.34 ? 2008 HOH A O     1 
HETATM 5381 O  O     . HOH M 7 .   ? -2.168  23.728 5.633   1.00 31.03 ? 2009 HOH A O     1 
HETATM 5382 O  O     . HOH M 7 .   ? 25.147  27.786 5.758   1.00 21.70 ? 2010 HOH A O     1 
HETATM 5383 O  O     . HOH M 7 .   ? 6.886   15.172 6.607   1.00 12.69 ? 2011 HOH A O     1 
HETATM 5384 O  O     . HOH M 7 .   ? 22.682  28.912 6.581   1.00 19.68 ? 2012 HOH A O     1 
HETATM 5385 O  O     . HOH M 7 .   ? 27.193  41.346 7.866   1.00 21.75 ? 2013 HOH A O     1 
HETATM 5386 O  O     . HOH M 7 .   ? 14.446  47.281 10.146  1.00 16.33 ? 2016 HOH A O     1 
HETATM 5387 O  O     . HOH M 7 .   ? 13.045  19.158 12.157  1.00 15.62 ? 2018 HOH A O     1 
HETATM 5388 O  O     . HOH M 7 .   ? 13.098  22.940 12.119  1.00 23.73 ? 2019 HOH A O     1 
HETATM 5389 O  O     . HOH M 7 .   ? -0.904  36.842 12.055  1.00 16.66 ? 2020 HOH A O     1 
HETATM 5390 O  O     . HOH M 7 .   ? 12.802  48.479 14.227  1.00 17.27 ? 2021 HOH A O     1 
HETATM 5391 O  O     . HOH M 7 .   ? 1.706   47.147 14.402  1.00 15.30 ? 2022 HOH A O     1 
HETATM 5392 O  O     . HOH M 7 .   ? 8.340   14.364 14.786  1.00 18.53 ? 2023 HOH A O     1 
HETATM 5393 O  O     . HOH M 7 .   ? 9.600   50.432 15.273  1.00 16.76 ? 2024 HOH A O     1 
HETATM 5394 O  O     . HOH M 7 .   ? 25.872  41.354 16.350  1.00 26.58 ? 2026 HOH A O     1 
HETATM 5395 O  O     . HOH M 7 .   ? 21.525  52.583 17.137  1.00 14.16 ? 2028 HOH A O     1 
HETATM 5396 O  O     . HOH M 7 .   ? -4.625  17.850 25.056  1.00 31.72 ? 2029 HOH A O     1 
HETATM 5397 O  O     . HOH M 7 .   ? 11.849  67.180 18.981  1.00 14.51 ? 2033 HOH A O     1 
HETATM 5398 O  O     . HOH M 7 .   ? -0.570  61.617 23.137  1.00 49.38 ? 2034 HOH A O     1 
HETATM 5399 O  O     . HOH M 7 .   ? 2.567   65.360 19.953  1.00 18.60 ? 2035 HOH A O     1 
HETATM 5400 O  O     . HOH M 7 .   ? -6.412  34.356 22.279  1.00 14.04 ? 2037 HOH A O     1 
HETATM 5401 O  O     . HOH M 7 .   ? 7.651   24.566 23.359  1.00 23.73 ? 2038 HOH A O     1 
HETATM 5402 O  O     . HOH M 7 .   ? -1.945  51.183 23.188  1.00 13.92 ? 2040 HOH A O     1 
HETATM 5403 O  O     . HOH M 7 .   ? -4.527  29.331 27.663  1.00 21.40 ? 2045 HOH A O     1 
HETATM 5404 O  O     . HOH M 7 .   ? -7.181  22.689 28.682  1.00 16.30 ? 2046 HOH A O     1 
HETATM 5405 O  O     . HOH M 7 .   ? 20.234  45.822 28.878  1.00 16.72 ? 2048 HOH A O     1 
HETATM 5406 O  O     . HOH M 7 .   ? -4.368  20.677 32.021  1.00 15.13 ? 2051 HOH A O     1 
HETATM 5407 O  O     . HOH M 7 .   ? 9.638   60.175 32.903  1.00 26.21 ? 2053 HOH A O     1 
HETATM 5408 O  O     . HOH M 7 .   ? -0.307  19.869 34.318  1.00 17.05 ? 2055 HOH A O     1 
HETATM 5409 O  O     . HOH M 7 .   ? -8.916  19.718 35.199  1.00 10.89 ? 2056 HOH A O     1 
HETATM 5410 O  O     . HOH M 7 .   ? -5.716  28.367 34.874  1.00 18.76 ? 2057 HOH A O     1 
HETATM 5411 O  O     . HOH M 7 .   ? 5.689   21.853 37.182  1.00 15.29 ? 2059 HOH A O     1 
HETATM 5412 O  O     . HOH M 7 .   ? 13.262  15.090 7.482   1.00 15.09 ? 2101 HOH A O     1 
HETATM 5413 O  O     . HOH M 7 .   ? 0.612   8.792  14.023  1.00 14.28 ? 2103 HOH A O     1 
HETATM 5414 O  O     . HOH M 7 .   ? 22.760  37.852 3.021   1.00 17.68 ? 2105 HOH A O     1 
HETATM 5415 O  O     . HOH M 7 .   ? 10.528  12.810 14.271  1.00 18.11 ? 2112 HOH A O     1 
HETATM 5416 O  O     . HOH M 7 .   ? 3.611   43.230 12.638  1.00 18.64 ? 2115 HOH A O     1 
HETATM 5417 O  O     . HOH M 7 .   ? 22.258  63.708 25.805  1.00 23.62 ? 2116 HOH A O     1 
HETATM 5418 O  O     . HOH M 7 .   ? 14.322  27.718 14.084  1.00 28.00 ? 2121 HOH A O     1 
HETATM 5419 O  O     . HOH M 7 .   ? 6.535   53.114 43.440  1.00 30.42 ? 2123 HOH A O     1 
HETATM 5420 O  O     . HOH M 7 .   ? -3.438  21.619 8.120   1.00 19.65 ? 2132 HOH A O     1 
HETATM 5421 O  O     . HOH M 7 .   ? 7.904   6.580  14.600  1.00 27.11 ? 2135 HOH A O     1 
HETATM 5422 O  O     . HOH M 7 .   ? -6.605  45.176 50.644  1.00 18.42 ? 2139 HOH A O     1 
HETATM 5423 O  O     . HOH M 7 .   ? 8.909   22.070 40.515  1.00 24.82 ? 2140 HOH A O     1 
HETATM 5424 O  O     . HOH M 7 .   ? 15.251  28.836 8.334   1.00 21.61 ? 2145 HOH A O     1 
HETATM 5425 O  O     . HOH M 7 .   ? 22.276  32.396 0.228   1.00 21.04 ? 2146 HOH A O     1 
HETATM 5426 O  O     . HOH M 7 .   ? 12.748  30.302 -12.189 1.00 31.35 ? 2148 HOH A O     1 
HETATM 5427 O  O     . HOH M 7 .   ? 4.448   36.105 -8.713  1.00 25.32 ? 2149 HOH A O     1 
HETATM 5428 O  O     . HOH M 7 .   ? 16.163  52.618 51.447  1.00 23.53 ? 2154 HOH A O     1 
HETATM 5429 O  O     . HOH M 7 .   ? 25.800  30.761 13.714  1.00 29.78 ? 2157 HOH A O     1 
HETATM 5430 O  O     . HOH M 7 .   ? -2.643  25.554 -1.806  1.00 22.61 ? 2160 HOH A O     1 
HETATM 5431 O  O     . HOH M 7 .   ? 29.118  37.044 31.530  1.00 25.23 ? 2161 HOH A O     1 
HETATM 5432 O  O     . HOH M 7 .   ? -5.325  36.615 23.529  1.00 23.05 ? 2163 HOH A O     1 
HETATM 5433 O  O     . HOH M 7 .   ? 14.148  26.125 12.074  1.00 31.89 ? 2167 HOH A O     1 
HETATM 5434 O  O     . HOH M 7 .   ? 4.737   66.705 26.059  1.00 21.33 ? 2171 HOH A O     1 
HETATM 5435 O  O     . HOH M 7 .   ? 3.043   54.341 42.006  1.00 26.72 ? 2188 HOH A O     1 
HETATM 5436 O  O     . HOH M 7 .   ? -1.871  23.336 25.495  1.00 13.48 ? 2214 HOH A O     1 
HETATM 5437 O  O     . HOH M 7 .   ? -11.674 23.247 34.217  1.00 22.43 ? 2229 HOH A O     1 
HETATM 5438 O  O     . HOH M 7 .   ? 16.463  48.550 9.014   1.00 22.95 ? 2242 HOH A O     1 
HETATM 5439 O  O     . HOH M 7 .   ? 13.468  26.522 7.906   1.00 27.99 ? 2250 HOH A O     1 
HETATM 5440 O  O     . HOH M 7 .   ? -0.843  29.867 5.254   1.00 24.61 ? 2254 HOH A O     1 
HETATM 5441 O  O     . HOH M 7 .   ? 7.714   36.568 11.265  1.00 20.27 ? 2255 HOH A O     1 
HETATM 5442 O  O     . HOH M 7 .   ? 9.526   40.570 8.676   1.00 25.42 ? 2256 HOH A O     1 
HETATM 5443 O  O     . HOH M 7 .   ? 11.533  11.224 8.144   1.00 21.60 ? 2264 HOH A O     1 
HETATM 5444 O  O     . HOH M 7 .   ? 14.587  13.366 5.711   1.00 21.65 ? 2266 HOH A O     1 
HETATM 5445 O  O     . HOH M 7 .   ? 3.165   45.698 47.745  1.00 21.61 ? 2302 HOH A O     1 
HETATM 5446 O  O     . HOH M 7 .   ? 15.900  46.067 48.962  1.00 23.47 ? 2304 HOH A O     1 
HETATM 5447 O  O     . HOH M 7 .   ? 1.142   38.683 11.535  1.00 19.24 ? 2308 HOH A O     1 
HETATM 5448 O  O     . HOH M 7 .   ? 5.336   44.812 10.984  1.00 28.27 ? 2309 HOH A O     1 
HETATM 5449 O  O     . HOH M 7 .   ? -2.434  42.767 15.895  1.00 21.52 ? 2313 HOH A O     1 
HETATM 5450 O  O     . HOH M 7 .   ? -2.503  42.733 19.877  1.00 25.69 ? 2321 HOH A O     1 
HETATM 5451 O  O     . HOH M 7 .   ? -2.874  45.283 19.102  1.00 31.35 ? 2322 HOH A O     1 
HETATM 5452 O  O     . HOH M 7 .   ? 13.104  46.026 8.203   1.00 23.12 ? 2326 HOH A O     1 
HETATM 5453 O  O     . HOH M 7 .   ? 27.103  44.024 7.929   1.00 25.27 ? 2327 HOH A O     1 
HETATM 5454 O  O     . HOH M 7 .   ? 24.928  45.589 9.751   1.00 36.78 ? 2328 HOH A O     1 
HETATM 5455 O  O     . HOH M 7 .   ? 15.476  55.740 51.486  1.00 41.63 ? 2330 HOH A O     1 
HETATM 5456 O  O     . HOH M 7 .   ? 15.288  44.601 46.574  1.00 30.99 ? 2333 HOH A O     1 
HETATM 5457 O  O     . HOH M 7 .   ? 18.236  31.796 22.016  1.00 31.04 ? 2355 HOH A O     1 
HETATM 5458 O  O     . HOH M 7 .   ? 15.937  44.765 3.302   1.00 25.68 ? 2366 HOH A O     1 
HETATM 5459 O  O     . HOH M 7 .   ? -9.628  55.866 45.238  1.00 21.94 ? 2373 HOH A O     1 
HETATM 5460 O  O     . HOH M 7 .   ? -8.274  23.347 26.091  1.00 22.92 ? 2377 HOH A O     1 
HETATM 5461 O  O     . HOH M 7 .   ? -0.469  19.386 21.263  1.00 27.70 ? 2379 HOH A O     1 
HETATM 5462 O  O     . HOH M 7 .   ? -0.959  21.013 24.360  1.00 25.46 ? 2380 HOH A O     1 
HETATM 5463 O  O     . HOH M 7 .   ? 26.579  33.383 7.997   1.00 32.25 ? 2403 HOH A O     1 
HETATM 5464 O  O     . HOH M 7 .   ? 23.565  41.520 3.007   1.00 16.83 ? 2407 HOH A O     1 
HETATM 5465 O  O     . HOH M 7 .   ? 2.354   16.666 1.709   1.00 28.72 ? 2412 HOH A O     1 
HETATM 5466 O  O     . HOH M 7 .   ? 13.568  17.402 17.585  1.00 21.75 ? 2419 HOH A O     1 
HETATM 5467 O  O     . HOH M 7 .   ? 11.872  10.686 11.003  1.00 27.83 ? 2422 HOH A O     1 
HETATM 5468 O  O     . HOH M 7 .   ? 6.437   7.436  18.831  1.00 33.70 ? 2424 HOH A O     1 
HETATM 5469 O  O     . HOH M 7 .   ? -5.446  19.420 17.866  1.00 24.47 ? 2429 HOH A O     1 
HETATM 5470 O  O     . HOH M 7 .   ? -5.127  21.859 25.012  1.00 19.60 ? 2430 HOH A O     1 
HETATM 5471 O  O     . HOH M 7 .   ? -8.884  43.282 49.348  1.00 25.96 ? 2462 HOH A O     1 
HETATM 5472 O  O     . HOH M 7 .   ? -9.231  52.414 45.414  1.00 18.71 ? 2463 HOH A O     1 
HETATM 5473 O  O     . HOH M 7 .   ? -0.417  51.897 10.975  1.00 24.32 ? 2516 HOH A O     1 
HETATM 5474 O  O     . HOH M 7 .   ? 10.463  54.218 36.040  1.00 28.17 ? 2518 HOH A O     1 
HETATM 5475 O  O     . HOH M 7 .   ? -9.913  46.265 33.556  1.00 35.30 ? 2540 HOH A O     1 
HETATM 5476 O  O     . HOH M 7 .   ? 26.005  58.333 16.295  1.00 31.52 ? 2543 HOH A O     1 
HETATM 5477 O  O     . HOH M 7 .   ? -3.368  53.663 32.273  1.00 30.21 ? 2624 HOH A O     1 
HETATM 5478 O  O     . HOH M 7 .   ? -6.646  52.481 29.836  1.00 36.90 ? 2646 HOH A O     1 
HETATM 5479 O  O     . HOH M 7 .   ? 23.466  21.107 -1.028  1.00 45.17 ? 2670 HOH A O     1 
HETATM 5480 O  O     . HOH M 7 .   ? -4.688  34.233 10.257  1.00 34.44 ? 2697 HOH A O     1 
HETATM 5481 O  O     . HOH M 7 .   ? 2.059   60.850 26.895  1.00 24.36 ? 2756 HOH A O     1 
HETATM 5482 O  O     . HOH M 7 .   ? 12.626  52.850 63.443  1.00 38.12 ? 2775 HOH A O     1 
HETATM 5483 O  O     . HOH M 7 .   ? 25.410  41.070 27.545  1.00 25.61 ? 2783 HOH A O     1 
HETATM 5484 O  O     . HOH M 7 .   ? 6.489   45.847 39.989  1.00 16.77 ? 2788 HOH A O     1 
HETATM 5485 O  O     . HOH M 7 .   ? 19.706  51.109 13.932  1.00 17.49 ? 2789 HOH A O     1 
HETATM 5486 O  O     . HOH M 7 .   ? 20.300  53.676 30.246  1.00 18.84 ? 2792 HOH A O     1 
HETATM 5487 O  O     . HOH M 7 .   ? 43.736  42.547 55.987  1.00 27.02 ? 2799 HOH A O     1 
HETATM 5488 O  O     . HOH M 7 .   ? -0.306  55.744 52.271  1.00 46.94 ? 2802 HOH A O     1 
HETATM 5489 O  O     . HOH M 7 .   ? 15.328  63.036 29.134  1.00 27.22 ? 2812 HOH A O     1 
HETATM 5490 O  O     . HOH M 7 .   ? 9.736   50.085 37.995  1.00 20.94 ? 2814 HOH A O     1 
HETATM 5491 O  O     . HOH M 7 .   ? -4.525  35.617 34.855  1.00 33.21 ? 2819 HOH A O     1 
HETATM 5492 O  O     . HOH M 7 .   ? -6.645  36.500 33.584  1.00 35.50 ? 2824 HOH A O     1 
HETATM 5493 O  O     . HOH M 7 .   ? 11.667  49.408 42.572  1.00 46.16 ? 2832 HOH A O     1 
HETATM 5494 O  O     . HOH M 7 .   ? 13.295  49.648 11.603  1.00 22.64 ? 2847 HOH A O     1 
HETATM 5495 O  O     . HOH M 7 .   ? 4.617   11.083 18.620  1.00 28.51 ? 2858 HOH A O     1 
HETATM 5496 O  O     . HOH M 7 .   ? 17.855  57.581 64.253  1.00 34.35 ? 2862 HOH A O     1 
HETATM 5497 O  O     . HOH M 7 .   ? -4.288  41.521 21.529  1.00 41.38 ? 2863 HOH A O     1 
HETATM 5498 O  O     . HOH M 7 .   ? -1.938  51.677 17.585  1.00 23.99 ? 2880 HOH A O     1 
HETATM 5499 O  O     . HOH M 7 .   ? 16.118  25.430 10.377  1.00 34.01 ? 2889 HOH A O     1 
HETATM 5500 O  O     . HOH M 7 .   ? 17.066  19.154 16.234  1.00 21.98 ? 2899 HOH A O     1 
HETATM 5501 O  O     . HOH M 7 .   ? -7.982  29.031 32.956  1.00 31.20 ? 2905 HOH A O     1 
HETATM 5502 O  O     . HOH M 7 .   ? -7.375  38.006 45.471  1.00 22.35 ? 2918 HOH A O     1 
HETATM 5503 O  O     . HOH M 7 .   ? -12.107 49.273 43.158  1.00 34.24 ? 2929 HOH A O     1 
HETATM 5504 O  O     . HOH M 7 .   ? 19.990  55.982 53.343  1.00 32.27 ? 2947 HOH A O     1 
HETATM 5505 O  O     . HOH M 7 .   ? 33.593  54.363 17.053  1.00 29.98 ? 2984 HOH A O     1 
HETATM 5506 O  O     . HOH M 7 .   ? -5.676  20.314 29.587  1.00 16.62 ? 3000 HOH A O     1 
HETATM 5507 O  O     . HOH M 7 .   ? 10.559  63.304 10.995  1.00 29.16 ? 3018 HOH A O     1 
