data_2HHT
# 
_entry.id   2HHT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HHT         
NDB   PD0826       
RCSB  RCSB038361   
WWPDB D_1000038361 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2HHQ . unspecified 
PDB 2HHS . unspecified 
PDB 2HHU . unspecified 
PDB 2HHV . unspecified 
PDB 2HHW . unspecified 
PDB 2HHX . unspecified 
PDB 2HHY . unspecified 
# 
_pdbx_database_status.entry_id                        2HHT 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-06-28 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Warren, J.J.'   1 
'Forsberg, L.J.' 2 
'Beese, L.S.'    3 
# 
_citation.id                        primary 
_citation.title                     'The structural basis for the mutagenicity of O6-methyl-guanine lesions.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            103 
_citation.page_first                19701 
_citation.page_last                 19706 
_citation.year                      2006 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17179038 
_citation.pdbx_database_id_DOI      10.1073/pnas.0609580103 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Warren, J.J.'   1 
primary 'Forsberg, L.J.' 2 
primary 'Beese, L.S.'    3 
# 
_cell.length_a           87.864 
_cell.length_b           93.431 
_cell.length_c           107.071 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           2HHT 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         2HHT 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*CP*G)-3'"                 3663.392  1   ?       ? ? 'DNA Primer Strand'   
2 polymer     syn "5'-D(*GP*TP*AP*CP*(6OG)P*AP*GP*CP*TP*GP*AP*TP*CP*GP*CP*A)-3'" 4937.231  1   ?       ? ? 'DNA Template Strand' 
3 polymer     man 'DNA polymerase I'                                             66230.953 1   2.7.7.7 ? 
'residues 299-876 (analogous to E Coli Klenow Fragment)' ?                     
4 non-polymer man SUCROSE                                                        342.296   2   ?       ? ? ?                     
5 non-polymer syn 'SULFATE ION'                                                  96.063    5   ?       ? ? ?                     
6 non-polymer syn 'MAGNESIUM ION'                                                24.305    1   ?       ? ? ?                     
7 water       nat water                                                          18.015    538 ?       ? ? ?                     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no  '(DG)(DC)(DG)(DA)(DT)(DC)(DA)(DG)(DC)(DT)(DC)(DG)' GCGATCAGCTCG B ? 
2 polydeoxyribonucleotide no yes '(DG)(DT)(DA)(DC)(6OG)(DA)(DG)(DC)(DT)(DG)(DA)(DT)(DC)(DG)(DC)(DA)' GTACGAGCTGATCGCA C ? 
3 'polypeptide(L)'        no no  
;KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWE
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
;KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWE
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DC  n 
1 3   DG  n 
1 4   DA  n 
1 5   DT  n 
1 6   DC  n 
1 7   DA  n 
1 8   DG  n 
1 9   DC  n 
1 10  DT  n 
1 11  DC  n 
1 12  DG  n 
2 1   DG  n 
2 2   DT  n 
2 3   DA  n 
2 4   DC  n 
2 5   6OG n 
2 6   DA  n 
2 7   DG  n 
2 8   DC  n 
2 9   DT  n 
2 10  DG  n 
2 11  DA  n 
2 12  DT  n 
2 13  DC  n 
2 14  DG  n 
2 15  DC  n 
2 16  DA  n 
3 1   LYS n 
3 2   LYS n 
3 3   MET n 
3 4   ALA n 
3 5   PHE n 
3 6   THR n 
3 7   LEU n 
3 8   ALA n 
3 9   ASP n 
3 10  ARG n 
3 11  VAL n 
3 12  THR n 
3 13  GLU n 
3 14  GLU n 
3 15  MET n 
3 16  LEU n 
3 17  ALA n 
3 18  ASP n 
3 19  LYS n 
3 20  ALA n 
3 21  ALA n 
3 22  LEU n 
3 23  VAL n 
3 24  VAL n 
3 25  GLU n 
3 26  VAL n 
3 27  VAL n 
3 28  GLU n 
3 29  GLU n 
3 30  ASN n 
3 31  TYR n 
3 32  HIS n 
3 33  ASP n 
3 34  ALA n 
3 35  PRO n 
3 36  ILE n 
3 37  VAL n 
3 38  GLY n 
3 39  ILE n 
3 40  ALA n 
3 41  VAL n 
3 42  VAL n 
3 43  ASN n 
3 44  GLU n 
3 45  HIS n 
3 46  GLY n 
3 47  ARG n 
3 48  PHE n 
3 49  PHE n 
3 50  LEU n 
3 51  ARG n 
3 52  PRO n 
3 53  GLU n 
3 54  THR n 
3 55  ALA n 
3 56  LEU n 
3 57  ALA n 
3 58  ASP n 
3 59  PRO n 
3 60  GLN n 
3 61  PHE n 
3 62  VAL n 
3 63  ALA n 
3 64  TRP n 
3 65  LEU n 
3 66  GLY n 
3 67  ASP n 
3 68  GLU n 
3 69  THR n 
3 70  LYS n 
3 71  LYS n 
3 72  LYS n 
3 73  SER n 
3 74  MET n 
3 75  PHE n 
3 76  ASP n 
3 77  SER n 
3 78  LYS n 
3 79  ARG n 
3 80  ALA n 
3 81  ALA n 
3 82  VAL n 
3 83  ALA n 
3 84  LEU n 
3 85  LYS n 
3 86  TRP n 
3 87  LYS n 
3 88  GLY n 
3 89  ILE n 
3 90  GLU n 
3 91  LEU n 
3 92  CYS n 
3 93  GLY n 
3 94  VAL n 
3 95  SER n 
3 96  PHE n 
3 97  ASP n 
3 98  LEU n 
3 99  LEU n 
3 100 LEU n 
3 101 ALA n 
3 102 ALA n 
3 103 TYR n 
3 104 LEU n 
3 105 LEU n 
3 106 ASP n 
3 107 PRO n 
3 108 ALA n 
3 109 GLN n 
3 110 GLY n 
3 111 VAL n 
3 112 ASP n 
3 113 ASP n 
3 114 VAL n 
3 115 ALA n 
3 116 ALA n 
3 117 ALA n 
3 118 ALA n 
3 119 LYS n 
3 120 MET n 
3 121 LYS n 
3 122 GLN n 
3 123 TYR n 
3 124 GLU n 
3 125 ALA n 
3 126 VAL n 
3 127 ARG n 
3 128 PRO n 
3 129 ASP n 
3 130 GLU n 
3 131 ALA n 
3 132 VAL n 
3 133 TYR n 
3 134 GLY n 
3 135 LYS n 
3 136 GLY n 
3 137 ALA n 
3 138 LYS n 
3 139 ARG n 
3 140 ALA n 
3 141 VAL n 
3 142 PRO n 
3 143 ASP n 
3 144 GLU n 
3 145 PRO n 
3 146 VAL n 
3 147 LEU n 
3 148 ALA n 
3 149 GLU n 
3 150 HIS n 
3 151 LEU n 
3 152 VAL n 
3 153 ARG n 
3 154 LYS n 
3 155 ALA n 
3 156 ALA n 
3 157 ALA n 
3 158 ILE n 
3 159 TRP n 
3 160 GLU n 
3 161 LEU n 
3 162 GLU n 
3 163 ARG n 
3 164 PRO n 
3 165 PHE n 
3 166 LEU n 
3 167 ASP n 
3 168 GLU n 
3 169 LEU n 
3 170 ARG n 
3 171 ARG n 
3 172 ASN n 
3 173 GLU n 
3 174 GLN n 
3 175 ASP n 
3 176 ARG n 
3 177 LEU n 
3 178 LEU n 
3 179 VAL n 
3 180 GLU n 
3 181 LEU n 
3 182 GLU n 
3 183 GLN n 
3 184 PRO n 
3 185 LEU n 
3 186 SER n 
3 187 SER n 
3 188 ILE n 
3 189 LEU n 
3 190 ALA n 
3 191 GLU n 
3 192 MET n 
3 193 GLU n 
3 194 PHE n 
3 195 ALA n 
3 196 GLY n 
3 197 VAL n 
3 198 LYS n 
3 199 VAL n 
3 200 ASP n 
3 201 THR n 
3 202 LYS n 
3 203 ARG n 
3 204 LEU n 
3 205 GLU n 
3 206 GLN n 
3 207 MET n 
3 208 GLY n 
3 209 LYS n 
3 210 GLU n 
3 211 LEU n 
3 212 ALA n 
3 213 GLU n 
3 214 GLN n 
3 215 LEU n 
3 216 GLY n 
3 217 THR n 
3 218 VAL n 
3 219 GLU n 
3 220 GLN n 
3 221 ARG n 
3 222 ILE n 
3 223 TYR n 
3 224 GLU n 
3 225 LEU n 
3 226 ALA n 
3 227 GLY n 
3 228 GLN n 
3 229 GLU n 
3 230 PHE n 
3 231 ASN n 
3 232 ILE n 
3 233 ASN n 
3 234 SER n 
3 235 PRO n 
3 236 LYS n 
3 237 GLN n 
3 238 LEU n 
3 239 GLY n 
3 240 VAL n 
3 241 ILE n 
3 242 LEU n 
3 243 PHE n 
3 244 GLU n 
3 245 LYS n 
3 246 LEU n 
3 247 GLN n 
3 248 LEU n 
3 249 PRO n 
3 250 VAL n 
3 251 LEU n 
3 252 LYS n 
3 253 LYS n 
3 254 THR n 
3 255 LYS n 
3 256 THR n 
3 257 GLY n 
3 258 TYR n 
3 259 SER n 
3 260 THR n 
3 261 SER n 
3 262 ALA n 
3 263 ASP n 
3 264 VAL n 
3 265 LEU n 
3 266 GLU n 
3 267 LYS n 
3 268 LEU n 
3 269 ALA n 
3 270 PRO n 
3 271 TYR n 
3 272 HIS n 
3 273 GLU n 
3 274 ILE n 
3 275 VAL n 
3 276 GLU n 
3 277 ASN n 
3 278 ILE n 
3 279 LEU n 
3 280 HIS n 
3 281 TYR n 
3 282 ARG n 
3 283 GLN n 
3 284 LEU n 
3 285 GLY n 
3 286 LYS n 
3 287 LEU n 
3 288 GLN n 
3 289 SER n 
3 290 THR n 
3 291 TYR n 
3 292 ILE n 
3 293 GLU n 
3 294 GLY n 
3 295 LEU n 
3 296 LEU n 
3 297 LYS n 
3 298 VAL n 
3 299 VAL n 
3 300 ARG n 
3 301 PRO n 
3 302 ASP n 
3 303 THR n 
3 304 LYS n 
3 305 LYS n 
3 306 VAL n 
3 307 HIS n 
3 308 THR n 
3 309 ILE n 
3 310 PHE n 
3 311 ASN n 
3 312 GLN n 
3 313 ALA n 
3 314 LEU n 
3 315 THR n 
3 316 GLN n 
3 317 THR n 
3 318 GLY n 
3 319 ARG n 
3 320 LEU n 
3 321 SER n 
3 322 SER n 
3 323 THR n 
3 324 GLU n 
3 325 PRO n 
3 326 ASN n 
3 327 LEU n 
3 328 GLN n 
3 329 ASN n 
3 330 ILE n 
3 331 PRO n 
3 332 ILE n 
3 333 ARG n 
3 334 LEU n 
3 335 GLU n 
3 336 GLU n 
3 337 GLY n 
3 338 ARG n 
3 339 LYS n 
3 340 ILE n 
3 341 ARG n 
3 342 GLN n 
3 343 ALA n 
3 344 PHE n 
3 345 VAL n 
3 346 PRO n 
3 347 SER n 
3 348 GLU n 
3 349 SER n 
3 350 ASP n 
3 351 TRP n 
3 352 LEU n 
3 353 ILE n 
3 354 PHE n 
3 355 ALA n 
3 356 ALA n 
3 357 ASP n 
3 358 TYR n 
3 359 SER n 
3 360 GLN n 
3 361 ILE n 
3 362 GLU n 
3 363 LEU n 
3 364 ARG n 
3 365 VAL n 
3 366 LEU n 
3 367 ALA n 
3 368 HIS n 
3 369 ILE n 
3 370 ALA n 
3 371 GLU n 
3 372 ASP n 
3 373 ASP n 
3 374 ASN n 
3 375 LEU n 
3 376 MET n 
3 377 GLU n 
3 378 ALA n 
3 379 PHE n 
3 380 ARG n 
3 381 ARG n 
3 382 ASP n 
3 383 LEU n 
3 384 ASP n 
3 385 ILE n 
3 386 HIS n 
3 387 THR n 
3 388 LYS n 
3 389 THR n 
3 390 ALA n 
3 391 MET n 
3 392 ASP n 
3 393 ILE n 
3 394 PHE n 
3 395 GLN n 
3 396 VAL n 
3 397 SER n 
3 398 GLU n 
3 399 ASP n 
3 400 GLU n 
3 401 VAL n 
3 402 THR n 
3 403 PRO n 
3 404 ASN n 
3 405 MET n 
3 406 ARG n 
3 407 ARG n 
3 408 GLN n 
3 409 ALA n 
3 410 LYS n 
3 411 ALA n 
3 412 VAL n 
3 413 ASN n 
3 414 PHE n 
3 415 GLY n 
3 416 ILE n 
3 417 VAL n 
3 418 TYR n 
3 419 GLY n 
3 420 ILE n 
3 421 SER n 
3 422 ASP n 
3 423 TYR n 
3 424 GLY n 
3 425 LEU n 
3 426 ALA n 
3 427 GLN n 
3 428 ASN n 
3 429 LEU n 
3 430 ASN n 
3 431 ILE n 
3 432 SER n 
3 433 ARG n 
3 434 LYS n 
3 435 GLU n 
3 436 ALA n 
3 437 ALA n 
3 438 GLU n 
3 439 PHE n 
3 440 ILE n 
3 441 GLU n 
3 442 ARG n 
3 443 TYR n 
3 444 PHE n 
3 445 GLU n 
3 446 SER n 
3 447 PHE n 
3 448 PRO n 
3 449 GLY n 
3 450 VAL n 
3 451 LYS n 
3 452 ARG n 
3 453 TYR n 
3 454 MET n 
3 455 GLU n 
3 456 ASN n 
3 457 ILE n 
3 458 VAL n 
3 459 GLN n 
3 460 GLU n 
3 461 ALA n 
3 462 LYS n 
3 463 GLN n 
3 464 LYS n 
3 465 GLY n 
3 466 TYR n 
3 467 VAL n 
3 468 THR n 
3 469 THR n 
3 470 LEU n 
3 471 LEU n 
3 472 HIS n 
3 473 ARG n 
3 474 ARG n 
3 475 ARG n 
3 476 TYR n 
3 477 LEU n 
3 478 PRO n 
3 479 ASP n 
3 480 ILE n 
3 481 THR n 
3 482 SER n 
3 483 ARG n 
3 484 ASN n 
3 485 PHE n 
3 486 ASN n 
3 487 VAL n 
3 488 ARG n 
3 489 SER n 
3 490 PHE n 
3 491 ALA n 
3 492 GLU n 
3 493 ARG n 
3 494 MET n 
3 495 ALA n 
3 496 MET n 
3 497 ASN n 
3 498 THR n 
3 499 PRO n 
3 500 ILE n 
3 501 GLN n 
3 502 GLY n 
3 503 SER n 
3 504 ALA n 
3 505 ALA n 
3 506 ASP n 
3 507 ILE n 
3 508 ILE n 
3 509 LYS n 
3 510 LYS n 
3 511 ALA n 
3 512 MET n 
3 513 ILE n 
3 514 ASP n 
3 515 LEU n 
3 516 ASN n 
3 517 ALA n 
3 518 ARG n 
3 519 LEU n 
3 520 LYS n 
3 521 GLU n 
3 522 GLU n 
3 523 ARG n 
3 524 LEU n 
3 525 GLN n 
3 526 ALA n 
3 527 HIS n 
3 528 LEU n 
3 529 LEU n 
3 530 LEU n 
3 531 GLN n 
3 532 VAL n 
3 533 HIS n 
3 534 ASP n 
3 535 GLU n 
3 536 LEU n 
3 537 ILE n 
3 538 LEU n 
3 539 GLU n 
3 540 ALA n 
3 541 PRO n 
3 542 LYS n 
3 543 GLU n 
3 544 GLU n 
3 545 MET n 
3 546 GLU n 
3 547 ARG n 
3 548 LEU n 
3 549 CYS n 
3 550 ARG n 
3 551 LEU n 
3 552 VAL n 
3 553 PRO n 
3 554 GLU n 
3 555 VAL n 
3 556 MET n 
3 557 GLU n 
3 558 GLN n 
3 559 ALA n 
3 560 VAL n 
3 561 THR n 
3 562 LEU n 
3 563 ARG n 
3 564 VAL n 
3 565 PRO n 
3 566 LEU n 
3 567 LYS n 
3 568 VAL n 
3 569 ASP n 
3 570 TYR n 
3 571 HIS n 
3 572 TYR n 
3 573 GLY n 
3 574 SER n 
3 575 THR n 
3 576 TRP n 
3 577 TYR n 
3 578 ASP n 
3 579 ALA n 
3 580 LYS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Geobacillus 
_entity_src_gen.pdbx_gene_src_gene                 polA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Geobacillus stearothermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PUC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? ? ? ? 'chemically synthesized' 
2 1 sample ? ? ? ? ? 'chemically synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP Q5KWC1_GEOKA Q5KWC1 3 300 ? ? 
2 PDB 2HHT         2HHT   1 ?   ? ? 
3 PDB 2HHT         2HHT   2 ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2HHT A 2 ? 580 ? Q5KWC1 300 ? 878 ? 298 876 
2 2 2HHT B 1 ? 12  ? 2HHT   19  ? 30  ? 19  30  
3 3 2HHT C 1 ? 16  ? 2HHT   3   ? 18  ? 3   18  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
6OG 'DNA linking'       n 
;6-O-METHYL GUANOSINE-5'-MONOPHOSPHATE
;
? 'C11 H16 N5 O7 P' 361.248 
ALA 'L-peptide linking' y ALANINE                                 ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                              ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                         ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"    ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"     ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"    ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"            ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                               ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                         ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                 ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                               ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                   ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                              ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                 ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                  ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                              ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                         ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                           ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                 ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                  ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                           ? 'O4 S -2'         96.063  
SUC saccharide          . SUCROSE                                 ? 'C12 H22 O11'     342.296 
THR 'L-peptide linking' y THREONINE                               ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                              ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                  ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2HHT 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.95 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   58.33 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'45% saturated ammonium sulfate, 2.5% MPD, 100 mM MES, pH 5.8, VAPOR DIFFUSION, HANGING DROP, temperature 290K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 'ammonium sulfate' ? ? ? 
1 2 1 MPD                ? ? ? 
1 3 1 MES                ? ? ? 
1 4 1 H2O                ? ? ? 
1 5 2 'ammonium sulfate' ? ? ? 
1 6 2 MPD                ? ? ? 
1 7 2 H2O                ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Yale mirrors' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     2HHT 
_reflns.d_resolution_high            2.050 
_reflns.number_obs                   50787 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_netI_over_sigmaI        20.150 
_reflns.percent_possible_obs         89.800 
_reflns.B_iso_Wilson_estimate        27.239 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_low             50 
_reflns.number_all                   50787 
_reflns.pdbx_Rsym_value              0.053 
_reflns.pdbx_redundancy              4.3 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.05 
_reflns_shell.d_res_low              2.12 
_reflns_shell.number_measured_obs    7765 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    4.7 
_reflns_shell.pdbx_Rsym_value        0.229 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_redundancy        2.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2846 
_reflns_shell.percent_possible_all   53.40 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2HHT 
_refine.ls_d_res_high                            2.050 
_refine.ls_d_res_low                             50.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    90.400 
_refine.ls_number_reflns_obs                     50609 
_refine.ls_R_factor_R_work                       0.197 
_refine.ls_R_factor_R_free                       0.229 
_refine.ls_percent_reflns_R_free                 4.600 
_refine.ls_number_reflns_R_free                  2575 
_refine.B_iso_mean                               26.870 
_refine.solvent_model_param_bsol                 50.625 
_refine.aniso_B[1][1]                            -6.603 
_refine.aniso_B[2][2]                            3.336 
_refine.aniso_B[3][3]                            3.267 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     50787 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2HHT 
_refine_analyze.Luzzati_coordinate_error_obs    0.23 
_refine_analyze.Luzzati_sigma_a_obs             0.18 
_refine_analyze.Luzzati_d_res_low_obs           5 
_refine_analyze.Luzzati_coordinate_error_free   0.27 
_refine_analyze.Luzzati_sigma_a_free            0.24 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4650 
_refine_hist.pdbx_number_atoms_nucleic_acid   529 
_refine_hist.pdbx_number_atoms_ligand         72 
_refine_hist.number_atoms_solvent             538 
_refine_hist.number_atoms_total               5789 
_refine_hist.d_res_high                       2.050 
_refine_hist.d_res_low                        50.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           ? 0.006 ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d          ? 1.122 ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d ? 22.3  ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d ? 0.949 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.05 
_refine_ls_shell.d_res_low                        2.12 
_refine_ls_shell.number_reflns_obs                3052 
_refine_ls_shell.number_reflns_R_free             157 
_refine_ls_shell.R_factor_R_work                  0.2424 
_refine_ls_shell.R_factor_R_free                  0.3037 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_obs               55 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 CNS_TOPPAR:protein_rep.param             ? 'X-RAY DIFFRACTION' 
2 CNS_TOPPAR:dna-rna-multi-endo-new2.param ? 'X-RAY DIFFRACTION' 
3 CNS_TOPPAR:water_rep.param               ? 'X-RAY DIFFRACTION' 
4 CNS_TOPPAR:ion.param                     ? 'X-RAY DIFFRACTION' 
5 CNS_TOPPAR:sucrose.par                   ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2HHT 
_struct.title                     'C:O6-methyl-guanine pair in the polymerase-2 basepair position' 
_struct.pdbx_descriptor           'DNA polymerase I (E.C.2.7.7.7)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HHT 
_struct_keywords.pdbx_keywords   Transferase/DNA 
_struct_keywords.text            
'DNA polymerase I, DNA replication, Klenow fragment, Protein-DNA complex, O6-methyl-guanine, Transferase-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 7 ? 
M N N 7 ? 
N N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The asymmetric unit contains one biological assembly.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR C 12  ? ALA C 17  ? THR A 308 ALA A 313 5 ? 6  
HELX_P HELX_P2  2  ARG C 51  ? LEU C 56  ? ARG A 347 LEU A 352 1 ? 6  
HELX_P HELX_P3  3  ASP C 58  ? GLY C 66  ? ASP A 354 GLY A 362 1 ? 9  
HELX_P HELX_P4  4  ASP C 76  ? TRP C 86  ? ASP A 372 TRP A 382 1 ? 11 
HELX_P HELX_P5  5  LEU C 98  ? ASP C 106 ? LEU A 394 ASP A 402 1 ? 9  
HELX_P HELX_P6  6  PRO C 107 ? GLY C 110 ? PRO A 403 GLY A 406 5 ? 4  
HELX_P HELX_P7  7  ASP C 113 ? MET C 120 ? ASP A 409 MET A 416 1 ? 8  
HELX_P HELX_P8  8  PRO C 128 ? GLY C 134 ? PRO A 424 GLY A 430 1 ? 7  
HELX_P HELX_P9  9  LYS C 135 ? ARG C 139 ? LYS A 431 ARG A 435 5 ? 5  
HELX_P HELX_P10 10 ASP C 143 ? ASN C 172 ? ASP A 439 ASN A 468 1 ? 30 
HELX_P HELX_P11 11 GLN C 174 ? GLU C 180 ? GLN A 470 GLU A 476 1 ? 7  
HELX_P HELX_P12 12 LEU C 181 ? GLY C 196 ? LEU A 477 GLY A 492 1 ? 16 
HELX_P HELX_P13 13 ASP C 200 ? GLY C 227 ? ASP A 496 GLY A 523 1 ? 28 
HELX_P HELX_P14 14 SER C 234 ? GLU C 244 ? SER A 530 GLU A 540 1 ? 11 
HELX_P HELX_P15 15 SER C 261 ? ALA C 269 ? SER A 557 ALA A 565 1 ? 9  
HELX_P HELX_P16 16 GLU C 273 ? ILE C 292 ? GLU A 569 ILE A 588 1 ? 20 
HELX_P HELX_P17 17 ILE C 292 ? VAL C 299 ? ILE A 588 VAL A 595 1 ? 8  
HELX_P HELX_P18 18 LEU C 334 ? LYS C 339 ? LEU A 630 LYS A 635 1 ? 6  
HELX_P HELX_P19 19 ILE C 340 ? GLN C 342 ? ILE A 636 GLN A 638 5 ? 3  
HELX_P HELX_P20 20 GLN C 360 ? GLU C 371 ? GLN A 656 GLU A 667 1 ? 12 
HELX_P HELX_P21 21 ASP C 372 ? ARG C 381 ? ASP A 668 ARG A 677 1 ? 10 
HELX_P HELX_P22 22 ASP C 384 ? GLN C 395 ? ASP A 680 GLN A 691 1 ? 12 
HELX_P HELX_P23 23 SER C 397 ? VAL C 401 ? SER A 693 VAL A 697 5 ? 5  
HELX_P HELX_P24 24 THR C 402 ? GLY C 419 ? THR A 698 GLY A 715 1 ? 18 
HELX_P HELX_P25 25 SER C 421 ? ASN C 430 ? SER A 717 ASN A 726 1 ? 10 
HELX_P HELX_P26 26 SER C 432 ? PHE C 447 ? SER A 728 PHE A 743 1 ? 16 
HELX_P HELX_P27 27 PHE C 447 ? GLY C 465 ? PHE A 743 GLY A 761 1 ? 19 
HELX_P HELX_P28 28 PRO C 478 ? SER C 482 ? PRO A 774 SER A 778 5 ? 5  
HELX_P HELX_P29 29 ASN C 484 ? GLU C 522 ? ASN A 780 GLU A 818 1 ? 39 
HELX_P HELX_P30 30 GLU C 544 ? GLN C 558 ? GLU A 840 GLN A 854 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? K MG  .  MG    ? ? ? 1_555 C ASP 357 OD1 ? ? A MG  920 A ASP 653  1_555 ? ? ? ? ? ? ?             2.787 ? 
metalc2  metalc ? ? K MG  .  MG    ? ? ? 1_555 N HOH .   O   ? ? A MG  920 A HOH 2525 1_555 ? ? ? ? ? ? ?             3.026 ? 
metalc3  metalc ? ? K MG  .  MG    ? ? ? 1_555 C ASP 534 OD2 ? ? A MG  920 A ASP 830  1_555 ? ? ? ? ? ? ?             2.824 ? 
metalc4  metalc ? ? K MG  .  MG    ? ? ? 1_555 C TYR 358 O   ? ? A MG  920 A TYR 654  1_555 ? ? ? ? ? ? ?             2.816 ? 
covale1  covale ? ? B DC  4  "O3'" ? ? ? 1_555 B 6OG 5   P   ? ? C DC  6   C 6OG 7    1_555 ? ? ? ? ? ? ?             1.610 ? 
covale2  covale ? ? B 6OG 5  "O3'" ? ? ? 1_555 B DA  6   P   ? ? C 6OG 7   C DA  8    1_555 ? ? ? ? ? ? ?             1.612 ? 
hydrog1  hydrog ? ? A DG  1  N1    ? ? ? 1_555 B DC  15  O2  ? ? B DG  19  C DC  17   1_555 ? ? ? ? ? ? 'DG-DC PAIR'  ?     ? 
hydrog2  hydrog ? ? A DC  2  O2    ? ? ? 1_555 B DG  14  N1  ? ? B DC  20  C DG  16   1_555 ? ? ? ? ? ? 'DC-DG PAIR'  ?     ? 
hydrog3  hydrog ? ? A DG  3  N2    ? ? ? 1_555 B DC  13  O2  ? ? B DG  21  C DC  15   1_555 ? ? ? ? ? ? 'DG-DC PAIR'  ?     ? 
hydrog4  hydrog ? ? A DA  4  N1    ? ? ? 1_555 B DT  12  N3  ? ? B DA  22  C DT  14   1_555 ? ? ? ? ? ? 'DA-DT PAIR'  ?     ? 
hydrog5  hydrog ? ? A DT  5  N3    ? ? ? 1_555 B DA  11  N1  ? ? B DT  23  C DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog6  hydrog ? ? A DT  5  O4    ? ? ? 1_555 B DA  11  N6  ? ? B DT  23  C DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog7  hydrog ? ? A DC  6  O2    ? ? ? 1_555 B DG  10  N2  ? ? B DC  24  C DG  12   1_555 ? ? ? ? ? ? 'DC-DG PAIR'  ?     ? 
hydrog8  hydrog ? ? A DA  7  N1    ? ? ? 1_555 B DT  9   N3  ? ? B DA  25  C DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog9  hydrog ? ? A DA  7  N6    ? ? ? 1_555 B DT  9   O4  ? ? B DA  25  C DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog10 hydrog ? ? A DG  8  N1    ? ? ? 1_555 B DC  8   N3  ? ? B DG  26  C DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog11 hydrog ? ? A DG  8  N2    ? ? ? 1_555 B DC  8   O2  ? ? B DG  26  C DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog12 hydrog ? ? A DG  8  O6    ? ? ? 1_555 B DC  8   N4  ? ? B DG  26  C DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog13 hydrog ? ? A DC  9  N3    ? ? ? 1_555 B DG  7   N1  ? ? B DC  27  C DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog14 hydrog ? ? A DC  9  N4    ? ? ? 1_555 B DG  7   O6  ? ? B DC  27  C DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog15 hydrog ? ? A DC  9  O2    ? ? ? 1_555 B DG  7   N2  ? ? B DC  27  C DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog16 hydrog ? ? A DT  10 N3    ? ? ? 1_555 B DA  6   N1  ? ? B DT  28  C DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog17 hydrog ? ? A DT  10 O4    ? ? ? 1_555 B DA  6   N6  ? ? B DT  28  C DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog18 hydrog ? ? A DC  11 O2    ? ? ? 1_555 B 6OG 5   N2  ? ? B DC  29  C 6OG 7    1_555 ? ? ? ? ? ? 'DC-6OG PAIR' ?     ? 
hydrog19 hydrog ? ? A DG  12 N1    ? ? ? 1_555 B DC  4   N3  ? ? B DG  30  C DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog20 hydrog ? ? A DG  12 N2    ? ? ? 1_555 B DC  4   O2  ? ? B DG  30  C DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog21 hydrog ? ? A DG  12 O6    ? ? ? 1_555 B DC  4   N4  ? ? B DG  30  C DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           324 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            620 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    325 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     621 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.00 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 4 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR C 6   ? LEU C 7   ? THR A 302 LEU A 303 
A 2 GLY C 46  ? LEU C 50  ? GLY A 342 LEU A 346 
A 3 GLY C 38  ? ASN C 43  ? GLY A 334 ASN A 339 
A 4 LYS C 19  ? GLU C 25  ? LYS A 315 GLU A 321 
A 5 LYS C 71  ? MET C 74  ? LYS A 367 MET A 370 
A 6 VAL C 94  ? ASP C 97  ? VAL A 390 ASP A 393 
B 1 LYS C 305 ? VAL C 306 ? LYS A 601 VAL A 602 
B 2 VAL C 197 ? VAL C 199 ? VAL A 493 VAL A 495 
B 3 PHE C 344 ? VAL C 345 ? PHE A 640 VAL A 641 
C 1 ILE C 309 ? ASN C 311 ? ILE A 605 ASN A 607 
C 2 SER C 321 ? THR C 323 ? SER A 617 THR A 619 
D 1 HIS C 527 ? GLN C 531 ? HIS A 823 GLN A 827 
D 2 GLU C 535 ? PRO C 541 ? GLU A 831 PRO A 837 
D 3 TRP C 351 ? TYR C 358 ? TRP A 647 TYR A 654 
D 4 VAL C 568 ? GLY C 573 ? VAL A 864 GLY A 869 
E 1 TYR C 466 ? THR C 468 ? TYR A 762 THR A 764 
E 2 ARG C 474 ? TYR C 476 ? ARG A 770 TYR A 772 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR C 6   ? N THR A 302 O ARG C 47  ? O ARG A 343 
A 2 3 O PHE C 48  ? O PHE A 344 N VAL C 41  ? N VAL A 337 
A 3 4 O VAL C 42  ? O VAL A 338 N ALA C 21  ? N ALA A 317 
A 4 5 N LEU C 22  ? N LEU A 318 O SER C 73  ? O SER A 369 
A 5 6 N MET C 74  ? N MET A 370 O PHE C 96  ? O PHE A 392 
B 1 2 O VAL C 306 ? O VAL A 602 N VAL C 197 ? N VAL A 493 
B 2 3 N LYS C 198 ? N LYS A 494 O VAL C 345 ? O VAL A 641 
C 1 2 N ILE C 309 ? N ILE A 605 O THR C 323 ? O THR A 619 
D 1 2 N LEU C 529 ? N LEU A 825 O ILE C 537 ? O ILE A 833 
D 2 3 O LEU C 538 ? O LEU A 834 N PHE C 354 ? N PHE A 650 
D 3 4 N ALA C 355 ? N ALA A 651 O HIS C 571 ? O HIS A 867 
E 1 2 N VAL C 467 ? N VAL A 763 O ARG C 475 ? O ARG A 771 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE SUC A 901' 
AC2 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE SUC A 902' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 910' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 911' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 912' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 913' 
AC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 A 914' 
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 920'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 GLU C 29  ? GLU A 325  . ? 1_555 ? 
2  AC1 13 TYR C 31  ? TYR A 327  . ? 1_555 ? 
3  AC1 13 ASP C 76  ? ASP A 372  . ? 1_555 ? 
4  AC1 13 ARG C 79  ? ARG A 375  . ? 1_555 ? 
5  AC1 13 LEU C 99  ? LEU A 395  . ? 1_555 ? 
6  AC1 13 ASP C 112 ? ASP A 408  . ? 1_555 ? 
7  AC1 13 ILE C 309 ? ILE A 605  . ? 1_555 ? 
8  AC1 13 ASN C 311 ? ASN A 607  . ? 1_555 ? 
9  AC1 13 HOH N .   ? HOH A 1031 . ? 1_555 ? 
10 AC1 13 HOH N .   ? HOH A 1045 . ? 1_555 ? 
11 AC1 13 HOH N .   ? HOH A 2121 . ? 1_555 ? 
12 AC1 13 HOH N .   ? HOH A 2268 . ? 1_555 ? 
13 AC1 13 HOH N .   ? HOH A 3198 . ? 1_555 ? 
14 AC2 13 GLU C 244 ? GLU A 540  . ? 4_456 ? 
15 AC2 13 GLN C 247 ? GLN A 543  . ? 4_456 ? 
16 AC2 13 TYR C 258 ? TYR A 554  . ? 4_456 ? 
17 AC2 13 GLU C 455 ? GLU A 751  . ? 1_555 ? 
18 AC2 13 LYS C 462 ? LYS A 758  . ? 1_555 ? 
19 AC2 13 ARG C 488 ? ARG A 784  . ? 1_555 ? 
20 AC2 13 GLU C 492 ? GLU A 788  . ? 1_555 ? 
21 AC2 13 HOH N .   ? HOH A 2619 . ? 1_555 ? 
22 AC2 13 HOH N .   ? HOH A 2646 . ? 1_555 ? 
23 AC2 13 HOH N .   ? HOH A 2810 . ? 1_555 ? 
24 AC2 13 HOH N .   ? HOH A 2819 . ? 1_555 ? 
25 AC2 13 HOH N .   ? HOH A 2892 . ? 1_555 ? 
26 AC2 13 HOH N .   ? HOH A 3254 . ? 1_555 ? 
27 AC3 4  HIS C 386 ? HIS A 682  . ? 1_555 ? 
28 AC3 4  ARG C 406 ? ARG A 702  . ? 1_555 ? 
29 AC3 4  LYS C 410 ? LYS A 706  . ? 1_555 ? 
30 AC3 4  HOH N .   ? HOH A 2816 . ? 1_555 ? 
31 AC4 4  ARG C 483 ? ARG A 779  . ? 3_555 ? 
32 AC4 4  ARG C 523 ? ARG A 819  . ? 1_555 ? 
33 AC4 4  HOH N .   ? HOH A 2743 . ? 1_555 ? 
34 AC4 4  HOH N .   ? HOH A 3222 . ? 2_564 ? 
35 AC5 4  MET C 3   ? MET A 299  . ? 1_555 ? 
36 AC5 4  ALA C 4   ? ALA A 300  . ? 1_555 ? 
37 AC5 4  ARG C 47  ? ARG A 343  . ? 1_555 ? 
38 AC5 4  ARG C 381 ? ARG A 677  . ? 3_545 ? 
39 AC6 4  SER C 349 ? SER A 645  . ? 2_565 ? 
40 AC6 4  SER C 432 ? SER A 728  . ? 1_555 ? 
41 AC6 4  ARG C 433 ? ARG A 729  . ? 1_555 ? 
42 AC6 4  HOH N .   ? HOH A 2823 . ? 1_555 ? 
43 AC7 2  ILE C 420 ? ILE A 716  . ? 1_555 ? 
44 AC7 2  ILE C 440 ? ILE A 736  . ? 1_555 ? 
45 AC8 4  ASP C 357 ? ASP A 653  . ? 1_555 ? 
46 AC8 4  TYR C 358 ? TYR A 654  . ? 1_555 ? 
47 AC8 4  ASP C 534 ? ASP A 830  . ? 1_555 ? 
48 AC8 4  HOH N .   ? HOH A 2525 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2HHT 
_atom_sites.fract_transf_matrix[1][1]   0.011381 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010703 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009340 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 1   ? 44.543  20.655 21.285  1.00 84.11  ? 19   DG  B "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 1   ? 44.265  20.322 19.920  1.00 84.45  ? 19   DG  B "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 1   ? 43.095  19.373 19.787  1.00 84.41  ? 19   DG  B "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 1   ? 43.293  18.232 20.649  1.00 84.10  ? 19   DG  B "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 1   ? 41.743  19.954 20.189  1.00 84.59  ? 19   DG  B "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 1   ? 41.136  20.582 19.049  1.00 85.43  ? 19   DG  B "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 1   ? 40.965  18.726 20.626  1.00 83.90  ? 19   DG  B "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 1   ? 42.045  17.797 21.182  1.00 83.79  ? 19   DG  B "C1'" 1 
ATOM   9    N  N9    . DG  A 1 1   ? 42.170  17.755 22.638  1.00 83.24  ? 19   DG  B N9    1 
ATOM   10   C  C8    . DG  A 1 1   ? 43.018  18.504 23.421  1.00 82.81  ? 19   DG  B C8    1 
ATOM   11   N  N7    . DG  A 1 1   ? 42.919  18.228 24.694  1.00 82.67  ? 19   DG  B N7    1 
ATOM   12   C  C5    . DG  A 1 1   ? 41.943  17.242 24.758  1.00 82.69  ? 19   DG  B C5    1 
ATOM   13   C  C6    . DG  A 1 1   ? 41.411  16.545 25.878  1.00 82.42  ? 19   DG  B C6    1 
ATOM   14   O  O6    . DG  A 1 1   ? 41.713  16.658 27.072  1.00 81.88  ? 19   DG  B O6    1 
ATOM   15   N  N1    . DG  A 1 1   ? 40.434  15.631 25.494  1.00 82.38  ? 19   DG  B N1    1 
ATOM   16   C  C2    . DG  A 1 1   ? 40.023  15.410 24.202  1.00 82.62  ? 19   DG  B C2    1 
ATOM   17   N  N2    . DG  A 1 1   ? 39.064  14.488 24.037  1.00 82.65  ? 19   DG  B N2    1 
ATOM   18   N  N3    . DG  A 1 1   ? 40.514  16.047 23.149  1.00 82.98  ? 19   DG  B N3    1 
ATOM   19   C  C4    . DG  A 1 1   ? 41.464  16.943 23.499  1.00 83.02  ? 19   DG  B C4    1 
ATOM   20   P  P     . DC  A 1 2   ? 40.183  21.867 19.245  1.00 86.19  ? 20   DC  B P     1 
ATOM   21   O  OP1   . DC  A 1 2   ? 40.020  22.524 17.919  1.00 86.10  ? 20   DC  B OP1   1 
ATOM   22   O  OP2   . DC  A 1 2   ? 40.703  22.656 20.395  1.00 85.94  ? 20   DC  B OP2   1 
ATOM   23   O  "O5'" . DC  A 1 2   ? 38.776  21.248 19.663  1.00 85.20  ? 20   DC  B "O5'" 1 
ATOM   24   C  "C5'" . DC  A 1 2   ? 38.111  20.285 18.822  1.00 83.49  ? 20   DC  B "C5'" 1 
ATOM   25   C  "C4'" . DC  A 1 2   ? 37.176  19.433 19.647  1.00 82.44  ? 20   DC  B "C4'" 1 
ATOM   26   O  "O4'" . DC  A 1 2   ? 37.933  18.773 20.685  1.00 81.89  ? 20   DC  B "O4'" 1 
ATOM   27   C  "C3'" . DC  A 1 2   ? 36.082  20.205 20.377  1.00 81.75  ? 20   DC  B "C3'" 1 
ATOM   28   O  "O3'" . DC  A 1 2   ? 34.928  20.314 19.533  1.00 81.85  ? 20   DC  B "O3'" 1 
ATOM   29   C  "C2'" . DC  A 1 2   ? 35.809  19.339 21.591  1.00 81.25  ? 20   DC  B "C2'" 1 
ATOM   30   C  "C1'" . DC  A 1 2   ? 37.167  18.707 21.885  1.00 81.13  ? 20   DC  B "C1'" 1 
ATOM   31   N  N1    . DC  A 1 2   ? 37.946  19.351 22.964  1.00 80.27  ? 20   DC  B N1    1 
ATOM   32   C  C2    . DC  A 1 2   ? 37.668  19.001 24.292  1.00 79.55  ? 20   DC  B C2    1 
ATOM   33   O  O2    . DC  A 1 2   ? 36.764  18.189 24.520  1.00 79.27  ? 20   DC  B O2    1 
ATOM   34   N  N3    . DC  A 1 2   ? 38.390  19.560 25.290  1.00 79.34  ? 20   DC  B N3    1 
ATOM   35   C  C4    . DC  A 1 2   ? 39.351  20.441 25.006  1.00 79.67  ? 20   DC  B C4    1 
ATOM   36   N  N4    . DC  A 1 2   ? 40.046  20.959 26.022  1.00 79.38  ? 20   DC  B N4    1 
ATOM   37   C  C5    . DC  A 1 2   ? 39.645  20.829 23.665  1.00 79.82  ? 20   DC  B C5    1 
ATOM   38   C  C6    . DC  A 1 2   ? 38.926  20.265 22.685  1.00 80.14  ? 20   DC  B C6    1 
ATOM   39   P  P     . DG  A 1 3   ? 33.719  21.294 19.944  1.00 82.12  ? 21   DG  B P     1 
ATOM   40   O  OP1   . DG  A 1 3   ? 32.745  21.316 18.821  1.00 82.16  ? 21   DG  B OP1   1 
ATOM   41   O  OP2   . DG  A 1 3   ? 34.314  22.570 20.425  1.00 82.17  ? 21   DG  B OP2   1 
ATOM   42   O  "O5'" . DG  A 1 3   ? 33.031  20.563 21.182  1.00 80.63  ? 21   DG  B "O5'" 1 
ATOM   43   C  "C5'" . DG  A 1 3   ? 32.578  19.199 21.074  1.00 77.68  ? 21   DG  B "C5'" 1 
ATOM   44   C  "C4'" . DG  A 1 3   ? 32.027  18.718 22.398  1.00 76.39  ? 21   DG  B "C4'" 1 
ATOM   45   O  "O4'" . DG  A 1 3   ? 33.073  18.742 23.400  1.00 76.13  ? 21   DG  B "O4'" 1 
ATOM   46   C  "C3'" . DG  A 1 3   ? 30.870  19.539 22.970  1.00 75.90  ? 21   DG  B "C3'" 1 
ATOM   47   O  "O3'" . DG  A 1 3   ? 29.910  18.660 23.572  1.00 75.25  ? 21   DG  B "O3'" 1 
ATOM   48   C  "C2'" . DG  A 1 3   ? 31.530  20.395 24.036  1.00 75.56  ? 21   DG  B "C2'" 1 
ATOM   49   C  "C1'" . DG  A 1 3   ? 32.662  19.507 24.524  1.00 75.12  ? 21   DG  B "C1'" 1 
ATOM   50   N  N9    . DG  A 1 3   ? 33.825  20.238 25.022  1.00 74.23  ? 21   DG  B N9    1 
ATOM   51   C  C8    . DG  A 1 3   ? 34.535  21.221 24.372  1.00 74.06  ? 21   DG  B C8    1 
ATOM   52   N  N7    . DG  A 1 3   ? 35.527  21.690 25.079  1.00 73.60  ? 21   DG  B N7    1 
ATOM   53   C  C5    . DG  A 1 3   ? 35.471  20.974 26.268  1.00 73.14  ? 21   DG  B C5    1 
ATOM   54   C  C6    . DG  A 1 3   ? 36.295  21.042 27.421  1.00 73.02  ? 21   DG  B C6    1 
ATOM   55   O  O6    . DG  A 1 3   ? 37.270  21.773 27.631  1.00 72.81  ? 21   DG  B O6    1 
ATOM   56   N  N1    . DG  A 1 3   ? 35.886  20.138 28.395  1.00 72.87  ? 21   DG  B N1    1 
ATOM   57   C  C2    . DG  A 1 3   ? 34.822  19.279 28.278  1.00 72.57  ? 21   DG  B C2    1 
ATOM   58   N  N2    . DG  A 1 3   ? 34.587  18.482 29.331  1.00 72.79  ? 21   DG  B N2    1 
ATOM   59   N  N3    . DG  A 1 3   ? 34.045  19.205 27.209  1.00 72.67  ? 21   DG  B N3    1 
ATOM   60   C  C4    . DG  A 1 3   ? 34.425  20.075 26.249  1.00 73.13  ? 21   DG  B C4    1 
ATOM   61   P  P     . DA  A 1 4   ? 28.548  19.255 24.191  1.00 75.16  ? 22   DA  B P     1 
ATOM   62   O  OP1   . DA  A 1 4   ? 27.421  18.377 23.783  1.00 74.81  ? 22   DA  B OP1   1 
ATOM   63   O  OP2   . DA  A 1 4   ? 28.486  20.714 23.897  1.00 75.34  ? 22   DA  B OP2   1 
ATOM   64   O  "O5'" . DA  A 1 4   ? 28.754  19.085 25.760  1.00 73.87  ? 22   DA  B "O5'" 1 
ATOM   65   C  "C5'" . DA  A 1 4   ? 28.870  17.777 26.346  1.00 71.22  ? 22   DA  B "C5'" 1 
ATOM   66   C  "C4'" . DA  A 1 4   ? 28.950  17.882 27.851  1.00 68.96  ? 22   DA  B "C4'" 1 
ATOM   67   O  "O4'" . DA  A 1 4   ? 30.209  18.490 28.229  1.00 67.11  ? 22   DA  B "O4'" 1 
ATOM   68   C  "C3'" . DA  A 1 4   ? 27.853  18.726 28.500  1.00 68.11  ? 22   DA  B "C3'" 1 
ATOM   69   O  "O3'" . DA  A 1 4   ? 27.413  18.095 29.709  1.00 67.93  ? 22   DA  B "O3'" 1 
ATOM   70   C  "C2'" . DA  A 1 4   ? 28.543  20.050 28.785  1.00 66.67  ? 22   DA  B "C2'" 1 
ATOM   71   C  "C1'" . DA  A 1 4   ? 29.987  19.642 29.028  1.00 65.78  ? 22   DA  B "C1'" 1 
ATOM   72   N  N9    . DA  A 1 4   ? 30.980  20.650 28.643  1.00 63.51  ? 22   DA  B N9    1 
ATOM   73   C  C8    . DA  A 1 4   ? 31.041  21.389 27.485  1.00 62.75  ? 22   DA  B C8    1 
ATOM   74   N  N7    . DA  A 1 4   ? 32.060  22.212 27.435  1.00 61.87  ? 22   DA  B N7    1 
ATOM   75   C  C5    . DA  A 1 4   ? 32.716  22.003 28.640  1.00 62.25  ? 22   DA  B C5    1 
ATOM   76   C  C6    . DA  A 1 4   ? 33.879  22.569 29.195  1.00 62.37  ? 22   DA  B C6    1 
ATOM   77   N  N6    . DA  A 1 4   ? 34.617  23.498 28.582  1.00 61.80  ? 22   DA  B N6    1 
ATOM   78   N  N1    . DA  A 1 4   ? 34.264  22.139 30.417  1.00 62.60  ? 22   DA  B N1    1 
ATOM   79   C  C2    . DA  A 1 4   ? 33.526  21.203 31.030  1.00 62.20  ? 22   DA  B C2    1 
ATOM   80   N  N3    . DA  A 1 4   ? 32.417  20.596 30.611  1.00 62.06  ? 22   DA  B N3    1 
ATOM   81   C  C4    . DA  A 1 4   ? 32.060  21.045 29.395  1.00 62.82  ? 22   DA  B C4    1 
ATOM   82   P  P     . DT  A 1 5   ? 26.350  18.833 30.666  1.00 68.34  ? 23   DT  B P     1 
ATOM   83   O  OP1   . DT  A 1 5   ? 25.406  17.811 31.188  1.00 68.67  ? 23   DT  B OP1   1 
ATOM   84   O  OP2   . DT  A 1 5   ? 25.815  20.032 29.964  1.00 69.18  ? 23   DT  B OP2   1 
ATOM   85   O  "O5'" . DT  A 1 5   ? 27.255  19.326 31.879  1.00 67.09  ? 23   DT  B "O5'" 1 
ATOM   86   C  "C5'" . DT  A 1 5   ? 28.072  18.384 32.596  1.00 65.36  ? 23   DT  B "C5'" 1 
ATOM   87   C  "C4'" . DT  A 1 5   ? 28.702  19.036 33.804  1.00 63.73  ? 23   DT  B "C4'" 1 
ATOM   88   O  "O4'" . DT  A 1 5   ? 29.796  19.898 33.411  1.00 63.07  ? 23   DT  B "O4'" 1 
ATOM   89   C  "C3'" . DT  A 1 5   ? 27.759  19.889 34.652  1.00 62.70  ? 23   DT  B "C3'" 1 
ATOM   90   O  "O3'" . DT  A 1 5   ? 28.015  19.632 36.035  1.00 62.46  ? 23   DT  B "O3'" 1 
ATOM   91   C  "C2'" . DT  A 1 5   ? 28.132  21.314 34.278  1.00 62.20  ? 23   DT  B "C2'" 1 
ATOM   92   C  "C1'" . DT  A 1 5   ? 29.612  21.203 33.937  1.00 61.54  ? 23   DT  B "C1'" 1 
ATOM   93   N  N1    . DT  A 1 5   ? 30.108  22.172 32.930  1.00 60.85  ? 23   DT  B N1    1 
ATOM   94   C  C2    . DT  A 1 5   ? 31.331  22.776 33.156  1.00 60.16  ? 23   DT  B C2    1 
ATOM   95   O  O2    . DT  A 1 5   ? 32.018  22.559 34.143  1.00 58.84  ? 23   DT  B O2    1 
ATOM   96   N  N3    . DT  A 1 5   ? 31.725  23.652 32.175  1.00 60.36  ? 23   DT  B N3    1 
ATOM   97   C  C4    . DT  A 1 5   ? 31.041  23.982 31.021  1.00 61.20  ? 23   DT  B C4    1 
ATOM   98   O  O4    . DT  A 1 5   ? 31.530  24.788 30.231  1.00 62.04  ? 23   DT  B O4    1 
ATOM   99   C  C5    . DT  A 1 5   ? 29.764  23.317 30.849  1.00 60.85  ? 23   DT  B C5    1 
ATOM   100  C  C7    . DT  A 1 5   ? 28.945  23.612 29.632  1.00 61.20  ? 23   DT  B C7    1 
ATOM   101  C  C6    . DT  A 1 5   ? 29.370  22.458 31.798  1.00 60.32  ? 23   DT  B C6    1 
ATOM   102  P  P     . DC  A 1 6   ? 27.180  20.409 37.168  1.00 62.66  ? 24   DC  B P     1 
ATOM   103  O  OP1   . DC  A 1 6   ? 26.781  19.421 38.203  1.00 61.89  ? 24   DC  B OP1   1 
ATOM   104  O  OP2   . DC  A 1 6   ? 26.137  21.249 36.512  1.00 62.23  ? 24   DC  B OP2   1 
ATOM   105  O  "O5'" . DC  A 1 6   ? 28.278  21.372 37.800  1.00 60.52  ? 24   DC  B "O5'" 1 
ATOM   106  C  "C5'" . DC  A 1 6   ? 29.571  20.854 38.168  1.00 57.57  ? 24   DC  B "C5'" 1 
ATOM   107  C  "C4'" . DC  A 1 6   ? 30.476  21.971 38.634  1.00 55.68  ? 24   DC  B "C4'" 1 
ATOM   108  O  "O4'" . DC  A 1 6   ? 30.944  22.767 37.518  1.00 54.95  ? 24   DC  B "O4'" 1 
ATOM   109  C  "C3'" . DC  A 1 6   ? 29.838  22.944 39.621  1.00 54.19  ? 24   DC  B "C3'" 1 
ATOM   110  O  "O3'" . DC  A 1 6   ? 30.772  23.240 40.658  1.00 52.34  ? 24   DC  B "O3'" 1 
ATOM   111  C  "C2'" . DC  A 1 6   ? 29.546  24.175 38.778  1.00 53.03  ? 24   DC  B "C2'" 1 
ATOM   112  C  "C1'" . DC  A 1 6   ? 30.655  24.142 37.736  1.00 53.04  ? 24   DC  B "C1'" 1 
ATOM   113  N  N1    . DC  A 1 6   ? 30.322  24.750 36.429  1.00 51.22  ? 24   DC  B N1    1 
ATOM   114  C  C2    . DC  A 1 6   ? 31.158  25.763 35.915  1.00 50.46  ? 24   DC  B C2    1 
ATOM   115  O  O2    . DC  A 1 6   ? 32.146  26.131 36.574  1.00 50.74  ? 24   DC  B O2    1 
ATOM   116  N  N3    . DC  A 1 6   ? 30.865  26.314 34.715  1.00 49.79  ? 24   DC  B N3    1 
ATOM   117  C  C4    . DC  A 1 6   ? 29.792  25.902 34.035  1.00 49.88  ? 24   DC  B C4    1 
ATOM   118  N  N4    . DC  A 1 6   ? 29.543  26.476 32.854  1.00 48.53  ? 24   DC  B N4    1 
ATOM   119  C  C5    . DC  A 1 6   ? 28.925  24.884 34.534  1.00 49.41  ? 24   DC  B C5    1 
ATOM   120  C  C6    . DC  A 1 6   ? 29.225  24.341 35.721  1.00 49.89  ? 24   DC  B C6    1 
ATOM   121  P  P     . DA  A 1 7   ? 30.298  24.072 41.943  1.00 52.23  ? 25   DA  B P     1 
ATOM   122  O  OP1   . DA  A 1 7   ? 31.117  23.618 43.099  1.00 52.15  ? 25   DA  B OP1   1 
ATOM   123  O  OP2   . DA  A 1 7   ? 28.813  24.015 42.025  1.00 50.99  ? 25   DA  B OP2   1 
ATOM   124  O  "O5'" . DA  A 1 7   ? 30.719  25.562 41.570  1.00 50.14  ? 25   DA  B "O5'" 1 
ATOM   125  C  "C5'" . DA  A 1 7   ? 32.096  25.886 41.301  1.00 46.50  ? 25   DA  B "C5'" 1 
ATOM   126  C  "C4'" . DA  A 1 7   ? 32.255  27.371 41.067  1.00 43.96  ? 25   DA  B "C4'" 1 
ATOM   127  O  "O4'" . DA  A 1 7   ? 31.943  27.729 39.699  1.00 43.16  ? 25   DA  B "O4'" 1 
ATOM   128  C  "C3'" . DA  A 1 7   ? 31.388  28.261 41.958  1.00 41.98  ? 25   DA  B "C3'" 1 
ATOM   129  O  "O3'" . DA  A 1 7   ? 32.149  29.377 42.421  1.00 38.95  ? 25   DA  B "O3'" 1 
ATOM   130  C  "C2'" . DA  A 1 7   ? 30.290  28.737 41.022  1.00 42.26  ? 25   DA  B "C2'" 1 
ATOM   131  C  "C1'" . DA  A 1 7   ? 31.010  28.799 39.686  1.00 42.14  ? 25   DA  B "C1'" 1 
ATOM   132  N  N9    . DA  A 1 7   ? 30.165  28.653 38.500  1.00 41.80  ? 25   DA  B N9    1 
ATOM   133  C  C8    . DA  A 1 7   ? 29.013  27.918 38.346  1.00 41.18  ? 25   DA  B C8    1 
ATOM   134  N  N7    . DA  A 1 7   ? 28.492  27.998 37.145  1.00 41.47  ? 25   DA  B N7    1 
ATOM   135  C  C5    . DA  A 1 7   ? 29.357  28.841 36.461  1.00 40.79  ? 25   DA  B C5    1 
ATOM   136  C  C6    . DA  A 1 7   ? 29.358  29.326 35.142  1.00 41.02  ? 25   DA  B C6    1 
ATOM   137  N  N6    . DA  A 1 7   ? 28.428  29.014 34.238  1.00 40.12  ? 25   DA  B N6    1 
ATOM   138  N  N1    . DA  A 1 7   ? 30.362  30.155 34.778  1.00 39.71  ? 25   DA  B N1    1 
ATOM   139  C  C2    . DA  A 1 7   ? 31.295  30.469 35.688  1.00 40.20  ? 25   DA  B C2    1 
ATOM   140  N  N3    . DA  A 1 7   ? 31.402  30.078 36.955  1.00 40.07  ? 25   DA  B N3    1 
ATOM   141  C  C4    . DA  A 1 7   ? 30.391  29.255 37.284  1.00 41.12  ? 25   DA  B C4    1 
ATOM   142  P  P     . DG  A 1 8   ? 31.528  30.362 43.528  1.00 37.94  ? 26   DG  B P     1 
ATOM   143  O  OP1   . DG  A 1 8   ? 32.584  30.581 44.550  1.00 38.41  ? 26   DG  B OP1   1 
ATOM   144  O  OP2   . DG  A 1 8   ? 30.200  29.843 43.948  1.00 34.09  ? 26   DG  B OP2   1 
ATOM   145  O  "O5'" . DG  A 1 8   ? 31.299  31.715 42.714  1.00 36.92  ? 26   DG  B "O5'" 1 
ATOM   146  C  "C5'" . DG  A 1 8   ? 32.410  32.399 42.109  1.00 35.90  ? 26   DG  B "C5'" 1 
ATOM   147  C  "C4'" . DG  A 1 8   ? 31.952  33.273 40.963  1.00 36.22  ? 26   DG  B "C4'" 1 
ATOM   148  O  "O4'" . DG  A 1 8   ? 31.399  32.484 39.887  1.00 37.50  ? 26   DG  B "O4'" 1 
ATOM   149  C  "C3'" . DG  A 1 8   ? 30.879  34.314 41.259  1.00 35.51  ? 26   DG  B "C3'" 1 
ATOM   150  O  "O3'" . DG  A 1 8   ? 31.489  35.504 41.773  1.00 32.79  ? 26   DG  B "O3'" 1 
ATOM   151  C  "C2'" . DG  A 1 8   ? 30.310  34.599 39.880  1.00 37.77  ? 26   DG  B "C2'" 1 
ATOM   152  C  "C1'" . DG  A 1 8   ? 30.646  33.360 39.059  1.00 37.77  ? 26   DG  B "C1'" 1 
ATOM   153  N  N9    . DG  A 1 8   ? 29.500  32.640 38.511  1.00 38.63  ? 26   DG  B N9    1 
ATOM   154  C  C8    . DG  A 1 8   ? 28.676  31.732 39.135  1.00 38.59  ? 26   DG  B C8    1 
ATOM   155  N  N7    . DG  A 1 8   ? 27.738  31.271 38.351  1.00 39.85  ? 26   DG  B N7    1 
ATOM   156  C  C5    . DG  A 1 8   ? 27.956  31.914 37.138  1.00 40.22  ? 26   DG  B C5    1 
ATOM   157  C  C6    . DG  A 1 8   ? 27.261  31.819 35.901  1.00 41.55  ? 26   DG  B C6    1 
ATOM   158  O  O6    . DG  A 1 8   ? 26.277  31.123 35.620  1.00 43.97  ? 26   DG  B O6    1 
ATOM   159  N  N1    . DG  A 1 8   ? 27.824  32.645 34.933  1.00 41.36  ? 26   DG  B N1    1 
ATOM   160  C  C2    . DG  A 1 8   ? 28.915  33.459 35.125  1.00 42.17  ? 26   DG  B C2    1 
ATOM   161  N  N2    . DG  A 1 8   ? 29.315  34.183 34.068  1.00 42.34  ? 26   DG  B N2    1 
ATOM   162  N  N3    . DG  A 1 8   ? 29.569  33.557 36.269  1.00 40.30  ? 26   DG  B N3    1 
ATOM   163  C  C4    . DG  A 1 8   ? 29.039  32.762 37.224  1.00 39.12  ? 26   DG  B C4    1 
ATOM   164  P  P     . DC  A 1 9   ? 30.569  36.739 42.238  1.00 30.68  ? 27   DC  B P     1 
ATOM   165  O  OP1   . DC  A 1 9   ? 31.457  37.735 42.892  1.00 30.02  ? 27   DC  B OP1   1 
ATOM   166  O  OP2   . DC  A 1 9   ? 29.420  36.179 42.988  1.00 30.77  ? 27   DC  B OP2   1 
ATOM   167  O  "O5'" . DC  A 1 9   ? 30.027  37.369 40.875  1.00 32.01  ? 27   DC  B "O5'" 1 
ATOM   168  C  "C5'" . DC  A 1 9   ? 30.917  38.069 39.984  1.00 34.83  ? 27   DC  B "C5'" 1 
ATOM   169  C  "C4'" . DC  A 1 9   ? 30.225  38.386 38.678  1.00 38.58  ? 27   DC  B "C4'" 1 
ATOM   170  O  "O4'" . DC  A 1 9   ? 29.738  37.172 38.071  1.00 41.68  ? 27   DC  B "O4'" 1 
ATOM   171  C  "C3'" . DC  A 1 9   ? 29.008  39.304 38.750  1.00 38.93  ? 27   DC  B "C3'" 1 
ATOM   172  O  "O3'" . DC  A 1 9   ? 29.452  40.665 38.670  1.00 37.25  ? 27   DC  B "O3'" 1 
ATOM   173  C  "C2'" . DC  A 1 9   ? 28.244  38.934 37.492  1.00 41.84  ? 27   DC  B "C2'" 1 
ATOM   174  C  "C1'" . DC  A 1 9   ? 28.641  37.484 37.222  1.00 41.79  ? 27   DC  B "C1'" 1 
ATOM   175  N  N1    . DC  A 1 9   ? 27.588  36.464 37.409  1.00 43.45  ? 27   DC  B N1    1 
ATOM   176  C  C2    . DC  A 1 9   ? 26.841  36.073 36.287  1.00 42.26  ? 27   DC  B C2    1 
ATOM   177  O  O2    . DC  A 1 9   ? 27.085  36.597 35.190  1.00 43.08  ? 27   DC  B O2    1 
ATOM   178  N  N3    . DC  A 1 9   ? 25.878  35.137 36.425  1.00 41.38  ? 27   DC  B N3    1 
ATOM   179  C  C4    . DC  A 1 9   ? 25.642  34.595 37.618  1.00 39.91  ? 27   DC  B C4    1 
ATOM   180  N  N4    . DC  A 1 9   ? 24.685  33.671 37.698  1.00 39.06  ? 27   DC  B N4    1 
ATOM   181  C  C5    . DC  A 1 9   ? 26.379  34.975 38.781  1.00 40.42  ? 27   DC  B C5    1 
ATOM   182  C  C6    . DC  A 1 9   ? 27.335  35.905 38.633  1.00 41.24  ? 27   DC  B C6    1 
ATOM   183  P  P     . DT  A 1 10  ? 28.441  41.869 39.003  1.00 36.09  ? 28   DT  B P     1 
ATOM   184  O  OP1   . DT  A 1 10  ? 29.247  43.116 38.980  1.00 35.38  ? 28   DT  B OP1   1 
ATOM   185  O  OP2   . DT  A 1 10  ? 27.671  41.515 40.224  1.00 37.87  ? 28   DT  B OP2   1 
ATOM   186  O  "O5'" . DT  A 1 10  ? 27.429  41.899 37.769  1.00 38.66  ? 28   DT  B "O5'" 1 
ATOM   187  C  "C5'" . DT  A 1 10  ? 27.781  42.570 36.540  1.00 37.06  ? 28   DT  B "C5'" 1 
ATOM   188  C  "C4'" . DT  A 1 10  ? 26.663  42.462 35.527  1.00 34.87  ? 28   DT  B "C4'" 1 
ATOM   189  O  "O4'" . DT  A 1 10  ? 26.496  41.097 35.082  1.00 35.61  ? 28   DT  B "O4'" 1 
ATOM   190  C  "C3'" . DT  A 1 10  ? 25.275  42.888 35.988  1.00 34.82  ? 28   DT  B "C3'" 1 
ATOM   191  O  "O3'" . DT  A 1 10  ? 25.094  44.302 35.902  1.00 33.53  ? 28   DT  B "O3'" 1 
ATOM   192  C  "C2'" . DT  A 1 10  ? 24.370  42.168 35.007  1.00 33.64  ? 28   DT  B "C2'" 1 
ATOM   193  C  "C1'" . DT  A 1 10  ? 25.127  40.874 34.725  1.00 33.58  ? 28   DT  B "C1'" 1 
ATOM   194  N  N1    . DT  A 1 10  ? 24.608  39.730 35.512  1.00 32.27  ? 28   DT  B N1    1 
ATOM   195  C  C2    . DT  A 1 10  ? 23.733  38.868 34.885  1.00 31.50  ? 28   DT  B C2    1 
ATOM   196  O  O2    . DT  A 1 10  ? 23.390  38.991 33.717  1.00 33.81  ? 28   DT  B O2    1 
ATOM   197  N  N3    . DT  A 1 10  ? 23.268  37.849 35.676  1.00 30.75  ? 28   DT  B N3    1 
ATOM   198  C  C4    . DT  A 1 10  ? 23.577  37.607 36.999  1.00 31.65  ? 28   DT  B C4    1 
ATOM   199  O  O4    . DT  A 1 10  ? 23.070  36.649 37.579  1.00 30.18  ? 28   DT  B O4    1 
ATOM   200  C  C5    . DT  A 1 10  ? 24.506  38.547 37.595  1.00 31.56  ? 28   DT  B C5    1 
ATOM   201  C  C7    . DT  A 1 10  ? 24.905  38.369 39.026  1.00 33.34  ? 28   DT  B C7    1 
ATOM   202  C  C6    . DT  A 1 10  ? 24.969  39.545 36.831  1.00 31.48  ? 28   DT  B C6    1 
ATOM   203  P  P     . DC  A 1 11  ? 23.901  44.993 36.723  1.00 34.12  ? 29   DC  B P     1 
ATOM   204  O  OP1   . DC  A 1 11  ? 24.059  46.469 36.623  1.00 35.23  ? 29   DC  B OP1   1 
ATOM   205  O  OP2   . DC  A 1 11  ? 23.855  44.348 38.055  1.00 34.68  ? 29   DC  B OP2   1 
ATOM   206  O  "O5'" . DC  A 1 11  ? 22.579  44.575 35.934  1.00 33.48  ? 29   DC  B "O5'" 1 