HETATM 5508 O  O     . HOH M 7 .   ? -7.730  46.099 27.836  1.00 26.60 ? 3044 HOH A O     1 
HETATM 5509 O  O     . HOH M 7 .   ? 13.214  55.447 63.731  1.00 42.40 ? 3050 HOH A O     1 
HETATM 5510 O  O     . HOH M 7 .   ? 6.269   47.060 12.044  1.00 32.99 ? 3053 HOH A O     1 
HETATM 5511 O  O     . HOH M 7 .   ? 37.121  33.228 41.220  1.00 28.25 ? 3065 HOH A O     1 
HETATM 5512 O  O     . HOH M 7 .   ? 5.539   18.060 -6.962  1.00 30.18 ? 3074 HOH A O     1 
HETATM 5513 O  O     . HOH M 7 .   ? 11.786  28.280 7.009   1.00 16.21 ? 3076 HOH A O     1 
HETATM 5514 O  O     . HOH M 7 .   ? 6.500   44.425 30.963  1.00 15.96 ? 3077 HOH A O     1 
HETATM 5515 O  O     . HOH M 7 .   ? 8.209   41.176 29.373  1.00 15.08 ? 3078 HOH A O     1 
HETATM 5516 O  O     . HOH M 7 .   ? 7.666   40.303 32.117  1.00 15.06 ? 3080 HOH A O     1 
HETATM 5517 O  O     . HOH M 7 .   ? 3.079   62.860 19.784  1.00 16.96 ? 3082 HOH A O     1 
HETATM 5518 O  O     . HOH M 7 .   ? 4.651   52.782 40.120  1.00 17.81 ? 3083 HOH A O     1 
HETATM 5519 O  O     . HOH M 7 .   ? 24.312  43.193 0.926   1.00 29.81 ? 3084 HOH A O     1 
HETATM 5520 O  O     . HOH M 7 .   ? 8.335   47.791 35.901  1.00 14.75 ? 3085 HOH A O     1 
HETATM 5521 O  O     . HOH M 7 .   ? 18.430  51.296 11.268  1.00 19.80 ? 3086 HOH A O     1 
HETATM 5522 O  O     . HOH M 7 .   ? 12.606  30.066 8.739   1.00 31.83 ? 3087 HOH A O     1 
HETATM 5523 O  O     . HOH M 7 .   ? 26.170  39.311 25.140  1.00 21.93 ? 3088 HOH A O     1 
HETATM 5524 O  O     . HOH M 7 .   ? 10.204  47.730 14.106  1.00 26.69 ? 3089 HOH A O     1 
HETATM 5525 O  O     . HOH M 7 .   ? 14.875  36.548 29.094  1.00 15.34 ? 3090 HOH A O     1 
HETATM 5526 O  O     . HOH M 7 .   ? 10.692  40.172 27.599  1.00 16.69 ? 3091 HOH A O     1 
HETATM 5527 O  O     . HOH M 7 .   ? 30.564  37.773 22.356  1.00 25.70 ? 3092 HOH A O     1 
HETATM 5528 O  O     . HOH M 7 .   ? 16.015  57.461 60.067  1.00 26.21 ? 3093 HOH A O     1 
HETATM 5529 O  O     . HOH M 7 .   ? 0.191   22.468 45.497  1.00 21.34 ? 3094 HOH A O     1 
HETATM 5530 O  O     . HOH M 7 .   ? 10.124  52.489 38.930  1.00 30.64 ? 3098 HOH A O     1 
HETATM 5531 O  O     . HOH M 7 .   ? -0.101  59.944 31.009  1.00 34.21 ? 3102 HOH A O     1 
HETATM 5532 O  O     . HOH M 7 .   ? 12.890  55.563 34.176  1.00 26.65 ? 3104 HOH A O     1 
HETATM 5533 O  O     . HOH M 7 .   ? 29.739  57.492 22.625  1.00 25.82 ? 3107 HOH A O     1 
HETATM 5534 O  O     . HOH M 7 .   ? 4.801   36.819 11.740  1.00 41.15 ? 3109 HOH A O     1 
HETATM 5535 O  O     . HOH M 7 .   ? -5.111  18.693 21.544  1.00 39.35 ? 3110 HOH A O     1 
HETATM 5536 O  O     . HOH M 7 .   ? 30.930  51.150 39.914  1.00 25.17 ? 3111 HOH A O     1 
HETATM 5537 O  O     . HOH M 7 .   ? 32.728  31.684 53.678  1.00 26.60 ? 3113 HOH A O     1 
HETATM 5538 O  O     . HOH M 7 .   ? 16.939  13.789 4.401   1.00 22.20 ? 3114 HOH A O     1 
HETATM 5539 O  O     . HOH M 7 .   ? -7.247  32.337 40.631  1.00 39.50 ? 3117 HOH A O     1 
HETATM 5540 O  O     . HOH M 7 .   ? 16.555  10.721 12.845  1.00 41.28 ? 3121 HOH A O     1 
HETATM 5541 O  O     . HOH M 7 .   ? 11.086  9.881  13.831  1.00 36.01 ? 3122 HOH A O     1 
HETATM 5542 O  O     . HOH M 7 .   ? 37.866  43.496 52.409  1.00 22.28 ? 3124 HOH A O     1 
HETATM 5543 O  O     . HOH M 7 .   ? -8.562  33.277 31.663  1.00 44.31 ? 3130 HOH A O     1 
HETATM 5544 O  O     . HOH M 7 .   ? 25.944  27.403 3.281   1.00 30.28 ? 3137 HOH A O     1 
HETATM 5545 O  O     . HOH M 7 .   ? -0.342  53.579 8.744   1.00 23.97 ? 3139 HOH A O     1 
HETATM 5546 O  O     . HOH M 7 .   ? 24.330  53.602 10.828  1.00 28.52 ? 3145 HOH A O     1 
HETATM 5547 O  O     . HOH M 7 .   ? 6.064   51.449 12.357  1.00 36.96 ? 3149 HOH A O     1 
HETATM 5548 O  O     . HOH M 7 .   ? -10.995 24.078 18.165  1.00 36.70 ? 3154 HOH A O     1 
HETATM 5549 O  O     . HOH M 7 .   ? -2.011  16.971 21.124  1.00 28.68 ? 3155 HOH A O     1 
HETATM 5550 O  O     . HOH M 7 .   ? -3.759  29.594 -5.666  1.00 26.21 ? 3158 HOH A O     1 
HETATM 5551 O  O     . HOH M 7 .   ? -3.874  52.169 49.973  1.00 34.58 ? 3160 HOH A O     1 
HETATM 5552 O  O     . HOH M 7 .   ? -8.793  28.749 42.851  1.00 30.30 ? 3161 HOH A O     1 
HETATM 5553 O  O     . HOH M 7 .   ? 0.689   61.017 8.907   1.00 18.40 ? 3168 HOH A O     1 
HETATM 5554 O  O     . HOH M 7 .   ? 33.742  52.055 33.305  1.00 33.74 ? 3174 HOH A O     1 
HETATM 5555 O  O     . HOH M 7 .   ? 2.743   19.440 25.800  1.00 28.13 ? 3175 HOH A O     1 
HETATM 5556 O  O     . HOH M 7 .   ? 34.501  39.005 64.429  1.00 38.51 ? 3181 HOH A O     1 
HETATM 5557 O  O     . HOH M 7 .   ? 17.960  64.659 12.462  1.00 26.55 ? 3185 HOH A O     1 
HETATM 5558 O  O     . HOH M 7 .   ? 10.841  25.045 8.742   1.00 32.02 ? 3188 HOH A O     1 
HETATM 5559 O  O     . HOH M 7 .   ? -5.012  31.552 1.109   1.00 36.15 ? 3189 HOH A O     1 
HETATM 5560 O  O     . HOH M 7 .   ? 21.975  54.925 31.846  1.00 21.58 ? 3192 HOH A O     1 
HETATM 5561 O  O     . HOH M 7 .   ? 14.035  10.671 12.583  1.00 42.04 ? 3195 HOH A O     1 
HETATM 5562 O  O     . HOH M 7 .   ? 3.944   35.492 46.486  1.00 47.40 ? 3198 HOH A O     1 
HETATM 5563 O  O     . HOH M 7 .   ? 21.482  52.852 10.173  1.00 38.64 ? 3199 HOH A O     1 
HETATM 5564 O  O     . HOH M 7 .   ? 20.757  45.968 8.432   1.00 35.17 ? 3200 HOH A O     1 
HETATM 5565 O  O     . HOH M 7 .   ? 22.686  24.527 -0.272  1.00 33.70 ? 3207 HOH A O     1 
HETATM 5566 O  O     . HOH M 7 .   ? -2.373  57.189 29.408  1.00 30.02 ? 3208 HOH A O     1 
HETATM 5567 O  O     . HOH M 7 .   ? 36.904  41.252 21.834  1.00 31.25 ? 3222 HOH A O     1 
HETATM 5568 O  O     . HOH M 7 .   ? 17.277  51.423 29.388  1.00 33.19 ? 3228 HOH A O     1 
HETATM 5569 O  O     . HOH M 7 .   ? 27.280  52.972 41.600  1.00 32.73 ? 3245 HOH A O     1 
HETATM 5570 O  O     . HOH M 7 .   ? -2.477  36.450 9.882   1.00 26.83 ? 3248 HOH A O     1 
HETATM 5571 O  O     . HOH M 7 .   ? 6.094   13.103 44.551  1.00 24.90 ? 3253 HOH A O     1 
HETATM 5572 O  O     . HOH M 7 .   ? 12.110  16.033 -9.538  1.00 28.58 ? 3258 HOH A O     1 
HETATM 5573 O  O     . HOH M 7 .   ? 7.402   23.526 38.429  1.00 21.24 ? 3266 HOH A O     1 
HETATM 5574 O  O     . HOH M 7 .   ? 13.801  68.589 22.020  1.00 52.80 ? 3268 HOH A O     1 
HETATM 5575 O  O     . HOH M 7 .   ? -0.996  16.716 4.915   1.00 24.66 ? 3282 HOH A O     1 
HETATM 5576 O  O     . HOH M 7 .   ? 32.661  36.185 37.479  1.00 40.14 ? 3284 HOH A O     1 
HETATM 5577 O  O     . HOH M 7 .   ? -4.904  31.136 35.594  1.00 23.47 ? 3285 HOH A O     1 
HETATM 5578 O  O     . HOH M 7 .   ? 10.839  15.794 20.467  1.00 28.01 ? 3286 HOH A O     1 
HETATM 5579 O  O     . HOH M 7 .   ? 3.681   30.763 29.536  1.00 27.67 ? 3292 HOH A O     1 
HETATM 5580 O  O     . HOH M 7 .   ? -3.228  53.141 21.919  1.00 33.27 ? 3293 HOH A O     1 
HETATM 5581 O  O     . HOH M 7 .   ? -4.353  16.679 45.891  1.00 21.70 ? 3294 HOH A O     1 
HETATM 5582 O  O     . HOH M 7 .   ? -8.679  25.693 28.066  1.00 31.60 ? 3299 HOH A O     1 
HETATM 5583 O  O     . HOH M 7 .   ? 7.639   28.497 48.524  1.00 36.86 ? 3300 HOH A O     1 
HETATM 5584 O  O     . HOH M 7 .   ? -10.507 37.430 34.132  1.00 49.33 ? 3305 HOH A O     1 
HETATM 5585 O  O     . HOH M 7 .   ? 14.510  65.399 10.998  1.00 39.82 ? 3313 HOH A O     1 
HETATM 5586 O  O     . HOH M 7 .   ? 1.614   16.965 4.402   1.00 25.13 ? 3319 HOH A O     1 
HETATM 5587 O  O     . HOH M 7 .   ? 48.585  29.642 55.391  1.00 22.62 ? 3321 HOH A O     1 
HETATM 5588 O  O     . HOH M 7 .   ? 9.231   46.039 42.946  1.00 32.67 ? 3324 HOH A O     1 
HETATM 5589 O  O     . HOH M 7 .   ? -11.427 48.765 45.862  1.00 41.85 ? 3326 HOH A O     1 
HETATM 5590 O  O     . HOH M 7 .   ? 17.526  43.073 56.306  1.00 45.57 ? 3332 HOH A O     1 
HETATM 5591 O  O     . HOH M 7 .   ? 42.921  39.794 34.715  1.00 41.00 ? 3334 HOH A O     1 
HETATM 5592 O  O     . HOH M 7 .   ? 35.882  37.738 26.381  1.00 31.14 ? 3336 HOH A O     1 
HETATM 5593 O  O     . HOH M 7 .   ? 3.628   34.933 -11.207 1.00 40.30 ? 3338 HOH A O     1 
HETATM 5594 O  O     . HOH M 7 .   ? 6.828   52.989 10.390  1.00 36.61 ? 3339 HOH A O     1 
HETATM 5595 O  O     . HOH M 7 .   ? 24.972  33.998 1.343   1.00 39.79 ? 3341 HOH A O     1 
HETATM 5596 O  O     . HOH M 7 .   ? -6.731  37.070 52.703  1.00 28.27 ? 3345 HOH A O     1 
HETATM 5597 O  O     . HOH M 7 .   ? 5.011   42.157 5.044   1.00 21.42 ? 3347 HOH A O     1 
HETATM 5598 O  O     . HOH M 7 .   ? 11.121  42.377 5.195   1.00 33.17 ? 3357 HOH A O     1 
HETATM 5599 O  O     . HOH M 7 .   ? 5.340   22.838 -11.677 1.00 32.89 ? 3362 HOH A O     1 
HETATM 5600 O  O     . HOH M 7 .   ? -1.814  32.444 -6.361  1.00 32.41 ? 3363 HOH A O     1 
HETATM 5601 O  O     . HOH M 7 .   ? -5.521  30.533 4.350   1.00 45.79 ? 3368 HOH A O     1 
HETATM 5602 O  O     . HOH M 7 .   ? 25.935  60.208 20.162  1.00 40.60 ? 3377 HOH A O     1 
HETATM 5603 O  O     . HOH M 7 .   ? 7.898   5.329  16.941  1.00 29.34 ? 3380 HOH A O     1 
HETATM 5604 O  O     . HOH M 7 .   ? -6.506  41.165 23.178  1.00 50.25 ? 3381 HOH A O     1 
HETATM 5605 O  O     . HOH M 7 .   ? 0.605   53.544 58.433  1.00 35.75 ? 3383 HOH A O     1 
HETATM 5606 O  O     . HOH M 7 .   ? 14.705  74.298 22.450  1.00 53.91 ? 3386 HOH A O     1 
HETATM 5607 O  O     . HOH M 7 .   ? 9.602   24.934 34.309  1.00 30.46 ? 3392 HOH A O     1 
HETATM 5608 O  O     . HOH M 7 .   ? 0.984   18.597 32.582  1.00 26.49 ? 3394 HOH A O     1 
HETATM 5609 O  O     . HOH M 7 .   ? -12.123 25.465 28.478  1.00 50.06 ? 3401 HOH A O     1 
HETATM 5610 O  O     . HOH M 7 .   ? -4.117  26.998 47.900  1.00 23.09 ? 3410 HOH A O     1 
HETATM 5611 O  O     . HOH M 7 .   ? 20.538  44.507 17.966  1.00 11.13 ? 3411 HOH A O     1 
HETATM 5612 O  O     . HOH M 7 .   ? 12.946  27.471 10.321  1.00 31.68 ? 3413 HOH A O     1 
HETATM 5613 O  O     . HOH M 7 .   ? 7.761   45.352 37.422  1.00 21.92 ? 3414 HOH A O     1 
HETATM 5614 O  O     . HOH M 7 .   ? 8.617   51.747 12.991  1.00 27.79 ? 3415 HOH A O     1 
HETATM 5615 O  O     . HOH M 7 .   ? 15.851  50.799 10.406  1.00 35.66 ? 3416 HOH A O     1 
HETATM 5616 O  O     . HOH M 7 .   ? 7.577   25.715 32.346  1.00 21.37 ? 3417 HOH A O     1 
HETATM 5617 O  O     . HOH M 7 .   ? 7.885   40.369 26.673  1.00 28.93 ? 3418 HOH A O     1 
HETATM 5618 O  O     . HOH M 7 .   ? 3.821   38.091 7.282   1.00 25.49 ? 3420 HOH A O     1 
HETATM 5619 O  O     . HOH M 7 .   ? -9.045  50.036 46.284  1.00 35.39 ? 3421 HOH A O     1 
HETATM 5620 O  O     . HOH M 7 .   ? 13.841  51.376 61.704  1.00 32.79 ? 3422 HOH A O     1 
HETATM 5621 O  O     . HOH M 7 .   ? 2.138   66.092 26.666  1.00 30.76 ? 3423 HOH A O     1 
HETATM 5622 O  O     . HOH M 7 .   ? -4.468  51.816 30.947  1.00 38.54 ? 3424 HOH A O     1 
HETATM 5623 O  O     . HOH M 7 .   ? -4.249  24.386 46.874  1.00 29.44 ? 3425 HOH A O     1 
HETATM 5624 O  O     . HOH M 7 .   ? 7.815   42.903 32.885  1.00 23.04 ? 3426 HOH A O     1 
HETATM 5625 O  O     . HOH M 7 .   ? 39.024  28.376 56.986  1.00 23.43 ? 3427 HOH A O     1 
HETATM 5626 O  O     . HOH M 7 .   ? -8.558  31.799 49.588  1.00 40.65 ? 3428 HOH A O     1 
HETATM 5627 O  O     . HOH M 7 .   ? -4.223  15.235 24.923  1.00 33.89 ? 3429 HOH A O     1 
HETATM 5628 O  O     . HOH M 7 .   ? -2.874  54.548 50.698  1.00 40.77 ? 3430 HOH A O     1 
HETATM 5629 O  O     . HOH M 7 .   ? -7.384  22.778 43.605  1.00 31.09 ? 3431 HOH A O     1 
HETATM 5630 O  O     . HOH M 7 .   ? 48.223  39.606 53.766  1.00 34.63 ? 3432 HOH A O     1 
HETATM 5631 O  O     . HOH M 7 .   ? -3.097  27.800 -7.672  1.00 39.18 ? 3435 HOH A O     1 
HETATM 5632 O  O     . HOH M 7 .   ? 2.548   62.278 17.236  1.00 34.14 ? 3436 HOH A O     1 
HETATM 5633 O  O     . HOH M 7 .   ? 9.426   42.498 40.301  1.00 39.33 ? 3437 HOH A O     1 
HETATM 5634 O  O     . HOH M 7 .   ? 0.188   17.012 0.066   1.00 42.74 ? 3438 HOH A O     1 
HETATM 5635 O  O     . HOH M 7 .   ? 7.947   38.680 9.376   1.00 25.24 ? 3439 HOH A O     1 
HETATM 5636 O  O     . HOH M 7 .   ? 20.428  51.138 8.363   1.00 52.12 ? 3440 HOH A O     1 
HETATM 5637 O  O     . HOH M 7 .   ? 32.735  29.751 51.689  1.00 27.57 ? 3441 HOH A O     1 
HETATM 5638 O  O     . HOH M 7 .   ? 12.381  27.371 20.765  1.00 27.06 ? 3442 HOH A O     1 
HETATM 5639 O  O     . HOH M 7 .   ? 3.022   22.610 51.195  1.00 20.54 ? 3444 HOH A O     1 
HETATM 5640 O  O     . HOH M 7 .   ? 3.771   63.221 13.744  1.00 42.04 ? 3446 HOH A O     1 
HETATM 5641 O  O     . HOH M 7 .   ? 19.078  48.250 8.160   1.00 36.30 ? 3447 HOH A O     1 
HETATM 5642 O  O     . HOH M 7 .   ? 8.840   38.196 37.756  1.00 30.33 ? 3448 HOH A O     1 
HETATM 5643 O  O     . HOH M 7 .   ? 10.960  42.230 -1.887  1.00 34.13 ? 3449 HOH A O     1 
HETATM 5644 O  O     . HOH M 7 .   ? -3.401  31.154 11.072  1.00 25.47 ? 3450 HOH A O     1 
HETATM 5645 O  O     . HOH M 7 .   ? -11.929 47.463 41.267  1.00 48.75 ? 3451 HOH A O     1 
HETATM 5646 O  O     . HOH M 7 .   ? 9.821   2.412  0.589   1.00 38.86 ? 3452 HOH A O     1 
HETATM 5647 O  O     . HOH M 7 .   ? -7.839  35.663 43.763  1.00 28.85 ? 3453 HOH A O     1 
HETATM 5648 O  O     . HOH M 7 .   ? 31.870  42.572 42.695  1.00 29.06 ? 3454 HOH A O     1 
HETATM 5649 O  O     . HOH M 7 .   ? 5.521   13.086 50.977  1.00 37.51 ? 3455 HOH A O     1 
HETATM 5650 O  O     . HOH M 7 .   ? 11.450  21.482 40.420  1.00 40.62 ? 3456 HOH A O     1 
HETATM 5651 O  O     . HOH M 7 .   ? 20.441  16.597 -6.775  1.00 46.99 ? 3457 HOH A O     1 
HETATM 5652 O  O     . HOH M 7 .   ? -1.184  14.124 13.633  1.00 32.59 ? 3458 HOH A O     1 
HETATM 5653 O  O     . HOH M 7 .   ? -3.520  40.435 5.562   1.00 51.41 ? 3459 HOH A O     1 
HETATM 5654 O  O     . HOH M 7 .   ? 16.076  56.479 62.591  1.00 34.66 ? 3460 HOH A O     1 
HETATM 5655 O  O     . HOH M 7 .   ? 2.234   46.311 6.562   1.00 52.90 ? 3461 HOH A O     1 
HETATM 5656 O  O     . HOH M 7 .   ? -1.952  59.371 50.066  1.00 37.77 ? 3462 HOH A O     1 
HETATM 5657 O  O     . HOH M 7 .   ? 6.278   58.206 49.811  1.00 31.61 ? 3465 HOH A O     1 
HETATM 5658 O  O     . HOH M 7 .   ? 2.940   37.382 9.976   1.00 28.15 ? 3466 HOH A O     1 
HETATM 5659 O  O     . HOH M 7 .   ? -7.306  32.477 36.624  1.00 39.15 ? 3467 HOH A O     1 
HETATM 5660 O  O     . HOH M 7 .   ? 38.921  43.117 22.271  1.00 36.08 ? 3468 HOH A O     1 
HETATM 5661 O  O     . HOH M 7 .   ? 23.061  47.186 8.325   1.00 29.44 ? 3469 HOH A O     1 
HETATM 5662 O  O     . HOH M 7 .   ? 9.302   42.920 9.367   1.00 34.88 ? 3470 HOH A O     1 
HETATM 5663 O  O     . HOH M 7 .   ? 4.758   41.455 -4.265  1.00 35.93 ? 3471 HOH A O     1 
HETATM 5664 O  O     . HOH M 7 .   ? 2.234   48.517 11.981  1.00 22.00 ? 3472 HOH A O     1 
HETATM 5665 O  O     . HOH M 7 .   ? 13.967  40.243 47.706  1.00 31.41 ? 3473 HOH A O     1 
HETATM 5666 O  O     . HOH M 7 .   ? 2.251   35.744 -6.880  1.00 28.02 ? 3474 HOH A O     1 
HETATM 5667 O  O     . HOH M 7 .   ? -7.203  20.273 24.229  1.00 33.65 ? 3475 HOH A O     1 
HETATM 5668 O  O     . HOH M 7 .   ? -6.798  47.737 20.936  1.00 48.83 ? 3477 HOH A O     1 
HETATM 5669 O  O     . HOH M 7 .   ? -11.372 44.196 34.381  1.00 51.26 ? 3478 HOH A O     1 
HETATM 5670 O  O     . HOH M 7 .   ? -3.772  36.312 -3.887  1.00 36.07 ? 3479 HOH A O     1 
HETATM 5671 O  O     . HOH M 7 .   ? 27.723  29.923 46.118  1.00 39.43 ? 3480 HOH A O     1 
HETATM 5672 O  O     . HOH M 7 .   ? 13.278  29.727 48.024  1.00 59.19 ? 3481 HOH A O     1 
HETATM 5673 O  O     . HOH M 7 .   ? 34.988  27.912 58.844  1.00 26.01 ? 3482 HOH A O     1 
HETATM 5674 O  O     . HOH M 7 .   ? 5.112   43.667 -0.111  1.00 35.57 ? 3483 HOH A O     1 
HETATM 5675 O  O     . HOH M 7 .   ? -1.498  46.767 14.255  1.00 39.71 ? 3484 HOH A O     1 
HETATM 5676 O  O     . HOH M 7 .   ? 0.666   61.717 20.843  1.00 34.75 ? 3485 HOH A O     1 
HETATM 5677 O  O     . HOH M 7 .   ? 11.832  15.300 17.941  1.00 27.73 ? 3487 HOH A O     1 
HETATM 5678 O  O     . HOH M 7 .   ? 40.137  36.470 32.274  1.00 37.76 ? 3488 HOH A O     1 
HETATM 5679 O  O     . HOH M 7 .   ? 28.054  31.213 6.508   1.00 35.71 ? 3489 HOH A O     1 
HETATM 5680 O  O     . HOH M 7 .   ? 7.565   31.581 37.315  1.00 27.74 ? 3490 HOH A O     1 
HETATM 5681 O  O     . HOH M 7 .   ? 34.671  38.070 16.085  1.00 48.41 ? 3491 HOH A O     1 
HETATM 5682 O  O     . HOH M 7 .   ? -1.073  18.638 36.723  1.00 31.29 ? 3492 HOH A O     1 
HETATM 5683 O  O     . HOH M 7 .   ? 1.447   42.757 -0.406  1.00 25.77 ? 3493 HOH A O     1 
HETATM 5684 O  O     . HOH M 7 .   ? 3.588   15.683 40.515  1.00 24.13 ? 3494 HOH A O     1 
HETATM 5685 O  O     . HOH M 7 .   ? 4.301   10.878 41.095  1.00 32.45 ? 3495 HOH A O     1 
HETATM 5686 O  O     . HOH M 7 .   ? -8.091  28.648 47.723  1.00 34.75 ? 3496 HOH A O     1 
HETATM 5687 O  O     . HOH M 7 .   ? -2.885  49.011 17.166  1.00 44.06 ? 3497 HOH A O     1 
HETATM 5688 O  O     . HOH M 7 .   ? 23.049  62.240 30.883  1.00 39.55 ? 3498 HOH A O     1 
HETATM 5689 O  O     . HOH M 7 .   ? 42.961  47.399 49.366  1.00 35.44 ? 3499 HOH A O     1 
HETATM 5690 O  O     . HOH M 7 .   ? 45.186  28.345 45.351  1.00 30.28 ? 3500 HOH A O     1 
HETATM 5691 O  O     . HOH M 7 .   ? 34.281  53.227 14.770  1.00 41.67 ? 3501 HOH A O     1 
HETATM 5692 O  O     . HOH M 7 .   ? 8.400   41.394 5.973   1.00 40.45 ? 3502 HOH A O     1 
HETATM 5693 O  O     . HOH M 7 .   ? -3.021  51.920 11.420  1.00 43.02 ? 3503 HOH A O     1 
HETATM 5694 O  O     . HOH M 7 .   ? -3.110  45.260 16.352  1.00 42.07 ? 3504 HOH A O     1 
HETATM 5695 O  O     . HOH M 7 .   ? -1.976  14.741 19.609  1.00 27.46 ? 3505 HOH A O     1 
HETATM 5696 O  O     . HOH M 7 .   ? 3.393   59.123 31.805  1.00 31.90 ? 3506 HOH A O     1 
HETATM 5697 O  O     . HOH M 7 .   ? 1.605   59.062 56.797  1.00 29.48 ? 3507 HOH A O     1 
HETATM 5698 O  O     . HOH M 7 .   ? -7.230  38.442 35.489  1.00 36.44 ? 3508 HOH A O     1 
HETATM 5699 O  O     . HOH M 7 .   ? 13.836  10.677 6.318   1.00 34.30 ? 3509 HOH A O     1 
HETATM 5700 O  O     . HOH M 7 .   ? 13.351  48.935 33.190  1.00 31.56 ? 3510 HOH A O     1 
HETATM 5701 O  O     . HOH M 7 .   ? -4.223  23.445 4.043   1.00 50.77 ? 3513 HOH A O     1 
HETATM 5702 O  O     . HOH M 7 .   ? 48.710  47.230 42.862  1.00 24.45 ? 3514 HOH A O     1 
HETATM 5703 O  O     . HOH M 7 .   ? 38.522  44.264 55.861  1.00 37.59 ? 3515 HOH A O     1 
HETATM 5704 O  O     . HOH M 7 .   ? 14.589  40.293 42.571  1.00 54.89 ? 3516 HOH A O     1 
HETATM 5705 O  O     . HOH M 7 .   ? 31.517  40.121 63.452  1.00 37.17 ? 3517 HOH A O     1 
HETATM 5706 O  O     . HOH M 7 .   ? -10.121 27.644 27.422  1.00 39.17 ? 3518 HOH A O     1 
HETATM 5707 O  O     . HOH M 7 .   ? 15.634  38.904 -7.561  1.00 42.96 ? 3520 HOH A O     1 
HETATM 5708 O  O     . HOH M 7 .   ? 37.453  51.258 39.667  1.00 45.83 ? 3521 HOH A O     1 
HETATM 5709 O  O     . HOH M 7 .   ? -0.183  60.023 28.035  1.00 32.05 ? 3522 HOH A O     1 
HETATM 5710 O  O     . HOH M 7 .   ? 24.912  18.390 -3.339  1.00 41.63 ? 3523 HOH A O     1 
HETATM 5711 O  O     . HOH M 7 .   ? 45.737  49.352 29.408  1.00 31.15 ? 3524 HOH A O     1 
HETATM 5712 O  O     . HOH M 7 .   ? 22.230  29.090 22.374  1.00 52.39 ? 3525 HOH A O     1 
HETATM 5713 O  O     . HOH M 7 .   ? 20.318  22.103 13.580  1.00 33.38 ? 3527 HOH A O     1 
HETATM 5714 O  O     . HOH M 7 .   ? -3.511  30.139 8.510   1.00 31.82 ? 3528 HOH A O     1 
HETATM 5715 O  O     . HOH M 7 .   ? 0.076   60.459 46.426  1.00 31.02 ? 3529 HOH A O     1 
HETATM 5716 O  O     . HOH M 7 .   ? 2.728   46.327 10.223  1.00 40.18 ? 3530 HOH A O     1 
HETATM 5717 O  O     . HOH M 7 .   ? 40.755  50.374 50.109  1.00 38.03 ? 3531 HOH A O     1 
HETATM 5718 O  O     . HOH M 7 .   ? 9.910   40.621 -8.146  1.00 25.23 ? 3532 HOH A O     1 
HETATM 5719 O  O     . HOH M 7 .   ? 5.577   23.639 32.250  1.00 25.35 ? 3533 HOH A O     1 
HETATM 5720 O  O     . HOH M 7 .   ? 2.407   13.311 40.692  1.00 32.80 ? 3534 HOH A O     1 
HETATM 5721 O  O     . HOH M 7 .   ? 14.884  51.258 49.584  1.00 26.08 ? 3535 HOH A O     1 
HETATM 5722 O  O     . HOH M 7 .   ? 7.346   20.978 35.123  1.00 27.13 ? 3536 HOH A O     1 
HETATM 5723 O  O     . HOH M 7 .   ? -2.748  19.560 38.546  1.00 25.73 ? 3537 HOH A O     1 
HETATM 5724 O  O     . HOH M 7 .   ? 8.993   26.534 22.063  1.00 26.99 ? 3538 HOH A O     1 
HETATM 5725 O  O     . HOH M 7 .   ? -2.648  16.378 44.052  1.00 29.59 ? 3539 HOH A O     1 
HETATM 5726 O  O     . HOH M 7 .   ? 0.843   31.255 -0.745  1.00 27.89 ? 3540 HOH A O     1 
HETATM 5727 O  O     . HOH M 7 .   ? 5.881   10.441 50.974  1.00 44.05 ? 3541 HOH A O     1 
HETATM 5728 O  O     . HOH M 7 .   ? -0.838  43.826 13.799  1.00 29.61 ? 3542 HOH A O     1 
HETATM 5729 O  O     . HOH M 7 .   ? 4.968   49.093 11.025  1.00 28.05 ? 3543 HOH A O     1 
HETATM 5730 O  O     . HOH M 7 .   ? 7.522   14.851 42.021  1.00 37.34 ? 3544 HOH A O     1 
HETATM 5731 O  O     . HOH M 7 .   ? 8.211   17.001 21.005  1.00 24.68 ? 3545 HOH A O     1 
HETATM 5732 O  O     . HOH M 7 .   ? 4.380   56.100 49.832  1.00 30.98 ? 3546 HOH A O     1 
HETATM 5733 O  O     . HOH M 7 .   ? 13.144  54.746 30.648  1.00 26.77 ? 3548 HOH A O     1 
HETATM 5734 O  O     . HOH M 7 .   ? -0.352  29.504 48.084  1.00 31.24 ? 3550 HOH A O     1 
HETATM 5735 O  O     . HOH M 7 .   ? 2.931   41.505 10.187  1.00 39.13 ? 3551 HOH A O     1 
HETATM 5736 O  O     . HOH M 7 .   ? 22.415  63.402 17.798  1.00 31.95 ? 3552 HOH A O     1 
HETATM 5737 O  O     . HOH M 7 .   ? -2.064  47.629 11.759  1.00 33.24 ? 3554 HOH A O     1 
HETATM 5738 O  O     . HOH M 7 .   ? -5.337  49.747 23.216  1.00 33.78 ? 3555 HOH A O     1 
HETATM 5739 O  O     . HOH M 7 .   ? 10.268  50.350 11.045  1.00 34.91 ? 3556 HOH A O     1 
HETATM 5740 O  O     . HOH M 7 .   ? 12.637  24.688 10.326  1.00 27.56 ? 3557 HOH A O     1 
HETATM 5741 O  O     . HOH M 7 .   ? 30.886  35.557 20.595  1.00 27.52 ? 3558 HOH A O     1 
HETATM 5742 O  O     . HOH M 7 .   ? 0.582   16.779 37.776  1.00 30.73 ? 3559 HOH A O     1 
HETATM 5743 O  O     . HOH M 7 .   ? 4.521   58.463 47.723  1.00 35.73 ? 3560 HOH A O     1 
HETATM 5744 O  O     . HOH M 7 .   ? 50.246  47.552 40.386  1.00 34.27 ? 3563 HOH A O     1 
HETATM 5745 O  O     . HOH M 7 .   ? 11.677  24.756 46.480  1.00 34.95 ? 3564 HOH A O     1 
HETATM 5746 O  O     . HOH M 7 .   ? -1.787  18.628 -0.896  1.00 43.07 ? 3565 HOH A O     1 
HETATM 5747 O  O     . HOH M 7 .   ? 0.218   49.336 10.782  1.00 29.66 ? 3566 HOH A O     1 
HETATM 5748 O  O     . HOH M 7 .   ? 13.229  53.624 66.267  1.00 40.52 ? 3567 HOH A O     1 
HETATM 5749 O  O     . HOH M 7 .   ? -0.929  62.533 29.384  1.00 35.20 ? 3568 HOH A O     1 
HETATM 5750 O  O     . HOH M 7 .   ? 16.924  26.634 20.744  1.00 32.93 ? 3569 HOH A O     1 
HETATM 5751 O  O     . HOH M 7 .   ? 12.743  26.183 23.455  1.00 29.92 ? 3570 HOH A O     1 
HETATM 5752 O  O     . HOH M 7 .   ? -6.211  41.782 56.630  1.00 42.66 ? 3571 HOH A O     1 
HETATM 5753 O  O     . HOH M 7 .   ? 25.934  57.239 13.928  1.00 41.82 ? 3572 HOH A O     1 
HETATM 5754 O  O     . HOH M 7 .   ? -3.312  52.557 15.445  1.00 35.49 ? 3573 HOH A O     1 
HETATM 5755 O  O     . HOH M 7 .   ? 14.912  57.035 8.590   1.00 40.12 ? 3574 HOH A O     1 
HETATM 5756 O  O     . HOH M 7 .   ? -10.026 26.304 40.112  1.00 38.30 ? 3575 HOH A O     1 
HETATM 5757 O  O     . HOH M 7 .   ? 2.103   16.799 25.791  1.00 37.38 ? 3576 HOH A O     1 
HETATM 5758 O  O     . HOH M 7 .   ? 11.420  18.559 50.034  1.00 32.54 ? 3578 HOH A O     1 
HETATM 5759 O  O     . HOH M 7 .   ? 25.150  17.227 7.726   1.00 34.73 ? 3579 HOH A O     1 
HETATM 5760 O  O     . HOH M 7 .   ? -12.931 25.276 20.144  1.00 42.03 ? 3580 HOH A O     1 
HETATM 5761 O  O     . HOH M 7 .   ? 14.639  30.777 61.188  1.00 44.45 ? 3581 HOH A O     1 