ATOM   207  C  "C5'" . DC  A 1 11  ? 22.358  45.028 34.583  1.00 31.69  ? 29   DC  B "C5'" 1 
ATOM   208  C  "C4'" . DC  A 1 11  ? 21.122  44.385 33.997  1.00 31.59  ? 29   DC  B "C4'" 1 
ATOM   209  O  "O4'" . DC  A 1 11  ? 21.285  42.953 33.908  1.00 30.57  ? 29   DC  B "O4'" 1 
ATOM   210  C  "C3'" . DC  A 1 11  ? 19.826  44.586 34.775  1.00 31.65  ? 29   DC  B "C3'" 1 
ATOM   211  O  "O3'" . DC  A 1 11  ? 19.220  45.829 34.402  1.00 30.42  ? 29   DC  B "O3'" 1 
ATOM   212  C  "C2'" . DC  A 1 11  ? 18.985  43.410 34.318  1.00 31.98  ? 29   DC  B "C2'" 1 
ATOM   213  C  "C1'" . DC  A 1 11  ? 20.016  42.317 34.035  1.00 31.45  ? 29   DC  B "C1'" 1 
ATOM   214  N  N1    . DC  A 1 11  ? 20.107  41.270 35.075  1.00 32.81  ? 29   DC  B N1    1 
ATOM   215  C  C2    . DC  A 1 11  ? 19.292  40.132 34.948  1.00 33.09  ? 29   DC  B C2    1 
ATOM   216  O  O2    . DC  A 1 11  ? 18.540  40.035 33.966  1.00 33.66  ? 29   DC  B O2    1 
ATOM   217  N  N3    . DC  A 1 11  ? 19.345  39.170 35.896  1.00 32.90  ? 29   DC  B N3    1 
ATOM   218  C  C4    . DC  A 1 11  ? 20.165  39.306 36.939  1.00 33.31  ? 29   DC  B C4    1 
ATOM   219  N  N4    . DC  A 1 11  ? 20.176  38.331 37.850  1.00 34.72  ? 29   DC  B N4    1 
ATOM   220  C  C5    . DC  A 1 11  ? 21.008  40.447 37.093  1.00 32.15  ? 29   DC  B C5    1 
ATOM   221  C  C6    . DC  A 1 11  ? 20.949  41.395 36.147  1.00 33.33  ? 29   DC  B C6    1 
ATOM   222  P  P     . DG  A 1 12  ? 18.040  46.448 35.303  1.00 30.41  ? 30   DG  B P     1 
ATOM   223  O  OP1   . DG  A 1 12  ? 17.791  47.835 34.826  1.00 31.88  ? 30   DG  B OP1   1 
ATOM   224  O  OP2   . DG  A 1 12  ? 18.369  46.209 36.730  1.00 29.58  ? 30   DG  B OP2   1 
ATOM   225  O  "O5'" . DG  A 1 12  ? 16.764  45.567 34.937  1.00 31.73  ? 30   DG  B "O5'" 1 
ATOM   226  C  "C5'" . DG  A 1 12  ? 16.298  45.478 33.578  1.00 32.79  ? 30   DG  B "C5'" 1 
ATOM   227  C  "C4'" . DG  A 1 12  ? 15.093  44.568 33.493  1.00 34.43  ? 30   DG  B "C4'" 1 
ATOM   228  O  "O4'" . DG  A 1 12  ? 15.469  43.235 33.917  1.00 34.26  ? 30   DG  B "O4'" 1 
ATOM   229  C  "C3'" . DG  A 1 12  ? 13.903  44.979 34.365  1.00 35.29  ? 30   DG  B "C3'" 1 
ATOM   230  O  "O3'" . DG  A 1 12  ? 12.665  44.729 33.694  1.00 35.72  ? 30   DG  B "O3'" 1 
ATOM   231  C  "C2'" . DG  A 1 12  ? 13.993  44.046 35.558  1.00 35.59  ? 30   DG  B "C2'" 1 
ATOM   232  C  "C1'" . DG  A 1 12  ? 14.616  42.794 34.962  1.00 36.30  ? 30   DG  B "C1'" 1 
ATOM   233  N  N9    . DG  A 1 12  ? 15.419  42.032 35.914  1.00 36.71  ? 30   DG  B N9    1 
ATOM   234  C  C8    . DG  A 1 12  ? 16.569  42.437 36.552  1.00 37.14  ? 30   DG  B C8    1 
ATOM   235  N  N7    . DG  A 1 12  ? 17.041  41.540 37.376  1.00 38.15  ? 30   DG  B N7    1 
ATOM   236  C  C5    . DG  A 1 12  ? 16.154  40.477 37.273  1.00 37.89  ? 30   DG  B C5    1 
ATOM   237  C  C6    . DG  A 1 12  ? 16.142  39.223 37.936  1.00 39.50  ? 30   DG  B C6    1 
ATOM   238  O  O6    . DG  A 1 12  ? 16.939  38.785 38.778  1.00 40.02  ? 30   DG  B O6    1 
ATOM   239  N  N1    . DG  A 1 12  ? 15.061  38.445 37.535  1.00 40.77  ? 30   DG  B N1    1 
ATOM   240  C  C2    . DG  A 1 12  ? 14.109  38.823 36.618  1.00 41.55  ? 30   DG  B C2    1 
ATOM   241  N  N2    . DG  A 1 12  ? 13.139  37.931 36.364  1.00 41.40  ? 30   DG  B N2    1 
ATOM   242  N  N3    . DG  A 1 12  ? 14.108  39.991 35.996  1.00 39.95  ? 30   DG  B N3    1 
ATOM   243  C  C4    . DG  A 1 12  ? 15.151  40.762 36.369  1.00 38.47  ? 30   DG  B C4    1 
ATOM   244  O  "O5'" . DA  B 2 3   ? 16.778  33.807 43.947  1.00 57.72  ? 5    DA  C "O5'" 1 
ATOM   245  C  "C5'" . DA  B 2 3   ? 16.664  32.498 44.517  1.00 53.67  ? 5    DA  C "C5'" 1 
ATOM   246  C  "C4'" . DA  B 2 3   ? 15.291  32.203 45.080  1.00 50.65  ? 5    DA  C "C4'" 1 
ATOM   247  O  "O4'" . DA  B 2 3   ? 15.007  33.085 46.193  1.00 49.98  ? 5    DA  C "O4'" 1 
ATOM   248  C  "C3'" . DA  B 2 3   ? 14.139  32.379 44.089  1.00 49.11  ? 5    DA  C "C3'" 1 
ATOM   249  O  "O3'" . DA  B 2 3   ? 13.159  31.365 44.313  1.00 45.83  ? 5    DA  C "O3'" 1 
ATOM   250  C  "C2'" . DA  B 2 3   ? 13.551  33.727 44.463  1.00 48.96  ? 5    DA  C "C2'" 1 
ATOM   251  C  "C1'" . DA  B 2 3   ? 13.800  33.797 45.962  1.00 47.93  ? 5    DA  C "C1'" 1 
ATOM   252  N  N9    . DA  B 2 3   ? 13.973  35.156 46.478  1.00 45.80  ? 5    DA  C N9    1 
ATOM   253  C  C8    . DA  B 2 3   ? 14.895  36.101 46.092  1.00 45.37  ? 5    DA  C C8    1 
ATOM   254  N  N7    . DA  B 2 3   ? 14.793  37.235 46.741  1.00 43.88  ? 5    DA  C N7    1 
ATOM   255  C  C5    . DA  B 2 3   ? 13.734  37.027 47.613  1.00 43.38  ? 5    DA  C C5    1 
ATOM   256  C  C6    . DA  B 2 3   ? 13.120  37.856 48.572  1.00 42.92  ? 5    DA  C C6    1 
ATOM   257  N  N6    . DA  B 2 3   ? 13.498  39.116 48.815  1.00 40.55  ? 5    DA  C N6    1 
ATOM   258  N  N1    . DA  B 2 3   ? 12.089  37.340 49.279  1.00 41.49  ? 5    DA  C N1    1 
ATOM   259  C  C2    . DA  B 2 3   ? 11.704  36.080 49.027  1.00 42.04  ? 5    DA  C C2    1 
ATOM   260  N  N3    . DA  B 2 3   ? 12.195  35.208 48.148  1.00 43.72  ? 5    DA  C N3    1 
ATOM   261  C  C4    . DA  B 2 3   ? 13.221  35.749 47.465  1.00 44.18  ? 5    DA  C C4    1 
ATOM   262  P  P     . DC  B 2 4   ? 12.670  30.445 43.091  1.00 45.27  ? 6    DC  C P     1 
ATOM   263  O  OP1   . DC  B 2 4   ? 11.569  29.590 43.607  1.00 43.28  ? 6    DC  C OP1   1 
ATOM   264  O  OP2   . DC  B 2 4   ? 13.884  29.806 42.515  1.00 44.69  ? 6    DC  C OP2   1 
ATOM   265  O  "O5'" . DC  B 2 4   ? 12.085  31.484 42.027  1.00 42.72  ? 6    DC  C "O5'" 1 
ATOM   266  C  "C5'" . DC  B 2 4   ? 10.660  31.619 41.819  1.00 40.17  ? 6    DC  C "C5'" 1 
ATOM   267  C  "C4'" . DC  B 2 4   ? 10.374  32.517 40.636  1.00 38.91  ? 6    DC  C "C4'" 1 
ATOM   268  O  "O4'" . DC  B 2 4   ? 10.768  33.878 40.924  1.00 39.28  ? 6    DC  C "O4'" 1 
ATOM   269  C  "C3'" . DC  B 2 4   ? 11.099  32.166 39.340  1.00 37.99  ? 6    DC  C "C3'" 1 
ATOM   270  O  "O3'" . DC  B 2 4   ? 10.394  31.162 38.600  1.00 37.22  ? 6    DC  C "O3'" 1 
ATOM   271  C  "C2'" . DC  B 2 4   ? 11.120  33.491 38.602  1.00 37.94  ? 6    DC  C "C2'" 1 
ATOM   272  C  "C1'" . DC  B 2 4   ? 11.231  34.512 39.730  1.00 39.37  ? 6    DC  C "C1'" 1 
ATOM   273  N  N1    . DC  B 2 4   ? 12.609  34.994 39.962  1.00 38.93  ? 6    DC  C N1    1 
ATOM   274  C  C2    . DC  B 2 4   ? 13.058  36.109 39.238  1.00 39.25  ? 6    DC  C C2    1 
ATOM   275  O  O2    . DC  B 2 4   ? 12.288  36.653 38.428  1.00 40.60  ? 6    DC  C O2    1 
ATOM   276  N  N3    . DC  B 2 4   ? 14.317  36.564 39.439  1.00 38.03  ? 6    DC  C N3    1 
ATOM   277  C  C4    . DC  B 2 4   ? 15.115  35.954 40.317  1.00 37.83  ? 6    DC  C C4    1 
ATOM   278  N  N4    . DC  B 2 4   ? 16.348  36.445 40.487  1.00 37.85  ? 6    DC  C N4    1 
ATOM   279  C  C5    . DC  B 2 4   ? 14.686  34.817 41.064  1.00 37.37  ? 6    DC  C C5    1 
ATOM   280  C  C6    . DC  B 2 4   ? 13.439  34.375 40.857  1.00 37.89  ? 6    DC  C C6    1 
HETATM 281  P  P     . 6OG B 2 5   ? 11.174  30.305 37.482  1.00 35.42  ? 7    6OG C P     1 
HETATM 282  O  OP1   . 6OG B 2 5   ? 10.221  29.329 36.891  1.00 36.81  ? 7    6OG C OP1   1 
HETATM 283  O  OP2   . 6OG B 2 5   ? 12.437  29.815 38.092  1.00 36.44  ? 7    6OG C OP2   1 
HETATM 284  O  "O5'" . 6OG B 2 5   ? 11.563  31.382 36.370  1.00 34.78  ? 7    6OG C "O5'" 1 
HETATM 285  N  N9    . 6OG B 2 5   ? 13.906  34.501 35.668  1.00 41.61  ? 7    6OG C N9    1 
HETATM 286  C  C4    . 6OG B 2 5   ? 15.081  35.221 35.683  1.00 43.06  ? 7    6OG C C4    1 
HETATM 287  N  N3    . 6OG B 2 5   ? 15.439  36.179 34.798  1.00 42.62  ? 7    6OG C N3    1 
HETATM 288  C  C2    . 6OG B 2 5   ? 16.634  36.685 35.071  1.00 43.82  ? 7    6OG C C2    1 
HETATM 289  N  N2    . 6OG B 2 5   ? 17.142  37.661 34.300  1.00 42.65  ? 7    6OG C N2    1 
HETATM 290  N  N1    . 6OG B 2 5   ? 17.418  36.278 36.123  1.00 43.24  ? 7    6OG C N1    1 
HETATM 291  C  C6    . 6OG B 2 5   ? 17.079  35.296 37.049  1.00 43.67  ? 7    6OG C C6    1 
HETATM 292  O  O6    . 6OG B 2 5   ? 17.888  35.014 37.966  1.00 44.12  ? 7    6OG C O6    1 
HETATM 293  C  C5    . 6OG B 2 5   ? 15.785  34.747 36.770  1.00 43.11  ? 7    6OG C C5    1 
HETATM 294  N  N7    . 6OG B 2 5   ? 15.064  33.762 37.433  1.00 43.47  ? 7    6OG C N7    1 
HETATM 295  C  C8    . 6OG B 2 5   ? 13.959  33.652 36.749  1.00 42.62  ? 7    6OG C C8    1 
HETATM 296  C  "C2'" . 6OG B 2 5   ? 13.150  33.746 33.448  1.00 37.54  ? 7    6OG C "C2'" 1 
HETATM 297  C  "C5'" . 6OG B 2 5   ? 10.575  31.906 35.460  1.00 33.62  ? 7    6OG C "C5'" 1 
HETATM 298  C  "C4'" . 6OG B 2 5   ? 11.203  32.912 34.519  1.00 35.95  ? 7    6OG C "C4'" 1 
HETATM 299  O  "O4'" . 6OG B 2 5   ? 11.641  34.078 35.255  1.00 36.84  ? 7    6OG C "O4'" 1 
HETATM 300  C  "C1'" . 6OG B 2 5   ? 12.840  34.599 34.674  1.00 39.69  ? 7    6OG C "C1'" 1 
HETATM 301  C  "C3'" . 6OG B 2 5   ? 12.448  32.440 33.770  1.00 35.92  ? 7    6OG C "C3'" 1 
HETATM 302  O  "O3'" . 6OG B 2 5   ? 12.123  31.698 32.588  1.00 31.98  ? 7    6OG C "O3'" 1 
HETATM 303  C  C     . 6OG B 2 5   ? 17.546  33.980 38.914  1.00 43.46  ? 7    6OG C C     1 
ATOM   304  P  P     . DA  B 2 6   ? 13.286  30.906 31.801  1.00 27.99  ? 8    DA  C P     1 
ATOM   305  O  OP1   . DA  B 2 6   ? 12.628  29.988 30.838  1.00 31.19  ? 8    DA  C OP1   1 
ATOM   306  O  OP2   . DA  B 2 6   ? 14.256  30.360 32.790  1.00 30.26  ? 8    DA  C OP2   1 
ATOM   307  O  "O5'" . DA  B 2 6   ? 14.040  32.053 30.991  1.00 30.70  ? 8    DA  C "O5'" 1 
ATOM   308  C  "C5'" . DA  B 2 6   ? 15.356  31.848 30.458  1.00 26.31  ? 8    DA  C "C5'" 1 
ATOM   309  C  "C4'" . DA  B 2 6   ? 16.030  33.180 30.224  1.00 26.42  ? 8    DA  C "C4'" 1 
ATOM   310  O  "O4'" . DA  B 2 6   ? 16.165  33.906 31.467  1.00 27.17  ? 8    DA  C "O4'" 1 
ATOM   311  C  "C3'" . DA  B 2 6   ? 17.441  33.089 29.657  1.00 26.64  ? 8    DA  C "C3'" 1 
ATOM   312  O  "O3'" . DA  B 2 6   ? 17.355  33.053 28.228  1.00 23.03  ? 8    DA  C "O3'" 1 
ATOM   313  C  "C2'" . DA  B 2 6   ? 18.079  34.384 30.131  1.00 28.36  ? 8    DA  C "C2'" 1 
ATOM   314  C  "C1'" . DA  B 2 6   ? 17.356  34.694 31.442  1.00 29.37  ? 8    DA  C "C1'" 1 
ATOM   315  N  N9    . DA  B 2 6   ? 18.112  34.431 32.670  1.00 33.18  ? 8    DA  C N9    1 
ATOM   316  C  C8    . DA  B 2 6   ? 17.895  33.447 33.607  1.00 33.65  ? 8    DA  C C8    1 
ATOM   317  N  N7    . DA  B 2 6   ? 18.736  33.479 34.612  1.00 33.57  ? 8    DA  C N7    1 
ATOM   318  C  C5    . DA  B 2 6   ? 19.565  34.553 34.323  1.00 33.22  ? 8    DA  C C5    1 
ATOM   319  C  C6    . DA  B 2 6   ? 20.659  35.115 35.008  1.00 33.16  ? 8    DA  C C6    1 
ATOM   320  N  N6    . DA  B 2 6   ? 21.113  34.659 36.181  1.00 32.95  ? 8    DA  C N6    1 
ATOM   321  N  N1    . DA  B 2 6   ? 21.273  36.179 34.446  1.00 31.49  ? 8    DA  C N1    1 
ATOM   322  C  C2    . DA  B 2 6   ? 20.809  36.643 33.279  1.00 34.19  ? 8    DA  C C2    1 
ATOM   323  N  N3    . DA  B 2 6   ? 19.786  36.205 32.543  1.00 33.33  ? 8    DA  C N3    1 
ATOM   324  C  C4    . DA  B 2 6   ? 19.199  35.146 33.127  1.00 33.31  ? 8    DA  C C4    1 
ATOM   325  P  P     . DG  B 2 7   ? 18.573  32.461 27.363  1.00 22.62  ? 9    DG  C P     1 
ATOM   326  O  OP1   . DG  B 2 7   ? 18.235  32.646 25.929  1.00 22.54  ? 9    DG  C OP1   1 
ATOM   327  O  OP2   . DG  B 2 7   ? 18.872  31.103 27.878  1.00 24.28  ? 9    DG  C OP2   1 
ATOM   328  O  "O5'" . DG  B 2 7   ? 19.802  33.402 27.728  1.00 21.38  ? 9    DG  C "O5'" 1 
ATOM   329  C  "C5'" . DG  B 2 7   ? 19.845  34.758 27.273  1.00 20.37  ? 9    DG  C "C5'" 1 
ATOM   330  C  "C4'" . DG  B 2 7   ? 21.260  35.284 27.337  1.00 22.69  ? 9    DG  C "C4'" 1 
ATOM   331  O  "O4'" . DG  B 2 7   ? 21.684  35.389 28.716  1.00 21.85  ? 9    DG  C "O4'" 1 
ATOM   332  C  "C3'" . DG  B 2 7   ? 22.306  34.424 26.628  1.00 21.87  ? 9    DG  C "C3'" 1 
ATOM   333  O  "O3'" . DG  B 2 7   ? 23.210  35.287 25.934  1.00 22.35  ? 9    DG  C "O3'" 1 
ATOM   334  C  "C2'" . DG  B 2 7   ? 22.990  33.682 27.767  1.00 22.02  ? 9    DG  C "C2'" 1 
ATOM   335  C  "C1'" . DG  B 2 7   ? 22.879  34.656 28.930  1.00 24.13  ? 9    DG  C "C1'" 1 
ATOM   336  N  N9    . DG  B 2 7   ? 22.787  34.042 30.254  1.00 26.53  ? 9    DG  C N9    1 
ATOM   337  C  C8    . DG  B 2 7   ? 22.019  32.964 30.624  1.00 26.35  ? 9    DG  C C8    1 
ATOM   338  N  N7    . DG  B 2 7   ? 22.148  32.651 31.886  1.00 27.89  ? 9    DG  C N7    1 
ATOM   339  C  C5    . DG  B 2 7   ? 23.055  33.577 32.380  1.00 29.22  ? 9    DG  C C5    1 
ATOM   340  C  C6    . DG  B 2 7   ? 23.585  33.736 33.687  1.00 31.09  ? 9    DG  C C6    1 
ATOM   341  O  O6    . DG  B 2 7   ? 23.346  33.067 34.703  1.00 35.14  ? 9    DG  C O6    1 
ATOM   342  N  N1    . DG  B 2 7   ? 24.476  34.801 33.752  1.00 30.55  ? 9    DG  C N1    1 
ATOM   343  C  C2    . DG  B 2 7   ? 24.815  35.612 32.693  1.00 31.11  ? 9    DG  C C2    1 
ATOM   344  N  N2    . DG  B 2 7   ? 25.695  36.592 32.951  1.00 30.45  ? 9    DG  C N2    1 
ATOM   345  N  N3    . DG  B 2 7   ? 24.329  35.473 31.471  1.00 27.23  ? 9    DG  C N3    1 
ATOM   346  C  C4    . DG  B 2 7   ? 23.461  34.443 31.387  1.00 28.27  ? 9    DG  C C4    1 
ATOM   347  P  P     . DC  B 2 8   ? 24.446  34.672 25.106  1.00 22.50  ? 10   DC  C P     1 
ATOM   348  O  OP1   . DC  B 2 8   ? 24.636  35.535 23.912  1.00 22.93  ? 10   DC  C OP1   1 
ATOM   349  O  OP2   . DC  B 2 8   ? 24.233  33.218 24.937  1.00 22.76  ? 10   DC  C OP2   1 
ATOM   350  O  "O5'" . DC  B 2 8   ? 25.670  34.927 26.082  1.00 23.07  ? 10   DC  C "O5'" 1 
ATOM   351  C  "C5'" . DC  B 2 8   ? 25.971  36.267 26.490  1.00 25.02  ? 10   DC  C "C5'" 1 
ATOM   352  C  "C4'" . DC  B 2 8   ? 27.297  36.321 27.204  1.00 27.20  ? 10   DC  C "C4'" 1 
ATOM   353  O  "O4'" . DC  B 2 8   ? 27.154  35.857 28.565  1.00 27.95  ? 10   DC  C "O4'" 1 
ATOM   354  C  "C3'" . DC  B 2 8   ? 28.435  35.515 26.579  1.00 28.48  ? 10   DC  C "C3'" 1 
ATOM   355  O  "O3'" . DC  B 2 8   ? 29.624  36.309 26.603  1.00 29.88  ? 10   DC  C "O3'" 1 
ATOM   356  C  "C2'" . DC  B 2 8   ? 28.554  34.302 27.490  1.00 27.77  ? 10   DC  C "C2'" 1 
ATOM   357  C  "C1'" . DC  B 2 8   ? 28.104  34.846 28.844  1.00 29.33  ? 10   DC  C "C1'" 1 
ATOM   358  N  N1    . DC  B 2 8   ? 27.471  33.883 29.771  1.00 28.50  ? 10   DC  C N1    1 
ATOM   359  C  C2    . DC  B 2 8   ? 27.826  33.926 31.130  1.00 28.71  ? 10   DC  C C2    1 
ATOM   360  O  O2    . DC  B 2 8   ? 28.659  34.764 31.514  1.00 29.41  ? 10   DC  C O2    1 
ATOM   361  N  N3    . DC  B 2 8   ? 27.255  33.054 31.988  1.00 27.92  ? 10   DC  C N3    1 
ATOM   362  C  C4    . DC  B 2 8   ? 26.371  32.158 31.542  1.00 27.88  ? 10   DC  C C4    1 
ATOM   363  N  N4    . DC  B 2 8   ? 25.847  31.307 32.424  1.00 26.86  ? 10   DC  C N4    1 
ATOM   364  C  C5    . DC  B 2 8   ? 25.988  32.094 30.171  1.00 27.86  ? 10   DC  C C5    1 
ATOM   365  C  C6    . DC  B 2 8   ? 26.557  32.967 29.328  1.00 27.65  ? 10   DC  C C6    1 
ATOM   366  P  P     . DT  B 2 9   ? 30.955  35.799 25.856  1.00 31.22  ? 11   DT  C P     1 
ATOM   367  O  OP1   . DT  B 2 9   ? 31.532  36.956 25.128  1.00 30.14  ? 11   DT  C OP1   1 
ATOM   368  O  OP2   . DT  B 2 9   ? 30.656  34.549 25.118  1.00 29.47  ? 11   DT  C OP2   1 
ATOM   369  O  "O5'" . DT  B 2 9   ? 31.914  35.457 27.080  1.00 30.88  ? 11   DT  C "O5'" 1 
ATOM   370  C  "C5'" . DT  B 2 9   ? 32.194  36.461 28.072  1.00 31.59  ? 11   DT  C "C5'" 1 
ATOM   371  C  "C4'" . DT  B 2 9   ? 33.028  35.890 29.194  1.00 32.39  ? 11   DT  C "C4'" 1 
ATOM   372  O  "O4'" . DT  B 2 9   ? 32.225  35.122 30.126  1.00 31.42  ? 11   DT  C "O4'" 1 
ATOM   373  C  "C3'" . DT  B 2 9   ? 34.181  34.985 28.760  1.00 32.75  ? 11   DT  C "C3'" 1 
ATOM   374  O  "O3'" . DT  B 2 9   ? 35.357  35.308 29.495  1.00 34.43  ? 11   DT  C "O3'" 1 
ATOM   375  C  "C2'" . DT  B 2 9   ? 33.709  33.594 29.146  1.00 32.79  ? 11   DT  C "C2'" 1 
ATOM   376  C  "C1'" . DT  B 2 9   ? 32.855  33.876 30.374  1.00 33.19  ? 11   DT  C "C1'" 1 
ATOM   377  N  N1    . DT  B 2 9   ? 31.807  32.878 30.695  1.00 34.27  ? 11   DT  C N1    1 
ATOM   378  C  C2    . DT  B 2 9   ? 31.586  32.582 32.027  1.00 35.24  ? 11   DT  C C2    1 
ATOM   379  O  O2    . DT  B 2 9   ? 32.200  33.104 32.945  1.00 35.77  ? 11   DT  C O2    1 
ATOM   380  N  N3    . DT  B 2 9   ? 30.611  31.643 32.249  1.00 35.42  ? 11   DT  C N3    1 
ATOM   381  C  C4    . DT  B 2 9   ? 29.850  30.986 31.303  1.00 35.30  ? 11   DT  C C4    1 
ATOM   382  O  O4    . DT  B 2 9   ? 29.006  30.168 31.662  1.00 35.88  ? 11   DT  C O4    1 
ATOM   383  C  C5    . DT  B 2 9   ? 30.132  31.343 29.929  1.00 34.83  ? 11   DT  C C5    1 
ATOM   384  C  C7    . DT  B 2 9   ? 29.360  30.680 28.830  1.00 36.18  ? 11   DT  C C7    1 
ATOM   385  C  C6    . DT  B 2 9   ? 31.081  32.258 29.699  1.00 33.85  ? 11   DT  C C6    1 
ATOM   386  P  P     . DG  B 2 10  ? 36.789  34.797 28.973  1.00 33.14  ? 12   DG  C P     1 
ATOM   387  O  OP1   . DG  B 2 10  ? 37.640  35.982 28.706  1.00 33.36  ? 12   DG  C OP1   1 
ATOM   388  O  OP2   . DG  B 2 10  ? 36.568  33.794 27.904  1.00 34.40  ? 12   DG  C OP2   1 
ATOM   389  O  "O5'" . DG  B 2 10  ? 37.380  34.039 30.235  1.00 33.98  ? 12   DG  C "O5'" 1 
ATOM   390  C  "C5'" . DG  B 2 10  ? 37.563  34.732 31.476  1.00 35.42  ? 12   DG  C "C5'" 1 
ATOM   391  C  "C4'" . DG  B 2 10  ? 37.896  33.750 32.571  1.00 36.97  ? 12   DG  C "C4'" 1 
ATOM   392  O  "O4'" . DG  B 2 10  ? 36.748  32.905 32.823  1.00 37.25  ? 12   DG  C "O4'" 1 
ATOM   393  C  "C3'" . DG  B 2 10  ? 39.055  32.812 32.241  1.00 37.65  ? 12   DG  C "C3'" 1 
ATOM   394  O  "O3'" . DG  B 2 10  ? 39.872  32.657 33.402  1.00 37.53  ? 12   DG  C "O3'" 1 
ATOM   395  C  "C2'" . DG  B 2 10  ? 38.368  31.515 31.839  1.00 36.75  ? 12   DG  C "C2'" 1 
ATOM   396  C  "C1'" . DG  B 2 10  ? 37.069  31.536 32.634  1.00 37.72  ? 12   DG  C "C1'" 1 
ATOM   397  N  N9    . DG  B 2 10  ? 35.933  30.910 31.960  1.00 38.73  ? 12   DG  C N9    1 
ATOM   398  C  C8    . DG  B 2 10  ? 35.595  31.020 30.631  1.00 39.33  ? 12   DG  C C8    1 
ATOM   399  N  N7    . DG  B 2 10  ? 34.515  30.356 30.318  1.00 39.83  ? 12   DG  C N7    1 
ATOM   400  C  C5    . DG  B 2 10  ? 34.114  29.769 31.509  1.00 38.85  ? 12   DG  C C5    1 
ATOM   401  C  C6    . DG  B 2 10  ? 33.002  28.934 31.789  1.00 39.00  ? 12   DG  C C6    1 
ATOM   402  O  O6    . DG  B 2 10  ? 32.124  28.535 31.016  1.00 38.15  ? 12   DG  C O6    1 
ATOM   403  N  N1    . DG  B 2 10  ? 32.967  28.561 33.128  1.00 39.98  ? 12   DG  C N1    1 
ATOM   404  C  C2    . DG  B 2 10  ? 33.884  28.941 34.077  1.00 40.01  ? 12   DG  C C2    1 
ATOM   405  N  N2    . DG  B 2 10  ? 33.679  28.471 35.315  1.00 40.56  ? 12   DG  C N2    1 
ATOM   406  N  N3    . DG  B 2 10  ? 34.926  29.721 33.831  1.00 40.10  ? 12   DG  C N3    1 
ATOM   407  C  C4    . DG  B 2 10  ? 34.979  30.096 32.534  1.00 39.42  ? 12   DG  C C4    1 
ATOM   408  P  P     . DA  B 2 11  ? 41.123  31.650 33.378  1.00 36.76  ? 13   DA  C P     1 
ATOM   409  O  OP1   . DA  B 2 11  ? 42.180  32.269 34.219  1.00 36.13  ? 13   DA  C OP1   1 
ATOM   410  O  OP2   . DA  B 2 11  ? 41.431  31.278 31.968  1.00 37.68  ? 13   DA  C OP2   1 
ATOM   411  O  "O5'" . DA  B 2 11  ? 40.545  30.371 34.125  1.00 34.45  ? 13   DA  C "O5'" 1 
ATOM   412  C  "C5'" . DA  B 2 11  ? 39.957  30.512 35.427  1.00 37.40  ? 13   DA  C "C5'" 1 
ATOM   413  C  "C4'" . DA  B 2 11  ? 39.517  29.173 35.969  1.00 38.69  ? 13   DA  C "C4'" 1 
ATOM   414  O  "O4'" . DA  B 2 11  ? 38.299  28.721 35.333  1.00 38.70  ? 13   DA  C "O4'" 1 
ATOM   415  C  "C3'" . DA  B 2 11  ? 40.521  28.027 35.853  1.00 39.93  ? 13   DA  C "C3'" 1 
ATOM   416  O  "O3'" . DA  B 2 11  ? 40.529  27.311 37.092  1.00 42.19  ? 13   DA  C "O3'" 1 
ATOM   417  C  "C2'" . DA  B 2 11  ? 39.955  27.174 34.728  1.00 39.46  ? 13   DA  C "C2'" 1 
ATOM   418  C  "C1'" . DA  B 2 11  ? 38.455  27.392 34.864  1.00 39.76  ? 13   DA  C "C1'" 1 
ATOM   419  N  N9    . DA  B 2 11  ? 37.683  27.263 33.626  1.00 40.41  ? 13   DA  C N9    1 
ATOM   420  C  C8    . DA  B 2 11  ? 37.941  27.821 32.395  1.00 40.57  ? 13   DA  C C8    1 
ATOM   421  N  N7    . DA  B 2 11  ? 37.046  27.526 31.482  1.00 41.59  ? 13   DA  C N7    1 
ATOM   422  C  C5    . DA  B 2 11  ? 36.140  26.717 32.152  1.00 41.00  ? 13   DA  C C5    1 
ATOM   423  C  C6    . DA  B 2 11  ? 34.954  26.081 31.738  1.00 42.15  ? 13   DA  C C6    1 
ATOM   424  N  N6    . DA  B 2 11  ? 34.464  26.162 30.500  1.00 43.71  ? 13   DA  C N6    1 
ATOM   425  N  N1    . DA  B 2 11  ? 34.279  25.350 32.653  1.00 42.29  ? 13   DA  C N1    1 
ATOM   426  C  C2    . DA  B 2 11  ? 34.772  25.271 33.898  1.00 42.23  ? 13   DA  C C2    1 
ATOM   427  N  N3    . DA  B 2 11  ? 35.876  25.823 34.407  1.00 40.46  ? 13   DA  C N3    1 
ATOM   428  C  C4    . DA  B 2 11  ? 36.521  26.542 33.472  1.00 40.35  ? 13   DA  C C4    1 
ATOM   429  P  P     . DT  B 2 12  ? 41.501  26.046 37.289  1.00 43.67  ? 14   DT  C P     1 
ATOM   430  O  OP1   . DT  B 2 12  ? 41.907  26.008 38.719  1.00 45.27  ? 14   DT  C OP1   1 
ATOM   431  O  OP2   . DT  B 2 12  ? 42.549  26.084 36.232  1.00 41.34  ? 14   DT  C OP2   1 
ATOM   432  O  "O5'" . DT  B 2 12  ? 40.524  24.819 37.028  1.00 45.43  ? 14   DT  C "O5'" 1 
ATOM   433  C  "C5'" . DT  B 2 12  ? 39.284  24.716 37.754  1.00 49.55  ? 14   DT  C "C5'" 1 
ATOM   434  C  "C4'" . DT  B 2 12  ? 38.497  23.510 37.298  1.00 53.18  ? 14   DT  C "C4'" 1 
ATOM   435  O  "O4'" . DT  B 2 12  ? 37.880  23.738 36.007  1.00 53.40  ? 14   DT  C "O4'" 1 
ATOM   436  C  "C3'" . DT  B 2 12  ? 39.295  22.211 37.173  1.00 55.97  ? 14   DT  C "C3'" 1 
ATOM   437  O  "O3'" . DT  B 2 12  ? 38.492  21.129 37.646  1.00 60.88  ? 14   DT  C "O3'" 1 
ATOM   438  C  "C2'" . DT  B 2 12  ? 39.477  22.055 35.673  1.00 54.78  ? 14   DT  C "C2'" 1 
ATOM   439  C  "C1'" . DT  B 2 12  ? 38.179  22.649 35.149  1.00 52.78  ? 14   DT  C "C1'" 1 
ATOM   440  N  N1    . DT  B 2 12  ? 38.171  23.135 33.748  1.00 51.18  ? 14   DT  C N1    1 
ATOM   441  C  C2    . DT  B 2 12  ? 37.113  22.745 32.949  1.00 50.40  ? 14   DT  C C2    1 
ATOM   442  O  O2    . DT  B 2 12  ? 36.197  22.038 33.345  1.00 49.81  ? 14   DT  C O2    1 
ATOM   443  N  N3    . DT  B 2 12  ? 37.164  23.218 31.662  1.00 50.23  ? 14   DT  C N3    1 
ATOM   444  C  C4    . DT  B 2 12  ? 38.138  24.020 31.102  1.00 50.92  ? 14   DT  C C4    1 
ATOM   445  O  O4    . DT  B 2 12  ? 38.044  24.361 29.924  1.00 51.48  ? 14   DT  C O4    1 
ATOM   446  C  C5    . DT  B 2 12  ? 39.217  24.394 31.995  1.00 50.81  ? 14   DT  C C5    1 
ATOM   447  C  C7    . DT  B 2 12  ? 40.321  25.263 31.478  1.00 50.13  ? 14   DT  C C7    1 
ATOM   448  C  C6    . DT  B 2 12  ? 39.179  23.940 33.256  1.00 51.17  ? 14   DT  C C6    1 
ATOM   449  P  P     . DC  B 2 13  ? 39.179  19.885 38.394  1.00 64.82  ? 15   DC  C P     1 
ATOM   450  O  OP1   . DC  B 2 13  ? 39.178  20.182 39.848  1.00 64.08  ? 15   DC  C OP1   1 
ATOM   451  O  OP2   . DC  B 2 13  ? 40.461  19.559 37.706  1.00 64.44  ? 15   DC  C OP2   1 
ATOM   452  O  "O5'" . DC  B 2 13  ? 38.150  18.698 38.131  1.00 65.52  ? 15   DC  C "O5'" 1 
ATOM   453  C  "C5'" . DC  B 2 13  ? 36.743  18.873 38.390  1.00 67.23  ? 15   DC  C "C5'" 1 
ATOM   454  C  "C4'" . DC  B 2 13  ? 35.921  18.138 37.355  1.00 68.97  ? 15   DC  C "C4'" 1 
ATOM   455  O  "O4'" . DC  B 2 13  ? 36.054  18.782 36.061  1.00 68.55  ? 15   DC  C "O4'" 1 
ATOM   456  C  "C3'" . DC  B 2 13  ? 36.315  16.674 37.150  1.00 70.05  ? 15   DC  C "C3'" 1 
ATOM   457  O  "O3'" . DC  B 2 13  ? 35.140  15.866 36.975  1.00 72.48  ? 15   DC  C "O3'" 1 
ATOM   458  C  "C2'" . DC  B 2 13  ? 37.133  16.706 35.870  1.00 69.38  ? 15   DC  C "C2'" 1 
ATOM   459  C  "C1'" . DC  B 2 13  ? 36.480  17.837 35.090  1.00 68.34  ? 15   DC  C "C1'" 1 
ATOM   460  N  N1    . DC  B 2 13  ? 37.351  18.530 34.114  1.00 67.37  ? 15   DC  C N1    1 
ATOM   461  C  C2    . DC  B 2 13  ? 36.841  18.813 32.832  1.00 67.04  ? 15   DC  C C2    1 
ATOM   462  O  O2    . DC  B 2 13  ? 35.673  18.485 32.555  1.00 67.45  ? 15   DC  C O2    1 
ATOM   463  N  N3    . DC  B 2 13  ? 37.634  19.436 31.928  1.00 66.36  ? 15   DC  C N3    1 
ATOM   464  C  C4    . DC  B 2 13  ? 38.884  19.774 32.256  1.00 66.40  ? 15   DC  C C4    1 
ATOM   465  N  N4    . DC  B 2 13  ? 39.629  20.383 31.331  1.00 66.30  ? 15   DC  C N4    1 
ATOM   466  C  C5    . DC  B 2 13  ? 39.425  19.501 33.547  1.00 66.19  ? 15   DC  C C5    1 
ATOM   467  C  C6    . DC  B 2 13  ? 38.633  18.886 34.437  1.00 66.98  ? 15   DC  C C6    1 
ATOM   468  P  P     . DG  B 2 14  ? 35.255  14.256 37.011  1.00 74.17  ? 16   DG  C P     1 
ATOM   469  O  OP1   . DG  B 2 14  ? 34.113  13.741 37.813  1.00 74.00  ? 16   DG  C OP1   1 
ATOM   470  O  OP2   . DG  B 2 14  ? 36.647  13.888 37.395  1.00 73.38  ? 16   DG  C OP2   1 
ATOM   471  O  "O5'" . DG  B 2 14  ? 35.037  13.822 35.490  1.00 75.16  ? 16   DG  C "O5'" 1 
ATOM   472  C  "C5'" . DG  B 2 14  ? 35.381  14.720 34.420  1.00 76.12  ? 16   DG  C "C5'" 1 
ATOM   473  C  "C4'" . DG  B 2 14  ? 34.881  14.203 33.092  1.00 76.90  ? 16   DG  C "C4'" 1 
ATOM   474  O  "O4'" . DG  B 2 14  ? 34.963  15.279 32.135  1.00 76.07  ? 16   DG  C "O4'" 1 
ATOM   475  C  "C3'" . DG  B 2 14  ? 35.688  13.057 32.487  1.00 77.87  ? 16   DG  C "C3'" 1 
ATOM   476  O  "O3'" . DG  B 2 14  ? 35.140  11.795 32.902  1.00 80.37  ? 16   DG  C "O3'" 1 
ATOM   477  C  "C2'" . DG  B 2 14  ? 35.499  13.267 30.998  1.00 76.75  ? 16   DG  C "C2'" 1 
ATOM   478  C  "C1'" . DG  B 2 14  ? 35.335  14.775 30.861  1.00 75.20  ? 16   DG  C "C1'" 1 
ATOM   479  N  N9    . DG  B 2 14  ? 36.515  15.509 30.415  1.00 73.99  ? 16   DG  C N9    1 
ATOM   480  C  C8    . DG  B 2 14  ? 37.640  15.826 31.142  1.00 73.30  ? 16   DG  C C8    1 
ATOM   481  N  N7    . DG  B 2 14  ? 38.513  16.516 30.458  1.00 72.57  ? 16   DG  C N7    1 
ATOM   482  C  C5    . DG  B 2 14  ? 37.932  16.657 29.204  1.00 72.39  ? 16   DG  C C5    1 
ATOM   483  C  C6    . DG  B 2 14  ? 38.401  17.319 28.036  1.00 71.93  ? 16   DG  C C6    1 
ATOM   484  O  O6    . DG  B 2 14  ? 39.456  17.947 27.874  1.00 71.52  ? 16   DG  C O6    1 
ATOM   485  N  N1    . DG  B 2 14  ? 37.493  17.205 26.986  1.00 71.24  ? 16   DG  C N1    1 
ATOM   486  C  C2    . DG  B 2 14  ? 36.287  16.546 27.051  1.00 71.61  ? 16   DG  C C2    1 
ATOM   487  N  N2    . DG  B 2 14  ? 35.546  16.537 25.934  1.00 70.90  ? 16   DG  C N2    1 
ATOM   488  N  N3    . DG  B 2 14  ? 35.838  15.938 28.132  1.00 72.39  ? 16   DG  C N3    1 
ATOM   489  C  C4    . DG  B 2 14  ? 36.704  16.032 29.162  1.00 72.96  ? 16   DG  C C4    1 
ATOM   490  P  P     . DC  B 2 15  ? 35.971  10.433 32.659  1.00 82.50  ? 17   DC  C P     1 
ATOM   491  O  OP1   . DC  B 2 15  ? 35.152  9.302  33.178  1.00 81.89  ? 17   DC  C OP1   1 
ATOM   492  O  OP2   . DC  B 2 15  ? 37.347  10.646 33.187  1.00 82.34  ? 17   DC  C OP2   1 
ATOM   493  O  "O5'" . DC  B 2 15  ? 36.069  10.293 31.072  1.00 81.87  ? 17   DC  C "O5'" 1 
ATOM   494  C  "C5'" . DC  B 2 15  ? 34.884  10.313 30.247  1.00 81.64  ? 17   DC  C "C5'" 1 
ATOM   495  C  "C4'" . DC  B 2 15  ? 35.255  10.536 28.798  1.00 81.99  ? 17   DC  C "C4'" 1 
ATOM   496  O  "O4'" . DC  B 2 15  ? 36.055  11.739 28.689  1.00 81.18  ? 17   DC  C "O4'" 1 
ATOM   497  C  "C3'" . DC  B 2 15  ? 36.079  9.419  28.150  1.00 82.30  ? 17   DC  C "C3'" 1 
ATOM   498  O  "O3'" . DC  B 2 15  ? 35.683  9.272  26.780  1.00 83.40  ? 17   DC  C "O3'" 1 
ATOM   499  C  "C2'" . DC  B 2 15  ? 37.500  9.952  28.199  1.00 81.58  ? 17   DC  C "C2'" 1 
ATOM   500  C  "C1'" . DC  B 2 15  ? 37.294  11.452 28.058  1.00 80.95  ? 17   DC  C "C1'" 1 
ATOM   501  N  N1    . DC  B 2 15  ? 38.336  12.287 28.689  1.00 80.21  ? 17   DC  C N1    1 
ATOM   502  C  C2    . DC  B 2 15  ? 39.032  13.217 27.894  1.00 79.64  ? 17   DC  C C2    1 
ATOM   503  O  O2    . DC  B 2 15  ? 38.749  13.319 26.687  1.00 78.57  ? 17   DC  C O2    1 
ATOM   504  N  N3    . DC  B 2 15  ? 39.994  13.981 28.463  1.00 79.41  ? 17   DC  C N3    1 
ATOM   505  C  C4    . DC  B 2 15  ? 40.270  13.849 29.764  1.00 79.66  ? 17   DC  C C4    1 
ATOM   506  N  N4    . DC  B 2 15  ? 41.225  14.626 30.282  1.00 79.19  ? 17   DC  C N4    1 
ATOM   507  C  C5    . DC  B 2 15  ? 39.578  12.917 30.593  1.00 79.48  ? 17   DC  C C5    1 
ATOM   508  C  C6    . DC  B 2 15  ? 38.629  12.164 30.021  1.00 79.83  ? 17   DC  C C6    1 
ATOM   509  P  P     . DA  B 2 16  ? 35.544  7.804  26.134  1.00 84.27  ? 18   DA  C P     1 
ATOM   510  O  OP1   . DA  B 2 16  ? 34.219  7.248  26.524  1.00 84.00  ? 18   DA  C OP1   1 
ATOM   511  O  OP2   . DA  B 2 16  ? 36.783  7.044  26.452  1.00 84.15  ? 18   DA  C OP2   1 
ATOM   512  O  "O5'" . DA  B 2 16  ? 35.537  8.078  24.563  1.00 83.43  ? 18   DA  C "O5'" 1 
ATOM   513  C  "C5'" . DA  B 2 16  ? 34.648  9.053  23.978  1.00 82.70  ? 18   DA  C "C5'" 1 
ATOM   514  C  "C4'" . DA  B 2 16  ? 35.361  9.827  22.891  1.00 82.84  ? 18   DA  C "C4'" 1 
ATOM   515  O  "O4'" . DA  B 2 16  ? 36.431  10.606 23.478  1.00 82.95  ? 18   DA  C "O4'" 1 
ATOM   516  C  "C3'" . DA  B 2 16  ? 36.007  8.971  21.798  1.00 82.80  ? 18   DA  C "C3'" 1 
ATOM   517  O  "O3'" . DA  B 2 16  ? 35.881  9.627  20.530  1.00 82.27  ? 18   DA  C "O3'" 1 
ATOM   518  C  "C2'" . DA  B 2 16  ? 37.473  8.934  22.191  1.00 82.75  ? 18   DA  C "C2'" 1 
ATOM   519  C  "C1'" . DA  B 2 16  ? 37.675  10.279 22.873  1.00 82.97  ? 18   DA  C "C1'" 1 
ATOM   520  N  N9    . DA  B 2 16  ? 38.697  10.284 23.923  1.00 82.76  ? 18   DA  C N9    1 
ATOM   521  C  C8    . DA  B 2 16  ? 38.701  9.580  25.104  1.00 82.47  ? 18   DA  C C8    1 
ATOM   522  N  N7    . DA  B 2 16  ? 39.755  9.805  25.851  1.00 82.36  ? 18   DA  C N7    1 
ATOM   523  C  C5    . DA  B 2 16  ? 40.498  10.716 25.113  1.00 82.41  ? 18   DA  C C5    1 
ATOM   524  C  C6    . DA  B 2 16  ? 41.727  11.355 25.360  1.00 82.62  ? 18   DA  C C6    1 
ATOM   525  N  N6    . DA  B 2 16  ? 42.451  11.170 26.468  1.00 82.21  ? 18   DA  C N6    1 
ATOM   526  N  N1    . DA  B 2 16  ? 42.192  12.206 24.418  1.00 82.82  ? 18   DA  C N1    1 
ATOM   527  C  C2    . DA  B 2 16  ? 41.465  12.396 23.310  1.00 82.35  ? 18   DA  C C2    1 
ATOM   528  N  N3    . DA  B 2 16  ? 40.297  11.857 22.965  1.00 82.45  ? 18   DA  C N3    1 
ATOM   529  C  C4    . DA  B 2 16  ? 39.862  11.016 23.921  1.00 82.42  ? 18   DA  C C4    1 
ATOM   530  N  N     . LYS C 3 1   ? 9.897   5.114  4.060   1.00 44.41  ? 297  LYS A N     1 
ATOM   531  C  CA    . LYS C 3 1   ? 9.490   5.353  2.644   1.00 45.00  ? 297  LYS A CA    1 
ATOM   532  C  C     . LYS C 3 1   ? 9.723   6.810  2.241   1.00 43.92  ? 297  LYS A C     1 
ATOM   533  O  O     . LYS C 3 1   ? 9.130   7.725  2.815   1.00 43.46  ? 297  LYS A O     1 
ATOM   534  C  CB    . LYS C 3 1   ? 8.016   4.984  2.460   1.00 45.83  ? 297  LYS A CB    1 
ATOM   535  N  N     . LYS C 3 2   ? 10.585  7.014  1.246   1.00 42.15  ? 298  LYS A N     1 
ATOM   536  C  CA    . LYS C 3 2   ? 10.917  8.351  0.761   1.00 39.46  ? 298  LYS A CA    1 
ATOM   537  C  C     . LYS C 3 2   ? 9.684   9.181  0.418   1.00 38.06  ? 298  LYS A C     1 
ATOM   538  O  O     . LYS C 3 2   ? 8.609   8.643  0.139   1.00 37.98  ? 298  LYS A O     1 
ATOM   539  C  CB    . LYS C 3 2   ? 11.827  8.249  -0.459  1.00 40.60  ? 298  LYS A CB    1 
ATOM   540  N  N     . MET C 3 3   ? 9.845   10.499 0.441   1.00 34.64  ? 299  MET A N     1 
ATOM   541  C  CA    . MET C 3 3   ? 8.739   11.392 0.125   1.00 31.16  ? 299  MET A CA    1 
ATOM   542  C  C     . MET C 3 3   ? 8.924   11.977 -1.268  1.00 29.42  ? 299  MET A C     1 
ATOM   543  O  O     . MET C 3 3   ? 9.968   12.552 -1.584  1.00 27.91  ? 299  MET A O     1 
ATOM   544  C  CB    . MET C 3 3   ? 8.642   12.519 1.154   1.00 28.79  ? 299  MET A CB    1 
ATOM   545  C  CG    . MET C 3 3   ? 7.446   13.432 0.932   1.00 24.54  ? 299  MET A CG    1 
ATOM   546  S  SD    . MET C 3 3   ? 7.243   14.627 2.253   1.00 21.93  ? 299  MET A SD    1 
ATOM   547  C  CE    . MET C 3 3   ? 6.233   13.671 3.396   1.00 20.19  ? 299  MET A CE    1 
ATOM   548  N  N     . ALA C 3 4   ? 7.897   11.824 -2.096  1.00 28.19  ? 300  ALA A N     1 
ATOM   549  C  CA    . ALA C 3 4   ? 7.937   12.318 -3.462  1.00 27.84  ? 300  ALA A CA    1 
ATOM   550  C  C     . ALA C 3 4   ? 7.896   13.835 -3.538  1.00 27.10  ? 300  ALA A C     1 
ATOM   551  O  O     . ALA C 3 4   ? 7.173   14.488 -2.787  1.00 27.29  ? 300  ALA A O     1 
ATOM   552  C  CB    . ALA C 3 4   ? 6.781   11.733 -4.257  1.00 28.98  ? 300  ALA A CB    1 
ATOM   553  N  N     . PHE C 3 5   ? 8.685   14.385 -4.454  1.00 24.87  ? 301  PHE A N     1 
ATOM   554  C  CA    . PHE C 3 5   ? 8.734   15.822 -4.669  1.00 24.47  ? 301  PHE A CA    1 
ATOM   555  C  C     . PHE C 3 5   ? 9.497   16.145 -5.951  1.00 25.15  ? 301  PHE A C     1 
ATOM   556  O  O     . PHE C 3 5   ? 10.270  15.329 -6.461  1.00 23.09  ? 301  PHE A O     1 
ATOM   557  C  CB    . PHE C 3 5   ? 9.379   16.529 -3.467  1.00 23.28  ? 301  PHE A CB    1 
ATOM   558  C  CG    . PHE C 3 5   ? 10.843  16.241 -3.295  1.00 21.20  ? 301  PHE A CG    1 
ATOM   559  C  CD1   . PHE C 3 5   ? 11.796  16.965 -4.002  1.00 22.06  ? 301  PHE A CD1   1 
ATOM   560  C  CD2   . PHE C 3 5   ? 11.271  15.256 -2.412  1.00 20.77  ? 301  PHE A CD2   1 
ATOM   561  C  CE1   . PHE C 3 5   ? 13.160  16.712 -3.831  1.00 21.55  ? 301  PHE A CE1   1 
ATOM   562  C  CE2   . PHE C 3 5   ? 12.631  14.995 -2.235  1.00 22.15  ? 301  PHE A CE2   1 
ATOM   563  C  CZ    . PHE C 3 5   ? 13.575  15.724 -2.945  1.00 20.75  ? 301  PHE A CZ    1 
ATOM   564  N  N     . THR C 3 6   ? 9.271   17.345 -6.468  1.00 25.49  ? 302  THR A N     1 
ATOM   565  C  CA    . THR C 3 6   ? 9.928   17.787 -7.683  1.00 25.63  ? 302  THR A CA    1 
ATOM   566  C  C     . THR C 3 6   ? 11.153  18.630 -7.357  1.00 26.05  ? 302  THR A C     1 
ATOM   567  O  O     . THR C 3 6   ? 11.039  19.662 -6.697  1.00 25.02  ? 302  THR A O     1 
ATOM   568  C  CB    . THR C 3 6   ? 8.976   18.638 -8.536  1.00 26.11  ? 302  THR A CB    1 
ATOM   569  O  OG1   . THR C 3 6   ? 7.750   17.922 -8.747  1.00 27.09  ? 302  THR A OG1   1 
ATOM   570  C  CG2   . THR C 3 6   ? 9.620   18.971 -9.876  1.00 24.88  ? 302  THR A CG2   1 
ATOM   571  N  N     . LEU C 3 7   ? 12.324  18.192 -7.805  1.00 26.11  ? 303  LEU A N     1 
ATOM   572  C  CA    . LEU C 3 7   ? 13.536  18.973 -7.585  1.00 28.67  ? 303  LEU A CA    1 
ATOM   573  C  C     . LEU C 3 7   ? 13.586  19.851 -8.831  1.00 29.11  ? 303  LEU A C     1 
ATOM   574  O  O     . LEU C 3 7   ? 14.096  19.442 -9.870  1.00 31.19  ? 303  LEU A O     1 
ATOM   575  C  CB    . LEU C 3 7   ? 14.768  18.067 -7.503  1.00 27.75  ? 303  LEU A CB    1 
ATOM   576  C  CG    . LEU C 3 7   ? 15.993  18.703 -6.825  1.00 29.77  ? 303  LEU A CG    1 
ATOM   577  C  CD1   . LEU C 3 7   ? 16.981  17.621 -6.416  1.00 29.97  ? 303  LEU A CD1   1 
ATOM   578  C  CD2   . LEU C 3 7   ? 16.646  19.714 -7.757  1.00 29.32  ? 303  LEU A CD2   1 
ATOM   579  N  N     . ALA C 3 8   ? 13.041  21.058 -8.715  1.00 29.86  ? 304  ALA A N     1 
ATOM   580  C  CA    . ALA C 3 8   ? 12.951  21.990 -9.838  1.00 31.15  ? 304  ALA A CA    1 
ATOM   581  C  C     . ALA C 3 8   ? 14.205  22.761 -10.229 1.00 32.00  ? 304  ALA A C     1 
ATOM   582  O  O     . ALA C 3 8   ? 15.033  23.107 -9.387  1.00 33.06  ? 304  ALA A O     1 
ATOM   583  C  CB    . ALA C 3 8   ? 11.813  22.975 -9.584  1.00 30.03  ? 304  ALA A CB    1 
ATOM   584  N  N     . ASP C 3 9   ? 14.317  23.039 -11.526 1.00 32.81  ? 305  ASP A N     1 
ATOM   585  C  CA    . ASP C 3 9   ? 15.437  23.795 -12.069 1.00 34.21  ? 305  ASP A CA    1 
ATOM   586  C  C     . ASP C 3 9   ? 14.996  25.221 -12.350 1.00 33.58  ? 305  ASP A C     1 
ATOM   587  O  O     . ASP C 3 9   ? 15.823  26.103 -12.554 1.00 33.89  ? 305  ASP A O     1 
ATOM   588  C  CB    . ASP C 3 9   ? 15.946  23.157 -13.364 1.00 37.25  ? 305  ASP A CB    1 
ATOM   589  C  CG    . ASP C 3 9   ? 16.684  21.860 -13.120 1.00 40.49  ? 305  ASP A CG    1 
ATOM   590  O  OD1   . ASP C 3 9   ? 17.592  21.849 -12.260 1.00 41.50  ? 305  ASP A OD1   1 
ATOM   591  O  OD2   . ASP C 3 9   ? 16.360  20.853 -13.788 1.00 44.04  ? 305  ASP A OD2   1 
ATOM   592  N  N     . ARG C 3 10  ? 13.683  25.432 -12.362 1.00 32.90  ? 306  ARG A N     1 
ATOM   593  C  CA    . ARG C 3 10  ? 13.106  26.749 -12.605 1.00 33.39  ? 306  ARG A CA    1 
ATOM   594  C  C     . ARG C 3 10  ? 11.768  26.876 -11.884 1.00 31.73  ? 306  ARG A C     1 
ATOM   595  O  O     . ARG C 3 10  ? 11.090  25.879 -11.633 1.00 30.23  ? 306  ARG A O     1 
ATOM   596  C  CB    . ARG C 3 10  ? 12.900  26.983 -14.106 1.00 36.42  ? 306  ARG A CB    1 
ATOM   597  C  CG    . ARG C 3 10  ? 12.053  25.923 -14.802 1.00 41.10  ? 306  ARG A CG    1 
ATOM   598  C  CD    . ARG C 3 10  ? 11.717  26.326 -16.241 1.00 46.30  ? 306  ARG A CD    1 
ATOM   599  N  NE    . ARG C 3 10  ? 11.188  25.207 -17.023 1.00 50.36  ? 306  ARG A NE    1 
ATOM   600  C  CZ    . ARG C 3 10  ? 10.812  25.289 -18.299 1.00 52.80  ? 306  ARG A CZ    1 
ATOM   601  N  NH1   . ARG C 3 10  ? 10.900  26.445 -18.950 1.00 53.89  ? 306  ARG A NH1   1 
ATOM   602  N  NH2   . ARG C 3 10  ? 10.360  24.211 -18.933 1.00 52.73  ? 306  ARG A NH2   1 
ATOM   603  N  N     . VAL C 3 11  ? 11.395  28.109 -11.559 1.00 30.62  ? 307  VAL A N     1 
ATOM   604  C  CA    . VAL C 3 11  ? 10.140  28.389 -10.866 1.00 30.14  ? 307  VAL A CA    1 
ATOM   605  C  C     . VAL C 3 11  ? 8.942   28.323 -11.815 1.00 29.89  ? 307  VAL A C     1 
ATOM   606  O  O     . VAL C 3 11  ? 9.005   28.839 -12.926 1.00 28.72  ? 307  VAL A O     1 
ATOM   607  C  CB    . VAL C 3 11  ? 10.178  29.795 -10.224 1.00 29.46  ? 307  VAL A CB    1 
ATOM   608  C  CG1   . VAL C 3 11  ? 8.881   30.071 -9.491  1.00 27.76  ? 307  VAL A CG1   1 
ATOM   609  C  CG2   . VAL C 3 11  ? 11.363  29.901 -9.280  1.00 30.28  ? 307  VAL A CG2   1 
ATOM   610  N  N     . THR C 3 12  ? 7.855   27.689 -11.375 1.00 29.89  ? 308  THR A N     1 
ATOM   611  C  CA    . THR C 3 12  ? 6.650   27.588 -12.197 1.00 30.65  ? 308  THR A CA    1 
ATOM   612  C  C     . THR C 3 12  ? 5.435   28.166 -11.477 1.00 32.08  ? 308  THR A C     1 
ATOM   613  O  O     . THR C 3 12  ? 5.442   28.352 -10.257 1.00 30.70  ? 308  THR A O     1 
ATOM   614  C  CB    . THR C 3 12  ? 6.324   26.126 -12.583 1.00 31.14  ? 308  THR A CB    1 
ATOM   615  O  OG1   . THR C 3 12  ? 5.931   25.394 -11.414 1.00 30.25  ? 308  THR A OG1   1 
ATOM   616  C  CG2   . THR C 3 12  ? 7.536   25.459 -13.226 1.00 28.63  ? 308  THR A CG2   1 
ATOM   617  N  N     . GLU C 3 13  ? 4.392   28.446 -12.251 1.00 32.96  ? 309  GLU A N     1 
ATOM   618  C  CA    . GLU C 3 13  ? 3.151   29.009 -11.734 1.00 34.63  ? 309  GLU A CA    1 
ATOM   619  C  C     . GLU C 3 13  ? 2.589   28.177 -10.581 1.00 32.89  ? 309  GLU A C     1 
ATOM   620  O  O     . GLU C 3 13  ? 2.178   28.718 -9.553  1.00 30.93  ? 309  GLU A O     1 
ATOM   621  C  CB    . GLU C 3 13  ? 2.122   29.092 -12.863 1.00 38.69  ? 309  GLU A CB    1 
ATOM   622  C  CG    . GLU C 3 13  ? 2.543   29.977 -14.036 1.00 45.84  ? 309  GLU A CG    1 
ATOM   623  C  CD    . GLU C 3 13  ? 3.902   29.601 -14.629 1.00 49.78  ? 309  GLU A CD    1 
ATOM   624  O  OE1   . GLU C 3 13  ? 4.080   28.442 -15.079 1.00 51.24  ? 309  GLU A OE1   1 
ATOM   625  O  OE2   . GLU C 3 13  ? 4.796   30.477 -14.649 1.00 52.53  ? 309  GLU A OE2   1 
ATOM   626  N  N     . GLU C 3 14  ? 2.579   26.862 -10.767 1.00 31.77  ? 310  GLU A N     1 
ATOM   627  C  CA    . GLU C 3 14  ? 2.074   25.923 -9.766  1.00 32.19  ? 310  GLU A CA    1 
ATOM   628  C  C     . GLU C 3 14  ? 2.673   26.149 -8.382  1.00 30.61  ? 310  GLU A C     1 
ATOM   629  O  O     . GLU C 3 14  ? 2.025   25.896 -7.365  1.00 29.19  ? 310  GLU A O     1 
ATOM   630  C  CB    . GLU C 3 14  ? 2.382   24.491 -10.201 1.00 32.84  ? 310  GLU A CB    1 
ATOM   631  C  CG    . GLU C 3 14  ? 1.170   23.675 -10.565 1.00 36.29  ? 310  GLU A CG    1 
ATOM   632  C  CD    . GLU C 3 14  ? 1.530   22.239 -10.858 1.00 37.48  ? 310  GLU A CD    1 
ATOM   633  O  OE1   . GLU C 3 14  ? 0.605   21.439 -11.113 1.00 40.77  ? 310  GLU A OE1   1 
ATOM   634  O  OE2   . GLU C 3 14  ? 2.738   21.913 -10.831 1.00 38.31  ? 310  GLU A OE2   1 
ATOM   635  N  N     . MET C 3 15  ? 3.915   26.618 -8.357  1.00 29.34  ? 311  MET A N     1 
ATOM   636  C  CA    . MET C 3 15  ? 4.627   26.869 -7.113  1.00 28.49  ? 311  MET A CA    1 
ATOM   637  C  C     . MET C 3 15  ? 4.182   28.163 -6.445  1.00 27.53  ? 311  MET A C     1 
ATOM   638  O  O     . MET C 3 15  ? 4.556   28.438 -5.306  1.00 28.09  ? 311  MET A O     1 
ATOM   639  C  CB    . MET C 3 15  ? 6.130   26.948 -7.382  1.00 27.96  ? 311  MET A CB    1 
ATOM   640  C  CG    . MET C 3 15  ? 6.722   25.716 -8.037  1.00 27.40  ? 311  MET A CG    1 
ATOM   641  S  SD    . MET C 3 15  ? 8.480   25.919 -8.394  1.00 28.12  ? 311  MET A SD    1 
ATOM   642  C  CE    . MET C 3 15  ? 8.766   24.500 -9.474  1.00 26.91  ? 311  MET A CE    1 
ATOM   643  N  N     . LEU C 3 16  ? 3.381   28.952 -7.152  1.00 26.31  ? 312  LEU A N     1 
ATOM   644  C  CA    . LEU C 3 16  ? 2.933   30.237 -6.629  1.00 25.54  ? 312  LEU A CA    1 
ATOM   645  C  C     . LEU C 3 16  ? 1.460   30.313 -6.246  1.00 24.53  ? 312  LEU A C     1 
ATOM   646  O  O     . LEU C 3 16  ? 0.808   31.325 -6.490  1.00 25.03  ? 312  LEU A O     1 
ATOM   647  C  CB    . LEU C 3 16  ? 3.260   31.332 -7.648  1.00 24.99  ? 312  LEU A CB    1 
ATOM   648  C  CG    . LEU C 3 16  ? 4.708   31.270 -8.152  1.00 25.37  ? 312  LEU A CG    1 
ATOM   649  C  CD1   . LEU C 3 16  ? 4.969   32.373 -9.163  1.00 26.66  ? 312  LEU A CD1   1 
ATOM   650  C  CD2   . LEU C 3 16  ? 5.655   31.391 -6.972  1.00 24.27  ? 312  LEU A CD2   1 
ATOM   651  N  N     . ALA C 3 17  ? 0.945   29.249 -5.634  1.00 24.69  ? 313  ALA A N     1 
ATOM   652  C  CA    . ALA C 3 17  ? -0.452  29.201 -5.202  1.00 23.75  ? 313  ALA A CA    1 
ATOM   653  C  C     . ALA C 3 17  ? -0.680  30.190 -4.062  1.00 23.18  ? 313  ALA A C     1 
ATOM   654  O  O     . ALA C 3 17  ? 0.280   30.664 -3.450  1.00 24.13  ? 313  ALA A O     1 
ATOM   655  C  CB    . ALA C 3 17  ? -0.809  27.791 -4.749  1.00 24.58  ? 313  ALA A CB    1 
ATOM   656  N  N     . ASP C 3 18  ? -1.944  30.495 -3.768  1.00 21.84  ? 314  ASP A N     1 
ATOM   657  C  CA    . ASP C 3 18  ? -2.247  31.445 -2.705  1.00 22.41  ? 314  ASP A CA    1 
ATOM   658  C  C     . ASP C 3 18  ? -2.170  30.886 -1.283  1.00 21.19  ? 314  ASP A C     1 
ATOM   659  O  O     . ASP C 3 18  ? -2.519  31.574 -0.331  1.00 21.20  ? 314  ASP A O     1 
ATOM   660  C  CB    . ASP C 3 18  ? -3.617  32.097 -2.924  1.00 26.60  ? 314  ASP A CB    1 
ATOM   661  C  CG    . ASP C 3 18  ? -4.755  31.108 -2.862  1.00 29.42  ? 314  ASP A CG    1 
ATOM   662  O  OD1   . ASP C 3 18  ? -4.604  30.053 -2.211  1.00 31.36  ? 314  ASP A OD1   1 
ATOM   663  O  OD2   . ASP C 3 18  ? -5.815  31.398 -3.456  1.00 35.77  ? 314  ASP A OD2   1 
ATOM   664  N  N     . LYS C 3 19  ? -1.727  29.641 -1.144  1.00 19.17  ? 315  LYS A N     1 
ATOM   665  C  CA    . LYS C 3 19  ? -1.555  29.036 0.178   1.00 21.76  ? 315  LYS A CA    1 
ATOM   666  C  C     . LYS C 3 19  ? -0.560  27.893 0.097   1.00 20.00  ? 315  LYS A C     1 
ATOM   667  O  O     . LYS C 3 19  ? -0.705  26.987 -0.718  1.00 20.49  ? 315  LYS A O     1 
ATOM   668  C  CB    . LYS C 3 19  ? -2.869  28.510 0.770   1.00 20.32  ? 315  LYS A CB    1 
ATOM   669  C  CG    . LYS C 3 19  ? -2.666  28.022 2.216   1.00 22.10  ? 315  LYS A CG    1 
ATOM   670  C  CD    . LYS C 3 19  ? -3.932  27.525 2.884   1.00 22.48  ? 315  LYS A CD    1 
ATOM   671  C  CE    . LYS C 3 19  ? -3.656  27.060 4.322   1.00 21.67  ? 315  LYS A CE    1 
ATOM   672  N  NZ    . LYS C 3 19  ? -3.148  28.162 5.211   1.00 21.63  ? 315  LYS A NZ    1 
ATOM   673  N  N     . ALA C 3 20  ? 0.454   27.938 0.948   1.00 19.18  ? 316  ALA A N     1 
ATOM   674  C  CA    . ALA C 3 20  ? 1.469   26.898 0.944   1.00 17.45  ? 316  ALA A CA    1 
ATOM   675  C  C     . ALA C 3 20  ? 2.280   26.883 2.225   1.00 16.25  ? 316  ALA A C     1 
ATOM   676  O  O     . ALA C 3 20  ? 2.269   27.845 2.993   1.00 15.99  ? 316  ALA A O     1 
ATOM   677  C  CB    . ALA C 3 20  ? 2.405   27.109 -0.234  1.00 18.91  ? 316  ALA A CB    1 
ATOM   678  N  N     . ALA C 3 21  ? 2.975   25.773 2.443   1.00 12.74  ? 317  ALA A N     1 
ATOM   679  C  CA    . ALA C 3 21  ? 3.871   25.637 3.576   1.00 12.96  ? 317  ALA A CA    1 
ATOM   680  C  C     . ALA C 3 21  ? 5.184   26.063 2.914   1.00 14.42  ? 317  ALA A C     1 
ATOM   681  O  O     . ALA C 3 21  ? 5.492   25.609 1.804   1.00 13.62  ? 317  ALA A O     1 
ATOM   682  C  CB    . ALA C 3 21  ? 3.945   24.188 4.033   1.00 9.68   ? 317  ALA A CB    1 
ATOM   683  N  N     . LEU C 3 22  ? 5.946   26.931 3.574   1.00 14.71  ? 318  LEU A N     1 
ATOM   684  C  CA    . LEU C 3 22  ? 7.200   27.423 3.002   1.00 14.57  ? 318  LEU A CA    1 
ATOM   685  C  C     . LEU C 3 22  ? 8.391   27.232 3.922   1.00 14.04  ? 318  LEU A C     1 
ATOM   686  O  O     . LEU C 3 22  ? 8.311   27.506 5.119   1.00 13.80  ? 318  LEU A O     1 
ATOM   687  C  CB    . LEU C 3 22  ? 7.081   28.922 2.665   1.00 11.60  ? 318  LEU A CB    1 
ATOM   688  C  CG    . LEU C 3 22  ? 8.348   29.658 2.196   1.00 12.06  ? 318  LEU A CG    1 
ATOM   689  C  CD1   . LEU C 3 22  ? 8.771   29.164 0.814   1.00 7.99   ? 318  LEU A CD1   1 
ATOM   690  C  CD2   . LEU C 3 22  ? 8.077   31.158 2.149   1.00 10.27  ? 318  LEU A CD2   1 
ATOM   691  N  N     . VAL C 3 23  ? 9.498   26.779 3.338   1.00 15.27  ? 319  VAL A N     1 
ATOM   692  C  CA    . VAL C 3 23  ? 10.742  26.569 4.067   1.00 14.83  ? 319  VAL A CA    1 
ATOM   693  C  C     . VAL C 3 23  ? 11.880  27.296 3.353   1.00 15.98  ? 319  VAL A C     1 
ATOM   694  O  O     . VAL C 3 23  ? 12.183  27.004 2.197   1.00 14.88  ? 319  VAL A O     1 
ATOM   695  C  CB    . VAL C 3 23  ? 11.124  25.062 4.162   1.00 15.71  ? 319  VAL A CB    1 
ATOM   696  C  CG1   . VAL C 3 23  ? 12.507  24.919 4.794   1.00 13.81  ? 319  VAL A CG1   1 
ATOM   697  C  CG2   . VAL C 3 23  ? 10.099  24.300 4.998   1.00 14.55  ? 319  VAL A CG2   1 
ATOM   698  N  N     . VAL C 3 24  ? 12.494  28.246 4.056   1.00 14.50  ? 320  VAL A N     1 
ATOM   699  C  CA    . VAL C 3 24  ? 13.625  29.019 3.549   1.00 14.59  ? 320  VAL A CA    1 
ATOM   700  C  C     . VAL C 3 24  ? 14.684  28.734 4.610   1.00 14.84  ? 320  VAL A C     1 
ATOM   701  O  O     . VAL C 3 24  ? 14.754  29.414 5.632   1.00 14.24  ? 320  VAL A O     1 
ATOM   702  C  CB    . VAL C 3 24  ? 13.293  30.533 3.505   1.00 15.36  ? 320  VAL A CB    1 
ATOM   703  C  CG1   . VAL C 3 24  ? 14.490  31.323 2.996   1.00 12.21  ? 320  VAL A CG1   1 
ATOM   704  C  CG2   . VAL C 3 24  ? 12.083  30.768 2.607   1.00 9.23   ? 320  VAL A CG2   1 
ATOM   705  N  N     . GLU C 3 25  ? 15.503  27.721 4.349   1.00 14.99  ? 321  GLU A N     1 
ATOM   706  C  CA    . GLU C 3 25  ? 16.506  27.250 5.295   1.00 15.20  ? 321  GLU A CA    1 
ATOM   707  C  C     . GLU C 3 25  ? 17.796  28.036 5.506   1.00 15.45  ? 321  GLU A C     1 
ATOM   708  O  O     . GLU C 3 25  ? 18.562  28.288 4.572   1.00 17.11  ? 321  GLU A O     1 
ATOM   709  C  CB    . GLU C 3 25  ? 16.868  25.790 4.963   1.00 15.29  ? 321  GLU A CB    1 
ATOM   710  C  CG    . GLU C 3 25  ? 17.574  25.042 6.104   1.00 16.85  ? 321  GLU A CG    1 
ATOM   711  C  CD    . GLU C 3 25  ? 16.595  24.394 7.084   1.00 17.49  ? 321  GLU A CD    1 
ATOM   712  O  OE1   . GLU C 3 25  ? 15.503  24.943 7.290   1.00 16.44  ? 321  GLU A OE1   1 
ATOM   713  O  OE2   . GLU C 3 25  ? 16.918  23.335 7.655   1.00 17.97  ? 321  GLU A OE2   1 
ATOM   714  N  N     . VAL C 3 26  ? 18.030  28.394 6.763   1.00 15.31  ? 322  VAL A N     1 
ATOM   715  C  CA    . VAL C 3 26  ? 19.233  29.107 7.181   1.00 15.68  ? 322  VAL A CA    1 
ATOM   716  C  C     . VAL C 3 26  ? 19.791  28.214 8.282   1.00 16.61  ? 322  VAL A C     1 
ATOM   717  O  O     . VAL C 3 26  ? 19.238  28.151 9.382   1.00 16.34  ? 322  VAL A O     1 
ATOM   718  C  CB    . VAL C 3 26  ? 18.901  30.495 7.767   1.00 15.26  ? 322  VAL A CB    1 
ATOM   719  C  CG1   . VAL C 3 26  ? 20.180  31.188 8.227   1.00 15.92  ? 322  VAL A CG1   1 
ATOM   720  C  CG2   . VAL C 3 26  ? 18.171  31.334 6.722   1.00 14.34  ? 322  VAL A CG2   1 
ATOM   721  N  N     . VAL C 3 27  ? 20.879  27.515 7.978   1.00 17.17  ? 323  VAL A N     1 