HETATM 5762 O  O     . HOH M 7 .   ? 7.568   56.402 38.349  1.00 38.32 ? 3582 HOH A O     1 
HETATM 5763 O  O     . HOH M 7 .   ? 40.690  43.587 57.116  1.00 41.49 ? 3583 HOH A O     1 
HETATM 5764 O  O     . HOH M 7 .   ? -8.639  38.638 38.577  1.00 35.12 ? 3584 HOH A O     1 
HETATM 5765 O  O     . HOH M 7 .   ? 20.753  62.125 9.799   1.00 39.01 ? 3585 HOH A O     1 
HETATM 5766 O  O     . HOH M 7 .   ? 28.457  59.452 21.306  1.00 32.56 ? 3586 HOH A O     1 
HETATM 5767 O  O     . HOH M 7 .   ? 23.980  53.460 38.562  1.00 41.06 ? 3587 HOH A O     1 
HETATM 5768 O  O     . HOH M 7 .   ? -1.347  36.951 7.167   1.00 38.51 ? 3588 HOH A O     1 
HETATM 5769 O  O     . HOH M 7 .   ? 22.321  14.059 6.880   1.00 33.84 ? 3589 HOH A O     1 
HETATM 5770 O  O     . HOH M 7 .   ? -5.678  26.503 8.245   1.00 33.61 ? 3590 HOH A O     1 
HETATM 5771 O  O     . HOH M 7 .   ? -5.049  39.255 2.671   1.00 38.64 ? 3591 HOH A O     1 
HETATM 5772 O  O     . HOH M 7 .   ? -8.682  40.720 34.356  1.00 37.36 ? 3592 HOH A O     1 
HETATM 5773 O  O     . HOH M 7 .   ? -3.970  14.776 22.417  1.00 39.27 ? 3593 HOH A O     1 
HETATM 5774 O  O     . HOH M 7 .   ? 17.128  11.749 1.772   1.00 31.22 ? 3594 HOH A O     1 
HETATM 5775 O  O     . HOH M 7 .   ? -6.724  49.929 26.619  1.00 33.19 ? 3596 HOH A O     1 
HETATM 5776 O  O     . HOH M 7 .   ? 20.425  53.506 52.775  1.00 33.31 ? 3597 HOH A O     1 
HETATM 5777 O  O     . HOH M 7 .   ? -10.776 54.864 42.715  1.00 31.57 ? 3598 HOH A O     1 
HETATM 5778 O  O     . HOH M 7 .   ? 10.951  62.622 31.983  1.00 36.11 ? 3599 HOH A O     1 
HETATM 5779 O  O     . HOH M 7 .   ? 24.613  57.702 35.544  1.00 33.98 ? 3600 HOH A O     1 
HETATM 5780 O  O     . HOH M 7 .   ? 4.181   63.206 11.095  1.00 34.47 ? 3602 HOH A O     1 
HETATM 5781 O  O     . HOH M 7 .   ? 39.154  25.281 46.781  1.00 35.62 ? 3603 HOH A O     1 
HETATM 5782 O  O     . HOH M 7 .   ? 27.078  16.487 10.082  1.00 39.97 ? 3604 HOH A O     1 
HETATM 5783 O  O     . HOH M 7 .   ? 39.866  53.877 21.304  1.00 37.03 ? 3605 HOH A O     1 
HETATM 5784 O  O     . HOH M 7 .   ? -6.916  34.309 38.317  1.00 30.07 ? 3606 HOH A O     1 
HETATM 5785 O  O     . HOH M 7 .   ? 15.948  42.156 46.993  1.00 42.49 ? 3607 HOH A O     1 
HETATM 5786 O  O     . HOH M 7 .   ? 39.655  45.061 26.409  1.00 35.31 ? 3608 HOH A O     1 
HETATM 5787 O  O     . HOH M 7 .   ? 1.801   44.627 13.637  1.00 31.69 ? 3609 HOH A O     1 
HETATM 5788 O  O     . HOH M 7 .   ? 4.021   27.476 -15.274 1.00 40.43 ? 3610 HOH A O     1 
HETATM 5789 O  O     . HOH M 7 .   ? -2.329  30.430 52.944  1.00 47.52 ? 3611 HOH A O     1 
HETATM 5790 O  O     . HOH M 7 .   ? 18.103  26.311 11.578  1.00 34.06 ? 3612 HOH A O     1 
HETATM 5791 O  O     . HOH M 7 .   ? 8.514   41.036 34.258  1.00 40.61 ? 3613 HOH A O     1 
HETATM 5792 O  O     . HOH M 7 .   ? 18.686  22.420 15.606  1.00 32.07 ? 3616 HOH A O     1 
HETATM 5793 O  O     . HOH M 7 .   ? 8.947   57.896 49.499  1.00 36.66 ? 3617 HOH A O     1 
HETATM 5794 O  O     . HOH M 7 .   ? 36.913  41.543 18.942  1.00 35.80 ? 3618 HOH A O     1 
HETATM 5795 O  O     . HOH M 7 .   ? -13.176 51.239 41.612  1.00 50.38 ? 3619 HOH A O     1 
HETATM 5796 O  O     . HOH M 7 .   ? -8.941  37.650 41.852  1.00 42.03 ? 3620 HOH A O     1 
HETATM 5797 O  O     . HOH M 7 .   ? 24.641  39.239 14.854  1.00 35.57 ? 3621 HOH A O     1 
HETATM 5798 O  O     . HOH M 7 .   ? 10.390  26.955 24.938  1.00 36.73 ? 3622 HOH A O     1 
HETATM 5799 O  O     . HOH M 7 .   ? -9.248  19.118 16.674  1.00 37.93 ? 3623 HOH A O     1 
HETATM 5800 O  O     . HOH M 7 .   ? 22.091  43.992 41.888  1.00 39.61 ? 3624 HOH A O     1 
HETATM 5801 O  O     . HOH M 7 .   ? 36.209  27.290 46.128  1.00 34.99 ? 3626 HOH A O     1 
HETATM 5802 O  O     . HOH M 7 .   ? -12.731 48.417 38.991  1.00 41.82 ? 3627 HOH A O     1 
HETATM 5803 O  O     . HOH M 7 .   ? -6.481  23.424 46.146  1.00 34.44 ? 3628 HOH A O     1 
HETATM 5804 O  O     . HOH M 7 .   ? -7.497  18.805 13.260  1.00 43.28 ? 3629 HOH A O     1 
HETATM 5805 O  O     . HOH M 7 .   ? 50.140  45.678 44.448  1.00 40.75 ? 3630 HOH A O     1 
HETATM 5806 O  O     . HOH M 7 .   ? 46.550  38.840 33.744  1.00 43.51 ? 3631 HOH A O     1 
HETATM 5807 O  O     . HOH M 7 .   ? -4.858  25.015 -0.362  1.00 35.20 ? 3632 HOH A O     1 
HETATM 5808 O  O     . HOH M 7 .   ? -4.546  38.420 55.344  1.00 32.71 ? 3633 HOH A O     1 
HETATM 5809 O  O     . HOH M 7 .   ? 44.294  22.254 49.280  1.00 34.18 ? 3634 HOH A O     1 
HETATM 5810 O  O     . HOH M 7 .   ? 11.941  13.391 -5.264  1.00 47.20 ? 3635 HOH A O     1 
HETATM 5811 O  O     . HOH M 7 .   ? 34.680  45.375 17.047  1.00 34.14 ? 3636 HOH A O     1 
HETATM 5812 O  O     . HOH M 7 .   ? 18.216  34.297 20.707  1.00 31.79 ? 3637 HOH A O     1 
HETATM 5813 O  O     . HOH M 7 .   ? 13.140  55.898 53.131  1.00 36.71 ? 3639 HOH A O     1 
HETATM 5814 O  O     . HOH M 7 .   ? 44.378  49.303 47.986  1.00 39.59 ? 3640 HOH A O     1 
HETATM 5815 O  O     . HOH M 7 .   ? 4.768   16.152 -5.069  1.00 42.55 ? 3641 HOH A O     1 
HETATM 5816 O  O     . HOH M 7 .   ? 17.780  42.010 49.265  1.00 37.50 ? 3642 HOH A O     1 
HETATM 5817 O  O     . HOH M 7 .   ? 16.734  51.003 32.540  1.00 38.00 ? 3643 HOH A O     1 
HETATM 5818 O  O     . HOH M 7 .   ? 36.982  38.570 37.130  1.00 33.07 ? 3644 HOH A O     1 
HETATM 5819 O  O     . HOH M 7 .   ? 34.056  45.814 14.541  1.00 35.22 ? 3645 HOH A O     1 
HETATM 5820 O  O     . HOH M 7 .   ? 14.913  18.300 19.544  1.00 41.58 ? 3647 HOH A O     1 
HETATM 5821 O  O     . HOH M 7 .   ? 34.959  46.302 46.337  1.00 41.75 ? 3648 HOH A O     1 
HETATM 5822 O  O     . HOH M 7 .   ? 49.709  45.401 36.750  1.00 46.09 ? 3649 HOH A O     1 
HETATM 5823 O  O     . HOH M 7 .   ? -5.879  31.502 12.003  1.00 35.49 ? 3651 HOH A O     1 
HETATM 5824 O  O     . HOH M 7 .   ? 6.419   12.446 42.023  1.00 37.34 ? 3652 HOH A O     1 
HETATM 5825 O  O     . HOH M 7 .   ? 33.495  58.850 22.070  1.00 43.37 ? 3653 HOH A O     1 
HETATM 5826 O  O     . HOH M 7 .   ? -7.364  29.126 28.716  1.00 42.30 ? 3654 HOH A O     1 
HETATM 5827 O  O     . HOH M 7 .   ? -0.408  48.894 59.181  1.00 47.90 ? 3655 HOH A O     1 
HETATM 5828 O  O     . HOH M 7 .   ? 44.431  41.983 35.311  1.00 29.92 ? 3656 HOH A O     1 
HETATM 5829 O  O     . HOH M 7 .   ? 5.095   59.832 41.156  1.00 35.50 ? 3657 HOH A O     1 
HETATM 5830 O  O     . HOH M 7 .   ? 40.834  41.227 22.562  1.00 39.97 ? 3658 HOH A O     1 
HETATM 5831 O  O     . HOH M 7 .   ? 12.160  13.005 16.421  1.00 38.08 ? 3659 HOH A O     1 
HETATM 5832 O  O     . HOH M 7 .   ? 33.914  38.606 37.180  1.00 36.08 ? 3660 HOH A O     1 
HETATM 5833 O  O     . HOH M 7 .   ? 10.593  54.833 62.741  1.00 30.34 ? 3661 HOH A O     1 
HETATM 5834 O  O     . HOH M 7 .   ? 30.035  53.751 15.749  1.00 38.58 ? 3662 HOH A O     1 
HETATM 5835 O  O     . HOH M 7 .   ? -11.759 21.504 18.403  1.00 44.70 ? 3663 HOH A O     1 
HETATM 5836 O  O     . HOH M 7 .   ? 10.547  73.165 20.932  1.00 47.02 ? 3664 HOH A O     1 
HETATM 5837 O  O     . HOH M 7 .   ? -4.827  58.902 27.970  1.00 39.87 ? 3666 HOH A O     1 
HETATM 5838 O  O     . HOH M 7 .   ? 16.229  13.248 -2.175  1.00 40.66 ? 3667 HOH A O     1 
HETATM 5839 O  O     . HOH M 7 .   ? -5.909  46.371 53.111  1.00 42.89 ? 3668 HOH A O     1 
HETATM 5840 O  O     . HOH M 7 .   ? -4.264  49.715 13.167  1.00 46.13 ? 3669 HOH A O     1 
HETATM 5841 O  O     . HOH M 7 .   ? 46.294  24.455 52.067  1.00 39.58 ? 3670 HOH A O     1 
HETATM 5842 O  O     . HOH M 7 .   ? 11.051  48.542 7.496   1.00 40.33 ? 3671 HOH A O     1 
HETATM 5843 O  O     . HOH M 7 .   ? -0.653  36.786 57.314  1.00 44.77 ? 3672 HOH A O     1 
HETATM 5844 O  O     . HOH M 7 .   ? 22.725  32.124 20.542  1.00 46.49 ? 3673 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   22  22  DC  C   B . n 
A 1 2   DA  2   23  23  DA  A   B . n 
A 1 3   DT  3   24  24  DT  T   B . n 
A 1 4   6OG 4   25  25  6OG 6OG B . n 
A 1 5   DC  5   26  26  DC  C   B . n 
A 1 6   DG  6   27  27  DG  G   B . n 
A 1 7   DA  7   28  28  DA  A   B . n 
A 1 8   DG  8   29  29  DG  G   B . n 
A 1 9   DT  9   30  30  DT  T   B . n 
A 1 10  DC  10  31  31  DC  C   B . n 
A 1 11  DA  11  32  32  DA  A   B . n 
A 1 12  DG  12  33  33  DG  G   B . n 
A 1 13  DG  13  34  34  DG  G   B . n 
B 2 1   DG  1   3   3   DG  G   C . n 
B 2 2   DC  2   4   4   DC  C   C . n 
B 2 3   DC  3   5   5   DC  C   C . n 
B 2 4   DT  4   6   6   DT  T   C . n 
B 2 5   DG  5   7   7   DG  G   C . n 
B 2 6   DA  6   8   8   DA  A   C . n 
B 2 7   DC  7   9   9   DC  C   C . n 
B 2 8   DT  8   10  10  DT  T   C . n 
B 2 9   DC  9   11  11  DC  C   C . n 
B 2 10  DG  10  12  12  DG  G   C . n 
B 2 11  DT  11  13  13  DT  T   C . n 
B 2 12  DA  12  14  14  DA  A   C . n 
B 2 13  DT  13  15  15  DT  T   C . n 
B 2 14  DG  14  16  16  DG  G   C . n 
B 2 15  DA  15  17  17  DA  A   C . n 
C 3 1   LYS 1   297 297 LYS ALA A . n 
C 3 2   LYS 2   298 298 LYS ALA A . n 
C 3 3   MET 3   299 299 MET MET A . n 
C 3 4   ALA 4   300 300 ALA ALA A . n 
C 3 5   PHE 5   301 301 PHE PHE A . n 
C 3 6   THR 6   302 302 THR THR A . n 
C 3 7   LEU 7   303 303 LEU LEU A . n 
C 3 8   ALA 8   304 304 ALA ALA A . n 
C 3 9   ASP 9   305 305 ASP ASP A . n 
C 3 10  ARG 10  306 306 ARG ARG A . n 
C 3 11  VAL 11  307 307 VAL VAL A . n 
C 3 12  THR 12  308 308 THR THR A . n 
C 3 13  GLU 13  309 309 GLU GLU A . n 
C 3 14  GLU 14  310 310 GLU GLU A . n 
C 3 15  MET 15  311 311 MET MET A . n 
C 3 16  LEU 16  312 312 LEU LEU A . n 
C 3 17  ALA 17  313 313 ALA ALA A . n 
C 3 18  ASP 18  314 314 ASP ASP A . n 
C 3 19  LYS 19  315 315 LYS LYS A . n 
C 3 20  ALA 20  316 316 ALA ALA A . n 
C 3 21  ALA 21  317 317 ALA ALA A . n 
C 3 22  LEU 22  318 318 LEU LEU A . n 
C 3 23  VAL 23  319 319 VAL VAL A . n 
C 3 24  VAL 24  320 320 VAL VAL A . n 
C 3 25  GLU 25  321 321 GLU GLU A . n 
C 3 26  VAL 26  322 322 VAL VAL A . n 
C 3 27  VAL 27  323 323 VAL VAL A . n 
C 3 28  GLU 28  324 324 GLU GLU A . n 
C 3 29  GLU 29  325 325 GLU GLU A . n 
C 3 30  ASN 30  326 326 ASN ASN A . n 
C 3 31  TYR 31  327 327 TYR TYR A . n 
C 3 32  HIS 32  328 328 HIS HIS A . n 
C 3 33  ASP 33  329 329 ASP ASP A . n 
C 3 34  ALA 34  330 330 ALA ALA A . n 
C 3 35  PRO 35  331 331 PRO PRO A . n 
C 3 36  ILE 36  332 332 ILE ILE A . n 
C 3 37  VAL 37  333 333 VAL VAL A . n 
C 3 38  GLY 38  334 334 GLY GLY A . n 
C 3 39  ILE 39  335 335 ILE ILE A . n 
C 3 40  ALA 40  336 336 ALA ALA A . n 
C 3 41  VAL 41  337 337 VAL VAL A . n 
C 3 42  VAL 42  338 338 VAL VAL A . n 
C 3 43  ASN 43  339 339 ASN ASN A . n 
C 3 44  GLU 44  340 340 GLU GLU A . n 
C 3 45  HIS 45  341 341 HIS HIS A . n 
C 3 46  GLY 46  342 342 GLY GLY A . n 
C 3 47  ARG 47  343 343 ARG ARG A . n 
C 3 48  PHE 48  344 344 PHE PHE A . n 
C 3 49  PHE 49  345 345 PHE PHE A . n 
C 3 50  LEU 50  346 346 LEU LEU A . n 
C 3 51  ARG 51  347 347 ARG ARG A . n 
C 3 52  PRO 52  348 348 PRO PRO A . n 
C 3 53  GLU 53  349 349 GLU GLU A . n 
C 3 54  THR 54  350 350 THR THR A . n 
C 3 55  ALA 55  351 351 ALA ALA A . n 
C 3 56  LEU 56  352 352 LEU LEU A . n 
C 3 57  ALA 57  353 353 ALA ALA A . n 
C 3 58  ASP 58  354 354 ASP ASP A . n 
C 3 59  PRO 59  355 355 PRO PRO A . n 
C 3 60  GLN 60  356 356 GLN GLN A . n 
C 3 61  PHE 61  357 357 PHE PHE A . n 
C 3 62  VAL 62  358 358 VAL VAL A . n 
C 3 63  ALA 63  359 359 ALA ALA A . n 
C 3 64  TRP 64  360 360 TRP TRP A . n 
C 3 65  LEU 65  361 361 LEU LEU A . n 
C 3 66  GLY 66  362 362 GLY GLY A . n 
C 3 67  ASP 67  363 363 ASP ASP A . n 
C 3 68  GLU 68  364 364 GLU GLU A . n 
C 3 69  THR 69  365 365 THR THR A . n 
C 3 70  LYS 70  366 366 LYS LYS A . n 
C 3 71  LYS 71  367 367 LYS LYS A . n 
C 3 72  LYS 72  368 368 LYS LYS A . n 
C 3 73  SER 73  369 369 SER SER A . n 
C 3 74  MET 74  370 370 MET MET A . n 
C 3 75  PHE 75  371 371 PHE PHE A . n 
C 3 76  ASP 76  372 372 ASP ASP A . n 
C 3 77  SER 77  373 373 SER SER A . n 