ATOM   722  C  CA    . VAL C 3 27  ? 21.483  26.594 8.932   1.00 18.04  ? 323  VAL A CA    1 
ATOM   723  C  C     . VAL C 3 27  ? 22.287  27.266 10.032  1.00 18.28  ? 323  VAL A C     1 
ATOM   724  O  O     . VAL C 3 27  ? 22.278  26.804 11.166  1.00 18.82  ? 323  VAL A O     1 
ATOM   725  C  CB    . VAL C 3 27  ? 22.353  25.555 8.191   1.00 16.80  ? 323  VAL A CB    1 
ATOM   726  C  CG1   . VAL C 3 27  ? 23.055  24.630 9.189   1.00 17.99  ? 323  VAL A CG1   1 
ATOM   727  C  CG2   . VAL C 3 27  ? 21.470  24.739 7.260   1.00 16.69  ? 323  VAL A CG2   1 
ATOM   728  N  N     . GLU C 3 28  ? 22.983  28.350 9.704   1.00 19.89  ? 324  GLU A N     1 
ATOM   729  C  CA    . GLU C 3 28  ? 23.770  29.082 10.701  1.00 22.26  ? 324  GLU A CA    1 
ATOM   730  C  C     . GLU C 3 28  ? 22.883  29.481 11.881  1.00 22.11  ? 324  GLU A C     1 
ATOM   731  O  O     . GLU C 3 28  ? 21.796  30.023 11.672  1.00 21.37  ? 324  GLU A O     1 
ATOM   732  C  CB    . GLU C 3 28  ? 24.355  30.355 10.086  1.00 26.90  ? 324  GLU A CB    1 
ATOM   733  C  CG    . GLU C 3 28  ? 25.467  30.138 9.086   1.00 32.32  ? 324  GLU A CG    1 
ATOM   734  C  CD    . GLU C 3 28  ? 26.687  29.524 9.723   1.00 36.06  ? 324  GLU A CD    1 
ATOM   735  O  OE1   . GLU C 3 28  ? 27.089  29.993 10.808  1.00 39.13  ? 324  GLU A OE1   1 
ATOM   736  O  OE2   . GLU C 3 28  ? 27.248  28.575 9.137   1.00 41.29  ? 324  GLU A OE2   1 
ATOM   737  N  N     . GLU C 3 29  ? 23.337  29.230 13.108  1.00 21.08  ? 325  GLU A N     1 
ATOM   738  C  CA    . GLU C 3 29  ? 22.544  29.596 14.286  1.00 23.33  ? 325  GLU A CA    1 
ATOM   739  C  C     . GLU C 3 29  ? 22.215  31.077 14.250  1.00 21.55  ? 325  GLU A C     1 
ATOM   740  O  O     . GLU C 3 29  ? 21.063  31.465 14.434  1.00 21.03  ? 325  GLU A O     1 
ATOM   741  C  CB    . GLU C 3 29  ? 23.282  29.269 15.593  1.00 27.18  ? 325  GLU A CB    1 
ATOM   742  C  CG    . GLU C 3 29  ? 23.101  27.828 16.057  1.00 34.68  ? 325  GLU A CG    1 
ATOM   743  C  CD    . GLU C 3 29  ? 23.536  27.613 17.502  1.00 39.25  ? 325  GLU A CD    1 
ATOM   744  O  OE1   . GLU C 3 29  ? 22.967  28.267 18.409  1.00 39.16  ? 325  GLU A OE1   1 
ATOM   745  O  OE2   . GLU C 3 29  ? 24.448  26.787 17.732  1.00 42.37  ? 325  GLU A OE2   1 
ATOM   746  N  N     . ASN C 3 30  ? 23.237  31.899 14.020  1.00 19.00  ? 326  ASN A N     1 
ATOM   747  C  CA    . ASN C 3 30  ? 23.056  33.342 13.915  1.00 17.21  ? 326  ASN A CA    1 
ATOM   748  C  C     . ASN C 3 30  ? 22.713  33.570 12.445  1.00 16.50  ? 326  ASN A C     1 
ATOM   749  O  O     . ASN C 3 30  ? 23.582  33.428 11.579  1.00 15.61  ? 326  ASN A O     1 
ATOM   750  C  CB    . ASN C 3 30  ? 24.355  34.067 14.270  1.00 15.36  ? 326  ASN A CB    1 
ATOM   751  C  CG    . ASN C 3 30  ? 24.182  35.570 14.348  1.00 16.30  ? 326  ASN A CG    1 
ATOM   752  O  OD1   . ASN C 3 30  ? 23.505  36.172 13.516  1.00 15.01  ? 326  ASN A OD1   1 
ATOM   753  N  ND2   . ASN C 3 30  ? 24.801  36.186 15.348  1.00 15.58  ? 326  ASN A ND2   1 
ATOM   754  N  N     . TYR C 3 31  ? 21.458  33.918 12.162  1.00 14.80  ? 327  TYR A N     1 
ATOM   755  C  CA    . TYR C 3 31  ? 21.006  34.105 10.779  1.00 13.22  ? 327  TYR A CA    1 
ATOM   756  C  C     . TYR C 3 31  ? 21.286  35.444 10.093  1.00 11.72  ? 327  TYR A C     1 
ATOM   757  O  O     . TYR C 3 31  ? 20.901  35.638 8.940   1.00 10.31  ? 327  TYR A O     1 
ATOM   758  C  CB    . TYR C 3 31  ? 19.506  33.794 10.685  1.00 12.65  ? 327  TYR A CB    1 
ATOM   759  C  CG    . TYR C 3 31  ? 18.657  34.478 11.742  1.00 14.15  ? 327  TYR A CG    1 
ATOM   760  C  CD1   . TYR C 3 31  ? 18.484  35.864 11.747  1.00 12.92  ? 327  TYR A CD1   1 
ATOM   761  C  CD2   . TYR C 3 31  ? 18.017  33.733 12.736  1.00 10.81  ? 327  TYR A CD2   1 
ATOM   762  C  CE1   . TYR C 3 31  ? 17.685  36.491 12.721  1.00 13.54  ? 327  TYR A CE1   1 
ATOM   763  C  CE2   . TYR C 3 31  ? 17.225  34.345 13.706  1.00 13.63  ? 327  TYR A CE2   1 
ATOM   764  C  CZ    . TYR C 3 31  ? 17.060  35.721 13.695  1.00 12.55  ? 327  TYR A CZ    1 
ATOM   765  O  OH    . TYR C 3 31  ? 16.271  36.315 14.657  1.00 14.10  ? 327  TYR A OH    1 
ATOM   766  N  N     . HIS C 3 32  ? 21.958  36.357 10.785  1.00 11.64  ? 328  HIS A N     1 
ATOM   767  C  CA    . HIS C 3 32  ? 22.259  37.666 10.216  1.00 12.88  ? 328  HIS A CA    1 
ATOM   768  C  C     . HIS C 3 32  ? 23.274  37.598 9.074   1.00 14.02  ? 328  HIS A C     1 
ATOM   769  O  O     . HIS C 3 32  ? 24.396  37.120 9.256   1.00 14.47  ? 328  HIS A O     1 
ATOM   770  C  CB    . HIS C 3 32  ? 22.765  38.598 11.319  1.00 13.81  ? 328  HIS A CB    1 
ATOM   771  C  CG    . HIS C 3 32  ? 21.691  39.059 12.256  1.00 16.25  ? 328  HIS A CG    1 
ATOM   772  N  ND1   . HIS C 3 32  ? 20.633  39.843 11.845  1.00 14.74  ? 328  HIS A ND1   1 
ATOM   773  C  CD2   . HIS C 3 32  ? 21.512  38.852 13.584  1.00 13.44  ? 328  HIS A CD2   1 
ATOM   774  C  CE1   . HIS C 3 32  ? 19.850  40.101 12.878  1.00 14.15  ? 328  HIS A CE1   1 
ATOM   775  N  NE2   . HIS C 3 32  ? 20.361  39.511 13.945  1.00 14.53  ? 328  HIS A NE2   1 
ATOM   776  N  N     . ASP C 3 33  ? 22.867  38.080 7.899   1.00 14.98  ? 329  ASP A N     1 
ATOM   777  C  CA    . ASP C 3 33  ? 23.714  38.082 6.702   1.00 14.43  ? 329  ASP A CA    1 
ATOM   778  C  C     . ASP C 3 33  ? 24.231  36.667 6.433   1.00 16.41  ? 329  ASP A C     1 
ATOM   779  O  O     . ASP C 3 33  ? 25.315  36.482 5.873   1.00 15.70  ? 329  ASP A O     1 
ATOM   780  C  CB    . ASP C 3 33  ? 24.900  39.047 6.880   1.00 13.56  ? 329  ASP A CB    1 
ATOM   781  C  CG    . ASP C 3 33  ? 25.287  39.770 5.581   1.00 14.51  ? 329  ASP A CG    1 
ATOM   782  O  OD1   . ASP C 3 33  ? 26.328  40.461 5.579   1.00 12.84  ? 329  ASP A OD1   1 
ATOM   783  O  OD2   . ASP C 3 33  ? 24.559  39.659 4.570   1.00 10.89  ? 329  ASP A OD2   1 
ATOM   784  N  N     . ALA C 3 34  ? 23.442  35.672 6.836   1.00 15.65  ? 330  ALA A N     1 
ATOM   785  C  CA    . ALA C 3 34  ? 23.804  34.269 6.651   1.00 16.02  ? 330  ALA A CA    1 
ATOM   786  C  C     . ALA C 3 34  ? 23.208  33.690 5.374   1.00 15.11  ? 330  ALA A C     1 
ATOM   787  O  O     . ALA C 3 34  ? 22.250  34.230 4.818   1.00 15.89  ? 330  ALA A O     1 
ATOM   788  C  CB    . ALA C 3 34  ? 23.348  33.447 7.852   1.00 12.66  ? 330  ALA A CB    1 
ATOM   789  N  N     . PRO C 3 35  ? 23.770  32.568 4.899   1.00 16.02  ? 331  PRO A N     1 
ATOM   790  C  CA    . PRO C 3 35  ? 23.319  31.885 3.684   1.00 15.88  ? 331  PRO A CA    1 
ATOM   791  C  C     . PRO C 3 35  ? 21.975  31.169 3.803   1.00 15.89  ? 331  PRO A C     1 
ATOM   792  O  O     . PRO C 3 35  ? 21.611  30.665 4.864   1.00 16.46  ? 331  PRO A O     1 
ATOM   793  C  CB    . PRO C 3 35  ? 24.454  30.897 3.378   1.00 16.25  ? 331  PRO A CB    1 
ATOM   794  C  CG    . PRO C 3 35  ? 25.637  31.396 4.209   1.00 16.97  ? 331  PRO A CG    1 
ATOM   795  C  CD    . PRO C 3 35  ? 24.962  31.901 5.454   1.00 14.49  ? 331  PRO A CD    1 
ATOM   796  N  N     . ILE C 3 36  ? 21.244  31.140 2.696   1.00 15.67  ? 332  ILE A N     1 
ATOM   797  C  CA    . ILE C 3 36  ? 19.984  30.416 2.621   1.00 15.99  ? 332  ILE A CA    1 
ATOM   798  C  C     . ILE C 3 36  ? 20.431  29.216 1.782   1.00 16.58  ? 332  ILE A C     1 
ATOM   799  O  O     . ILE C 3 36  ? 20.793  29.374 0.620   1.00 16.71  ? 332  ILE A O     1 
ATOM   800  C  CB    . ILE C 3 36  ? 18.917  31.241 1.881   1.00 15.55  ? 332  ILE A CB    1 
ATOM   801  C  CG1   . ILE C 3 36  ? 18.482  32.415 2.764   1.00 14.26  ? 332  ILE A CG1   1 
ATOM   802  C  CG2   . ILE C 3 36  ? 17.727  30.368 1.525   1.00 15.43  ? 332  ILE A CG2   1 
ATOM   803  C  CD1   . ILE C 3 36  ? 17.522  33.385 2.085   1.00 14.97  ? 332  ILE A CD1   1 
ATOM   804  N  N     . VAL C 3 37  ? 20.416  28.025 2.369   1.00 17.59  ? 333  VAL A N     1 
ATOM   805  C  CA    . VAL C 3 37  ? 20.898  26.828 1.681   1.00 18.06  ? 333  VAL A CA    1 
ATOM   806  C  C     . VAL C 3 37  ? 19.931  26.071 0.780   1.00 18.66  ? 333  VAL A C     1 
ATOM   807  O  O     . VAL C 3 37  ? 20.347  25.230 -0.019  1.00 18.73  ? 333  VAL A O     1 
ATOM   808  C  CB    . VAL C 3 37  ? 21.483  25.827 2.696   1.00 19.30  ? 333  VAL A CB    1 
ATOM   809  C  CG1   . VAL C 3 37  ? 22.518  26.530 3.576   1.00 20.17  ? 333  VAL A CG1   1 
ATOM   810  C  CG2   . VAL C 3 37  ? 20.371  25.229 3.545   1.00 19.44  ? 333  VAL A CG2   1 
ATOM   811  N  N     . GLY C 3 38  ? 18.645  26.357 0.904   1.00 18.22  ? 334  GLY A N     1 
ATOM   812  C  CA    . GLY C 3 38  ? 17.674  25.669 0.079   1.00 17.28  ? 334  GLY A CA    1 
ATOM   813  C  C     . GLY C 3 38  ? 16.281  26.178 0.371   1.00 17.63  ? 334  GLY A C     1 
ATOM   814  O  O     . GLY C 3 38  ? 16.062  26.859 1.378   1.00 17.23  ? 334  GLY A O     1 
ATOM   815  N  N     . ILE C 3 39  ? 15.339  25.831 -0.500  1.00 16.82  ? 335  ILE A N     1 
ATOM   816  C  CA    . ILE C 3 39  ? 13.957  26.265 -0.352  1.00 16.99  ? 335  ILE A CA    1 
ATOM   817  C  C     . ILE C 3 39  ? 12.980  25.143 -0.705  1.00 17.05  ? 335  ILE A C     1 
ATOM   818  O  O     . ILE C 3 39  ? 13.165  24.428 -1.688  1.00 17.12  ? 335  ILE A O     1 
ATOM   819  C  CB    . ILE C 3 39  ? 13.689  27.495 -1.256  1.00 17.64  ? 335  ILE A CB    1 
ATOM   820  C  CG1   . ILE C 3 39  ? 14.473  28.698 -0.723  1.00 19.60  ? 335  ILE A CG1   1 
ATOM   821  C  CG2   . ILE C 3 39  ? 12.187  27.800 -1.322  1.00 18.29  ? 335  ILE A CG2   1 
ATOM   822  C  CD1   . ILE C 3 39  ? 14.497  29.899 -1.666  1.00 18.27  ? 335  ILE A CD1   1 
ATOM   823  N  N     . ALA C 3 40  ? 11.942  24.985 0.108   1.00 16.26  ? 336  ALA A N     1 
ATOM   824  C  CA    . ALA C 3 40  ? 10.938  23.959 -0.151  1.00 16.73  ? 336  ALA A CA    1 
ATOM   825  C  C     . ALA C 3 40  ? 9.564   24.594 -0.096  1.00 16.22  ? 336  ALA A C     1 
ATOM   826  O  O     . ALA C 3 40  ? 9.310   25.487 0.719   1.00 16.42  ? 336  ALA A O     1 
ATOM   827  C  CB    . ALA C 3 40  ? 11.038  22.828 0.874   1.00 15.73  ? 336  ALA A CB    1 
ATOM   828  N  N     . VAL C 3 41  ? 8.682   24.133 -0.973  1.00 16.62  ? 337  VAL A N     1 
ATOM   829  C  CA    . VAL C 3 41  ? 7.319   24.639 -1.047  1.00 16.07  ? 337  VAL A CA    1 
ATOM   830  C  C     . VAL C 3 41  ? 6.356   23.469 -1.178  1.00 16.43  ? 337  VAL A C     1 
ATOM   831  O  O     . VAL C 3 41  ? 6.542   22.600 -2.024  1.00 16.36  ? 337  VAL A O     1 
ATOM   832  C  CB    . VAL C 3 41  ? 7.113   25.553 -2.277  1.00 18.25  ? 337  VAL A CB    1 
ATOM   833  C  CG1   . VAL C 3 41  ? 5.657   26.011 -2.346  1.00 17.75  ? 337  VAL A CG1   1 
ATOM   834  C  CG2   . VAL C 3 41  ? 8.049   26.747 -2.214  1.00 17.50  ? 337  VAL A CG2   1 
ATOM   835  N  N     . VAL C 3 42  ? 5.332   23.448 -0.334  1.00 15.86  ? 338  VAL A N     1 
ATOM   836  C  CA    . VAL C 3 42  ? 4.319   22.398 -0.387  1.00 15.89  ? 338  VAL A CA    1 
ATOM   837  C  C     . VAL C 3 42  ? 2.955   23.082 -0.460  1.00 17.15  ? 338  VAL A C     1 
ATOM   838  O  O     . VAL C 3 42  ? 2.622   23.905 0.398   1.00 16.83  ? 338  VAL A O     1 
ATOM   839  C  CB    . VAL C 3 42  ? 4.368   21.481 0.867   1.00 15.22  ? 338  VAL A CB    1 
ATOM   840  C  CG1   . VAL C 3 42  ? 3.103   20.621 0.942   1.00 13.49  ? 338  VAL A CG1   1 
ATOM   841  C  CG2   . VAL C 3 42  ? 5.594   20.574 0.804   1.00 14.98  ? 338  VAL A CG2   1 
ATOM   842  N  N     . ASN C 3 43  ? 2.179   22.754 -1.489  1.00 18.52  ? 339  ASN A N     1 
ATOM   843  C  CA    . ASN C 3 43  ? 0.846   23.330 -1.654  1.00 21.00  ? 339  ASN A CA    1 
ATOM   844  C  C     . ASN C 3 43  ? -0.119  22.311 -2.258  1.00 22.07  ? 339  ASN A C     1 
ATOM   845  O  O     . ASN C 3 43  ? 0.201   21.126 -2.348  1.00 22.57  ? 339  ASN A O     1 
ATOM   846  C  CB    . ASN C 3 43  ? 0.893   24.604 -2.521  1.00 20.11  ? 339  ASN A CB    1 
ATOM   847  C  CG    . ASN C 3 43  ? 1.437   24.352 -3.921  1.00 20.54  ? 339  ASN A CG    1 
ATOM   848  O  OD1   . ASN C 3 43  ? 1.197   23.302 -4.511  1.00 18.67  ? 339  ASN A OD1   1 
ATOM   849  N  ND2   . ASN C 3 43  ? 2.161   25.332 -4.463  1.00 18.39  ? 339  ASN A ND2   1 
ATOM   850  N  N     . GLU C 3 44  ? -1.299  22.765 -2.673  1.00 25.40  ? 340  GLU A N     1 
ATOM   851  C  CA    . GLU C 3 44  ? -2.291  21.857 -3.241  1.00 27.90  ? 340  GLU A CA    1 
ATOM   852  C  C     . GLU C 3 44  ? -1.804  21.152 -4.508  1.00 28.50  ? 340  GLU A C     1 
ATOM   853  O  O     . GLU C 3 44  ? -2.287  20.073 -4.840  1.00 29.77  ? 340  GLU A O     1 
ATOM   854  C  CB    . GLU C 3 44  ? -3.596  22.605 -3.544  1.00 29.71  ? 340  GLU A CB    1 
ATOM   855  C  CG    . GLU C 3 44  ? -3.534  23.560 -4.732  1.00 33.82  ? 340  GLU A CG    1 
ATOM   856  C  CD    . GLU C 3 44  ? -4.894  24.164 -5.074  1.00 36.52  ? 340  GLU A CD    1 
ATOM   857  O  OE1   . GLU C 3 44  ? -5.869  23.393 -5.215  1.00 39.99  ? 340  GLU A OE1   1 
ATOM   858  O  OE2   . GLU C 3 44  ? -4.990  25.404 -5.205  1.00 35.44  ? 340  GLU A OE2   1 
ATOM   859  N  N     . HIS C 3 45  ? -0.841  21.750 -5.201  1.00 28.58  ? 341  HIS A N     1 
ATOM   860  C  CA    . HIS C 3 45  ? -0.324  21.169 -6.438  1.00 28.02  ? 341  HIS A CA    1 
ATOM   861  C  C     . HIS C 3 45  ? 0.831   20.185 -6.271  1.00 27.89  ? 341  HIS A C     1 
ATOM   862  O  O     . HIS C 3 45  ? 1.211   19.520 -7.234  1.00 27.78  ? 341  HIS A O     1 
ATOM   863  C  CB    . HIS C 3 45  ? 0.097   22.279 -7.404  1.00 28.62  ? 341  HIS A CB    1 
ATOM   864  C  CG    . HIS C 3 45  ? -0.976  23.294 -7.657  1.00 29.77  ? 341  HIS A CG    1 
ATOM   865  N  ND1   . HIS C 3 45  ? -2.236  22.952 -8.096  1.00 29.05  ? 341  HIS A ND1   1 
ATOM   866  C  CD2   . HIS C 3 45  ? -0.980  24.642 -7.517  1.00 29.26  ? 341  HIS A CD2   1 
ATOM   867  C  CE1   . HIS C 3 45  ? -2.971  24.044 -8.216  1.00 29.48  ? 341  HIS A CE1   1 
ATOM   868  N  NE2   . HIS C 3 45  ? -2.232  25.083 -7.870  1.00 29.80  ? 341  HIS A NE2   1 
ATOM   869  N  N     . GLY C 3 46  ? 1.387   20.087 -5.066  1.00 26.45  ? 342  GLY A N     1 
ATOM   870  C  CA    . GLY C 3 46  ? 2.485   19.158 -4.841  1.00 23.70  ? 342  GLY A CA    1 
ATOM   871  C  C     . GLY C 3 46  ? 3.562   19.649 -3.888  1.00 23.82  ? 342  GLY A C     1 
ATOM   872  O  O     . GLY C 3 46  ? 3.335   20.574 -3.107  1.00 22.74  ? 342  GLY A O     1 
ATOM   873  N  N     . ARG C 3 47  ? 4.735   19.020 -3.956  1.00 22.80  ? 343  ARG A N     1 
ATOM   874  C  CA    . ARG C 3 47  ? 5.872   19.375 -3.111  1.00 22.20  ? 343  ARG A CA    1 
ATOM   875  C  C     . ARG C 3 47  ? 7.051   19.738 -4.013  1.00 23.62  ? 343  ARG A C     1 
ATOM   876  O  O     . ARG C 3 47  ? 7.377   18.998 -4.947  1.00 21.64  ? 343  ARG A O     1 
ATOM   877  C  CB    . ARG C 3 47  ? 6.258   18.196 -2.213  1.00 21.31  ? 343  ARG A CB    1 
ATOM   878  C  CG    . ARG C 3 47  ? 5.070   17.442 -1.629  1.00 20.74  ? 343  ARG A CG    1 
ATOM   879  C  CD    . ARG C 3 47  ? 5.486   16.586 -0.443  1.00 21.12  ? 343  ARG A CD    1 
ATOM   880  N  NE    . ARG C 3 47  ? 4.384   15.761 0.046   1.00 23.57  ? 343  ARG A NE    1 
ATOM   881  C  CZ    . ARG C 3 47  ? 4.097   14.548 -0.416  1.00 22.90  ? 343  ARG A CZ    1 
ATOM   882  N  NH1   . ARG C 3 47  ? 4.834   14.011 -1.379  1.00 22.12  ? 343  ARG A NH1   1 
ATOM   883  N  NH2   . ARG C 3 47  ? 3.072   13.872 0.081   1.00 21.88  ? 343  ARG A NH2   1 
ATOM   884  N  N     . PHE C 3 48  ? 7.697   20.866 -3.732  1.00 21.80  ? 344  PHE A N     1 
ATOM   885  C  CA    . PHE C 3 48  ? 8.819   21.303 -4.555  1.00 22.71  ? 344  PHE A CA    1 
ATOM   886  C  C     . PHE C 3 48  ? 10.063  21.722 -3.776  1.00 23.03  ? 344  PHE A C     1 
ATOM   887  O  O     . PHE C 3 48  ? 9.974   22.195 -2.644  1.00 21.42  ? 344  PHE A O     1 
ATOM   888  C  CB    . PHE C 3 48  ? 8.398   22.488 -5.433  1.00 20.88  ? 344  PHE A CB    1 
ATOM   889  C  CG    . PHE C 3 48  ? 7.052   22.326 -6.080  1.00 21.79  ? 344  PHE A CG    1 
ATOM   890  C  CD1   . PHE C 3 48  ? 5.885   22.559 -5.357  1.00 19.87  ? 344  PHE A CD1   1 
ATOM   891  C  CD2   . PHE C 3 48  ? 6.951   21.948 -7.420  1.00 21.12  ? 344  PHE A CD2   1 
ATOM   892  C  CE1   . PHE C 3 48  ? 4.631   22.421 -5.957  1.00 20.90  ? 344  PHE A CE1   1 
ATOM   893  C  CE2   . PHE C 3 48  ? 5.704   21.806 -8.031  1.00 21.96  ? 344  PHE A CE2   1 
ATOM   894  C  CZ    . PHE C 3 48  ? 4.539   22.044 -7.296  1.00 21.09  ? 344  PHE A CZ    1 
ATOM   895  N  N     . PHE C 3 49  ? 11.223  21.537 -4.398  1.00 22.85  ? 345  PHE A N     1 
ATOM   896  C  CA    . PHE C 3 49  ? 12.489  21.969 -3.817  1.00 22.74  ? 345  PHE A CA    1 
ATOM   897  C  C     . PHE C 3 49  ? 13.129  22.896 -4.846  1.00 23.16  ? 345  PHE A C     1 
ATOM   898  O  O     . PHE C 3 49  ? 13.189  22.568 -6.031  1.00 23.84  ? 345  PHE A O     1 
ATOM   899  C  CB    . PHE C 3 49  ? 13.451  20.817 -3.558  1.00 20.86  ? 345  PHE A CB    1 
ATOM   900  C  CG    . PHE C 3 49  ? 14.823  21.283 -3.149  1.00 22.65  ? 345  PHE A CG    1 
ATOM   901  C  CD1   . PHE C 3 49  ? 15.085  21.641 -1.827  1.00 20.37  ? 345  PHE A CD1   1 
ATOM   902  C  CD2   . PHE C 3 49  ? 15.842  21.407 -4.094  1.00 21.68  ? 345  PHE A CD2   1 
ATOM   903  C  CE1   . PHE C 3 49  ? 16.343  22.120 -1.449  1.00 21.49  ? 345  PHE A CE1   1 
ATOM   904  C  CE2   . PHE C 3 49  ? 17.107  21.887 -3.729  1.00 22.70  ? 345  PHE A CE2   1 
ATOM   905  C  CZ    . PHE C 3 49  ? 17.357  22.245 -2.402  1.00 21.55  ? 345  PHE A CZ    1 
ATOM   906  N  N     . LEU C 3 50  ? 13.608  24.047 -4.392  1.00 22.39  ? 346  LEU A N     1 
ATOM   907  C  CA    . LEU C 3 50  ? 14.227  25.022 -5.277  1.00 21.60  ? 346  LEU A CA    1 
ATOM   908  C  C     . LEU C 3 50  ? 15.578  25.460 -4.747  1.00 22.27  ? 346  LEU A C     1 
ATOM   909  O  O     . LEU C 3 50  ? 15.740  25.654 -3.542  1.00 20.12  ? 346  LEU A O     1 
ATOM   910  C  CB    . LEU C 3 50  ? 13.338  26.259 -5.408  1.00 22.31  ? 346  LEU A CB    1 
ATOM   911  C  CG    . LEU C 3 50  ? 12.048  26.204 -6.224  1.00 20.70  ? 346  LEU A CG    1 
ATOM   912  C  CD1   . LEU C 3 50  ? 11.213  27.440 -5.930  1.00 21.83  ? 346  LEU A CD1   1 
ATOM   913  C  CD2   . LEU C 3 50  ? 12.387  26.121 -7.705  1.00 22.13  ? 346  LEU A CD2   1 
ATOM   914  N  N     . ARG C 3 51  ? 16.543  25.618 -5.649  1.00 23.33  ? 347  ARG A N     1 
ATOM   915  C  CA    . ARG C 3 51  ? 17.867  26.081 -5.259  1.00 24.84  ? 347  ARG A CA    1 
ATOM   916  C  C     . ARG C 3 51  ? 17.712  27.578 -5.021  1.00 24.11  ? 347  ARG A C     1 
ATOM   917  O  O     . ARG C 3 51  ? 17.079  28.276 -5.808  1.00 24.28  ? 347  ARG A O     1 
ATOM   918  C  CB    . ARG C 3 51  ? 18.888  25.801 -6.366  1.00 27.17  ? 347  ARG A CB    1 
ATOM   919  C  CG    . ARG C 3 51  ? 19.011  24.320 -6.684  1.00 30.42  ? 347  ARG A CG    1 
ATOM   920  C  CD    . ARG C 3 51  ? 20.162  24.000 -7.632  1.00 32.05  ? 347  ARG A CD    1 
ATOM   921  N  NE    . ARG C 3 51  ? 20.221  22.565 -7.901  1.00 35.64  ? 347  ARG A NE    1 
ATOM   922  C  CZ    . ARG C 3 51  ? 19.436  21.925 -8.765  1.00 37.56  ? 347  ARG A CZ    1 
ATOM   923  N  NH1   . ARG C 3 51  ? 18.527  22.592 -9.467  1.00 39.35  ? 347  ARG A NH1   1 
ATOM   924  N  NH2   . ARG C 3 51  ? 19.554  20.612 -8.921  1.00 37.27  ? 347  ARG A NH2   1 
ATOM   925  N  N     . PRO C 3 52  ? 18.290  28.089 -3.925  1.00 24.74  ? 348  PRO A N     1 
ATOM   926  C  CA    . PRO C 3 52  ? 18.212  29.508 -3.564  1.00 25.13  ? 348  PRO A CA    1 
ATOM   927  C  C     . PRO C 3 52  ? 18.680  30.492 -4.632  1.00 26.12  ? 348  PRO A C     1 
ATOM   928  O  O     . PRO C 3 52  ? 18.022  31.505 -4.880  1.00 25.05  ? 348  PRO A O     1 
ATOM   929  C  CB    . PRO C 3 52  ? 19.034  29.581 -2.282  1.00 25.85  ? 348  PRO A CB    1 
ATOM   930  C  CG    . PRO C 3 52  ? 20.070  28.512 -2.501  1.00 26.13  ? 348  PRO A CG    1 
ATOM   931  C  CD    . PRO C 3 52  ? 19.242  27.379 -3.053  1.00 23.99  ? 348  PRO A CD    1 
ATOM   932  N  N     . GLU C 3 53  ? 19.812  30.199 -5.264  1.00 28.60  ? 349  GLU A N     1 
ATOM   933  C  CA    . GLU C 3 53  ? 20.342  31.085 -6.295  1.00 30.99  ? 349  GLU A CA    1 
ATOM   934  C  C     . GLU C 3 53  ? 19.392  31.187 -7.484  1.00 30.59  ? 349  GLU A C     1 
ATOM   935  O  O     . GLU C 3 53  ? 19.423  32.161 -8.231  1.00 32.03  ? 349  GLU A O     1 
ATOM   936  C  CB    . GLU C 3 53  ? 21.720  30.607 -6.766  1.00 32.92  ? 349  GLU A CB    1 
ATOM   937  C  CG    . GLU C 3 53  ? 21.743  29.236 -7.429  1.00 38.21  ? 349  GLU A CG    1 
ATOM   938  C  CD    . GLU C 3 53  ? 21.657  28.086 -6.438  1.00 40.71  ? 349  GLU A CD    1 
ATOM   939  O  OE1   . GLU C 3 53  ? 21.821  26.925 -6.871  1.00 43.21  ? 349  GLU A OE1   1 
ATOM   940  O  OE2   . GLU C 3 53  ? 21.428  28.335 -5.235  1.00 40.21  ? 349  GLU A OE2   1 
ATOM   941  N  N     . THR C 3 54  ? 18.542  30.180 -7.650  1.00 29.79  ? 350  THR A N     1 
ATOM   942  C  CA    . THR C 3 54  ? 17.578  30.163 -8.741  1.00 28.53  ? 350  THR A CA    1 
ATOM   943  C  C     . THR C 3 54  ? 16.295  30.892 -8.352  1.00 27.89  ? 350  THR A C     1 
ATOM   944  O  O     . THR C 3 54  ? 15.894  31.854 -9.004  1.00 29.26  ? 350  THR A O     1 
ATOM   945  C  CB    . THR C 3 54  ? 17.229  28.713 -9.137  1.00 29.76  ? 350  THR A CB    1 
ATOM   946  O  OG1   . THR C 3 54  ? 18.403  28.067 -9.640  1.00 30.45  ? 350  THR A OG1   1 
ATOM   947  C  CG2   . THR C 3 54  ? 16.140  28.685 -10.208 1.00 28.86  ? 350  THR A CG2   1 
ATOM   948  N  N     . ALA C 3 55  ? 15.658  30.430 -7.283  1.00 26.00  ? 351  ALA A N     1 
ATOM   949  C  CA    . ALA C 3 55  ? 14.415  31.027 -6.810  1.00 25.30  ? 351  ALA A CA    1 
ATOM   950  C  C     . ALA C 3 55  ? 14.539  32.499 -6.423  1.00 23.38  ? 351  ALA A C     1 
ATOM   951  O  O     . ALA C 3 55  ? 13.714  33.319 -6.816  1.00 22.62  ? 351  ALA A O     1 
ATOM   952  C  CB    . ALA C 3 55  ? 13.872  30.225 -5.625  1.00 24.26  ? 351  ALA A CB    1 
ATOM   953  N  N     . LEU C 3 56  ? 15.569  32.836 -5.659  1.00 22.88  ? 352  LEU A N     1 
ATOM   954  C  CA    . LEU C 3 56  ? 15.747  34.212 -5.217  1.00 24.01  ? 352  LEU A CA    1 
ATOM   955  C  C     . LEU C 3 56  ? 16.122  35.189 -6.330  1.00 24.48  ? 352  LEU A C     1 
ATOM   956  O  O     . LEU C 3 56  ? 16.125  36.401 -6.125  1.00 25.94  ? 352  LEU A O     1 
ATOM   957  C  CB    . LEU C 3 56  ? 16.775  34.268 -4.088  1.00 22.63  ? 352  LEU A CB    1 
ATOM   958  C  CG    . LEU C 3 56  ? 16.366  33.456 -2.854  1.00 23.01  ? 352  LEU A CG    1 
ATOM   959  C  CD1   . LEU C 3 56  ? 17.369  33.679 -1.731  1.00 22.21  ? 352  LEU A CD1   1 
ATOM   960  C  CD2   . LEU C 3 56  ? 14.975  33.871 -2.405  1.00 23.41  ? 352  LEU A CD2   1 
ATOM   961  N  N     . ALA C 3 57  ? 16.433  34.663 -7.509  1.00 24.67  ? 353  ALA A N     1 
ATOM   962  C  CA    . ALA C 3 57  ? 16.773  35.514 -8.641  1.00 27.06  ? 353  ALA A CA    1 
ATOM   963  C  C     . ALA C 3 57  ? 15.562  35.619 -9.569  1.00 26.82  ? 353  ALA A C     1 
ATOM   964  O  O     . ALA C 3 57  ? 15.556  36.420 -10.498 1.00 29.16  ? 353  ALA A O     1 
ATOM   965  C  CB    . ALA C 3 57  ? 17.971  34.936 -9.398  1.00 26.23  ? 353  ALA A CB    1 
ATOM   966  N  N     . ASP C 3 58  ? 14.538  34.809 -9.304  1.00 27.99  ? 354  ASP A N     1 
ATOM   967  C  CA    . ASP C 3 58  ? 13.319  34.797 -10.116 1.00 28.13  ? 354  ASP A CA    1 
ATOM   968  C  C     . ASP C 3 58  ? 12.352  35.902 -9.704  1.00 27.88  ? 354  ASP A C     1 
ATOM   969  O  O     . ASP C 3 58  ? 11.905  35.950 -8.560  1.00 27.59  ? 354  ASP A O     1 
ATOM   970  C  CB    . ASP C 3 58  ? 12.604  33.450 -9.987  1.00 29.08  ? 354  ASP A CB    1 
ATOM   971  C  CG    . ASP C 3 58  ? 11.373  33.354 -10.874 1.00 29.70  ? 354  ASP A CG    1 
ATOM   972  O  OD1   . ASP C 3 58  ? 11.501  32.877 -12.018 1.00 31.09  ? 354  ASP A OD1   1 
ATOM   973  O  OD2   . ASP C 3 58  ? 10.276  33.760 -10.434 1.00 31.01  ? 354  ASP A OD2   1 
ATOM   974  N  N     . PRO C 3 59  ? 12.001  36.796 -10.645 1.00 27.46  ? 355  PRO A N     1 
ATOM   975  C  CA    . PRO C 3 59  ? 11.078  37.910 -10.390 1.00 26.04  ? 355  PRO A CA    1 
ATOM   976  C  C     . PRO C 3 59  ? 9.722   37.450 -9.855  1.00 25.11  ? 355  PRO A C     1 
ATOM   977  O  O     . PRO C 3 59  ? 9.177   38.053 -8.933  1.00 24.62  ? 355  PRO A O     1 
ATOM   978  C  CB    . PRO C 3 59  ? 10.967  38.595 -11.751 1.00 26.97  ? 355  PRO A CB    1 
ATOM   979  C  CG    . PRO C 3 59  ? 12.279  38.276 -12.404 1.00 27.51  ? 355  PRO A CG    1 
ATOM   980  C  CD    . PRO C 3 59  ? 12.479  36.827 -12.038 1.00 27.22  ? 355  PRO A CD    1 
ATOM   981  N  N     . GLN C 3 60  ? 9.187   36.384 -10.448 1.00 24.39  ? 356  GLN A N     1 
ATOM   982  C  CA    . GLN C 3 60  ? 7.895   35.832 -10.053 1.00 24.91  ? 356  GLN A CA    1 
ATOM   983  C  C     . GLN C 3 60  ? 7.912   35.270 -8.635  1.00 24.07  ? 356  GLN A C     1 
ATOM   984  O  O     . GLN C 3 60  ? 6.960   35.457 -7.881  1.00 23.60  ? 356  GLN A O     1 
ATOM   985  C  CB    . GLN C 3 60  ? 7.463   34.722 -11.019 1.00 28.04  ? 356  GLN A CB    1 
ATOM   986  C  CG    . GLN C 3 60  ? 7.156   35.183 -12.444 1.00 33.48  ? 356  GLN A CG    1 
ATOM   987  C  CD    . GLN C 3 60  ? 8.380   35.714 -13.166 1.00 36.82  ? 356  GLN A CD    1 
ATOM   988  O  OE1   . GLN C 3 60  ? 9.361   34.993 -13.369 1.00 38.29  ? 356  GLN A OE1   1 
ATOM   989  N  NE2   . GLN C 3 60  ? 8.328   36.984 -13.558 1.00 38.01  ? 356  GLN A NE2   1 
ATOM   990  N  N     . PHE C 3 61  ? 8.989   34.577 -8.275  1.00 22.40  ? 357  PHE A N     1 
ATOM   991  C  CA    . PHE C 3 61  ? 9.090   34.007 -6.938  1.00 22.32  ? 357  PHE A CA    1 
ATOM   992  C  C     . PHE C 3 61  ? 9.201   35.106 -5.879  1.00 21.62  ? 357  PHE A C     1 
ATOM   993  O  O     . PHE C 3 61  ? 8.482   35.086 -4.881  1.00 20.34  ? 357  PHE A O     1 
ATOM   994  C  CB    . PHE C 3 61  ? 10.299  33.074 -6.834  1.00 22.28  ? 357  PHE A CB    1 
ATOM   995  C  CG    . PHE C 3 61  ? 10.326  32.264 -5.562  1.00 22.86  ? 357  PHE A CG    1 
ATOM   996  C  CD1   . PHE C 3 61  ? 9.412   31.231 -5.364  1.00 22.94  ? 357  PHE A CD1   1 
ATOM   997  C  CD2   . PHE C 3 61  ? 11.249  32.546 -4.558  1.00 22.20  ? 357  PHE A CD2   1 
ATOM   998  C  CE1   . PHE C 3 61  ? 9.414   30.491 -4.184  1.00 24.62  ? 357  PHE A CE1   1 
ATOM   999  C  CE2   . PHE C 3 61  ? 11.261  31.813 -3.371  1.00 22.82  ? 357  PHE A CE2   1 
ATOM   1000 C  CZ    . PHE C 3 61  ? 10.342  30.783 -3.184  1.00 23.79  ? 357  PHE A CZ    1 
ATOM   1001 N  N     . VAL C 3 62  ? 10.099  36.063 -6.105  1.00 20.44  ? 358  VAL A N     1 
ATOM   1002 C  CA    . VAL C 3 62  ? 10.304  37.171 -5.176  1.00 18.92  ? 358  VAL A CA    1 
ATOM   1003 C  C     . VAL C 3 62  ? 9.023   37.983 -4.981  1.00 19.89  ? 358  VAL A C     1 
ATOM   1004 O  O     . VAL C 3 62  ? 8.751   38.469 -3.877  1.00 19.17  ? 358  VAL A O     1 
ATOM   1005 C  CB    . VAL C 3 62  ? 11.447  38.118 -5.673  1.00 20.24  ? 358  VAL A CB    1 
ATOM   1006 C  CG1   . VAL C 3 62  ? 11.548  39.353 -4.783  1.00 20.41  ? 358  VAL A CG1   1 
ATOM   1007 C  CG2   . VAL C 3 62  ? 12.781  37.373 -5.664  1.00 18.74  ? 358  VAL A CG2   1 
ATOM   1008 N  N     . ALA C 3 63  ? 8.238   38.130 -6.049  1.00 18.92  ? 359  ALA A N     1 
ATOM   1009 C  CA    . ALA C 3 63  ? 6.986   38.880 -5.970  1.00 19.88  ? 359  ALA A CA    1 
ATOM   1010 C  C     . ALA C 3 63  ? 6.004   38.089 -5.118  1.00 19.76  ? 359  ALA A C     1 
ATOM   1011 O  O     . ALA C 3 63  ? 5.295   38.654 -4.290  1.00 22.29  ? 359  ALA A O     1 
ATOM   1012 C  CB    . ALA C 3 63  ? 6.407   39.104 -7.370  1.00 19.82  ? 359  ALA A CB    1 
ATOM   1013 N  N     . TRP C 3 64  ? 5.975   36.775 -5.328  1.00 20.05  ? 360  TRP A N     1 
ATOM   1014 C  CA    . TRP C 3 64  ? 5.093   35.889 -4.574  1.00 18.48  ? 360  TRP A CA    1 
ATOM   1015 C  C     . TRP C 3 64  ? 5.451   35.970 -3.088  1.00 18.49  ? 360  TRP A C     1 
ATOM   1016 O  O     . TRP C 3 64  ? 4.566   36.028 -2.233  1.00 16.72  ? 360  TRP A O     1 
ATOM   1017 C  CB    . TRP C 3 64  ? 5.240   34.448 -5.073  1.00 17.16  ? 360  TRP A CB    1 
ATOM   1018 C  CG    . TRP C 3 64  ? 4.420   33.432 -4.301  1.00 18.57  ? 360  TRP A CG    1 
ATOM   1019 C  CD1   . TRP C 3 64  ? 3.078   33.194 -4.414  1.00 16.49  ? 360  TRP A CD1   1 
ATOM   1020 C  CD2   . TRP C 3 64  ? 4.902   32.530 -3.294  1.00 18.56  ? 360  TRP A CD2   1 
ATOM   1021 N  NE1   . TRP C 3 64  ? 2.696   32.200 -3.542  1.00 18.12  ? 360  TRP A NE1   1 
ATOM   1022 C  CE2   . TRP C 3 64  ? 3.796   31.776 -2.843  1.00 17.74  ? 360  TRP A CE2   1 
ATOM   1023 C  CE3   . TRP C 3 64  ? 6.163   32.290 -2.727  1.00 18.72  ? 360  TRP A CE3   1 
ATOM   1024 C  CZ2   . TRP C 3 64  ? 3.911   30.795 -1.850  1.00 19.26  ? 360  TRP A CZ2   1 
ATOM   1025 C  CZ3   . TRP C 3 64  ? 6.276   31.312 -1.736  1.00 19.74  ? 360  TRP A CZ3   1 
ATOM   1026 C  CH2   . TRP C 3 64  ? 5.156   30.579 -1.311  1.00 19.10  ? 360  TRP A CH2   1 
ATOM   1027 N  N     . LEU C 3 65  ? 6.751   35.975 -2.792  1.00 17.37  ? 361  LEU A N     1 
ATOM   1028 C  CA    . LEU C 3 65  ? 7.230   36.061 -1.414  1.00 18.27  ? 361  LEU A CA    1 
ATOM   1029 C  C     . LEU C 3 65  ? 6.725   37.327 -0.723  1.00 17.95  ? 361  LEU A C     1 
ATOM   1030 O  O     . LEU C 3 65  ? 6.330   37.292 0.444   1.00 18.18  ? 361  LEU A O     1 
ATOM   1031 C  CB    . LEU C 3 65  ? 8.764   36.046 -1.372  1.00 16.92  ? 361  LEU A CB    1 
ATOM   1032 C  CG    . LEU C 3 65  ? 9.486   34.699 -1.487  1.00 16.62  ? 361  LEU A CG    1 
ATOM   1033 C  CD1   . LEU C 3 65  ? 10.985  34.933 -1.556  1.00 16.21  ? 361  LEU A CD1   1 
ATOM   1034 C  CD2   . LEU C 3 65  ? 9.137   33.819 -0.283  1.00 17.16  ? 361  LEU A CD2   1 
ATOM   1035 N  N     . GLY C 3 66  ? 6.732   38.440 -1.450  1.00 16.77  ? 362  GLY A N     1 
ATOM   1036 C  CA    . GLY C 3 66  ? 6.287   39.696 -0.875  1.00 17.71  ? 362  GLY A CA    1 
ATOM   1037 C  C     . GLY C 3 66  ? 4.809   40.013 -1.041  1.00 20.07  ? 362  GLY A C     1 
ATOM   1038 O  O     . GLY C 3 66  ? 4.355   41.089 -0.652  1.00 19.07  ? 362  GLY A O     1 
ATOM   1039 N  N     . ASP C 3 67  ? 4.048   39.089 -1.616  1.00 20.50  ? 363  ASP A N     1 
ATOM   1040 C  CA    . ASP C 3 67  ? 2.624   39.323 -1.808  1.00 21.07  ? 363  ASP A CA    1 
ATOM   1041 C  C     . ASP C 3 67  ? 1.855   38.881 -0.565  1.00 21.47  ? 363  ASP A C     1 
ATOM   1042 O  O     . ASP C 3 67  ? 1.737   37.687 -0.284  1.00 19.22  ? 363  ASP A O     1 
ATOM   1043 C  CB    . ASP C 3 67  ? 2.119   38.557 -3.029  1.00 21.22  ? 363  ASP A CB    1 
ATOM   1044 C  CG    . ASP C 3 67  ? 0.674   38.883 -3.367  1.00 22.30  ? 363  ASP A CG    1 
ATOM   1045 O  OD1   . ASP C 3 67  ? -0.049  39.387 -2.481  1.00 21.52  ? 363  ASP A OD1   1 
ATOM   1046 O  OD2   . ASP C 3 67  ? 0.262   38.626 -4.521  1.00 25.25  ? 363  ASP A OD2   1 
ATOM   1047 N  N     . GLU C 3 68  ? 1.328   39.859 0.165   1.00 21.55  ? 364  GLU A N     1 
ATOM   1048 C  CA    . GLU C 3 68  ? 0.569   39.608 1.384   1.00 23.82  ? 364  GLU A CA    1 
ATOM   1049 C  C     . GLU C 3 68  ? -0.673  38.734 1.192   1.00 22.16  ? 364  GLU A C     1 
ATOM   1050 O  O     . GLU C 3 68  ? -1.160  38.139 2.152   1.00 22.80  ? 364  GLU A O     1 
ATOM   1051 C  CB    . GLU C 3 68  ? 0.164   40.943 2.019   1.00 27.38  ? 364  GLU A CB    1 
ATOM   1052 C  CG    . GLU C 3 68  ? -0.792  40.817 3.198   1.00 34.30  ? 364  GLU A CG    1 
ATOM   1053 C  CD    . GLU C 3 68  ? -0.197  40.065 4.375   1.00 38.02  ? 364  GLU A CD    1 
ATOM   1054 O  OE1   . GLU C 3 68  ? -0.964  39.700 5.294   1.00 40.74  ? 364  GLU A OE1   1 
ATOM   1055 O  OE2   . GLU C 3 68  ? 1.034   39.839 4.387   1.00 40.49  ? 364  GLU A OE2   1 
ATOM   1056 N  N     . THR C 3 69  ? -1.191  38.647 -0.031  1.00 20.71  ? 365  THR A N     1 
ATOM   1057 C  CA    . THR C 3 69  ? -2.386  37.831 -0.269  1.00 20.55  ? 365  THR A CA    1 
ATOM   1058 C  C     . THR C 3 69  ? -2.061  36.362 -0.506  1.00 20.24  ? 365  THR A C     1 
ATOM   1059 O  O     . THR C 3 69  ? -2.957  35.515 -0.518  1.00 20.35  ? 365  THR A O     1 
ATOM   1060 C  CB    . THR C 3 69  ? -3.216  38.358 -1.461  1.00 20.54  ? 365  THR A CB    1 
ATOM   1061 O  OG1   . THR C 3 69  ? -2.454  38.256 -2.670  1.00 22.07  ? 365  THR A OG1   1 
ATOM   1062 C  CG2   . THR C 3 69  ? -3.594  39.810 -1.227  1.00 20.84  ? 365  THR A CG2   1 
ATOM   1063 N  N     . LYS C 3 70  ? -0.779  36.068 -0.703  1.00 18.72  ? 366  LYS A N     1 
ATOM   1064 C  CA    . LYS C 3 70  ? -0.318  34.696 -0.896  1.00 18.71  ? 366  LYS A CA    1 
ATOM   1065 C  C     . LYS C 3 70  ? 0.097   34.265 0.510   1.00 18.58  ? 366  LYS A C     1 
ATOM   1066 O  O     . LYS C 3 70  ? 1.115   34.726 1.026   1.00 17.57  ? 366  LYS A O     1 
ATOM   1067 C  CB    . LYS C 3 70  ? 0.884   34.671 -1.845  1.00 18.85  ? 366  LYS A CB    1 
ATOM   1068 C  CG    . LYS C 3 70  ? 0.638   35.399 -3.166  1.00 19.88  ? 366  LYS A CG    1 
ATOM   1069 C  CD    . LYS C 3 70  ? -0.493  34.761 -3.955  1.00 19.99  ? 366  LYS A CD    1 
ATOM   1070 C  CE    . LYS C 3 70  ? -0.830  35.572 -5.201  1.00 24.60  ? 366  LYS A CE    1 
ATOM   1071 N  NZ    . LYS C 3 70  ? -1.909  34.933 -6.002  1.00 24.76  ? 366  LYS A NZ    1 
ATOM   1072 N  N     . LYS C 3 71  ? -0.690  33.386 1.125   1.00 17.93  ? 367  LYS A N     1 
ATOM   1073 C  CA    . LYS C 3 71  ? -0.427  32.956 2.497   1.00 18.61  ? 367  LYS A CA    1 
ATOM   1074 C  C     . LYS C 3 71  ? 0.590   31.835 2.668   1.00 19.21  ? 367  LYS A C     1 
ATOM   1075 O  O     . LYS C 3 71  ? 0.591   30.859 1.922   1.00 21.56  ? 367  LYS A O     1 
ATOM   1076 C  CB    . LYS C 3 71  ? -1.744  32.561 3.174   1.00 19.46  ? 367  LYS A CB    1 
ATOM   1077 C  CG    . LYS C 3 71  ? -2.822  33.636 3.093   1.00 19.70  ? 367  LYS A CG    1 
ATOM   1078 C  CD    . LYS C 3 71  ? -2.342  34.956 3.693   1.00 20.99  ? 367  LYS A CD    1 
ATOM   1079 C  CE    . LYS C 3 71  ? -3.416  36.029 3.600   1.00 23.08  ? 367  LYS A CE    1 
ATOM   1080 N  NZ    . LYS C 3 71  ? -2.981  37.292 4.258   1.00 23.95  ? 367  LYS A NZ    1 
ATOM   1081 N  N     . LYS C 3 72  ? 1.453   31.992 3.667   1.00 18.37  ? 368  LYS A N     1 
ATOM   1082 C  CA    . LYS C 3 72  ? 2.485   31.008 3.968   1.00 17.00  ? 368  LYS A CA    1 
ATOM   1083 C  C     . LYS C 3 72  ? 2.426   30.518 5.414   1.00 15.72  ? 368  LYS A C     1 
ATOM   1084 O  O     . LYS C 3 72  ? 2.141   31.284 6.341   1.00 14.74  ? 368  LYS A O     1 
ATOM   1085 C  CB    . LYS C 3 72  ? 3.887   31.593 3.732   1.00 17.31  ? 368  LYS A CB    1 
ATOM   1086 C  CG    . LYS C 3 72  ? 4.208   32.012 2.296   1.00 18.57  ? 368  LYS A CG    1 
ATOM   1087 C  CD    . LYS C 3 72  ? 3.787   33.444 2.021   1.00 19.56  ? 368  LYS A CD    1 
ATOM   1088 C  CE    . LYS C 3 72  ? 4.219   33.895 0.626   1.00 17.49  ? 368  LYS A CE    1 
ATOM   1089 N  NZ    . LYS C 3 72  ? 3.812   35.307 0.375   1.00 17.62  ? 368  LYS A NZ    1 
ATOM   1090 N  N     . SER C 3 73  ? 2.693   29.231 5.591   1.00 14.66  ? 369  SER A N     1 
ATOM   1091 C  CA    . SER C 3 73  ? 2.750   28.624 6.914   1.00 14.80  ? 369  SER A CA    1 
ATOM   1092 C  C     . SER C 3 73  ? 4.224   28.254 7.035   1.00 13.61  ? 369  SER A C     1 
ATOM   1093 O  O     . SER C 3 73  ? 4.792   27.680 6.105   1.00 13.19  ? 369  SER A O     1 
ATOM   1094 C  CB    . SER C 3 73  ? 1.869   27.383 6.971   1.00 15.74  ? 369  SER A CB    1 
ATOM   1095 O  OG    . SER C 3 73  ? 0.513   27.759 6.828   1.00 18.36  ? 369  SER A OG    1 
ATOM   1096 N  N     . MET C 3 74  ? 4.844   28.589 8.161   1.00 12.41  ? 370  MET A N     1 
ATOM   1097 C  CA    . MET C 3 74  ? 6.269   28.320 8.335   1.00 13.83  ? 370  MET A CA    1 
ATOM   1098 C  C     . MET C 3 74  ? 6.633   27.950 9.766   1.00 11.96  ? 370  MET A C     1 
ATOM   1099 O  O     . MET C 3 74  ? 5.777   27.886 10.640  1.00 12.90  ? 370  MET A O     1 
ATOM   1100 C  CB    . MET C 3 74  ? 7.081   29.563 7.944   1.00 12.74  ? 370  MET A CB    1 
ATOM   1101 C  CG    . MET C 3 74  ? 6.761   30.165 6.563   1.00 13.32  ? 370  MET A CG    1 
ATOM   1102 S  SD    . MET C 3 74  ? 7.746   31.658 6.182   1.00 14.38  ? 370  MET A SD    1 
ATOM   1103 C  CE    . MET C 3 74  ? 9.340   30.936 5.766   1.00 12.86  ? 370  MET A CE    1 
ATOM   1104 N  N     . PHE C 3 75  ? 7.924   27.712 9.981   1.00 13.18  ? 371  PHE A N     1 
ATOM   1105 C  CA    . PHE C 3 75  ? 8.463   27.425 11.303  1.00 12.81  ? 371  PHE A CA    1 
ATOM   1106 C  C     . PHE C 3 75  ? 9.603   28.425 11.506  1.00 12.94  ? 371  PHE A C     1 
ATOM   1107 O  O     . PHE C 3 75  ? 10.598  28.384 10.782  1.00 14.26  ? 371  PHE A O     1 
ATOM   1108 C  CB    . PHE C 3 75  ? 9.028   26.007 11.389  1.00 11.86  ? 371  PHE A CB    1 
ATOM   1109 C  CG    . PHE C 3 75  ? 9.497   25.640 12.765  1.00 11.61  ? 371  PHE A CG    1 
ATOM   1110 C  CD1   . PHE C 3 75  ? 8.640   25.005 13.662  1.00 10.95  ? 371  PHE A CD1   1 
ATOM   1111 C  CD2   . PHE C 3 75  ? 10.793  25.950 13.178  1.00 11.24  ? 371  PHE A CD2   1 
ATOM   1112 C  CE1   . PHE C 3 75  ? 9.066   24.683 14.955  1.00 11.90  ? 371  PHE A CE1   1 
ATOM   1113 C  CE2   . PHE C 3 75  ? 11.232  25.635 14.469  1.00 10.93  ? 371  PHE A CE2   1 
ATOM   1114 C  CZ    . PHE C 3 75  ? 10.366  25.000 15.361  1.00 9.84   ? 371  PHE A CZ    1 
ATOM   1115 N  N     . ASP C 3 76  ? 9.460   29.316 12.486  1.00 13.54  ? 372  ASP A N     1 
ATOM   1116 C  CA    . ASP C 3 76  ? 10.472  30.336 12.764  1.00 13.32  ? 372  ASP A CA    1 
ATOM   1117 C  C     . ASP C 3 76  ? 10.576  31.260 11.554  1.00 13.63  ? 372  ASP A C     1 
ATOM   1118 O  O     . ASP C 3 76  ? 11.639  31.396 10.944  1.00 12.09  ? 372  ASP A O     1 
ATOM   1119 C  CB    . ASP C 3 76  ? 11.842  29.697 13.036  1.00 13.35  ? 372  ASP A CB    1 
ATOM   1120 C  CG    . ASP C 3 76  ? 12.827  30.677 13.663  1.00 15.14  ? 372  ASP A CG    1 
ATOM   1121 O  OD1   . ASP C 3 76  ? 12.459  31.857 13.855  1.00 16.15  ? 372  ASP A OD1   1 
ATOM   1122 O  OD2   . ASP C 3 76  ? 13.965  30.274 13.969  1.00 16.28  ? 372  ASP A OD2   1 
ATOM   1123 N  N     . SER C 3 77  ? 9.463   31.895 11.207  1.00 11.79  ? 373  SER A N     1 
ATOM   1124 C  CA    . SER C 3 77  ? 9.443   32.797 10.065  1.00 11.67  ? 373  SER A CA    1 
ATOM   1125 C  C     . SER C 3 77  ? 10.397  33.981 10.255  1.00 11.17  ? 373  SER A C     1 
ATOM   1126 O  O     . SER C 3 77  ? 10.922  34.506 9.279   1.00 14.19  ? 373  SER A O     1 
ATOM   1127 C  CB    . SER C 3 77  ? 8.015   33.295 9.814   1.00 11.51  ? 373  SER A CB    1 
ATOM   1128 O  OG    . SER C 3 77  ? 7.500   33.956 10.959  1.00 12.54  ? 373  SER A OG    1 
ATOM   1129 N  N     . LYS C 3 78  ? 10.646  34.387 11.500  1.00 10.99  ? 374  LYS A N     1 
ATOM   1130 C  CA    . LYS C 3 78  ? 11.553  35.515 11.750  1.00 10.20  ? 374  LYS A CA    1 
ATOM   1131 C  C     . LYS C 3 78  ? 12.961  35.243 11.219  1.00 11.20  ? 374  LYS A C     1 
ATOM   1132 O  O     . LYS C 3 78  ? 13.609  36.128 10.663  1.00 11.06  ? 374  LYS A O     1 
ATOM   1133 C  CB    . LYS C 3 78  ? 11.611  35.859 13.247  1.00 9.76   ? 374  LYS A CB    1 
ATOM   1134 C  CG    . LYS C 3 78  ? 12.636  36.957 13.592  1.00 10.67  ? 374  LYS A CG    1 
ATOM   1135 C  CD    . LYS C 3 78  ? 12.338  37.652 14.934  1.00 11.61  ? 374  LYS A CD    1 
ATOM   1136 C  CE    . LYS C 3 78  ? 12.510  36.722 16.140  1.00 11.84  ? 374  LYS A CE    1 
ATOM   1137 N  NZ    . LYS C 3 78  ? 13.949  36.346 16.401  1.00 12.50  ? 374  LYS A NZ    1 
ATOM   1138 N  N     . ARG C 3 79  ? 13.429  34.013 11.395  1.00 12.27  ? 375  ARG A N     1 
ATOM   1139 C  CA    . ARG C 3 79  ? 14.748  33.617 10.914  1.00 12.55  ? 375  ARG A CA    1 
ATOM   1140 C  C     . ARG C 3 79  ? 14.850  33.851 9.400   1.00 13.34  ? 375  ARG A C     1 
ATOM   1141 O  O     . ARG C 3 79  ? 15.825  34.425 8.914   1.00 12.07  ? 375  ARG A O     1 
ATOM   1142 C  CB    . ARG C 3 79  ? 14.976  32.138 11.241  1.00 13.67  ? 375  ARG A CB    1 
ATOM   1143 C  CG    . ARG C 3 79  ? 16.167  31.459 10.552  1.00 13.45  ? 375  ARG A CG    1 
ATOM   1144 C  CD    . ARG C 3 79  ? 16.340  30.036 11.105  1.00 12.77  ? 375  ARG A CD    1 
ATOM   1145 N  NE    . ARG C 3 79  ? 16.797  30.087 12.492  1.00 14.92  ? 375  ARG A NE    1 
ATOM   1146 C  CZ    . ARG C 3 79  ? 18.075  30.157 12.858  1.00 13.05  ? 375  ARG A CZ    1 
ATOM   1147 N  NH1   . ARG C 3 79  ? 19.037  30.162 11.943  1.00 10.93  ? 375  ARG A NH1   1 
ATOM   1148 N  NH2   . ARG C 3 79  ? 18.391  30.282 14.139  1.00 11.50  ? 375  ARG A NH2   1 
ATOM   1149 N  N     . ALA C 3 80  ? 13.825  33.418 8.669   1.00 12.24  ? 376  ALA A N     1 
ATOM   1150 C  CA    . ALA C 3 80  ? 13.785  33.555 7.214   1.00 13.66  ? 376  ALA A CA    1 
ATOM   1151 C  C     . ALA C 3 80  ? 13.611  35.002 6.797   1.00 14.19  ? 376  ALA A C     1 
ATOM   1152 O  O     . ALA C 3 80  ? 14.279  35.477 5.873   1.00 13.39  ? 376  ALA A O     1 
ATOM   1153 C  CB    . ALA C 3 80  ? 12.639  32.722 6.640   1.00 12.20  ? 376  ALA A CB    1 
ATOM   1154 N  N     . ALA C 3 81  ? 12.702  35.696 7.478   1.00 12.65  ? 377  ALA A N     1 
ATOM   1155 C  CA    . ALA C 3 81  ? 12.431  37.093 7.180   1.00 12.40  ? 377  ALA A CA    1 
ATOM   1156 C  C     . ALA C 3 81  ? 13.698  37.939 7.295   1.00 11.39  ? 377  ALA A C     1 
ATOM   1157 O  O     . ALA C 3 81  ? 13.982  38.770 6.427   1.00 12.30  ? 377  ALA A O     1 
ATOM   1158 C  CB    . ALA C 3 81  ? 11.342  37.629 8.120   1.00 11.43  ? 377  ALA A CB    1 
ATOM   1159 N  N     . VAL C 3 82  ? 14.468  37.728 8.354   1.00 10.85  ? 378  VAL A N     1 
ATOM   1160 C  CA    . VAL C 3 82  ? 15.691  38.503 8.519   1.00 10.65  ? 378  VAL A CA    1 
ATOM   1161 C  C     . VAL C 3 82  ? 16.749  38.109 7.491   1.00 12.02  ? 378  VAL A C     1 
ATOM   1162 O  O     . VAL C 3 82  ? 17.391  38.980 6.897   1.00 11.45  ? 378  VAL A O     1 
ATOM   1163 C  CB    . VAL C 3 82  ? 16.242  38.367 9.945   1.00 11.23  ? 378  VAL A CB    1 
ATOM   1164 C  CG1   . VAL C 3 82  ? 17.604  39.060 10.060  1.00 8.49   ? 378  VAL A CG1   1 
ATOM   1165 C  CG2   . VAL C 3 82  ? 15.256  39.014 10.919  1.00 9.41   ? 378  VAL A CG2   1 
ATOM   1166 N  N     . ALA C 3 83  ? 16.928  36.807 7.262   1.00 13.27  ? 379  ALA A N     1 
ATOM   1167 C  CA    . ALA C 3 83  ? 17.910  36.354 6.275   1.00 13.63  ? 379  ALA A CA    1 
ATOM   1168 C  C     . ALA C 3 83  ? 17.571  36.970 4.913   1.00 13.20  ? 379  ALA A C     1 
ATOM   1169 O  O     . ALA C 3 83  ? 18.462  37.343 4.150   1.00 13.95  ? 379  ALA A O     1 
ATOM   1170 C  CB    . ALA C 3 83  ? 17.914  34.825 6.182   1.00 13.35  ? 379  ALA A CB    1 
ATOM   1171 N  N     . LEU C 3 84  ? 16.280  37.080 4.615   1.00 11.87  ? 380  LEU A N     1 
ATOM   1172 C  CA    . LEU C 3 84  ? 15.845  37.674 3.359   1.00 14.03  ? 380  LEU A CA    1 
ATOM   1173 C  C     . LEU C 3 84  ? 16.047  39.199 3.355   1.00 14.92  ? 380  LEU A C     1 
ATOM   1174 O  O     . LEU C 3 84  ? 16.361  39.775 2.314   1.00 14.54  ? 380  LEU A O     1 
ATOM   1175 C  CB    . LEU C 3 84  ? 14.381  37.309 3.080   1.00 14.26  ? 380  LEU A CB    1 
ATOM   1176 C  CG    . LEU C 3 84  ? 14.171  35.826 2.723   1.00 15.91  ? 380  LEU A CG    1 
ATOM   1177 C  CD1   . LEU C 3 84  ? 12.676  35.486 2.660   1.00 11.14  ? 380  LEU A CD1   1 
ATOM   1178 C  CD2   . LEU C 3 84  ? 14.838  35.536 1.383   1.00 12.89  ? 380  LEU A CD2   1 
ATOM   1179 N  N     . LYS C 3 85  ? 15.878  39.846 4.511   1.00 14.59  ? 381  LYS A N     1 
ATOM   1180 C  CA    . LYS C 3 85  ? 16.092  41.293 4.617   1.00 13.55  ? 381  LYS A CA    1 
ATOM   1181 C  C     . LYS C 3 85  ? 17.541  41.642 4.234   1.00 14.46  ? 381  LYS A C     1 
ATOM   1182 O  O     . LYS C 3 85  ? 17.787  42.629 3.537   1.00 12.30  ? 381  LYS A O     1 
ATOM   1183 C  CB    . LYS C 3 85  ? 15.830  41.787 6.048   1.00 14.41  ? 381  LYS A CB    1 
ATOM   1184 C  CG    . LYS C 3 85  ? 14.358  42.037 6.412   1.00 13.16  ? 381  LYS A CG    1 
ATOM   1185 C  CD    . LYS C 3 85  ? 14.244  42.477 7.868   1.00 15.43  ? 381  LYS A CD    1 
ATOM   1186 C  CE    . LYS C 3 85  ? 12.795  42.519 8.361   1.00 14.12  ? 381  LYS A CE    1 
ATOM   1187 N  NZ    . LYS C 3 85  ? 11.977  43.545 7.660   1.00 12.85  ? 381  LYS A NZ    1 
ATOM   1188 N  N     . TRP C 3 86  ? 18.496  40.836 4.696   1.00 14.04  ? 382  TRP A N     1 
ATOM   1189 C  CA    . TRP C 3 86  ? 19.903  41.077 4.382   1.00 14.66  ? 382  TRP A CA    1 
ATOM   1190 C  C     . TRP C 3 86  ? 20.170  40.957 2.885   1.00 15.33  ? 382  TRP A C     1 
ATOM   1191 O  O     . TRP C 3 86  ? 21.184  41.445 2.386   1.00 14.62  ? 382  TRP A O     1 
ATOM   1192 C  CB    . TRP C 3 86  ? 20.815  40.107 5.147   1.00 13.92  ? 382  TRP A CB    1 
ATOM   1193 C  CG    . TRP C 3 86  ? 21.003  40.462 6.598   1.00 12.56  ? 382  TRP A CG    1 
ATOM   1194 C  CD1   . TRP C 3 86  ? 20.276  39.995 7.664   1.00 12.43  ? 382  TRP A CD1   1 
ATOM   1195 C  CD2   . TRP C 3 86  ? 21.971  41.372 7.140   1.00 12.05  ? 382  TRP A CD2   1 
ATOM   1196 N  NE1   . TRP C 3 86  ? 20.734  40.563 8.833   1.00 11.26  ? 382  TRP A NE1   1 
ATOM   1197 C  CE2   . TRP C 3 86  ? 21.771  41.410 8.541   1.00 11.14  ? 382  TRP A CE2   1 
ATOM   1198 C  CE3   . TRP C 3 86  ? 22.989  42.162 6.577   1.00 12.49  ? 382  TRP A CE3   1 
ATOM   1199 C  CZ2   . TRP C 3 86  ? 22.552  42.206 9.389   1.00 12.23  ? 382  TRP A CZ2   1 
ATOM   1200 C  CZ3   . TRP C 3 86  ? 23.767  42.955 7.419   1.00 10.07  ? 382  TRP A CZ3   1 
ATOM   1201 C  CH2   . TRP C 3 86  ? 23.543  42.970 8.814   1.00 13.36  ? 382  TRP A CH2   1 
ATOM   1202 N  N     . LYS C 3 87  ? 19.255  40.303 2.172   1.00 16.27  ? 383  LYS A N     1 
ATOM   1203 C  CA    . LYS C 3 87  ? 19.388  40.133 0.730   1.00 16.95  ? 383  LYS A CA    1 
ATOM   1204 C  C     . LYS C 3 87  ? 18.496  41.118 -0.016  1.00 17.70  ? 383  LYS A C     1 
ATOM   1205 O  O     . LYS C 3 87  ? 18.391  41.065 -1.240  1.00 17.15  ? 383  LYS A O     1 
ATOM   1206 C  CB    . LYS C 3 87  ? 19.027  38.701 0.323   1.00 17.58  ? 383  LYS A CB    1 
ATOM   1207 C  CG    . LYS C 3 87  ? 20.061  37.656 0.751   1.00 17.82  ? 383  LYS A CG    1 
ATOM   1208 C  CD    . LYS C 3 87  ? 19.555  36.246 0.488   1.00 17.33  ? 383  LYS A CD    1 
ATOM   1209 C  CE    . LYS C 3 87  ? 20.606  35.204 0.846   1.00 18.18  ? 383  LYS A CE    1 
ATOM   1210 N  NZ    . LYS C 3 87  ? 21.778  35.292 -0.063  1.00 18.10  ? 383  LYS A NZ    1 
ATOM   1211 N  N     . GLY C 3 88  ? 17.852  42.013 0.726   1.00 16.83  ? 384  GLY A N     1 
ATOM   1212 C  CA    . GLY C 3 88  ? 16.983  42.996 0.103   1.00 18.10  ? 384  GLY A CA    1 
ATOM   1213 C  C     . GLY C 3 88  ? 15.683  42.422 -0.434  1.00 19.21  ? 384  GLY A C     1 
ATOM   1214 O  O     . GLY C 3 88  ? 15.123  42.949 -1.393  1.00 18.61  ? 384  GLY A O     1 
ATOM   1215 N  N     . ILE C 3 89  ? 15.205  41.341 0.181   1.00 18.21  ? 385  ILE A N     1 
ATOM   1216 C  CA    . ILE C 3 89  ? 13.959  40.696 -0.230  1.00 18.61  ? 385  ILE A CA    1 
ATOM   1217 C  C     . ILE C 3 89  ? 12.950  40.717 0.927   1.00 20.53  ? 385  ILE A C     1 
ATOM   1218 O  O     . ILE C 3 89  ? 13.281  40.371 2.062   1.00 19.01  ? 385  ILE A O     1 
ATOM   1219 C  CB    . ILE C 3 89  ? 14.221  39.238 -0.675  1.00 19.17  ? 385  ILE A CB    1 
ATOM   1220 C  CG1   . ILE C 3 89  ? 15.040  39.242 -1.968  1.00 19.06  ? 385  ILE A CG1   1 
ATOM   1221 C  CG2   . ILE C 3 89  ? 12.904  38.489 -0.869  1.00 17.01  ? 385  ILE A CG2   1 
ATOM   1222 C  CD1   . ILE C 3 89  ? 15.505  37.873 -2.415  1.00 17.94  ? 385  ILE A CD1   1 
ATOM   1223 N  N     . GLU C 3 90  ? 11.718  41.125 0.636   1.00 21.34  ? 386  GLU A N     1 
ATOM   1224 C  CA    . GLU C 3 90  ? 10.686  41.200 1.667   1.00 22.10  ? 386  GLU A CA    1 
ATOM   1225 C  C     . GLU C 3 90  ? 9.788   39.966 1.716   1.00 19.78  ? 386  GLU A C     1 
ATOM   1226 O  O     . GLU C 3 90  ? 9.347   39.464 0.683   1.00 18.72  ? 386  GLU A O     1 
ATOM   1227 C  CB    . GLU C 3 90  ? 9.817   42.442 1.453   1.00 26.06  ? 386  GLU A CB    1 
ATOM   1228 C  CG    . GLU C 3 90  ? 8.923   42.777 2.640   1.00 32.56  ? 386  GLU A CG    1 
ATOM   1229 C  CD    . GLU C 3 90  ? 7.914   43.877 2.339   1.00 36.40  ? 386  GLU A CD    1 
ATOM   1230 O  OE1   . GLU C 3 90  ? 7.293   44.392 3.295   1.00 38.50  ? 386  GLU A OE1   1 
ATOM   1231 O  OE2   . GLU C 3 90  ? 7.735   44.225 1.151   1.00 37.87  ? 386  GLU A OE2   1 
ATOM   1232 N  N     . LEU C 3 91  ? 9.525   39.483 2.928   1.00 17.06  ? 387  LEU A N     1 
ATOM   1233 C  CA    . LEU C 3 91  ? 8.658   38.328 3.138   1.00 15.98  ? 387  LEU A CA    1 
ATOM   1234 C  C     . LEU C 3 91  ? 7.354   38.811 3.768   1.00 16.86  ? 387  LEU A C     1 
ATOM   1235 O  O     . LEU C 3 91  ? 7.368   39.449 4.817   1.00 18.13  ? 387  LEU A O     1 
ATOM   1236 C  CB    . LEU C 3 91  ? 9.320   37.305 4.077   1.00 15.05  ? 387  LEU A CB    1 
ATOM   1237 C  CG    . LEU C 3 91  ? 8.412   36.132 4.502   1.00 14.91  ? 387  LEU A CG    1 
ATOM   1238 C  CD1   . LEU C 3 91  ? 8.042   35.295 3.280   1.00 13.75  ? 387  LEU A CD1   1 
ATOM   1239 C  CD2   . LEU C 3 91  ? 9.116   35.264 5.543   1.00 12.80  ? 387  LEU A CD2   1 
ATOM   1240 N  N     . CYS C 3 92  ? 6.230   38.514 3.131   1.00 15.83  ? 388  CYS A N     1 
ATOM   1241 C  CA    . CYS C 3 92  ? 4.928   38.920 3.659   1.00 16.25  ? 388  CYS A CA    1 
ATOM   1242 C  C     . CYS C 3 92  ? 3.966   37.745 3.578   1.00 15.79  ? 388  CYS A C     1 
ATOM   1243 O  O     . CYS C 3 92  ? 4.270   36.720 2.965   1.00 14.37  ? 388  CYS A O     1 
ATOM   1244 C  CB    . CYS C 3 92  ? 4.342   40.086 2.844   1.00 17.32  ? 388  CYS A CB    1 
ATOM   1245 S  SG    . CYS C 3 92  ? 5.272   41.645 2.891   1.00 21.97  ? 388  CYS A SG    1 
ATOM   1246 N  N     . GLY C 3 93  ? 2.804   37.900 4.204   1.00 15.75  ? 389  GLY A N     1 
ATOM   1247 C  CA    . GLY C 3 93  ? 1.791   36.864 4.144   1.00 16.43  ? 389  GLY A CA    1 
ATOM   1248 C  C     . GLY C 3 93  ? 1.932   35.635 5.023   1.00 16.73  ? 389  GLY A C     1 
ATOM   1249 O  O     . GLY C 3 93  ? 1.267   34.636 4.768   1.00 15.62  ? 389  GLY A O     1 
ATOM   1250 N  N     . VAL C 3 94  ? 2.779   35.679 6.045   1.00 15.91  ? 390  VAL A N     1 
ATOM   1251 C  CA    . VAL C 3 94  ? 2.909   34.519 6.918   1.00 16.05  ? 390  VAL A CA    1 
ATOM   1252 C  C     . VAL C 3 94  ? 1.722   34.514 7.881   1.00 16.35  ? 390  VAL A C     1 
ATOM   1253 O  O     . VAL C 3 94  ? 1.648   35.333 8.799   1.00 18.45  ? 390  VAL A O     1 
ATOM   1254 C  CB    . VAL C 3 94  ? 4.230   34.550 7.718   1.00 16.74  ? 390  VAL A CB    1 
ATOM   1255 C  CG1   . VAL C 3 94  ? 4.343   33.295 8.587   1.00 15.95  ? 390  VAL A CG1   1 
ATOM   1256 C  CG2   . VAL C 3 94  ? 5.410   34.626 6.758   1.00 15.85  ? 390  VAL A CG2   1 
ATOM   1257 N  N     . SER C 3 95  ? 0.789   33.590 7.668   1.00 15.62  ? 391  SER A N     1 
ATOM   1258 C  CA    . SER C 3 95  ? -0.404  33.513 8.507   1.00 14.50  ? 391  SER A CA    1 
ATOM   1259 C  C     . SER C 3 95  ? -0.325  32.498 9.648   1.00 12.97  ? 391  SER A C     1 
ATOM   1260 O  O     . SER C 3 95  ? -1.174  32.492 10.539  1.00 14.38  ? 391  SER A O     1 
ATOM   1261 C  CB    . SER C 3 95  ? -1.625  33.212 7.635   1.00 14.31  ? 391  SER A CB    1 
ATOM   1262 O  OG    . SER C 3 95  ? -1.509  31.942 7.020   1.00 15.01  ? 391  SER A OG    1 
ATOM   1263 N  N     . PHE C 3 96  ? 0.687   31.638 9.628   1.00 12.66  ? 392  PHE A N     1 
ATOM   1264 C  CA    . PHE C 3 96  ? 0.845   30.634 10.680  1.00 12.68  ? 392  PHE A CA    1 
ATOM   1265 C  C     . PHE C 3 96  ? 2.316   30.287 10.861  1.00 13.27  ? 392  PHE A C     1 
ATOM   1266 O  O     . PHE C 3 96  ? 3.001   29.968 9.890   1.00 13.70  ? 392  PHE A O     1 
ATOM   1267 C  CB    . PHE C 3 96  ? 0.071   29.360 10.324  1.00 12.82  ? 392  PHE A CB    1 
ATOM   1268 C  CG    . PHE C 3 96  ? 0.271   28.231 11.304  1.00 14.49  ? 392  PHE A CG    1 
ATOM   1269 C  CD1   . PHE C 3 96  ? -0.412  28.213 12.520  1.00 13.27  ? 392  PHE A CD1   1 
ATOM   1270 C  CD2   . PHE C 3 96  ? 1.147   27.185 11.012  1.00 12.34  ? 392  PHE A CD2   1 
ATOM   1271 C  CE1   . PHE C 3 96  ? -0.228  27.164 13.435  1.00 11.20  ? 392  PHE A CE1   1 
ATOM   1272 C  CE2   . PHE C 3 96  ? 1.339   26.138 11.917  1.00 12.59  ? 392  PHE A CE2   1 
ATOM   1273 C  CZ    . PHE C 3 96  ? 0.647   26.127 13.134  1.00 10.65  ? 392  PHE A CZ    1 
ATOM   1274 N  N     . ASP C 3 97  ? 2.792   30.357 12.102  1.00 11.52  ? 393  ASP A N     1 
ATOM   1275 C  CA    . ASP C 3 97  ? 4.182   30.034 12.424  1.00 12.38  ? 393  ASP A CA    1 
ATOM   1276 C  C     . ASP C 3 97  ? 4.143   28.910 13.455  1.00 11.86  ? 393  ASP A C     1 
ATOM   1277 O  O     . ASP C 3 97  ? 3.794   29.135 14.619  1.00 12.81  ? 393  ASP A O     1 
ATOM   1278 C  CB    . ASP C 3 97  ? 4.905   31.260 13.010  1.00 10.66  ? 393  ASP A CB    1 
ATOM   1279 C  CG    . ASP C 3 97  ? 6.409   31.039 13.171  1.00 11.37  ? 393  ASP A CG    1 
ATOM   1280 O  OD1   . ASP C 3 97  ? 6.816   29.936 13.594  1.00 10.99  ? 393  ASP A OD1   1 
ATOM   1281 O  OD2   . ASP C 3 97  ? 7.188   31.973 12.878  1.00 12.47  ? 393  ASP A OD2   1 
ATOM   1282 N  N     . LEU C 3 98  ? 4.500   27.705 13.019  1.00 10.50  ? 394  LEU A N     1 
ATOM   1283 C  CA    . LEU C 3 98  ? 4.487   26.519 13.874  1.00 11.60  ? 394  LEU A CA    1 
ATOM   1284 C  C     . LEU C 3 98  ? 5.320   26.642 15.152  1.00 10.87  ? 394  LEU A C     1 
ATOM   1285 O  O     . LEU C 3 98  ? 4.951   26.076 16.178  1.00 10.42  ? 394  LEU A O     1 
ATOM   1286 C  CB    . LEU C 3 98  ? 4.944   25.289 13.068  1.00 10.57  ? 394  LEU A CB    1 
ATOM   1287 C  CG    . LEU C 3 98  ? 4.928   23.917 13.756  1.00 11.83  ? 394  LEU A CG    1 
ATOM   1288 C  CD1   . LEU C 3 98  ? 3.519   23.550 14.227  1.00 13.00  ? 394  LEU A CD1   1 
ATOM   1289 C  CD2   . LEU C 3 98  ? 5.430   22.879 12.775  1.00 11.61  ? 394  LEU A CD2   1 
ATOM   1290 N  N     . LEU C 3 99  ? 6.435   27.370 15.102  1.00 11.33  ? 395  LEU A N     1 
ATOM   1291 C  CA    . LEU C 3 99  ? 7.274   27.528 16.294  1.00 10.94  ? 395  LEU A CA    1 
ATOM   1292 C  C     . LEU C 3 99  ? 6.526   28.298 17.379  1.00 10.96  ? 395  LEU A C     1 
ATOM   1293 O  O     . LEU C 3 99  ? 6.515   27.903 18.545  1.00 11.88  ? 395  LEU A O     1 
ATOM   1294 C  CB    . LEU C 3 99  ? 8.578   28.269 15.964  1.00 11.88  ? 395  LEU A CB    1 
ATOM   1295 C  CG    . LEU C 3 99  ? 9.397   28.696 17.197  1.00 13.72  ? 395  LEU A CG    1 
ATOM   1296 C  CD1   . LEU C 3 99  ? 9.872   27.466 17.963  1.00 12.56  ? 395  LEU A CD1   1 
ATOM   1297 C  CD2   . LEU C 3 99  ? 10.592  29.542 16.772  1.00 14.39  ? 395  LEU A CD2   1 
ATOM   1298 N  N     . LEU C 3 100 ? 5.902   29.403 16.993  1.00 10.51  ? 396  LEU A N     1 
ATOM   1299 C  CA    . LEU C 3 100 ? 5.156   30.209 17.946  1.00 10.94  ? 396  LEU A CA    1 
ATOM   1300 C  C     . LEU C 3 100 ? 3.907   29.477 18.436  1.00 11.50  ? 396  LEU A C     1 
ATOM   1301 O  O     . LEU C 3 100 ? 3.520   29.614 19.598  1.00 9.38   ? 396  LEU A O     1 
ATOM   1302 C  CB    . LEU C 3 100 ? 4.781   31.552 17.312  1.00 10.76  ? 396  LEU A CB    1 
ATOM   1303 C  CG    . LEU C 3 100 ? 6.001   32.407 16.949  1.00 11.41  ? 396  LEU A CG    1 
ATOM   1304 C  CD1   . LEU C 3 100 ? 5.563   33.693 16.259  1.00 9.79   ? 396  LEU A CD1   1 
ATOM   1305 C  CD2   . LEU C 3 100 ? 6.795   32.726 18.223  1.00 12.12  ? 396  LEU A CD2   1 
ATOM   1306 N  N     . ALA C 3 101 ? 3.281   28.694 17.559  1.00 11.41  ? 397  ALA A N     1 
ATOM   1307 C  CA    . ALA C 3 101 ? 2.084   27.947 17.946  1.00 11.23  ? 397  ALA A CA    1 
ATOM   1308 C  C     . ALA C 3 101 ? 2.438   26.909 19.012  1.00 12.23  ? 397  ALA A C     1 
ATOM   1309 O  O     . ALA C 3 101 ? 1.746   26.774 20.026  1.00 11.69  ? 397  ALA A O     1 
ATOM   1310 C  CB    . ALA C 3 101 ? 1.467   27.261 16.722  1.00 10.51  ? 397  ALA A CB    1 
ATOM   1311 N  N     . ALA C 3 102 ? 3.522   26.177 18.781  1.00 11.40  ? 398  ALA A N     1 
ATOM   1312 C  CA    . ALA C 3 102 ? 3.960   25.157 19.731  1.00 12.18  ? 398  ALA A CA    1 
ATOM   1313 C  C     . ALA C 3 102 ? 4.335   25.798 21.065  1.00 12.27  ? 398  ALA A C     1 
ATOM   1314 O  O     . ALA C 3 102 ? 4.012   25.271 22.136  1.00 11.73  ? 398  ALA A O     1 
ATOM   1315 C  CB    . ALA C 3 102 ? 5.152   24.392 19.160  1.00 12.01  ? 398  ALA A CB    1 
ATOM   1316 N  N     . TYR C 3 103 ? 5.014   26.938 20.991  1.00 11.01  ? 399  TYR A N     1 
ATOM   1317 C  CA    . TYR C 3 103 ? 5.446   27.678 22.171  1.00 11.01  ? 399  TYR A CA    1 
ATOM   1318 C  C     . TYR C 3 103 ? 4.275   28.065 23.066  1.00 11.51  ? 399  TYR A C     1 
ATOM   1319 O  O     . TYR C 3 103 ? 4.341   27.907 24.283  1.00 10.40  ? 399  TYR A O     1 
ATOM   1320 C  CB    . TYR C 3 103 ? 6.190   28.945 21.743  1.00 14.04  ? 399  TYR A CB    1 
ATOM   1321 C  CG    . TYR C 3 103 ? 6.621   29.841 22.887  1.00 12.93  ? 399  TYR A CG    1 
ATOM   1322 C  CD1   . TYR C 3 103 ? 7.488   29.378 23.882  1.00 13.43  ? 399  TYR A CD1   1 
ATOM   1323 C  CD2   . TYR C 3 103 ? 6.184   31.160 22.958  1.00 12.90  ? 399  TYR A CD2   1 
ATOM   1324 C  CE1   . TYR C 3 103 ? 7.911   30.215 24.919  1.00 12.33  ? 399  TYR A CE1   1 
ATOM   1325 C  CE2   . TYR C 3 103 ? 6.597   32.001 23.984  1.00 12.74  ? 399  TYR A CE2   1 
ATOM   1326 C  CZ    . TYR C 3 103 ? 7.460   31.526 24.958  1.00 12.46  ? 399  TYR A CZ    1 
ATOM   1327 O  OH    . TYR C 3 103 ? 7.877   32.375 25.958  1.00 11.11  ? 399  TYR A OH    1 
ATOM   1328 N  N     . LEU C 3 104 ? 3.205   28.577 22.461  1.00 12.26  ? 400  LEU A N     1 
ATOM   1329 C  CA    . LEU C 3 104 ? 2.029   28.981 23.224  1.00 12.54  ? 400  LEU A CA    1 
ATOM   1330 C  C     . LEU C 3 104 ? 1.330   27.772 23.834  1.00 12.99  ? 400  LEU A C     1 
ATOM   1331 O  O     . LEU C 3 104 ? 0.886   27.826 24.976  1.00 15.29  ? 400  LEU A O     1 
ATOM   1332 C  CB    . LEU C 3 104 ? 1.050   29.768 22.335  1.00 11.08  ? 400  LEU A CB    1 
ATOM   1333 C  CG    . LEU C 3 104 ? 1.546   31.148 21.876  1.00 10.70  ? 400  LEU A CG    1 
ATOM   1334 C  CD1   . LEU C 3 104 ? 0.502   31.833 21.006  1.00 11.65  ? 400  LEU A CD1   1 
ATOM   1335 C  CD2   . LEU C 3 104 ? 1.874   32.008 23.098  1.00 10.38  ? 400  LEU A CD2   1 
ATOM   1336 N  N     . LEU C 3 105 ? 1.253   26.674 23.084  1.00 14.28  ? 401  LEU A N     1 
ATOM   1337 C  CA    . LEU C 3 105 ? 0.597   25.470 23.583  1.00 13.93  ? 401  LEU A CA    1 
ATOM   1338 C  C     . LEU C 3 105 ? 1.295   24.893 24.807  1.00 14.82  ? 401  LEU A C     1 
ATOM   1339 O  O     . LEU C 3 105 ? 0.638   24.474 25.758  1.00 16.59  ? 401  LEU A O     1 
ATOM   1340 C  CB    . LEU C 3 105 ? 0.505   24.401 22.487  1.00 12.49  ? 401  LEU A CB    1 
ATOM   1341 C  CG    . LEU C 3 105 ? -0.520  24.692 21.388  1.00 12.84  ? 401  LEU A CG    1 
ATOM   1342 C  CD1   . LEU C 3 105 ? -0.565  23.524 20.414  1.00 13.56  ? 401  LEU A CD1   1 
ATOM   1343 C  CD2   . LEU C 3 105 ? -1.899  24.929 22.013  1.00 11.87  ? 401  LEU A CD2   1 
ATOM   1344 N  N     . ASP C 3 106 ? 2.621   24.861 24.781  1.00 14.88  ? 402  ASP A N     1 
ATOM   1345 C  CA    . ASP C 3 106 ? 3.380   24.357 25.915  1.00 15.81  ? 402  ASP A CA    1 
ATOM   1346 C  C     . ASP C 3 106 ? 4.834   24.782 25.839  1.00 16.62  ? 402  ASP A C     1 
ATOM   1347 O  O     . ASP C 3 106 ? 5.662   24.096 25.235  1.00 14.77  ? 402  ASP A O     1 
ATOM   1348 C  CB    . ASP C 3 106 ? 3.322   22.837 26.002  1.00 15.27  ? 402  ASP A CB    1 
ATOM   1349 C  CG    . ASP C 3 106 ? 3.923   22.315 27.300  1.00 19.01  ? 402  ASP A CG    1 
ATOM   1350 O  OD1   . ASP C 3 106 ? 4.470   23.138 28.072  1.00 18.27  ? 402  ASP A OD1   1 
ATOM   1351 O  OD2   . ASP C 3 106 ? 3.852   21.094 27.550  1.00 17.06  ? 402  ASP A OD2   1 
ATOM   1352 N  N     . PRO C 3 107 ? 5.166   25.918 26.471  1.00 16.31  ? 403  PRO A N     1 
ATOM   1353 C  CA    . PRO C 3 107 ? 6.534   26.447 26.478  1.00 18.81  ? 403  PRO A CA    1 
ATOM   1354 C  C     . PRO C 3 107 ? 7.571   25.521 27.104  1.00 20.35  ? 403  PRO A C     1 
ATOM   1355 O  O     . PRO C 3 107 ? 8.750   25.581 26.754  1.00 21.12  ? 403  PRO A O     1 
ATOM   1356 C  CB    . PRO C 3 107 ? 6.392   27.782 27.217  1.00 18.34  ? 403  PRO A CB    1 
ATOM   1357 C  CG    . PRO C 3 107 ? 5.204   27.563 28.111  1.00 18.16  ? 403  PRO A CG    1 
ATOM   1358 C  CD    . PRO C 3 107 ? 4.252   26.797 27.223  1.00 15.07  ? 403  PRO A CD    1 
ATOM   1359 N  N     . ALA C 3 108 ? 7.134   24.659 28.018  1.00 19.74  ? 404  ALA A N     1 
ATOM   1360 C  CA    . ALA C 3 108 ? 8.050   23.740 28.687  1.00 22.05  ? 404  ALA A CA    1 
ATOM   1361 C  C     . ALA C 3 108 ? 8.598   22.660 27.766  1.00 23.41  ? 404  ALA A C     1 
ATOM   1362 O  O     . ALA C 3 108 ? 9.620   22.043 28.063  1.00 24.24  ? 404  ALA A O     1 
ATOM   1363 C  CB    . ALA C 3 108 ? 7.360   23.090 29.882  1.00 21.18  ? 404  ALA A CB    1 
ATOM   1364 N  N     . GLN C 3 109 ? 7.926   22.429 26.647  1.00 23.06  ? 405  GLN A N     1 
ATOM   1365 C  CA    . GLN C 3 109 ? 8.373   21.399 25.726  1.00 23.44  ? 405  GLN A CA    1 
ATOM   1366 C  C     . GLN C 3 109 ? 9.744   21.733 25.137  1.00 23.32  ? 405  GLN A C     1 
ATOM   1367 O  O     . GLN C 3 109 ? 10.501  20.839 24.771  1.00 22.83  ? 405  GLN A O     1 
ATOM   1368 C  CB    . GLN C 3 109 ? 7.343   21.212 24.610  1.00 25.34  ? 405  GLN A CB    1 
ATOM   1369 C  CG    . GLN C 3 109 ? 7.391   19.845 23.965  1.00 30.07  ? 405  GLN A CG    1 
ATOM   1370 C  CD    . GLN C 3 109 ? 7.316   18.728 24.994  1.00 33.30  ? 405  GLN A CD    1 
ATOM   1371 O  OE1   . GLN C 3 109 ? 6.365   18.645 25.775  1.00 31.67  ? 405  GLN A OE1   1 
ATOM   1372 N  NE2   . GLN C 3 109 ? 8.325   17.863 24.998  1.00 34.05  ? 405  GLN A NE2   1 
ATOM   1373 N  N     . GLY C 3 110 ? 10.066  23.019 25.065  1.00 23.20  ? 406  GLY A N     1 
ATOM   1374 C  CA    . GLY C 3 110 ? 11.348  23.424 24.518  1.00 23.35  ? 406  GLY A CA    1 
ATOM   1375 C  C     . GLY C 3 110 ? 11.464  23.157 23.027  1.00 23.05  ? 406  GLY A C     1 
ATOM   1376 O  O     . GLY C 3 110 ? 12.547  22.854 22.529  1.00 22.85  ? 406  GLY A O     1 
ATOM   1377 N  N     . VAL C 3 111 ? 10.350  23.271 22.311  1.00 22.67  ? 407  VAL A N     1 
ATOM   1378 C  CA    . VAL C 3 111 ? 10.336  23.039 20.869  1.00 22.47  ? 407  VAL A CA    1 
ATOM   1379 C  C     . VAL C 3 111 ? 11.272  23.991 20.120  1.00 22.67  ? 407  VAL A C     1 
ATOM   1380 O  O     . VAL C 3 111 ? 11.063  25.210 20.128  1.00 22.33  ? 407  VAL A O     1 
ATOM   1381 C  CB    . VAL C 3 111 ? 8.910   23.208 20.297  1.00 22.82  ? 407  VAL A CB    1 
ATOM   1382 C  CG1   . VAL C 3 111 ? 8.944   23.146 18.767  1.00 20.74  ? 407  VAL A CG1   1 
ATOM   1383 C  CG2   . VAL C 3 111 ? 7.994   22.122 20.858  1.00 21.94  ? 407  VAL A CG2   1 
ATOM   1384 N  N     . ASP C 3 112 ? 12.302  23.438 19.482  1.00 22.08  ? 408  ASP A N     1 
ATOM   1385 C  CA    . ASP C 3 112 ? 13.233  24.261 18.721  1.00 22.86  ? 408  ASP A CA    1 
ATOM   1386 C  C     . ASP C 3 112 ? 13.433  23.779 17.285  1.00 20.63  ? 408  ASP A C     1 
ATOM   1387 O  O     . ASP C 3 112 ? 14.330  24.238 16.585  1.00 20.81  ? 408  ASP A O     1 
ATOM   1388 C  CB    . ASP C 3 112 ? 14.587  24.402 19.436  1.00 26.25  ? 408  ASP A CB    1 
ATOM   1389 C  CG    . ASP C 3 112 ? 15.323  23.094 19.576  1.00 28.60  ? 408  ASP A CG    1 
ATOM   1390 O  OD1   . ASP C 3 112 ? 15.251  22.260 18.654  1.00 31.80  ? 408  ASP A OD1   1 
ATOM   1391 O  OD2   . ASP C 3 112 ? 15.997  22.908 20.609  1.00 34.44  ? 408  ASP A OD2   1 
ATOM   1392 N  N     . ASP C 3 113 ? 12.604  22.835 16.854  1.00 18.36  ? 409  ASP A N     1 
ATOM   1393 C  CA    . ASP C 3 113 ? 12.637  22.388 15.472  1.00 16.68  ? 409  ASP A CA    1 
ATOM   1394 C  C     . ASP C 3 113 ? 11.305  21.759 15.095  1.00 16.16  ? 409  ASP A C     1 
ATOM   1395 O  O     . ASP C 3 113 ? 10.509  21.400 15.969  1.00 14.51  ? 409  ASP A O     1 
ATOM   1396 C  CB    . ASP C 3 113 ? 13.839  21.469 15.165  1.00 18.36  ? 409  ASP A CB    1 
ATOM   1397 C  CG    . ASP C 3 113 ? 13.757  20.099 15.807  1.00 16.94  ? 409  ASP A CG    1 
ATOM   1398 O  OD1   . ASP C 3 113 ? 14.621  19.275 15.447  1.00 16.57  ? 409  ASP A OD1   1 
ATOM   1399 O  OD2   . ASP C 3 113 ? 12.882  19.830 16.655  1.00 18.54  ? 409  ASP A OD2   1 
ATOM   1400 N  N     . VAL C 3 114 ? 11.054  21.656 13.793  1.00 15.44  ? 410  VAL A N     1 
ATOM   1401 C  CA    . VAL C 3 114 ? 9.800   21.099 13.293  1.00 15.05  ? 410  VAL A CA    1 
ATOM   1402 C  C     . VAL C 3 114 ? 9.503   19.723 13.862  1.00 13.76  ? 410  VAL A C     1 
ATOM   1403 O  O     . VAL C 3 114 ? 8.366   19.427 14.222  1.00 15.45  ? 410  VAL A O     1 
ATOM   1404 C  CB    . VAL C 3 114 ? 9.804   21.014 11.746  1.00 14.44  ? 410  VAL A CB    1 
ATOM   1405 C  CG1   . VAL C 3 114 ? 8.566   20.270 11.258  1.00 10.71  ? 410  VAL A CG1   1 
ATOM   1406 C  CG2   . VAL C 3 114 ? 9.834   22.420 11.155  1.00 10.29  ? 410  VAL A CG2   1 
ATOM   1407 N  N     . ALA C 3 115 ? 10.527  18.884 13.949  1.00 14.25  ? 411  ALA A N     1 
ATOM   1408 C  CA    . ALA C 3 115 ? 10.348  17.539 14.471  1.00 14.86  ? 411  ALA A CA    1 
ATOM   1409 C  C     . ALA C 3 115 ? 9.796   17.523 15.901  1.00 16.01  ? 411  ALA A C     1 
ATOM   1410 O  O     . ALA C 3 115 ? 8.923   16.709 16.222  1.00 15.98  ? 411  ALA A O     1 
ATOM   1411 C  CB    . ALA C 3 115 ? 11.663  16.776 14.399  1.00 14.39  ? 411  ALA A CB    1 
ATOM   1412 N  N     . ALA C 3 116 ? 10.286  18.422 16.754  1.00 14.94  ? 412  ALA A N     1 
ATOM   1413 C  CA    . ALA C 3 116 ? 9.824   18.465 18.142  1.00 16.33  ? 412  ALA A CA    1 
ATOM   1414 C  C     . ALA C 3 116 ? 8.361   18.895 18.221  1.00 16.22  ? 412  ALA A C     1 
ATOM   1415 O  O     . ALA C 3 116 ? 7.587   18.367 19.021  1.00 16.35  ? 412  ALA A O     1 
ATOM   1416 C  CB    . ALA C 3 116 ? 10.710  19.413 18.972  1.00 16.26  ? 412  ALA A CB    1 
ATOM   1417 N  N     . ALA C 3 117 ? 7.979   19.854 17.387  1.00 15.48  ? 413  ALA A N     1 
ATOM   1418 C  CA    . ALA C 3 117 ? 6.598   20.320 17.366  1.00 14.68  ? 413  ALA A CA    1 
ATOM   1419 C  C     . ALA C 3 117 ? 5.686   19.225 16.808  1.00 15.41  ? 413  ALA A C     1 
ATOM   1420 O  O     . ALA C 3 117 ? 4.619   18.956 17.357  1.00 14.74  ? 413  ALA A O     1 
ATOM   1421 C  CB    . ALA C 3 117 ? 6.484   21.577 16.517  1.00 15.45  ? 413  ALA A CB    1 
ATOM   1422 N  N     . ALA C 3 118 ? 6.111   18.588 15.720  1.00 15.24  ? 414  ALA A N     1 
ATOM   1423 C  CA    . ALA C 3 118 ? 5.310   17.531 15.107  1.00 16.63  ? 414  ALA A CA    1 
ATOM   1424 C  C     . ALA C 3 118 ? 5.086   16.353 16.059  1.00 17.75  ? 414  ALA A C     1 
ATOM   1425 O  O     . ALA C 3 118 ? 4.047   15.685 16.018  1.00 18.09  ? 414  ALA A O     1 
ATOM   1426 C  CB    . ALA C 3 118 ? 5.981   17.044 13.819  1.00 15.91  ? 414  ALA A CB    1 
ATOM   1427 N  N     . LYS C 3 119 ? 6.057   16.092 16.921  1.00 20.07  ? 415  LYS A N     1 
ATOM   1428 C  CA    . LYS C 3 119 ? 5.923   14.984 17.851  1.00 23.76  ? 415  LYS A CA    1 
ATOM   1429 C  C     . LYS C 3 119 ? 4.740   15.207 18.802  1.00 24.13  ? 415  LYS A C     1 
ATOM   1430 O  O     . LYS C 3 119 ? 4.122   14.251 19.263  1.00 24.19  ? 415  LYS A O     1 
ATOM   1431 C  CB    . LYS C 3 119 ? 7.226   14.794 18.632  1.00 25.06  ? 415  LYS A CB    1 
ATOM   1432 C  CG    . LYS C 3 119 ? 7.374   13.398 19.212  1.00 29.80  ? 415  LYS A CG    1 
ATOM   1433 C  CD    . LYS C 3 119 ? 8.767   13.152 19.765  1.00 32.63  ? 415  LYS A CD    1 
ATOM   1434 C  CE    . LYS C 3 119 ? 8.929   11.699 20.185  1.00 35.46  ? 415  LYS A CE    1 
ATOM   1435 N  NZ    . LYS C 3 119 ? 10.274  11.437 20.774  1.00 39.25  ? 415  LYS A NZ    1 
ATOM   1436 N  N     . MET C 3 120 ? 4.419   16.469 19.076  1.00 24.03  ? 416  MET A N     1 
ATOM   1437 C  CA    . MET C 3 120 ? 3.298   16.814 19.956  1.00 24.45  ? 416  MET A CA    1 
ATOM   1438 C  C     . MET C 3 120 ? 1.966   16.253 19.441  1.00 24.09  ? 416  MET A C     1 
ATOM   1439 O  O     . MET C 3 120 ? 1.043   16.001 20.224  1.00 22.86  ? 416  MET A O     1 
ATOM   1440 C  CB    . MET C 3 120 ? 3.162   18.341 20.084  1.00 25.70  ? 416  MET A CB    1 
ATOM   1441 C  CG    . MET C 3 120 ? 4.262   19.042 20.872  1.00 26.60  ? 416  MET A CG    1 
ATOM   1442 S  SD    . MET C 3 120 ? 4.113   20.856 20.755  1.00 28.67  ? 416  MET A SD    1 
ATOM   1443 C  CE    . MET C 3 120 ? 2.714   21.161 21.829  1.00 29.77  ? 416  MET A CE    1 
ATOM   1444 N  N     . LYS C 3 121 ? 1.867   16.068 18.126  1.00 21.03  ? 417  LYS A N     1 
ATOM   1445 C  CA    . LYS C 3 121 ? 0.648   15.550 17.511  1.00 19.03  ? 417  LYS A CA    1 
ATOM   1446 C  C     . LYS C 3 121 ? 0.844   14.174 16.872  1.00 18.90  ? 417  LYS A C     1 
ATOM   1447 O  O     . LYS C 3 121 ? 0.160   13.824 15.916  1.00 18.18  ? 417  LYS A O     1 
ATOM   1448 C  CB    . LYS C 3 121 ? 0.131   16.535 16.456  1.00 21.27  ? 417  LYS A CB    1 
ATOM   1449 C  CG    . LYS C 3 121 ? -0.278  17.905 17.001  1.00 21.70  ? 417  LYS A CG    1 
ATOM   1450 C  CD    . LYS C 3 121 ? -1.492  17.815 17.911  1.00 23.09  ? 417  LYS A CD    1 
ATOM   1451 C  CE    . LYS C 3 121 ? -1.886  19.188 18.436  1.00 24.29  ? 417  LYS A CE    1 
ATOM   1452 N  NZ    . LYS C 3 121 ? -3.020  19.102 19.402  1.00 23.15  ? 417  LYS A NZ    1 
ATOM   1453 N  N     . GLN C 3 122 ? 1.785   13.401 17.403  1.00 18.05  ? 418  GLN A N     1 
ATOM   1454 C  CA    . GLN C 3 122 ? 2.066   12.054 16.910  1.00 19.71  ? 418  GLN A CA    1 
ATOM   1455 C  C     . GLN C 3 122 ? 2.469   11.993 15.430  1.00 17.58  ? 418  GLN A C     1 
ATOM   1456 O  O     . GLN C 3 122 ? 2.147   11.031 14.740  1.00 18.62  ? 418  GLN A O     1 
ATOM   1457 C  CB    . GLN C 3 122 ? 0.850   11.141 17.137  1.00 23.30  ? 418  GLN A CB    1 
ATOM   1458 C  CG    . GLN C 3 122 ? 0.186   11.261 18.507  1.00 27.41  ? 418  GLN A CG    1 
ATOM   1459 C  CD    . GLN C 3 122 ? 1.139   11.015 19.668  1.00 31.23  ? 418  GLN A CD    1 
ATOM   1460 O  OE1   . GLN C 3 122 ? 1.562   9.885  19.919  1.00 34.03  ? 418  GLN A OE1   1 
ATOM   1461 N  NE2   . GLN C 3 122 ? 1.481   12.082 20.383  1.00 32.83  ? 418  GLN A NE2   1 
ATOM   1462 N  N     . TYR C 3 123 ? 3.161   13.021 14.949  1.00 15.81  ? 419  TYR A N     1 
ATOM   1463 C  CA    . TYR C 3 123 ? 3.629   13.065 13.561  1.00 15.15  ? 419  TYR A CA    1 
ATOM   1464 C  C     . TYR C 3 123 ? 5.149   12.906 13.644  1.00 15.33  ? 419  TYR A C     1 
ATOM   1465 O  O     . TYR C 3 123 ? 5.828   13.716 14.276  1.00 14.81  ? 419  TYR A O     1 
ATOM   1466 C  CB    . TYR C 3 123 ? 3.278   14.414 12.919  1.00 14.18  ? 419  TYR A CB    1 
ATOM   1467 C  CG    . TYR C 3 123 ? 3.590   14.506 11.437  1.00 14.04  ? 419  TYR A CG    1 
ATOM   1468 C  CD1   . TYR C 3 123 ? 2.585   14.344 10.488  1.00 11.24  ? 419  TYR A CD1   1 
ATOM   1469 C  CD2   . TYR C 3 123 ? 4.895   14.749 10.983  1.00 12.85  ? 419  TYR A CD2   1 
ATOM   1470 C  CE1   . TYR C 3 123 ? 2.857   14.421 9.122   1.00 13.19  ? 419  TYR A CE1   1 
ATOM   1471 C  CE2   . TYR C 3 123 ? 5.185   14.826 9.608   1.00 11.23  ? 419  TYR A CE2   1 
ATOM   1472 C  CZ    . TYR C 3 123 ? 4.157   14.662 8.688   1.00 12.96  ? 419  TYR A CZ    1 
ATOM   1473 O  OH    . TYR C 3 123 ? 4.403   14.745 7.333   1.00 13.64  ? 419  TYR A OH    1 
ATOM   1474 N  N     . GLU C 3 124 ? 5.690   11.867 13.018  1.00 15.48  ? 420  GLU A N     1 
ATOM   1475 C  CA    . GLU C 3 124 ? 7.129   11.645 13.090  1.00 16.82  ? 420  GLU A CA    1 
ATOM   1476 C  C     . GLU C 3 124 ? 7.810   11.392 11.749  1.00 16.94  ? 420  GLU A C     1 
ATOM   1477 O  O     . GLU C 3 124 ? 8.924   10.872 11.700  1.00 16.16  ? 420  GLU A O     1 
ATOM   1478 C  CB    . GLU C 3 124 ? 7.415   10.490 14.060  1.00 18.21  ? 420  GLU A CB    1 
ATOM   1479 C  CG    . GLU C 3 124 ? 7.226   10.878 15.520  1.00 20.85  ? 420  GLU A CG    1 
ATOM   1480 C  CD    . GLU C 3 124 ? 7.403   9.718  16.482  1.00 24.29  ? 420  GLU A CD    1 
ATOM   1481 O  OE1   . GLU C 3 124 ? 8.236   8.832  16.202  1.00 25.73  ? 420  GLU A OE1   1 
ATOM   1482 O  OE2   . GLU C 3 124 ? 6.719   9.703  17.528  1.00 24.37  ? 420  GLU A OE2   1 
ATOM   1483 N  N     . ALA C 3 125 ? 7.148   11.783 10.666  1.00 15.44  ? 421  ALA A N     1 
ATOM   1484 C  CA    . ALA C 3 125 ? 7.691   11.588 9.328   1.00 16.28  ? 421  ALA A CA    1 
ATOM   1485 C  C     . ALA C 3 125 ? 8.631   12.725 8.937   1.00 15.77  ? 421  ALA A C     1 
ATOM   1486 O  O     . ALA C 3 125 ? 8.632   13.185 7.789   1.00 15.07  ? 421  ALA A O     1 
ATOM   1487 C  CB    . ALA C 3 125 ? 6.557   11.472 8.320   1.00 15.21  ? 421  ALA A CB    1 
ATOM   1488 N  N     . VAL C 3 126 ? 9.430   13.170 9.901   1.00 16.75  ? 422  VAL A N     1 
ATOM   1489 C  CA    . VAL C 3 126 ? 10.390  14.243 9.684   1.00 15.92  ? 422  VAL A CA    1 
ATOM   1490 C  C     . VAL C 3 126 ? 11.506  14.105 10.727  1.00 16.88  ? 422  VAL A C     1 
ATOM   1491 O  O     . VAL C 3 126 ? 11.244  13.768 11.884  1.00 16.21  ? 422  VAL A O     1 
ATOM   1492 C  CB    . VAL C 3 126 ? 9.697   15.621 9.805   1.00 15.94  ? 422  VAL A CB    1 
ATOM   1493 C  CG1   . VAL C 3 126 ? 9.132   15.800 11.212  1.00 15.92  ? 422  VAL A CG1   1 
ATOM   1494 C  CG2   . VAL C 3 126 ? 10.682  16.741 9.455   1.00 16.51  ? 422  VAL A CG2   1 
ATOM   1495 N  N     . ARG C 3 127 ? 12.745  14.362 10.317  1.00 16.25  ? 423  ARG A N     1 
ATOM   1496 C  CA    . ARG C 3 127 ? 13.903  14.241 11.210  1.00 17.70  ? 423  ARG A CA    1 
ATOM   1497 C  C     . ARG C 3 127 ? 14.252  15.528 11.963  1.00 16.36  ? 423  ARG A C     1 
ATOM   1498 O  O     . ARG C 3 127 ? 13.970  16.630 11.494  1.00 15.92  ? 423  ARG A O     1 
ATOM   1499 C  CB    . ARG C 3 127 ? 15.135  13.809 10.403  1.00 16.91  ? 423  ARG A CB    1 
ATOM   1500 C  CG    . ARG C 3 127 ? 14.948  12.536 9.589   1.00 21.22  ? 423  ARG A CG    1 
ATOM   1501 C  CD    . ARG C 3 127 ? 16.006  12.429 8.488   1.00 22.47  ? 423  ARG A CD    1 
ATOM   1502 N  NE    . ARG C 3 127 ? 17.337  12.163 9.017   1.00 26.67  ? 423  ARG A NE    1 
ATOM   1503 C  CZ    . ARG C 3 127 ? 18.465  12.325 8.329   1.00 28.54  ? 423  ARG A CZ    1 
ATOM   1504 N  NH1   . ARG C 3 127 ? 18.436  12.764 7.073   1.00 26.86  ? 423  ARG A NH1   1 
ATOM   1505 N  NH2   . ARG C 3 127 ? 19.626  12.039 8.899   1.00 25.50  ? 423  ARG A NH2   1 
ATOM   1506 N  N     . PRO C 3 128 ? 14.869  15.399 13.152  1.00 17.53  ? 424  PRO A N     1 
ATOM   1507 C  CA    . PRO C 3 128 ? 15.249  16.590 13.925  1.00 17.67  ? 424  PRO A CA    1 
ATOM   1508 C  C     . PRO C 3 128 ? 16.416  17.223 13.156  1.00 18.55  ? 424  PRO A C     1 
ATOM   1509 O  O     . PRO C 3 128 ? 17.207  16.505 12.545  1.00 17.92  ? 424  PRO A O     1 
ATOM   1510 C  CB    . PRO C 3 128 ? 15.673  16.025 15.282  1.00 16.76  ? 424  PRO A CB    1 
ATOM   1511 C  CG    . PRO C 3 128 ? 15.031  14.629 15.324  1.00 18.80  ? 424  PRO A CG    1 
ATOM   1512 C  CD    . PRO C 3 128 ? 15.169  14.167 13.899  1.00 19.09  ? 424  PRO A CD    1 
ATOM   1513 N  N     . ASP C 3 129 ? 16.527  18.547 13.174  1.00 18.23  ? 425  ASP A N     1 
ATOM   1514 C  CA    . ASP C 3 129 ? 17.610  19.209 12.450  1.00 20.01  ? 425  ASP A CA    1 
ATOM   1515 C  C     . ASP C 3 129 ? 19.006  18.724 12.853  1.00 21.15  ? 425  ASP A C     1 
ATOM   1516 O  O     . ASP C 3 129 ? 19.893  18.595 12.007  1.00 20.90  ? 425  ASP A O     1 
ATOM   1517 C  CB    . ASP C 3 129 ? 17.547  20.730 12.641  1.00 20.44  ? 425  ASP A CB    1 
ATOM   1518 C  CG    . ASP C 3 129 ? 16.358  21.362 11.944  1.00 21.36  ? 425  ASP A CG    1 
ATOM   1519 O  OD1   . ASP C 3 129 ? 15.974  20.879 10.858  1.00 21.79  ? 425  ASP A OD1   1 
ATOM   1520 O  OD2   . ASP C 3 129 ? 15.809  22.350 12.479  1.00 22.36  ? 425  ASP A OD2   1 
ATOM   1521 N  N     . GLU C 3 130 ? 19.202  18.454 14.137  1.00 21.53  ? 426  GLU A N     1 
ATOM   1522 C  CA    . GLU C 3 130 ? 20.509  18.020 14.607  1.00 23.90  ? 426  GLU A CA    1 
ATOM   1523 C  C     . GLU C 3 130 ? 20.960  16.726 13.942  1.00 24.11  ? 426  GLU A C     1 
ATOM   1524 O  O     . GLU C 3 130 ? 22.137  16.565 13.622  1.00 24.04  ? 426  GLU A O     1 
ATOM   1525 C  CB    . GLU C 3 130 ? 20.504  17.848 16.129  1.00 27.26  ? 426  GLU A CB    1 
ATOM   1526 C  CG    . GLU C 3 130 ? 21.899  17.793 16.734  1.00 31.16  ? 426  GLU A CG    1 
ATOM   1527 C  CD    . GLU C 3 130 ? 21.881  17.696 18.250  1.00 35.11  ? 426  GLU A CD    1 
ATOM   1528 O  OE1   . GLU C 3 130 ? 21.867  16.562 18.778  1.00 35.13  ? 426  GLU A OE1   1 
ATOM   1529 O  OE2   . GLU C 3 130 ? 21.876  18.760 18.911  1.00 36.43  ? 426  GLU A OE2   1 
ATOM   1530 N  N     . ALA C 3 131 ? 20.022  15.809 13.728  1.00 22.79  ? 427  ALA A N     1 
ATOM   1531 C  CA    . ALA C 3 131 ? 20.339  14.534 13.105  1.00 22.80  ? 427  ALA A CA    1 
ATOM   1532 C  C     . ALA C 3 131 ? 20.775  14.730 11.658  1.00 23.59  ? 427  ALA A C     1 
ATOM   1533 O  O     . ALA C 3 131 ? 21.587  13.969 11.136  1.00 22.79  ? 427  ALA A O     1 
ATOM   1534 C  CB    . ALA C 3 131 ? 19.131  13.605 13.166  1.00 21.23  ? 427  ALA A CB    1 
ATOM   1535 N  N     . VAL C 3 132 ? 20.233  15.751 11.008  1.00 22.90  ? 428  VAL A N     1 
ATOM   1536 C  CA    . VAL C 3 132 ? 20.581  16.015 9.620   1.00 24.10  ? 428  VAL A CA    1 
ATOM   1537 C  C     . VAL C 3 132 ? 21.860  16.836 9.497   1.00 24.05  ? 428  VAL A C     1 
ATOM   1538 O  O     . VAL C 3 132 ? 22.755  16.491 8.728   1.00 24.03  ? 428  VAL A O     1 
ATOM   1539 C  CB    . VAL C 3 132 ? 19.436  16.761 8.891   1.00 23.12  ? 428  VAL A CB    1 
ATOM   1540 C  CG1   . VAL C 3 132 ? 19.859  17.122 7.474   1.00 24.32  ? 428  VAL A CG1   1 
ATOM   1541 C  CG2   . VAL C 3 132 ? 18.189  15.894 8.866   1.00 22.76  ? 428  VAL A CG2   1 
ATOM   1542 N  N     . TYR C 3 133 ? 21.948  17.912 10.271  1.00 24.69  ? 429  TYR A N     1 
ATOM   1543 C  CA    . TYR C 3 133 ? 23.105  18.802 10.217  1.00 25.85  ? 429  TYR A CA    1 
ATOM   1544 C  C     . TYR C 3 133 ? 24.250  18.498 11.178  1.00 27.91  ? 429  TYR A C     1 
ATOM   1545 O  O     . TYR C 3 133 ? 25.359  19.000 10.995  1.00 27.23  ? 429  TYR A O     1 
ATOM   1546 C  CB    . TYR C 3 133 ? 22.641  20.245 10.427  1.00 23.71  ? 429  TYR A CB    1 
ATOM   1547 C  CG    . TYR C 3 133 ? 21.594  20.678 9.425   1.00 21.59  ? 429  TYR A CG    1 
ATOM   1548 C  CD1   . TYR C 3 133 ? 20.318  21.060 9.839   1.00 23.13  ? 429  TYR A CD1   1 
ATOM   1549 C  CD2   . TYR C 3 133 ? 21.876  20.690 8.061   1.00 22.00  ? 429  TYR A CD2   1 
ATOM   1550 C  CE1   . TYR C 3 133 ? 19.341  21.443 8.911   1.00 22.31  ? 429  TYR A CE1   1 
ATOM   1551 C  CE2   . TYR C 3 133 ? 20.913  21.068 7.127   1.00 22.56  ? 429  TYR A CE2   1 
ATOM   1552 C  CZ    . TYR C 3 133 ? 19.649  21.444 7.559   1.00 22.79  ? 429  TYR A CZ    1 
ATOM   1553 O  OH    . TYR C 3 133 ? 18.706  21.828 6.637   1.00 21.07  ? 429  TYR A OH    1 
ATOM   1554 N  N     . GLY C 3 134 ? 23.992  17.681 12.193  1.00 30.67  ? 430  GLY A N     1 
ATOM   1555 C  CA    . GLY C 3 134 ? 25.029  17.368 13.158  1.00 33.75  ? 430  GLY A CA    1 
ATOM   1556 C  C     . GLY C 3 134 ? 25.182  18.531 14.118  1.00 36.96  ? 430  GLY A C     1 
ATOM   1557 O  O     . GLY C 3 134 ? 24.512  19.552 13.970  1.00 36.78  ? 430  GLY A O     1 
ATOM   1558 N  N     . LYS C 3 135 ? 26.063  18.395 15.103  1.00 40.18  ? 431  LYS A N     1 
ATOM   1559 C  CA    . LYS C 3 135 ? 26.264  19.467 16.072  1.00 43.86  ? 431  LYS A CA    1 
ATOM   1560 C  C     . LYS C 3 135 ? 27.729  19.803 16.324  1.00 44.87  ? 431  LYS A C     1 
ATOM   1561 O  O     . LYS C 3 135 ? 28.614  18.970 16.126  1.00 44.38  ? 431  LYS A O     1 
ATOM   1562 C  CB    . LYS C 3 135 ? 25.574  19.110 17.395  1.00 45.54  ? 431  LYS A CB    1 
ATOM   1563 C  CG    . LYS C 3 135 ? 25.839  17.695 17.893  1.00 48.37  ? 431  LYS A CG    1 
ATOM   1564 C  CD    . LYS C 3 135 ? 27.285  17.503 18.334  1.00 51.29  ? 431  LYS A CD    1 
ATOM   1565 C  CE    . LYS C 3 135 ? 27.530  16.081 18.829  1.00 52.46  ? 431  LYS A CE    1 
ATOM   1566 N  NZ    . LYS C 3 135 ? 28.936  15.880 19.282  1.00 53.07  ? 431  LYS A NZ    1 
ATOM   1567 N  N     . GLY C 3 136 ? 27.971  21.034 16.764  1.00 45.58  ? 432  GLY A N     1 
ATOM   1568 C  CA    . GLY C 3 136 ? 29.324  21.472 17.050  1.00 46.43  ? 432  GLY A CA    1 
ATOM   1569 C  C     . GLY C 3 136 ? 30.211  21.578 15.825  1.00 47.18  ? 432  GLY A C     1 
ATOM   1570 O  O     . GLY C 3 136 ? 29.783  22.043 14.768  1.00 46.92  ? 432  GLY A O     1 
ATOM   1571 N  N     . ALA C 3 137 ? 31.457  21.141 15.974  1.00 47.99  ? 433  ALA A N     1 
ATOM   1572 C  CA    . ALA C 3 137 ? 32.426  21.187 14.885  1.00 48.51  ? 433  ALA A CA    1 
ATOM   1573 C  C     . ALA C 3 137 ? 32.008  20.296 13.722  1.00 48.49  ? 433  ALA A C     1 
ATOM   1574 O  O     . ALA C 3 137 ? 32.323  20.585 12.567  1.00 49.30  ? 433  ALA A O     1 
ATOM   1575 C  CB    . ALA C 3 137 ? 33.803  20.765 15.398  1.00 48.24  ? 433  ALA A CB    1 
ATOM   1576 N  N     . LYS C 3 138 ? 31.297  19.215 14.030  1.00 48.04  ? 434  LYS A N     1 
ATOM   1577 C  CA    . LYS C 3 138 ? 30.844  18.277 13.007  1.00 47.14  ? 434  LYS A CA    1 
ATOM   1578 C  C     . LYS C 3 138 ? 29.664  18.794 12.183  1.00 46.29  ? 434  LYS A C     1 
ATOM   1579 O  O     . LYS C 3 138 ? 29.306  18.199 11.166  1.00 45.60  ? 434  LYS A O     1 
ATOM   1580 C  CB    . LYS C 3 138 ? 30.466  16.942 13.653  1.00 48.38  ? 434  LYS A CB    1 
ATOM   1581 C  CG    . LYS C 3 138 ? 31.628  16.223 14.325  1.00 49.40  ? 434  LYS A CG    1 
ATOM   1582 C  CD    . LYS C 3 138 ? 31.191  14.880 14.896  1.00 49.71  ? 434  LYS A CD    1 
ATOM   1583 C  CE    . LYS C 3 138 ? 32.370  14.122 15.485  1.00 50.93  ? 434  LYS A CE    1 
ATOM   1584 N  NZ    . LYS C 3 138 ? 33.429  13.876 14.464  1.00 50.26  ? 434  LYS A NZ    1 
ATOM   1585 N  N     . ARG C 3 139 ? 29.064  19.897 12.618  1.00 44.50  ? 435  ARG A N     1 
ATOM   1586 C  CA    . ARG C 3 139 ? 27.926  20.463 11.904  1.00 43.40  ? 435  ARG A CA    1 
ATOM   1587 C  C     . ARG C 3 139 ? 28.286  20.789 10.459  1.00 42.11  ? 435  ARG A C     1 
ATOM   1588 O  O     . ARG C 3 139 ? 29.394  21.248 10.180  1.00 43.23  ? 435  ARG A O     1 
ATOM   1589 C  CB    . ARG C 3 139 ? 27.429  21.724 12.612  1.00 44.57  ? 435  ARG A CB    1 
ATOM   1590 C  CG    . ARG C 3 139 ? 26.186  22.322 11.985  1.00 46.42  ? 435  ARG A CG    1 
ATOM   1591 C  CD    . ARG C 3 139 ? 25.439  23.206 12.970  1.00 48.92  ? 435  ARG A CD    1 
ATOM   1592 N  NE    . ARG C 3 139 ? 24.145  23.618 12.435  1.00 50.36  ? 435  ARG A NE    1 
ATOM   1593 C  CZ    . ARG C 3 139 ? 23.162  24.127 13.168  1.00 51.39  ? 435  ARG A CZ    1 
ATOM   1594 N  NH1   . ARG C 3 139 ? 23.323  24.291 14.474  1.00 53.46  ? 435  ARG A NH1   1 
ATOM   1595 N  NH2   . ARG C 3 139 ? 22.015  24.467 12.595  1.00 52.02  ? 435  ARG A NH2   1 
ATOM   1596 N  N     . ALA C 3 140 ? 27.349  20.548 9.546   1.00 39.18  ? 436  ALA A N     1 
ATOM   1597 C  CA    . ALA C 3 140 ? 27.574  20.808 8.127   1.00 36.21  ? 436  ALA A CA    1 
ATOM   1598 C  C     . ALA C 3 140 ? 26.314  20.610 7.289   1.00 34.37  ? 436  ALA A C     1 
ATOM   1599 O  O     . ALA C 3 140 ? 25.412  19.858 7.666   1.00 32.58  ? 436  ALA A O     1 
ATOM   1600 C  CB    . ALA C 3 140 ? 28.682  19.899 7.603   1.00 36.28  ? 436  ALA A CB    1 
ATOM   1601 N  N     . VAL C 3 141 ? 26.265  21.289 6.146   1.00 32.55  ? 437  VAL A N     1 
ATOM   1602 C  CA    . VAL C 3 141 ? 25.136  21.185 5.230   1.00 31.04  ? 437  VAL A CA    1 
ATOM   1603 C  C     . VAL C 3 141 ? 25.344  19.951 4.354   1.00 30.95  ? 437  VAL A C     1 
ATOM   1604 O  O     . VAL C 3 141 ? 26.360  19.834 3.670   1.00 31.84  ? 437  VAL A O     1 
ATOM   1605 C  CB    . VAL C 3 141 ? 25.038  22.426 4.320   1.00 30.66  ? 437  VAL A CB    1 
ATOM   1606 C  CG1   . VAL C 3 141 ? 23.731  22.399 3.547   1.00 29.69  ? 437  VAL A CG1   1 
ATOM   1607 C  CG2   . VAL C 3 141 ? 25.149  23.691 5.151   1.00 28.70  ? 437  VAL A CG2   1 
ATOM   1608 N  N     . PRO C 3 142 ? 24.383  19.015 4.364   1.00 30.38  ? 438  PRO A N     1 
ATOM   1609 C  CA    . PRO C 3 142 ? 24.464  17.782 3.570   1.00 30.05  ? 438  PRO A CA    1 
ATOM   1610 C  C     . PRO C 3 142 ? 24.411  18.029 2.067   1.00 30.23  ? 438  PRO A C     1 
ATOM   1611 O  O     . PRO C 3 142 ? 24.157  19.148 1.622   1.00 30.69  ? 438  PRO A O     1 
ATOM   1612 C  CB    . PRO C 3 142 ? 23.275  16.958 4.068   1.00 30.45  ? 438  PRO A CB    1 
ATOM   1613 C  CG    . PRO C 3 142 ? 22.986  17.527 5.432   1.00 30.82  ? 438  PRO A CG    1 
ATOM   1614 C  CD    . PRO C 3 142 ? 23.185  18.999 5.219   1.00 30.82  ? 438  PRO A CD    1 
ATOM   1615 N  N     . ASP C 3 143 ? 24.653  16.977 1.291   1.00 30.57  ? 439  ASP A N     1 
ATOM   1616 C  CA    . ASP C 3 143 ? 24.609  17.072 -0.162  1.00 30.62  ? 439  ASP A CA    1 
ATOM   1617 C  C     . ASP C 3 143 ? 23.157  17.306 -0.573  1.00 30.43  ? 439  ASP A C     1 
ATOM   1618 O  O     . ASP C 3 143 ? 22.232  16.927 0.152   1.00 29.07  ? 439  ASP A O     1 
ATOM   1619 C  CB    . ASP C 3 143 ? 25.155  15.788 -0.793  1.00 33.61  ? 439  ASP A CB    1 
ATOM   1620 C  CG    . ASP C 3 143 ? 26.668  15.650 -0.624  1.00 35.74  ? 439  ASP A CG    1 
ATOM   1621 O  OD1   . ASP C 3 143 ? 27.224  14.580 -0.954  1.00 37.52  ? 439  ASP A OD1   1 
ATOM   1622 O  OD2   . ASP C 3 143 ? 27.306  16.619 -0.162  1.00 38.55  ? 439  ASP A OD2   1 
ATOM   1623 N  N     . GLU C 3 144 ? 22.962  17.927 -1.732  1.00 29.00  ? 440  GLU A N     1 
ATOM   1624 C  CA    . GLU C 3 144 ? 21.627  18.255 -2.220  1.00 29.80  ? 440  GLU A CA    1 
ATOM   1625 C  C     . GLU C 3 144 ? 20.529  17.223 -1.998  1.00 29.57  ? 440  GLU A C     1 
ATOM   1626 O  O     . GLU C 3 144 ? 19.485  17.545 -1.439  1.00 29.87  ? 440  GLU A O     1 
ATOM   1627 C  CB    . GLU C 3 144 ? 21.670  18.616 -3.706  1.00 29.38  ? 440  GLU A CB    1 
ATOM   1628 C  CG    . GLU C 3 144 ? 20.376  19.254 -4.186  1.00 30.54  ? 440  GLU A CG    1 
ATOM   1629 C  CD    . GLU C 3 144 ? 20.466  19.799 -5.596  1.00 31.08  ? 440  GLU A CD    1 
ATOM   1630 O  OE1   . GLU C 3 144 ? 20.458  18.994 -6.549  1.00 33.00  ? 440  GLU A OE1   1 
ATOM   1631 O  OE2   . GLU C 3 144 ? 20.550  21.035 -5.750  1.00 29.47  ? 440  GLU A OE2   1 
ATOM   1632 N  N     . PRO C 3 145 ? 20.744  15.971 -2.431  1.00 29.79  ? 441  PRO A N     1 
ATOM   1633 C  CA    . PRO C 3 145 ? 19.706  14.953 -2.240  1.00 29.10  ? 441  PRO A CA    1 
ATOM   1634 C  C     . PRO C 3 145 ? 19.191  14.825 -0.807  1.00 28.34  ? 441  PRO A C     1 
ATOM   1635 O  O     . PRO C 3 145 ? 17.981  14.756 -0.575  1.00 27.38  ? 441  PRO A O     1 
ATOM   1636 C  CB    . PRO C 3 145 ? 20.368  13.675 -2.768  1.00 30.17  ? 441  PRO A CB    1 
ATOM   1637 C  CG    . PRO C 3 145 ? 21.844  13.949 -2.599  1.00 30.69  ? 441  PRO A CG    1 
ATOM   1638 C  CD    . PRO C 3 145 ? 21.948  15.380 -3.040  1.00 29.70  ? 441  PRO A CD    1 
ATOM   1639 N  N     . VAL C 3 146 ? 20.108  14.802 0.151   1.00 26.36  ? 442  VAL A N     1 
ATOM   1640 C  CA    . VAL C 3 146 ? 19.729  14.680 1.549   1.00 25.56  ? 442  VAL A CA    1 
ATOM   1641 C  C     . VAL C 3 146 ? 19.101  15.978 2.054   1.00 24.65  ? 442  VAL A C     1 
ATOM   1642 O  O     . VAL C 3 146 ? 18.135  15.955 2.819   1.00 24.34  ? 442  VAL A O     1 
ATOM   1643 C  CB    . VAL C 3 146 ? 20.956  14.325 2.421   1.00 27.07  ? 442  VAL A CB    1 
ATOM   1644 C  CG1   . VAL C 3 146 ? 20.567  14.295 3.889   1.00 25.09  ? 442  VAL A CG1   1 
ATOM   1645 C  CG2   . VAL C 3 146 ? 21.517  12.969 1.993   1.00 25.91  ? 442  VAL A CG2   1 
ATOM   1646 N  N     . LEU C 3 147 ? 19.646  17.108 1.616   1.00 22.64  ? 443  LEU A N     1 
ATOM   1647 C  CA    . LEU C 3 147 ? 19.136  18.407 2.034   1.00 21.57  ? 443  LEU A CA    1 
ATOM   1648 C  C     . LEU C 3 147 ? 17.707  18.611 1.539   1.00 21.40  ? 443  LEU A C     1 
ATOM   1649 O  O     . LEU C 3 147 ? 16.808  18.938 2.319   1.00 20.16  ? 443  LEU A O     1 
ATOM   1650 C  CB    . LEU C 3 147 ? 20.035  19.523 1.494   1.00 21.73  ? 443  LEU A CB    1 
ATOM   1651 C  CG    . LEU C 3 147 ? 19.544  20.968 1.666   1.00 22.72  ? 443  LEU A CG    1 
ATOM   1652 C  CD1   . LEU C 3 147 ? 19.464  21.329 3.149   1.00 22.16  ? 443  LEU A CD1   1 
ATOM   1653 C  CD2   . LEU C 3 147 ? 20.492  21.912 0.942   1.00 21.37  ? 443  LEU A CD2   1 
ATOM   1654 N  N     . ALA C 3 148 ? 17.508  18.405 0.241   1.00 20.39  ? 444  ALA A N     1 
ATOM   1655 C  CA    . ALA C 3 148 ? 16.208  18.578 -0.388  1.00 21.05  ? 444  ALA A CA    1 
ATOM   1656 C  C     . ALA C 3 148 ? 15.092  17.750 0.245   1.00 21.73  ? 444  ALA A C     1 
ATOM   1657 O  O     . ALA C 3 148 ? 13.962  18.227 0.373   1.00 20.85  ? 444  ALA A O     1 
ATOM   1658 C  CB    . ALA C 3 148 ? 16.307  18.267 -1.878  1.00 20.38  ? 444  ALA A CB    1 
ATOM   1659 N  N     . GLU C 3 149 ? 15.390  16.515 0.638   1.00 21.97  ? 445  GLU A N     1 
ATOM   1660 C  CA    . GLU C 3 149 ? 14.354  15.699 1.251   1.00 21.81  ? 445  GLU A CA    1 
ATOM   1661 C  C     . GLU C 3 149 ? 14.016  16.202 2.643   1.00 19.67  ? 445  GLU A C     1 
ATOM   1662 O  O     . GLU C 3 149 ? 12.852  16.203 3.029   1.00 18.40  ? 445  GLU A O     1 
ATOM   1663 C  CB    . GLU C 3 149 ? 14.753  14.221 1.330   1.00 25.00  ? 445  GLU A CB    1 
ATOM   1664 C  CG    . GLU C 3 149 ? 13.798  13.426 2.229   1.00 30.71  ? 445  GLU A CG    1 
ATOM   1665 C  CD    . GLU C 3 149 ? 13.834  11.933 1.998   1.00 33.80  ? 445  GLU A CD    1 
ATOM   1666 O  OE1   . GLU C 3 149 ? 14.941  11.352 1.997   1.00 36.80  ? 445  GLU A OE1   1 
ATOM   1667 O  OE2   . GLU C 3 149 ? 12.747  11.339 1.828   1.00 33.49  ? 445  GLU A OE2   1 
ATOM   1668 N  N     . HIS C 3 150 ? 15.028  16.626 3.399   1.00 17.71  ? 446  HIS A N     1 
ATOM   1669 C  CA    . HIS C 3 150 ? 14.777  17.127 4.740   1.00 17.03  ? 446  HIS A CA    1 
ATOM   1670 C  C     . HIS C 3 150 ? 13.879  18.358 4.715   1.00 17.09  ? 446  HIS A C     1 
ATOM   1671 O  O     . HIS C 3 150 ? 12.935  18.451 5.494   1.00 17.86  ? 446  HIS A O     1 
ATOM   1672 C  CB    . HIS C 3 150 ? 16.088  17.459 5.465   1.00 16.59  ? 446  HIS A CB    1 
ATOM   1673 C  CG    . HIS C 3 150 ? 15.885  17.987 6.853   1.00 15.29  ? 446  HIS A CG    1 
ATOM   1674 N  ND1   . HIS C 3 150 ? 15.027  17.394 7.755   1.00 15.10  ? 446  HIS A ND1   1 
ATOM   1675 C  CD2   . HIS C 3 150 ? 16.433  19.046 7.497   1.00 15.92  ? 446  HIS A CD2   1 
ATOM   1676 C  CE1   . HIS C 3 150 ? 15.055  18.063 8.894   1.00 15.24  ? 446  HIS A CE1   1 
ATOM   1677 N  NE2   . HIS C 3 150 ? 15.901  19.070 8.765   1.00 13.93  ? 446  HIS A NE2   1 
ATOM   1678 N  N     . LEU C 3 151 ? 14.165  19.298 3.818   1.00 16.64  ? 447  LEU A N     1 
ATOM   1679 C  CA    . LEU C 3 151 ? 13.365  20.516 3.715   1.00 17.27  ? 447  LEU A CA    1 
ATOM   1680 C  C     . LEU C 3 151 ? 11.932  20.230 3.258   1.00 17.54  ? 447  LEU A C     1 
ATOM   1681 O  O     . LEU C 3 151 ? 10.980  20.860 3.730   1.00 17.46  ? 447  LEU A O     1 
ATOM   1682 C  CB    . LEU C 3 151 ? 14.027  21.519 2.756   1.00 17.82  ? 447  LEU A CB    1 
ATOM   1683 C  CG    . LEU C 3 151 ? 15.473  21.936 3.063   1.00 19.43  ? 447  LEU A CG    1 
ATOM   1684 C  CD1   . LEU C 3 151 ? 15.829  23.183 2.252   1.00 16.52  ? 447  LEU A CD1   1 
ATOM   1685 C  CD2   . LEU C 3 151 ? 15.630  22.220 4.557   1.00 16.49  ? 447  LEU A CD2   1 
ATOM   1686 N  N     . VAL C 3 152 ? 11.775  19.285 2.337   1.00 17.30  ? 448  VAL A N     1 
ATOM   1687 C  CA    . VAL C 3 152 ? 10.446  18.930 1.851   1.00 16.19  ? 448  VAL A CA    1 
ATOM   1688 C  C     . VAL C 3 152 ? 9.614   18.286 2.961   1.00 15.29  ? 448  VAL A C     1 
ATOM   1689 O  O     . VAL C 3 152 ? 8.435   18.591 3.111   1.00 13.24  ? 448  VAL A O     1 
ATOM   1690 C  CB    . VAL C 3 152 ? 10.526  17.966 0.647   1.00 18.24  ? 448  VAL A CB    1 
ATOM   1691 C  CG1   . VAL C 3 152 ? 9.150   17.357 0.359   1.00 16.66  ? 448  VAL A CG1   1 
ATOM   1692 C  CG2   . VAL C 3 152 ? 11.015  18.723 -0.576  1.00 16.73  ? 448  VAL A CG2   1 
ATOM   1693 N  N     . ARG C 3 153 ? 10.223  17.395 3.740   1.00 15.63  ? 449  ARG A N     1 
ATOM   1694 C  CA    . ARG C 3 153 ? 9.503   16.750 4.834   1.00 15.20  ? 449  ARG A CA    1 
ATOM   1695 C  C     . ARG C 3 153 ? 9.115   17.770 5.912   1.00 14.33  ? 449  ARG A C     1 
ATOM   1696 O  O     . ARG C 3 153 ? 8.077   17.638 6.560   1.00 13.96  ? 449  ARG A O     1 
ATOM   1697 C  CB    . ARG C 3 153 ? 10.344  15.625 5.445   1.00 14.45  ? 449  ARG A CB    1 
ATOM   1698 C  CG    . ARG C 3 153 ? 10.361  14.337 4.616   1.00 15.85  ? 449  ARG A CG    1 
ATOM   1699 C  CD    . ARG C 3 153 ? 11.267  13.278 5.237   1.00 14.80  ? 449  ARG A CD    1 
ATOM   1700 N  NE    . ARG C 3 153 ? 11.169  11.989 4.555   1.00 17.33  ? 449  ARG A NE    1 
ATOM   1701 C  CZ    . ARG C 3 153 ? 10.114  11.179 4.627   1.00 17.67  ? 449  ARG A CZ    1 
ATOM   1702 N  NH1   . ARG C 3 153 ? 9.055   11.522 5.357   1.00 14.25  ? 449  ARG A NH1   1 
ATOM   1703 N  NH2   . ARG C 3 153 ? 10.119  10.024 3.973   1.00 14.35  ? 449  ARG A NH2   1 
ATOM   1704 N  N     . LYS C 3 154 ? 9.943   18.788 6.114   1.00 13.36  ? 450  LYS A N     1 
ATOM   1705 C  CA    . LYS C 3 154 ? 9.607   19.810 7.105   1.00 13.43  ? 450  LYS A CA    1 
ATOM   1706 C  C     . LYS C 3 154 ? 8.415   20.625 6.587   1.00 13.46  ? 450  LYS A C     1 
ATOM   1707 O  O     . LYS C 3 154 ? 7.484   20.924 7.337   1.00 16.16  ? 450  LYS A O     1 
ATOM   1708 C  CB    . LYS C 3 154 ? 10.816  20.715 7.377   1.00 13.81  ? 450  LYS A CB    1 
ATOM   1709 C  CG    . LYS C 3 154 ? 11.841  20.079 8.315   1.00 15.07  ? 450  LYS A CG    1 
ATOM   1710 C  CD    . LYS C 3 154 ? 13.197  20.777 8.294   1.00 19.33  ? 450  LYS A CD    1 
ATOM   1711 C  CE    . LYS C 3 154 ? 13.161  22.166 8.896   1.00 18.21  ? 450  LYS A CE    1 
ATOM   1712 N  NZ    . LYS C 3 154 ? 14.532  22.741 9.050   1.00 12.58  ? 450  LYS A NZ    1 
ATOM   1713 N  N     . ALA C 3 155 ? 8.433   20.958 5.300   1.00 12.60  ? 451  ALA A N     1 
ATOM   1714 C  CA    . ALA C 3 155 ? 7.347   21.720 4.701   1.00 11.83  ? 451  ALA A CA    1 
ATOM   1715 C  C     . ALA C 3 155 ? 6.057   20.902 4.735   1.00 10.85  ? 451  ALA A C     1 
ATOM   1716 O  O     . ALA C 3 155 ? 4.981   21.431 5.008   1.00 11.60  ? 451  ALA A O     1 
ATOM   1717 C  CB    . ALA C 3 155 ? 7.701   22.096 3.262   1.00 13.74  ? 451  ALA A CB    1 
ATOM   1718 N  N     . ALA C 3 156 ? 6.175   19.607 4.466   1.00 11.38  ? 452  ALA A N     1 
ATOM   1719 C  CA    . ALA C 3 156 ? 5.020   18.717 4.477   1.00 14.22  ? 452  ALA A CA    1 
ATOM   1720 C  C     . ALA C 3 156 ? 4.436   18.623 5.885   1.00 13.12  ? 452  ALA A C     1 
ATOM   1721 O  O     . ALA C 3 156 ? 3.216   18.627 6.054   1.00 14.13  ? 452  ALA A O     1 
ATOM   1722 C  CB    . ALA C 3 156 ? 5.419   17.327 3.983   1.00 12.12  ? 452  ALA A CB    1 
ATOM   1723 N  N     . ALA C 3 157 ? 5.305   18.535 6.892   1.00 13.12  ? 453  ALA A N     1 
ATOM   1724 C  CA    . ALA C 3 157 ? 4.847   18.449 8.278   1.00 15.02  ? 453  ALA A CA    1 
ATOM   1725 C  C     . ALA C 3 157 ? 4.079   19.717 8.647   1.00 15.16  ? 453  ALA A C     1 
ATOM   1726 O  O     . ALA C 3 157 ? 3.007   19.651 9.244   1.00 15.45  ? 453  ALA A O     1 
ATOM   1727 C  CB    . ALA C 3 157 ? 6.034   18.256 9.228   1.00 14.33  ? 453  ALA A CB    1 
ATOM   1728 N  N     . ILE C 3 158 ? 4.628   20.872 8.284   1.00 14.86  ? 454  ILE A N     1 
ATOM   1729 C  CA    . ILE C 3 158 ? 3.975   22.143 8.571   1.00 14.47  ? 454  ILE A CA    1 
ATOM   1730 C  C     . ILE C 3 158 ? 2.599   22.203 7.892   1.00 15.49  ? 454  ILE A C     1 
ATOM   1731 O  O     . ILE C 3 158 ? 1.621   22.645 8.488   1.00 15.17  ? 454  ILE A O     1 
ATOM   1732 C  CB    . ILE C 3 158 ? 4.846   23.324 8.091   1.00 14.56  ? 454  ILE A CB    1 
ATOM   1733 C  CG1   . ILE C 3 158 ? 6.166   23.347 8.878   1.00 14.15  ? 454  ILE A CG1   1 
ATOM   1734 C  CG2   . ILE C 3 158 ? 4.100   24.631 8.276   1.00 16.18  ? 454  ILE A CG2   1 
ATOM   1735 C  CD1   . ILE C 3 158 ? 7.242   24.268 8.276   1.00 11.91  ? 454  ILE A CD1   1 
ATOM   1736 N  N     . TRP C 3 159 ? 2.535   21.736 6.649   1.00 15.98  ? 455  TRP A N     1 
ATOM   1737 C  CA    . TRP C 3 159 ? 1.299   21.726 5.867   1.00 16.53  ? 455  TRP A CA    1 
ATOM   1738 C  C     . TRP C 3 159 ? 0.202   20.893 6.545   1.00 16.42  ? 455  TRP A C     1 
ATOM   1739 O  O     . TRP C 3 159 ? -0.958  21.297 6.597   1.00 17.67  ? 455  TRP A O     1 
ATOM   1740 C  CB    . TRP C 3 159 ? 1.612   21.188 4.465   1.00 15.54  ? 455  TRP A CB    1 
ATOM   1741 C  CG    . TRP C 3 159 ? 0.447   21.092 3.512   1.00 17.46  ? 455  TRP A CG    1 
ATOM   1742 C  CD1   . TRP C 3 159 ? -0.153  19.945 3.068   1.00 17.40  ? 455  TRP A CD1   1 
ATOM   1743 C  CD2   . TRP C 3 159 ? -0.225  22.175 2.851   1.00 17.29  ? 455  TRP A CD2   1 
ATOM   1744 N  NE1   . TRP C 3 159 ? -1.148  20.246 2.170   1.00 17.74  ? 455  TRP A NE1   1 
ATOM   1745 C  CE2   . TRP C 3 159 ? -1.214  21.607 2.018   1.00 17.77  ? 455  TRP A CE2   1 
ATOM   1746 C  CE3   . TRP C 3 159 ? -0.082  23.570 2.876   1.00 18.95  ? 455  TRP A CE3   1 
ATOM   1747 C  CZ2   . TRP C 3 159 ? -2.060  22.385 1.217   1.00 18.22  ? 455  TRP A CZ2   1 
ATOM   1748 C  CZ3   . TRP C 3 159 ? -0.925  24.346 2.078   1.00 20.39  ? 455  TRP A CZ3   1 
ATOM   1749 C  CH2   . TRP C 3 159 ? -1.901  23.748 1.259   1.00 19.51  ? 455  TRP A CH2   1 
ATOM   1750 N  N     . GLU C 3 160 ? 0.593   19.747 7.087   1.00 16.66  ? 456  GLU A N     1 
ATOM   1751 C  CA    . GLU C 3 160 ? -0.314  18.832 7.767   1.00 18.01  ? 456  GLU A CA    1 
ATOM   1752 C  C     . GLU C 3 160 ? -0.700  19.241 9.192   1.00 18.82  ? 456  GLU A C     1 