C 3 78  LYS 78  374 374 LYS LYS A . n 
C 3 79  ARG 79  375 375 ARG ARG A . n 
C 3 80  ALA 80  376 376 ALA ALA A . n 
C 3 81  ALA 81  377 377 ALA ALA A . n 
C 3 82  VAL 82  378 378 VAL VAL A . n 
C 3 83  ALA 83  379 379 ALA ALA A . n 
C 3 84  LEU 84  380 380 LEU LEU A . n 
C 3 85  LYS 85  381 381 LYS LYS A . n 
C 3 86  TRP 86  382 382 TRP TRP A . n 
C 3 87  LYS 87  383 383 LYS LYS A . n 
C 3 88  GLY 88  384 384 GLY GLY A . n 
C 3 89  ILE 89  385 385 ILE ILE A . n 
C 3 90  GLU 90  386 386 GLU GLU A . n 
C 3 91  LEU 91  387 387 LEU LEU A . n 
C 3 92  CYS 92  388 388 CYS CYS A . n 
C 3 93  GLY 93  389 389 GLY GLY A . n 
C 3 94  VAL 94  390 390 VAL VAL A . n 
C 3 95  SER 95  391 391 SER SER A . n 
C 3 96  PHE 96  392 392 PHE PHE A . n 
C 3 97  ASP 97  393 393 ASP ASP A . n 
C 3 98  LEU 98  394 394 LEU LEU A . n 
C 3 99  LEU 99  395 395 LEU LEU A . n 
C 3 100 LEU 100 396 396 LEU LEU A . n 
C 3 101 ALA 101 397 397 ALA ALA A . n 
C 3 102 ALA 102 398 398 ALA ALA A . n 
C 3 103 TYR 103 399 399 TYR TYR A . n 
C 3 104 LEU 104 400 400 LEU LEU A . n 
C 3 105 LEU 105 401 401 LEU LEU A . n 
C 3 106 ASP 106 402 402 ASP ASP A . n 
C 3 107 PRO 107 403 403 PRO PRO A . n 
C 3 108 ALA 108 404 404 ALA ALA A . n 
C 3 109 GLN 109 405 405 GLN GLN A . n 
C 3 110 GLY 110 406 406 GLY GLY A . n 
C 3 111 VAL 111 407 407 VAL VAL A . n 
C 3 112 ASP 112 408 408 ASP ASP A . n 
C 3 113 ASP 113 409 409 ASP ASP A . n 
C 3 114 VAL 114 410 410 VAL VAL A . n 
C 3 115 ALA 115 411 411 ALA ALA A . n 
C 3 116 ALA 116 412 412 ALA ALA A . n 
C 3 117 ALA 117 413 413 ALA ALA A . n 
C 3 118 ALA 118 414 414 ALA ALA A . n 
C 3 119 LYS 119 415 415 LYS LYS A . n 
C 3 120 MET 120 416 416 MET MET A . n 
C 3 121 LYS 121 417 417 LYS LYS A . n 
C 3 122 GLN 122 418 418 GLN GLN A . n 
C 3 123 TYR 123 419 419 TYR TYR A . n 
C 3 124 GLU 124 420 420 GLU GLU A . n 
C 3 125 ALA 125 421 421 ALA ALA A . n 
C 3 126 VAL 126 422 422 VAL VAL A . n 
C 3 127 ARG 127 423 423 ARG ARG A . n 
C 3 128 PRO 128 424 424 PRO PRO A . n 
C 3 129 ASP 129 425 425 ASP ASP A . n 
C 3 130 GLU 130 426 426 GLU GLU A . n 
C 3 131 ALA 131 427 427 ALA ALA A . n 
C 3 132 VAL 132 428 428 VAL VAL A . n 
C 3 133 TYR 133 429 429 TYR TYR A . n 
C 3 134 GLY 134 430 430 GLY GLY A . n 
C 3 135 LYS 135 431 431 LYS LYS A . n 
C 3 136 GLY 136 432 432 GLY GLY A . n 
C 3 137 ALA 137 433 433 ALA ALA A . n 
C 3 138 LYS 138 434 434 LYS LYS A . n 
C 3 139 ARG 139 435 435 ARG ARG A . n 
C 3 140 ALA 140 436 436 ALA ALA A . n 
C 3 141 VAL 141 437 437 VAL VAL A . n 
C 3 142 PRO 142 438 438 PRO PRO A . n 
C 3 143 ASP 143 439 439 ASP ASP A . n 
C 3 144 GLU 144 440 440 GLU GLU A . n 
C 3 145 PRO 145 441 441 PRO PRO A . n 
C 3 146 VAL 146 442 442 VAL VAL A . n 
C 3 147 LEU 147 443 443 LEU LEU A . n 
C 3 148 ALA 148 444 444 ALA ALA A . n 
C 3 149 GLU 149 445 445 GLU GLU A . n 
C 3 150 HIS 150 446 446 HIS HIS A . n 
C 3 151 LEU 151 447 447 LEU LEU A . n 
C 3 152 VAL 152 448 448 VAL VAL A . n 
C 3 153 ARG 153 449 449 ARG ARG A . n 
C 3 154 LYS 154 450 450 LYS LYS A . n 
C 3 155 ALA 155 451 451 ALA ALA A . n 
C 3 156 ALA 156 452 452 ALA ALA A . n 
C 3 157 ALA 157 453 453 ALA ALA A . n 
C 3 158 ILE 158 454 454 ILE ILE A . n 
C 3 159 TRP 159 455 455 TRP TRP A . n 
C 3 160 GLU 160 456 456 GLU GLU A . n 
C 3 161 LEU 161 457 457 LEU LEU A . n 
C 3 162 GLU 162 458 458 GLU GLU A . n 
C 3 163 ARG 163 459 459 ARG ARG A . n 
C 3 164 PRO 164 460 460 PRO PRO A . n 
C 3 165 PHE 165 461 461 PHE PHE A . n 
C 3 166 LEU 166 462 462 LEU LEU A . n 
C 3 167 ASP 167 463 463 ASP ASP A . n 
C 3 168 GLU 168 464 464 GLU GLU A . n 
C 3 169 LEU 169 465 465 LEU LEU A . n 
C 3 170 ARG 170 466 466 ARG ARG A . n 
C 3 171 ARG 171 467 467 ARG ARG A . n 
C 3 172 ASN 172 468 468 ASN ASN A . n 
C 3 173 GLU 173 469 469 GLU GLU A . n 
C 3 174 GLN 174 470 470 GLN GLN A . n 
C 3 175 ASP 175 471 471 ASP ASP A . n 
C 3 176 ARG 176 472 472 ARG ARG A . n 
C 3 177 LEU 177 473 473 LEU LEU A . n 
C 3 178 LEU 178 474 474 LEU LEU A . n 
C 3 179 VAL 179 475 475 VAL VAL A . n 
C 3 180 GLU 180 476 476 GLU GLU A . n 
C 3 181 LEU 181 477 477 LEU LEU A . n 
C 3 182 GLU 182 478 478 GLU GLU A . n 
C 3 183 GLN 183 479 479 GLN GLN A . n 
C 3 184 PRO 184 480 480 PRO PRO A . n 
C 3 185 LEU 185 481 481 LEU LEU A . n 
C 3 186 SER 186 482 482 SER SER A . n 
C 3 187 SER 187 483 483 SER SER A . n 
C 3 188 ILE 188 484 484 ILE ILE A . n 
C 3 189 LEU 189 485 485 LEU LEU A . n 
C 3 190 ALA 190 486 486 ALA ALA A . n 
C 3 191 GLU 191 487 487 GLU GLU A . n 
C 3 192 MET 192 488 488 MET MET A . n 
C 3 193 GLU 193 489 489 GLU GLU A . n 
C 3 194 PHE 194 490 490 PHE PHE A . n 
C 3 195 ALA 195 491 491 ALA ALA A . n 
C 3 196 GLY 196 492 492 GLY GLY A . n 
C 3 197 VAL 197 493 493 VAL VAL A . n 
C 3 198 LYS 198 494 494 LYS LYS A . n 
C 3 199 VAL 199 495 495 VAL VAL A . n 
C 3 200 ASP 200 496 496 ASP ASP A . n 
C 3 201 THR 201 497 497 THR THR A . n 
C 3 202 LYS 202 498 498 LYS LYS A . n 
C 3 203 ARG 203 499 499 ARG ARG A . n 
C 3 204 LEU 204 500 500 LEU LEU A . n 
C 3 205 GLU 205 501 501 GLU GLU A . n 
C 3 206 GLN 206 502 502 GLN GLN A . n 
C 3 207 MET 207 503 503 MET MET A . n 
C 3 208 GLY 208 504 504 GLY GLY A . n 
C 3 209 LYS 209 505 505 LYS LYS A . n 
C 3 210 GLU 210 506 506 GLU GLU A . n 
C 3 211 LEU 211 507 507 LEU LEU A . n 
C 3 212 ALA 212 508 508 ALA ALA A . n 
C 3 213 GLU 213 509 509 GLU GLU A . n 
C 3 214 GLN 214 510 510 GLN GLN A . n 
C 3 215 LEU 215 511 511 LEU LEU A . n 
C 3 216 GLY 216 512 512 GLY GLY A . n 
C 3 217 THR 217 513 513 THR THR A . n 
C 3 218 VAL 218 514 514 VAL VAL A . n 
C 3 219 GLU 219 515 515 GLU GLU A . n 
C 3 220 GLN 220 516 516 GLN GLN A . n 
C 3 221 ARG 221 517 517 ARG ARG A . n 
C 3 222 ILE 222 518 518 ILE ILE A . n 
C 3 223 TYR 223 519 519 TYR TYR A . n 
C 3 224 GLU 224 520 520 GLU GLU A . n 
C 3 225 LEU 225 521 521 LEU LEU A . n 
C 3 226 ALA 226 522 522 ALA ALA A . n 
C 3 227 GLY 227 523 523 GLY GLY A . n 
C 3 228 GLN 228 524 524 GLN GLN A . n 
C 3 229 GLU 229 525 525 GLU GLU A . n 
C 3 230 PHE 230 526 526 PHE PHE A . n 
C 3 231 ASN 231 527 527 ASN ASN A . n 
C 3 232 ILE 232 528 528 ILE ILE A . n 
C 3 233 ASN 233 529 529 ASN ASN A . n 
C 3 234 SER 234 530 530 SER SER A . n 
C 3 235 PRO 235 531 531 PRO PRO A . n 
C 3 236 LYS 236 532 532 LYS LYS A . n 
C 3 237 GLN 237 533 533 GLN GLN A . n 
C 3 238 LEU 238 534 534 LEU LEU A . n 
C 3 239 GLY 239 535 535 GLY GLY A . n 
C 3 240 VAL 240 536 536 VAL VAL A . n 
C 3 241 ILE 241 537 537 ILE ILE A . n 
C 3 242 LEU 242 538 538 LEU LEU A . n 
C 3 243 PHE 243 539 539 PHE PHE A . n 
C 3 244 GLU 244 540 540 GLU GLU A . n 
C 3 245 LYS 245 541 541 LYS LYS A . n 
C 3 246 LEU 246 542 542 LEU LEU A . n 
C 3 247 GLN 247 543 543 GLN GLN A . n 
C 3 248 LEU 248 544 544 LEU LEU A . n 
C 3 249 PRO 249 545 545 PRO PRO A . n 
C 3 250 VAL 250 546 546 VAL VAL A . n 
C 3 251 LEU 251 547 547 LEU LEU A . n 
C 3 252 LYS 252 548 548 LYS LYS A . n 
C 3 253 LYS 253 549 549 LYS LYS A . n 
C 3 254 THR 254 550 550 THR THR A . n 
C 3 255 LYS 255 551 551 LYS LYS A . n 
C 3 256 THR 256 552 552 THR THR A . n 
C 3 257 GLY 257 553 553 GLY GLY A . n 
C 3 258 TYR 258 554 554 TYR TYR A . n 
C 3 259 SER 259 555 555 SER SER A . n 
C 3 260 THR 260 556 556 THR THR A . n 
C 3 261 SER 261 557 557 SER SER A . n 
C 3 262 ALA 262 558 558 ALA ALA A . n 
C 3 263 ASP 263 559 559 ASP ASP A . n 
C 3 264 VAL 264 560 560 VAL VAL A . n 
C 3 265 LEU 265 561 561 LEU LEU A . n 
C 3 266 GLU 266 562 562 GLU GLU A . n 
C 3 267 LYS 267 563 563 LYS LYS A . n 
C 3 268 LEU 268 564 564 LEU LEU A . n 
C 3 269 ALA 269 565 565 ALA ALA A . n 
C 3 270 PRO 270 566 566 PRO PRO A . n 
C 3 271 TYR 271 567 567 TYR TYR A . n 
C 3 272 HIS 272 568 568 HIS HIS A . n 
C 3 273 GLU 273 569 569 GLU GLU A . n 
C 3 274 ILE 274 570 570 ILE ILE A . n 
C 3 275 VAL 275 571 571 VAL VAL A . n 
C 3 276 GLU 276 572 572 GLU GLU A . n 
C 3 277 ASN 277 573 573 ASN ASN A . n 
C 3 278 ILE 278 574 574 ILE ILE A . n 
C 3 279 LEU 279 575 575 LEU LEU A . n 
C 3 280 HIS 280 576 576 HIS HIS A . n 
C 3 281 TYR 281 577 577 TYR TYR A . n 
C 3 282 ARG 282 578 578 ARG ARG A . n 
C 3 283 GLN 283 579 579 GLN GLN A . n 
C 3 284 LEU 284 580 580 LEU LEU A . n 
C 3 285 GLY 285 581 581 GLY GLY A . n 
C 3 286 LYS 286 582 582 LYS LYS A . n 
C 3 287 LEU 287 583 583 LEU LEU A . n 
C 3 288 GLN 288 584 584 GLN GLN A . n 
C 3 289 SER 289 585 585 SER SER A . n 
C 3 290 THR 290 586 586 THR THR A . n 
C 3 291 TYR 291 587 587 TYR TYR A . n 
C 3 292 ILE 292 588 588 ILE ILE A . n 
C 3 293 GLU 293 589 589 GLU GLU A . n 
C 3 294 GLY 294 590 590 GLY GLY A . n 
C 3 295 LEU 295 591 591 LEU LEU A . n 
C 3 296 LEU 296 592 592 LEU LEU A . n 
C 3 297 LYS 297 593 593 LYS LYS A . n 
C 3 298 VAL 298 594 594 VAL VAL A . n 
C 3 299 VAL 299 595 595 VAL VAL A . n 
C 3 300 ARG 300 596 596 ARG ARG A . n 
C 3 301 PRO 301 597 597 PRO PRO A . n 
C 3 302 ASP 302 598 598 ASP ASP A . n 
C 3 303 THR 303 599 599 THR THR A . n 
C 3 304 LYS 304 600 600 LYS LYS A . n 
C 3 305 LYS 305 601 601 LYS LYS A . n 
C 3 306 VAL 306 602 602 VAL VAL A . n 
C 3 307 HIS 307 603 603 HIS HIS A . n 
C 3 308 THR 308 604 604 THR THR A . n 
C 3 309 ILE 309 605 605 ILE ILE A . n 
C 3 310 PHE 310 606 606 PHE PHE A . n 
C 3 311 ASN 311 607 607 ASN ASN A . n 
C 3 312 GLN 312 608 608 GLN GLN A . n 
C 3 313 ALA 313 609 609 ALA ALA A . n 
C 3 314 LEU 314 610 610 LEU LEU A . n 
C 3 315 THR 315 611 611 THR THR A . n 
C 3 316 GLN 316 612 612 GLN GLN A . n 
C 3 317 THR 317 613 613 THR THR A . n 
C 3 318 GLY 318 614 614 GLY GLY A . n 
C 3 319 ARG 319 615 615 ARG ARG A . n 
C 3 320 LEU 320 616 616 LEU LEU A . n 
C 3 321 SER 321 617 617 SER SER A . n 
C 3 322 SER 322 618 618 SER SER A . n 
C 3 323 THR 323 619 619 THR THR A . n 
C 3 324 GLU 324 620 620 GLU GLU A . n 
C 3 325 PRO 325 621 621 PRO PRO A . n 
C 3 326 ASN 326 622 622 ASN ASN A . n 
C 3 327 LEU 327 623 623 LEU LEU A . n 
C 3 328 GLN 328 624 624 GLN GLN A . n 
C 3 329 ASN 329 625 625 ASN ASN A . n 
C 3 330 ILE 330 626 626 ILE ILE A . n 
C 3 331 PRO 331 627 627 PRO PRO A . n 
C 3 332 ILE 332 628 628 ILE ILE A . n 
C 3 333 ARG 333 629 629 ARG ARG A . n 
C 3 334 LEU 334 630 630 LEU LEU A . n 
C 3 335 GLU 335 631 631 GLU GLU A . n 
C 3 336 GLU 336 632 632 GLU GLU A . n 
C 3 337 GLY 337 633 633 GLY GLY A . n 
C 3 338 ARG 338 634 634 ARG ARG A . n 
C 3 339 LYS 339 635 635 LYS LYS A . n 
C 3 340 ILE 340 636 636 ILE ILE A . n 
C 3 341 ARG 341 637 637 ARG ARG A . n 
C 3 342 GLN 342 638 638 GLN GLN A . n 
C 3 343 ALA 343 639 639 ALA ALA A . n 
C 3 344 PHE 344 640 640 PHE PHE A . n 
C 3 345 VAL 345 641 641 VAL VAL A . n 
C 3 346 PRO 346 642 642 PRO PRO A . n 
C 3 347 SER 347 643 643 SER SER A . n 
C 3 348 GLU 348 644 644 GLU GLU A . n 
C 3 349 SER 349 645 645 SER SER A . n 
C 3 350 ASP 350 646 646 ASP ASP A . n 
C 3 351 TRP 351 647 647 TRP TRP A . n 
C 3 352 LEU 352 648 648 LEU LEU A . n 
C 3 353 ILE 353 649 649 ILE ILE A . n 
C 3 354 PHE 354 650 650 PHE PHE A . n 
C 3 355 ALA 355 651 651 ALA ALA A . n 
C 3 356 ALA 356 652 652 ALA ALA A . n 
C 3 357 ASP 357 653 653 ASP ASP A . n 
C 3 358 TYR 358 654 654 TYR TYR A . n 
C 3 359 SER 359 655 655 SER SER A . n 
C 3 360 GLN 360 656 656 GLN GLN A . n 
C 3 361 ILE 361 657 657 ILE ILE A . n 
C 3 362 GLU 362 658 658 GLU GLU A . n 
C 3 363 LEU 363 659 659 LEU LEU A . n 
C 3 364 ARG 364 660 660 ARG ARG A . n 
C 3 365 VAL 365 661 661 VAL VAL A . n 
C 3 366 LEU 366 662 662 LEU LEU A . n 
C 3 367 ALA 367 663 663 ALA ALA A . n 
C 3 368 HIS 368 664 664 HIS HIS A . n 
C 3 369 ILE 369 665 665 ILE ILE A . n 
C 3 370 ALA 370 666 666 ALA ALA A . n 
C 3 371 GLU 371 667 667 GLU GLU A . n 
C 3 372 ASP 372 668 668 ASP ASP A . n 
C 3 373 ASP 373 669 669 ASP ASP A . n 
C 3 374 ASN 374 670 670 ASN ASN A . n 
C 3 375 LEU 375 671 671 LEU LEU A . n 
C 3 376 MET 376 672 672 MET MET A . n 
C 3 377 GLU 377 673 673 GLU GLU A . n 
C 3 378 ALA 378 674 674 ALA ALA A . n 
C 3 379 PHE 379 675 675 PHE PHE A . n 
C 3 380 ARG 380 676 676 ARG ARG A . n 