ATOM   1753 O  O     . GLU C 3 160 ? -1.826  18.998 9.634   1.00 19.15  ? 456  GLU A O     1 
ATOM   1754 C  CB    . GLU C 3 160 ? 0.333   17.443 7.797   1.00 18.95  ? 456  GLU A CB    1 
ATOM   1755 C  CG    . GLU C 3 160 ? -0.314  16.424 8.721   1.00 23.92  ? 456  GLU A CG    1 
ATOM   1756 C  CD    . GLU C 3 160 ? -1.729  16.061 8.306   1.00 27.86  ? 456  GLU A CD    1 
ATOM   1757 O  OE1   . GLU C 3 160 ? -1.989  15.962 7.086   1.00 28.95  ? 456  GLU A OE1   1 
ATOM   1758 O  OE2   . GLU C 3 160 ? -2.577  15.863 9.200   1.00 30.38  ? 456  GLU A OE2   1 
ATOM   1759 N  N     . LEU C 3 161 ? 0.232   19.869 9.903   1.00 17.93  ? 457  LEU A N     1 
ATOM   1760 C  CA    . LEU C 3 161 ? 0.023   20.252 11.300  1.00 18.16  ? 457  LEU A CA    1 
ATOM   1761 C  C     . LEU C 3 161 ? -0.677  21.572 11.610  1.00 17.13  ? 457  LEU A C     1 
ATOM   1762 O  O     . LEU C 3 161 ? -1.073  21.796 12.750  1.00 16.76  ? 457  LEU A O     1 
ATOM   1763 C  CB    . LEU C 3 161 ? 1.368   20.232 12.030  1.00 17.17  ? 457  LEU A CB    1 
ATOM   1764 C  CG    . LEU C 3 161 ? 2.086   18.881 12.069  1.00 18.71  ? 457  LEU A CG    1 
ATOM   1765 C  CD1   . LEU C 3 161 ? 3.493   19.066 12.613  1.00 19.64  ? 457  LEU A CD1   1 
ATOM   1766 C  CD2   . LEU C 3 161 ? 1.296   17.906 12.930  1.00 18.97  ? 457  LEU A CD2   1 
ATOM   1767 N  N     . GLU C 3 162 ? -0.829  22.440 10.617  1.00 16.68  ? 458  GLU A N     1 
ATOM   1768 C  CA    . GLU C 3 162 ? -1.474  23.730 10.837  1.00 17.60  ? 458  GLU A CA    1 
ATOM   1769 C  C     . GLU C 3 162 ? -2.861  23.644 11.479  1.00 16.25  ? 458  GLU A C     1 
ATOM   1770 O  O     . GLU C 3 162 ? -3.103  24.263 12.509  1.00 14.43  ? 458  GLU A O     1 
ATOM   1771 C  CB    . GLU C 3 162 ? -1.583  24.501 9.518   1.00 17.84  ? 458  GLU A CB    1 
ATOM   1772 C  CG    . GLU C 3 162 ? -2.347  25.808 9.640   1.00 19.13  ? 458  GLU A CG    1 
ATOM   1773 C  CD    . GLU C 3 162 ? -2.367  26.603 8.348   1.00 20.93  ? 458  GLU A CD    1 
ATOM   1774 O  OE1   . GLU C 3 162 ? -3.064  27.632 8.303   1.00 24.52  ? 458  GLU A OE1   1 
ATOM   1775 O  OE2   . GLU C 3 162 ? -1.688  26.207 7.380   1.00 23.12  ? 458  GLU A OE2   1 
ATOM   1776 N  N     . ARG C 3 163 ? -3.766  22.883 10.869  1.00 18.09  ? 459  ARG A N     1 
ATOM   1777 C  CA    . ARG C 3 163 ? -5.130  22.755 11.388  1.00 19.52  ? 459  ARG A CA    1 
ATOM   1778 C  C     . ARG C 3 163 ? -5.196  22.174 12.802  1.00 18.15  ? 459  ARG A C     1 
ATOM   1779 O  O     . ARG C 3 163 ? -5.933  22.675 13.646  1.00 16.61  ? 459  ARG A O     1 
ATOM   1780 C  CB    . ARG C 3 163 ? -5.985  21.925 10.423  1.00 24.00  ? 459  ARG A CB    1 
ATOM   1781 C  CG    . ARG C 3 163 ? -7.403  21.600 10.916  1.00 29.47  ? 459  ARG A CG    1 
ATOM   1782 C  CD    . ARG C 3 163 ? -8.068  22.797 11.597  1.00 34.80  ? 459  ARG A CD    1 
ATOM   1783 N  NE    . ARG C 3 163 ? -8.003  24.011 10.785  1.00 40.78  ? 459  ARG A NE    1 
ATOM   1784 C  CZ    . ARG C 3 163 ? -8.111  25.243 11.275  1.00 41.68  ? 459  ARG A CZ    1 
ATOM   1785 N  NH1   . ARG C 3 163 ? -8.289  25.427 12.579  1.00 42.71  ? 459  ARG A NH1   1 
ATOM   1786 N  NH2   . ARG C 3 163 ? -8.034  26.292 10.466  1.00 41.94  ? 459  ARG A NH2   1 
ATOM   1787 N  N     . PRO C 3 164 ? -4.433  21.104 13.076  1.00 18.37  ? 460  PRO A N     1 
ATOM   1788 C  CA    . PRO C 3 164 ? -4.445  20.504 14.416  1.00 17.13  ? 460  PRO A CA    1 
ATOM   1789 C  C     . PRO C 3 164 ? -3.966  21.499 15.475  1.00 16.40  ? 460  PRO A C     1 
ATOM   1790 O  O     . PRO C 3 164 ? -4.511  21.559 16.584  1.00 14.79  ? 460  PRO A O     1 
ATOM   1791 C  CB    . PRO C 3 164 ? -3.518  19.297 14.271  1.00 17.54  ? 460  PRO A CB    1 
ATOM   1792 C  CG    . PRO C 3 164 ? -3.685  18.923 12.835  1.00 17.92  ? 460  PRO A CG    1 
ATOM   1793 C  CD    . PRO C 3 164 ? -3.680  20.258 12.133  1.00 19.38  ? 460  PRO A CD    1 
ATOM   1794 N  N     . PHE C 3 165 ? -2.941  22.277 15.133  1.00 14.14  ? 461  PHE A N     1 
ATOM   1795 C  CA    . PHE C 3 165 ? -2.422  23.268 16.071  1.00 14.27  ? 461  PHE A CA    1 
ATOM   1796 C  C     . PHE C 3 165 ? -3.398  24.435 16.277  1.00 13.63  ? 461  PHE A C     1 
ATOM   1797 O  O     . PHE C 3 165 ? -3.608  24.878 17.402  1.00 14.47  ? 461  PHE A O     1 
ATOM   1798 C  CB    . PHE C 3 165 ? -1.047  23.787 15.615  1.00 12.89  ? 461  PHE A CB    1 
ATOM   1799 C  CG    . PHE C 3 165 ? 0.107   22.972 16.141  1.00 11.73  ? 461  PHE A CG    1 
ATOM   1800 C  CD1   . PHE C 3 165 ? 0.405   21.724 15.603  1.00 12.01  ? 461  PHE A CD1   1 
ATOM   1801 C  CD2   . PHE C 3 165 ? 0.879   23.444 17.199  1.00 11.53  ? 461  PHE A CD2   1 
ATOM   1802 C  CE1   . PHE C 3 165 ? 1.453   20.956 16.113  1.00 12.51  ? 461  PHE A CE1   1 
ATOM   1803 C  CE2   . PHE C 3 165 ? 1.931   22.682 17.719  1.00 9.02   ? 461  PHE A CE2   1 
ATOM   1804 C  CZ    . PHE C 3 165 ? 2.217   21.434 17.174  1.00 11.26  ? 461  PHE A CZ    1 
ATOM   1805 N  N     . LEU C 3 166 ? -4.001  24.924 15.200  1.00 14.12  ? 462  LEU A N     1 
ATOM   1806 C  CA    . LEU C 3 166 ? -4.956  26.022 15.320  1.00 14.30  ? 462  LEU A CA    1 
ATOM   1807 C  C     . LEU C 3 166 ? -6.176  25.580 16.134  1.00 14.22  ? 462  LEU A C     1 
ATOM   1808 O  O     . LEU C 3 166 ? -6.691  26.342 16.944  1.00 14.28  ? 462  LEU A O     1 
ATOM   1809 C  CB    . LEU C 3 166 ? -5.391  26.514 13.933  1.00 11.74  ? 462  LEU A CB    1 
ATOM   1810 C  CG    . LEU C 3 166 ? -4.298  27.230 13.123  1.00 14.88  ? 462  LEU A CG    1 
ATOM   1811 C  CD1   . LEU C 3 166 ? -4.844  27.633 11.756  1.00 12.95  ? 462  LEU A CD1   1 
ATOM   1812 C  CD2   . LEU C 3 166 ? -3.817  28.475 13.895  1.00 12.63  ? 462  LEU A CD2   1 
ATOM   1813 N  N     . ASP C 3 167 ? -6.619  24.342 15.936  1.00 15.12  ? 463  ASP A N     1 
ATOM   1814 C  CA    . ASP C 3 167 ? -7.772  23.822 16.670  1.00 17.59  ? 463  ASP A CA    1 
ATOM   1815 C  C     . ASP C 3 167 ? -7.533  23.796 18.182  1.00 16.74  ? 463  ASP A C     1 
ATOM   1816 O  O     . ASP C 3 167 ? -8.387  24.232 18.954  1.00 17.40  ? 463  ASP A O     1 
ATOM   1817 C  CB    . ASP C 3 167 ? -8.124  22.411 16.183  1.00 18.77  ? 463  ASP A CB    1 
ATOM   1818 C  CG    . ASP C 3 167 ? -8.822  22.413 14.828  1.00 22.58  ? 463  ASP A CG    1 
ATOM   1819 O  OD1   . ASP C 3 167 ? -8.963  21.326 14.224  1.00 25.11  ? 463  ASP A OD1   1 
ATOM   1820 O  OD2   . ASP C 3 167 ? -9.234  23.498 14.369  1.00 22.46  ? 463  ASP A OD2   1 
ATOM   1821 N  N     . GLU C 3 168 ? -6.380  23.287 18.609  1.00 14.48  ? 464  GLU A N     1 
ATOM   1822 C  CA    . GLU C 3 168 ? -6.089  23.234 20.035  1.00 15.67  ? 464  GLU A CA    1 
ATOM   1823 C  C     . GLU C 3 168 ? -5.904  24.638 20.614  1.00 15.21  ? 464  GLU A C     1 
ATOM   1824 O  O     . GLU C 3 168 ? -6.327  24.908 21.733  1.00 14.77  ? 464  GLU A O     1 
ATOM   1825 C  CB    . GLU C 3 168 ? -4.848  22.381 20.332  1.00 13.39  ? 464  GLU A CB    1 
ATOM   1826 C  CG    . GLU C 3 168 ? -4.628  22.225 21.841  1.00 15.62  ? 464  GLU A CG    1 
ATOM   1827 C  CD    . GLU C 3 168 ? -3.418  21.383 22.205  1.00 18.17  ? 464  GLU A CD    1 
ATOM   1828 O  OE1   . GLU C 3 168 ? -3.156  21.232 23.418  1.00 17.08  ? 464  GLU A OE1   1 
ATOM   1829 O  OE2   . GLU C 3 168 ? -2.731  20.875 21.290  1.00 16.77  ? 464  GLU A OE2   1 
ATOM   1830 N  N     . LEU C 3 169 ? -5.272  25.529 19.856  1.00 14.40  ? 465  LEU A N     1 
ATOM   1831 C  CA    . LEU C 3 169 ? -5.085  26.895 20.330  1.00 15.40  ? 465  LEU A CA    1 
ATOM   1832 C  C     . LEU C 3 169 ? -6.468  27.513 20.554  1.00 14.75  ? 465  LEU A C     1 
ATOM   1833 O  O     . LEU C 3 169 ? -6.699  28.213 21.541  1.00 15.44  ? 465  LEU A O     1 
ATOM   1834 C  CB    . LEU C 3 169 ? -4.298  27.718 19.300  1.00 12.95  ? 465  LEU A CB    1 
ATOM   1835 C  CG    . LEU C 3 169 ? -2.789  27.450 19.195  1.00 16.54  ? 465  LEU A CG    1 
ATOM   1836 C  CD1   . LEU C 3 169 ? -2.251  28.010 17.892  1.00 13.02  ? 465  LEU A CD1   1 
ATOM   1837 C  CD2   . LEU C 3 169 ? -2.064  28.075 20.395  1.00 13.81  ? 465  LEU A CD2   1 
ATOM   1838 N  N     . ARG C 3 170 ? -7.385  27.242 19.631  1.00 15.68  ? 466  ARG A N     1 
ATOM   1839 C  CA    . ARG C 3 170 ? -8.746  27.758 19.727  1.00 19.76  ? 466  ARG A CA    1 
ATOM   1840 C  C     . ARG C 3 170 ? -9.451  27.241 20.987  1.00 18.25  ? 466  ARG A C     1 
ATOM   1841 O  O     . ARG C 3 170 ? -10.137 27.996 21.672  1.00 17.09  ? 466  ARG A O     1 
ATOM   1842 C  CB    . ARG C 3 170 ? -9.549  27.357 18.489  1.00 23.79  ? 466  ARG A CB    1 
ATOM   1843 C  CG    . ARG C 3 170 ? -10.941 27.962 18.440  1.00 31.03  ? 466  ARG A CG    1 
ATOM   1844 C  CD    . ARG C 3 170 ? -10.873 29.471 18.248  1.00 38.64  ? 466  ARG A CD    1 
ATOM   1845 N  NE    . ARG C 3 170 ? -12.176 30.112 18.413  1.00 42.99  ? 466  ARG A NE    1 
ATOM   1846 C  CZ    . ARG C 3 170 ? -12.821 30.210 19.573  1.00 46.29  ? 466  ARG A CZ    1 
ATOM   1847 N  NH1   . ARG C 3 170 ? -12.286 29.709 20.682  1.00 45.95  ? 466  ARG A NH1   1 
ATOM   1848 N  NH2   . ARG C 3 170 ? -14.004 30.812 19.626  1.00 48.49  ? 466  ARG A NH2   1 
ATOM   1849 N  N     . ARG C 3 171 ? -9.281  25.955 21.286  1.00 18.57  ? 467  ARG A N     1 
ATOM   1850 C  CA    . ARG C 3 171 ? -9.894  25.361 22.473  1.00 18.93  ? 467  ARG A CA    1 
ATOM   1851 C  C     . ARG C 3 171 ? -9.317  26.009 23.729  1.00 18.51  ? 467  ARG A C     1 
ATOM   1852 O  O     . ARG C 3 171 ? -10.011 26.165 24.732  1.00 16.70  ? 467  ARG A O     1 
ATOM   1853 C  CB    . ARG C 3 171 ? -9.639  23.847 22.528  1.00 20.41  ? 467  ARG A CB    1 
ATOM   1854 C  CG    . ARG C 3 171 ? -10.375 23.032 21.472  1.00 25.35  ? 467  ARG A CG    1 
ATOM   1855 C  CD    . ARG C 3 171 ? -10.377 21.542 21.822  1.00 27.38  ? 467  ARG A CD    1 
ATOM   1856 N  NE    . ARG C 3 171 ? -9.066  20.908 21.680  1.00 29.71  ? 467  ARG A NE    1 
ATOM   1857 C  CZ    . ARG C 3 171 ? -8.537  20.523 20.520  1.00 29.47  ? 467  ARG A CZ    1 
ATOM   1858 N  NH1   . ARG C 3 171 ? -9.207  20.700 19.389  1.00 28.41  ? 467  ARG A NH1   1 
ATOM   1859 N  NH2   . ARG C 3 171 ? -7.335  19.958 20.489  1.00 29.67  ? 467  ARG A NH2   1 
ATOM   1860 N  N     . ASN C 3 172 ? -8.039  26.382 23.660  1.00 16.76  ? 468  ASN A N     1 
ATOM   1861 C  CA    . ASN C 3 172 ? -7.350  27.021 24.777  1.00 16.93  ? 468  ASN A CA    1 
ATOM   1862 C  C     . ASN C 3 172 ? -7.632  28.521 24.824  1.00 16.91  ? 468  ASN A C     1 
ATOM   1863 O  O     . ASN C 3 172 ? -7.151  29.207 25.718  1.00 15.88  ? 468  ASN A O     1 
ATOM   1864 C  CB    . ASN C 3 172 ? -5.833  26.828 24.654  1.00 16.83  ? 468  ASN A CB    1 
ATOM   1865 C  CG    . ASN C 3 172 ? -5.376  25.427 25.024  1.00 18.61  ? 468  ASN A CG    1 
ATOM   1866 O  OD1   . ASN C 3 172 ? -6.186  24.541 25.289  1.00 17.35  ? 468  ASN A OD1   1 
ATOM   1867 N  ND2   . ASN C 3 172 ? -4.059  25.224 25.042  1.00 16.44  ? 468  ASN A ND2   1 
ATOM   1868 N  N     . GLU C 3 173 ? -8.403  29.025 23.863  1.00 17.38  ? 469  GLU A N     1 
ATOM   1869 C  CA    . GLU C 3 173 ? -8.700  30.455 23.788  1.00 19.87  ? 469  GLU A CA    1 
ATOM   1870 C  C     . GLU C 3 173 ? -7.397  31.224 23.580  1.00 18.64  ? 469  GLU A C     1 
ATOM   1871 O  O     . GLU C 3 173 ? -7.218  32.326 24.097  1.00 18.26  ? 469  GLU A O     1 
ATOM   1872 C  CB    . GLU C 3 173 ? -9.383  30.946 25.071  1.00 22.74  ? 469  GLU A CB    1 
ATOM   1873 C  CG    . GLU C 3 173 ? -10.791 30.423 25.265  1.00 29.95  ? 469  GLU A CG    1 
ATOM   1874 C  CD    . GLU C 3 173 ? -11.391 30.847 26.592  1.00 34.00  ? 469  GLU A CD    1 
ATOM   1875 O  OE1   . GLU C 3 173 ? -11.384 32.062 26.897  1.00 36.10  ? 469  GLU A OE1   1 
ATOM   1876 O  OE2   . GLU C 3 173 ? -11.874 29.964 27.330  1.00 37.97  ? 469  GLU A OE2   1 
ATOM   1877 N  N     . GLN C 3 174 ? -6.489  30.626 22.816  1.00 19.02  ? 470  GLN A N     1 
ATOM   1878 C  CA    . GLN C 3 174 ? -5.192  31.232 22.523  1.00 17.39  ? 470  GLN A CA    1 
ATOM   1879 C  C     . GLN C 3 174 ? -5.047  31.541 21.037  1.00 18.57  ? 470  GLN A C     1 
ATOM   1880 O  O     . GLN C 3 174 ? -3.958  31.906 20.581  1.00 16.14  ? 470  GLN A O     1 
ATOM   1881 C  CB    . GLN C 3 174 ? -4.058  30.288 22.928  1.00 17.33  ? 470  GLN A CB    1 
ATOM   1882 C  CG    . GLN C 3 174 ? -3.993  29.937 24.399  1.00 16.17  ? 470  GLN A CG    1 
ATOM   1883 C  CD    . GLN C 3 174 ? -2.862  28.971 24.696  1.00 16.86  ? 470  GLN A CD    1 
ATOM   1884 O  OE1   . GLN C 3 174 ? -2.799  27.876 24.133  1.00 17.73  ? 470  GLN A OE1   1 
ATOM   1885 N  NE2   . GLN C 3 174 ? -1.960  29.371 25.582  1.00 18.23  ? 470  GLN A NE2   1 
ATOM   1886 N  N     . ASP C 3 175 ? -6.134  31.392 20.281  1.00 18.19  ? 471  ASP A N     1 
ATOM   1887 C  CA    . ASP C 3 175 ? -6.084  31.651 18.847  1.00 19.56  ? 471  ASP A CA    1 
ATOM   1888 C  C     . ASP C 3 175 ? -5.725  33.105 18.546  1.00 18.24  ? 471  ASP A C     1 
ATOM   1889 O  O     . ASP C 3 175 ? -4.918  33.373 17.656  1.00 17.94  ? 471  ASP A O     1 
ATOM   1890 C  CB    . ASP C 3 175 ? -7.413  31.253 18.171  1.00 22.72  ? 471  ASP A CB    1 
ATOM   1891 C  CG    . ASP C 3 175 ? -8.632  31.844 18.857  1.00 24.68  ? 471  ASP A CG    1 
ATOM   1892 O  OD1   . ASP C 3 175 ? -8.801  31.639 20.081  1.00 25.47  ? 471  ASP A OD1   1 
ATOM   1893 O  OD2   . ASP C 3 175 ? -9.430  32.513 18.166  1.00 27.58  ? 471  ASP A OD2   1 
ATOM   1894 N  N     . ARG C 3 176 ? -6.303  34.044 19.288  1.00 17.49  ? 472  ARG A N     1 
ATOM   1895 C  CA    . ARG C 3 176 ? -5.986  35.452 19.072  1.00 17.39  ? 472  ARG A CA    1 
ATOM   1896 C  C     . ARG C 3 176 ? -4.589  35.776 19.619  1.00 16.01  ? 472  ARG A C     1 
ATOM   1897 O  O     . ARG C 3 176 ? -3.912  36.674 19.120  1.00 13.94  ? 472  ARG A O     1 
ATOM   1898 C  CB    . ARG C 3 176 ? -7.029  36.348 19.749  1.00 19.21  ? 472  ARG A CB    1 
ATOM   1899 C  CG    . ARG C 3 176 ? -8.442  36.163 19.212  1.00 25.22  ? 472  ARG A CG    1 
ATOM   1900 C  CD    . ARG C 3 176 ? -9.436  37.023 19.976  1.00 30.14  ? 472  ARG A CD    1 
ATOM   1901 N  NE    . ARG C 3 176 ? -9.162  38.446 19.807  1.00 35.09  ? 472  ARG A NE    1 
ATOM   1902 C  CZ    . ARG C 3 176 ? -9.823  39.415 20.436  1.00 38.60  ? 472  ARG A CZ    1 
ATOM   1903 N  NH1   . ARG C 3 176 ? -10.799 39.113 21.285  1.00 40.40  ? 472  ARG A NH1   1 
ATOM   1904 N  NH2   . ARG C 3 176 ? -9.512  40.687 20.210  1.00 38.98  ? 472  ARG A NH2   1 
ATOM   1905 N  N     . LEU C 3 177 ? -4.160  35.044 20.644  1.00 13.86  ? 473  LEU A N     1 
ATOM   1906 C  CA    . LEU C 3 177 ? -2.838  35.265 21.228  1.00 15.19  ? 473  LEU A CA    1 
ATOM   1907 C  C     . LEU C 3 177 ? -1.753  35.035 20.171  1.00 14.56  ? 473  LEU A C     1 
ATOM   1908 O  O     . LEU C 3 177 ? -0.748  35.746 20.132  1.00 13.81  ? 473  LEU A O     1 
ATOM   1909 C  CB    . LEU C 3 177 ? -2.614  34.327 22.421  1.00 13.30  ? 473  LEU A CB    1 
ATOM   1910 C  CG    . LEU C 3 177 ? -1.299  34.475 23.204  1.00 12.63  ? 473  LEU A CG    1 
ATOM   1911 C  CD1   . LEU C 3 177 ? -1.169  35.890 23.768  1.00 13.99  ? 473  LEU A CD1   1 
ATOM   1912 C  CD2   . LEU C 3 177 ? -1.274  33.450 24.337  1.00 11.19  ? 473  LEU A CD2   1 
ATOM   1913 N  N     . LEU C 3 178 ? -1.958  34.039 19.314  1.00 13.48  ? 474  LEU A N     1 
ATOM   1914 C  CA    . LEU C 3 178 ? -0.992  33.750 18.259  1.00 14.07  ? 474  LEU A CA    1 
ATOM   1915 C  C     . LEU C 3 178 ? -1.123  34.704 17.068  1.00 14.43  ? 474  LEU A C     1 
ATOM   1916 O  O     . LEU C 3 178 ? -0.140  35.295 16.617  1.00 13.74  ? 474  LEU A O     1 
ATOM   1917 C  CB    . LEU C 3 178 ? -1.171  32.321 17.743  1.00 13.80  ? 474  LEU A CB    1 
ATOM   1918 C  CG    . LEU C 3 178 ? -0.341  32.009 16.494  1.00 15.22  ? 474  LEU A CG    1 
ATOM   1919 C  CD1   . LEU C 3 178 ? 1.105   31.739 16.910  1.00 13.73  ? 474  LEU A CD1   1 
ATOM   1920 C  CD2   . LEU C 3 178 ? -0.917  30.801 15.755  1.00 14.38  ? 474  LEU A CD2   1 
ATOM   1921 N  N     . VAL C 3 179 ? -2.346  34.844 16.566  1.00 14.07  ? 475  VAL A N     1 
ATOM   1922 C  CA    . VAL C 3 179 ? -2.614  35.670 15.392  1.00 15.55  ? 475  VAL A CA    1 
ATOM   1923 C  C     . VAL C 3 179 ? -2.579  37.182 15.569  1.00 14.52  ? 475  VAL A C     1 
ATOM   1924 O  O     . VAL C 3 179 ? -2.182  37.901 14.655  1.00 14.37  ? 475  VAL A O     1 
ATOM   1925 C  CB    . VAL C 3 179 ? -3.976  35.270 14.753  1.00 16.75  ? 475  VAL A CB    1 
ATOM   1926 C  CG1   . VAL C 3 179 ? -4.358  36.247 13.650  1.00 16.99  ? 475  VAL A CG1   1 
ATOM   1927 C  CG2   . VAL C 3 179 ? -3.875  33.864 14.174  1.00 16.66  ? 475  VAL A CG2   1 
ATOM   1928 N  N     . GLU C 3 180 ? -2.982  37.671 16.734  1.00 14.45  ? 476  GLU A N     1 
ATOM   1929 C  CA    . GLU C 3 180 ? -2.993  39.107 16.957  1.00 13.84  ? 476  GLU A CA    1 
ATOM   1930 C  C     . GLU C 3 180 ? -1.855  39.616 17.840  1.00 13.31  ? 476  GLU A C     1 
ATOM   1931 O  O     . GLU C 3 180 ? -1.623  40.822 17.910  1.00 13.42  ? 476  GLU A O     1 
ATOM   1932 C  CB    . GLU C 3 180 ? -4.344  39.524 17.547  1.00 15.26  ? 476  GLU A CB    1 
ATOM   1933 C  CG    . GLU C 3 180 ? -5.523  39.082 16.683  1.00 18.98  ? 476  GLU A CG    1 
ATOM   1934 C  CD    . GLU C 3 180 ? -6.869  39.480 17.254  1.00 22.03  ? 476  GLU A CD    1 
ATOM   1935 O  OE1   . GLU C 3 180 ? -7.897  39.037 16.700  1.00 25.88  ? 476  GLU A OE1   1 
ATOM   1936 O  OE2   . GLU C 3 180 ? -6.907  40.233 18.249  1.00 25.21  ? 476  GLU A OE2   1 
ATOM   1937 N  N     . LEU C 3 181 ? -1.147  38.715 18.513  1.00 10.05  ? 477  LEU A N     1 
ATOM   1938 C  CA    . LEU C 3 181 ? -0.042  39.154 19.364  1.00 11.19  ? 477  LEU A CA    1 
ATOM   1939 C  C     . LEU C 3 181 ? 1.329   38.617 18.931  1.00 9.78   ? 477  LEU A C     1 
ATOM   1940 O  O     . LEU C 3 181 ? 2.140   39.362 18.398  1.00 9.82   ? 477  LEU A O     1 
ATOM   1941 C  CB    . LEU C 3 181 ? -0.286  38.778 20.832  1.00 10.75  ? 477  LEU A CB    1 
ATOM   1942 C  CG    . LEU C 3 181 ? 0.718   39.471 21.768  1.00 14.95  ? 477  LEU A CG    1 
ATOM   1943 C  CD1   . LEU C 3 181 ? 0.140   40.813 22.218  1.00 14.47  ? 477  LEU A CD1   1 
ATOM   1944 C  CD2   . LEU C 3 181 ? 1.020   38.607 22.975  1.00 14.37  ? 477  LEU A CD2   1 
ATOM   1945 N  N     . GLU C 3 182 ? 1.583   37.328 19.137  1.00 9.33   ? 478  GLU A N     1 
ATOM   1946 C  CA    . GLU C 3 182 ? 2.893   36.762 18.795  1.00 11.59  ? 478  GLU A CA    1 
ATOM   1947 C  C     . GLU C 3 182 ? 3.336   36.850 17.325  1.00 11.77  ? 478  GLU A C     1 
ATOM   1948 O  O     . GLU C 3 182 ? 4.474   37.224 17.051  1.00 12.07  ? 478  GLU A O     1 
ATOM   1949 C  CB    . GLU C 3 182 ? 2.987   35.305 19.267  1.00 9.94   ? 478  GLU A CB    1 
ATOM   1950 C  CG    . GLU C 3 182 ? 2.777   35.077 20.777  1.00 11.20  ? 478  GLU A CG    1 
ATOM   1951 C  CD    . GLU C 3 182 ? 3.835   35.733 21.671  1.00 12.59  ? 478  GLU A CD    1 
ATOM   1952 O  OE1   . GLU C 3 182 ? 4.803   36.329 21.154  1.00 15.90  ? 478  GLU A OE1   1 
ATOM   1953 O  OE2   . GLU C 3 182 ? 3.694   35.651 22.908  1.00 12.99  ? 478  GLU A OE2   1 
ATOM   1954 N  N     . GLN C 3 183 ? 2.471   36.512 16.371  1.00 13.03  ? 479  GLN A N     1 
ATOM   1955 C  CA    . GLN C 3 183 ? 2.903   36.582 14.977  1.00 12.26  ? 479  GLN A CA    1 
ATOM   1956 C  C     . GLN C 3 183 ? 3.224   38.011 14.530  1.00 13.03  ? 479  GLN A C     1 
ATOM   1957 O  O     . GLN C 3 183 ? 4.243   38.241 13.883  1.00 14.54  ? 479  GLN A O     1 
ATOM   1958 C  CB    . GLN C 3 183 ? 1.886   35.883 14.059  1.00 10.81  ? 479  GLN A CB    1 
ATOM   1959 C  CG    . GLN C 3 183 ? 2.013   34.361 14.202  1.00 11.68  ? 479  GLN A CG    1 
ATOM   1960 C  CD    . GLN C 3 183 ? 1.021   33.538 13.388  1.00 13.62  ? 479  GLN A CD    1 
ATOM   1961 O  OE1   . GLN C 3 183 ? 1.099   32.311 13.393  1.00 13.70  ? 479  GLN A OE1   1 
ATOM   1962 N  NE2   . GLN C 3 183 ? 0.091   34.198 12.696  1.00 12.05  ? 479  GLN A NE2   1 
ATOM   1963 N  N     . PRO C 3 184 ? 2.368   38.990 14.868  1.00 12.96  ? 480  PRO A N     1 
ATOM   1964 C  CA    . PRO C 3 184 ? 2.688   40.361 14.455  1.00 12.98  ? 480  PRO A CA    1 
ATOM   1965 C  C     . PRO C 3 184 ? 3.966   40.859 15.157  1.00 12.91  ? 480  PRO A C     1 
ATOM   1966 O  O     . PRO C 3 184 ? 4.759   41.603 14.575  1.00 10.66  ? 480  PRO A O     1 
ATOM   1967 C  CB    . PRO C 3 184 ? 1.444   41.149 14.853  1.00 14.03  ? 480  PRO A CB    1 
ATOM   1968 C  CG    . PRO C 3 184 ? 0.338   40.127 14.694  1.00 14.55  ? 480  PRO A CG    1 
ATOM   1969 C  CD    . PRO C 3 184 ? 0.963   38.888 15.309  1.00 13.76  ? 480  PRO A CD    1 
ATOM   1970 N  N     . LEU C 3 185 ? 4.161   40.448 16.410  1.00 11.53  ? 481  LEU A N     1 
ATOM   1971 C  CA    . LEU C 3 185 ? 5.351   40.858 17.160  1.00 13.12  ? 481  LEU A CA    1 
ATOM   1972 C  C     . LEU C 3 185 ? 6.603   40.291 16.491  1.00 12.84  ? 481  LEU A C     1 
ATOM   1973 O  O     . LEU C 3 185 ? 7.660   40.920 16.494  1.00 14.02  ? 481  LEU A O     1 
ATOM   1974 C  CB    . LEU C 3 185 ? 5.285   40.365 18.612  1.00 10.94  ? 481  LEU A CB    1 
ATOM   1975 C  CG    . LEU C 3 185 ? 6.508   40.688 19.487  1.00 14.23  ? 481  LEU A CG    1 
ATOM   1976 C  CD1   . LEU C 3 185 ? 6.571   42.188 19.729  1.00 13.86  ? 481  LEU A CD1   1 
ATOM   1977 C  CD2   . LEU C 3 185 ? 6.433   39.950 20.817  1.00 13.58  ? 481  LEU A CD2   1 
ATOM   1978 N  N     . SER C 3 186 ? 6.473   39.097 15.919  1.00 12.38  ? 482  SER A N     1 
ATOM   1979 C  CA    . SER C 3 186 ? 7.586   38.443 15.253  1.00 12.20  ? 482  SER A CA    1 
ATOM   1980 C  C     . SER C 3 186 ? 8.181   39.327 14.158  1.00 13.18  ? 482  SER A C     1 
ATOM   1981 O  O     . SER C 3 186 ? 9.404   39.428 14.028  1.00 12.81  ? 482  SER A O     1 
ATOM   1982 C  CB    . SER C 3 186 ? 7.124   37.115 14.646  1.00 13.05  ? 482  SER A CB    1 
ATOM   1983 O  OG    . SER C 3 186 ? 8.205   36.428 14.048  1.00 17.70  ? 482  SER A OG    1 
ATOM   1984 N  N     . SER C 3 187 ? 7.312   39.961 13.370  1.00 13.37  ? 483  SER A N     1 
ATOM   1985 C  CA    . SER C 3 187 ? 7.749   40.839 12.290  1.00 13.86  ? 483  SER A CA    1 
ATOM   1986 C  C     . SER C 3 187 ? 8.459   42.076 12.839  1.00 13.27  ? 483  SER A C     1 
ATOM   1987 O  O     . SER C 3 187 ? 9.426   42.565 12.251  1.00 12.26  ? 483  SER A O     1 
ATOM   1988 C  CB    . SER C 3 187 ? 6.550   41.283 11.441  1.00 13.85  ? 483  SER A CB    1 
ATOM   1989 O  OG    . SER C 3 187 ? 5.960   40.180 10.781  1.00 15.28  ? 483  SER A OG    1 
ATOM   1990 N  N     . ILE C 3 188 ? 7.968   42.576 13.966  1.00 11.37  ? 484  ILE A N     1 
ATOM   1991 C  CA    . ILE C 3 188 ? 8.544   43.756 14.596  1.00 11.71  ? 484  ILE A CA    1 
ATOM   1992 C  C     . ILE C 3 188 ? 9.951   43.459 15.134  1.00 11.47  ? 484  ILE A C     1 
ATOM   1993 O  O     . ILE C 3 188 ? 10.864  44.276 15.008  1.00 11.76  ? 484  ILE A O     1 
ATOM   1994 C  CB    . ILE C 3 188 ? 7.618   44.260 15.737  1.00 12.33  ? 484  ILE A CB    1 
ATOM   1995 C  CG1   . ILE C 3 188 ? 6.287   44.741 15.140  1.00 12.32  ? 484  ILE A CG1   1 
ATOM   1996 C  CG2   . ILE C 3 188 ? 8.294   45.389 16.519  1.00 9.44   ? 484  ILE A CG2   1 
ATOM   1997 C  CD1   . ILE C 3 188 ? 5.279   45.236 16.183  1.00 10.21  ? 484  ILE A CD1   1 
ATOM   1998 N  N     . LEU C 3 189 ? 10.120  42.286 15.729  1.00 11.61  ? 485  LEU A N     1 
ATOM   1999 C  CA    . LEU C 3 189 ? 11.413  41.889 16.265  1.00 11.12  ? 485  LEU A CA    1 
ATOM   2000 C  C     . LEU C 3 189 ? 12.418  41.734 15.121  1.00 10.08  ? 485  LEU A C     1 
ATOM   2001 O  O     . LEU C 3 189 ? 13.593  42.047 15.279  1.00 9.44   ? 485  LEU A O     1 
ATOM   2002 C  CB    . LEU C 3 189 ? 11.274  40.576 17.053  1.00 10.89  ? 485  LEU A CB    1 
ATOM   2003 C  CG    . LEU C 3 189 ? 10.466  40.695 18.359  1.00 9.90   ? 485  LEU A CG    1 
ATOM   2004 C  CD1   . LEU C 3 189 ? 10.243  39.332 18.985  1.00 8.28   ? 485  LEU A CD1   1 
ATOM   2005 C  CD2   . LEU C 3 189 ? 11.198  41.600 19.328  1.00 7.98   ? 485  LEU A CD2   1 
ATOM   2006 N  N     . ALA C 3 190 ? 11.936  41.262 13.972  1.00 10.89  ? 486  ALA A N     1 
ATOM   2007 C  CA    . ALA C 3 190 ? 12.770  41.073 12.788  1.00 11.88  ? 486  ALA A CA    1 
ATOM   2008 C  C     . ALA C 3 190 ? 13.325  42.418 12.313  1.00 11.56  ? 486  ALA A C     1 
ATOM   2009 O  O     . ALA C 3 190 ? 14.496  42.518 11.951  1.00 10.13  ? 486  ALA A O     1 
ATOM   2010 C  CB    . ALA C 3 190 ? 11.955  40.419 11.670  1.00 11.25  ? 486  ALA A CB    1 
ATOM   2011 N  N     . GLU C 3 191 ? 12.480  43.445 12.314  1.00 11.47  ? 487  GLU A N     1 
ATOM   2012 C  CA    . GLU C 3 191 ? 12.908  44.781 11.906  1.00 12.70  ? 487  GLU A CA    1 
ATOM   2013 C  C     . GLU C 3 191 ? 13.951  45.313 12.894  1.00 12.95  ? 487  GLU A C     1 
ATOM   2014 O  O     . GLU C 3 191 ? 14.965  45.883 12.486  1.00 12.40  ? 487  GLU A O     1 
ATOM   2015 C  CB    . GLU C 3 191 ? 11.719  45.752 11.871  1.00 13.84  ? 487  GLU A CB    1 
ATOM   2016 C  CG    . GLU C 3 191 ? 10.585  45.346 10.940  1.00 18.49  ? 487  GLU A CG    1 
ATOM   2017 C  CD    . GLU C 3 191 ? 9.463   46.384 10.883  1.00 22.04  ? 487  GLU A CD    1 
ATOM   2018 O  OE1   . GLU C 3 191 ? 9.194   47.051 11.910  1.00 23.78  ? 487  GLU A OE1   1 
ATOM   2019 O  OE2   . GLU C 3 191 ? 8.842   46.528 9.810   1.00 22.08  ? 487  GLU A OE2   1 
ATOM   2020 N  N     . MET C 3 192 ? 13.689  45.122 14.189  1.00 11.11  ? 488  MET A N     1 
ATOM   2021 C  CA    . MET C 3 192 ? 14.585  45.589 15.244  1.00 11.72  ? 488  MET A CA    1 
ATOM   2022 C  C     . MET C 3 192 ? 15.965  44.947 15.145  1.00 11.76  ? 488  MET A C     1 
ATOM   2023 O  O     . MET C 3 192 ? 16.985  45.628 15.246  1.00 12.58  ? 488  MET A O     1 
ATOM   2024 C  CB    . MET C 3 192 ? 13.984  45.293 16.630  1.00 11.79  ? 488  MET A CB    1 
ATOM   2025 C  CG    . MET C 3 192 ? 12.795  46.175 17.012  1.00 10.57  ? 488  MET A CG    1 
ATOM   2026 S  SD    . MET C 3 192 ? 11.804  45.499 18.376  1.00 12.10  ? 488  MET A SD    1 
ATOM   2027 C  CE    . MET C 3 192 ? 12.948  45.745 19.783  1.00 5.37   ? 488  MET A CE    1 
ATOM   2028 N  N     . GLU C 3 193 ? 15.981  43.633 14.956  1.00 12.06  ? 489  GLU A N     1 
ATOM   2029 C  CA    . GLU C 3 193 ? 17.223  42.884 14.846  1.00 13.24  ? 489  GLU A CA    1 
ATOM   2030 C  C     . GLU C 3 193 ? 17.995  43.324 13.602  1.00 14.13  ? 489  GLU A C     1 
ATOM   2031 O  O     . GLU C 3 193 ? 19.191  43.609 13.667  1.00 13.61  ? 489  GLU A O     1 
ATOM   2032 C  CB    . GLU C 3 193 ? 16.919  41.388 14.768  1.00 14.12  ? 489  GLU A CB    1 
ATOM   2033 C  CG    . GLU C 3 193 ? 16.219  40.829 16.005  1.00 13.39  ? 489  GLU A CG    1 
ATOM   2034 C  CD    . GLU C 3 193 ? 15.884  39.356 15.863  1.00 14.59  ? 489  GLU A CD    1 
ATOM   2035 O  OE1   . GLU C 3 193 ? 15.363  38.772 16.834  1.00 13.61  ? 489  GLU A OE1   1 
ATOM   2036 O  OE2   . GLU C 3 193 ? 16.145  38.784 14.779  1.00 13.11  ? 489  GLU A OE2   1 
ATOM   2037 N  N     . PHE C 3 194 ? 17.302  43.381 12.472  1.00 13.09  ? 490  PHE A N     1 
ATOM   2038 C  CA    . PHE C 3 194 ? 17.925  43.794 11.219  1.00 15.24  ? 490  PHE A CA    1 
ATOM   2039 C  C     . PHE C 3 194 ? 18.497  45.212 11.303  1.00 15.30  ? 490  PHE A C     1 
ATOM   2040 O  O     . PHE C 3 194 ? 19.548  45.489 10.737  1.00 15.33  ? 490  PHE A O     1 
ATOM   2041 C  CB    . PHE C 3 194 ? 16.913  43.715 10.073  1.00 13.00  ? 490  PHE A CB    1 
ATOM   2042 C  CG    . PHE C 3 194 ? 17.471  44.135 8.739   1.00 14.73  ? 490  PHE A CG    1 
ATOM   2043 C  CD1   . PHE C 3 194 ? 18.542  43.451 8.172   1.00 14.33  ? 490  PHE A CD1   1 
ATOM   2044 C  CD2   . PHE C 3 194 ? 16.928  45.219 8.053   1.00 13.97  ? 490  PHE A CD2   1 
ATOM   2045 C  CE1   . PHE C 3 194 ? 19.069  43.837 6.938   1.00 13.22  ? 490  PHE A CE1   1 
ATOM   2046 C  CE2   . PHE C 3 194 ? 17.447  45.616 6.815   1.00 15.36  ? 490  PHE A CE2   1 
ATOM   2047 C  CZ    . PHE C 3 194 ? 18.522  44.923 6.257   1.00 15.30  ? 490  PHE A CZ    1 
ATOM   2048 N  N     . ALA C 3 195 ? 17.806  46.104 12.008  1.00 16.38  ? 491  ALA A N     1 
ATOM   2049 C  CA    . ALA C 3 195 ? 18.265  47.484 12.151  1.00 15.35  ? 491  ALA A CA    1 
ATOM   2050 C  C     . ALA C 3 195 ? 19.557  47.533 12.957  1.00 15.90  ? 491  ALA A C     1 
ATOM   2051 O  O     . ALA C 3 195 ? 20.512  48.213 12.573  1.00 14.90  ? 491  ALA A O     1 
ATOM   2052 C  CB    . ALA C 3 195 ? 17.194  48.332 12.835  1.00 15.77  ? 491  ALA A CB    1 
ATOM   2053 N  N     . GLY C 3 196 ? 19.579  46.809 14.074  1.00 12.94  ? 492  GLY A N     1 
ATOM   2054 C  CA    . GLY C 3 196 ? 20.760  46.782 14.914  1.00 13.55  ? 492  GLY A CA    1 
ATOM   2055 C  C     . GLY C 3 196 ? 20.979  48.046 15.728  1.00 13.43  ? 492  GLY A C     1 
ATOM   2056 O  O     . GLY C 3 196 ? 20.236  49.028 15.601  1.00 13.24  ? 492  GLY A O     1 
ATOM   2057 N  N     . VAL C 3 197 ? 22.009  48.013 16.570  1.00 14.85  ? 493  VAL A N     1 
ATOM   2058 C  CA    . VAL C 3 197 ? 22.374  49.140 17.427  1.00 14.88  ? 493  VAL A CA    1 
ATOM   2059 C  C     . VAL C 3 197 ? 23.826  49.541 17.148  1.00 16.85  ? 493  VAL A C     1 
ATOM   2060 O  O     . VAL C 3 197 ? 24.732  48.698 17.159  1.00 16.24  ? 493  VAL A O     1 
ATOM   2061 C  CB    . VAL C 3 197 ? 22.257  48.779 18.926  1.00 13.53  ? 493  VAL A CB    1 
ATOM   2062 C  CG1   . VAL C 3 197 ? 22.557  50.008 19.780  1.00 14.15  ? 493  VAL A CG1   1 
ATOM   2063 C  CG2   . VAL C 3 197 ? 20.871  48.245 19.228  1.00 13.99  ? 493  VAL A CG2   1 
ATOM   2064 N  N     . LYS C 3 198 ? 24.037  50.831 16.908  1.00 16.22  ? 494  LYS A N     1 
ATOM   2065 C  CA    . LYS C 3 198 ? 25.364  51.361 16.612  1.00 16.79  ? 494  LYS A CA    1 
ATOM   2066 C  C     . LYS C 3 198 ? 26.238  51.379 17.867  1.00 16.64  ? 494  LYS A C     1 
ATOM   2067 O  O     . LYS C 3 198 ? 25.788  51.772 18.945  1.00 17.40  ? 494  LYS A O     1 
ATOM   2068 C  CB    . LYS C 3 198 ? 25.231  52.780 16.056  1.00 17.74  ? 494  LYS A CB    1 
ATOM   2069 C  CG    . LYS C 3 198 ? 26.504  53.362 15.447  1.00 21.25  ? 494  LYS A CG    1 
ATOM   2070 C  CD    . LYS C 3 198 ? 26.869  52.653 14.157  1.00 25.80  ? 494  LYS A CD    1 
ATOM   2071 C  CE    . LYS C 3 198 ? 27.822  53.490 13.324  1.00 28.82  ? 494  LYS A CE    1 
ATOM   2072 N  NZ    . LYS C 3 198 ? 27.163  54.735 12.825  1.00 35.88  ? 494  LYS A NZ    1 
ATOM   2073 N  N     . VAL C 3 199 ? 27.489  50.962 17.721  1.00 16.50  ? 495  VAL A N     1 
ATOM   2074 C  CA    . VAL C 3 199 ? 28.422  50.929 18.842  1.00 16.78  ? 495  VAL A CA    1 
ATOM   2075 C  C     . VAL C 3 199 ? 29.636  51.826 18.592  1.00 17.29  ? 495  VAL A C     1 
ATOM   2076 O  O     . VAL C 3 199 ? 30.201  51.835 17.498  1.00 15.27  ? 495  VAL A O     1 
ATOM   2077 C  CB    . VAL C 3 199 ? 28.930  49.494 19.094  1.00 17.93  ? 495  VAL A CB    1 
ATOM   2078 C  CG1   . VAL C 3 199 ? 29.871  49.472 20.301  1.00 17.76  ? 495  VAL A CG1   1 
ATOM   2079 C  CG2   . VAL C 3 199 ? 27.752  48.553 19.314  1.00 19.85  ? 495  VAL A CG2   1 
ATOM   2080 N  N     . ASP C 3 200 ? 30.026  52.576 19.617  1.00 18.83  ? 496  ASP A N     1 
ATOM   2081 C  CA    . ASP C 3 200 ? 31.188  53.461 19.545  1.00 20.20  ? 496  ASP A CA    1 
ATOM   2082 C  C     . ASP C 3 200 ? 32.373  52.595 19.967  1.00 19.97  ? 496  ASP A C     1 
ATOM   2083 O  O     . ASP C 3 200 ? 32.751  52.588 21.135  1.00 19.30  ? 496  ASP A O     1 
ATOM   2084 C  CB    . ASP C 3 200 ? 31.024  54.625 20.525  1.00 21.06  ? 496  ASP A CB    1 
ATOM   2085 C  CG    . ASP C 3 200 ? 32.138  55.658 20.409  1.00 21.89  ? 496  ASP A CG    1 
ATOM   2086 O  OD1   . ASP C 3 200 ? 33.257  55.296 19.993  1.00 23.72  ? 496  ASP A OD1   1 
ATOM   2087 O  OD2   . ASP C 3 200 ? 31.891  56.833 20.744  1.00 23.27  ? 496  ASP A OD2   1 
ATOM   2088 N  N     . THR C 3 201 ? 32.948  51.860 19.019  1.00 21.37  ? 497  THR A N     1 
ATOM   2089 C  CA    . THR C 3 201 ? 34.065  50.971 19.326  1.00 23.33  ? 497  THR A CA    1 
ATOM   2090 C  C     . THR C 3 201 ? 35.290  51.690 19.877  1.00 25.00  ? 497  THR A C     1 
ATOM   2091 O  O     . THR C 3 201 ? 36.010  51.138 20.711  1.00 24.85  ? 497  THR A O     1 
ATOM   2092 C  CB    . THR C 3 201 ? 34.481  50.134 18.092  1.00 22.50  ? 497  THR A CB    1 
ATOM   2093 O  OG1   . THR C 3 201 ? 34.726  51.002 16.979  1.00 24.57  ? 497  THR A OG1   1 
ATOM   2094 C  CG2   . THR C 3 201 ? 33.389  49.143 17.730  1.00 21.42  ? 497  THR A CG2   1 
ATOM   2095 N  N     . LYS C 3 202 ? 35.535  52.915 19.418  1.00 26.86  ? 498  LYS A N     1 
ATOM   2096 C  CA    . LYS C 3 202 ? 36.681  53.671 19.914  1.00 28.95  ? 498  LYS A CA    1 
ATOM   2097 C  C     . LYS C 3 202 ? 36.504  53.893 21.413  1.00 29.32  ? 498  LYS A C     1 
ATOM   2098 O  O     . LYS C 3 202 ? 37.447  53.738 22.191  1.00 27.09  ? 498  LYS A O     1 
ATOM   2099 C  CB    . LYS C 3 202 ? 36.790  55.021 19.203  1.00 31.95  ? 498  LYS A CB    1 
ATOM   2100 C  CG    . LYS C 3 202 ? 37.137  54.927 17.723  1.00 35.39  ? 498  LYS A CG    1 
ATOM   2101 C  CD    . LYS C 3 202 ? 38.500  54.299 17.514  1.00 39.92  ? 498  LYS A CD    1 
ATOM   2102 C  CE    . LYS C 3 202 ? 38.855  54.215 16.035  1.00 41.75  ? 498  LYS A CE    1 
ATOM   2103 N  NZ    . LYS C 3 202 ? 40.215  53.634 15.842  1.00 43.74  ? 498  LYS A NZ    1 
ATOM   2104 N  N     . ARG C 3 203 ? 35.285  54.250 21.810  1.00 29.92  ? 499  ARG A N     1 
ATOM   2105 C  CA    . ARG C 3 203 ? 34.975  54.479 23.216  1.00 30.48  ? 499  ARG A CA    1 
ATOM   2106 C  C     . ARG C 3 203 ? 35.234  53.208 24.014  1.00 29.36  ? 499  ARG A C     1 
ATOM   2107 O  O     . ARG C 3 203 ? 35.928  53.236 25.030  1.00 29.54  ? 499  ARG A O     1 
ATOM   2108 C  CB    . ARG C 3 203 ? 33.511  54.893 23.382  1.00 33.11  ? 499  ARG A CB    1 
ATOM   2109 C  CG    . ARG C 3 203 ? 33.026  54.857 24.828  1.00 37.32  ? 499  ARG A CG    1 
ATOM   2110 C  CD    . ARG C 3 203 ? 33.356  56.125 25.600  1.00 40.17  ? 499  ARG A CD    1 
ATOM   2111 N  NE    . ARG C 3 203 ? 32.327  57.143 25.406  1.00 43.66  ? 499  ARG A NE    1 
ATOM   2112 C  CZ    . ARG C 3 203 ? 32.230  58.261 26.120  1.00 45.36  ? 499  ARG A CZ    1 
ATOM   2113 N  NH1   . ARG C 3 203 ? 33.105  58.513 27.085  1.00 47.15  ? 499  ARG A NH1   1 
ATOM   2114 N  NH2   . ARG C 3 203 ? 31.254  59.127 25.872  1.00 44.90  ? 499  ARG A NH2   1 
ATOM   2115 N  N     . LEU C 3 204 ? 34.677  52.093 23.550  1.00 28.65  ? 500  LEU A N     1 
ATOM   2116 C  CA    . LEU C 3 204 ? 34.861  50.813 24.231  1.00 29.65  ? 500  LEU A CA    1 
ATOM   2117 C  C     . LEU C 3 204 ? 36.329  50.413 24.357  1.00 29.93  ? 500  LEU A C     1 
ATOM   2118 O  O     . LEU C 3 204 ? 36.759  49.916 25.397  1.00 30.00  ? 500  LEU A O     1 
ATOM   2119 C  CB    . LEU C 3 204 ? 34.109  49.697 23.498  1.00 28.65  ? 500  LEU A CB    1 
ATOM   2120 C  CG    . LEU C 3 204 ? 32.604  49.556 23.730  1.00 29.13  ? 500  LEU A CG    1 
ATOM   2121 C  CD1   . LEU C 3 204 ? 32.092  48.347 22.962  1.00 28.22  ? 500  LEU A CD1   1 
ATOM   2122 C  CD2   . LEU C 3 204 ? 32.320  49.395 25.222  1.00 27.05  ? 500  LEU A CD2   1 
ATOM   2123 N  N     . GLU C 3 205 ? 37.099  50.625 23.298  1.00 30.58  ? 501  GLU A N     1 
ATOM   2124 C  CA    . GLU C 3 205 ? 38.510  50.262 23.327  1.00 32.36  ? 501  GLU A CA    1 
ATOM   2125 C  C     . GLU C 3 205 ? 39.286  51.084 24.344  1.00 32.18  ? 501  GLU A C     1 
ATOM   2126 O  O     . GLU C 3 205 ? 40.205  50.578 24.987  1.00 32.35  ? 501  GLU A O     1 
ATOM   2127 C  CB    . GLU C 3 205 ? 39.126  50.420 21.938  1.00 32.70  ? 501  GLU A CB    1 
ATOM   2128 C  CG    . GLU C 3 205 ? 38.464  49.537 20.897  1.00 36.77  ? 501  GLU A CG    1 
ATOM   2129 C  CD    . GLU C 3 205 ? 39.032  49.736 19.511  1.00 39.01  ? 501  GLU A CD    1 
ATOM   2130 O  OE1   . GLU C 3 205 ? 39.175  50.904 19.087  1.00 39.60  ? 501  GLU A OE1   1 
ATOM   2131 O  OE2   . GLU C 3 205 ? 39.330  48.721 18.846  1.00 40.94  ? 501  GLU A OE2   1 
ATOM   2132 N  N     . GLN C 3 206 ? 38.913  52.350 24.494  1.00 32.83  ? 502  GLN A N     1 
ATOM   2133 C  CA    . GLN C 3 206 ? 39.587  53.221 25.444  1.00 34.33  ? 502  GLN A CA    1 
ATOM   2134 C  C     . GLN C 3 206 ? 39.230  52.813 26.874  1.00 34.66  ? 502  GLN A C     1 
ATOM   2135 O  O     . GLN C 3 206 ? 40.077  52.864 27.770  1.00 34.56  ? 502  GLN A O     1 
ATOM   2136 C  CB    . GLN C 3 206 ? 39.211  54.679 25.177  1.00 36.61  ? 502  GLN A CB    1 
ATOM   2137 C  CG    . GLN C 3 206 ? 39.505  55.105 23.739  1.00 41.80  ? 502  GLN A CG    1 
ATOM   2138 C  CD    . GLN C 3 206 ? 39.270  56.584 23.485  1.00 44.54  ? 502  GLN A CD    1 
ATOM   2139 O  OE1   . GLN C 3 206 ? 38.203  57.123 23.796  1.00 47.76  ? 502  GLN A OE1   1 
ATOM   2140 N  NE2   . GLN C 3 206 ? 40.271  57.250 22.910  1.00 45.17  ? 502  GLN A NE2   1 
ATOM   2141 N  N     . MET C 3 207 ? 37.982  52.399 27.086  1.00 33.27  ? 503  MET A N     1 
ATOM   2142 C  CA    . MET C 3 207 ? 37.551  51.956 28.409  1.00 33.86  ? 503  MET A CA    1 
ATOM   2143 C  C     . MET C 3 207 ? 38.321  50.687 28.751  1.00 33.03  ? 503  MET A C     1 
ATOM   2144 O  O     . MET C 3 207 ? 38.759  50.500 29.880  1.00 32.98  ? 503  MET A O     1 
ATOM   2145 C  CB    . MET C 3 207 ? 36.047  51.656 28.429  1.00 34.01  ? 503  MET A CB    1 
ATOM   2146 C  CG    . MET C 3 207 ? 35.155  52.880 28.373  1.00 35.83  ? 503  MET A CG    1 
ATOM   2147 S  SD    . MET C 3 207 ? 33.400  52.448 28.368  1.00 39.44  ? 503  MET A SD    1 
ATOM   2148 C  CE    . MET C 3 207 ? 33.125  52.135 30.110  1.00 40.37  ? 503  MET A CE    1 
ATOM   2149 N  N     . GLY C 3 208 ? 38.484  49.820 27.758  1.00 33.27  ? 504  GLY A N     1 
ATOM   2150 C  CA    . GLY C 3 208 ? 39.204  48.579 27.967  1.00 34.81  ? 504  GLY A CA    1 
ATOM   2151 C  C     . GLY C 3 208 ? 40.634  48.807 28.419  1.00 36.23  ? 504  GLY A C     1 
ATOM   2152 O  O     . GLY C 3 208 ? 41.151  48.065 29.258  1.00 35.25  ? 504  GLY A O     1 
ATOM   2153 N  N     . LYS C 3 209 ? 41.277  49.833 27.866  1.00 36.74  ? 505  LYS A N     1 
ATOM   2154 C  CA    . LYS C 3 209 ? 42.657  50.150 28.222  1.00 38.21  ? 505  LYS A CA    1 
ATOM   2155 C  C     . LYS C 3 209 ? 42.743  50.566 29.682  1.00 37.43  ? 505  LYS A C     1 
ATOM   2156 O  O     . LYS C 3 209 ? 43.659  50.163 30.396  1.00 37.39  ? 505  LYS A O     1 
ATOM   2157 C  CB    . LYS C 3 209 ? 43.192  51.282 27.342  1.00 39.51  ? 505  LYS A CB    1 
ATOM   2158 C  CG    . LYS C 3 209 ? 43.248  50.955 25.860  1.00 42.04  ? 505  LYS A CG    1 
ATOM   2159 C  CD    . LYS C 3 209 ? 43.560  52.205 25.044  1.00 45.36  ? 505  LYS A CD    1 
ATOM   2160 C  CE    . LYS C 3 209 ? 43.420  51.950 23.553  1.00 46.55  ? 505  LYS A CE    1 
ATOM   2161 N  NZ    . LYS C 3 209 ? 43.551  53.210 22.767  1.00 47.69  ? 505  LYS A NZ    1 
ATOM   2162 N  N     . GLU C 3 210 ? 41.783  51.376 30.119  1.00 37.30  ? 506  GLU A N     1 
ATOM   2163 C  CA    . GLU C 3 210 ? 41.749  51.848 31.497  1.00 38.07  ? 506  GLU A CA    1 
ATOM   2164 C  C     . GLU C 3 210 ? 41.462  50.704 32.464  1.00 37.70  ? 506  GLU A C     1 
ATOM   2165 O  O     . GLU C 3 210 ? 42.022  50.657 33.560  1.00 37.13  ? 506  GLU A O     1 
ATOM   2166 C  CB    . GLU C 3 210 ? 40.687  52.936 31.659  1.00 40.43  ? 506  GLU A CB    1 
ATOM   2167 C  CG    . GLU C 3 210 ? 40.882  54.125 30.739  1.00 44.20  ? 506  GLU A CG    1 
ATOM   2168 C  CD    . GLU C 3 210 ? 39.830  55.194 30.940  1.00 46.81  ? 506  GLU A CD    1 
ATOM   2169 O  OE1   . GLU C 3 210 ? 38.625  54.860 30.894  1.00 50.27  ? 506  GLU A OE1   1 
ATOM   2170 O  OE2   . GLU C 3 210 ? 40.206  56.369 31.142  1.00 49.35  ? 506  GLU A OE2   1 
ATOM   2171 N  N     . LEU C 3 211 ? 40.586  49.786 32.065  1.00 36.92  ? 507  LEU A N     1 
ATOM   2172 C  CA    . LEU C 3 211 ? 40.258  48.644 32.914  1.00 36.48  ? 507  LEU A CA    1 
ATOM   2173 C  C     . LEU C 3 211 ? 41.489  47.765 33.064  1.00 35.77  ? 507  LEU A C     1 
ATOM   2174 O  O     . LEU C 3 211 ? 41.716  47.172 34.117  1.00 34.71  ? 507  LEU A O     1 
ATOM   2175 C  CB    . LEU C 3 211 ? 39.112  47.827 32.311  1.00 36.50  ? 507  LEU A CB    1 
ATOM   2176 C  CG    . LEU C 3 211 ? 37.707  48.386 32.535  1.00 39.47  ? 507  LEU A CG    1 
ATOM   2177 C  CD1   . LEU C 3 211 ? 36.680  47.538 31.793  1.00 38.42  ? 507  LEU A CD1   1 
ATOM   2178 C  CD2   . LEU C 3 211 ? 37.408  48.398 34.026  1.00 39.70  ? 507  LEU A CD2   1 
ATOM   2179 N  N     . ALA C 3 212 ? 42.281  47.689 31.998  1.00 35.17  ? 508  ALA A N     1 
ATOM   2180 C  CA    . ALA C 3 212 ? 43.499  46.892 32.003  1.00 37.15  ? 508  ALA A CA    1 
ATOM   2181 C  C     . ALA C 3 212 ? 44.486  47.470 33.009  1.00 37.90  ? 508  ALA A C     1 
ATOM   2182 O  O     . ALA C 3 212 ? 45.224  46.736 33.659  1.00 37.53  ? 508  ALA A O     1 
ATOM   2183 C  CB    . ALA C 3 212 ? 44.118  46.871 30.610  1.00 35.57  ? 508  ALA A CB    1 
ATOM   2184 N  N     . GLU C 3 213 ? 44.494  48.791 33.136  1.00 40.10  ? 509  GLU A N     1 
ATOM   2185 C  CA    . GLU C 3 213 ? 45.392  49.451 34.075  1.00 42.33  ? 509  GLU A CA    1 
ATOM   2186 C  C     . GLU C 3 213 ? 44.927  49.160 35.496  1.00 42.17  ? 509  GLU A C     1 
ATOM   2187 O  O     . GLU C 3 213 ? 45.716  48.741 36.345  1.00 41.69  ? 509  GLU A O     1 
ATOM   2188 C  CB    . GLU C 3 213 ? 45.406  50.963 33.823  1.00 44.63  ? 509  GLU A CB    1 
ATOM   2189 C  CG    . GLU C 3 213 ? 45.874  51.344 32.419  1.00 50.09  ? 509  GLU A CG    1 
ATOM   2190 C  CD    . GLU C 3 213 ? 45.788  52.840 32.136  1.00 53.59  ? 509  GLU A CD    1 
ATOM   2191 O  OE1   . GLU C 3 213 ? 46.193  53.256 31.026  1.00 54.39  ? 509  GLU A OE1   1 
ATOM   2192 O  OE2   . GLU C 3 213 ? 45.317  53.598 33.014  1.00 55.60  ? 509  GLU A OE2   1 
ATOM   2193 N  N     . GLN C 3 214 ? 43.638  49.369 35.741  1.00 41.32  ? 510  GLN A N     1 
ATOM   2194 C  CA    . GLN C 3 214 ? 43.059  49.133 37.056  1.00 41.28  ? 510  GLN A CA    1 
ATOM   2195 C  C     . GLN C 3 214 ? 43.176  47.676 37.495  1.00 40.31  ? 510  GLN A C     1 
ATOM   2196 O  O     . GLN C 3 214 ? 43.560  47.395 38.633  1.00 40.29  ? 510  GLN A O     1 
ATOM   2197 C  CB    . GLN C 3 214 ? 41.593  49.564 37.065  1.00 42.66  ? 510  GLN A CB    1 
ATOM   2198 C  CG    . GLN C 3 214 ? 41.400  51.060 36.891  1.00 44.65  ? 510  GLN A CG    1 
ATOM   2199 C  CD    . GLN C 3 214 ? 39.940  51.458 36.854  1.00 46.26  ? 510  GLN A CD    1 
ATOM   2200 O  OE1   . GLN C 3 214 ? 39.186  51.185 37.789  1.00 47.15  ? 510  GLN A OE1   1 
ATOM   2201 N  NE2   . GLN C 3 214 ? 39.531  52.108 35.769  1.00 47.47  ? 510  GLN A NE2   1 
ATOM   2202 N  N     . LEU C 3 215 ? 42.848  46.751 36.599  1.00 39.10  ? 511  LEU A N     1 
ATOM   2203 C  CA    . LEU C 3 215 ? 42.938  45.330 36.922  1.00 37.90  ? 511  LEU A CA    1 
ATOM   2204 C  C     . LEU C 3 215 ? 44.357  44.939 37.302  1.00 37.49  ? 511  LEU A C     1 
ATOM   2205 O  O     . LEU C 3 215 ? 44.563  44.141 38.214  1.00 36.12  ? 511  LEU A O     1 
ATOM   2206 C  CB    . LEU C 3 215 ? 42.479  44.473 35.741  1.00 36.95  ? 511  LEU A CB    1 
ATOM   2207 C  CG    . LEU C 3 215 ? 40.981  44.188 35.611  1.00 37.15  ? 511  LEU A CG    1 
ATOM   2208 C  CD1   . LEU C 3 215 ? 40.709  43.464 34.297  1.00 35.84  ? 511  LEU A CD1   1 
ATOM   2209 C  CD2   . LEU C 3 215 ? 40.517  43.344 36.794  1.00 36.39  ? 511  LEU A CD2   1 
ATOM   2210 N  N     . GLY C 3 216 ? 45.333  45.505 36.597  1.00 37.94  ? 512  GLY A N     1 
ATOM   2211 C  CA    . GLY C 3 216 ? 46.724  45.199 36.877  1.00 38.15  ? 512  GLY A CA    1 
ATOM   2212 C  C     . GLY C 3 216 ? 47.154  45.647 38.260  1.00 38.50  ? 512  GLY A C     1 
ATOM   2213 O  O     . GLY C 3 216 ? 47.958  44.985 38.916  1.00 38.81  ? 512  GLY A O     1 
ATOM   2214 N  N     . THR C 3 217 ? 46.617  46.777 38.705  1.00 38.11  ? 513  THR A N     1 
ATOM   2215 C  CA    . THR C 3 217 ? 46.947  47.317 40.018  1.00 38.70  ? 513  THR A CA    1 
ATOM   2216 C  C     . THR C 3 217 ? 46.309  46.487 41.128  1.00 38.50  ? 513  THR A C     1 
ATOM   2217 O  O     . THR C 3 217 ? 46.958  46.172 42.127  1.00 38.16  ? 513  THR A O     1 
ATOM   2218 C  CB    . THR C 3 217 ? 46.480  48.787 40.147  1.00 38.25  ? 513  THR A CB    1 
ATOM   2219 O  OG1   . THR C 3 217 ? 47.219  49.604 39.227  1.00 38.81  ? 513  THR A OG1   1 
ATOM   2220 C  CG2   . THR C 3 217 ? 46.704  49.299 41.564  1.00 38.36  ? 513  THR A CG2   1 
ATOM   2221 N  N     . VAL C 3 218 ? 45.038  46.135 40.951  1.00 37.84  ? 514  VAL A N     1 
ATOM   2222 C  CA    . VAL C 3 218 ? 44.331  45.333 41.941  1.00 38.55  ? 514  VAL A CA    1 
ATOM   2223 C  C     . VAL C 3 218 ? 44.890  43.908 41.961  1.00 38.81  ? 514  VAL A C     1 
ATOM   2224 O  O     . VAL C 3 218 ? 44.976  43.274 43.016  1.00 38.90  ? 514  VAL A O     1 
ATOM   2225 C  CB    . VAL C 3 218 ? 42.816  45.271 41.640  1.00 37.83  ? 514  VAL A CB    1 
ATOM   2226 C  CG1   . VAL C 3 218 ? 42.116  44.417 42.685  1.00 38.70  ? 514  VAL A CG1   1 
ATOM   2227 C  CG2   . VAL C 3 218 ? 42.227  46.673 41.630  1.00 37.76  ? 514  VAL A CG2   1 
ATOM   2228 N  N     . GLU C 3 219 ? 45.274  43.410 40.791  1.00 38.00  ? 515  GLU A N     1 
ATOM   2229 C  CA    . GLU C 3 219 ? 45.818  42.066 40.691  1.00 38.13  ? 515  GLU A CA    1 
ATOM   2230 C  C     . GLU C 3 219 ? 47.063  41.936 41.558  1.00 38.85  ? 515  GLU A C     1 
ATOM   2231 O  O     . GLU C 3 219 ? 47.192  40.992 42.336  1.00 38.35  ? 515  GLU A O     1 
ATOM   2232 C  CB    . GLU C 3 219 ? 46.174  41.739 39.240  1.00 37.74  ? 515  GLU A CB    1 
ATOM   2233 C  CG    . GLU C 3 219 ? 46.667  40.319 39.044  1.00 36.52  ? 515  GLU A CG    1 
ATOM   2234 C  CD    . GLU C 3 219 ? 47.178  40.050 37.635  1.00 38.06  ? 515  GLU A CD    1 
ATOM   2235 O  OE1   . GLU C 3 219 ? 47.484  38.876 37.332  1.00 37.53  ? 515  GLU A OE1   1 
ATOM   2236 O  OE2   . GLU C 3 219 ? 47.275  41.005 36.834  1.00 36.08  ? 515  GLU A OE2   1 
ATOM   2237 N  N     . GLN C 3 220 ? 47.979  42.890 41.419  1.00 39.57  ? 516  GLN A N     1 
ATOM   2238 C  CA    . GLN C 3 220 ? 49.218  42.875 42.185  1.00 40.01  ? 516  GLN A CA    1 
ATOM   2239 C  C     . GLN C 3 220 ? 48.956  43.032 43.674  1.00 39.53  ? 516  GLN A C     1 
ATOM   2240 O  O     . GLN C 3 220 ? 49.507  42.293 44.489  1.00 40.67  ? 516  GLN A O     1 
ATOM   2241 C  CB    . GLN C 3 220 ? 50.153  43.983 41.700  1.00 40.86  ? 516  GLN A CB    1 
ATOM   2242 C  CG    . GLN C 3 220 ? 50.677  43.759 40.293  1.00 43.58  ? 516  GLN A CG    1 
ATOM   2243 C  CD    . GLN C 3 220 ? 51.285  42.380 40.116  1.00 44.73  ? 516  GLN A CD    1 
ATOM   2244 O  OE1   . GLN C 3 220 ? 52.138  41.959 40.900  1.00 46.00  ? 516  GLN A OE1   1 
ATOM   2245 N  NE2   . GLN C 3 220 ? 50.849  41.668 39.082  1.00 44.82  ? 516  GLN A NE2   1 
ATOM   2246 N  N     . ARG C 3 221 ? 48.112  43.996 44.024  1.00 39.36  ? 517  ARG A N     1 
ATOM   2247 C  CA    . ARG C 3 221 ? 47.769  44.242 45.416  1.00 38.96  ? 517  ARG A CA    1 
ATOM   2248 C  C     . ARG C 3 221 ? 47.237  42.963 46.054  1.00 38.92  ? 517  ARG A C     1 
ATOM   2249 O  O     . ARG C 3 221 ? 47.459  42.711 47.238  1.00 40.43  ? 517  ARG A O     1 
ATOM   2250 C  CB    . ARG C 3 221 ? 46.717  45.352 45.507  1.00 39.48  ? 517  ARG A CB    1 
ATOM   2251 C  CG    . ARG C 3 221 ? 46.267  45.680 46.924  1.00 40.15  ? 517  ARG A CG    1 
ATOM   2252 C  CD    . ARG C 3 221 ? 47.462  45.914 47.837  1.00 40.47  ? 517  ARG A CD    1 
ATOM   2253 N  NE    . ARG C 3 221 ? 47.065  46.351 49.171  1.00 40.57  ? 517  ARG A NE    1 
ATOM   2254 C  CZ    . ARG C 3 221 ? 47.886  46.389 50.215  1.00 41.25  ? 517  ARG A CZ    1 
ATOM   2255 N  NH1   . ARG C 3 221 ? 49.150  46.010 50.079  1.00 40.68  ? 517  ARG A NH1   1 
ATOM   2256 N  NH2   . ARG C 3 221 ? 47.447  46.812 51.393  1.00 41.09  ? 517  ARG A NH2   1 
ATOM   2257 N  N     . ILE C 3 222 ? 46.539  42.154 45.261  1.00 37.37  ? 518  ILE A N     1 
ATOM   2258 C  CA    . ILE C 3 222 ? 45.984  40.899 45.751  1.00 35.65  ? 518  ILE A CA    1 
ATOM   2259 C  C     . ILE C 3 222 ? 47.081  39.881 46.055  1.00 35.34  ? 518  ILE A C     1 
ATOM   2260 O  O     . ILE C 3 222 ? 47.028  39.193 47.074  1.00 34.71  ? 518  ILE A O     1 
ATOM   2261 C  CB    . ILE C 3 222 ? 44.982  40.288 44.731  1.00 34.58  ? 518  ILE A CB    1 
ATOM   2262 C  CG1   . ILE C 3 222 ? 43.690  41.114 44.720  1.00 34.74  ? 518  ILE A CG1   1 
ATOM   2263 C  CG2   . ILE C 3 222 ? 44.686  38.838 45.087  1.00 33.36  ? 518  ILE A CG2   1 
ATOM   2264 C  CD1   . ILE C 3 222 ? 42.616  40.598 43.771  1.00 33.91  ? 518  ILE A CD1   1 
ATOM   2265 N  N     . TYR C 3 223 ? 48.072  39.783 45.174  1.00 35.43  ? 519  TYR A N     1 
ATOM   2266 C  CA    . TYR C 3 223 ? 49.166  38.840 45.385  1.00 36.54  ? 519  TYR A CA    1 
ATOM   2267 C  C     . TYR C 3 223 ? 49.989  39.309 46.577  1.00 37.64  ? 519  TYR A C     1 
ATOM   2268 O  O     . TYR C 3 223 ? 50.478  38.506 47.373  1.00 37.79  ? 519  TYR A O     1 
ATOM   2269 C  CB    . TYR C 3 223 ? 50.073  38.762 44.152  1.00 36.54  ? 519  TYR A CB    1 
ATOM   2270 C  CG    . TYR C 3 223 ? 49.392  38.320 42.872  1.00 36.84  ? 519  TYR A CG    1 
ATOM   2271 C  CD1   . TYR C 3 223 ? 48.447  37.292 42.873  1.00 36.90  ? 519  TYR A CD1   1 
ATOM   2272 C  CD2   . TYR C 3 223 ? 49.711  38.920 41.653  1.00 37.25  ? 519  TYR A CD2   1 
ATOM   2273 C  CE1   . TYR C 3 223 ? 47.836  36.871 41.687  1.00 37.21  ? 519  TYR A CE1   1 
ATOM   2274 C  CE2   . TYR C 3 223 ? 49.109  38.507 40.463  1.00 36.40  ? 519  TYR A CE2   1 
ATOM   2275 C  CZ    . TYR C 3 223 ? 48.174  37.484 40.485  1.00 36.83  ? 519  TYR A CZ    1 
ATOM   2276 O  OH    . TYR C 3 223 ? 47.583  37.081 39.308  1.00 35.63  ? 519  TYR A OH    1 
ATOM   2277 N  N     . GLU C 3 224 ? 50.133  40.623 46.683  1.00 38.15  ? 520  GLU A N     1 
ATOM   2278 C  CA    . GLU C 3 224 ? 50.887  41.245 47.760  1.00 39.27  ? 520  GLU A CA    1 
ATOM   2279 C  C     . GLU C 3 224 ? 50.283  40.868 49.114  1.00 38.51  ? 520  GLU A C     1 
ATOM   2280 O  O     . GLU C 3 224 ? 51.000  40.514 50.047  1.00 39.00  ? 520  GLU A O     1 
ATOM   2281 C  CB    . GLU C 3 224 ? 50.867  42.764 47.565  1.00 40.86  ? 520  GLU A CB    1 
ATOM   2282 C  CG    . GLU C 3 224 ? 51.757  43.558 48.498  1.00 43.12  ? 520  GLU A CG    1 
ATOM   2283 C  CD    . GLU C 3 224 ? 51.821  45.029 48.108  1.00 45.39  ? 520  GLU A CD    1 
ATOM   2284 O  OE1   . GLU C 3 224 ? 50.761  45.688 48.075  1.00 47.01  ? 520  GLU A OE1   1 
ATOM   2285 O  OE2   . GLU C 3 224 ? 52.932  45.528 47.832  1.00 47.54  ? 520  GLU A OE2   1 
ATOM   2286 N  N     . LEU C 3 225 ? 48.960  40.936 49.206  1.00 38.18  ? 521  LEU A N     1 
ATOM   2287 C  CA    . LEU C 3 225 ? 48.252  40.608 50.438  1.00 37.59  ? 521  LEU A CA    1 
ATOM   2288 C  C     . LEU C 3 225 ? 48.172  39.112 50.717  1.00 37.47  ? 521  LEU A C     1 
ATOM   2289 O  O     . LEU C 3 225 ? 48.020  38.698 51.866  1.00 36.32  ? 521  LEU A O     1 
ATOM   2290 C  CB    . LEU C 3 225 ? 46.842  41.197 50.399  1.00 35.99  ? 521  LEU A CB    1 
ATOM   2291 C  CG    . LEU C 3 225 ? 46.782  42.720 50.517  1.00 36.53  ? 521  LEU A CG    1 
ATOM   2292 C  CD1   . LEU C 3 225 ? 45.362  43.212 50.277  1.00 35.63  ? 521  LEU A CD1   1 
ATOM   2293 C  CD2   . LEU C 3 225 ? 47.268  43.132 51.898  1.00 35.13  ? 521  LEU A CD2   1 
ATOM   2294 N  N     . ALA C 3 226 ? 48.271  38.301 49.670  1.00 38.32  ? 522  ALA A N     1 
ATOM   2295 C  CA    . ALA C 3 226 ? 48.202  36.855 49.831  1.00 39.37  ? 522  ALA A CA    1 
ATOM   2296 C  C     . ALA C 3 226 ? 49.594  36.271 50.044  1.00 40.23  ? 522  ALA A C     1 
ATOM   2297 O  O     . ALA C 3 226 ? 49.738  35.119 50.456  1.00 39.73  ? 522  ALA A O     1 
ATOM   2298 C  CB    . ALA C 3 226 ? 47.546  36.221 48.606  1.00 38.85  ? 522  ALA A CB    1 
ATOM   2299 N  N     . GLY C 3 227 ? 50.614  37.072 49.757  1.00 41.01  ? 523  GLY A N     1 
ATOM   2300 C  CA    . GLY C 3 227 ? 51.981  36.617 49.924  1.00 41.66  ? 523  GLY A CA    1 
ATOM   2301 C  C     . GLY C 3 227 ? 52.465  35.720 48.802  1.00 41.78  ? 523  GLY A C     1 
ATOM   2302 O  O     . GLY C 3 227 ? 53.519  35.094 48.916  1.00 42.44  ? 523  GLY A O     1 
ATOM   2303 N  N     . GLN C 3 228 ? 51.698  35.654 47.717  1.00 41.92  ? 524  GLN A N     1 
ATOM   2304 C  CA    . GLN C 3 228 ? 52.062  34.826 46.569  1.00 41.46  ? 524  GLN A CA    1 
ATOM   2305 C  C     . GLN C 3 228 ? 51.142  35.091 45.379  1.00 42.11  ? 524  GLN A C     1 
ATOM   2306 O  O     . GLN C 3 228 ? 50.122  35.766 45.508  1.00 42.84  ? 524  GLN A O     1 
ATOM   2307 C  CB    . GLN C 3 228 ? 51.989  33.343 46.941  1.00 40.96  ? 524  GLN A CB    1 
ATOM   2308 C  CG    . GLN C 3 228 ? 50.598  32.865 47.305  1.00 40.13  ? 524  GLN A CG    1 
ATOM   2309 C  CD    . GLN C 3 228 ? 50.522  31.361 47.459  1.00 41.40  ? 524  GLN A CD    1 
ATOM   2310 O  OE1   . GLN C 3 228 ? 50.267  30.845 48.551  1.00 41.77  ? 524  GLN A OE1   1 
ATOM   2311 N  NE2   . GLN C 3 228 ? 50.753  30.646 46.368  1.00 40.40  ? 524  GLN A NE2   1 
ATOM   2312 N  N     . GLU C 3 229 ? 51.509  34.555 44.219  1.00 41.89  ? 525  GLU A N     1 
ATOM   2313 C  CA    . GLU C 3 229 ? 50.704  34.731 43.020  1.00 41.12  ? 525  GLU A CA    1 
ATOM   2314 C  C     . GLU C 3 229 ? 49.864  33.487 42.764  1.00 39.62  ? 525  GLU A C     1 
ATOM   2315 O  O     . GLU C 3 229 ? 50.304  32.370 43.030  1.00 39.62  ? 525  GLU A O     1 
ATOM   2316 C  CB    . GLU C 3 229 ? 51.600  35.010 41.813  1.00 43.11  ? 525  GLU A CB    1 
ATOM   2317 C  CG    . GLU C 3 229 ? 52.382  36.306 41.922  1.00 46.01  ? 525  GLU A CG    1 
ATOM   2318 C  CD    . GLU C 3 229 ? 53.065  36.684 40.622  1.00 48.16  ? 525  GLU A CD    1 
ATOM   2319 O  OE1   . GLU C 3 229 ? 53.723  37.749 40.583  1.00 47.69  ? 525  GLU A OE1   1 
ATOM   2320 O  OE2   . GLU C 3 229 ? 52.943  35.918 39.639  1.00 49.02  ? 525  GLU A OE2   1 
ATOM   2321 N  N     . PHE C 3 230 ? 48.653  33.688 42.251  1.00 37.46  ? 526  PHE A N     1 
ATOM   2322 C  CA    . PHE C 3 230 ? 47.746  32.583 41.954  1.00 34.52  ? 526  PHE A CA    1 
ATOM   2323 C  C     . PHE C 3 230 ? 46.668  33.043 40.975  1.00 34.04  ? 526  PHE A C     1 
ATOM   2324 O  O     . PHE C 3 230 ? 46.516  34.241 40.733  1.00 32.92  ? 526  PHE A O     1 
ATOM   2325 C  CB    . PHE C 3 230 ? 47.086  32.080 43.240  1.00 33.23  ? 526  PHE A CB    1 
ATOM   2326 C  CG    . PHE C 3 230 ? 46.240  33.109 43.925  1.00 32.13  ? 526  PHE A CG    1 
ATOM   2327 C  CD1   . PHE C 3 230 ? 46.827  34.181 44.590  1.00 33.20  ? 526  PHE A CD1   1 
ATOM   2328 C  CD2   . PHE C 3 230 ? 44.854  33.021 43.888  1.00 32.31  ? 526  PHE A CD2   1 
ATOM   2329 C  CE1   . PHE C 3 230 ? 46.043  35.154 45.208  1.00 31.25  ? 526  PHE A CE1   1 
ATOM   2330 C  CE2   . PHE C 3 230 ? 44.060  33.988 44.503  1.00 32.24  ? 526  PHE A CE2   1 
ATOM   2331 C  CZ    . PHE C 3 230 ? 44.655  35.055 45.163  1.00 31.30  ? 526  PHE A CZ    1 
ATOM   2332 N  N     . ASN C 3 231 ? 45.917  32.093 40.420  1.00 33.16  ? 527  ASN A N     1 
ATOM   2333 C  CA    . ASN C 3 231 ? 44.859  32.427 39.474  1.00 32.99  ? 527  ASN A CA    1 
ATOM   2334 C  C     . ASN C 3 231 ? 43.612  32.869 40.234  1.00 31.76  ? 527  ASN A C     1 
ATOM   2335 O  O     . ASN C 3 231 ? 42.811  32.044 40.669  1.00 30.89  ? 527  ASN A O     1 
ATOM   2336 C  CB    . ASN C 3 231 ? 44.516  31.223 38.592  1.00 32.49  ? 527  ASN A CB    1 
ATOM   2337 C  CG    . ASN C 3 231 ? 43.577  31.589 37.449  1.00 34.23  ? 527  ASN A CG    1 
ATOM   2338 O  OD1   . ASN C 3 231 ? 42.587  32.291 37.648  1.00 32.57  ? 527  ASN A OD1   1 
ATOM   2339 N  ND2   . ASN C 3 231 ? 43.886  31.110 36.247  1.00 34.13  ? 527  ASN A ND2   1 
ATOM   2340 N  N     . ILE C 3 232 ? 43.452  34.177 40.385  1.00 31.98  ? 528  ILE A N     1 
ATOM   2341 C  CA    . ILE C 3 232 ? 42.315  34.725 41.108  1.00 31.87  ? 528  ILE A CA    1 
ATOM   2342 C  C     . ILE C 3 232 ? 40.979  34.245 40.547  1.00 32.91  ? 528  ILE A C     1 
ATOM   2343 O  O     . ILE C 3 232 ? 40.016  34.066 41.296  1.00 32.67  ? 528  ILE A O     1 
ATOM   2344 C  CB    . ILE C 3 232 ? 42.346  36.262 41.083  1.00 32.46  ? 528  ILE A CB    1 
ATOM   2345 C  CG1   . ILE C 3 232 ? 43.716  36.756 41.549  1.00 30.85  ? 528  ILE A CG1   1 
ATOM   2346 C  CG2   . ILE C 3 232 ? 41.262  36.818 41.991  1.00 32.23  ? 528  ILE A CG2   1 
ATOM   2347 C  CD1   . ILE C 3 232 ? 43.959  38.224 41.277  1.00 30.70  ? 528  ILE A CD1   1 
ATOM   2348 N  N     . ASN C 3 233 ? 40.924  34.029 39.233  1.00 32.82  ? 529  ASN A N     1 
ATOM   2349 C  CA    . ASN C 3 233 ? 39.694  33.578 38.584  1.00 33.44  ? 529  ASN A CA    1 
ATOM   2350 C  C     . ASN C 3 233 ? 39.397  32.103 38.783  1.00 33.98  ? 529  ASN A C     1 
ATOM   2351 O  O     . ASN C 3 233 ? 38.492  31.554 38.156  1.00 33.89  ? 529  ASN A O     1 
ATOM   2352 C  CB    . ASN C 3 233 ? 39.733  33.881 37.087  1.00 33.73  ? 529  ASN A CB    1 
ATOM   2353 C  CG    . ASN C 3 233 ? 39.645  35.360 36.801  1.00 34.27  ? 529  ASN A CG    1 
ATOM   2354 O  OD1   . ASN C 3 233 ? 38.794  36.053 37.354  1.00 32.96  ? 529  ASN A OD1   1 
ATOM   2355 N  ND2   . ASN C 3 233 ? 40.520  35.853 35.935  1.00 34.32  ? 529  ASN A ND2   1 
ATOM   2356 N  N     . SER C 3 234 ? 40.159  31.459 39.654  1.00 35.31  ? 530  SER A N     1 
ATOM   2357 C  CA    . SER C 3 234 ? 39.943  30.051 39.929  1.00 35.86  ? 530  SER A CA    1 
ATOM   2358 C  C     . SER C 3 234 ? 39.351  29.892 41.319  1.00 36.81  ? 530  SER A C     1 
ATOM   2359 O  O     . SER C 3 234 ? 40.046  30.061 42.322  1.00 36.64  ? 530  SER A O     1 
ATOM   2360 C  CB    . SER C 3 234 ? 41.254  29.275 39.844  1.00 34.98  ? 530  SER A CB    1 
ATOM   2361 O  OG    . SER C 3 234 ? 41.048  27.939 40.258  1.00 36.12  ? 530  SER A OG    1 
ATOM   2362 N  N     . PRO C 3 235 ? 38.050  29.574 41.399  1.00 37.81  ? 531  PRO A N     1 
ATOM   2363 C  CA    . PRO C 3 235 ? 37.399  29.398 42.699  1.00 38.32  ? 531  PRO A CA    1 
ATOM   2364 C  C     . PRO C 3 235 ? 38.167  28.431 43.601  1.00 38.73  ? 531  PRO A C     1 
ATOM   2365 O  O     . PRO C 3 235 ? 38.193  28.595 44.822  1.00 38.60  ? 531  PRO A O     1 
ATOM   2366 C  CB    . PRO C 3 235 ? 36.008  28.900 42.320  1.00 37.63  ? 531  PRO A CB    1 
ATOM   2367 C  CG    . PRO C 3 235 ? 35.749  29.639 41.039  1.00 38.08  ? 531  PRO A CG    1 
ATOM   2368 C  CD    . PRO C 3 235 ? 37.067  29.488 40.303  1.00 37.38  ? 531  PRO A CD    1 
ATOM   2369 N  N     . LYS C 3 236 ? 38.801  27.435 42.988  1.00 38.34  ? 532  LYS A N     1 
ATOM   2370 C  CA    . LYS C 3 236 ? 39.565  26.445 43.734  1.00 38.16  ? 532  LYS A CA    1 
ATOM   2371 C  C     . LYS C 3 236 ? 40.852  27.014 44.315  1.00 36.00  ? 532  LYS A C     1 
ATOM   2372 O  O     . LYS C 3 236 ? 41.127  26.848 45.502  1.00 35.04  ? 532  LYS A O     1 
ATOM   2373 C  CB    . LYS C 3 236 ? 39.915  25.249 42.849  1.00 40.59  ? 532  LYS A CB    1 
ATOM   2374 C  CG    . LYS C 3 236 ? 40.705  24.191 43.606  1.00 43.72  ? 532  LYS A CG    1 
ATOM   2375 C  CD    . LYS C 3 236 ? 41.313  23.142 42.697  1.00 47.10  ? 532  LYS A CD    1 
ATOM   2376 C  CE    . LYS C 3 236 ? 40.261  22.256 42.063  1.00 49.09  ? 532  LYS A CE    1 
ATOM   2377 N  NZ    . LYS C 3 236 ? 40.924  21.135 41.339  1.00 48.30  ? 532  LYS A NZ    1 
ATOM   2378 N  N     . GLN C 3 237 ? 41.646  27.675 43.476  1.00 34.20  ? 533  GLN A N     1 
ATOM   2379 C  CA    . GLN C 3 237 ? 42.899  28.262 43.933  1.00 32.58  ? 533  GLN A CA    1 
ATOM   2380 C  C     . GLN C 3 237 ? 42.597  29.345 44.963  1.00 31.95  ? 533  GLN A C     1 
ATOM   2381 O  O     . GLN C 3 237 ? 43.236  29.423 46.013  1.00 30.92  ? 533  GLN A O     1 
ATOM   2382 C  CB    . GLN C 3 237 ? 43.670  28.861 42.754  1.00 33.30  ? 533  GLN A CB    1 
ATOM   2383 C  CG    . GLN C 3 237 ? 44.207  27.827 41.764  1.00 34.99  ? 533  GLN A CG    1 
ATOM   2384 C  CD    . GLN C 3 237 ? 45.047  28.452 40.661  1.00 34.37  ? 533  GLN A CD    1 
ATOM   2385 O  OE1   . GLN C 3 237 ? 45.946  29.253 40.925  1.00 35.40  ? 533  GLN A OE1   1 
ATOM   2386 N  NE2   . GLN C 3 237 ? 44.762  28.081 39.418  1.00 36.35  ? 533  GLN A NE2   1 
ATOM   2387 N  N     . LEU C 3 238 ? 41.608  30.174 44.653  1.00 29.82  ? 534  LEU A N     1 
ATOM   2388 C  CA    . LEU C 3 238 ? 41.201  31.251 45.539  1.00 28.91  ? 534  LEU A CA    1 
ATOM   2389 C  C     . LEU C 3 238 ? 40.773  30.673 46.883  1.00 28.26  ? 534  LEU A C     1 
ATOM   2390 O  O     . LEU C 3 238 ? 41.109  31.212 47.934  1.00 27.06  ? 534  LEU A O     1 
ATOM   2391 C  CB    . LEU C 3 238 ? 40.041  32.034 44.913  1.00 28.22  ? 534  LEU A CB    1 
ATOM   2392 C  CG    . LEU C 3 238 ? 39.436  33.166 45.747  1.00 27.19  ? 534  LEU A CG    1 
ATOM   2393 C  CD1   . LEU C 3 238 ? 40.522  34.157 46.121  1.00 23.61  ? 534  LEU A CD1   1 
ATOM   2394 C  CD2   . LEU C 3 238 ? 38.328  33.859 44.954  1.00 27.81  ? 534  LEU A CD2   1 
ATOM   2395 N  N     . GLY C 3 239 ? 40.030  29.571 46.837  1.00 28.54  ? 535  GLY A N     1 
ATOM   2396 C  CA    . GLY C 3 239 ? 39.568  28.933 48.058  1.00 29.05  ? 535  GLY A CA    1 
ATOM   2397 C  C     . GLY C 3 239 ? 40.699  28.523 48.990  1.00 30.08  ? 535  GLY A C     1 
ATOM   2398 O  O     . GLY C 3 239 ? 40.577  28.638 50.210  1.00 29.84  ? 535  GLY A O     1 
ATOM   2399 N  N     . VAL C 3 240 ? 41.799  28.043 48.417  1.00 29.41  ? 536  VAL A N     1 
ATOM   2400 C  CA    . VAL C 3 240 ? 42.954  27.614 49.202  1.00 28.78  ? 536  VAL A CA    1 
ATOM   2401 C  C     . VAL C 3 240 ? 43.641  28.801 49.875  1.00 28.42  ? 536  VAL A C     1 
ATOM   2402 O  O     . VAL C 3 240 ? 44.058  28.715 51.030  1.00 28.66  ? 536  VAL A O     1 
ATOM   2403 C  CB    . VAL C 3 240 ? 43.987  26.882 48.314  1.00 29.34  ? 536  VAL A CB    1 
ATOM   2404 C  CG1   . VAL C 3 240 ? 45.204  26.496 49.139  1.00 29.20  ? 536  VAL A CG1   1 
ATOM   2405 C  CG2   . VAL C 3 240 ? 43.353  25.642 47.694  1.00 28.11  ? 536  VAL A CG2   1 
ATOM   2406 N  N     . ILE C 3 241 ? 43.754  29.907 49.147  1.00 27.74  ? 537  ILE A N     1 
ATOM   2407 C  CA    . ILE C 3 241 ? 44.389  31.110 49.672  1.00 27.16  ? 537  ILE A CA    1 
ATOM   2408 C  C     . ILE C 3 241 ? 43.594  31.681 50.843  1.00 27.14  ? 537  ILE A C     1 
ATOM   2409 O  O     . ILE C 3 241 ? 44.147  31.960 51.908  1.00 27.16  ? 537  ILE A O     1 
ATOM   2410 C  CB    . ILE C 3 241 ? 44.500  32.204 48.576  1.00 27.46  ? 537  ILE A CB    1 
ATOM   2411 C  CG1   . ILE C 3 241 ? 45.443  31.738 47.467  1.00 27.75  ? 537  ILE A CG1   1 
ATOM   2412 C  CG2   . ILE C 3 241 ? 44.989  33.516 49.181  1.00 24.16  ? 537  ILE A CG2   1 
ATOM   2413 C  CD1   . ILE C 3 241 ? 46.878  31.523 47.927  1.00 29.53  ? 537  ILE A CD1   1 
ATOM   2414 N  N     . LEU C 3 242 ? 42.290  31.836 50.642  1.00 24.58  ? 538  LEU A N     1 
ATOM   2415 C  CA    . LEU C 3 242 ? 41.415  32.407 51.658  1.00 24.26  ? 538  LEU A CA    1 
ATOM   2416 C  C     . LEU C 3 242 ? 41.174  31.572 52.916  1.00 23.74  ? 538  LEU A C     1 
ATOM   2417 O  O     . LEU C 3 242 ? 41.461  32.019 54.030  1.00 21.48  ? 538  LEU A O     1 
ATOM   2418 C  CB    . LEU C 3 242 ? 40.056  32.760 51.034  1.00 23.59  ? 538  LEU A CB    1 
ATOM   2419 C  CG    . LEU C 3 242 ? 40.036  33.758 49.865  1.00 23.39  ? 538  LEU A CG    1 
ATOM   2420 C  CD1   . LEU C 3 242 ? 38.583  34.103 49.527  1.00 21.27  ? 538  LEU A CD1   1 
ATOM   2421 C  CD2   . LEU C 3 242 ? 40.812  35.024 50.228  1.00 21.45  ? 538  LEU A CD2   1 
ATOM   2422 N  N     . PHE C 3 243 ? 40.648  30.365 52.731  1.00 24.02  ? 539  PHE A N     1 
ATOM   2423 C  CA    . PHE C 3 243 ? 40.304  29.487 53.843  1.00 24.92  ? 539  PHE A CA    1 
ATOM   2424 C  C     . PHE C 3 243 ? 41.398  28.593 54.414  1.00 25.53  ? 539  PHE A C     1 
ATOM   2425 O  O     . PHE C 3 243 ? 41.195  27.954 55.447  1.00 25.60  ? 539  PHE A O     1 
ATOM   2426 C  CB    . PHE C 3 243 ? 39.095  28.648 53.434  1.00 25.25  ? 539  PHE A CB    1 
ATOM   2427 C  CG    . PHE C 3 243 ? 37.967  29.474 52.890  1.00 27.32  ? 539  PHE A CG    1 
ATOM   2428 C  CD1   . PHE C 3 243 ? 37.289  30.371 53.712  1.00 28.13  ? 539  PHE A CD1   1 
ATOM   2429 C  CD2   . PHE C 3 243 ? 37.638  29.423 51.540  1.00 26.58  ? 539  PHE A CD2   1 
ATOM   2430 C  CE1   . PHE C 3 243 ? 36.300  31.210 53.193  1.00 28.04  ? 539  PHE A CE1   1 
ATOM   2431 C  CE2   . PHE C 3 243 ? 36.654  30.254 51.014  1.00 25.88  ? 539  PHE A CE2   1 
ATOM   2432 C  CZ    . PHE C 3 243 ? 35.985  31.150 51.841  1.00 27.53  ? 539  PHE A CZ    1 
ATOM   2433 N  N     . GLU C 3 244 ? 42.550  28.542 53.753  1.00 25.26  ? 540  GLU A N     1 
ATOM   2434 C  CA    . GLU C 3 244 ? 43.654  27.727 54.239  1.00 25.64  ? 540  GLU A CA    1 
ATOM   2435 C  C     . GLU C 3 244 ? 44.861  28.581 54.611  1.00 26.52  ? 540  GLU A C     1 
ATOM   2436 O  O     . GLU C 3 244 ? 45.237  28.649 55.787  1.00 27.90  ? 540  GLU A O     1 
ATOM   2437 C  CB    . GLU C 3 244 ? 44.034  26.664 53.198  1.00 26.24  ? 540  GLU A CB    1 
ATOM   2438 C  CG    . GLU C 3 244 ? 43.086  25.473 53.205  1.00 26.53  ? 540  GLU A CG    1 
ATOM   2439 C  CD    . GLU C 3 244 ? 43.426  24.401 52.178  1.00 29.33  ? 540  GLU A CD    1 
ATOM   2440 O  OE1   . GLU C 3 244 ? 44.620  24.054 52.024  1.00 28.07  ? 540  GLU A OE1   1 
ATOM   2441 O  OE2   . GLU C 3 244 ? 42.485  23.891 51.536  1.00 27.15  ? 540  GLU A OE2   1 
ATOM   2442 N  N     . LYS C 3 245 ? 45.456  29.252 53.630  1.00 25.22  ? 541  LYS A N     1 
ATOM   2443 C  CA    . LYS C 3 245 ? 46.622  30.091 53.905  1.00 26.25  ? 541  LYS A CA    1 
ATOM   2444 C  C     . LYS C 3 245 ? 46.302  31.253 54.848  1.00 25.28  ? 541  LYS A C     1 
ATOM   2445 O  O     . LYS C 3 245 ? 47.049  31.516 55.792  1.00 25.40  ? 541  LYS A O     1 
ATOM   2446 C  CB    . LYS C 3 245 ? 47.209  30.648 52.604  1.00 26.58  ? 541  LYS A CB    1 
ATOM   2447 C  CG    . LYS C 3 245 ? 48.554  31.352 52.789  1.00 28.82  ? 541  LYS A CG    1 
ATOM   2448 C  CD    . LYS C 3 245 ? 49.115  31.848 51.459  1.00 30.47  ? 541  LYS A CD    1 
ATOM   2449 C  CE    . LYS C 3 245 ? 50.567  32.306 51.588  1.00 30.29  ? 541  LYS A CE    1 
ATOM   2450 N  NZ    . LYS C 3 245 ? 50.740  33.406 52.576  1.00 30.51  ? 541  LYS A NZ    1 
ATOM   2451 N  N     . LEU C 3 246 ? 45.191  31.941 54.597  1.00 24.27  ? 542  LEU A N     1 
ATOM   2452 C  CA    . LEU C 3 246 ? 44.807  33.077 55.429  1.00 23.81  ? 542  LEU A CA    1 
ATOM   2453 C  C     . LEU C 3 246 ? 43.911  32.716 56.611  1.00 23.72  ? 542  LEU A C     1 
ATOM   2454 O  O     . LEU C 3 246 ? 43.645  33.557 57.472  1.00 24.08  ? 542  LEU A O     1 
ATOM   2455 C  CB    . LEU C 3 246 ? 44.129  34.152 54.574  1.00 23.14  ? 542  LEU A CB    1 
ATOM   2456 C  CG    . LEU C 3 246 ? 44.978  34.729 53.439  1.00 24.32  ? 542  LEU A CG    1 
ATOM   2457 C  CD1   . LEU C 3 246 ? 44.215  35.862 52.771  1.00 25.96  ? 542  LEU A CD1   1 
ATOM   2458 C  CD2   . LEU C 3 246 ? 46.314  35.231 53.986  1.00 23.71  ? 542  LEU A CD2   1 
ATOM   2459 N  N     . GLN C 3 247 ? 43.437  31.474 56.648  1.00 24.61  ? 543  GLN A N     1 
ATOM   2460 C  CA    . GLN C 3 247 ? 42.598  31.003 57.750  1.00 25.15  ? 543  GLN A CA    1 
ATOM   2461 C  C     . GLN C 3 247 ? 41.252  31.703 57.928  1.00 25.17  ? 543  GLN A C     1 
ATOM   2462 O  O     . GLN C 3 247 ? 40.709  31.722 59.036  1.00 24.48  ? 543  GLN A O     1 
ATOM   2463 C  CB    . GLN C 3 247 ? 43.378  31.102 59.067  1.00 26.47  ? 543  GLN A CB    1 
ATOM   2464 C  CG    . GLN C 3 247 ? 44.570  30.160 59.149  1.00 27.94  ? 543  GLN A CG    1 
ATOM   2465 C  CD    . GLN C 3 247 ? 44.140  28.712 59.249  1.00 28.37  ? 543  GLN A CD    1 
ATOM   2466 O  OE1   . GLN C 3 247 ? 43.479  28.317 60.208  1.00 28.83  ? 543  GLN A OE1   1 
ATOM   2467 N  NE2   . GLN C 3 247 ? 44.504  27.913 58.253  1.00 29.20  ? 543  GLN A NE2   1 
ATOM   2468 N  N     . LEU C 3 248 ? 40.702  32.272 56.861  1.00 24.46  ? 544  LEU A N     1 
ATOM   2469 C  CA    . LEU C 3 248 ? 39.415  32.941 56.989  1.00 23.45  ? 544  LEU A CA    1 
ATOM   2470 C  C     . LEU C 3 248 ? 38.326  31.919 57.317  1.00 24.79  ? 544  LEU A C     1 
ATOM   2471 O  O     . LEU C 3 248 ? 38.434  30.747 56.955  1.00 24.61  ? 544  LEU A O     1 
ATOM   2472 C  CB    . LEU C 3 248 ? 39.069  33.699 55.702  1.00 21.62  ? 544  LEU A CB    1 
ATOM   2473 C  CG    . LEU C 3 248 ? 40.018  34.847 55.337  1.00 22.99  ? 544  LEU A CG    1 
ATOM   2474 C  CD1   . LEU C 3 248 ? 39.411  35.669 54.202  1.00 23.12  ? 544  LEU A CD1   1 
ATOM   2475 C  CD2   . LEU C 3 248 ? 40.263  35.733 56.552  1.00 20.30  ? 544  LEU A CD2   1 
ATOM   2476 N  N     . PRO C 3 249 ? 37.263  32.354 58.012  1.00 26.41  ? 545  PRO A N     1 
ATOM   2477 C  CA    . PRO C 3 249 ? 36.146  31.487 58.400  1.00 28.87  ? 545  PRO A CA    1 
ATOM   2478 C  C     . PRO C 3 249 ? 35.396  30.894 57.210  1.00 31.26  ? 545  PRO A C     1 
ATOM   2479 O  O     . PRO C 3 249 ? 35.151  31.574 56.214  1.00 31.24  ? 545  PRO A O     1 
ATOM   2480 C  CB    . PRO C 3 249 ? 35.254  32.402 59.241  1.00 28.68  ? 545  PRO A CB    1 
ATOM   2481 C  CG    . PRO C 3 249 ? 36.185  33.482 59.714  1.00 29.84  ? 545  PRO A CG    1 
ATOM   2482 C  CD    . PRO C 3 249 ? 37.052  33.723 58.509  1.00 28.29  ? 545  PRO A CD    1 
ATOM   2483 N  N     . VAL C 3 250 ? 35.035  29.623 57.322  1.00 34.33  ? 546  VAL A N     1 
ATOM   2484 C  CA    . VAL C 3 250 ? 34.280  28.956 56.275  1.00 37.76  ? 546  VAL A CA    1 
ATOM   2485 C  C     . VAL C 3 250 ? 32.822  29.009 56.704  1.00 40.32  ? 546  VAL A C     1 
ATOM   2486 O  O     . VAL C 3 250 ? 32.410  28.292 57.613  1.00 41.84  ? 546  VAL A O     1 
ATOM   2487 C  CB    . VAL C 3 250 ? 34.702  27.488 56.119  1.00 38.01  ? 546  VAL A CB    1 
ATOM   2488 C  CG1   . VAL C 3 250 ? 33.781  26.794 55.130  1.00 37.55  ? 546  VAL A CG1   1 
ATOM   2489 C  CG2   . VAL C 3 250 ? 36.151  27.409 55.648  1.00 36.13  ? 546  VAL A CG2   1 
ATOM   2490 N  N     . LEU C 3 251 ? 32.044  29.863 56.049  1.00 43.72  ? 547  LEU A N     1 
ATOM   2491 C  CA    . LEU C 3 251 ? 30.633  30.015 56.385  1.00 47.33  ? 547  LEU A CA    1 
ATOM   2492 C  C     . LEU C 3 251 ? 29.708  29.236 55.455  1.00 49.58  ? 547  LEU A C     1 
ATOM   2493 O  O     . LEU C 3 251 ? 28.545  29.006 55.786  1.00 50.62  ? 547  LEU A O     1 
ATOM   2494 C  CB    . LEU C 3 251 ? 30.258  31.497 56.363  1.00 47.47  ? 547  LEU A CB    1 
ATOM   2495 C  CG    . LEU C 3 251 ? 31.132  32.388 57.251  1.00 48.70  ? 547  LEU A CG    1 
ATOM   2496 C  CD1   . LEU C 3 251 ? 30.783  33.849 57.022  1.00 48.56  ? 547  LEU A CD1   1 
ATOM   2497 C  CD2   . LEU C 3 251 ? 30.943  32.002 58.712  1.00 48.13  ? 547  LEU A CD2   1 
ATOM   2498 N  N     . LYS C 3 252 ? 30.220  28.829 54.296  1.00 52.20  ? 548  LYS A N     1 
ATOM   2499 C  CA    . LYS C 3 252 ? 29.413  28.074 53.342  1.00 54.10  ? 548  LYS A CA    1 
ATOM   2500 C  C     . LYS C 3 252 ? 30.255  27.335 52.302  1.00 55.17  ? 548  LYS A C     1 
ATOM   2501 O  O     . LYS C 3 252 ? 31.262  27.856 51.822  1.00 54.92  ? 548  LYS A O     1 
ATOM   2502 C  CB    . LYS C 3 252 ? 28.426  29.014 52.638  1.00 54.60  ? 548  LYS A CB    1 
ATOM   2503 C  CG    . LYS C 3 252 ? 27.488  28.318 51.658  1.00 56.08  ? 548  LYS A CG    1 
ATOM   2504 C  CD    . LYS C 3 252 ? 26.389  29.254 51.165  1.00 56.91  ? 548  LYS A CD    1 
ATOM   2505 C  CE    . LYS C 3 252 ? 26.946  30.407 50.345  1.00 57.83  ? 548  LYS A CE    1 
ATOM   2506 N  NZ    . LYS C 3 252 ? 27.586  29.933 49.085  1.00 58.75  ? 548  LYS A NZ    1 
ATOM   2507 N  N     . LYS C 3 253 ? 29.833  26.116 51.967  1.00 56.81  ? 549  LYS A N     1 
ATOM   2508 C  CA    . LYS C 3 253 ? 30.520  25.289 50.974  1.00 58.59  ? 549  LYS A CA    1 
ATOM   2509 C  C     . LYS C 3 253 ? 29.763  25.276 49.649  1.00 59.10  ? 549  LYS A C     1 
ATOM   2510 O  O     . LYS C 3 253 ? 28.690  25.871 49.527  1.00 59.24  ? 549  LYS A O     1 
ATOM   2511 C  CB    . LYS C 3 253 ? 30.655  23.841 51.461  1.00 59.72  ? 549  LYS A CB    1 
ATOM   2512 C  CG    . LYS C 3 253 ? 31.801  23.569 52.423  1.00 60.51  ? 549  LYS A CG    1 
ATOM   2513 C  CD    . LYS C 3 253 ? 31.553  24.164 53.793  1.00 61.69  ? 549  LYS A CD    1 
ATOM   2514 C  CE    . LYS C 3 253 ? 32.613  23.690 54.775  1.00 62.85  ? 549  LYS A CE    1 
ATOM   2515 N  NZ    . LYS C 3 253 ? 33.991  23.962 54.269  1.00 62.96  ? 549  LYS A NZ    1 
ATOM   2516 N  N     . THR C 3 254 ? 30.328  24.583 48.664  1.00 59.79  ? 550  THR A N     1 
ATOM   2517 C  CA    . THR C 3 254 ? 29.716  24.471 47.345  1.00 60.36  ? 550  THR A CA    1 
ATOM   2518 C  C     . THR C 3 254 ? 29.600  23.007 46.932  1.00 61.19  ? 550  THR A C     1 
ATOM   2519 O  O     . THR C 3 254 ? 28.558  22.377 47.114  1.00 61.72  ? 550  THR A O     1 
ATOM   2520 C  CB    . THR C 3 254 ? 30.542  25.217 46.275  1.00 59.89  ? 550  THR A CB    1 
ATOM   2521 O  OG1   . THR C 3 254 ? 31.908  24.783 46.335  1.00 59.06  ? 550  THR A OG1   1 
ATOM   2522 C  CG2   . THR C 3 254 ? 30.472  26.716 46.496  1.00 58.97  ? 550  THR A CG2   1 
ATOM   2523 N  N     . LYS C 3 255 ? 30.682  22.475 46.373  1.00 61.97  ? 551  LYS A N     1 
ATOM   2524 C  CA    . LYS C 3 255 ? 30.732  21.089 45.929  1.00 62.31  ? 551  LYS A CA    1 
ATOM   2525 C  C     . LYS C 3 255 ? 32.167  20.587 45.937  1.00 62.49  ? 551  LYS A C     1 
ATOM   2526 O  O     . LYS C 3 255 ? 32.556  19.798 46.799  1.00 63.11  ? 551  LYS A O     1 
ATOM   2527 C  CB    . LYS C 3 255 ? 30.153  20.958 44.516  1.00 62.90  ? 551  LYS A CB    1 
ATOM   2528 C  CG    . LYS C 3 255 ? 28.633  20.926 44.460  1.00 63.75  ? 551  LYS A CG    1 
ATOM   2529 C  CD    . LYS C 3 255 ? 28.089  19.652 45.095  1.00 64.32  ? 551  LYS A CD    1 
ATOM   2530 C  CE    . LYS C 3 255 ? 26.566  19.634 45.106  1.00 64.52  ? 551  LYS A CE    1 
ATOM   2531 N  NZ    . LYS C 3 255 ? 26.005  20.731 45.942  1.00 64.67  ? 551  LYS A NZ    1 
ATOM   2532 N  N     . THR C 3 256 ? 32.950  21.056 44.971  1.00 62.18  ? 552  THR A N     1 
ATOM   2533 C  CA    . THR C 3 256 ? 34.347  20.659 44.845  1.00 62.03  ? 552  THR A CA    1 
ATOM   2534 C  C     . THR C 3 256 ? 35.187  21.229 45.986  1.00 61.04  ? 552  THR A C     1 
ATOM   2535 O  O     . THR C 3 256 ? 35.922  20.497 46.651  1.00 61.40  ? 552  THR A O     1 
ATOM   2536 C  CB    . THR C 3 256 ? 34.937  21.138 43.497  1.00 62.65  ? 552  THR A CB    1 
ATOM   2537 O  OG1   . THR C 3 256 ? 34.081  20.720 42.426  1.00 63.70  ? 552  THR A OG1   1 
ATOM   2538 C  CG2   . THR C 3 256 ? 36.330  20.549 43.280  1.00 62.69  ? 552  THR A CG2   1 
ATOM   2539 N  N     . GLY C 3 257 ? 35.073  22.536 46.208  1.00 59.81  ? 553  GLY A N     1 
ATOM   2540 C  CA    . GLY C 3 257 ? 35.830  23.178 47.269  1.00 57.73  ? 553  GLY A CA    1 
ATOM   2541 C  C     . GLY C 3 257 ? 34.978  24.071 48.153  1.00 55.66  ? 553  GLY A C     1 
ATOM   2542 O  O     . GLY C 3 257 ? 33.855  23.714 48.514  1.00 56.56  ? 553  GLY A O     1 
ATOM   2543 N  N     . TYR C 3 258 ? 35.511  25.238 48.504  1.00 52.90  ? 554  TYR A N     1 
ATOM   2544 C  CA    . TYR C 3 258 ? 34.786  26.179 49.350  1.00 50.10  ? 554  TYR A CA    1 
ATOM   2545 C  C     . TYR C 3 258 ? 34.010  27.166 48.490  1.00 49.18  ? 554  TYR A C     1 
ATOM   2546 O  O     . TYR C 3 258 ? 34.292  27.328 47.301  1.00 49.17  ? 554  TYR A O     1 
ATOM   2547 C  CB    . TYR C 3 258 ? 35.746  26.974 50.241  1.00 48.58  ? 554  TYR A CB    1 
ATOM   2548 C  CG    . TYR C 3 258 ? 36.881  26.185 50.855  1.00 46.60  ? 554  TYR A CG    1 
ATOM   2549 C  CD1   . TYR C 3 258 ? 38.057  25.946 50.143  1.00 45.57  ? 554  TYR A CD1   1 
ATOM   2550 C  CD2   . TYR C 3 258 ? 36.794  25.705 52.161  1.00 45.74  ? 554  TYR A CD2   1 
ATOM   2551 C  CE1   . TYR C 3 258 ? 39.122  25.252 50.720  1.00 45.25  ? 554  TYR A CE1   1 
ATOM   2552 C  CE2   . TYR C 3 258 ? 37.852  25.007 52.747  1.00 44.87  ? 554  TYR A CE2   1 
ATOM   2553 C  CZ    . TYR C 3 258 ? 39.011  24.786 52.022  1.00 44.38  ? 554  TYR A CZ    1 
ATOM   2554 O  OH    . TYR C 3 258 ? 40.058  24.103 52.599  1.00 44.33  ? 554  TYR A OH    1 
ATOM   2555 N  N     . SER C 3 259 ? 33.038  27.833 49.100  1.00 47.51  ? 555  SER A N     1 
ATOM   2556 C  CA    . SER C 3 259 ? 32.232  28.821 48.395  1.00 45.51  ? 555  SER A CA    1 
ATOM   2557 C  C     . SER C 3 259 ? 32.907  30.190 48.465  1.00 43.42  ? 555  SER A C     1 
ATOM   2558 O  O     . SER C 3 259 ? 33.343  30.619 49.531  1.00 42.35  ? 555  SER A O     1 
ATOM   2559 C  CB    . SER C 3 259 ? 30.837  28.902 49.016  1.00 45.77  ? 555  SER A CB    1 
ATOM   2560 O  OG    . SER C 3 259 ? 30.088  29.956 48.439  1.00 47.56  ? 555  SER A OG    1 
ATOM   2561 N  N     . THR C 3 260 ? 32.994  30.872 47.329  1.00 42.24  ? 556  THR A N     1 
ATOM   2562 C  CA    . THR C 3 260 ? 33.612  32.190 47.292  1.00 41.12  ? 556  THR A CA    1 
ATOM   2563 C  C     . THR C 3 260 ? 32.706  33.210 46.608  1.00 41.73  ? 556  THR A C     1 
ATOM   2564 O  O     . THR C 3 260 ? 33.185  34.181 46.024  1.00 41.84  ? 556  THR A O     1 
ATOM   2565 C  CB    . THR C 3 260 ? 34.982  32.155 46.565  1.00 40.14  ? 556  THR A CB    1 
ATOM   2566 O  OG1   . THR C 3 260 ? 34.798  31.785 45.193  1.00 38.72  ? 556  THR A OG1   1 
ATOM   2567 C  CG2   . THR C 3 260 ? 35.912  31.153 47.235  1.00 38.89  ? 556  THR A CG2   1 
ATOM   2568 N  N     . SER C 3 261 ? 31.396  32.987 46.692  1.00 42.32  ? 557  SER A N     1 
ATOM   2569 C  CA    . SER C 3 261 ? 30.425  33.891 46.085  1.00 43.90  ? 557  SER A CA    1 
ATOM   2570 C  C     . SER C 3 261 ? 30.494  35.273 46.726  1.00 44.44  ? 557  SER A C     1 
ATOM   2571 O  O     . SER C 3 261 ? 30.869  35.410 47.891  1.00 44.74  ? 557  SER A O     1 
ATOM   2572 C  CB    . SER C 3 261 ? 29.008  33.326 46.225  1.00 44.84  ? 557  SER A CB    1 
ATOM   2573 O  OG    . SER C 3 261 ? 28.647  33.166 47.586  1.00 46.79  ? 557  SER A OG    1 
ATOM   2574 N  N     . ALA C 3 262 ? 30.131  36.295 45.956  1.00 45.09  ? 558  ALA A N     1 
ATOM   2575 C  CA    . ALA C 3 262 ? 30.162  37.673 46.434  1.00 44.75  ? 558  ALA A CA    1 
ATOM   2576 C  C     . ALA C 3 262 ? 29.494  37.847 47.797  1.00 45.11  ? 558  ALA A C     1 
ATOM   2577 O  O     . ALA C 3 262 ? 29.925  38.668 48.607  1.00 44.89  ? 558  ALA A O     1 
ATOM   2578 C  CB    . ALA C 3 262 ? 29.503  38.587 45.411  1.00 45.36  ? 558  ALA A CB    1 
ATOM   2579 N  N     . ASP C 3 263 ? 28.442  37.074 48.044  1.00 45.75  ? 559  ASP A N     1 
ATOM   2580 C  CA    . ASP C 3 263 ? 27.717  37.152 49.307  1.00 47.29  ? 559  ASP A CA    1 
ATOM   2581 C  C     . ASP C 3 263 ? 28.578  36.654 50.465  1.00 45.96  ? 559  ASP A C     1 
ATOM   2582 O  O     . ASP C 3 263 ? 28.525  37.194 51.569  1.00 45.62  ? 559  ASP A O     1 
ATOM   2583 C  CB    . ASP C 3 263 ? 26.430  36.328 49.223  1.00 49.94  ? 559  ASP A CB    1 
ATOM   2584 C  CG    . ASP C 3 263 ? 25.484  36.833 48.146  1.00 53.35  ? 559  ASP A CG    1 
ATOM   2585 O  OD1   . ASP C 3 263 ? 25.013  37.989 48.253  1.00 55.23  ? 559  ASP A OD1   1 
ATOM   2586 O  OD2   . ASP C 3 263 ? 25.213  36.075 47.189  1.00 56.06  ? 559  ASP A OD2   1 
ATOM   2587 N  N     . VAL C 3 264 ? 29.370  35.621 50.201  1.00 44.75  ? 560  VAL A N     1 
ATOM   2588 C  CA    . VAL C 3 264 ? 30.248  35.048 51.213  1.00 42.82  ? 560  VAL A CA    1 
ATOM   2589 C  C     . VAL C 3 264 ? 31.414  35.989 51.506  1.00 41.79  ? 560  VAL A C     1 
ATOM   2590 O  O     . VAL C 3 264 ? 31.778  36.199 52.664  1.00 42.97  ? 560  VAL A O     1 
ATOM   2591 C  CB    . VAL C 3 264 ? 30.805  33.680 50.748  1.00 42.95  ? 560  VAL A CB    1 
ATOM   2592 C  CG1   . VAL C 3 264 ? 31.789  33.134 51.772  1.00 42.99  ? 560  VAL A CG1   1 
ATOM   2593 C  CG2   . VAL C 3 264 ? 29.664  32.704 50.539  1.00 41.52  ? 560  VAL A CG2   1 
ATOM   2594 N  N     . LEU C 3 265 ? 31.991  36.561 50.454  1.00 39.53  ? 561  LEU A N     1 
ATOM   2595 C  CA    . LEU C 3 265 ? 33.117  37.472 50.609  1.00 38.32  ? 561  LEU A CA    1 
ATOM   2596 C  C     . LEU C 3 265 ? 32.716  38.767 51.309  1.00 39.02  ? 561  LEU A C     1 
ATOM   2597 O  O     . LEU C 3 265 ? 33.511  39.361 52.039  1.00 36.87  ? 561  LEU A O     1 
ATOM   2598 C  CB    . LEU C 3 265 ? 33.726  37.802 49.244  1.00 37.04  ? 561  LEU A CB    1 
ATOM   2599 C  CG    . LEU C 3 265 ? 34.257  36.625 48.420  1.00 35.34  ? 561  LEU A CG    1 
ATOM   2600 C  CD1   . LEU C 3 265 ? 34.888  37.148 47.136  1.00 34.40  ? 561  LEU A CD1   1 
ATOM   2601 C  CD2   . LEU C 3 265 ? 35.281  35.850 49.226  1.00 34.13  ? 561  LEU A CD2   1 
ATOM   2602 N  N     . GLU C 3 266 ? 31.480  39.200 51.081  1.00 39.54  ? 562  GLU A N     1 
ATOM   2603 C  CA    . GLU C 3 266 ? 30.985  40.429 51.691  1.00 41.43  ? 562  GLU A CA    1 
ATOM   2604 C  C     . GLU C 3 266 ? 31.040  40.289 53.209  1.00 40.43  ? 562  GLU A C     1 
ATOM   2605 O  O     . GLU C 3 266 ? 31.344  41.245 53.921  1.00 41.45  ? 562  GLU A O     1 
ATOM   2606 C  CB    . GLU C 3 266 ? 29.543  40.700 51.248  1.00 43.96  ? 562  GLU A CB    1 
ATOM   2607 C  CG    . GLU C 3 266 ? 29.190  42.178 51.154  1.00 50.33  ? 562  GLU A CG    1 
ATOM   2608 C  CD    . GLU C 3 266 ? 27.696  42.420 50.998  1.00 53.54  ? 562  GLU A CD    1 
ATOM   2609 O  OE1   . GLU C 3 266 ? 27.045  41.680 50.226  1.00 55.65  ? 562  GLU A OE1   1 
ATOM   2610 O  OE2   . GLU C 3 266 ? 27.174  43.354 51.646  1.00 55.40  ? 562  GLU A OE2   1 
ATOM   2611 N  N     . LYS C 3 267 ? 30.753  39.086 53.696  1.00 39.23  ? 563  LYS A N     1 
ATOM   2612 C  CA    . LYS C 3 267 ? 30.766  38.811 55.128  1.00 38.52  ? 563  LYS A CA    1 
ATOM   2613 C  C     . LYS C 3 267 ? 32.176  38.584 55.673  1.00 37.64  ? 563  LYS A C     1 
ATOM   2614 O  O     . LYS C 3 267 ? 32.417  38.748 56.869  1.00 38.83  ? 563  LYS A O     1 
ATOM   2615 C  CB    . LYS C 3 267 ? 29.888  37.595 55.424  1.00 38.23  ? 563  LYS A CB    1 
ATOM   2616 C  CG    . LYS C 3 267 ? 28.429  37.804 55.046  1.00 39.41  ? 563  LYS A CG    1 
ATOM   2617 C  CD    . LYS C 3 267 ? 27.599  36.539 55.203  1.00 40.01  ? 563  LYS A CD    1 
ATOM   2618 C  CE    . LYS C 3 267 ? 26.142  36.798 54.831  1.00 41.20  ? 563  LYS A CE    1 
ATOM   2619 N  NZ    . LYS C 3 267 ? 25.308  35.564 54.905  1.00 42.15  ? 563  LYS A NZ    1 
ATOM   2620 N  N     . LEU C 3 268 ? 33.106  38.218 54.794  1.00 36.24  ? 564  LEU A N     1 
ATOM   2621 C  CA    . LEU C 3 268 ? 34.492  37.966 55.190  1.00 33.34  ? 564  LEU A CA    1 
ATOM   2622 C  C     . LEU C 3 268 ? 35.346  39.224 55.165  1.00 32.40  ? 564  LEU A C     1 
ATOM   2623 O  O     . LEU C 3 268 ? 36.414  39.277 55.781  1.00 31.00  ? 564  LEU A O     1 
ATOM   2624 C  CB    . LEU C 3 268 ? 35.124  36.927 54.260  1.00 33.27  ? 564  LEU A CB    1 
ATOM   2625 C  CG    . LEU C 3 268 ? 34.504  35.533 54.252  1.00 32.34  ? 564  LEU A CG    1 
ATOM   2626 C  CD1   . LEU C 3 268 ? 35.246  34.659 53.259  1.00 32.61  ? 564  LEU A CD1   1 
ATOM   2627 C  CD2   . LEU C 3 268 ? 34.574  34.933 55.653  1.00 33.03  ? 564  LEU A CD2   1 
ATOM   2628 N  N     . ALA C 3 269 ? 34.874  40.234 54.443  1.00 32.61  ? 565  ALA A N     1 
ATOM   2629 C  CA    . ALA C 3 269 ? 35.595  41.494 54.314  1.00 31.90  ? 565  ALA A CA    1 
ATOM   2630 C  C     . ALA C 3 269 ? 36.148  42.021 55.639  1.00 32.13  ? 565  ALA A C     1 
ATOM   2631 O  O     . ALA C 3 269 ? 37.303  42.446 55.715  1.00 30.51  ? 565  ALA A O     1 
ATOM   2632 C  CB    . ALA C 3 269 ? 34.691  42.540 53.668  1.00 33.60  ? 565  ALA A CB    1 
ATOM   2633 N  N     . PRO C 3 270 ? 35.331  42.000 56.705  1.00 32.22  ? 566  PRO A N     1 
ATOM   2634 C  CA    . PRO C 3 270 ? 35.804  42.495 58.003  1.00 33.35  ? 566  PRO A CA    1 
ATOM   2635 C  C     . PRO C 3 270 ? 37.073  41.817 58.520  1.00 33.82  ? 566  PRO A C     1 
ATOM   2636 O  O     . PRO C 3 270 ? 37.856  42.427 59.249  1.00 34.86  ? 566  PRO A O     1 
ATOM   2637 C  CB    . PRO C 3 270 ? 34.600  42.277 58.920  1.00 34.46  ? 566  PRO A CB    1 
ATOM   2638 C  CG    . PRO C 3 270 ? 33.431  42.412 57.982  1.00 33.18  ? 566  PRO A CG    1 
ATOM   2639 C  CD    . PRO C 3 270 ? 33.903  41.639 56.772  1.00 32.34  ? 566  PRO A CD    1 
ATOM   2640 N  N     . TYR C 3 271 ? 37.288  40.564 58.129  1.00 33.51  ? 567  TYR A N     1 
ATOM   2641 C  CA    . TYR C 3 271 ? 38.453  39.824 58.600  1.00 32.17  ? 567  TYR A CA    1 
ATOM   2642 C  C     . TYR C 3 271 ? 39.779  40.090 57.901  1.00 32.10  ? 567  TYR A C     1 
ATOM   2643 O  O     . TYR C 3 271 ? 40.825  40.066 58.549  1.00 31.01  ? 567  TYR A O     1 
ATOM   2644 C  CB    . TYR C 3 271 ? 38.171  38.321 58.567  1.00 32.58  ? 567  TYR A CB    1 
ATOM   2645 C  CG    . TYR C 3 271 ? 37.058  37.888 59.493  1.00 33.48  ? 567  TYR A CG    1 
ATOM   2646 C  CD1   . TYR C 3 271 ? 35.746  37.800 59.042  1.00 32.53  ? 567  TYR A CD1   1 
ATOM   2647 C  CD2   . TYR C 3 271 ? 37.320  37.576 60.830  1.00 32.58  ? 567  TYR A CD2   1 
ATOM   2648 C  CE1   . TYR C 3 271 ? 34.720  37.411 59.894  1.00 34.10  ? 567  TYR A CE1   1 
ATOM   2649 C  CE2   . TYR C 3 271 ? 36.302  37.189 61.690  1.00 32.38  ? 567  TYR A CE2   1 
ATOM   2650 C  CZ    . TYR C 3 271 ? 35.006  37.109 61.216  1.00 33.71  ? 567  TYR A CZ    1 
ATOM   2651 O  OH    . TYR C 3 271 ? 33.989  36.733 62.058  1.00 34.29  ? 567  TYR A OH    1 
ATOM   2652 N  N     . HIS C 3 272 ? 39.754  40.344 56.594  1.00 32.05  ? 568  HIS A N     1 
ATOM   2653 C  CA    . HIS C 3 272 ? 41.003  40.573 55.864  1.00 30.98  ? 568  HIS A CA    1 
ATOM   2654 C  C     . HIS C 3 272 ? 40.850  41.537 54.680  1.00 31.38  ? 568  HIS A C     1 
ATOM   2655 O  O     . HIS C 3 272 ? 39.834  41.532 53.980  1.00 29.11  ? 568  HIS A O     1 
ATOM   2656 C  CB    . HIS C 3 272 ? 41.560  39.224 55.387  1.00 30.01  ? 568  HIS A CB    1 
ATOM   2657 C  CG    . HIS C 3 272 ? 43.030  39.238 55.104  1.00 31.20  ? 568  HIS A CG    1 
ATOM   2658 N  ND1   . HIS C 3 272 ? 43.579  39.914 54.035  1.00 31.02  ? 568  HIS A ND1   1 
ATOM   2659 C  CD2   . HIS C 3 272 ? 44.067  38.661 55.756  1.00 30.56  ? 568  HIS A CD2   1 
ATOM   2660 C  CE1   . HIS C 3 272 ? 44.890  39.753 54.040  1.00 31.27  ? 568  HIS A CE1   1 
ATOM   2661 N  NE2   . HIS C 3 272 ? 45.212  38.997 55.075  1.00 31.26  ? 568  HIS A NE2   1 
ATOM   2662 N  N     . GLU C 3 273 ? 41.879  42.354 54.470  1.00 31.77  ? 569  GLU A N     1 
ATOM   2663 C  CA    . GLU C 3 273 ? 41.901  43.355 53.404  1.00 33.17  ? 569  GLU A CA    1 
ATOM   2664 C  C     . GLU C 3 273 ? 41.921  42.778 51.986  1.00 32.36  ? 569  GLU A C     1 
ATOM   2665 O  O     . GLU C 3 273 ? 41.580  43.469 51.024  1.00 32.56  ? 569  GLU A O     1 
ATOM   2666 C  CB    . GLU C 3 273 ? 43.113  44.275 53.595  1.00 35.52  ? 569  GLU A CB    1 
ATOM   2667 C  CG    . GLU C 3 273 ? 43.381  45.221 52.428  1.00 40.32  ? 569  GLU A CG    1 
ATOM   2668 C  CD    . GLU C 3 273 ? 44.649  46.032 52.612  1.00 41.94  ? 569  GLU A CD    1 
ATOM   2669 O  OE1   . GLU C 3 273 ? 45.674  45.444 53.008  1.00 45.17  ? 569  GLU A OE1   1 
ATOM   2670 O  OE2   . GLU C 3 273 ? 44.626  47.253 52.349  1.00 42.98  ? 569  GLU A OE2   1 
ATOM   2671 N  N     . ILE C 3 274 ? 42.319  41.518 51.850  1.00 31.41  ? 570  ILE A N     1 
ATOM   2672 C  CA    . ILE C 3 274 ? 42.378  40.891 50.533  1.00 29.37  ? 570  ILE A CA    1 
ATOM   2673 C  C     . ILE C 3 274 ? 40.983  40.695 49.942  1.00 29.11  ? 570  ILE A C     1 
ATOM   2674 O  O     . ILE C 3 274 ? 40.805  40.723 48.726  1.00 29.61  ? 570  ILE A O     1 
ATOM   2675 C  CB    . ILE C 3 274 ? 43.082  39.517 50.604  1.00 29.24  ? 570  ILE A CB    1 
ATOM   2676 C  CG1   . ILE C 3 274 ? 43.482  39.057 49.198  1.00 28.56  ? 570  ILE A CG1   1 
ATOM   2677 C  CG2   . ILE C 3 274 ? 42.155  38.492 51.248  1.00 26.82  ? 570  ILE A CG2   1 
ATOM   2678 C  CD1   . ILE C 3 274 ? 44.195  37.716 49.172  1.00 27.13  ? 570  ILE A CD1   1 
ATOM   2679 N  N     . VAL C 3 275 ? 39.997  40.499 50.809  1.00 28.28  ? 571  VAL A N     1 
ATOM   2680 C  CA    . VAL C 3 275 ? 38.628  40.271 50.371  1.00 28.95  ? 571  VAL A CA    1 
ATOM   2681 C  C     . VAL C 3 275 ? 38.057  41.406 49.520  1.00 31.38  ? 571  VAL A C     1 
ATOM   2682 O  O     . VAL C 3 275 ? 37.513  41.163 48.442  1.00 29.51  ? 571  VAL A O     1 
ATOM   2683 C  CB    . VAL C 3 275 ? 37.700  40.030 51.577  1.00 28.47  ? 571  VAL A CB    1 
ATOM   2684 C  CG1   . VAL C 3 275 ? 36.289  39.724 51.098  1.00 26.48  ? 571  VAL A CG1   1 
ATOM   2685 C  CG2   . VAL C 3 275 ? 38.239  38.873 52.419  1.00 28.17  ? 571  VAL A CG2   1 
ATOM   2686 N  N     . GLU C 3 276 ? 38.182  42.640 50.000  1.00 32.79  ? 572  GLU A N     1 
ATOM   2687 C  CA    . GLU C 3 276 ? 37.667  43.791 49.266  1.00 34.39  ? 572  GLU A CA    1 
ATOM   2688 C  C     . GLU C 3 276 ? 38.321  43.894 47.888  1.00 33.49  ? 572  GLU A C     1 
ATOM   2689 O  O     . GLU C 3 276 ? 37.666  44.243 46.905  1.00 33.34  ? 572  GLU A O     1 
ATOM   2690 C  CB    . GLU C 3 276 ? 37.906  45.080 50.062  1.00 36.14  ? 572  GLU A CB    1 
ATOM   2691 C  CG    . GLU C 3 276 ? 39.367  45.493 50.192  1.00 40.57  ? 572  GLU A CG    1 
ATOM   2692 C  CD    . GLU C 3 276 ? 39.563  46.669 51.135  1.00 44.27  ? 572  GLU A CD    1 
ATOM   2693 O  OE1   . GLU C 3 276 ? 40.659  47.272 51.123  1.00 46.52  ? 572  GLU A OE1   1 
ATOM   2694 O  OE2   . GLU C 3 276 ? 38.622  46.991 51.894  1.00 46.23  ? 572  GLU A OE2   1 
ATOM   2695 N  N     . ASN C 3 277 ? 39.612  43.580 47.822  1.00 32.18  ? 573  ASN A N     1 
ATOM   2696 C  CA    . ASN C 3 277 ? 40.351  43.632 46.566  1.00 31.89  ? 573  ASN A CA    1 
ATOM   2697 C  C     . ASN C 3 277 ? 39.923  42.543 45.587  1.00 30.03  ? 573  ASN A C     1 
ATOM   2698 O  O     . ASN C 3 277 ? 40.015  42.724 44.374  1.00 30.04  ? 573  ASN A O     1 
ATOM   2699 C  CB    . ASN C 3 277 ? 41.851  43.532 46.836  1.00 32.45  ? 573  ASN A CB    1 
ATOM   2700 C  CG    . ASN C 3 277 ? 42.423  44.820 47.387  1.00 34.68  ? 573  ASN A CG    1 
ATOM   2701 O  OD1   . ASN C 3 277 ? 42.495  45.828 46.682  1.00 33.56  ? 573  ASN A OD1   1 
ATOM   2702 N  ND2   . ASN C 3 277 ? 42.822  44.800 48.654  1.00 32.69  ? 573  ASN A ND2   1 
ATOM   2703 N  N     . ILE C 3 278 ? 39.458  41.414 46.111  1.00 28.67  ? 574  ILE A N     1 
ATOM   2704 C  CA    . ILE C 3 278 ? 38.995  40.325 45.262  1.00 27.51  ? 574  ILE A CA    1 
ATOM   2705 C  C     . ILE C 3 278 ? 37.632  40.684 44.673  1.00 27.23  ? 574  ILE A C     1 
ATOM   2706 O  O     . ILE C 3 278 ? 37.352  40.387 43.515  1.00 27.68  ? 574  ILE A O     1 
ATOM   2707 C  CB    . ILE C 3 278 ? 38.884  38.999 46.054  1.00 27.17  ? 574  ILE A CB    1 
ATOM   2708 C  CG1   . ILE C 3 278 ? 40.286  38.490 46.391  1.00 27.83  ? 574  ILE A CG1   1 
ATOM   2709 C  CG2   . ILE C 3 278 ? 38.118  37.954 45.239  1.00 22.70  ? 574  ILE A CG2   1 
ATOM   2710 C  CD1   . ILE C 3 278 ? 40.299  37.302 47.327  1.00 30.91  ? 574  ILE A CD1   1 
ATOM   2711 N  N     . LEU C 3 279 ? 36.791  41.327 45.474  1.00 27.37  ? 575  LEU A N     1 
ATOM   2712 C  CA    . LEU C 3 279 ? 35.467  41.733 45.017  1.00 28.73  ? 575  LEU A CA    1 
ATOM   2713 C  C     . LEU C 3 279 ? 35.603  42.770 43.911  1.00 28.17  ? 575  LEU A C     1 
ATOM   2714 O  O     . LEU C 3 279 ? 34.904  42.713 42.907  1.00 29.96  ? 575  LEU A O     1 
ATOM   2715 C  CB    . LEU C 3 279 ? 34.666  42.331 46.176  1.00 28.84  ? 575  LEU A CB    1 
ATOM   2716 C  CG    . LEU C 3 279 ? 34.181  41.370 47.259  1.00 29.15  ? 575  LEU A CG    1 
ATOM   2717 C  CD1   . LEU C 3 279 ? 33.762  42.156 48.492  1.00 31.21  ? 575  LEU A CD1   1 
ATOM   2718 C  CD2   . LEU C 3 279 ? 33.030  40.543 46.720  1.00 25.90  ? 575  LEU A CD2   1 
ATOM   2719 N  N     . HIS C 3 280 ? 36.511  43.716 44.100  1.00 27.99  ? 576  HIS A N     1 
ATOM   2720 C  CA    . HIS C 3 280 ? 36.717  44.768 43.119  1.00 29.10  ? 576  HIS A CA    1 
ATOM   2721 C  C     . HIS C 3 280 ? 37.289  44.161 41.852  1.00 28.64  ? 576  HIS A C     1 
ATOM   2722 O  O     . HIS C 3 280 ? 36.890  44.516 40.743  1.00 28.85  ? 576  HIS A O     1 
ATOM   2723 C  CB    . HIS C 3 280 ? 37.685  45.813 43.665  1.00 30.47  ? 576  HIS A CB    1 
ATOM   2724 C  CG    . HIS C 3 280 ? 37.768  47.053 42.831  1.00 33.31  ? 576  HIS A CG    1 
ATOM   2725 N  ND1   . HIS C 3 280 ? 38.955  47.722 42.607  1.00 33.80  ? 576  HIS A ND1   1 
ATOM   2726 C  CD2   . HIS C 3 280 ? 36.809  47.757 42.184  1.00 33.54  ? 576  HIS A CD2   1 
ATOM   2727 C  CE1   . HIS C 3 280 ? 38.724  48.784 41.856  1.00 34.30  ? 576  HIS A CE1   1 
ATOM   2728 N  NE2   . HIS C 3 280 ? 37.430  48.828 41.586  1.00 34.48  ? 576  HIS A NE2   1 
ATOM   2729 N  N     . TYR C 3 281 ? 38.229  43.239 42.032  1.00 26.48  ? 577  TYR A N     1 
ATOM   2730 C  CA    . TYR C 3 281 ? 38.870  42.556 40.919  1.00 24.59  ? 577  TYR A CA    1 
ATOM   2731 C  C     . TYR C 3 281 ? 37.817  41.846 40.069  1.00 22.91  ? 577  TYR A C     1 
ATOM   2732 O  O     . TYR C 3 281 ? 37.872  41.877 38.846  1.00 20.29  ? 577  TYR A O     1 
ATOM   2733 C  CB    . TYR C 3 281 ? 39.871  41.530 41.445  1.00 22.69  ? 577  TYR A CB    1 
ATOM   2734 C  CG    . TYR C 3 281 ? 40.528  40.739 40.346  1.00 26.07  ? 577  TYR A CG    1 
ATOM   2735 C  CD1   . TYR C 3 281 ? 41.594  41.269 39.622  1.00 26.33  ? 577  TYR A CD1   1 
ATOM   2736 C  CD2   . TYR C 3 281 ? 40.069  39.467 40.011  1.00 26.33  ? 577  TYR A CD2   1 
ATOM   2737 C  CE1   . TYR C 3 281 ? 42.186  40.551 38.587  1.00 26.99  ? 577  TYR A CE1   1 
ATOM   2738 C  CE2   . TYR C 3 281 ? 40.652  38.743 38.980  1.00 27.84  ? 577  TYR A CE2   1 
ATOM   2739 C  CZ    . TYR C 3 281 ? 41.710  39.291 38.271  1.00 27.65  ? 577  TYR A CZ    1 
ATOM   2740 O  OH    . TYR C 3 281 ? 42.278  38.582 37.237  1.00 31.30  ? 577  TYR A OH    1 
ATOM   2741 N  N     . ARG C 3 282 ? 36.860  41.202 40.725  1.00 24.54  ? 578  ARG A N     1 
ATOM   2742 C  CA    . ARG C 3 282 ? 35.807  40.495 40.004  1.00 26.47  ? 578  ARG A CA    1 
ATOM   2743 C  C     . ARG C 3 282 ? 34.875  41.447 39.270  1.00 26.66  ? 578  ARG A C     1 
ATOM   2744 O  O     . ARG C 3 282 ? 34.371  41.121 38.197  1.00 27.25  ? 578  ARG A O     1 
ATOM   2745 C  CB    . ARG C 3 282 ? 34.995  39.627 40.957  1.00 26.15  ? 578  ARG A CB    1 
ATOM   2746 C  CG    . ARG C 3 282 ? 35.686  38.340 41.332  1.00 27.20  ? 578  ARG A CG    1 
ATOM   2747 C  CD    . ARG C 3 282 ? 34.736  37.434 42.069  1.00 28.79  ? 578  ARG A CD    1 
ATOM   2748 N  NE    . ARG C 3 282 ? 35.348  36.158 42.411  1.00 26.48  ? 578  ARG A NE    1 
ATOM   2749 C  CZ    . ARG C 3 282 ? 34.784  35.266 43.212  1.00 25.72  ? 578  ARG A CZ    1 
ATOM   2750 N  NH1   . ARG C 3 282 ? 33.598  35.526 43.746  1.00 26.74  ? 578  ARG A NH1   1 
ATOM   2751 N  NH2   . ARG C 3 282 ? 35.398  34.119 43.478  1.00 26.09  ? 578  ARG A NH2   1 
ATOM   2752 N  N     . GLN C 3 283 ? 34.643  42.623 39.845  1.00 27.59  ? 579  GLN A N     1 
ATOM   2753 C  CA    . GLN C 3 283 ? 33.774  43.600 39.203  1.00 28.82  ? 579  GLN A CA    1 
ATOM   2754 C  C     . GLN C 3 283 ? 34.404  44.048 37.882  1.00 27.82  ? 579  GLN A C     1 
ATOM   2755 O  O     . GLN C 3 283 ? 33.772  43.981 36.828  1.00 27.13  ? 579  GLN A O     1 
ATOM   2756 C  CB    . GLN C 3 283 ? 33.561  44.821 40.113  1.00 30.27  ? 579  GLN A CB    1 
ATOM   2757 C  CG    . GLN C 3 283 ? 32.572  45.838 39.534  1.00 32.58  ? 579  GLN A CG    1 
ATOM   2758 C  CD    . GLN C 3 283 ? 32.599  47.190 40.238  1.00 34.38  ? 579  GLN A CD    1 
ATOM   2759 O  OE1   . GLN C 3 283 ? 33.382  47.419 41.156  1.00 37.23  ? 579  GLN A OE1   1 
ATOM   2760 N  NE2   . GLN C 3 283 ? 31.732  48.099 39.794  1.00 35.62  ? 579  GLN A NE2   1 
ATOM   2761 N  N     . LEU C 3 284 ? 35.654  44.494 37.948  1.00 27.16  ? 580  LEU A N     1 
ATOM   2762 C  CA    . LEU C 3 284 ? 36.366  44.961 36.762  1.00 27.22  ? 580  LEU A CA    1 
ATOM   2763 C  C     . LEU C 3 284 ? 36.516  43.837 35.749  1.00 26.42  ? 580  LEU A C     1 
ATOM   2764 O  O     . LEU C 3 284 ? 36.315  44.034 34.549  1.00 26.11  ? 580  LEU A O     1 
ATOM   2765 C  CB    . LEU C 3 284 ? 37.750  45.490 37.148  1.00 29.70  ? 580  LEU A CB    1 
ATOM   2766 C  CG    . LEU C 3 284 ? 37.829  46.657 38.134  1.00 30.89  ? 580  LEU A CG    1 
ATOM   2767 C  CD1   . LEU C 3 284 ? 39.285  46.952 38.440  1.00 31.89  ? 580  LEU A CD1   1 
ATOM   2768 C  CD2   . LEU C 3 284 ? 37.143  47.887 37.558  1.00 32.81  ? 580  LEU A CD2   1 
ATOM   2769 N  N     . GLY C 3 285 ? 36.870  42.656 36.243  1.00 25.98  ? 581  GLY A N     1 
ATOM   2770 C  CA    . GLY C 3 285 ? 37.044  41.508 35.375  1.00 25.10  ? 581  GLY A CA    1 
ATOM   2771 C  C     . GLY C 3 285 ? 35.818  41.173 34.548  1.00 24.80  ? 581  GLY A C     1 
ATOM   2772 O  O     . GLY C 3 285 ? 35.940  40.790 33.386  1.00 24.63  ? 581  GLY A O     1 
ATOM   2773 N  N     . LYS C 3 286 ? 34.636  41.308 35.139  1.00 25.15  ? 582  LYS A N     1 
ATOM   2774 C  CA    . LYS C 3 286 ? 33.397  41.014 34.427  1.00 27.29  ? 582  LYS A CA    1 
ATOM   2775 C  C     . LYS C 3 286 ? 33.178  42.030 33.308  1.00 26.28  ? 582  LYS A C     1 
ATOM   2776 O  O     . LYS C 3 286 ? 32.812  41.671 32.192  1.00 25.38  ? 582  LYS A O     1 
ATOM   2777 C  CB    . LYS C 3 286 ? 32.211  41.042 35.398  1.00 31.43  ? 582  LYS A CB    1 
ATOM   2778 C  CG    . LYS C 3 286 ? 30.865  40.722 34.759  1.00 37.88  ? 582  LYS A CG    1 
ATOM   2779 C  CD    . LYS C 3 286 ? 30.863  39.348 34.091  1.00 40.90  ? 582  LYS A CD    1 
ATOM   2780 C  CE    . LYS C 3 286 ? 29.516  39.060 33.436  1.00 43.14  ? 582  LYS A CE    1 
ATOM   2781 N  NZ    . LYS C 3 286 ? 29.504  37.778 32.672  1.00 44.48  ? 582  LYS A NZ    1 
ATOM   2782 N  N     . LEU C 3 287 ? 33.408  43.301 33.611  1.00 25.60  ? 583  LEU A N     1 
ATOM   2783 C  CA    . LEU C 3 287 ? 33.236  44.354 32.620  1.00 25.69  ? 583  LEU A CA    1 