C 3 381 ARG 381 677 677 ARG ARG A . n 
C 3 382 ASP 382 678 678 ASP ASP A . n 
C 3 383 LEU 383 679 679 LEU LEU A . n 
C 3 384 ASP 384 680 680 ASP ASP A . n 
C 3 385 ILE 385 681 681 ILE ILE A . n 
C 3 386 HIS 386 682 682 HIS HIS A . n 
C 3 387 THR 387 683 683 THR THR A . n 
C 3 388 LYS 388 684 684 LYS LYS A . n 
C 3 389 THR 389 685 685 THR THR A . n 
C 3 390 ALA 390 686 686 ALA ALA A . n 
C 3 391 MET 391 687 687 MET MET A . n 
C 3 392 ASP 392 688 688 ASP ASP A . n 
C 3 393 ILE 393 689 689 ILE ILE A . n 
C 3 394 PHE 394 690 690 PHE PHE A . n 
C 3 395 GLN 395 691 691 GLN GLN A . n 
C 3 396 VAL 396 692 692 VAL VAL A . n 
C 3 397 SER 397 693 693 SER SER A . n 
C 3 398 GLU 398 694 694 GLU GLU A . n 
C 3 399 ASP 399 695 695 ASP ASP A . n 
C 3 400 GLU 400 696 696 GLU GLU A . n 
C 3 401 VAL 401 697 697 VAL VAL A . n 
C 3 402 THR 402 698 698 THR THR A . n 
C 3 403 PRO 403 699 699 PRO PRO A . n 
C 3 404 ASN 404 700 700 ASN ASN A . n 
C 3 405 MET 405 701 701 MET MET A . n 
C 3 406 ARG 406 702 702 ARG ARG A . n 
C 3 407 ARG 407 703 703 ARG ARG A . n 
C 3 408 GLN 408 704 704 GLN GLN A . n 
C 3 409 ALA 409 705 705 ALA ALA A . n 
C 3 410 LYS 410 706 706 LYS LYS A . n 
C 3 411 ALA 411 707 707 ALA ALA A . n 
C 3 412 VAL 412 708 708 VAL VAL A . n 
C 3 413 ASN 413 709 709 ASN ASN A . n 
C 3 414 PHE 414 710 710 PHE PHE A . n 
C 3 415 GLY 415 711 711 GLY GLY A . n 
C 3 416 ILE 416 712 712 ILE ILE A . n 
C 3 417 VAL 417 713 713 VAL VAL A . n 
C 3 418 TYR 418 714 714 TYR TYR A . n 
C 3 419 GLY 419 715 715 GLY GLY A . n 
C 3 420 ILE 420 716 716 ILE ILE A . n 
C 3 421 SER 421 717 717 SER SER A . n 
C 3 422 ASP 422 718 718 ASP ASP A . n 
C 3 423 TYR 423 719 719 TYR TYR A . n 
C 3 424 GLY 424 720 720 GLY GLY A . n 
C 3 425 LEU 425 721 721 LEU LEU A . n 
C 3 426 ALA 426 722 722 ALA ALA A . n 
C 3 427 GLN 427 723 723 GLN GLN A . n 
C 3 428 ASN 428 724 724 ASN ASN A . n 
C 3 429 LEU 429 725 725 LEU LEU A . n 
C 3 430 ASN 430 726 726 ASN ASN A . n 
C 3 431 ILE 431 727 727 ILE ILE A . n 
C 3 432 SER 432 728 728 SER SER A . n 
C 3 433 ARG 433 729 729 ARG ARG A . n 
C 3 434 LYS 434 730 730 LYS LYS A . n 
C 3 435 GLU 435 731 731 GLU GLU A . n 
C 3 436 ALA 436 732 732 ALA ALA A . n 
C 3 437 ALA 437 733 733 ALA ALA A . n 
C 3 438 GLU 438 734 734 GLU GLU A . n 
C 3 439 PHE 439 735 735 PHE PHE A . n 
C 3 440 ILE 440 736 736 ILE ILE A . n 
C 3 441 GLU 441 737 737 GLU GLU A . n 
C 3 442 ARG 442 738 738 ARG ARG A . n 
C 3 443 TYR 443 739 739 TYR TYR A . n 
C 3 444 PHE 444 740 740 PHE PHE A . n 
C 3 445 GLU 445 741 741 GLU GLU A . n 
C 3 446 SER 446 742 742 SER SER A . n 
C 3 447 PHE 447 743 743 PHE PHE A . n 
C 3 448 PRO 448 744 744 PRO PRO A . n 
C 3 449 GLY 449 745 745 GLY GLY A . n 
C 3 450 VAL 450 746 746 VAL VAL A . n 
C 3 451 LYS 451 747 747 LYS LYS A . n 
C 3 452 ARG 452 748 748 ARG ARG A . n 
C 3 453 TYR 453 749 749 TYR TYR A . n 
C 3 454 MET 454 750 750 MET MET A . n 
C 3 455 GLU 455 751 751 GLU GLU A . n 
C 3 456 ASN 456 752 752 ASN ASN A . n 
C 3 457 ILE 457 753 753 ILE ILE A . n 
C 3 458 VAL 458 754 754 VAL VAL A . n 
C 3 459 GLN 459 755 755 GLN GLN A . n 
C 3 460 GLU 460 756 756 GLU GLU A . n 
C 3 461 ALA 461 757 757 ALA ALA A . n 
C 3 462 LYS 462 758 758 LYS LYS A . n 
C 3 463 GLN 463 759 759 GLN GLN A . n 
C 3 464 LYS 464 760 760 LYS LYS A . n 
C 3 465 GLY 465 761 761 GLY GLY A . n 
C 3 466 TYR 466 762 762 TYR TYR A . n 
C 3 467 VAL 467 763 763 VAL VAL A . n 
C 3 468 THR 468 764 764 THR THR A . n 
C 3 469 THR 469 765 765 THR THR A . n 
C 3 470 LEU 470 766 766 LEU LEU A . n 
C 3 471 LEU 471 767 767 LEU LEU A . n 
C 3 472 HIS 472 768 768 HIS HIS A . n 
C 3 473 ARG 473 769 769 ARG ARG A . n 
C 3 474 ARG 474 770 770 ARG ARG A . n 
C 3 475 ARG 475 771 771 ARG ARG A . n 
C 3 476 TYR 476 772 772 TYR TYR A . n 
C 3 477 LEU 477 773 773 LEU LEU A . n 
C 3 478 PRO 478 774 774 PRO PRO A . n 
C 3 479 ASP 479 775 775 ASP ASP A . n 
C 3 480 ILE 480 776 776 ILE ILE A . n 
C 3 481 THR 481 777 777 THR THR A . n 
C 3 482 SER 482 778 778 SER SER A . n 
C 3 483 ARG 483 779 779 ARG ARG A . n 
C 3 484 ASN 484 780 780 ASN ASN A . n 
C 3 485 PHE 485 781 781 PHE PHE A . n 
C 3 486 ASN 486 782 782 ASN ASN A . n 
C 3 487 VAL 487 783 783 VAL VAL A . n 
C 3 488 ARG 488 784 784 ARG ARG A . n 
C 3 489 SER 489 785 785 SER SER A . n 
C 3 490 PHE 490 786 786 PHE PHE A . n 
C 3 491 ALA 491 787 787 ALA ALA A . n 
C 3 492 GLU 492 788 788 GLU GLU A . n 
C 3 493 ARG 493 789 789 ARG ARG A . n 
C 3 494 MET 494 790 790 MET MET A . n 
C 3 495 ALA 495 791 791 ALA ALA A . n 
C 3 496 MET 496 792 792 MET MET A . n 
C 3 497 ASN 497 793 793 ASN ASN A . n 
C 3 498 THR 498 794 794 THR THR A . n 
C 3 499 PRO 499 795 795 PRO PRO A . n 
C 3 500 ILE 500 796 796 ILE ILE A . n 
C 3 501 GLN 501 797 797 GLN GLN A . n 
C 3 502 GLY 502 798 798 GLY GLY A . n 
C 3 503 SER 503 799 799 SER SER A . n 
C 3 504 ALA 504 800 800 ALA ALA A . n 
C 3 505 ALA 505 801 801 ALA ALA A . n 
C 3 506 ASP 506 802 802 ASP ASP A . n 
C 3 507 ILE 507 803 803 ILE ILE A . n 
C 3 508 ILE 508 804 804 ILE ILE A . n 
C 3 509 LYS 509 805 805 LYS LYS A . n 
C 3 510 LYS 510 806 806 LYS LYS A . n 
C 3 511 ALA 511 807 807 ALA ALA A . n 
C 3 512 MET 512 808 808 MET MET A . n 
C 3 513 ILE 513 809 809 ILE ILE A . n 
C 3 514 ASP 514 810 810 ASP ASP A . n 
C 3 515 LEU 515 811 811 LEU LEU A . n 
C 3 516 ASN 516 812 812 ASN ASN A . n 
C 3 517 ALA 517 813 813 ALA ALA A . n 
C 3 518 ARG 518 814 814 ARG ARG A . n 
C 3 519 LEU 519 815 815 LEU LEU A . n 
C 3 520 LYS 520 816 816 LYS LYS A . n 
C 3 521 GLU 521 817 817 GLU GLU A . n 
C 3 522 GLU 522 818 818 GLU GLU A . n 
C 3 523 ARG 523 819 819 ARG ARG A . n 
C 3 524 LEU 524 820 820 LEU LEU A . n 
C 3 525 GLN 525 821 821 GLN GLN A . n 
C 3 526 ALA 526 822 822 ALA ALA A . n 
C 3 527 HIS 527 823 823 HIS HIS A . n 
C 3 528 LEU 528 824 824 LEU LEU A . n 
C 3 529 LEU 529 825 825 LEU LEU A . n 
C 3 530 LEU 530 826 826 LEU LEU A . n 
C 3 531 GLN 531 827 827 GLN GLN A . n 
C 3 532 VAL 532 828 828 VAL VAL A . n 
C 3 533 HIS 533 829 829 HIS HIS A . n 
C 3 534 ASP 534 830 830 ASP ASP A . n 
C 3 535 GLU 535 831 831 GLU GLU A . n 
C 3 536 LEU 536 832 832 LEU LEU A . n 
C 3 537 ILE 537 833 833 ILE ILE A . n 
C 3 538 LEU 538 834 834 LEU LEU A . n 
C 3 539 GLU 539 835 835 GLU GLU A . n 
C 3 540 ALA 540 836 836 ALA ALA A . n 
C 3 541 PRO 541 837 837 PRO PRO A . n 
C 3 542 LYS 542 838 838 LYS LYS A . n 
C 3 543 GLU 543 839 839 GLU GLU A . n 
C 3 544 GLU 544 840 840 GLU GLU A . n 
C 3 545 MET 545 841 841 MET MET A . n 
C 3 546 GLU 546 842 842 GLU GLU A . n 
C 3 547 ARG 547 843 843 ARG ARG A . n 
C 3 548 LEU 548 844 844 LEU LEU A . n 
C 3 549 CYS 549 845 845 CYS CYS A . n 
C 3 550 ARG 550 846 846 ARG ARG A . n 
C 3 551 LEU 551 847 847 LEU LEU A . n 
C 3 552 VAL 552 848 848 VAL VAL A . n 
C 3 553 PRO 553 849 849 PRO PRO A . n 
C 3 554 GLU 554 850 850 GLU GLU A . n 
C 3 555 VAL 555 851 851 VAL VAL A . n 
C 3 556 MET 556 852 852 MET MET A . n 
C 3 557 GLU 557 853 853 GLU GLU A . n 
C 3 558 GLN 558 854 854 GLN GLN A . n 
C 3 559 ALA 559 855 855 ALA ALA A . n 
C 3 560 VAL 560 856 856 VAL VAL A . n 
C 3 561 THR 561 857 857 THR THR A . n 
C 3 562 LEU 562 858 858 LEU LEU A . n 
C 3 563 ARG 563 859 859 ARG ARG A . n 
C 3 564 VAL 564 860 860 VAL VAL A . n 
C 3 565 PRO 565 861 861 PRO PRO A . n 
C 3 566 LEU 566 862 862 LEU LEU A . n 
C 3 567 LYS 567 863 863 LYS LYS A . n 
C 3 568 VAL 568 864 864 VAL VAL A . n 
C 3 569 ASP 569 865 865 ASP ASP A . n 
C 3 570 TYR 570 866 866 TYR TYR A . n 
C 3 571 HIS 571 867 867 HIS HIS A . n 
C 3 572 TYR 572 868 868 TYR TYR A . n 
C 3 573 GLY 573 869 869 GLY GLY A . n 
C 3 574 SER 574 870 870 SER SER A . n 
C 3 575 THR 575 871 871 THR THR A . n 
C 3 576 TRP 576 872 872 TRP TRP A . n 
C 3 577 TYR 577 873 873 TYR TYR A . n 
C 3 578 ASP 578 874 874 ASP ASP A . n 
C 3 579 ALA 579 875 875 ALA ALA A . n 
C 3 580 LYS 580 876 876 LYS LYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 SUC 1   901  901  SUC SUC A . 
E 4 SUC 1   902  902  SUC SUC A . 
F 4 SUC 1   903  903  SUC SUC A . 
G 5 SO4 1   904  904  SO4 SO4 A . 
H 5 SO4 1   905  905  SO4 SO4 A . 
I 5 SO4 1   906  906  SO4 SO4 A . 
J 6 MG  1   920  920  MG  MG  A . 
K 7 HOH 1   3020 3020 HOH HOH B . 
K 7 HOH 2   3032 3032 HOH HOH B . 
K 7 HOH 3   3033 3033 HOH HOH B . 
K 7 HOH 4   3066 3066 HOH HOH B . 
K 7 HOH 5   3079 3079 HOH HOH B . 
K 7 HOH 6   3162 3162 HOH HOH B . 
K 7 HOH 7   3183 3183 HOH HOH B . 
K 7 HOH 8   3351 3351 HOH HOH B . 
K 7 HOH 9   3397 3397 HOH HOH B . 
K 7 HOH 10  3412 3412 HOH HOH B . 
K 7 HOH 11  3433 3433 HOH HOH B . 
K 7 HOH 12  3443 3443 HOH HOH B . 
K 7 HOH 13  3464 3464 HOH HOH B . 
K 7 HOH 14  3476 3476 HOH HOH B . 
K 7 HOH 15  3511 3511 HOH HOH B . 
K 7 HOH 16  3519 3519 HOH HOH B . 
K 7 HOH 17  3553 3553 HOH HOH B . 
K 7 HOH 18  3561 3561 HOH HOH B . 
K 7 HOH 19  3562 3562 HOH HOH B . 
K 7 HOH 20  3595 3595 HOH HOH B . 
K 7 HOH 21  3601 3601 HOH HOH B . 
K 7 HOH 22  3615 3615 HOH HOH B . 
K 7 HOH 23  3625 3625 HOH HOH B . 
L 7 HOH 1   1050 1050 HOH HOH C . 
L 7 HOH 2   2734 2734 HOH HOH C . 
L 7 HOH 3   2795 2795 HOH HOH C . 
L 7 HOH 4   3152 3152 HOH HOH C . 
L 7 HOH 5   3210 3210 HOH HOH C . 
L 7 HOH 6   3287 3287 HOH HOH C . 
L 7 HOH 7   3288 3288 HOH HOH C . 
L 7 HOH 8   3297 3297 HOH HOH C . 
L 7 HOH 9   3302 3302 HOH HOH C . 
L 7 HOH 10  3312 3312 HOH HOH C . 
L 7 HOH 11  3315 3315 HOH HOH C . 
L 7 HOH 12  3348 3348 HOH HOH C . 
L 7 HOH 13  3369 3369 HOH HOH C . 
L 7 HOH 14  3419 3419 HOH HOH C . 
L 7 HOH 15  3434 3434 HOH HOH C . 
L 7 HOH 16  3445 3445 HOH HOH C . 
L 7 HOH 17  3463 3463 HOH HOH C . 
L 7 HOH 18  3486 3486 HOH HOH C . 
L 7 HOH 19  3512 3512 HOH HOH C . 
L 7 HOH 20  3526 3526 HOH HOH C . 
L 7 HOH 21  3547 3547 HOH HOH C . 
L 7 HOH 22  3549 3549 HOH HOH C . 
L 7 HOH 23  3577 3577 HOH HOH C . 
L 7 HOH 24  3614 3614 HOH HOH C . 
L 7 HOH 25  3638 3638 HOH HOH C . 
L 7 HOH 26  3646 3646 HOH HOH C . 
L 7 HOH 27  3650 3650 HOH HOH C . 
L 7 HOH 28  3665 3665 HOH HOH C . 
M 7 HOH 1   1004 1004 HOH HOH A . 
M 7 HOH 2   1008 1008 HOH HOH A . 
M 7 HOH 3   1009 1009 HOH HOH A . 
M 7 HOH 4   1016 1016 HOH HOH A . 
M 7 HOH 5   1017 1017 HOH HOH A . 
M 7 HOH 6   1018 1018 HOH HOH A . 
M 7 HOH 7   1030 1030 HOH HOH A . 
M 7 HOH 8   1031 1031 HOH HOH A . 
M 7 HOH 9   1032 1032 HOH HOH A . 
M 7 HOH 10  1033 1033 HOH HOH A . 
M 7 HOH 11  1039 1039 HOH HOH A . 
M 7 HOH 12  1040 1040 HOH HOH A . 
M 7 HOH 13  1041 1041 HOH HOH A . 
M 7 HOH 14  1042 1042 HOH HOH A . 
M 7 HOH 15  1045 1045 HOH HOH A . 
M 7 HOH 16  2001 2001 HOH HOH A . 
M 7 HOH 17  2002 2002 HOH HOH A . 
M 7 HOH 18  2003 2003 HOH HOH A . 
M 7 HOH 19  2005 2005 HOH HOH A . 
M 7 HOH 20  2006 2006 HOH HOH A . 
M 7 HOH 21  2007 2007 HOH HOH A . 
M 7 HOH 22  2008 2008 HOH HOH A . 
M 7 HOH 23  2009 2009 HOH HOH A . 
M 7 HOH 24  2010 2010 HOH HOH A . 
M 7 HOH 25  2011 2011 HOH HOH A . 
M 7 HOH 26  2012 2012 HOH HOH A . 
M 7 HOH 27  2013 2013 HOH HOH A . 
M 7 HOH 28  2016 2016 HOH HOH A . 
M 7 HOH 29  2018 2018 HOH HOH A . 
M 7 HOH 30  2019 2019 HOH HOH A . 
M 7 HOH 31  2020 2020 HOH HOH A . 
M 7 HOH 32  2021 2021 HOH HOH A . 
M 7 HOH 33  2022 2022 HOH HOH A . 
M 7 HOH 34  2023 2023 HOH HOH A . 
M 7 HOH 35  2024 2024 HOH HOH A . 
M 7 HOH 36  2026 2026 HOH HOH A . 
M 7 HOH 37  2028 2028 HOH HOH A . 
M 7 HOH 38  2029 2029 HOH HOH A . 
M 7 HOH 39  2033 2033 HOH HOH A . 
M 7 HOH 40  2034 2034 HOH HOH A . 
M 7 HOH 41  2035 2035 HOH HOH A . 
M 7 HOH 42  2037 2037 HOH HOH A . 
M 7 HOH 43  2038 2038 HOH HOH A . 
M 7 HOH 44  2040 2040 HOH HOH A . 
M 7 HOH 45  2045 2045 HOH HOH A . 
M 7 HOH 46  2046 2046 HOH HOH A . 
M 7 HOH 47  2048 2048 HOH HOH A . 
M 7 HOH 48  2051 2051 HOH HOH A . 
M 7 HOH 49  2053 2053 HOH HOH A . 
M 7 HOH 50  2055 2055 HOH HOH A . 
M 7 HOH 51  2056 2056 HOH HOH A . 
M 7 HOH 52  2057 2057 HOH HOH A . 
M 7 HOH 53  2059 2059 HOH HOH A . 
M 7 HOH 54  2101 2101 HOH HOH A . 
M 7 HOH 55  2103 2103 HOH HOH A . 
M 7 HOH 56  2105 2105 HOH HOH A . 