ATOM   2784 C  C     . LEU C 3 287 ? 34.205  44.171 31.456  1.00 26.31  ? 583  LEU A C     1 
ATOM   2785 O  O     . LEU C 3 287 ? 33.818  44.283 30.289  1.00 25.30  ? 583  LEU A O     1 
ATOM   2786 C  CB    . LEU C 3 287 ? 33.460  45.727 33.259  1.00 24.23  ? 583  LEU A CB    1 
ATOM   2787 C  CG    . LEU C 3 287 ? 32.465  46.158 34.341  1.00 24.28  ? 583  LEU A CG    1 
ATOM   2788 C  CD1   . LEU C 3 287 ? 32.925  47.467 34.965  1.00 22.08  ? 583  LEU A CD1   1 
ATOM   2789 C  CD2   . LEU C 3 287 ? 31.069  46.308 33.734  1.00 22.67  ? 583  LEU A CD2   1 
ATOM   2790 N  N     . GLN C 3 288 ? 35.461  43.875 31.779  1.00 27.06  ? 584  GLN A N     1 
ATOM   2791 C  CA    . GLN C 3 288 ? 36.493  43.698 30.762  1.00 27.34  ? 584  GLN A CA    1 
ATOM   2792 C  C     . GLN C 3 288 ? 36.216  42.528 29.828  1.00 28.14  ? 584  GLN A C     1 
ATOM   2793 O  O     . GLN C 3 288 ? 36.167  42.692 28.609  1.00 27.08  ? 584  GLN A O     1 
ATOM   2794 C  CB    . GLN C 3 288 ? 37.861  43.504 31.429  1.00 27.92  ? 584  GLN A CB    1 
ATOM   2795 C  CG    . GLN C 3 288 ? 39.040  43.425 30.460  1.00 29.25  ? 584  GLN A CG    1 
ATOM   2796 C  CD    . GLN C 3 288 ? 39.305  44.745 29.739  1.00 30.46  ? 584  GLN A CD    1 
ATOM   2797 O  OE1   . GLN C 3 288 ? 38.437  45.269 29.037  1.00 30.45  ? 584  GLN A OE1   1 
ATOM   2798 N  NE2   . GLN C 3 288 ? 40.509  45.285 29.911  1.00 27.89  ? 584  GLN A NE2   1 
ATOM   2799 N  N     . SER C 3 289 ? 36.023  41.349 30.407  1.00 27.24  ? 585  SER A N     1 
ATOM   2800 C  CA    . SER C 3 289 ? 35.783  40.142 29.629  1.00 28.91  ? 585  SER A CA    1 
ATOM   2801 C  C     . SER C 3 289 ? 34.461  40.093 28.869  1.00 28.82  ? 585  SER A C     1 
ATOM   2802 O  O     . SER C 3 289 ? 34.437  39.815 27.670  1.00 27.90  ? 585  SER A O     1 
ATOM   2803 C  CB    . SER C 3 289 ? 35.858  38.917 30.539  1.00 31.05  ? 585  SER A CB    1 
ATOM   2804 O  OG    . SER C 3 289 ? 34.663  38.791 31.297  1.00 33.69  ? 585  SER A OG    1 
ATOM   2805 N  N     . THR C 3 290 ? 33.365  40.361 29.570  1.00 29.23  ? 586  THR A N     1 
ATOM   2806 C  CA    . THR C 3 290 ? 32.035  40.292 28.972  1.00 29.41  ? 586  THR A CA    1 
ATOM   2807 C  C     . THR C 3 290 ? 31.537  41.509 28.199  1.00 29.43  ? 586  THR A C     1 
ATOM   2808 O  O     . THR C 3 290 ? 31.030  41.369 27.087  1.00 29.66  ? 586  THR A O     1 
ATOM   2809 C  CB    . THR C 3 290 ? 30.976  39.968 30.042  1.00 30.73  ? 586  THR A CB    1 
ATOM   2810 O  OG1   . THR C 3 290 ? 31.310  38.732 30.685  1.00 30.07  ? 586  THR A OG1   1 
ATOM   2811 C  CG2   . THR C 3 290 ? 29.591  39.852 29.409  1.00 29.16  ? 586  THR A CG2   1 
ATOM   2812 N  N     . TYR C 3 291 ? 31.681  42.696 28.777  1.00 27.91  ? 587  TYR A N     1 
ATOM   2813 C  CA    . TYR C 3 291 ? 31.167  43.896 28.130  1.00 28.71  ? 587  TYR A CA    1 
ATOM   2814 C  C     . TYR C 3 291 ? 32.115  44.721 27.277  1.00 28.70  ? 587  TYR A C     1 
ATOM   2815 O  O     . TYR C 3 291 ? 31.676  45.623 26.561  1.00 31.33  ? 587  TYR A O     1 
ATOM   2816 C  CB    . TYR C 3 291 ? 30.495  44.777 29.181  1.00 27.05  ? 587  TYR A CB    1 
ATOM   2817 C  CG    . TYR C 3 291 ? 29.392  44.038 29.896  1.00 27.55  ? 587  TYR A CG    1 
ATOM   2818 C  CD1   . TYR C 3 291 ? 29.569  43.562 31.196  1.00 26.96  ? 587  TYR A CD1   1 
ATOM   2819 C  CD2   . TYR C 3 291 ? 28.175  43.787 29.260  1.00 27.72  ? 587  TYR A CD2   1 
ATOM   2820 C  CE1   . TYR C 3 291 ? 28.558  42.852 31.846  1.00 28.14  ? 587  TYR A CE1   1 
ATOM   2821 C  CE2   . TYR C 3 291 ? 27.159  43.075 29.896  1.00 26.85  ? 587  TYR A CE2   1 
ATOM   2822 C  CZ    . TYR C 3 291 ? 27.357  42.612 31.185  1.00 27.07  ? 587  TYR A CZ    1 
ATOM   2823 O  OH    . TYR C 3 291 ? 26.358  41.905 31.808  1.00 28.15  ? 587  TYR A OH    1 
ATOM   2824 N  N     . ILE C 3 292 ? 33.407  44.430 27.345  1.00 26.72  ? 588  ILE A N     1 
ATOM   2825 C  CA    . ILE C 3 292 ? 34.358  45.163 26.527  1.00 25.29  ? 588  ILE A CA    1 
ATOM   2826 C  C     . ILE C 3 292 ? 34.828  44.256 25.398  1.00 24.89  ? 588  ILE A C     1 
ATOM   2827 O  O     . ILE C 3 292 ? 34.541  44.512 24.229  1.00 23.87  ? 588  ILE A O     1 
ATOM   2828 C  CB    . ILE C 3 292 ? 35.582  45.634 27.343  1.00 25.23  ? 588  ILE A CB    1 
ATOM   2829 C  CG1   . ILE C 3 292 ? 35.131  46.541 28.490  1.00 23.60  ? 588  ILE A CG1   1 
ATOM   2830 C  CG2   . ILE C 3 292 ? 36.552  46.378 26.431  1.00 23.13  ? 588  ILE A CG2   1 
ATOM   2831 C  CD1   . ILE C 3 292 ? 34.323  47.741 28.048  1.00 25.75  ? 588  ILE A CD1   1 
ATOM   2832 N  N     . GLU C 3 293 ? 35.529  43.184 25.756  1.00 24.68  ? 589  GLU A N     1 
ATOM   2833 C  CA    . GLU C 3 293 ? 36.044  42.237 24.777  1.00 25.01  ? 589  GLU A CA    1 
ATOM   2834 C  C     . GLU C 3 293 ? 34.921  41.431 24.122  1.00 25.12  ? 589  GLU A C     1 
ATOM   2835 O  O     . GLU C 3 293 ? 34.914  41.236 22.904  1.00 24.36  ? 589  GLU A O     1 
ATOM   2836 C  CB    . GLU C 3 293 ? 37.047  41.300 25.450  1.00 27.10  ? 589  GLU A CB    1 
ATOM   2837 C  CG    . GLU C 3 293 ? 38.124  42.046 26.233  1.00 30.42  ? 589  GLU A CG    1 
ATOM   2838 C  CD    . GLU C 3 293 ? 39.123  41.120 26.901  1.00 33.17  ? 589  GLU A CD    1 
ATOM   2839 O  OE1   . GLU C 3 293 ? 38.695  40.112 27.504  1.00 36.25  ? 589  GLU A OE1   1 
ATOM   2840 O  OE2   . GLU C 3 293 ? 40.336  41.403 26.829  1.00 36.35  ? 589  GLU A OE2   1 
ATOM   2841 N  N     . GLY C 3 294 ? 33.971  40.972 24.932  1.00 24.72  ? 590  GLY A N     1 
ATOM   2842 C  CA    . GLY C 3 294 ? 32.861  40.200 24.404  1.00 24.92  ? 590  GLY A CA    1 
ATOM   2843 C  C     . GLY C 3 294 ? 32.037  40.982 23.397  1.00 25.96  ? 590  GLY A C     1 
ATOM   2844 O  O     . GLY C 3 294 ? 31.700  40.477 22.328  1.00 25.98  ? 590  GLY A O     1 
ATOM   2845 N  N     . LEU C 3 295 ? 31.715  42.223 23.741  1.00 25.99  ? 591  LEU A N     1 
ATOM   2846 C  CA    . LEU C 3 295 ? 30.927  43.080 22.865  1.00 27.00  ? 591  LEU A CA    1 
ATOM   2847 C  C     . LEU C 3 295 ? 31.678  43.352 21.562  1.00 26.49  ? 591  LEU A C     1 
ATOM   2848 O  O     . LEU C 3 295 ? 31.122  43.226 20.469  1.00 25.69  ? 591  LEU A O     1 
ATOM   2849 C  CB    . LEU C 3 295 ? 30.627  44.399 23.581  1.00 28.13  ? 591  LEU A CB    1 
ATOM   2850 C  CG    . LEU C 3 295 ? 29.439  45.229 23.103  1.00 29.90  ? 591  LEU A CG    1 
ATOM   2851 C  CD1   . LEU C 3 295 ? 28.164  44.391 23.129  1.00 29.21  ? 591  LEU A CD1   1 
ATOM   2852 C  CD2   . LEU C 3 295 ? 29.295  46.443 24.004  1.00 30.71  ? 591  LEU A CD2   1 
ATOM   2853 N  N     . LEU C 3 296 ? 32.949  43.719 21.683  1.00 26.33  ? 592  LEU A N     1 
ATOM   2854 C  CA    . LEU C 3 296 ? 33.765  44.014 20.516  1.00 26.41  ? 592  LEU A CA    1 
ATOM   2855 C  C     . LEU C 3 296 ? 33.826  42.849 19.531  1.00 26.54  ? 592  LEU A C     1 
ATOM   2856 O  O     . LEU C 3 296 ? 33.948  43.058 18.326  1.00 26.01  ? 592  LEU A O     1 
ATOM   2857 C  CB    . LEU C 3 296 ? 35.176  44.424 20.959  1.00 26.12  ? 592  LEU A CB    1 
ATOM   2858 C  CG    . LEU C 3 296 ? 35.243  45.788 21.664  1.00 26.70  ? 592  LEU A CG    1 
ATOM   2859 C  CD1   . LEU C 3 296 ? 36.600  45.987 22.311  1.00 26.16  ? 592  LEU A CD1   1 
ATOM   2860 C  CD2   . LEU C 3 296 ? 34.972  46.891 20.660  1.00 25.29  ? 592  LEU A CD2   1 
ATOM   2861 N  N     . LYS C 3 297 ? 33.717  41.624 20.040  1.00 26.51  ? 593  LYS A N     1 
ATOM   2862 C  CA    . LYS C 3 297 ? 33.761  40.436 19.189  1.00 27.54  ? 593  LYS A CA    1 
ATOM   2863 C  C     . LYS C 3 297 ? 32.551  40.276 18.274  1.00 26.38  ? 593  LYS A C     1 
ATOM   2864 O  O     . LYS C 3 297 ? 32.650  39.646 17.220  1.00 26.77  ? 593  LYS A O     1 
ATOM   2865 C  CB    . LYS C 3 297 ? 33.888  39.162 20.035  1.00 29.80  ? 593  LYS A CB    1 
ATOM   2866 C  CG    . LYS C 3 297 ? 35.152  39.078 20.862  1.00 35.00  ? 593  LYS A CG    1 
ATOM   2867 C  CD    . LYS C 3 297 ? 35.324  37.689 21.464  1.00 37.35  ? 593  LYS A CD    1 
ATOM   2868 C  CE    . LYS C 3 297 ? 36.534  37.653 22.386  1.00 40.11  ? 593  LYS A CE    1 
ATOM   2869 N  NZ    . LYS C 3 297 ? 37.731  38.278 21.751  1.00 42.11  ? 593  LYS A NZ    1 
ATOM   2870 N  N     . VAL C 3 298 ? 31.411  40.834 18.666  1.00 24.02  ? 594  VAL A N     1 
ATOM   2871 C  CA    . VAL C 3 298 ? 30.211  40.690 17.852  1.00 23.49  ? 594  VAL A CA    1 
ATOM   2872 C  C     . VAL C 3 298 ? 29.813  41.918 17.036  1.00 23.19  ? 594  VAL A C     1 
ATOM   2873 O  O     . VAL C 3 298 ? 28.818  41.882 16.313  1.00 22.10  ? 594  VAL A O     1 
ATOM   2874 C  CB    . VAL C 3 298 ? 29.004  40.247 18.713  1.00 24.33  ? 594  VAL A CB    1 
ATOM   2875 C  CG1   . VAL C 3 298 ? 29.243  38.841 19.242  1.00 25.56  ? 594  VAL A CG1   1 
ATOM   2876 C  CG2   . VAL C 3 298 ? 28.794  41.213 19.862  1.00 22.91  ? 594  VAL A CG2   1 
ATOM   2877 N  N     . VAL C 3 299 ? 30.579  43.000 17.149  1.00 21.87  ? 595  VAL A N     1 
ATOM   2878 C  CA    . VAL C 3 299 ? 30.282  44.203 16.379  1.00 22.22  ? 595  VAL A CA    1 
ATOM   2879 C  C     . VAL C 3 299 ? 30.673  43.952 14.921  1.00 21.70  ? 595  VAL A C     1 
ATOM   2880 O  O     . VAL C 3 299 ? 31.711  43.352 14.650  1.00 21.14  ? 595  VAL A O     1 
ATOM   2881 C  CB    . VAL C 3 299 ? 31.081  45.420 16.889  1.00 23.04  ? 595  VAL A CB    1 
ATOM   2882 C  CG1   . VAL C 3 299 ? 30.832  46.624 15.983  1.00 21.53  ? 595  VAL A CG1   1 
ATOM   2883 C  CG2   . VAL C 3 299 ? 30.680  45.747 18.317  1.00 24.27  ? 595  VAL A CG2   1 
ATOM   2884 N  N     . ARG C 3 300 ? 29.848  44.404 13.985  1.00 22.18  ? 596  ARG A N     1 
ATOM   2885 C  CA    . ARG C 3 300 ? 30.154  44.222 12.567  1.00 21.61  ? 596  ARG A CA    1 
ATOM   2886 C  C     . ARG C 3 300 ? 31.222  45.248 12.208  1.00 21.54  ? 596  ARG A C     1 
ATOM   2887 O  O     . ARG C 3 300 ? 31.023  46.444 12.395  1.00 22.14  ? 596  ARG A O     1 
ATOM   2888 C  CB    . ARG C 3 300 ? 28.905  44.454 11.719  1.00 21.41  ? 596  ARG A CB    1 
ATOM   2889 C  CG    . ARG C 3 300 ? 27.735  43.576 12.119  1.00 23.43  ? 596  ARG A CG    1 
ATOM   2890 C  CD    . ARG C 3 300 ? 27.708  42.288 11.336  1.00 23.74  ? 596  ARG A CD    1 
ATOM   2891 N  NE    . ARG C 3 300 ? 27.062  41.212 12.078  1.00 26.86  ? 596  ARG A NE    1 
ATOM   2892 C  CZ    . ARG C 3 300 ? 26.678  40.059 11.538  1.00 25.22  ? 596  ARG A CZ    1 
ATOM   2893 N  NH1   . ARG C 3 300 ? 26.865  39.835 10.243  1.00 23.92  ? 596  ARG A NH1   1 
ATOM   2894 N  NH2   . ARG C 3 300 ? 26.131  39.121 12.297  1.00 25.34  ? 596  ARG A NH2   1 
ATOM   2895 N  N     . PRO C 3 301 ? 32.368  44.789 11.676  1.00 22.50  ? 597  PRO A N     1 
ATOM   2896 C  CA    . PRO C 3 301 ? 33.474  45.678 11.298  1.00 22.53  ? 597  PRO A CA    1 
ATOM   2897 C  C     . PRO C 3 301 ? 33.088  46.761 10.291  1.00 22.97  ? 597  PRO A C     1 
ATOM   2898 O  O     . PRO C 3 301 ? 33.583  47.886 10.360  1.00 25.73  ? 597  PRO A O     1 
ATOM   2899 C  CB    . PRO C 3 301 ? 34.529  44.718 10.744  1.00 23.64  ? 597  PRO A CB    1 
ATOM   2900 C  CG    . PRO C 3 301 ? 34.172  43.390 11.358  1.00 23.05  ? 597  PRO A CG    1 
ATOM   2901 C  CD    . PRO C 3 301 ? 32.675  43.395 11.318  1.00 21.92  ? 597  PRO A CD    1 
ATOM   2902 N  N     . ASP C 3 302 ? 32.199  46.417 9.364   1.00 21.94  ? 598  ASP A N     1 
ATOM   2903 C  CA    . ASP C 3 302 ? 31.774  47.348 8.327   1.00 24.25  ? 598  ASP A CA    1 
ATOM   2904 C  C     . ASP C 3 302 ? 30.783  48.427 8.752   1.00 25.44  ? 598  ASP A C     1 
ATOM   2905 O  O     . ASP C 3 302 ? 30.878  49.568 8.294   1.00 26.84  ? 598  ASP A O     1 
ATOM   2906 C  CB    . ASP C 3 302 ? 31.219  46.566 7.129   1.00 24.34  ? 598  ASP A CB    1 
ATOM   2907 C  CG    . ASP C 3 302 ? 30.094  45.612 7.512   1.00 24.76  ? 598  ASP A CG    1 
ATOM   2908 O  OD1   . ASP C 3 302 ? 30.193  44.943 8.563   1.00 21.71  ? 598  ASP A OD1   1 
ATOM   2909 O  OD2   . ASP C 3 302 ? 29.112  45.526 6.746   1.00 23.87  ? 598  ASP A OD2   1 
ATOM   2910 N  N     . THR C 3 303 ? 29.841  48.087 9.624   1.00 25.31  ? 599  THR A N     1 
ATOM   2911 C  CA    . THR C 3 303 ? 28.851  49.065 10.064  1.00 24.18  ? 599  THR A CA    1 
ATOM   2912 C  C     . THR C 3 303 ? 29.006  49.510 11.512  1.00 23.70  ? 599  THR A C     1 
ATOM   2913 O  O     . THR C 3 303 ? 28.447  50.529 11.909  1.00 23.48  ? 599  THR A O     1 
ATOM   2914 C  CB    . THR C 3 303 ? 27.439  48.520 9.906   1.00 23.48  ? 599  THR A CB    1 
ATOM   2915 O  OG1   . THR C 3 303 ? 27.282  47.374 10.749  1.00 23.47  ? 599  THR A OG1   1 
ATOM   2916 C  CG2   . THR C 3 303 ? 27.181  48.127 8.455   1.00 24.67  ? 599  THR A CG2   1 
ATOM   2917 N  N     . LYS C 3 304 ? 29.759  48.745 12.296  1.00 22.51  ? 600  LYS A N     1 
ATOM   2918 C  CA    . LYS C 3 304 ? 29.965  49.058 13.706  1.00 23.18  ? 600  LYS A CA    1 
ATOM   2919 C  C     . LYS C 3 304 ? 28.662  48.898 14.492  1.00 21.39  ? 600  LYS A C     1 
ATOM   2920 O  O     . LYS C 3 304 ? 28.416  49.591 15.480  1.00 21.52  ? 600  LYS A O     1 
ATOM   2921 C  CB    . LYS C 3 304 ? 30.516  50.479 13.859  1.00 26.78  ? 600  LYS A CB    1 
ATOM   2922 C  CG    . LYS C 3 304 ? 31.908  50.674 13.247  1.00 30.58  ? 600  LYS A CG    1 
ATOM   2923 C  CD    . LYS C 3 304 ? 32.951  49.813 13.955  1.00 34.40  ? 600  LYS A CD    1 
ATOM   2924 C  CE    . LYS C 3 304 ? 34.378  50.118 13.483  1.00 35.59  ? 600  LYS A CE    1 
ATOM   2925 N  NZ    . LYS C 3 304 ? 34.650  49.653 12.091  1.00 37.17  ? 600  LYS A NZ    1 
ATOM   2926 N  N     . LYS C 3 305 ? 27.827  47.971 14.039  1.00 20.10  ? 601  LYS A N     1 
ATOM   2927 C  CA    . LYS C 3 305 ? 26.562  47.688 14.703  1.00 20.50  ? 601  LYS A CA    1 
ATOM   2928 C  C     . LYS C 3 305 ? 26.556  46.283 15.279  1.00 17.91  ? 601  LYS A C     1 
ATOM   2929 O  O     . LYS C 3 305 ? 27.243  45.393 14.774  1.00 18.26  ? 601  LYS A O     1 
ATOM   2930 C  CB    . LYS C 3 305 ? 25.391  47.791 13.720  1.00 18.90  ? 601  LYS A CB    1 
ATOM   2931 C  CG    . LYS C 3 305 ? 24.991  49.201 13.317  1.00 22.28  ? 601  LYS A CG    1 
ATOM   2932 C  CD    . LYS C 3 305 ? 23.811  49.153 12.357  1.00 21.02  ? 601  LYS A CD    1 
ATOM   2933 C  CE    . LYS C 3 305 ? 23.223  50.541 12.147  1.00 24.24  ? 601  LYS A CE    1 
ATOM   2934 N  NZ    . LYS C 3 305 ? 21.968  50.491 11.348  1.00 23.89  ? 601  LYS A NZ    1 
ATOM   2935 N  N     . VAL C 3 306 ? 25.787  46.093 16.344  1.00 16.55  ? 602  VAL A N     1 
ATOM   2936 C  CA    . VAL C 3 306 ? 25.620  44.767 16.918  1.00 16.10  ? 602  VAL A CA    1 
ATOM   2937 C  C     . VAL C 3 306 ? 24.181  44.396 16.572  1.00 15.06  ? 602  VAL A C     1 
ATOM   2938 O  O     . VAL C 3 306 ? 23.267  45.213 16.730  1.00 16.90  ? 602  VAL A O     1 
ATOM   2939 C  CB    . VAL C 3 306 ? 25.814  44.732 18.457  1.00 14.42  ? 602  VAL A CB    1 
ATOM   2940 C  CG1   . VAL C 3 306 ? 27.272  44.981 18.796  1.00 18.37  ? 602  VAL A CG1   1 
ATOM   2941 C  CG2   . VAL C 3 306 ? 24.920  45.750 19.137  1.00 17.22  ? 602  VAL A CG2   1 
ATOM   2942 N  N     . HIS C 3 307 ? 23.983  43.175 16.085  1.00 13.38  ? 603  HIS A N     1 
ATOM   2943 C  CA    . HIS C 3 307 ? 22.655  42.700 15.709  1.00 13.64  ? 603  HIS A CA    1 
ATOM   2944 C  C     . HIS C 3 307 ? 22.255  41.513 16.590  1.00 13.56  ? 603  HIS A C     1 
ATOM   2945 O  O     . HIS C 3 307 ? 22.602  40.362 16.303  1.00 12.53  ? 603  HIS A O     1 
ATOM   2946 C  CB    . HIS C 3 307 ? 22.645  42.279 14.234  1.00 14.22  ? 603  HIS A CB    1 
ATOM   2947 C  CG    . HIS C 3 307 ? 22.905  43.402 13.274  1.00 14.69  ? 603  HIS A CG    1 
ATOM   2948 N  ND1   . HIS C 3 307 ? 21.892  44.115 12.666  1.00 14.61  ? 603  HIS A ND1   1 
ATOM   2949 C  CD2   . HIS C 3 307 ? 24.064  43.947 12.830  1.00 14.72  ? 603  HIS A CD2   1 
ATOM   2950 C  CE1   . HIS C 3 307 ? 22.414  45.049 11.891  1.00 15.32  ? 603  HIS A CE1   1 
ATOM   2951 N  NE2   . HIS C 3 307 ? 23.731  44.970 11.973  1.00 16.33  ? 603  HIS A NE2   1 
ATOM   2952 N  N     . THR C 3 308 ? 21.527  41.798 17.664  1.00 13.93  ? 604  THR A N     1 
ATOM   2953 C  CA    . THR C 3 308 ? 21.084  40.757 18.586  1.00 14.44  ? 604  THR A CA    1 
ATOM   2954 C  C     . THR C 3 308 ? 20.016  39.887 17.937  1.00 14.88  ? 604  THR A C     1 
ATOM   2955 O  O     . THR C 3 308 ? 19.490  40.215 16.873  1.00 15.78  ? 604  THR A O     1 
ATOM   2956 C  CB    . THR C 3 308 ? 20.480  41.368 19.882  1.00 14.14  ? 604  THR A CB    1 
ATOM   2957 O  OG1   . THR C 3 308 ? 20.279  40.337 20.857  1.00 14.20  ? 604  THR A OG1   1 
ATOM   2958 C  CG2   . THR C 3 308 ? 19.130  42.023 19.590  1.00 11.27  ? 604  THR A CG2   1 
ATOM   2959 N  N     . ILE C 3 309 ? 19.708  38.769 18.584  1.00 13.60  ? 605  ILE A N     1 
ATOM   2960 C  CA    . ILE C 3 309 ? 18.656  37.882 18.116  1.00 13.90  ? 605  ILE A CA    1 
ATOM   2961 C  C     . ILE C 3 309 ? 17.744  37.649 19.320  1.00 14.84  ? 605  ILE A C     1 
ATOM   2962 O  O     . ILE C 3 309 ? 18.181  37.117 20.345  1.00 14.17  ? 605  ILE A O     1 
ATOM   2963 C  CB    . ILE C 3 309 ? 19.217  36.537 17.597  1.00 16.01  ? 605  ILE A CB    1 
ATOM   2964 C  CG1   . ILE C 3 309 ? 19.945  36.767 16.261  1.00 14.81  ? 605  ILE A CG1   1 
ATOM   2965 C  CG2   . ILE C 3 309 ? 18.078  35.524 17.415  1.00 14.91  ? 605  ILE A CG2   1 
ATOM   2966 C  CD1   . ILE C 3 309 ? 20.468  35.501 15.602  1.00 16.30  ? 605  ILE A CD1   1 
ATOM   2967 N  N     . PHE C 3 310 ? 16.486  38.067 19.207  1.00 13.23  ? 606  PHE A N     1 
ATOM   2968 C  CA    . PHE C 3 310 ? 15.541  37.878 20.306  1.00 14.82  ? 606  PHE A CA    1 
ATOM   2969 C  C     . PHE C 3 310 ? 14.873  36.521 20.207  1.00 16.46  ? 606  PHE A C     1 
ATOM   2970 O  O     . PHE C 3 310 ? 14.175  36.251 19.233  1.00 17.64  ? 606  PHE A O     1 
ATOM   2971 C  CB    . PHE C 3 310 ? 14.434  38.936 20.291  1.00 13.81  ? 606  PHE A CB    1 
ATOM   2972 C  CG    . PHE C 3 310 ? 14.911  40.327 20.567  1.00 14.47  ? 606  PHE A CG    1 
ATOM   2973 C  CD1   . PHE C 3 310 ? 15.090  41.236 19.526  1.00 13.98  ? 606  PHE A CD1   1 
ATOM   2974 C  CD2   . PHE C 3 310 ? 15.180  40.734 21.869  1.00 14.01  ? 606  PHE A CD2   1 
ATOM   2975 C  CE1   . PHE C 3 310 ? 15.532  42.538 19.781  1.00 15.34  ? 606  PHE A CE1   1 
ATOM   2976 C  CE2   . PHE C 3 310 ? 15.623  42.033 22.134  1.00 16.23  ? 606  PHE A CE2   1 
ATOM   2977 C  CZ    . PHE C 3 310 ? 15.799  42.937 21.083  1.00 15.70  ? 606  PHE A CZ    1 
ATOM   2978 N  N     . ASN C 3 311 ? 15.081  35.665 21.200  1.00 15.30  ? 607  ASN A N     1 
ATOM   2979 C  CA    . ASN C 3 311 ? 14.425  34.372 21.171  1.00 14.44  ? 607  ASN A CA    1 
ATOM   2980 C  C     . ASN C 3 311 ? 13.014  34.633 21.688  1.00 14.56  ? 607  ASN A C     1 
ATOM   2981 O  O     . ASN C 3 311 ? 12.820  34.985 22.855  1.00 14.86  ? 607  ASN A O     1 
ATOM   2982 C  CB    . ASN C 3 311 ? 15.138  33.367 22.070  1.00 16.02  ? 607  ASN A CB    1 
ATOM   2983 C  CG    . ASN C 3 311 ? 14.734  31.941 21.764  1.00 15.83  ? 607  ASN A CG    1 
ATOM   2984 O  OD1   . ASN C 3 311 ? 13.570  31.668 21.445  1.00 14.56  ? 607  ASN A OD1   1 
ATOM   2985 N  ND2   . ASN C 3 311 ? 15.685  31.019 21.861  1.00 14.35  ? 607  ASN A ND2   1 
ATOM   2986 N  N     . GLN C 3 312 ? 12.032  34.462 20.813  1.00 13.16  ? 608  GLN A N     1 
ATOM   2987 C  CA    . GLN C 3 312 ? 10.636  34.704 21.153  1.00 13.26  ? 608  GLN A CA    1 
ATOM   2988 C  C     . GLN C 3 312 ? 9.903   33.445 21.632  1.00 13.75  ? 608  GLN A C     1 
ATOM   2989 O  O     . GLN C 3 312 ? 8.741   33.513 22.041  1.00 13.85  ? 608  GLN A O     1 
ATOM   2990 C  CB    . GLN C 3 312 ? 9.934   35.289 19.921  1.00 14.87  ? 608  GLN A CB    1 
ATOM   2991 C  CG    . GLN C 3 312 ? 8.471   35.663 20.091  1.00 11.07  ? 608  GLN A CG    1 
ATOM   2992 C  CD    . GLN C 3 312 ? 7.884   36.208 18.804  1.00 13.99  ? 608  GLN A CD    1 
ATOM   2993 O  OE1   . GLN C 3 312 ? 8.538   36.186 17.759  1.00 14.71  ? 608  GLN A OE1   1 
ATOM   2994 N  NE2   . GLN C 3 312 ? 6.647   36.691 18.865  1.00 10.97  ? 608  GLN A NE2   1 
ATOM   2995 N  N     . ALA C 3 313 ? 10.575  32.298 21.597  1.00 11.70  ? 609  ALA A N     1 
ATOM   2996 C  CA    . ALA C 3 313 ? 9.929   31.054 22.012  1.00 13.30  ? 609  ALA A CA    1 
ATOM   2997 C  C     . ALA C 3 313 ? 10.759  30.248 22.998  1.00 15.03  ? 609  ALA A C     1 
ATOM   2998 O  O     . ALA C 3 313 ? 10.998  29.057 22.785  1.00 16.88  ? 609  ALA A O     1 
ATOM   2999 C  CB    . ALA C 3 313 ? 9.622   30.203 20.780  1.00 11.60  ? 609  ALA A CB    1 
ATOM   3000 N  N     . LEU C 3 314 ? 11.181  30.876 24.087  1.00 15.99  ? 610  LEU A N     1 
ATOM   3001 C  CA    . LEU C 3 314 ? 12.009  30.165 25.050  1.00 17.20  ? 610  LEU A CA    1 
ATOM   3002 C  C     . LEU C 3 314 ? 11.567  30.246 26.510  1.00 16.37  ? 610  LEU A C     1 
ATOM   3003 O  O     . LEU C 3 314 ? 11.357  29.215 27.139  1.00 16.03  ? 610  LEU A O     1 
ATOM   3004 C  CB    . LEU C 3 314 ? 13.470  30.631 24.920  1.00 17.89  ? 610  LEU A CB    1 
ATOM   3005 C  CG    . LEU C 3 314 ? 14.542  29.931 25.771  1.00 22.14  ? 610  LEU A CG    1 
ATOM   3006 C  CD1   . LEU C 3 314 ? 15.919  30.220 25.202  1.00 24.99  ? 610  LEU A CD1   1 
ATOM   3007 C  CD2   . LEU C 3 314 ? 14.463  30.395 27.206  1.00 23.98  ? 610  LEU A CD2   1 
ATOM   3008 N  N     . THR C 3 315 ? 11.425  31.456 27.049  1.00 16.48  ? 611  THR A N     1 
ATOM   3009 C  CA    . THR C 3 315 ? 11.046  31.610 28.454  1.00 16.44  ? 611  THR A CA    1 
ATOM   3010 C  C     . THR C 3 315 ? 9.715   30.959 28.801  1.00 17.17  ? 611  THR A C     1 
ATOM   3011 O  O     . THR C 3 315 ? 8.806   30.886 27.978  1.00 16.64  ? 611  THR A O     1 
ATOM   3012 C  CB    . THR C 3 315 ? 11.005  33.093 28.880  1.00 16.59  ? 611  THR A CB    1 
ATOM   3013 O  OG1   . THR C 3 315 ? 9.773   33.693 28.452  1.00 16.72  ? 611  THR A OG1   1 
ATOM   3014 C  CG2   . THR C 3 315 ? 12.180  33.845 28.260  1.00 15.87  ? 611  THR A CG2   1 
ATOM   3015 N  N     . GLN C 3 316 ? 9.611   30.490 30.037  1.00 16.62  ? 612  GLN A N     1 
ATOM   3016 C  CA    . GLN C 3 316 ? 8.413   29.811 30.501  1.00 17.02  ? 612  GLN A CA    1 
ATOM   3017 C  C     . GLN C 3 316 ? 7.298   30.766 30.908  1.00 16.66  ? 612  GLN A C     1 
ATOM   3018 O  O     . GLN C 3 316 ? 6.166   30.341 31.132  1.00 17.46  ? 612  GLN A O     1 
ATOM   3019 C  CB    . GLN C 3 316 ? 8.775   28.907 31.680  1.00 18.56  ? 612  GLN A CB    1 
ATOM   3020 C  CG    . GLN C 3 316 ? 9.938   27.966 31.382  1.00 22.41  ? 612  GLN A CG    1 
ATOM   3021 C  CD    . GLN C 3 316 ? 9.652   27.061 30.202  1.00 24.01  ? 612  GLN A CD    1 
ATOM   3022 O  OE1   . GLN C 3 316 ? 8.735   26.237 30.249  1.00 25.97  ? 612  GLN A OE1   1 
ATOM   3023 N  NE2   . GLN C 3 316 ? 10.429  27.216 29.128  1.00 21.23  ? 612  GLN A NE2   1 
ATOM   3024 N  N     . THR C 3 317 ? 7.616   32.054 30.990  1.00 15.97  ? 613  THR A N     1 
ATOM   3025 C  CA    . THR C 3 317 ? 6.643   33.057 31.396  1.00 16.26  ? 613  THR A CA    1 
ATOM   3026 C  C     . THR C 3 317 ? 6.123   33.949 30.266  1.00 14.49  ? 613  THR A C     1 
ATOM   3027 O  O     . THR C 3 317 ? 5.196   34.728 30.479  1.00 14.36  ? 613  THR A O     1 
ATOM   3028 C  CB    . THR C 3 317 ? 7.236   33.976 32.478  1.00 16.53  ? 613  THR A CB    1 
ATOM   3029 O  OG1   . THR C 3 317 ? 8.414   34.611 31.959  1.00 17.02  ? 613  THR A OG1   1 
ATOM   3030 C  CG2   . THR C 3 317 ? 7.602   33.173 33.728  1.00 14.82  ? 613  THR A CG2   1 
ATOM   3031 N  N     . GLY C 3 318 ? 6.711   33.846 29.077  1.00 14.42  ? 614  GLY A N     1 
ATOM   3032 C  CA    . GLY C 3 318 ? 6.265   34.678 27.970  1.00 13.31  ? 614  GLY A CA    1 
ATOM   3033 C  C     . GLY C 3 318 ? 7.209   35.830 27.657  1.00 14.84  ? 614  GLY A C     1 
ATOM   3034 O  O     . GLY C 3 318 ? 7.000   36.581 26.701  1.00 15.00  ? 614  GLY A O     1 
ATOM   3035 N  N     . ARG C 3 319 ? 8.248   35.984 28.469  1.00 14.00  ? 615  ARG A N     1 
ATOM   3036 C  CA    . ARG C 3 319 ? 9.246   37.031 28.251  1.00 14.41  ? 615  ARG A CA    1 
ATOM   3037 C  C     . ARG C 3 319 ? 10.135  36.675 27.055  1.00 15.23  ? 615  ARG A C     1 
ATOM   3038 O  O     . ARG C 3 319 ? 10.171  35.527 26.612  1.00 13.52  ? 615  ARG A O     1 
ATOM   3039 C  CB    . ARG C 3 319 ? 10.154  37.178 29.475  1.00 15.80  ? 615  ARG A CB    1 
ATOM   3040 C  CG    . ARG C 3 319 ? 9.633   38.023 30.609  1.00 17.63  ? 615  ARG A CG    1 
ATOM   3041 C  CD    . ARG C 3 319 ? 10.761  38.231 31.605  1.00 19.18  ? 615  ARG A CD    1 
ATOM   3042 N  NE    . ARG C 3 319 ? 10.419  39.175 32.659  1.00 20.24  ? 615  ARG A NE    1 
ATOM   3043 C  CZ    . ARG C 3 319 ? 11.278  39.594 33.583  1.00 23.68  ? 615  ARG A CZ    1 
ATOM   3044 N  NH1   . ARG C 3 319 ? 12.534  39.151 33.580  1.00 22.57  ? 615  ARG A NH1   1 
ATOM   3045 N  NH2   . ARG C 3 319 ? 10.882  40.454 34.512  1.00 23.42  ? 615  ARG A NH2   1 
ATOM   3046 N  N     . LEU C 3 320 ? 10.857  37.666 26.546  1.00 14.57  ? 616  LEU A N     1 
ATOM   3047 C  CA    . LEU C 3 320 ? 11.787  37.457 25.437  1.00 14.32  ? 616  LEU A CA    1 
ATOM   3048 C  C     . LEU C 3 320 ? 13.171  37.256 26.061  1.00 14.96  ? 616  LEU A C     1 
ATOM   3049 O  O     . LEU C 3 320 ? 13.382  37.599 27.228  1.00 14.83  ? 616  LEU A O     1 
ATOM   3050 C  CB    . LEU C 3 320 ? 11.851  38.703 24.532  1.00 13.56  ? 616  LEU A CB    1 
ATOM   3051 C  CG    . LEU C 3 320 ? 10.564  39.264 23.911  1.00 12.87  ? 616  LEU A CG    1 
ATOM   3052 C  CD1   . LEU C 3 320 ? 10.844  40.611 23.258  1.00 10.54  ? 616  LEU A CD1   1 
ATOM   3053 C  CD2   . LEU C 3 320 ? 10.013  38.275 22.888  1.00 9.13   ? 616  LEU A CD2   1 
ATOM   3054 N  N     . SER C 3 321 ? 14.102  36.691 25.297  1.00 13.62  ? 617  SER A N     1 
ATOM   3055 C  CA    . SER C 3 321 ? 15.486  36.564 25.760  1.00 15.29  ? 617  SER A CA    1 
ATOM   3056 C  C     . SER C 3 321 ? 16.300  37.183 24.625  1.00 14.03  ? 617  SER A C     1 
ATOM   3057 O  O     . SER C 3 321 ? 15.776  37.380 23.527  1.00 13.50  ? 617  SER A O     1 
ATOM   3058 C  CB    . SER C 3 321 ? 15.898  35.103 26.000  1.00 15.61  ? 617  SER A CB    1 
ATOM   3059 O  OG    . SER C 3 321 ? 15.823  34.336 24.816  1.00 21.77  ? 617  SER A OG    1 
ATOM   3060 N  N     . SER C 3 322 ? 17.566  37.493 24.876  1.00 14.71  ? 618  SER A N     1 
ATOM   3061 C  CA    . SER C 3 322 ? 18.415  38.124 23.866  1.00 14.63  ? 618  SER A CA    1 
ATOM   3062 C  C     . SER C 3 322 ? 19.801  37.490 23.843  1.00 14.95  ? 618  SER A C     1 
ATOM   3063 O  O     . SER C 3 322 ? 20.349  37.180 24.898  1.00 15.01  ? 618  SER A O     1 
ATOM   3064 C  CB    . SER C 3 322 ? 18.525  39.620 24.176  1.00 15.82  ? 618  SER A CB    1 
ATOM   3065 O  OG    . SER C 3 322 ? 19.483  40.269 23.354  1.00 17.51  ? 618  SER A OG    1 
ATOM   3066 N  N     . THR C 3 323 ? 20.364  37.297 22.647  1.00 16.18  ? 619  THR A N     1 
ATOM   3067 C  CA    . THR C 3 323 ? 21.693  36.690 22.511  1.00 17.64  ? 619  THR A CA    1 
ATOM   3068 C  C     . THR C 3 323 ? 22.593  37.256 21.413  1.00 17.90  ? 619  THR A C     1 
ATOM   3069 O  O     . THR C 3 323 ? 22.143  37.912 20.475  1.00 16.49  ? 619  THR A O     1 
ATOM   3070 C  CB    . THR C 3 323 ? 21.622  35.167 22.215  1.00 18.09  ? 619  THR A CB    1 
ATOM   3071 O  OG1   . THR C 3 323 ? 20.998  34.963 20.941  1.00 20.36  ? 619  THR A OG1   1 
ATOM   3072 C  CG2   . THR C 3 323 ? 20.841  34.430 23.283  1.00 18.88  ? 619  THR A CG2   1 
ATOM   3073 N  N     . GLU C 3 324 ? 23.881  36.965 21.562  1.00 19.88  ? 620  GLU A N     1 
ATOM   3074 C  CA    . GLU C 3 324 ? 24.922  37.321 20.604  1.00 21.59  ? 620  GLU A CA    1 
ATOM   3075 C  C     . GLU C 3 324 ? 24.789  38.685 19.928  1.00 19.95  ? 620  GLU A C     1 
ATOM   3076 O  O     . GLU C 3 324 ? 24.655  38.778 18.711  1.00 19.99  ? 620  GLU A O     1 
ATOM   3077 C  CB    . GLU C 3 324 ? 24.982  36.207 19.553  1.00 24.82  ? 620  GLU A CB    1 
ATOM   3078 C  CG    . GLU C 3 324 ? 26.188  36.218 18.635  1.00 31.67  ? 620  GLU A CG    1 
ATOM   3079 C  CD    . GLU C 3 324 ? 26.272  34.948 17.804  1.00 34.71  ? 620  GLU A CD    1 
ATOM   3080 O  OE1   . GLU C 3 324 ? 27.134  34.878 16.900  1.00 37.03  ? 620  GLU A OE1   1 
ATOM   3081 O  OE2   . GLU C 3 324 ? 25.473  34.017 18.060  1.00 35.29  ? 620  GLU A OE2   1 
ATOM   3082 N  N     . PRO C 3 325 ? 24.855  39.768 20.713  1.00 19.08  ? 621  PRO A N     1 
ATOM   3083 C  CA    . PRO C 3 325 ? 25.044  39.768 22.169  1.00 17.78  ? 621  PRO A CA    1 
ATOM   3084 C  C     . PRO C 3 325 ? 23.734  39.855 22.949  1.00 17.09  ? 621  PRO A C     1 
ATOM   3085 O  O     . PRO C 3 325 ? 22.680  40.137 22.380  1.00 16.83  ? 621  PRO A O     1 
ATOM   3086 C  CB    . PRO C 3 325 ? 25.913  40.984 22.389  1.00 18.84  ? 621  PRO A CB    1 
ATOM   3087 C  CG    . PRO C 3 325 ? 25.278  41.962 21.420  1.00 20.04  ? 621  PRO A CG    1 
ATOM   3088 C  CD    . PRO C 3 325 ? 25.066  41.121 20.165  1.00 18.42  ? 621  PRO A CD    1 
ATOM   3089 N  N     . ASN C 3 326 ? 23.811  39.617 24.255  1.00 17.28  ? 622  ASN A N     1 
ATOM   3090 C  CA    . ASN C 3 326 ? 22.643  39.733 25.120  1.00 16.26  ? 622  ASN A CA    1 
ATOM   3091 C  C     . ASN C 3 326 ? 22.594  41.212 25.460  1.00 17.80  ? 622  ASN A C     1 
ATOM   3092 O  O     . ASN C 3 326 ? 23.458  41.712 26.173  1.00 19.07  ? 622  ASN A O     1 
ATOM   3093 C  CB    . ASN C 3 326 ? 22.824  38.926 26.407  1.00 14.53  ? 622  ASN A CB    1 
ATOM   3094 C  CG    . ASN C 3 326 ? 21.642  39.075 27.372  1.00 15.98  ? 622  ASN A CG    1 
ATOM   3095 O  OD1   . ASN C 3 326 ? 20.753  39.900 27.167  1.00 14.54  ? 622  ASN A OD1   1 
ATOM   3096 N  ND2   . ASN C 3 326 ? 21.640  38.275 28.434  1.00 15.11  ? 622  ASN A ND2   1 
ATOM   3097 N  N     . LEU C 3 327 ? 21.593  41.918 24.951  1.00 17.82  ? 623  LEU A N     1 
ATOM   3098 C  CA    . LEU C 3 327 ? 21.480  43.346 25.211  1.00 18.86  ? 623  LEU A CA    1 
ATOM   3099 C  C     . LEU C 3 327 ? 20.460  43.650 26.295  1.00 19.12  ? 623  LEU A C     1 
ATOM   3100 O  O     . LEU C 3 327 ? 20.012  44.789 26.443  1.00 20.17  ? 623  LEU A O     1 
ATOM   3101 C  CB    . LEU C 3 327 ? 21.118  44.082 23.918  1.00 18.05  ? 623  LEU A CB    1 
ATOM   3102 C  CG    . LEU C 3 327 ? 22.159  43.908 22.805  1.00 20.91  ? 623  LEU A CG    1 
ATOM   3103 C  CD1   . LEU C 3 327 ? 21.680  44.558 21.514  1.00 19.82  ? 623  LEU A CD1   1 
ATOM   3104 C  CD2   . LEU C 3 327 ? 23.482  44.511 23.259  1.00 19.92  ? 623  LEU A CD2   1 
ATOM   3105 N  N     . GLN C 3 328 ? 20.105  42.629 27.066  1.00 19.01  ? 624  GLN A N     1 
ATOM   3106 C  CA    . GLN C 3 328 ? 19.142  42.801 28.139  1.00 19.63  ? 624  GLN A CA    1 
ATOM   3107 C  C     . GLN C 3 328 ? 19.804  42.756 29.510  1.00 20.83  ? 624  GLN A C     1 
ATOM   3108 O  O     . GLN C 3 328 ? 19.122  42.762 30.536  1.00 19.75  ? 624  GLN A O     1 
ATOM   3109 C  CB    . GLN C 3 328 ? 18.057  41.731 28.050  1.00 20.58  ? 624  GLN A CB    1 
ATOM   3110 C  CG    . GLN C 3 328 ? 17.265  41.778 26.747  1.00 19.92  ? 624  GLN A CG    1 
ATOM   3111 C  CD    . GLN C 3 328 ? 16.116  40.795 26.736  1.00 20.56  ? 624  GLN A CD    1 
ATOM   3112 O  OE1   . GLN C 3 328 ? 16.288  39.624 27.074  1.00 19.57  ? 624  GLN A OE1   1 
ATOM   3113 N  NE2   . GLN C 3 328 ? 14.934  41.265 26.344  1.00 20.37  ? 624  GLN A NE2   1 
ATOM   3114 N  N     . ASN C 3 329 ? 21.135  42.710 29.532  1.00 21.43  ? 625  ASN A N     1 
ATOM   3115 C  CA    . ASN C 3 329 ? 21.843  42.690 30.805  1.00 23.05  ? 625  ASN A CA    1 
ATOM   3116 C  C     . ASN C 3 329 ? 23.065  43.612 30.835  1.00 24.41  ? 625  ASN A C     1 
ATOM   3117 O  O     . ASN C 3 329 ? 24.051  43.333 31.516  1.00 25.06  ? 625  ASN A O     1 
ATOM   3118 C  CB    . ASN C 3 329 ? 22.230  41.250 31.181  1.00 22.90  ? 625  ASN A CB    1 
ATOM   3119 C  CG    . ASN C 3 329 ? 23.326  40.673 30.300  1.00 22.94  ? 625  ASN A CG    1 
ATOM   3120 O  OD1   . ASN C 3 329 ? 23.688  41.239 29.267  1.00 24.95  ? 625  ASN A OD1   1 
ATOM   3121 N  ND2   . ASN C 3 329 ? 23.859  39.524 30.713  1.00 23.46  ? 625  ASN A ND2   1 
ATOM   3122 N  N     . ILE C 3 330 ? 22.994  44.719 30.099  1.00 24.78  ? 626  ILE A N     1 
ATOM   3123 C  CA    . ILE C 3 330 ? 24.096  45.677 30.090  1.00 22.86  ? 626  ILE A CA    1 
ATOM   3124 C  C     . ILE C 3 330 ? 24.083  46.370 31.455  1.00 23.57  ? 626  ILE A C     1 
ATOM   3125 O  O     . ILE C 3 330 ? 23.031  46.795 31.936  1.00 23.89  ? 626  ILE A O     1 
ATOM   3126 C  CB    . ILE C 3 330 ? 23.931  46.715 28.962  1.00 21.42  ? 626  ILE A CB    1 
ATOM   3127 C  CG1   . ILE C 3 330 ? 23.788  45.998 27.614  1.00 19.62  ? 626  ILE A CG1   1 
ATOM   3128 C  CG2   . ILE C 3 330 ? 25.136  47.653 28.933  1.00 18.82  ? 626  ILE A CG2   1 
ATOM   3129 C  CD1   . ILE C 3 330 ? 24.975  45.084 27.249  1.00 17.37  ? 626  ILE A CD1   1 
ATOM   3130 N  N     . PRO C 3 331 ? 25.258  46.491 32.097  1.00 23.38  ? 627  PRO A N     1 
ATOM   3131 C  CA    . PRO C 3 331 ? 25.400  47.119 33.416  1.00 23.65  ? 627  PRO A CA    1 
ATOM   3132 C  C     . PRO C 3 331 ? 24.675  48.456 33.611  1.00 24.00  ? 627  PRO A C     1 
ATOM   3133 O  O     . PRO C 3 331 ? 24.545  49.254 32.680  1.00 24.29  ? 627  PRO A O     1 
ATOM   3134 C  CB    . PRO C 3 331 ? 26.917  47.240 33.584  1.00 22.47  ? 627  PRO A CB    1 
ATOM   3135 C  CG    . PRO C 3 331 ? 27.436  46.072 32.796  1.00 21.88  ? 627  PRO A CG    1 
ATOM   3136 C  CD    . PRO C 3 331 ? 26.578  46.117 31.552  1.00 24.15  ? 627  PRO A CD    1 
ATOM   3137 N  N     . ILE C 3 332 ? 24.204  48.693 34.832  1.00 24.29  ? 628  ILE A N     1 
ATOM   3138 C  CA    . ILE C 3 332 ? 23.525  49.943 35.143  1.00 25.12  ? 628  ILE A CA    1 
ATOM   3139 C  C     . ILE C 3 332 ? 23.479  50.219 36.644  1.00 26.13  ? 628  ILE A C     1 
ATOM   3140 O  O     . ILE C 3 332 ? 23.446  51.373 37.068  1.00 25.39  ? 628  ILE A O     1 
ATOM   3141 C  CB    . ILE C 3 332 ? 22.081  49.952 34.596  1.00 24.82  ? 628  ILE A CB    1 
ATOM   3142 C  CG1   . ILE C 3 332 ? 21.508  51.371 34.677  1.00 24.55  ? 628  ILE A CG1   1 
ATOM   3143 C  CG2   . ILE C 3 332 ? 21.213  48.986 35.396  1.00 23.47  ? 628  ILE A CG2   1 
ATOM   3144 C  CD1   . ILE C 3 332 ? 20.125  51.513 34.074  1.00 27.42  ? 628  ILE A CD1   1 
ATOM   3145 N  N     . ARG C 3 333 ? 23.487  49.157 37.445  1.00 28.73  ? 629  ARG A N     1 
ATOM   3146 C  CA    . ARG C 3 333 ? 23.423  49.293 38.898  1.00 30.31  ? 629  ARG A CA    1 
ATOM   3147 C  C     . ARG C 3 333 ? 24.635  50.014 39.486  1.00 30.81  ? 629  ARG A C     1 
ATOM   3148 O  O     . ARG C 3 333 ? 24.481  50.933 40.289  1.00 31.98  ? 629  ARG A O     1 
ATOM   3149 C  CB    . ARG C 3 333 ? 23.256  47.913 39.540  1.00 32.35  ? 629  ARG A CB    1 
ATOM   3150 C  CG    . ARG C 3 333 ? 22.025  47.174 39.031  1.00 36.00  ? 629  ARG A CG    1 
ATOM   3151 C  CD    . ARG C 3 333 ? 21.882  45.776 39.625  1.00 37.21  ? 629  ARG A CD    1 
ATOM   3152 N  NE    . ARG C 3 333 ? 20.747  45.064 39.041  1.00 37.34  ? 629  ARG A NE    1 
ATOM   3153 C  CZ    . ARG C 3 333 ? 20.427  43.802 39.313  1.00 38.67  ? 629  ARG A CZ    1 
ATOM   3154 N  NH1   . ARG C 3 333 ? 21.160  43.098 40.169  1.00 38.07  ? 629  ARG A NH1   1 
ATOM   3155 N  NH2   . ARG C 3 333 ? 19.373  43.240 38.726  1.00 37.68  ? 629  ARG A NH2   1 
ATOM   3156 N  N     . LEU C 3 334 ? 25.834  49.598 39.089  1.00 30.64  ? 630  LEU A N     1 
ATOM   3157 C  CA    . LEU C 3 334 ? 27.060  50.227 39.574  1.00 30.88  ? 630  LEU A CA    1 
ATOM   3158 C  C     . LEU C 3 334 ? 27.540  51.231 38.531  1.00 29.62  ? 630  LEU A C     1 
ATOM   3159 O  O     . LEU C 3 334 ? 27.563  50.934 37.342  1.00 28.43  ? 630  LEU A O     1 
ATOM   3160 C  CB    . LEU C 3 334 ? 28.138  49.169 39.832  1.00 31.73  ? 630  LEU A CB    1 
ATOM   3161 C  CG    . LEU C 3 334 ? 27.791  48.172 40.942  1.00 34.33  ? 630  LEU A CG    1 
ATOM   3162 C  CD1   . LEU C 3 334 ? 28.863  47.097 41.042  1.00 36.34  ? 630  LEU A CD1   1 
ATOM   3163 C  CD2   . LEU C 3 334 ? 27.642  48.923 42.261  1.00 34.39  ? 630  LEU A CD2   1 
ATOM   3164 N  N     . GLU C 3 335 ? 27.925  52.417 38.987  1.00 29.78  ? 631  GLU A N     1 
ATOM   3165 C  CA    . GLU C 3 335 ? 28.374  53.485 38.097  1.00 30.44  ? 631  GLU A CA    1 
ATOM   3166 C  C     . GLU C 3 335 ? 29.472  53.093 37.112  1.00 30.71  ? 631  GLU A C     1 
ATOM   3167 O  O     . GLU C 3 335 ? 29.385  53.394 35.918  1.00 29.53  ? 631  GLU A O     1 
ATOM   3168 C  CB    . GLU C 3 335 ? 28.830  54.687 38.928  1.00 32.32  ? 631  GLU A CB    1 
ATOM   3169 C  CG    . GLU C 3 335 ? 29.137  55.930 38.108  1.00 33.65  ? 631  GLU A CG    1 
ATOM   3170 C  CD    . GLU C 3 335 ? 28.004  56.303 37.167  1.00 33.62  ? 631  GLU A CD    1 
ATOM   3171 O  OE1   . GLU C 3 335 ? 26.840  56.373 37.624  1.00 36.26  ? 631  GLU A OE1   1 
ATOM   3172 O  OE2   . GLU C 3 335 ? 28.279  56.532 35.971  1.00 31.03  ? 631  GLU A OE2   1 
ATOM   3173 N  N     . GLU C 3 336 ? 30.506  52.422 37.603  1.00 31.74  ? 632  GLU A N     1 
ATOM   3174 C  CA    . GLU C 3 336 ? 31.608  52.017 36.743  1.00 32.44  ? 632  GLU A CA    1 
ATOM   3175 C  C     . GLU C 3 336 ? 31.145  51.130 35.588  1.00 31.55  ? 632  GLU A C     1 
ATOM   3176 O  O     . GLU C 3 336 ? 31.636  51.256 34.461  1.00 31.30  ? 632  GLU A O     1 
ATOM   3177 C  CB    . GLU C 3 336 ? 32.680  51.320 37.582  1.00 34.98  ? 632  GLU A CB    1 
ATOM   3178 C  CG    . GLU C 3 336 ? 33.384  52.288 38.525  1.00 39.84  ? 632  GLU A CG    1 
ATOM   3179 C  CD    . GLU C 3 336 ? 34.330  51.607 39.492  1.00 43.08  ? 632  GLU A CD    1 
ATOM   3180 O  OE1   . GLU C 3 336 ? 33.845  50.895 40.400  1.00 44.47  ? 632  GLU A OE1   1 
ATOM   3181 O  OE2   . GLU C 3 336 ? 35.560  51.785 39.343  1.00 44.43  ? 632  GLU A OE2   1 
ATOM   3182 N  N     . GLY C 3 337 ? 30.188  50.249 35.863  1.00 29.04  ? 633  GLY A N     1 
ATOM   3183 C  CA    . GLY C 3 337 ? 29.682  49.376 34.820  1.00 27.70  ? 633  GLY A CA    1 
ATOM   3184 C  C     . GLY C 3 337 ? 28.676  50.086 33.933  1.00 25.78  ? 633  GLY A C     1 
ATOM   3185 O  O     . GLY C 3 337 ? 28.544  49.776 32.752  1.00 26.38  ? 633  GLY A O     1 
ATOM   3186 N  N     . ARG C 3 338 ? 27.963  51.045 34.511  1.00 24.61  ? 634  ARG A N     1 
ATOM   3187 C  CA    . ARG C 3 338 ? 26.957  51.810 33.784  1.00 25.53  ? 634  ARG A CA    1 
ATOM   3188 C  C     . ARG C 3 338 ? 27.578  52.612 32.637  1.00 24.45  ? 634  ARG A C     1 
ATOM   3189 O  O     . ARG C 3 338 ? 26.927  52.863 31.622  1.00 24.28  ? 634  ARG A O     1 
ATOM   3190 C  CB    . ARG C 3 338 ? 26.235  52.746 34.755  1.00 26.68  ? 634  ARG A CB    1 
ATOM   3191 C  CG    . ARG C 3 338 ? 25.041  53.488 34.176  1.00 30.46  ? 634  ARG A CG    1 
ATOM   3192 C  CD    . ARG C 3 338 ? 24.260  54.184 35.285  1.00 32.88  ? 634  ARG A CD    1 
ATOM   3193 N  NE    . ARG C 3 338 ? 22.998  54.740 34.807  1.00 38.57  ? 634  ARG A NE    1 
ATOM   3194 C  CZ    . ARG C 3 338 ? 21.978  55.069 35.595  1.00 39.49  ? 634  ARG A CZ    1 
ATOM   3195 N  NH1   . ARG C 3 338 ? 22.067  54.896 36.907  1.00 40.18  ? 634  ARG A NH1   1 
ATOM   3196 N  NH2   . ARG C 3 338 ? 20.866  55.569 35.071  1.00 38.81  ? 634  ARG A NH2   1 
ATOM   3197 N  N     . LYS C 3 339 ? 28.838  53.007 32.803  1.00 23.37  ? 635  LYS A N     1 
ATOM   3198 C  CA    . LYS C 3 339 ? 29.547  53.772 31.781  1.00 23.67  ? 635  LYS A CA    1 
ATOM   3199 C  C     . LYS C 3 339 ? 29.608  53.009 30.460  1.00 22.47  ? 635  LYS A C     1 
ATOM   3200 O  O     . LYS C 3 339 ? 29.824  53.602 29.403  1.00 21.50  ? 635  LYS A O     1 
ATOM   3201 C  CB    . LYS C 3 339 ? 30.970  54.094 32.250  1.00 26.25  ? 635  LYS A CB    1 
ATOM   3202 C  CG    . LYS C 3 339 ? 31.038  55.040 33.447  1.00 30.73  ? 635  LYS A CG    1 
ATOM   3203 C  CD    . LYS C 3 339 ? 30.532  56.429 33.084  1.00 34.49  ? 635  LYS A CD    1 
ATOM   3204 C  CE    . LYS C 3 339 ? 30.436  57.337 34.313  1.00 37.56  ? 635  LYS A CE    1 
ATOM   3205 N  NZ    . LYS C 3 339 ? 31.726  57.441 35.050  1.00 37.55  ? 635  LYS A NZ    1 
ATOM   3206 N  N     . ILE C 3 340 ? 29.423  51.693 30.530  1.00 22.42  ? 636  ILE A N     1 
ATOM   3207 C  CA    . ILE C 3 340 ? 29.441  50.844 29.341  1.00 22.60  ? 636  ILE A CA    1 
ATOM   3208 C  C     . ILE C 3 340 ? 28.410  51.341 28.332  1.00 21.88  ? 636  ILE A C     1 
ATOM   3209 O  O     . ILE C 3 340 ? 28.624  51.270 27.121  1.00 22.88  ? 636  ILE A O     1 
ATOM   3210 C  CB    . ILE C 3 340 ? 29.093  49.368 29.692  1.00 23.93  ? 636  ILE A CB    1 
ATOM   3211 C  CG1   . ILE C 3 340 ? 30.187  48.752 30.575  1.00 24.60  ? 636  ILE A CG1   1 
ATOM   3212 C  CG2   . ILE C 3 340 ? 28.917  48.556 28.417  1.00 21.67  ? 636  ILE A CG2   1 
ATOM   3213 C  CD1   . ILE C 3 340 ? 31.500  48.512 29.869  1.00 25.32  ? 636  ILE A CD1   1 
ATOM   3214 N  N     . ARG C 3 341 ? 27.294  51.849 28.844  1.00 21.00  ? 637  ARG A N     1 
ATOM   3215 C  CA    . ARG C 3 341 ? 26.206  52.327 28.003  1.00 20.93  ? 637  ARG A CA    1 
ATOM   3216 C  C     . ARG C 3 341 ? 26.510  53.554 27.152  1.00 20.23  ? 637  ARG A C     1 
ATOM   3217 O  O     . ARG C 3 341 ? 25.751  53.874 26.240  1.00 19.97  ? 637  ARG A O     1 
ATOM   3218 C  CB    . ARG C 3 341 ? 24.964  52.585 28.860  1.00 20.75  ? 637  ARG A CB    1 
ATOM   3219 C  CG    . ARG C 3 341 ? 24.468  51.333 29.549  1.00 19.93  ? 637  ARG A CG    1 
ATOM   3220 C  CD    . ARG C 3 341 ? 23.088  51.510 30.152  1.00 21.65  ? 637  ARG A CD    1 
ATOM   3221 N  NE    . ARG C 3 341 ? 22.584  50.241 30.661  1.00 19.70  ? 637  ARG A NE    1 
ATOM   3222 C  CZ    . ARG C 3 341 ? 21.297  49.941 30.806  1.00 18.56  ? 637  ARG A CZ    1 
ATOM   3223 N  NH1   . ARG C 3 341 ? 20.357  50.820 30.482  1.00 19.67  ? 637  ARG A NH1   1 
ATOM   3224 N  NH2   . ARG C 3 341 ? 20.954  48.748 31.261  1.00 17.80  ? 637  ARG A NH2   1 
ATOM   3225 N  N     . GLN C 3 342 ? 27.608  54.243 27.441  1.00 19.78  ? 638  GLN A N     1 
ATOM   3226 C  CA    . GLN C 3 342 ? 27.971  55.412 26.651  1.00 19.40  ? 638  GLN A CA    1 
ATOM   3227 C  C     . GLN C 3 342 ? 28.450  54.937 25.280  1.00 19.73  ? 638  GLN A C     1 
ATOM   3228 O  O     . GLN C 3 342 ? 28.609  55.738 24.360  1.00 19.91  ? 638  GLN A O     1 
ATOM   3229 C  CB    . GLN C 3 342 ? 29.095  56.203 27.324  1.00 21.10  ? 638  GLN A CB    1 
ATOM   3230 C  CG    . GLN C 3 342 ? 28.852  56.582 28.772  1.00 25.18  ? 638  GLN A CG    1 
ATOM   3231 C  CD    . GLN C 3 342 ? 30.043  57.311 29.372  1.00 28.61  ? 638  GLN A CD    1 
ATOM   3232 O  OE1   . GLN C 3 342 ? 31.189  56.911 29.176  1.00 29.86  ? 638  GLN A OE1   1 
ATOM   3233 N  NE2   . GLN C 3 342 ? 29.777  58.382 30.109  1.00 30.32  ? 638  GLN A NE2   1 
ATOM   3234 N  N     . ALA C 3 343 ? 28.683  53.633 25.153  1.00 19.04  ? 639  ALA A N     1 
ATOM   3235 C  CA    . ALA C 3 343 ? 29.155  53.050 23.899  1.00 20.93  ? 639  ALA A CA    1 
ATOM   3236 C  C     . ALA C 3 343 ? 28.037  52.735 22.905  1.00 20.41  ? 639  ALA A C     1 
ATOM   3237 O  O     . ALA C 3 343 ? 28.311  52.447 21.745  1.00 21.75  ? 639  ALA A O     1 
ATOM   3238 C  CB    . ALA C 3 343 ? 29.960  51.787 24.181  1.00 22.93  ? 639  ALA A CB    1 
ATOM   3239 N  N     . PHE C 3 344 ? 26.787  52.779 23.359  1.00 19.28  ? 640  PHE A N     1 
ATOM   3240 C  CA    . PHE C 3 344 ? 25.644  52.517 22.483  1.00 18.53  ? 640  PHE A CA    1 
ATOM   3241 C  C     . PHE C 3 344 ? 25.107  53.871 22.052  1.00 17.73  ? 640  PHE A C     1 
ATOM   3242 O  O     . PHE C 3 344 ? 24.612  54.650 22.873  1.00 15.49  ? 640  PHE A O     1 
ATOM   3243 C  CB    . PHE C 3 344 ? 24.586  51.707 23.228  1.00 18.72  ? 640  PHE A CB    1 
ATOM   3244 C  CG    . PHE C 3 344 ? 25.019  50.298 23.534  1.00 20.70  ? 640  PHE A CG    1 
ATOM   3245 C  CD1   . PHE C 3 344 ? 24.687  49.252 22.678  1.00 21.03  ? 640  PHE A CD1   1 
ATOM   3246 C  CD2   . PHE C 3 344 ? 25.787  50.020 24.662  1.00 22.07  ? 640  PHE A CD2   1 
ATOM   3247 C  CE1   . PHE C 3 344 ? 25.113  47.946 22.938  1.00 20.86  ? 640  PHE A CE1   1 
ATOM   3248 C  CE2   . PHE C 3 344 ? 26.221  48.715 24.932  1.00 22.94  ? 640  PHE A CE2   1 
ATOM   3249 C  CZ    . PHE C 3 344 ? 25.881  47.678 24.066  1.00 20.78  ? 640  PHE A CZ    1 
ATOM   3250 N  N     . VAL C 3 345 ? 25.207  54.136 20.753  1.00 17.78  ? 641  VAL A N     1 
ATOM   3251 C  CA    . VAL C 3 345 ? 24.821  55.421 20.185  1.00 17.15  ? 641  VAL A CA    1 
ATOM   3252 C  C     . VAL C 3 345 ? 23.822  55.330 19.030  1.00 17.36  ? 641  VAL A C     1 
ATOM   3253 O  O     . VAL C 3 345 ? 23.567  54.248 18.516  1.00 18.45  ? 641  VAL A O     1 
ATOM   3254 C  CB    . VAL C 3 345 ? 26.090  56.140 19.686  1.00 17.47  ? 641  VAL A CB    1 
ATOM   3255 C  CG1   . VAL C 3 345 ? 27.096  56.273 20.831  1.00 18.60  ? 641  VAL A CG1   1 
ATOM   3256 C  CG2   . VAL C 3 345 ? 26.722  55.338 18.545  1.00 15.22  ? 641  VAL A CG2   1 
ATOM   3257 N  N     . PRO C 3 346 ? 23.243  56.478 18.614  1.00 17.66  ? 642  PRO A N     1 
ATOM   3258 C  CA    . PRO C 3 346 ? 22.277  56.523 17.508  1.00 17.42  ? 642  PRO A CA    1 
ATOM   3259 C  C     . PRO C 3 346 ? 22.982  56.081 16.224  1.00 17.33  ? 642  PRO A C     1 
ATOM   3260 O  O     . PRO C 3 346 ? 24.185  56.276 16.086  1.00 18.30  ? 642  PRO A O     1 
ATOM   3261 C  CB    . PRO C 3 346 ? 21.845  57.989 17.471  1.00 18.68  ? 642  PRO A CB    1 
ATOM   3262 C  CG    . PRO C 3 346 ? 22.041  58.448 18.885  1.00 17.00  ? 642  PRO A CG    1 
ATOM   3263 C  CD    . PRO C 3 346 ? 23.353  57.801 19.260  1.00 16.56  ? 642  PRO A CD    1 
ATOM   3264 N  N     . SER C 3 347 ? 22.239  55.500 15.290  1.00 16.84  ? 643  SER A N     1 
ATOM   3265 C  CA    . SER C 3 347 ? 22.825  55.021 14.042  1.00 19.22  ? 643  SER A CA    1 
ATOM   3266 C  C     . SER C 3 347 ? 23.008  56.105 12.979  1.00 20.00  ? 643  SER A C     1 
ATOM   3267 O  O     . SER C 3 347 ? 23.562  55.840 11.912  1.00 20.39  ? 643  SER A O     1 
ATOM   3268 C  CB    . SER C 3 347 ? 21.970  53.893 13.463  1.00 17.30  ? 643  SER A CB    1 
ATOM   3269 O  OG    . SER C 3 347 ? 20.698  54.379 13.073  1.00 16.52  ? 643  SER A OG    1 
ATOM   3270 N  N     . GLU C 3 348 ? 22.544  57.318 13.269  1.00 21.24  ? 644  GLU A N     1 
ATOM   3271 C  CA    . GLU C 3 348 ? 22.665  58.424 12.325  1.00 24.44  ? 644  GLU A CA    1 
ATOM   3272 C  C     . GLU C 3 348 ? 22.960  59.747 13.010  1.00 24.14  ? 644  GLU A C     1 
ATOM   3273 O  O     . GLU C 3 348 ? 22.669  59.934 14.196  1.00 23.43  ? 644  GLU A O     1 
ATOM   3274 C  CB    . GLU C 3 348 ? 21.386  58.553 11.492  1.00 27.47  ? 644  GLU A CB    1 
ATOM   3275 C  CG    . GLU C 3 348 ? 21.176  57.413 10.507  1.00 33.85  ? 644  GLU A CG    1 
ATOM   3276 C  CD    . GLU C 3 348 ? 19.892  57.559 9.713   1.00 36.14  ? 644  GLU A CD    1 
ATOM   3277 O  OE1   . GLU C 3 348 ? 19.703  58.616 9.070   1.00 38.53  ? 644  GLU A OE1   1 
ATOM   3278 O  OE2   . GLU C 3 348 ? 19.074  56.615 9.730   1.00 38.37  ? 644  GLU A OE2   1 
ATOM   3279 N  N     . SER C 3 349 ? 23.535  60.669 12.246  1.00 23.87  ? 645  SER A N     1 
ATOM   3280 C  CA    . SER C 3 349 ? 23.890  61.985 12.758  1.00 23.87  ? 645  SER A CA    1 
ATOM   3281 C  C     . SER C 3 349 ? 22.642  62.746 13.170  1.00 21.33  ? 645  SER A C     1 
ATOM   3282 O  O     . SER C 3 349 ? 21.648  62.749 12.453  1.00 21.53  ? 645  SER A O     1 
ATOM   3283 C  CB    . SER C 3 349 ? 24.630  62.792 11.686  1.00 25.01  ? 645  SER A CB    1 
ATOM   3284 O  OG    . SER C 3 349 ? 25.683  62.037 11.113  1.00 32.12  ? 645  SER A OG    1 
ATOM   3285 N  N     . ASP C 3 350 ? 22.704  63.394 14.325  1.00 20.53  ? 646  ASP A N     1 
ATOM   3286 C  CA    . ASP C 3 350 ? 21.583  64.181 14.813  1.00 22.09  ? 646  ASP A CA    1 
ATOM   3287 C  C     . ASP C 3 350 ? 20.364  63.349 15.192  1.00 20.91  ? 646  ASP A C     1 
ATOM   3288 O  O     . ASP C 3 350 ? 19.227  63.808 15.078  1.00 21.51  ? 646  ASP A O     1 
ATOM   3289 C  CB    . ASP C 3 350 ? 21.195  65.235 13.768  1.00 23.62  ? 646  ASP A CB    1 
ATOM   3290 C  CG    . ASP C 3 350 ? 22.353  66.159 13.420  1.00 27.01  ? 646  ASP A CG    1 
ATOM   3291 O  OD1   . ASP C 3 350 ? 22.875  66.831 14.333  1.00 27.29  ? 646  ASP A OD1   1 
ATOM   3292 O  OD2   . ASP C 3 350 ? 22.745  66.210 12.235  1.00 28.12  ? 646  ASP A OD2   1 
ATOM   3293 N  N     . TRP C 3 351 ? 20.601  62.117 15.629  1.00 20.15  ? 647  TRP A N     1 
ATOM   3294 C  CA    . TRP C 3 351 ? 19.522  61.247 16.080  1.00 17.57  ? 647  TRP A CA    1 
ATOM   3295 C  C     . TRP C 3 351 ? 19.810  61.083 17.558  1.00 16.22  ? 647  TRP A C     1 
ATOM   3296 O  O     . TRP C 3 351 ? 20.919  61.387 18.004  1.00 15.85  ? 647  TRP A O     1 
ATOM   3297 C  CB    . TRP C 3 351 ? 19.557  59.894 15.364  1.00 16.52  ? 647  TRP A CB    1 
ATOM   3298 C  CG    . TRP C 3 351 ? 18.822  59.889 14.049  1.00 15.34  ? 647  TRP A CG    1 
ATOM   3299 C  CD1   . TRP C 3 351 ? 18.870  60.851 13.075  1.00 17.73  ? 647  TRP A CD1   1 