M 7 HOH 57  2112 2112 HOH HOH A . 
M 7 HOH 58  2115 2115 HOH HOH A . 
M 7 HOH 59  2116 2116 HOH HOH A . 
M 7 HOH 60  2121 2121 HOH HOH A . 
M 7 HOH 61  2123 2123 HOH HOH A . 
M 7 HOH 62  2132 2132 HOH HOH A . 
M 7 HOH 63  2135 2135 HOH HOH A . 
M 7 HOH 64  2139 2139 HOH HOH A . 
M 7 HOH 65  2140 2140 HOH HOH A . 
M 7 HOH 66  2145 2145 HOH HOH A . 
M 7 HOH 67  2146 2146 HOH HOH A . 
M 7 HOH 68  2148 2148 HOH HOH A . 
M 7 HOH 69  2149 2149 HOH HOH A . 
M 7 HOH 70  2154 2154 HOH HOH A . 
M 7 HOH 71  2157 2157 HOH HOH A . 
M 7 HOH 72  2160 2160 HOH HOH A . 
M 7 HOH 73  2161 2161 HOH HOH A . 
M 7 HOH 74  2163 2163 HOH HOH A . 
M 7 HOH 75  2167 2167 HOH HOH A . 
M 7 HOH 76  2171 2171 HOH HOH A . 
M 7 HOH 77  2188 2188 HOH HOH A . 
M 7 HOH 78  2214 2214 HOH HOH A . 
M 7 HOH 79  2229 2229 HOH HOH A . 
M 7 HOH 80  2242 2242 HOH HOH A . 
M 7 HOH 81  2250 2250 HOH HOH A . 
M 7 HOH 82  2254 2254 HOH HOH A . 
M 7 HOH 83  2255 2255 HOH HOH A . 
M 7 HOH 84  2256 2256 HOH HOH A . 
M 7 HOH 85  2264 2264 HOH HOH A . 
M 7 HOH 86  2266 2266 HOH HOH A . 
M 7 HOH 87  2302 2302 HOH HOH A . 
M 7 HOH 88  2304 2304 HOH HOH A . 
M 7 HOH 89  2308 2308 HOH HOH A . 
M 7 HOH 90  2309 2309 HOH HOH A . 
M 7 HOH 91  2313 2313 HOH HOH A . 
M 7 HOH 92  2321 2321 HOH HOH A . 
M 7 HOH 93  2322 2322 HOH HOH A . 
M 7 HOH 94  2326 2326 HOH HOH A . 
M 7 HOH 95  2327 2327 HOH HOH A . 
M 7 HOH 96  2328 2328 HOH HOH A . 
M 7 HOH 97  2330 2330 HOH HOH A . 
M 7 HOH 98  2333 2333 HOH HOH A . 
M 7 HOH 99  2355 2355 HOH HOH A . 
M 7 HOH 100 2366 2366 HOH HOH A . 
M 7 HOH 101 2373 2373 HOH HOH A . 
M 7 HOH 102 2377 2377 HOH HOH A . 
M 7 HOH 103 2379 2379 HOH HOH A . 
M 7 HOH 104 2380 2380 HOH HOH A . 
M 7 HOH 105 2403 2403 HOH HOH A . 
M 7 HOH 106 2407 2407 HOH HOH A . 
M 7 HOH 107 2412 2412 HOH HOH A . 
M 7 HOH 108 2419 2419 HOH HOH A . 
M 7 HOH 109 2422 2422 HOH HOH A . 
M 7 HOH 110 2424 2424 HOH HOH A . 
M 7 HOH 111 2429 2429 HOH HOH A . 
M 7 HOH 112 2430 2430 HOH HOH A . 
M 7 HOH 113 2462 2462 HOH HOH A . 
M 7 HOH 114 2463 2463 HOH HOH A . 
M 7 HOH 115 2516 2516 HOH HOH A . 
M 7 HOH 116 2518 2518 HOH HOH A . 
M 7 HOH 117 2540 2540 HOH HOH A . 
M 7 HOH 118 2543 2543 HOH HOH A . 
M 7 HOH 119 2624 2624 HOH HOH A . 
M 7 HOH 120 2646 2646 HOH HOH A . 
M 7 HOH 121 2670 2670 HOH HOH A . 
M 7 HOH 122 2697 2697 HOH HOH A . 
M 7 HOH 123 2756 2756 HOH HOH A . 
M 7 HOH 124 2775 2775 HOH HOH A . 
M 7 HOH 125 2783 2783 HOH HOH A . 
M 7 HOH 126 2788 2788 HOH HOH A . 
M 7 HOH 127 2789 2789 HOH HOH A . 
M 7 HOH 128 2792 2792 HOH HOH A . 
M 7 HOH 129 2799 2799 HOH HOH A . 
M 7 HOH 130 2802 2802 HOH HOH A . 
M 7 HOH 131 2812 2812 HOH HOH A . 
M 7 HOH 132 2814 2814 HOH HOH A . 
M 7 HOH 133 2819 2819 HOH HOH A . 
M 7 HOH 134 2824 2824 HOH HOH A . 
M 7 HOH 135 2832 2832 HOH HOH A . 
M 7 HOH 136 2847 2847 HOH HOH A . 
M 7 HOH 137 2858 2858 HOH HOH A . 
M 7 HOH 138 2862 2862 HOH HOH A . 
M 7 HOH 139 2863 2863 HOH HOH A . 
M 7 HOH 140 2880 2880 HOH HOH A . 
M 7 HOH 141 2889 2889 HOH HOH A . 
M 7 HOH 142 2899 2899 HOH HOH A . 
M 7 HOH 143 2905 2905 HOH HOH A . 
M 7 HOH 144 2918 2918 HOH HOH A . 
M 7 HOH 145 2929 2929 HOH HOH A . 
M 7 HOH 146 2947 2947 HOH HOH A . 
M 7 HOH 147 2984 2984 HOH HOH A . 
M 7 HOH 148 3000 3000 HOH HOH A . 
M 7 HOH 149 3018 3018 HOH HOH A . 
M 7 HOH 150 3044 3044 HOH HOH A . 
M 7 HOH 151 3050 3050 HOH HOH A . 
M 7 HOH 152 3053 3053 HOH HOH A . 
M 7 HOH 153 3065 3065 HOH HOH A . 
M 7 HOH 154 3074 3074 HOH HOH A . 
M 7 HOH 155 3076 3076 HOH HOH A . 
M 7 HOH 156 3077 3077 HOH HOH A . 
M 7 HOH 157 3078 3078 HOH HOH A . 
M 7 HOH 158 3080 3080 HOH HOH A . 
M 7 HOH 159 3082 3082 HOH HOH A . 
M 7 HOH 160 3083 3083 HOH HOH A . 
M 7 HOH 161 3084 3084 HOH HOH A . 
M 7 HOH 162 3085 3085 HOH HOH A . 
M 7 HOH 163 3086 3086 HOH HOH A . 
M 7 HOH 164 3087 3087 HOH HOH A . 
M 7 HOH 165 3088 3088 HOH HOH A . 
M 7 HOH 166 3089 3089 HOH HOH A . 
M 7 HOH 167 3090 3090 HOH HOH A . 
M 7 HOH 168 3091 3091 HOH HOH A . 
M 7 HOH 169 3092 3092 HOH HOH A . 
M 7 HOH 170 3093 3093 HOH HOH A . 
M 7 HOH 171 3094 3094 HOH HOH A . 
M 7 HOH 172 3098 3098 HOH HOH A . 
M 7 HOH 173 3102 3102 HOH HOH A . 
M 7 HOH 174 3104 3104 HOH HOH A . 
M 7 HOH 175 3107 3107 HOH HOH A . 
M 7 HOH 176 3109 3109 HOH HOH A . 
M 7 HOH 177 3110 3110 HOH HOH A . 
M 7 HOH 178 3111 3111 HOH HOH A . 
M 7 HOH 179 3113 3113 HOH HOH A . 
M 7 HOH 180 3114 3114 HOH HOH A . 
M 7 HOH 181 3117 3117 HOH HOH A . 
M 7 HOH 182 3121 3121 HOH HOH A . 
M 7 HOH 183 3122 3122 HOH HOH A . 
M 7 HOH 184 3124 3124 HOH HOH A . 
M 7 HOH 185 3130 3130 HOH HOH A . 
M 7 HOH 186 3137 3137 HOH HOH A . 
M 7 HOH 187 3139 3139 HOH HOH A . 
M 7 HOH 188 3145 3145 HOH HOH A . 
M 7 HOH 189 3149 3149 HOH HOH A . 
M 7 HOH 190 3154 3154 HOH HOH A . 
M 7 HOH 191 3155 3155 HOH HOH A . 
M 7 HOH 192 3158 3158 HOH HOH A . 
M 7 HOH 193 3160 3160 HOH HOH A . 
M 7 HOH 194 3161 3161 HOH HOH A . 
M 7 HOH 195 3168 3168 HOH HOH A . 
M 7 HOH 196 3174 3174 HOH HOH A . 
M 7 HOH 197 3175 3175 HOH HOH A . 
M 7 HOH 198 3181 3181 HOH HOH A . 
M 7 HOH 199 3185 3185 HOH HOH A . 
M 7 HOH 200 3188 3188 HOH HOH A . 
M 7 HOH 201 3189 3189 HOH HOH A . 
M 7 HOH 202 3192 3192 HOH HOH A . 
M 7 HOH 203 3195 3195 HOH HOH A . 
M 7 HOH 204 3198 3198 HOH HOH A . 
M 7 HOH 205 3199 3199 HOH HOH A . 
M 7 HOH 206 3200 3200 HOH HOH A . 
M 7 HOH 207 3207 3207 HOH HOH A . 
M 7 HOH 208 3208 3208 HOH HOH A . 
M 7 HOH 209 3222 3222 HOH HOH A . 
M 7 HOH 210 3228 3228 HOH HOH A . 
M 7 HOH 211 3245 3245 HOH HOH A . 
M 7 HOH 212 3248 3248 HOH HOH A . 
M 7 HOH 213 3253 3253 HOH HOH A . 
M 7 HOH 214 3258 3258 HOH HOH A . 
M 7 HOH 215 3266 3266 HOH HOH A . 
M 7 HOH 216 3268 3268 HOH HOH A . 
M 7 HOH 217 3282 3282 HOH HOH A . 
M 7 HOH 218 3284 3284 HOH HOH A . 
M 7 HOH 219 3285 3285 HOH HOH A . 
M 7 HOH 220 3286 3286 HOH HOH A . 
M 7 HOH 221 3292 3292 HOH HOH A . 
M 7 HOH 222 3293 3293 HOH HOH A . 
M 7 HOH 223 3294 3294 HOH HOH A . 
M 7 HOH 224 3299 3299 HOH HOH A . 
M 7 HOH 225 3300 3300 HOH HOH A . 
M 7 HOH 226 3305 3305 HOH HOH A . 
M 7 HOH 227 3313 3313 HOH HOH A . 
M 7 HOH 228 3319 3319 HOH HOH A . 
M 7 HOH 229 3321 3321 HOH HOH A . 
M 7 HOH 230 3324 3324 HOH HOH A . 
M 7 HOH 231 3326 3326 HOH HOH A . 
M 7 HOH 232 3332 3332 HOH HOH A . 
M 7 HOH 233 3334 3334 HOH HOH A . 
M 7 HOH 234 3336 3336 HOH HOH A . 
M 7 HOH 235 3338 3338 HOH HOH A . 
M 7 HOH 236 3339 3339 HOH HOH A . 
M 7 HOH 237 3341 3341 HOH HOH A . 
M 7 HOH 238 3345 3345 HOH HOH A . 
M 7 HOH 239 3347 3347 HOH HOH A . 
M 7 HOH 240 3357 3357 HOH HOH A . 
M 7 HOH 241 3362 3362 HOH HOH A . 
M 7 HOH 242 3363 3363 HOH HOH A . 
M 7 HOH 243 3368 3368 HOH HOH A . 
M 7 HOH 244 3377 3377 HOH HOH A . 
M 7 HOH 245 3380 3380 HOH HOH A . 
M 7 HOH 246 3381 3381 HOH HOH A . 
M 7 HOH 247 3383 3383 HOH HOH A . 
M 7 HOH 248 3386 3386 HOH HOH A . 
M 7 HOH 249 3392 3392 HOH HOH A . 
M 7 HOH 250 3394 3394 HOH HOH A . 
M 7 HOH 251 3401 3401 HOH HOH A . 
M 7 HOH 252 3410 3410 HOH HOH A . 
M 7 HOH 253 3411 3411 HOH HOH A . 
M 7 HOH 254 3413 3413 HOH HOH A . 
M 7 HOH 255 3414 3414 HOH HOH A . 
M 7 HOH 256 3415 3415 HOH HOH A . 
M 7 HOH 257 3416 3416 HOH HOH A . 
M 7 HOH 258 3417 3417 HOH HOH A . 
M 7 HOH 259 3418 3418 HOH HOH A . 
M 7 HOH 260 3420 3420 HOH HOH A . 
M 7 HOH 261 3421 3421 HOH HOH A . 
M 7 HOH 262 3422 3422 HOH HOH A . 
M 7 HOH 263 3423 3423 HOH HOH A . 
M 7 HOH 264 3424 3424 HOH HOH A . 
M 7 HOH 265 3425 3425 HOH HOH A . 
M 7 HOH 266 3426 3426 HOH HOH A . 
M 7 HOH 267 3427 3427 HOH HOH A . 
M 7 HOH 268 3428 3428 HOH HOH A . 
M 7 HOH 269 3429 3429 HOH HOH A . 
M 7 HOH 270 3430 3430 HOH HOH A . 
M 7 HOH 271 3431 3431 HOH HOH A . 
M 7 HOH 272 3432 3432 HOH HOH A . 
M 7 HOH 273 3435 3435 HOH HOH A . 
M 7 HOH 274 3436 3436 HOH HOH A . 
M 7 HOH 275 3437 3437 HOH HOH A . 
M 7 HOH 276 3438 3438 HOH HOH A . 
M 7 HOH 277 3439 3439 HOH HOH A . 
M 7 HOH 278 3440 3440 HOH HOH A . 
M 7 HOH 279 3441 3441 HOH HOH A . 
M 7 HOH 280 3442 3442 HOH HOH A . 
M 7 HOH 281 3444 3444 HOH HOH A . 
M 7 HOH 282 3446 3446 HOH HOH A . 
M 7 HOH 283 3447 3447 HOH HOH A . 
M 7 HOH 284 3448 3448 HOH HOH A . 
M 7 HOH 285 3449 3449 HOH HOH A . 
M 7 HOH 286 3450 3450 HOH HOH A . 
M 7 HOH 287 3451 3451 HOH HOH A . 
M 7 HOH 288 3452 3452 HOH HOH A . 
M 7 HOH 289 3453 3453 HOH HOH A . 
M 7 HOH 290 3454 3454 HOH HOH A . 
M 7 HOH 291 3455 3455 HOH HOH A . 
M 7 HOH 292 3456 3456 HOH HOH A . 
M 7 HOH 293 3457 3457 HOH HOH A . 
M 7 HOH 294 3458 3458 HOH HOH A . 
M 7 HOH 295 3459 3459 HOH HOH A . 
M 7 HOH 296 3460 3460 HOH HOH A . 
M 7 HOH 297 3461 3461 HOH HOH A . 
M 7 HOH 298 3462 3462 HOH HOH A . 
M 7 HOH 299 3465 3465 HOH HOH A . 
M 7 HOH 300 3466 3466 HOH HOH A . 
M 7 HOH 301 3467 3467 HOH HOH A . 
M 7 HOH 302 3468 3468 HOH HOH A . 
M 7 HOH 303 3469 3469 HOH HOH A . 
M 7 HOH 304 3470 3470 HOH HOH A . 
M 7 HOH 305 3471 3471 HOH HOH A . 
M 7 HOH 306 3472 3472 HOH HOH A . 
M 7 HOH 307 3473 3473 HOH HOH A . 
M 7 HOH 308 3474 3474 HOH HOH A . 
M 7 HOH 309 3475 3475 HOH HOH A . 
M 7 HOH 310 3477 3477 HOH HOH A . 
M 7 HOH 311 3478 3478 HOH HOH A . 
M 7 HOH 312 3479 3479 HOH HOH A . 
M 7 HOH 313 3480 3480 HOH HOH A . 
M 7 HOH 314 3481 3481 HOH HOH A . 
M 7 HOH 315 3482 3482 HOH HOH A . 
M 7 HOH 316 3483 3483 HOH HOH A . 
M 7 HOH 317 3484 3484 HOH HOH A . 
M 7 HOH 318 3485 3485 HOH HOH A . 
M 7 HOH 319 3487 3487 HOH HOH A . 
M 7 HOH 320 3488 3488 HOH HOH A . 
M 7 HOH 321 3489 3489 HOH HOH A . 
M 7 HOH 322 3490 3490 HOH HOH A . 
M 7 HOH 323 3491 3491 HOH HOH A . 
M 7 HOH 324 3492 3492 HOH HOH A . 
M 7 HOH 325 3493 3493 HOH HOH A . 
M 7 HOH 326 3494 3494 HOH HOH A . 
M 7 HOH 327 3495 3495 HOH HOH A . 
M 7 HOH 328 3496 3496 HOH HOH A . 
M 7 HOH 329 3497 3497 HOH HOH A . 
M 7 HOH 330 3498 3498 HOH HOH A . 
M 7 HOH 331 3499 3499 HOH HOH A . 
M 7 HOH 332 3500 3500 HOH HOH A . 
M 7 HOH 333 3501 3501 HOH HOH A . 
M 7 HOH 334 3502 3502 HOH HOH A . 
M 7 HOH 335 3503 3503 HOH HOH A . 
M 7 HOH 336 3504 3504 HOH HOH A . 
M 7 HOH 337 3505 3505 HOH HOH A . 
M 7 HOH 338 3506 3506 HOH HOH A . 
M 7 HOH 339 3507 3507 HOH HOH A . 
M 7 HOH 340 3508 3508 HOH HOH A . 
M 7 HOH 341 3509 3509 HOH HOH A . 
M 7 HOH 342 3510 3510 HOH HOH A . 
M 7 HOH 343 3513 3513 HOH HOH A . 
M 7 HOH 344 3514 3514 HOH HOH A . 
M 7 HOH 345 3515 3515 HOH HOH A . 
M 7 HOH 346 3516 3516 HOH HOH A . 
M 7 HOH 347 3517 3517 HOH HOH A . 
M 7 HOH 348 3518 3518 HOH HOH A . 
M 7 HOH 349 3520 3520 HOH HOH A . 
M 7 HOH 350 3521 3521 HOH HOH A . 
M 7 HOH 351 3522 3522 HOH HOH A . 
M 7 HOH 352 3523 3523 HOH HOH A . 
M 7 HOH 353 3524 3524 HOH HOH A . 
M 7 HOH 354 3525 3525 HOH HOH A . 
M 7 HOH 355 3527 3527 HOH HOH A . 
M 7 HOH 356 3528 3528 HOH HOH A . 
M 7 HOH 357 3529 3529 HOH HOH A . 
M 7 HOH 358 3530 3530 HOH HOH A . 
M 7 HOH 359 3531 3531 HOH HOH A . 
M 7 HOH 360 3532 3532 HOH HOH A . 
M 7 HOH 361 3533 3533 HOH HOH A . 
M 7 HOH 362 3534 3534 HOH HOH A . 
M 7 HOH 363 3535 3535 HOH HOH A . 
M 7 HOH 364 3536 3536 HOH HOH A . 
M 7 HOH 365 3537 3537 HOH HOH A . 
M 7 HOH 366 3538 3538 HOH HOH A . 
M 7 HOH 367 3539 3539 HOH HOH A . 
M 7 HOH 368 3540 3540 HOH HOH A . 
M 7 HOH 369 3541 3541 HOH HOH A . 
M 7 HOH 370 3542 3542 HOH HOH A . 
M 7 HOH 371 3543 3543 HOH HOH A . 
M 7 HOH 372 3544 3544 HOH HOH A . 
M 7 HOH 373 3545 3545 HOH HOH A . 
M 7 HOH 374 3546 3546 HOH HOH A . 
M 7 HOH 375 3548 3548 HOH HOH A . 
M 7 HOH 376 3550 3550 HOH HOH A . 
M 7 HOH 377 3551 3551 HOH HOH A . 
M 7 HOH 378 3552 3552 HOH HOH A . 
M 7 HOH 379 3554 3554 HOH HOH A . 
M 7 HOH 380 3555 3555 HOH HOH A . 
M 7 HOH 381 3556 3556 HOH HOH A . 
M 7 HOH 382 3557 3557 HOH HOH A . 
M 7 HOH 383 3558 3558 HOH HOH A . 
M 7 HOH 384 3559 3559 HOH HOH A . 
M 7 HOH 385 3560 3560 HOH HOH A . 
M 7 HOH 386 3563 3563 HOH HOH A . 
M 7 HOH 387 3564 3564 HOH HOH A . 
M 7 HOH 388 3565 3565 HOH HOH A . 
M 7 HOH 389 3566 3566 HOH HOH A . 
M 7 HOH 390 3567 3567 HOH HOH A . 
M 7 HOH 391 3568 3568 HOH HOH A . 
M 7 HOH 392 3569 3569 HOH HOH A . 
M 7 HOH 393 3570 3570 HOH HOH A . 
M 7 HOH 394 3571 3571 HOH HOH A . 
M 7 HOH 395 3572 3572 HOH HOH A . 
M 7 HOH 396 3573 3573 HOH HOH A . 
M 7 HOH 397 3574 3574 HOH HOH A . 
M 7 HOH 398 3575 3575 HOH HOH A . 
M 7 HOH 399 3576 3576 HOH HOH A . 
M 7 HOH 400 3578 3578 HOH HOH A . 
M 7 HOH 401 3579 3579 HOH HOH A . 
M 7 HOH 402 3580 3580 HOH HOH A . 
M 7 HOH 403 3581 3581 HOH HOH A . 
M 7 HOH 404 3582 3582 HOH HOH A . 
M 7 HOH 405 3583 3583 HOH HOH A . 
M 7 HOH 406 3584 3584 HOH HOH A . 
M 7 HOH 407 3585 3585 HOH HOH A . 
M 7 HOH 408 3586 3586 HOH HOH A . 
M 7 HOH 409 3587 3587 HOH HOH A . 
M 7 HOH 410 3588 3588 HOH HOH A . 
M 7 HOH 411 3589 3589 HOH HOH A . 
M 7 HOH 412 3590 3590 HOH HOH A . 
M 7 HOH 413 3591 3591 HOH HOH A . 
M 7 HOH 414 3592 3592 HOH HOH A . 
M 7 HOH 415 3593 3593 HOH HOH A . 
M 7 HOH 416 3594 3594 HOH HOH A . 
M 7 HOH 417 3596 3596 HOH HOH A . 
M 7 HOH 418 3597 3597 HOH HOH A . 
M 7 HOH 419 3598 3598 HOH HOH A . 
M 7 HOH 420 3599 3599 HOH HOH A . 
M 7 HOH 421 3600 3600 HOH HOH A . 
M 7 HOH 422 3602 3602 HOH HOH A . 
M 7 HOH 423 3603 3603 HOH HOH A . 
M 7 HOH 424 3604 3604 HOH HOH A . 
M 7 HOH 425 3605 3605 HOH HOH A . 
M 7 HOH 426 3606 3606 HOH HOH A . 
M 7 HOH 427 3607 3607 HOH HOH A . 
M 7 HOH 428 3608 3608 HOH HOH A . 
M 7 HOH 429 3609 3609 HOH HOH A . 
M 7 HOH 430 3610 3610 HOH HOH A . 
M 7 HOH 431 3611 3611 HOH HOH A . 
M 7 HOH 432 3612 3612 HOH HOH A . 
M 7 HOH 433 3613 3613 HOH HOH A . 
M 7 HOH 434 3616 3616 HOH HOH A . 
M 7 HOH 435 3617 3617 HOH HOH A . 
M 7 HOH 436 3618 3618 HOH HOH A . 
M 7 HOH 437 3619 3619 HOH HOH A . 
M 7 HOH 438 3620 3620 HOH HOH A . 
M 7 HOH 439 3621 3621 HOH HOH A . 
M 7 HOH 440 3622 3622 HOH HOH A . 
M 7 HOH 441 3623 3623 HOH HOH A . 
M 7 HOH 442 3624 3624 HOH HOH A . 
M 7 HOH 443 3626 3626 HOH HOH A . 
M 7 HOH 444 3627 3627 HOH HOH A . 
M 7 HOH 445 3628 3628 HOH HOH A . 
M 7 HOH 446 3629 3629 HOH HOH A . 
M 7 HOH 447 3630 3630 HOH HOH A . 
M 7 HOH 448 3631 3631 HOH HOH A . 
M 7 HOH 449 3632 3632 HOH HOH A . 
M 7 HOH 450 3633 3633 HOH HOH A . 
M 7 HOH 451 3634 3634 HOH HOH A . 
M 7 HOH 452 3635 3635 HOH HOH A . 
M 7 HOH 453 3636 3636 HOH HOH A . 
M 7 HOH 454 3637 3637 HOH HOH A . 
M 7 HOH 455 3639 3639 HOH HOH A . 
M 7 HOH 456 3640 3640 HOH HOH A . 
M 7 HOH 457 3641 3641 HOH HOH A . 
M 7 HOH 458 3642 3642 HOH HOH A . 
M 7 HOH 459 3643 3643 HOH HOH A . 
M 7 HOH 460 3644 3644 HOH HOH A . 
M 7 HOH 461 3645 3645 HOH HOH A . 
M 7 HOH 462 3647 3647 HOH HOH A . 
M 7 HOH 463 3648 3648 HOH HOH A . 
M 7 HOH 464 3649 3649 HOH HOH A . 
M 7 HOH 465 3651 3651 HOH HOH A . 
M 7 HOH 466 3652 3652 HOH HOH A . 
M 7 HOH 467 3653 3653 HOH HOH A . 
M 7 HOH 468 3654 3654 HOH HOH A . 
M 7 HOH 469 3655 3655 HOH HOH A . 
M 7 HOH 470 3656 3656 HOH HOH A . 
M 7 HOH 471 3657 3657 HOH HOH A . 
M 7 HOH 472 3658 3658 HOH HOH A . 
M 7 HOH 473 3659 3659 HOH HOH A . 
M 7 HOH 474 3660 3660 HOH HOH A . 
M 7 HOH 475 3661 3661 HOH HOH A . 
M 7 HOH 476 3662 3662 HOH HOH A . 
M 7 HOH 477 3663 3663 HOH HOH A . 
M 7 HOH 478 3664 3664 HOH HOH A . 
M 7 HOH 479 3666 3666 HOH HOH A . 
M 7 HOH 480 3667 3667 HOH HOH A . 
M 7 HOH 481 3668 3668 HOH HOH A . 
M 7 HOH 482 3669 3669 HOH HOH A . 
M 7 HOH 483 3670 3670 HOH HOH A . 
M 7 HOH 484 3671 3671 HOH HOH A . 
M 7 HOH 485 3672 3672 HOH HOH A . 
M 7 HOH 486 3673 3673 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    6OG 
_pdbx_struct_mod_residue.label_seq_id     4 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     6OG 
_pdbx_struct_mod_residue.auth_seq_id      25 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DG 
_pdbx_struct_mod_residue.details          
;6-O-METHYL GUANOSINE-5'-MONOPHOSPHATE
;
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OD2 ? C ASP 534 ? A ASP 830 ? 1_555 MG ? J MG . ? A MG 920 ? 1_555 O   ? C TYR 358 ? A TYR 654  ? 1_555 77.7  ? 
2 OD2 ? C ASP 534 ? A ASP 830 ? 1_555 MG ? J MG . ? A MG 920 ? 1_555 OD2 ? C ASP 357 ? A ASP 653  ? 1_555 133.3 ? 
3 O   ? C TYR 358 ? A TYR 654 ? 1_555 MG ? J MG . ? A MG 920 ? 1_555 OD2 ? C ASP 357 ? A ASP 653  ? 1_555 79.7  ? 
4 OD2 ? C ASP 534 ? A ASP 830 ? 1_555 MG ? J MG . ? A MG 920 ? 1_555 O   ? M HOH .   ? A HOH 2814 ? 1_555 97.1  ? 
5 O   ? C TYR 358 ? A TYR 654 ? 1_555 MG ? J MG . ? A MG 920 ? 1_555 O   ? M HOH .   ? A HOH 2814 ? 1_555 77.2  ? 
6 OD2 ? C ASP 357 ? A ASP 653 ? 1_555 MG ? J MG . ? A MG 920 ? 1_555 O   ? M HOH .   ? A HOH 2814 ? 1_555 117.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-12-12 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
XSCALE      .     ?                package 'Wolfgang Kabsch' ?                        'data processing' 
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/xscale_program.html ?          ? 1 
CNS         .     ?                package 'Axel T. Brunger' axel.brunger@yale.edu    refinement        
http://cns.csb.yale.edu/v1.1/                                      Fortran_77 ? 2 
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                                   C++        ? 3 
XDS         .     ?                ?       ?                 ?                        'data reduction'  ? ?          ? 4 
XSCALE      .     ?                ?       ?                 ?                        'data scaling'    ? ?          ? 5 
CNS         .     ?                ?       ?                 ?                        phasing           ? ?          ? 6 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE

THE DNA POLYMERASE GENE WAS CLONED FROM AN
ORGANISM THAT WAS CLASSIFIED AS A THERMOSTABLE 
STRAIN OF BACILLUS STEAROTHERMOPHILUS BY 
RIBOSOMAL RNA SEQUENCING.  HOWEVER, THIS
PARTICULAR GENE HAS MUCH GREATER HOMOLOGY WITH
THE ANALOGOUS GENE FROM GEOBACILLUS KAUSTOPHILUS, 
UNP ACCESSION, Q5KWC1_GEOKA.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 298 ? ? -48.25  152.09 
2 1 ASP A 402 ? ? -164.24 91.46  
3 1 ALA A 421 ? ? -85.45  39.74  
4 1 LEU A 477 ? ? -115.57 -71.59 
5 1 LEU A 610 ? ? -121.99 -58.01 
6 1 ILE A 628 ? ? -158.69 -28.51 
7 1 ILE A 716 ? ? -37.71  147.52 
8 1 SER A 717 ? ? -172.85 102.52 
9 1 HIS A 829 ? ? 69.26   -54.78 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 297 ? CG ? C LYS 1 CG 
2 1 Y 1 A LYS 297 ? CD ? C LYS 1 CD 
3 1 Y 1 A LYS 297 ? CE ? C LYS 1 CE 
4 1 Y 1 A LYS 297 ? NZ ? C LYS 1 NZ 
5 1 Y 1 A LYS 298 ? CG ? C LYS 2 CG 
6 1 Y 1 A LYS 298 ? CD ? C LYS 2 CD 
7 1 Y 1 A LYS 298 ? CE ? C LYS 2 CE 
8 1 Y 1 A LYS 298 ? NZ ? C LYS 2 NZ 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2HHQ 'double helix'         
2HHQ 'a-form double helix'  
2HHQ 'b-form double helix'  
2HHQ 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC  1  1_555 B DG 14 1_555 -3.076 1.512  1.087  -0.437  -26.051 61.580 1  B_DC22:DG16_C  B 22 ? C 16 ? ?  ? 
1 A DA  2  1_555 B DT 13 1_555 -0.344 0.822  0.932  3.723   -16.725 33.317 2  B_DA23:DT15_C  B 23 ? C 15 ? ?  1 
1 A DT  3  1_555 B DA 12 1_555 -0.792 0.539  0.211  17.560  -28.982 12.313 3  B_DT24:DA14_C  B 24 ? C 14 ? ?  ? 
1 A 6OG 4  1_555 B DT 11 1_555 -0.843 0.745  0.418  1.386   -13.581 18.553 4  B_6OG25:DT13_C B 25 ? C 13 ? ?  ? 
1 A DC  5  1_555 B DG 10 1_555 -0.134 0.325  0.465  -10.544 -13.315 9.831  5  B_DC26:DG12_C  B 26 ? C 12 ? ?  1 
1 A DG  6  1_555 B DC 9  1_555 -0.332 -0.074 0.184  2.331   -10.252 -3.379 6  B_DG27:DC11_C  B 27 ? C 11 ? 19 1 
1 A DA  7  1_555 B DT 8  1_555 -0.170 -0.190 0.239  1.182   -14.899 0.198  7  B_DA28:DT10_C  B 28 ? C 10 ? 20 1 
1 A DG  8  1_555 B DC 7  1_555 -0.172 -0.151 -0.221 -5.470  -15.206 -1.556 8  B_DG29:DC9_C   B 29 ? C 9  ? 19 1 
1 A DT  9  1_555 B DA 6  1_555 0.213  0.022  -0.032 -8.623  -5.461  3.832  9  B_DT30:DA8_C   B 30 ? C 8  ? 20 1 
1 A DC  10 1_555 B DG 5  1_555 0.423  -0.178 -0.446 4.257   4.215   0.635  10 B_DC31:DG7_C   B 31 ? C 7  ? 19 1 
1 A DA  11 1_555 B DT 4  1_555 0.057  -0.240 -0.161 1.346   -9.602  4.573  11 B_DA32:DT6_C   B 32 ? C 6  ? 20 1 
1 A DG  12 1_555 B DC 3  1_555 -0.317 -0.025 0.394  13.092  -2.256  5.167  12 B_DG33:DC5_C   B 33 ? C 5  ? 19 1 
1 A DG  13 1_555 B DC 2  1_555 -0.030 -0.102 -0.317 9.718   -11.661 3.600  13 B_DG34:DC4_C   B 34 ? C 4  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC  1  1_555 B DG 14 1_555 A DA  2  1_555 B DT 13 1_555 -1.283 1.616  3.402 -6.177 -3.301 55.204 1.933  1.000  3.422 -3.546  
6.636   55.612 1  BB_DC22DA23:DT15DG16_CC  B 22 ? C 16 ? B 23 ? C 15 ? 
1 A DA  2  1_555 B DT 13 1_555 A DT  3  1_555 B DA 12 1_555 -1.299 -0.108 2.731 2.786  17.990 24.143 -3.179 2.957  2.013 37.014  
-5.733  30.156 2  BB_DA23DT24:DA14DT15_CC  B 23 ? C 15 ? B 24 ? C 14 ? 
1 A DT  3  1_555 B DA 12 1_555 A 6OG 4  1_555 B DT 11 1_555 0.505  -0.428 3.656 -5.546 2.956  34.513 -1.199 -1.754 3.488 4.932   
9.252   35.063 3  BB_DT246OG25:DT13DA14_CC B 24 ? C 14 ? B 25 ? C 13 ? 
1 A 6OG 4  1_555 B DT 11 1_555 A DC  5  1_555 B DG 10 1_555 -0.741 0.298  3.665 -1.889 -8.611 41.682 1.383  0.808  3.566 -11.941 
2.619   42.563 4  BB_6OG25DC26:DG12DT13_CC B 25 ? C 13 ? B 26 ? C 12 ? 
1 A DC  5  1_555 B DG 10 1_555 A DG  6  1_555 B DC 9  1_555 -0.807 0.134  3.039 1.264  7.254  30.792 -1.002 1.698  2.958 13.421  
-2.338  31.639 5  BB_DC26DG27:DC11DG12_CC  B 26 ? C 12 ? B 27 ? C 11 ? 
1 A DG  6  1_555 B DC 9  1_555 A DA  7  1_555 B DT 8  1_555 -0.031 -0.187 3.280 -2.625 4.758  35.305 -0.993 -0.328 3.222 7.787   
4.297   35.707 6  BB_DG27DA28:DT10DC11_CC  B 27 ? C 11 ? B 28 ? C 10 ? 
1 A DA  7  1_555 B DT 8  1_555 A DG  8  1_555 B DC 7  1_555 0.366  -0.205 3.584 2.554  6.357  34.635 -1.369 -0.189 3.510 10.551  
-4.238  35.285 7  BB_DA28DG29:DC9DT10_CC   B 28 ? C 10 ? B 29 ? C 9  ? 
1 A DG  8  1_555 B DC 7  1_555 A DT  9  1_555 B DA 6  1_555 0.806  -0.562 3.289 0.923  0.936  32.788 -1.157 -1.268 3.293 1.658   
-1.635  32.813 8  BB_DG29DT30:DA8DC9_CC    B 29 ? C 9  ? B 30 ? C 8  ? 
1 A DT  9  1_555 B DA 6  1_555 A DC  10 1_555 B DG 5  1_555 0.606  -0.226 3.160 5.756  6.814  30.426 -1.642 -0.073 3.098 12.647  
-10.682 31.677 9  BB_DT30DC31:DG7DA8_CC    B 30 ? C 8  ? B 31 ? C 7  ? 
1 A DC  10 1_555 B DG 5  1_555 A DA  11 1_555 B DT 4  1_555 -0.370 -0.133 3.539 -9.712 10.837 38.273 -1.495 -0.639 3.375 15.847  
14.203  40.849 10 BB_DC31DA32:DT6DG7_CC    B 31 ? C 7  ? B 32 ? C 6  ? 
1 A DA  11 1_555 B DT 4  1_555 A DG  12 1_555 B DC 3  1_555 -0.530 -1.964 3.137 -7.342 6.766  21.072 -6.945 -0.947 2.443 17.303  
18.776  23.294 11 BB_DA32DG33:DC5DT6_CC    B 32 ? C 6  ? B 33 ? C 5  ? 
1 A DG  12 1_555 B DC 3  1_555 A DG  13 1_555 B DC 2  1_555 -0.210 -1.450 3.434 4.584  11.829 32.168 -4.227 1.044  2.696 20.385  
-7.900  34.518 12 BB_DG33DG34:DC4DC5_CC    B 33 ? C 5  ? B 34 ? C 4  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 SUCROSE         SUC 
5 'SULFATE ION'   SO4 
6 'MAGNESIUM ION' MG  
7 water           HOH 
#