ATOM   3300 C  CD2   . TRP C 3 351 ? 17.948  58.864 13.555  1.00 15.24  ? 647  TRP A CD2   1 
ATOM   3301 N  NE1   . TRP C 3 351 ? 18.080  60.486 12.009  1.00 14.74  ? 647  TRP A NE1   1 
ATOM   3302 C  CE2   . TRP C 3 351 ? 17.504  59.272 12.277  1.00 15.78  ? 647  TRP A CE2   1 
ATOM   3303 C  CE3   . TRP C 3 351 ? 17.497  57.640 14.069  1.00 15.65  ? 647  TRP A CE3   1 
ATOM   3304 C  CZ2   . TRP C 3 351 ? 16.632  58.498 11.504  1.00 17.64  ? 647  TRP A CZ2   1 
ATOM   3305 C  CZ3   . TRP C 3 351 ? 16.628  56.869 13.300  1.00 17.36  ? 647  TRP A CZ3   1 
ATOM   3306 C  CH2   . TRP C 3 351 ? 16.205  57.302 12.031  1.00 18.09  ? 647  TRP A CH2   1 
ATOM   3307 N  N     . LEU C 3 352 ? 18.826  60.621 18.322  1.00 14.74  ? 648  LEU A N     1 
ATOM   3308 C  CA    . LEU C 3 352 ? 19.006  60.448 19.762  1.00 13.93  ? 648  LEU A CA    1 
ATOM   3309 C  C     . LEU C 3 352 ? 18.373  59.149 20.243  1.00 13.83  ? 648  LEU A C     1 
ATOM   3310 O  O     . LEU C 3 352 ? 17.538  58.569 19.551  1.00 14.41  ? 648  LEU A O     1 
ATOM   3311 C  CB    . LEU C 3 352 ? 18.375  61.628 20.513  1.00 12.73  ? 648  LEU A CB    1 
ATOM   3312 C  CG    . LEU C 3 352 ? 18.992  63.015 20.290  1.00 14.68  ? 648  LEU A CG    1 
ATOM   3313 C  CD1   . LEU C 3 352 ? 18.100  64.090 20.894  1.00 15.02  ? 648  LEU A CD1   1 
ATOM   3314 C  CD2   . LEU C 3 352 ? 20.372  63.062 20.923  1.00 15.93  ? 648  LEU A CD2   1 
ATOM   3315 N  N     . ILE C 3 353 ? 18.779  58.699 21.428  1.00 14.28  ? 649  ILE A N     1 
ATOM   3316 C  CA    . ILE C 3 353 ? 18.238  57.476 22.022  1.00 14.56  ? 649  ILE A CA    1 
ATOM   3317 C  C     . ILE C 3 353 ? 17.095  57.853 22.969  1.00 14.29  ? 649  ILE A C     1 
ATOM   3318 O  O     . ILE C 3 353 ? 17.261  58.727 23.820  1.00 13.80  ? 649  ILE A O     1 
ATOM   3319 C  CB    . ILE C 3 353 ? 19.315  56.706 22.838  1.00 14.54  ? 649  ILE A CB    1 
ATOM   3320 C  CG1   . ILE C 3 353 ? 20.526  56.366 21.954  1.00 16.35  ? 649  ILE A CG1   1 
ATOM   3321 C  CG2   . ILE C 3 353 ? 18.717  55.417 23.419  1.00 16.22  ? 649  ILE A CG2   1 
ATOM   3322 C  CD1   . ILE C 3 353 ? 20.197  55.568 20.690  1.00 17.57  ? 649  ILE A CD1   1 
ATOM   3323 N  N     . PHE C 3 354 ? 15.946  57.190 22.814  1.00 13.12  ? 650  PHE A N     1 
ATOM   3324 C  CA    . PHE C 3 354 ? 14.755  57.430 23.645  1.00 13.25  ? 650  PHE A CA    1 
ATOM   3325 C  C     . PHE C 3 354 ? 14.404  56.124 24.380  1.00 14.16  ? 650  PHE A C     1 
ATOM   3326 O  O     . PHE C 3 354 ? 14.222  55.082 23.745  1.00 13.90  ? 650  PHE A O     1 
ATOM   3327 C  CB    . PHE C 3 354 ? 13.566  57.854 22.756  1.00 11.76  ? 650  PHE A CB    1 
ATOM   3328 C  CG    . PHE C 3 354 ? 12.344  58.316 23.528  1.00 13.41  ? 650  PHE A CG    1 
ATOM   3329 C  CD1   . PHE C 3 354 ? 12.126  59.671 23.770  1.00 14.56  ? 650  PHE A CD1   1 
ATOM   3330 C  CD2   . PHE C 3 354 ? 11.416  57.394 24.012  1.00 12.74  ? 650  PHE A CD2   1 
ATOM   3331 C  CE1   . PHE C 3 354 ? 10.998  60.106 24.484  1.00 14.08  ? 650  PHE A CE1   1 
ATOM   3332 C  CE2   . PHE C 3 354 ? 10.286  57.813 24.727  1.00 14.20  ? 650  PHE A CE2   1 
ATOM   3333 C  CZ    . PHE C 3 354 ? 10.076  59.174 24.963  1.00 14.95  ? 650  PHE A CZ    1 
ATOM   3334 N  N     . ALA C 3 355 ? 14.311  56.181 25.707  1.00 11.74  ? 651  ALA A N     1 
ATOM   3335 C  CA    . ALA C 3 355 ? 13.984  54.999 26.506  1.00 12.83  ? 651  ALA A CA    1 
ATOM   3336 C  C     . ALA C 3 355 ? 12.776  55.239 27.406  1.00 13.21  ? 651  ALA A C     1 
ATOM   3337 O  O     . ALA C 3 355 ? 12.725  56.229 28.133  1.00 15.56  ? 651  ALA A O     1 
ATOM   3338 C  CB    . ALA C 3 355 ? 15.185  54.601 27.357  1.00 11.98  ? 651  ALA A CB    1 
ATOM   3339 N  N     . ALA C 3 356 ? 11.802  54.336 27.352  1.00 13.47  ? 652  ALA A N     1 
ATOM   3340 C  CA    . ALA C 3 356 ? 10.600  54.452 28.183  1.00 14.23  ? 652  ALA A CA    1 
ATOM   3341 C  C     . ALA C 3 356 ? 10.423  53.153 28.963  1.00 13.83  ? 652  ALA A C     1 
ATOM   3342 O  O     . ALA C 3 356 ? 10.523  52.071 28.392  1.00 15.68  ? 652  ALA A O     1 
ATOM   3343 C  CB    . ALA C 3 356 ? 9.372   54.718 27.315  1.00 10.73  ? 652  ALA A CB    1 
ATOM   3344 N  N     . ASP C 3 357 ? 10.152  53.260 30.262  1.00 13.79  ? 653  ASP A N     1 
ATOM   3345 C  CA    . ASP C 3 357 ? 9.994   52.068 31.095  1.00 15.28  ? 653  ASP A CA    1 
ATOM   3346 C  C     . ASP C 3 357 ? 8.770   52.131 32.000  1.00 14.59  ? 653  ASP A C     1 
ATOM   3347 O  O     . ASP C 3 357 ? 8.439   53.193 32.532  1.00 15.16  ? 653  ASP A O     1 
ATOM   3348 C  CB    . ASP C 3 357 ? 11.235  51.875 31.966  1.00 16.67  ? 653  ASP A CB    1 
ATOM   3349 C  CG    . ASP C 3 357 ? 11.340  52.917 33.059  1.00 18.59  ? 653  ASP A CG    1 
ATOM   3350 O  OD1   . ASP C 3 357 ? 11.137  52.567 34.244  1.00 20.40  ? 653  ASP A OD1   1 
ATOM   3351 O  OD2   . ASP C 3 357 ? 11.616  54.091 32.733  1.00 20.21  ? 653  ASP A OD2   1 
ATOM   3352 N  N     . TYR C 3 358 ? 8.100   50.993 32.171  1.00 14.50  ? 654  TYR A N     1 
ATOM   3353 C  CA    . TYR C 3 358 ? 6.936   50.926 33.049  1.00 12.83  ? 654  TYR A CA    1 
ATOM   3354 C  C     . TYR C 3 358 ? 7.420   51.031 34.488  1.00 14.16  ? 654  TYR A C     1 
ATOM   3355 O  O     . TYR C 3 358 ? 8.441   50.447 34.849  1.00 14.77  ? 654  TYR A O     1 
ATOM   3356 C  CB    . TYR C 3 358 ? 6.196   49.596 32.897  1.00 14.10  ? 654  TYR A CB    1 
ATOM   3357 C  CG    . TYR C 3 358 ? 5.347   49.461 31.656  1.00 11.99  ? 654  TYR A CG    1 
ATOM   3358 C  CD1   . TYR C 3 358 ? 5.759   48.668 30.587  1.00 12.35  ? 654  TYR A CD1   1 
ATOM   3359 C  CD2   . TYR C 3 358 ? 4.117   50.112 31.560  1.00 12.12  ? 654  TYR A CD2   1 
ATOM   3360 C  CE1   . TYR C 3 358 ? 4.962   48.524 29.447  1.00 11.22  ? 654  TYR A CE1   1 
ATOM   3361 C  CE2   . TYR C 3 358 ? 3.315   49.981 30.431  1.00 11.23  ? 654  TYR A CE2   1 
ATOM   3362 C  CZ    . TYR C 3 358 ? 3.743   49.186 29.378  1.00 13.81  ? 654  TYR A CZ    1 
ATOM   3363 O  OH    . TYR C 3 358 ? 2.965   49.078 28.248  1.00 14.46  ? 654  TYR A OH    1 
ATOM   3364 N  N     . SER C 3 359 ? 6.688   51.768 35.311  1.00 13.57  ? 655  SER A N     1 
ATOM   3365 C  CA    . SER C 3 359 ? 7.051   51.896 36.713  1.00 15.10  ? 655  SER A CA    1 
ATOM   3366 C  C     . SER C 3 359 ? 6.247   50.886 37.530  1.00 14.31  ? 655  SER A C     1 
ATOM   3367 O  O     . SER C 3 359 ? 5.017   50.972 37.601  1.00 14.72  ? 655  SER A O     1 
ATOM   3368 C  CB    . SER C 3 359 ? 6.760   53.310 37.217  1.00 14.44  ? 655  SER A CB    1 
ATOM   3369 O  OG    . SER C 3 359 ? 6.973   53.389 38.618  1.00 18.46  ? 655  SER A OG    1 
ATOM   3370 N  N     . GLN C 3 360 ? 6.952   49.933 38.134  1.00 13.94  ? 656  GLN A N     1 
ATOM   3371 C  CA    . GLN C 3 360 ? 6.336   48.900 38.964  1.00 15.56  ? 656  GLN A CA    1 
ATOM   3372 C  C     . GLN C 3 360 ? 5.190   48.165 38.268  1.00 14.46  ? 656  GLN A C     1 
ATOM   3373 O  O     . GLN C 3 360 ? 4.125   47.993 38.861  1.00 14.47  ? 656  GLN A O     1 
ATOM   3374 C  CB    . GLN C 3 360 ? 5.794   49.516 40.266  1.00 15.40  ? 656  GLN A CB    1 
ATOM   3375 C  CG    . GLN C 3 360 ? 6.821   50.199 41.153  1.00 17.20  ? 656  GLN A CG    1 
ATOM   3376 C  CD    . GLN C 3 360 ? 7.924   49.262 41.583  1.00 21.30  ? 656  GLN A CD    1 
ATOM   3377 O  OE1   . GLN C 3 360 ? 7.714   48.054 41.692  1.00 23.90  ? 656  GLN A OE1   1 
ATOM   3378 N  NE2   . GLN C 3 360 ? 9.108   49.811 41.840  1.00 21.65  ? 656  GLN A NE2   1 
ATOM   3379 N  N     . ILE C 3 361 ? 5.391   47.717 37.031  1.00 14.54  ? 657  ILE A N     1 
ATOM   3380 C  CA    . ILE C 3 361 ? 4.305   47.026 36.343  1.00 14.18  ? 657  ILE A CA    1 
ATOM   3381 C  C     . ILE C 3 361 ? 3.897   45.718 37.037  1.00 13.49  ? 657  ILE A C     1 
ATOM   3382 O  O     . ILE C 3 361 ? 2.712   45.399 37.105  1.00 13.76  ? 657  ILE A O     1 
ATOM   3383 C  CB    . ILE C 3 361 ? 4.643   46.760 34.840  1.00 14.99  ? 657  ILE A CB    1 
ATOM   3384 C  CG1   . ILE C 3 361 ? 3.415   46.173 34.139  1.00 11.47  ? 657  ILE A CG1   1 
ATOM   3385 C  CG2   . ILE C 3 361 ? 5.866   45.841 34.707  1.00 11.46  ? 657  ILE A CG2   1 
ATOM   3386 C  CD1   . ILE C 3 361 ? 3.523   46.139 32.626  1.00 15.33  ? 657  ILE A CD1   1 
ATOM   3387 N  N     . GLU C 3 362 ? 4.863   44.977 37.572  1.00 13.02  ? 658  GLU A N     1 
ATOM   3388 C  CA    . GLU C 3 362 ? 4.547   43.720 38.251  1.00 13.30  ? 658  GLU A CA    1 
ATOM   3389 C  C     . GLU C 3 362 ? 3.637   43.908 39.470  1.00 13.02  ? 658  GLU A C     1 
ATOM   3390 O  O     . GLU C 3 362 ? 2.658   43.186 39.634  1.00 12.83  ? 658  GLU A O     1 
ATOM   3391 C  CB    . GLU C 3 362 ? 5.830   42.996 38.675  1.00 15.13  ? 658  GLU A CB    1 
ATOM   3392 C  CG    . GLU C 3 362 ? 6.611   42.397 37.506  1.00 20.19  ? 658  GLU A CG    1 
ATOM   3393 C  CD    . GLU C 3 362 ? 7.890   41.697 37.947  1.00 24.51  ? 658  GLU A CD    1 
ATOM   3394 O  OE1   . GLU C 3 362 ? 8.425   40.888 37.159  1.00 26.94  ? 658  GLU A OE1   1 
ATOM   3395 O  OE2   . GLU C 3 362 ? 8.362   41.957 39.076  1.00 26.72  ? 658  GLU A OE2   1 
ATOM   3396 N  N     . LEU C 3 363 ? 3.957   44.867 40.331  1.00 12.82  ? 659  LEU A N     1 
ATOM   3397 C  CA    . LEU C 3 363 ? 3.121   45.104 41.501  1.00 12.89  ? 659  LEU A CA    1 
ATOM   3398 C  C     . LEU C 3 363 ? 1.754   45.685 41.105  1.00 12.16  ? 659  LEU A C     1 
ATOM   3399 O  O     . LEU C 3 363 ? 0.757   45.456 41.790  1.00 11.29  ? 659  LEU A O     1 
ATOM   3400 C  CB    . LEU C 3 363 ? 3.852   46.012 42.504  1.00 13.09  ? 659  LEU A CB    1 
ATOM   3401 C  CG    . LEU C 3 363 ? 4.943   45.284 43.310  1.00 13.08  ? 659  LEU A CG    1 
ATOM   3402 C  CD1   . LEU C 3 363 ? 5.725   46.259 44.172  1.00 11.86  ? 659  LEU A CD1   1 
ATOM   3403 C  CD2   . LEU C 3 363 ? 4.294   44.211 44.184  1.00 13.33  ? 659  LEU A CD2   1 
ATOM   3404 N  N     . ARG C 3 364 ? 1.704   46.428 39.998  1.00 11.77  ? 660  ARG A N     1 
ATOM   3405 C  CA    . ARG C 3 364 ? 0.442   46.998 39.531  1.00 11.18  ? 660  ARG A CA    1 
ATOM   3406 C  C     . ARG C 3 364 ? -0.444  45.887 38.985  1.00 11.36  ? 660  ARG A C     1 
ATOM   3407 O  O     . ARG C 3 364 ? -1.654  45.883 39.215  1.00 11.12  ? 660  ARG A O     1 
ATOM   3408 C  CB    . ARG C 3 364 ? 0.684   48.066 38.460  1.00 11.01  ? 660  ARG A CB    1 
ATOM   3409 C  CG    . ARG C 3 364 ? 1.221   49.371 39.035  1.00 11.63  ? 660  ARG A CG    1 
ATOM   3410 C  CD    . ARG C 3 364 ? 1.659   50.340 37.943  1.00 10.97  ? 660  ARG A CD    1 
ATOM   3411 N  NE    . ARG C 3 364 ? 2.320   51.505 38.515  1.00 10.84  ? 660  ARG A NE    1 
ATOM   3412 C  CZ    . ARG C 3 364 ? 1.698   52.602 38.932  1.00 14.37  ? 660  ARG A CZ    1 
ATOM   3413 N  NH1   . ARG C 3 364 ? 0.374   52.710 38.838  1.00 12.55  ? 660  ARG A NH1   1 
ATOM   3414 N  NH2   . ARG C 3 364 ? 2.408   53.591 39.464  1.00 13.05  ? 660  ARG A NH2   1 
ATOM   3415 N  N     . VAL C 3 365 ? 0.162   44.944 38.271  1.00 10.69  ? 661  VAL A N     1 
ATOM   3416 C  CA    . VAL C 3 365 ? -0.568  43.798 37.744  1.00 11.20  ? 661  VAL A CA    1 
ATOM   3417 C  C     . VAL C 3 365 ? -1.100  42.966 38.920  1.00 12.39  ? 661  VAL A C     1 
ATOM   3418 O  O     . VAL C 3 365 ? -2.218  42.449 38.868  1.00 12.39  ? 661  VAL A O     1 
ATOM   3419 C  CB    . VAL C 3 365 ? 0.343   42.906 36.846  1.00 12.22  ? 661  VAL A CB    1 
ATOM   3420 C  CG1   . VAL C 3 365 ? -0.287  41.530 36.643  1.00 11.32  ? 661  VAL A CG1   1 
ATOM   3421 C  CG2   . VAL C 3 365 ? 0.541   43.574 35.489  1.00 12.24  ? 661  VAL A CG2   1 
ATOM   3422 N  N     . LEU C 3 366 ? -0.303  42.841 39.978  1.00 11.91  ? 662  LEU A N     1 
ATOM   3423 C  CA    . LEU C 3 366 ? -0.724  42.076 41.157  1.00 13.21  ? 662  LEU A CA    1 
ATOM   3424 C  C     . LEU C 3 366 ? -1.943  42.717 41.817  1.00 12.90  ? 662  LEU A C     1 
ATOM   3425 O  O     . LEU C 3 366 ? -2.880  42.023 42.215  1.00 14.18  ? 662  LEU A O     1 
ATOM   3426 C  CB    . LEU C 3 366 ? 0.414   41.980 42.183  1.00 14.66  ? 662  LEU A CB    1 
ATOM   3427 C  CG    . LEU C 3 366 ? 0.056   41.330 43.532  1.00 15.30  ? 662  LEU A CG    1 
ATOM   3428 C  CD1   . LEU C 3 366 ? -0.467  39.921 43.306  1.00 13.87  ? 662  LEU A CD1   1 
ATOM   3429 C  CD2   . LEU C 3 366 ? 1.281   41.302 44.437  1.00 14.58  ? 662  LEU A CD2   1 
ATOM   3430 N  N     . ALA C 3 367 ? -1.927  44.042 41.931  1.00 12.92  ? 663  ALA A N     1 
ATOM   3431 C  CA    . ALA C 3 367 ? -3.040  44.763 42.536  1.00 12.64  ? 663  ALA A CA    1 
ATOM   3432 C  C     . ALA C 3 367 ? -4.301  44.488 41.725  1.00 13.42  ? 663  ALA A C     1 
ATOM   3433 O  O     . ALA C 3 367 ? -5.376  44.275 42.280  1.00 12.11  ? 663  ALA A O     1 
ATOM   3434 C  CB    . ALA C 3 367 ? -2.748  46.268 42.569  1.00 11.48  ? 663  ALA A CB    1 
ATOM   3435 N  N     . HIS C 3 368 ? -4.156  44.489 40.404  1.00 14.06  ? 664  HIS A N     1 
ATOM   3436 C  CA    . HIS C 3 368 ? -5.276  44.232 39.508  1.00 14.25  ? 664  HIS A CA    1 
ATOM   3437 C  C     . HIS C 3 368 ? -5.852  42.818 39.627  1.00 14.63  ? 664  HIS A C     1 
ATOM   3438 O  O     . HIS C 3 368 ? -7.055  42.652 39.824  1.00 13.55  ? 664  HIS A O     1 
ATOM   3439 C  CB    . HIS C 3 368 ? -4.850  44.456 38.055  1.00 14.86  ? 664  HIS A CB    1 
ATOM   3440 C  CG    . HIS C 3 368 ? -5.872  44.009 37.053  1.00 15.44  ? 664  HIS A CG    1 
ATOM   3441 N  ND1   . HIS C 3 368 ? -6.964  44.778 36.706  1.00 14.44  ? 664  HIS A ND1   1 
ATOM   3442 C  CD2   . HIS C 3 368 ? -5.970  42.868 36.330  1.00 15.72  ? 664  HIS A CD2   1 
ATOM   3443 C  CE1   . HIS C 3 368 ? -7.688  44.131 35.809  1.00 16.19  ? 664  HIS A CE1   1 
ATOM   3444 N  NE2   . HIS C 3 368 ? -7.107  42.969 35.563  1.00 16.09  ? 664  HIS A NE2   1 
ATOM   3445 N  N     . ILE C 3 369 ? -5.000  41.801 39.500  1.00 15.31  ? 665  ILE A N     1 
ATOM   3446 C  CA    . ILE C 3 369 ? -5.471  40.418 39.563  1.00 16.48  ? 665  ILE A CA    1 
ATOM   3447 C  C     . ILE C 3 369 ? -5.948  39.969 40.944  1.00 16.89  ? 665  ILE A C     1 
ATOM   3448 O  O     . ILE C 3 369 ? -6.869  39.157 41.043  1.00 15.36  ? 665  ILE A O     1 
ATOM   3449 C  CB    . ILE C 3 369 ? -4.392  39.412 39.052  1.00 18.18  ? 665  ILE A CB    1 
ATOM   3450 C  CG1   . ILE C 3 369 ? -3.153  39.451 39.949  1.00 21.55  ? 665  ILE A CG1   1 
ATOM   3451 C  CG2   . ILE C 3 369 ? -3.996  39.750 37.622  1.00 17.98  ? 665  ILE A CG2   1 
ATOM   3452 C  CD1   . ILE C 3 369 ? -2.020  38.553 39.464  1.00 23.76  ? 665  ILE A CD1   1 
ATOM   3453 N  N     . ALA C 3 370 ? -5.332  40.493 42.001  1.00 16.35  ? 666  ALA A N     1 
ATOM   3454 C  CA    . ALA C 3 370 ? -5.716  40.132 43.365  1.00 15.73  ? 666  ALA A CA    1 
ATOM   3455 C  C     . ALA C 3 370 ? -6.868  40.999 43.860  1.00 16.51  ? 666  ALA A C     1 
ATOM   3456 O  O     . ALA C 3 370 ? -7.571  40.635 44.801  1.00 16.59  ? 666  ALA A O     1 
ATOM   3457 C  CB    . ALA C 3 370 ? -4.514  40.276 44.318  1.00 14.22  ? 666  ALA A CB    1 
ATOM   3458 N  N     . GLU C 3 371 ? -7.064  42.144 43.217  1.00 17.47  ? 667  GLU A N     1 
ATOM   3459 C  CA    . GLU C 3 371 ? -8.118  43.065 43.617  1.00 19.68  ? 667  GLU A CA    1 
ATOM   3460 C  C     . GLU C 3 371 ? -8.001  43.401 45.097  1.00 19.89  ? 667  GLU A C     1 
ATOM   3461 O  O     . GLU C 3 371 ? -8.992  43.429 45.830  1.00 19.34  ? 667  GLU A O     1 
ATOM   3462 C  CB    . GLU C 3 371 ? -9.497  42.471 43.317  1.00 21.26  ? 667  GLU A CB    1 
ATOM   3463 C  CG    . GLU C 3 371 ? -9.895  42.558 41.849  1.00 23.69  ? 667  GLU A CG    1 
ATOM   3464 C  CD    . GLU C 3 371 ? -11.291 42.021 41.598  1.00 26.22  ? 667  GLU A CD    1 
ATOM   3465 O  OE1   . GLU C 3 371 ? -11.441 40.792 41.440  1.00 26.27  ? 667  GLU A OE1   1 
ATOM   3466 O  OE2   . GLU C 3 371 ? -12.242 42.831 41.578  1.00 27.88  ? 667  GLU A OE2   1 
ATOM   3467 N  N     . ASP C 3 372 ? -6.773  43.654 45.534  1.00 19.71  ? 668  ASP A N     1 
ATOM   3468 C  CA    . ASP C 3 372 ? -6.520  44.014 46.919  1.00 16.56  ? 668  ASP A CA    1 
ATOM   3469 C  C     . ASP C 3 372 ? -6.835  45.506 47.071  1.00 16.96  ? 668  ASP A C     1 
ATOM   3470 O  O     . ASP C 3 372 ? -6.212  46.357 46.423  1.00 15.97  ? 668  ASP A O     1 
ATOM   3471 C  CB    . ASP C 3 372 ? -5.060  43.724 47.264  1.00 16.55  ? 668  ASP A CB    1 
ATOM   3472 C  CG    . ASP C 3 372 ? -4.741  43.979 48.717  1.00 15.89  ? 668  ASP A CG    1 
ATOM   3473 O  OD1   . ASP C 3 372 ? -4.646  45.159 49.107  1.00 15.70  ? 668  ASP A OD1   1 
ATOM   3474 O  OD2   . ASP C 3 372 ? -4.589  42.994 49.472  1.00 18.50  ? 668  ASP A OD2   1 
ATOM   3475 N  N     . ASP C 3 373 ? -7.806  45.816 47.925  1.00 16.31  ? 669  ASP A N     1 
ATOM   3476 C  CA    . ASP C 3 373 ? -8.224  47.197 48.157  1.00 16.29  ? 669  ASP A CA    1 
ATOM   3477 C  C     . ASP C 3 373 ? -7.085  48.128 48.564  1.00 14.73  ? 669  ASP A C     1 
ATOM   3478 O  O     . ASP C 3 373 ? -6.946  49.220 48.017  1.00 13.93  ? 669  ASP A O     1 
ATOM   3479 C  CB    . ASP C 3 373 ? -9.309  47.243 49.235  1.00 19.08  ? 669  ASP A CB    1 
ATOM   3480 C  CG    . ASP C 3 373 ? -10.642 46.678 48.759  1.00 23.63  ? 669  ASP A CG    1 
ATOM   3481 O  OD1   . ASP C 3 373 ? -11.508 46.409 49.617  1.00 25.70  ? 669  ASP A OD1   1 
ATOM   3482 O  OD2   . ASP C 3 373 ? -10.834 46.516 47.538  1.00 24.74  ? 669  ASP A OD2   1 
ATOM   3483 N  N     . ASN C 3 374 ? -6.270  47.701 49.522  1.00 15.11  ? 670  ASN A N     1 
ATOM   3484 C  CA    . ASN C 3 374 ? -5.164  48.531 49.997  1.00 16.43  ? 670  ASN A CA    1 
ATOM   3485 C  C     . ASN C 3 374 ? -4.104  48.771 48.920  1.00 14.59  ? 670  ASN A C     1 
ATOM   3486 O  O     . ASN C 3 374 ? -3.605  49.886 48.767  1.00 14.17  ? 670  ASN A O     1 
ATOM   3487 C  CB    . ASN C 3 374 ? -4.543  47.886 51.246  1.00 18.73  ? 670  ASN A CB    1 
ATOM   3488 C  CG    . ASN C 3 374 ? -3.550  48.795 51.958  1.00 19.96  ? 670  ASN A CG    1 
ATOM   3489 O  OD1   . ASN C 3 374 ? -3.743  50.010 52.044  1.00 22.27  ? 670  ASN A OD1   1 
ATOM   3490 N  ND2   . ASN C 3 374 ? -2.494  48.199 52.502  1.00 21.17  ? 670  ASN A ND2   1 
ATOM   3491 N  N     . LEU C 3 375 ? -3.769  47.734 48.162  1.00 13.82  ? 671  LEU A N     1 
ATOM   3492 C  CA    . LEU C 3 375 ? -2.757  47.871 47.119  1.00 13.13  ? 671  LEU A CA    1 
ATOM   3493 C  C     . LEU C 3 375 ? -3.250  48.683 45.915  1.00 13.78  ? 671  LEU A C     1 
ATOM   3494 O  O     . LEU C 3 375 ? -2.474  49.425 45.308  1.00 13.48  ? 671  LEU A O     1 
ATOM   3495 C  CB    . LEU C 3 375 ? -2.281  46.490 46.649  1.00 14.24  ? 671  LEU A CB    1 
ATOM   3496 C  CG    . LEU C 3 375 ? -0.979  46.525 45.841  1.00 15.14  ? 671  LEU A CG    1 
ATOM   3497 C  CD1   . LEU C 3 375 ? 0.124   47.153 46.694  1.00 14.78  ? 671  LEU A CD1   1 
ATOM   3498 C  CD2   . LEU C 3 375 ? -0.582  45.118 45.417  1.00 18.37  ? 671  LEU A CD2   1 
ATOM   3499 N  N     . MET C 3 376 ? -4.530  48.541 45.567  1.00 13.03  ? 672  MET A N     1 
ATOM   3500 C  CA    . MET C 3 376 ? -5.095  49.281 44.444  1.00 13.14  ? 672  MET A CA    1 
ATOM   3501 C  C     . MET C 3 376 ? -5.162  50.761 44.801  1.00 13.83  ? 672  MET A C     1 
ATOM   3502 O  O     . MET C 3 376 ? -4.890  51.618 43.963  1.00 15.18  ? 672  MET A O     1 
ATOM   3503 C  CB    . MET C 3 376 ? -6.504  48.774 44.093  1.00 14.69  ? 672  MET A CB    1 
ATOM   3504 C  CG    . MET C 3 376 ? -6.549  47.390 43.459  1.00 15.59  ? 672  MET A CG    1 
ATOM   3505 S  SD    . MET C 3 376 ? -8.188  46.941 42.806  1.00 17.83  ? 672  MET A SD    1 
ATOM   3506 C  CE    . MET C 3 376 ? -9.090  46.645 44.284  1.00 17.01  ? 672  MET A CE    1 
ATOM   3507 N  N     . GLU C 3 377 ? -5.528  51.052 46.046  1.00 12.42  ? 673  GLU A N     1 
ATOM   3508 C  CA    . GLU C 3 377 ? -5.620  52.431 46.524  1.00 13.11  ? 673  GLU A CA    1 
ATOM   3509 C  C     . GLU C 3 377 ? -4.225  53.054 46.515  1.00 13.94  ? 673  GLU A C     1 
ATOM   3510 O  O     . GLU C 3 377 ? -4.051  54.224 46.158  1.00 13.07  ? 673  GLU A O     1 
ATOM   3511 C  CB    . GLU C 3 377 ? -6.198  52.459 47.949  1.00 12.60  ? 673  GLU A CB    1 
ATOM   3512 C  CG    . GLU C 3 377 ? -6.265  53.847 48.615  1.00 12.38  ? 673  GLU A CG    1 
ATOM   3513 C  CD    . GLU C 3 377 ? -7.248  54.796 47.933  1.00 14.26  ? 673  GLU A CD    1 
ATOM   3514 O  OE1   . GLU C 3 377 ? -7.872  54.391 46.928  1.00 16.64  ? 673  GLU A OE1   1 
ATOM   3515 O  OE2   . GLU C 3 377 ? -7.397  55.946 48.401  1.00 14.26  ? 673  GLU A OE2   1 
ATOM   3516 N  N     . ALA C 3 378 ? -3.234  52.262 46.907  1.00 12.93  ? 674  ALA A N     1 
ATOM   3517 C  CA    . ALA C 3 378 ? -1.853  52.731 46.947  1.00 12.26  ? 674  ALA A CA    1 
ATOM   3518 C  C     . ALA C 3 378 ? -1.406  53.226 45.573  1.00 12.33  ? 674  ALA A C     1 
ATOM   3519 O  O     . ALA C 3 378 ? -0.827  54.297 45.452  1.00 12.06  ? 674  ALA A O     1 
ATOM   3520 C  CB    . ALA C 3 378 ? -0.939  51.608 47.432  1.00 10.98  ? 674  ALA A CB    1 
ATOM   3521 N  N     . PHE C 3 379 ? -1.692  52.451 44.531  1.00 14.28  ? 675  PHE A N     1 
ATOM   3522 C  CA    . PHE C 3 379 ? -1.302  52.843 43.186  1.00 13.64  ? 675  PHE A CA    1 
ATOM   3523 C  C     . PHE C 3 379 ? -2.212  53.926 42.625  1.00 14.81  ? 675  PHE A C     1 
ATOM   3524 O  O     . PHE C 3 379 ? -1.793  54.709 41.780  1.00 15.14  ? 675  PHE A O     1 
ATOM   3525 C  CB    . PHE C 3 379 ? -1.271  51.620 42.263  1.00 14.32  ? 675  PHE A CB    1 
ATOM   3526 C  CG    . PHE C 3 379 ? -0.064  50.743 42.473  1.00 12.15  ? 675  PHE A CG    1 
ATOM   3527 C  CD1   . PHE C 3 379 ? -0.205  49.410 42.851  1.00 12.08  ? 675  PHE A CD1   1 
ATOM   3528 C  CD2   . PHE C 3 379 ? 1.216   51.263 42.311  1.00 10.82  ? 675  PHE A CD2   1 
ATOM   3529 C  CE1   . PHE C 3 379 ? 0.916   48.606 43.067  1.00 12.67  ? 675  PHE A CE1   1 
ATOM   3530 C  CE2   . PHE C 3 379 ? 2.347   50.474 42.523  1.00 11.33  ? 675  PHE A CE2   1 
ATOM   3531 C  CZ    . PHE C 3 379 ? 2.197   49.138 42.903  1.00 12.20  ? 675  PHE A CZ    1 
ATOM   3532 N  N     . ARG C 3 380 ? -3.456  53.975 43.098  1.00 14.62  ? 676  ARG A N     1 
ATOM   3533 C  CA    . ARG C 3 380 ? -4.390  55.001 42.642  1.00 15.66  ? 676  ARG A CA    1 
ATOM   3534 C  C     . ARG C 3 380 ? -3.906  56.353 43.156  1.00 15.20  ? 676  ARG A C     1 
ATOM   3535 O  O     . ARG C 3 380 ? -4.178  57.394 42.556  1.00 14.86  ? 676  ARG A O     1 
ATOM   3536 C  CB    . ARG C 3 380 ? -5.814  54.681 43.122  1.00 14.56  ? 676  ARG A CB    1 
ATOM   3537 C  CG    . ARG C 3 380 ? -6.502  53.653 42.223  1.00 15.63  ? 676  ARG A CG    1 
ATOM   3538 C  CD    . ARG C 3 380 ? -7.752  53.033 42.837  1.00 20.24  ? 676  ARG A CD    1 
ATOM   3539 N  NE    . ARG C 3 380 ? -8.373  52.078 41.916  1.00 20.25  ? 676  ARG A NE    1 
ATOM   3540 C  CZ    . ARG C 3 380 ? -9.323  51.209 42.260  1.00 23.20  ? 676  ARG A CZ    1 
ATOM   3541 N  NH1   . ARG C 3 380 ? -9.764  51.161 43.511  1.00 21.00  ? 676  ARG A NH1   1 
ATOM   3542 N  NH2   . ARG C 3 380 ? -9.841  50.390 41.348  1.00 22.46  ? 676  ARG A NH2   1 
ATOM   3543 N  N     . ARG C 3 381 ? -3.164  56.321 44.260  1.00 14.80  ? 677  ARG A N     1 
ATOM   3544 C  CA    . ARG C 3 381 ? -2.584  57.526 44.850  1.00 15.44  ? 677  ARG A CA    1 
ATOM   3545 C  C     . ARG C 3 381 ? -1.144  57.681 44.352  1.00 16.15  ? 677  ARG A C     1 
ATOM   3546 O  O     . ARG C 3 381 ? -0.446  58.622 44.736  1.00 17.15  ? 677  ARG A O     1 
ATOM   3547 C  CB    . ARG C 3 381 ? -2.544  57.425 46.376  1.00 15.60  ? 677  ARG A CB    1 
ATOM   3548 C  CG    . ARG C 3 381 ? -3.885  57.332 47.079  1.00 16.33  ? 677  ARG A CG    1 
ATOM   3549 C  CD    . ARG C 3 381 ? -3.662  57.356 48.588  1.00 16.41  ? 677  ARG A CD    1 
ATOM   3550 N  NE    . ARG C 3 381 ? -4.851  56.986 49.341  1.00 17.13  ? 677  ARG A NE    1 
ATOM   3551 C  CZ    . ARG C 3 381 ? -4.913  56.972 50.669  1.00 20.29  ? 677  ARG A CZ    1 
ATOM   3552 N  NH1   . ARG C 3 381 ? -3.850  57.314 51.389  1.00 19.62  ? 677  ARG A NH1   1 
ATOM   3553 N  NH2   . ARG C 3 381 ? -6.033  56.612 51.279  1.00 16.03  ? 677  ARG A NH2   1 
ATOM   3554 N  N     . ASP C 3 382 ? -0.708  56.752 43.502  1.00 15.83  ? 678  ASP A N     1 
ATOM   3555 C  CA    . ASP C 3 382 ? 0.655   56.753 42.973  1.00 18.35  ? 678  ASP A CA    1 
ATOM   3556 C  C     . ASP C 3 382 ? 1.681   56.936 44.092  1.00 18.30  ? 678  ASP A C     1 
ATOM   3557 O  O     . ASP C 3 382 ? 2.613   57.731 43.974  1.00 19.34  ? 678  ASP A O     1 
ATOM   3558 C  CB    . ASP C 3 382 ? 0.831   57.854 41.916  1.00 17.86  ? 678  ASP A CB    1 
ATOM   3559 C  CG    . ASP C 3 382 ? 2.158   57.737 41.161  1.00 20.09  ? 678  ASP A CG    1 
ATOM   3560 O  OD1   . ASP C 3 382 ? 2.679   56.609 41.019  1.00 19.59  ? 678  ASP A OD1   1 
ATOM   3561 O  OD2   . ASP C 3 382 ? 2.675   58.770 40.696  1.00 19.49  ? 678  ASP A OD2   1 
ATOM   3562 N  N     . LEU C 3 383 ? 1.507   56.192 45.180  1.00 18.93  ? 679  LEU A N     1 
ATOM   3563 C  CA    . LEU C 3 383 ? 2.423   56.273 46.322  1.00 19.74  ? 679  LEU A CA    1 
ATOM   3564 C  C     . LEU C 3 383 ? 3.718   55.504 46.072  1.00 18.88  ? 679  LEU A C     1 
ATOM   3565 O  O     . LEU C 3 383 ? 3.792   54.666 45.171  1.00 17.43  ? 679  LEU A O     1 
ATOM   3566 C  CB    . LEU C 3 383 ? 1.783   55.677 47.584  1.00 21.07  ? 679  LEU A CB    1 
ATOM   3567 C  CG    . LEU C 3 383 ? 0.443   56.138 48.154  1.00 22.56  ? 679  LEU A CG    1 
ATOM   3568 C  CD1   . LEU C 3 383 ? 0.137   55.306 49.398  1.00 24.33  ? 679  LEU A CD1   1 
ATOM   3569 C  CD2   . LEU C 3 383 ? 0.488   57.609 48.509  1.00 23.52  ? 679  LEU A CD2   1 
ATOM   3570 N  N     . ASP C 3 384 ? 4.737   55.796 46.876  1.00 18.19  ? 680  ASP A N     1 
ATOM   3571 C  CA    . ASP C 3 384 ? 5.995   55.062 46.796  1.00 19.13  ? 680  ASP A CA    1 
ATOM   3572 C  C     . ASP C 3 384 ? 5.580   53.758 47.471  1.00 17.43  ? 680  ASP A C     1 
ATOM   3573 O  O     . ASP C 3 384 ? 5.352   53.721 48.681  1.00 17.98  ? 680  ASP A O     1 
ATOM   3574 C  CB    . ASP C 3 384 ? 7.093   55.761 47.610  1.00 21.48  ? 680  ASP A CB    1 
ATOM   3575 C  CG    . ASP C 3 384 ? 8.297   54.859 47.873  1.00 23.91  ? 680  ASP A CG    1 
ATOM   3576 O  OD1   . ASP C 3 384 ? 9.280   55.335 48.478  1.00 30.40  ? 680  ASP A OD1   1 
ATOM   3577 O  OD2   . ASP C 3 384 ? 8.268   53.675 47.489  1.00 22.95  ? 680  ASP A OD2   1 
ATOM   3578 N  N     . ILE C 3 385 ? 5.472   52.697 46.680  1.00 17.53  ? 681  ILE A N     1 
ATOM   3579 C  CA    . ILE C 3 385 ? 5.019   51.401 47.172  1.00 15.63  ? 681  ILE A CA    1 
ATOM   3580 C  C     . ILE C 3 385 ? 5.878   50.750 48.268  1.00 15.82  ? 681  ILE A C     1 
ATOM   3581 O  O     . ILE C 3 385 ? 5.353   50.054 49.143  1.00 15.82  ? 681  ILE A O     1 
ATOM   3582 C  CB    . ILE C 3 385 ? 4.829   50.425 45.969  1.00 16.50  ? 681  ILE A CB    1 
ATOM   3583 C  CG1   . ILE C 3 385 ? 4.121   49.152 46.429  1.00 18.21  ? 681  ILE A CG1   1 
ATOM   3584 C  CG2   . ILE C 3 385 ? 6.170   50.110 45.317  1.00 16.41  ? 681  ILE A CG2   1 
ATOM   3585 C  CD1   . ILE C 3 385 ? 2.717   49.400 46.937  1.00 19.09  ? 681  ILE A CD1   1 
ATOM   3586 N  N     . HIS C 3 386 ? 7.188   50.975 48.247  1.00 13.62  ? 682  HIS A N     1 
ATOM   3587 C  CA    . HIS C 3 386 ? 8.045   50.372 49.268  1.00 14.04  ? 682  HIS A CA    1 
ATOM   3588 C  C     . HIS C 3 386 ? 7.903   51.098 50.605  1.00 13.51  ? 682  HIS A C     1 
ATOM   3589 O  O     . HIS C 3 386 ? 7.907   50.477 51.665  1.00 15.26  ? 682  HIS A O     1 
ATOM   3590 C  CB    . HIS C 3 386 ? 9.499   50.358 48.794  1.00 13.05  ? 682  HIS A CB    1 
ATOM   3591 C  CG    . HIS C 3 386 ? 9.694   49.625 47.506  1.00 13.30  ? 682  HIS A CG    1 
ATOM   3592 N  ND1   . HIS C 3 386 ? 9.302   48.315 47.331  1.00 14.30  ? 682  HIS A ND1   1 
ATOM   3593 C  CD2   . HIS C 3 386 ? 10.219  50.022 46.323  1.00 14.68  ? 682  HIS A CD2   1 
ATOM   3594 C  CE1   . HIS C 3 386 ? 9.577   47.936 46.096  1.00 13.47  ? 682  HIS A CE1   1 
ATOM   3595 N  NE2   . HIS C 3 386 ? 10.134  48.953 45.464  1.00 12.73  ? 682  HIS A NE2   1 
ATOM   3596 N  N     . THR C 3 387 ? 7.759   52.415 50.553  1.00 14.34  ? 683  THR A N     1 
ATOM   3597 C  CA    . THR C 3 387 ? 7.572   53.193 51.769  1.00 14.50  ? 683  THR A CA    1 
ATOM   3598 C  C     . THR C 3 387 ? 6.202   52.827 52.353  1.00 15.12  ? 683  THR A C     1 
ATOM   3599 O  O     . THR C 3 387 ? 6.068   52.606 53.554  1.00 15.07  ? 683  THR A O     1 
ATOM   3600 C  CB    . THR C 3 387 ? 7.636   54.708 51.469  1.00 14.68  ? 683  THR A CB    1 
ATOM   3601 O  OG1   . THR C 3 387 ? 8.958   55.041 51.021  1.00 15.51  ? 683  THR A OG1   1 
ATOM   3602 C  CG2   . THR C 3 387 ? 7.307   55.529 52.711  1.00 16.80  ? 683  THR A CG2   1 
ATOM   3603 N  N     . LYS C 3 388 ? 5.191   52.748 51.490  1.00 15.20  ? 684  LYS A N     1 
ATOM   3604 C  CA    . LYS C 3 388 ? 3.832   52.401 51.919  1.00 15.85  ? 684  LYS A CA    1 
ATOM   3605 C  C     . LYS C 3 388 ? 3.794   51.022 52.582  1.00 15.66  ? 684  LYS A C     1 
ATOM   3606 O  O     . LYS C 3 388 ? 3.140   50.825 53.607  1.00 15.74  ? 684  LYS A O     1 
ATOM   3607 C  CB    . LYS C 3 388 ? 2.891   52.426 50.710  1.00 17.41  ? 684  LYS A CB    1 
ATOM   3608 C  CG    . LYS C 3 388 ? 1.582   51.673 50.889  1.00 21.15  ? 684  LYS A CG    1 
ATOM   3609 C  CD    . LYS C 3 388 ? 0.701   52.293 51.958  1.00 21.61  ? 684  LYS A CD    1 
ATOM   3610 C  CE    . LYS C 3 388 ? -0.675  51.642 51.944  1.00 24.28  ? 684  LYS A CE    1 
ATOM   3611 N  NZ    . LYS C 3 388 ? -1.527  52.125 53.057  1.00 25.17  ? 684  LYS A NZ    1 
ATOM   3612 N  N     . THR C 3 389 ? 4.498   50.066 51.991  1.00 16.01  ? 685  THR A N     1 
ATOM   3613 C  CA    . THR C 3 389 ? 4.544   48.721 52.544  1.00 15.90  ? 685  THR A CA    1 
ATOM   3614 C  C     . THR C 3 389 ? 5.226   48.736 53.918  1.00 16.48  ? 685  THR A C     1 
ATOM   3615 O  O     . THR C 3 389 ? 4.823   48.011 54.824  1.00 15.80  ? 685  THR A O     1 
ATOM   3616 C  CB    . THR C 3 389 ? 5.289   47.776 51.588  1.00 17.96  ? 685  THR A CB    1 
ATOM   3617 O  OG1   . THR C 3 389 ? 4.581   47.718 50.344  1.00 19.14  ? 685  THR A OG1   1 
ATOM   3618 C  CG2   . THR C 3 389 ? 5.383   46.380 52.166  1.00 16.61  ? 685  THR A CG2   1 
ATOM   3619 N  N     . ALA C 3 390 ? 6.255   49.568 54.073  1.00 17.14  ? 686  ALA A N     1 
ATOM   3620 C  CA    . ALA C 3 390 ? 6.958   49.668 55.352  1.00 17.13  ? 686  ALA A CA    1 
ATOM   3621 C  C     . ALA C 3 390 ? 6.009   50.203 56.415  1.00 18.03  ? 686  ALA A C     1 
ATOM   3622 O  O     . ALA C 3 390 ? 5.969   49.696 57.536  1.00 19.02  ? 686  ALA A O     1 
ATOM   3623 C  CB    . ALA C 3 390 ? 8.162   50.592 55.223  1.00 17.50  ? 686  ALA A CB    1 
ATOM   3624 N  N     . MET C 3 391 ? 5.246   51.232 56.053  1.00 18.84  ? 687  MET A N     1 
ATOM   3625 C  CA    . MET C 3 391 ? 4.282   51.847 56.964  1.00 20.49  ? 687  MET A CA    1 
ATOM   3626 C  C     . MET C 3 391 ? 3.265   50.834 57.490  1.00 21.32  ? 687  MET A C     1 
ATOM   3627 O  O     . MET C 3 391 ? 2.953   50.820 58.680  1.00 21.50  ? 687  MET A O     1 
ATOM   3628 C  CB    . MET C 3 391 ? 3.534   52.980 56.255  1.00 21.06  ? 687  MET A CB    1 
ATOM   3629 C  CG    . MET C 3 391 ? 4.354   54.235 56.013  1.00 20.92  ? 687  MET A CG    1 
ATOM   3630 S  SD    . MET C 3 391 ? 3.509   55.417 54.941  1.00 21.31  ? 687  MET A SD    1 
ATOM   3631 C  CE    . MET C 3 391 ? 2.045   55.787 55.937  1.00 22.28  ? 687  MET A CE    1 
ATOM   3632 N  N     . ASP C 3 392 ? 2.751   49.992 56.595  1.00 20.93  ? 688  ASP A N     1 
ATOM   3633 C  CA    . ASP C 3 392 ? 1.753   48.987 56.956  1.00 21.36  ? 688  ASP A CA    1 
ATOM   3634 C  C     . ASP C 3 392 ? 2.332   47.841 57.787  1.00 21.57  ? 688  ASP A C     1 
ATOM   3635 O  O     . ASP C 3 392 ? 1.811   47.514 58.846  1.00 21.08  ? 688  ASP A O     1 
ATOM   3636 C  CB    . ASP C 3 392 ? 1.097   48.423 55.689  1.00 20.92  ? 688  ASP A CB    1 
ATOM   3637 C  CG    . ASP C 3 392 ? 0.133   49.404 55.040  1.00 21.45  ? 688  ASP A CG    1 
ATOM   3638 O  OD1   . ASP C 3 392 ? -0.290  49.156 53.894  1.00 23.43  ? 688  ASP A OD1   1 
ATOM   3639 O  OD2   . ASP C 3 392 ? -0.212  50.418 55.672  1.00 23.29  ? 688  ASP A OD2   1 
ATOM   3640 N  N     . ILE C 3 393 ? 3.407   47.235 57.297  1.00 23.38  ? 689  ILE A N     1 
ATOM   3641 C  CA    . ILE C 3 393 ? 4.058   46.128 57.990  1.00 24.58  ? 689  ILE A CA    1 
ATOM   3642 C  C     . ILE C 3 393 ? 4.585   46.498 59.374  1.00 25.75  ? 689  ILE A C     1 
ATOM   3643 O  O     . ILE C 3 393 ? 4.467   45.710 60.317  1.00 25.53  ? 689  ILE A O     1 
ATOM   3644 C  CB    . ILE C 3 393 ? 5.243   45.582 57.166  1.00 25.57  ? 689  ILE A CB    1 
ATOM   3645 C  CG1   . ILE C 3 393 ? 4.724   44.802 55.964  1.00 27.04  ? 689  ILE A CG1   1 
ATOM   3646 C  CG2   . ILE C 3 393 ? 6.122   44.688 58.029  1.00 24.72  ? 689  ILE A CG2   1 
ATOM   3647 C  CD1   . ILE C 3 393 ? 5.830   44.315 55.065  1.00 27.96  ? 689  ILE A CD1   1 
ATOM   3648 N  N     . PHE C 3 394 ? 5.167   47.688 59.500  1.00 25.92  ? 690  PHE A N     1 
ATOM   3649 C  CA    . PHE C 3 394 ? 5.731   48.111 60.779  1.00 28.01  ? 690  PHE A CA    1 
ATOM   3650 C  C     . PHE C 3 394 ? 4.808   49.002 61.595  1.00 28.83  ? 690  PHE A C     1 
ATOM   3651 O  O     . PHE C 3 394 ? 5.158   49.423 62.699  1.00 30.04  ? 690  PHE A O     1 
ATOM   3652 C  CB    . PHE C 3 394 ? 7.072   48.820 60.555  1.00 27.26  ? 690  PHE A CB    1 
ATOM   3653 C  CG    . PHE C 3 394 ? 8.082   47.981 59.829  1.00 28.00  ? 690  PHE A CG    1 
ATOM   3654 C  CD1   . PHE C 3 394 ? 8.521   46.777 60.366  1.00 28.92  ? 690  PHE A CD1   1 
ATOM   3655 C  CD2   . PHE C 3 394 ? 8.580   48.383 58.596  1.00 27.26  ? 690  PHE A CD2   1 
ATOM   3656 C  CE1   . PHE C 3 394 ? 9.442   45.983 59.682  1.00 28.37  ? 690  PHE A CE1   1 
ATOM   3657 C  CE2   . PHE C 3 394 ? 9.500   47.598 57.905  1.00 27.61  ? 690  PHE A CE2   1 
ATOM   3658 C  CZ    . PHE C 3 394 ? 9.931   46.396 58.449  1.00 28.25  ? 690  PHE A CZ    1 
ATOM   3659 N  N     . GLN C 3 395 ? 3.631   49.294 61.056  1.00 29.68  ? 691  GLN A N     1 
ATOM   3660 C  CA    . GLN C 3 395 ? 2.670   50.119 61.771  1.00 31.43  ? 691  GLN A CA    1 
ATOM   3661 C  C     . GLN C 3 395 ? 3.236   51.467 62.203  1.00 31.95  ? 691  GLN A C     1 
ATOM   3662 O  O     . GLN C 3 395 ? 3.171   51.824 63.381  1.00 32.57  ? 691  GLN A O     1 
ATOM   3663 C  CB    . GLN C 3 395 ? 2.174   49.370 63.006  1.00 34.40  ? 691  GLN A CB    1 
ATOM   3664 C  CG    . GLN C 3 395 ? 1.400   48.102 62.703  1.00 37.40  ? 691  GLN A CG    1 
ATOM   3665 C  CD    . GLN C 3 395 ? 1.320   47.176 63.903  1.00 40.83  ? 691  GLN A CD    1 
ATOM   3666 O  OE1   . GLN C 3 395 ? 0.532   46.228 63.920  1.00 43.16  ? 691  GLN A OE1   1 
ATOM   3667 N  NE2   . GLN C 3 395 ? 2.148   47.438 64.912  1.00 39.43  ? 691  GLN A NE2   1 
ATOM   3668 N  N     . VAL C 3 396 ? 3.793   52.217 61.260  1.00 30.67  ? 692  VAL A N     1 
ATOM   3669 C  CA    . VAL C 3 396 ? 4.334   53.531 61.580  1.00 30.20  ? 692  VAL A CA    1 
ATOM   3670 C  C     . VAL C 3 396 ? 3.864   54.543 60.537  1.00 30.98  ? 692  VAL A C     1 
ATOM   3671 O  O     . VAL C 3 396 ? 3.305   54.166 59.504  1.00 29.46  ? 692  VAL A O     1 
ATOM   3672 C  CB    . VAL C 3 396 ? 5.882   53.513 61.626  1.00 30.83  ? 692  VAL A CB    1 
ATOM   3673 C  CG1   . VAL C 3 396 ? 6.359   52.534 62.699  1.00 30.54  ? 692  VAL A CG1   1 
ATOM   3674 C  CG2   . VAL C 3 396 ? 6.447   53.131 60.268  1.00 29.56  ? 692  VAL A CG2   1 
ATOM   3675 N  N     . SER C 3 397 ? 4.082   55.825 60.813  1.00 29.45  ? 693  SER A N     1 
ATOM   3676 C  CA    . SER C 3 397 ? 3.687   56.878 59.889  1.00 29.73  ? 693  SER A CA    1 
ATOM   3677 C  C     . SER C 3 397 ? 4.775   57.022 58.832  1.00 29.90  ? 693  SER A C     1 
ATOM   3678 O  O     . SER C 3 397 ? 5.868   56.486 58.988  1.00 28.70  ? 693  SER A O     1 
ATOM   3679 C  CB    . SER C 3 397 ? 3.504   58.201 60.639  1.00 29.47  ? 693  SER A CB    1 
ATOM   3680 O  OG    . SER C 3 397 ? 4.720   58.616 61.241  1.00 30.73  ? 693  SER A OG    1 
ATOM   3681 N  N     . GLU C 3 398 ? 4.480   57.744 57.756  1.00 29.42  ? 694  GLU A N     1 
ATOM   3682 C  CA    . GLU C 3 398 ? 5.459   57.925 56.695  1.00 29.13  ? 694  GLU A CA    1 
ATOM   3683 C  C     . GLU C 3 398 ? 6.760   58.525 57.231  1.00 29.98  ? 694  GLU A C     1 
ATOM   3684 O  O     . GLU C 3 398 ? 7.854   58.150 56.794  1.00 29.47  ? 694  GLU A O     1 
ATOM   3685 C  CB    . GLU C 3 398 ? 4.900   58.826 55.593  1.00 28.24  ? 694  GLU A CB    1 
ATOM   3686 C  CG    . GLU C 3 398 ? 5.780   58.874 54.352  1.00 28.87  ? 694  GLU A CG    1 
ATOM   3687 C  CD    . GLU C 3 398 ? 5.232   59.780 53.268  1.00 30.92  ? 694  GLU A CD    1 
ATOM   3688 O  OE1   . GLU C 3 398 ? 4.010   59.748 53.017  1.00 33.19  ? 694  GLU A OE1   1 
ATOM   3689 O  OE2   . GLU C 3 398 ? 6.026   60.522 52.659  1.00 32.66  ? 694  GLU A OE2   1 
ATOM   3690 N  N     . ASP C 3 399 ? 6.637   59.455 58.174  1.00 30.16  ? 695  ASP A N     1 
ATOM   3691 C  CA    . ASP C 3 399 ? 7.801   60.112 58.761  1.00 31.39  ? 695  ASP A CA    1 
ATOM   3692 C  C     . ASP C 3 399 ? 8.640   59.192 59.638  1.00 29.83  ? 695  ASP A C     1 
ATOM   3693 O  O     . ASP C 3 399 ? 9.829   59.434 59.833  1.00 30.44  ? 695  ASP A O     1 
ATOM   3694 C  CB    . ASP C 3 399 ? 7.367   61.331 59.580  1.00 35.44  ? 695  ASP A CB    1 
ATOM   3695 C  CG    . ASP C 3 399 ? 6.901   62.479 58.707  1.00 40.45  ? 695  ASP A CG    1 
ATOM   3696 O  OD1   . ASP C 3 399 ? 7.683   62.911 57.832  1.00 43.71  ? 695  ASP A OD1   1 
ATOM   3697 O  OD2   . ASP C 3 399 ? 5.759   62.950 58.892  1.00 43.12  ? 695  ASP A OD2   1 
ATOM   3698 N  N     . GLU C 3 400 ? 8.026   58.136 60.158  1.00 27.88  ? 696  GLU A N     1 
ATOM   3699 C  CA    . GLU C 3 400 ? 8.735   57.200 61.019  1.00 27.55  ? 696  GLU A CA    1 
ATOM   3700 C  C     . GLU C 3 400 ? 9.404   56.048 60.266  1.00 26.25  ? 696  GLU A C     1 
ATOM   3701 O  O     . GLU C 3 400 ? 9.993   55.166 60.887  1.00 24.83  ? 696  GLU A O     1 
ATOM   3702 C  CB    . GLU C 3 400 ? 7.775   56.640 62.071  1.00 29.14  ? 696  GLU A CB    1 
ATOM   3703 C  CG    . GLU C 3 400 ? 7.108   57.721 62.913  1.00 33.22  ? 696  GLU A CG    1 
ATOM   3704 C  CD    . GLU C 3 400 ? 6.060   57.168 63.860  1.00 35.48  ? 696  GLU A CD    1 
ATOM   3705 O  OE1   . GLU C 3 400 ? 5.180   56.410 63.399  1.00 36.97  ? 696  GLU A OE1   1 
ATOM   3706 O  OE2   . GLU C 3 400 ? 6.110   57.493 65.065  1.00 38.21  ? 696  GLU A OE2   1 
ATOM   3707 N  N     . VAL C 3 401 ? 9.313   56.045 58.938  1.00 23.93  ? 697  VAL A N     1 
ATOM   3708 C  CA    . VAL C 3 401 ? 9.942   54.981 58.160  1.00 22.48  ? 697  VAL A CA    1 
ATOM   3709 C  C     . VAL C 3 401 ? 11.410  55.323 57.956  1.00 21.77  ? 697  VAL A C     1 
ATOM   3710 O  O     . VAL C 3 401 ? 11.737  56.352 57.371  1.00 22.30  ? 697  VAL A O     1 
ATOM   3711 C  CB    . VAL C 3 401 ? 9.281   54.798 56.771  1.00 22.78  ? 697  VAL A CB    1 
ATOM   3712 C  CG1   . VAL C 3 401 ? 10.059  53.767 55.963  1.00 21.66  ? 697  VAL A CG1   1 
ATOM   3713 C  CG2   . VAL C 3 401 ? 7.827   54.343 56.932  1.00 22.86  ? 697  VAL A CG2   1 
ATOM   3714 N  N     . THR C 3 402 ? 12.292  54.458 58.447  1.00 19.23  ? 698  THR A N     1 
ATOM   3715 C  CA    . THR C 3 402 ? 13.730  54.669 58.313  1.00 18.14  ? 698  THR A CA    1 
ATOM   3716 C  C     . THR C 3 402 ? 14.257  54.005 57.039  1.00 17.30  ? 698  THR A C     1 
ATOM   3717 O  O     . THR C 3 402 ? 13.601  53.140 56.457  1.00 17.24  ? 698  THR A O     1 
ATOM   3718 C  CB    . THR C 3 402 ? 14.497  54.067 59.511  1.00 17.09  ? 698  THR A CB    1 
ATOM   3719 O  OG1   . THR C 3 402 ? 14.239  52.658 59.575  1.00 19.25  ? 698  THR A OG1   1 
ATOM   3720 C  CG2   . THR C 3 402 ? 14.048  54.704 60.816  1.00 16.80  ? 698  THR A CG2   1 
ATOM   3721 N  N     . PRO C 3 403 ? 15.453  54.408 56.587  1.00 16.64  ? 699  PRO A N     1 
ATOM   3722 C  CA    . PRO C 3 403 ? 16.027  53.814 55.379  1.00 16.99  ? 699  PRO A CA    1 
ATOM   3723 C  C     . PRO C 3 403 ? 16.063  52.280 55.429  1.00 16.93  ? 699  PRO A C     1 
ATOM   3724 O  O     . PRO C 3 403 ? 15.764  51.617 54.436  1.00 14.96  ? 699  PRO A O     1 
ATOM   3725 C  CB    . PRO C 3 403 ? 17.413  54.439 55.310  1.00 16.80  ? 699  PRO A CB    1 
ATOM   3726 C  CG    . PRO C 3 403 ? 17.178  55.817 55.881  1.00 17.07  ? 699  PRO A CG    1 
ATOM   3727 C  CD    . PRO C 3 403 ? 16.273  55.539 57.065  1.00 18.05  ? 699  PRO A CD    1 
ATOM   3728 N  N     . ASN C 3 404 ? 16.423  51.721 56.584  1.00 16.22  ? 700  ASN A N     1 
ATOM   3729 C  CA    . ASN C 3 404 ? 16.504  50.267 56.718  1.00 15.93  ? 700  ASN A CA    1 
ATOM   3730 C  C     . ASN C 3 404 ? 15.130  49.604 56.653  1.00 16.24  ? 700  ASN A C     1 
ATOM   3731 O  O     . ASN C 3 404 ? 14.994  48.490 56.132  1.00 13.97  ? 700  ASN A O     1 
ATOM   3732 C  CB    . ASN C 3 404 ? 17.212  49.888 58.020  1.00 14.83  ? 700  ASN A CB    1 
ATOM   3733 C  CG    . ASN C 3 404 ? 17.735  48.466 58.000  1.00 17.26  ? 700  ASN A CG    1 
ATOM   3734 O  OD1   . ASN C 3 404 ? 18.331  48.022 57.012  1.00 18.20  ? 700  ASN A OD1   1 
ATOM   3735 N  ND2   . ASN C 3 404 ? 17.528  47.743 59.095  1.00 17.18  ? 700  ASN A ND2   1 
ATOM   3736 N  N     . MET C 3 405 ? 14.115  50.285 57.179  1.00 14.29  ? 701  MET A N     1 
ATOM   3737 C  CA    . MET C 3 405 ? 12.749  49.772 57.139  1.00 16.58  ? 701  MET A CA    1 
ATOM   3738 C  C     . MET C 3 405 ? 12.254  49.666 55.694  1.00 16.51  ? 701  MET A C     1 
ATOM   3739 O  O     . MET C 3 405 ? 11.622  48.674 55.313  1.00 17.54  ? 701  MET A O     1 
ATOM   3740 C  CB    . MET C 3 405 ? 11.815  50.690 57.930  1.00 17.39  ? 701  MET A CB    1 
ATOM   3741 C  CG    . MET C 3 405 ? 11.896  50.507 59.432  1.00 20.40  ? 701  MET A CG    1 
ATOM   3742 S  SD    . MET C 3 405 ? 11.006  51.774 60.368  1.00 27.50  ? 701  MET A SD    1 
ATOM   3743 C  CE    . MET C 3 405 ? 9.369   51.175 60.296  1.00 24.34  ? 701  MET A CE    1 
ATOM   3744 N  N     . ARG C 3 406 ? 12.544  50.688 54.890  1.00 16.97  ? 702  ARG A N     1 
ATOM   3745 C  CA    . ARG C 3 406 ? 12.120  50.699 53.491  1.00 17.47  ? 702  ARG A CA    1 
ATOM   3746 C  C     . ARG C 3 406 ? 12.853  49.616 52.713  1.00 16.92  ? 702  ARG A C     1 
ATOM   3747 O  O     . ARG C 3 406 ? 12.266  48.949 51.864  1.00 16.04  ? 702  ARG A O     1 
ATOM   3748 C  CB    . ARG C 3 406 ? 12.391  52.065 52.848  1.00 17.79  ? 702  ARG A CB    1 
ATOM   3749 C  CG    . ARG C 3 406 ? 11.933  52.170 51.387  1.00 18.24  ? 702  ARG A CG    1 
ATOM   3750 C  CD    . ARG C 3 406 ? 12.224  53.554 50.816  1.00 19.94  ? 702  ARG A CD    1 
ATOM   3751 N  NE    . ARG C 3 406 ? 11.659  53.758 49.482  1.00 19.23  ? 702  ARG A NE    1 
ATOM   3752 C  CZ    . ARG C 3 406 ? 12.132  53.202 48.373  1.00 19.23  ? 702  ARG A CZ    1 
ATOM   3753 N  NH1   . ARG C 3 406 ? 13.188  52.400 48.425  1.00 19.18  ? 702  ARG A NH1   1 
ATOM   3754 N  NH2   . ARG C 3 406 ? 11.547  53.447 47.209  1.00 18.51  ? 702  ARG A NH2   1 
ATOM   3755 N  N     . ARG C 3 407 ? 14.137  49.446 53.010  1.00 17.56  ? 703  ARG A N     1 
ATOM   3756 C  CA    . ARG C 3 407 ? 14.948  48.442 52.342  1.00 17.29  ? 703  ARG A CA    1 
ATOM   3757 C  C     . ARG C 3 407 ? 14.353  47.055 52.553  1.00 17.93  ? 703  ARG A C     1 
ATOM   3758 O  O     . ARG C 3 407 ? 14.254  46.267 51.616  1.00 17.92  ? 703  ARG A O     1 
ATOM   3759 C  CB    . ARG C 3 407 ? 16.385  48.470 52.879  1.00 20.15  ? 703  ARG A CB    1 
ATOM   3760 C  CG    . ARG C 3 407 ? 17.314  47.411 52.270  1.00 21.45  ? 703  ARG A CG    1 
ATOM   3761 C  CD    . ARG C 3 407 ? 18.722  47.504 52.868  1.00 23.64  ? 703  ARG A CD    1 
ATOM   3762 N  NE    . ARG C 3 407 ? 18.767  47.067 54.265  1.00 23.70  ? 703  ARG A NE    1 
ATOM   3763 C  CZ    . ARG C 3 407 ? 18.790  45.793 54.653  1.00 24.91  ? 703  ARG A CZ    1 
ATOM   3764 N  NH1   . ARG C 3 407 ? 18.779  44.819 53.751  1.00 25.15  ? 703  ARG A NH1   1 
ATOM   3765 N  NH2   . ARG C 3 407 ? 18.821  45.489 55.944  1.00 25.48  ? 703  ARG A NH2   1 
ATOM   3766 N  N     . GLN C 3 408 ? 13.951  46.758 53.783  1.00 17.64  ? 704  GLN A N     1 
ATOM   3767 C  CA    . GLN C 3 408 ? 13.388  45.451 54.078  1.00 19.21  ? 704  GLN A CA    1 
ATOM   3768 C  C     . GLN C 3 408 ? 11.977  45.263 53.523  1.00 18.75  ? 704  GLN A C     1 
ATOM   3769 O  O     . GLN C 3 408 ? 11.602  44.149 53.158  1.00 18.24  ? 704  GLN A O     1 
ATOM   3770 C  CB    . GLN C 3 408 ? 13.420  45.191 55.590  1.00 20.64  ? 704  GLN A CB    1 
ATOM   3771 C  CG    . GLN C 3 408 ? 14.833  45.270 56.167  1.00 23.58  ? 704  GLN A CG    1 
ATOM   3772 C  CD    . GLN C 3 408 ? 14.940  44.735 57.581  1.00 24.67  ? 704  GLN A CD    1 
ATOM   3773 O  OE1   . GLN C 3 408 ? 14.959  43.523 57.805  1.00 25.30  ? 704  GLN A OE1   1 
ATOM   3774 N  NE2   . GLN C 3 408 ? 15.010  45.640 58.546  1.00 25.71  ? 704  GLN A NE2   1 
ATOM   3775 N  N     . ALA C 3 409 ? 11.202  46.342 53.451  1.00 18.46  ? 705  ALA A N     1 
ATOM   3776 C  CA    . ALA C 3 409 ? 9.847   46.266 52.906  1.00 19.14  ? 705  ALA A CA    1 
ATOM   3777 C  C     . ALA C 3 409 ? 9.965   46.050 51.398  1.00 19.36  ? 705  ALA A C     1 
ATOM   3778 O  O     . ALA C 3 409 ? 9.120   45.403 50.772  1.00 18.74  ? 705  ALA A O     1 
ATOM   3779 C  CB    . ALA C 3 409 ? 9.086   47.555 53.190  1.00 16.31  ? 705  ALA A CB    1 
ATOM   3780 N  N     . LYS C 3 410 ? 11.025  46.603 50.822  1.00 18.77  ? 706  LYS A N     1 
ATOM   3781 C  CA    . LYS C 3 410 ? 11.285  46.466 49.396  1.00 19.00  ? 706  LYS A CA    1 
ATOM   3782 C  C     . LYS C 3 410 ? 11.570  44.995 49.099  1.00 19.57  ? 706  LYS A C     1 
ATOM   3783 O  O     . LYS C 3 410 ? 11.064  44.438 48.118  1.00 18.86  ? 706  LYS A O     1 
ATOM   3784 C  CB    . LYS C 3 410 ? 12.483  47.334 48.998  1.00 19.77  ? 706  LYS A CB    1 
ATOM   3785 C  CG    . LYS C 3 410 ? 12.893  47.231 47.530  1.00 20.66  ? 706  LYS A CG    1 
ATOM   3786 C  CD    . LYS C 3 410 ? 14.006  48.218 47.217  1.00 24.66  ? 706  LYS A CD    1 
ATOM   3787 C  CE    . LYS C 3 410 ? 14.441  48.126 45.766  1.00 25.81  ? 706  LYS A CE    1 
ATOM   3788 N  NZ    . LYS C 3 410 ? 15.392  49.218 45.423  1.00 27.08  ? 706  LYS A NZ    1 
ATOM   3789 N  N     . ALA C 3 411 ? 12.374  44.371 49.959  1.00 17.30  ? 707  ALA A N     1 
ATOM   3790 C  CA    . ALA C 3 411 ? 12.718  42.960 49.810  1.00 16.78  ? 707  ALA A CA    1 
ATOM   3791 C  C     . ALA C 3 411 ? 11.481  42.073 49.983  1.00 16.48  ? 707  ALA A C     1 
ATOM   3792 O  O     . ALA C 3 411 ? 11.368  41.023 49.358  1.00 16.42  ? 707  ALA A O     1 
ATOM   3793 C  CB    . ALA C 3 411 ? 13.793  42.570 50.827  1.00 17.79  ? 707  ALA A CB    1 
ATOM   3794 N  N     . VAL C 3 412 ? 10.556  42.489 50.838  1.00 17.93  ? 708  VAL A N     1 
ATOM   3795 C  CA    . VAL C 3 412 ? 9.337   41.715 51.042  1.00 18.01  ? 708  VAL A CA    1 
ATOM   3796 C  C     . VAL C 3 412 ? 8.508   41.787 49.757  1.00 20.33  ? 708  VAL A C     1 
ATOM   3797 O  O     . VAL C 3 412 ? 7.917   40.793 49.336  1.00 18.95  ? 708  VAL A O     1 
ATOM   3798 C  CB    . VAL C 3 412 ? 8.509   42.269 52.224  1.00 17.54  ? 708  VAL A CB    1 
ATOM   3799 C  CG1   . VAL C 3 412 ? 7.165   41.545 52.323  1.00 16.50  ? 708  VAL A CG1   1 
ATOM   3800 C  CG2   . VAL C 3 412 ? 9.287   42.093 53.518  1.00 16.77  ? 708  VAL A CG2   1 
ATOM   3801 N  N     . ASN C 3 413 ? 8.482   42.966 49.134  1.00 21.02  ? 709  ASN A N     1 
ATOM   3802 C  CA    . ASN C 3 413 ? 7.733   43.154 47.898  1.00 22.26  ? 709  ASN A CA    1 
ATOM   3803 C  C     . ASN C 3 413 ? 8.255   42.281 46.765  1.00 23.18  ? 709  ASN A C     1 
ATOM   3804 O  O     . ASN C 3 413 ? 7.473   41.813 45.939  1.00 24.32  ? 709  ASN A O     1 
ATOM   3805 C  CB    . ASN C 3 413 ? 7.742   44.623 47.462  1.00 18.48  ? 709  ASN A CB    1 
ATOM   3806 C  CG    . ASN C 3 413 ? 6.667   45.438 48.153  1.00 18.76  ? 709  ASN A CG    1 
ATOM   3807 O  OD1   . ASN C 3 413 ? 5.580   44.933 48.428  1.00 17.94  ? 709  ASN A OD1   1 
ATOM   3808 N  ND2   . ASN C 3 413 ? 6.961   46.702 48.429  1.00 15.21  ? 709  ASN A ND2   1 
ATOM   3809 N  N     . PHE C 3 414 ? 9.565   42.059 46.718  1.00 25.20  ? 710  PHE A N     1 
ATOM   3810 C  CA    . PHE C 3 414 ? 10.132  41.211 45.668  1.00 26.74  ? 710  PHE A CA    1 
ATOM   3811 C  C     . PHE C 3 414 ? 9.770   39.752 45.912  1.00 25.35  ? 710  PHE A C     1 
ATOM   3812 O  O     . PHE C 3 414 ? 9.453   39.014 44.977  1.00 25.33  ? 710  PHE A O     1 
ATOM   3813 C  CB    . PHE C 3 414 ? 11.656  41.349 45.604  1.00 29.72  ? 710  PHE A CB    1 
ATOM   3814 C  CG    . PHE C 3 414 ? 12.124  42.636 44.987  1.00 33.90  ? 710  PHE A CG    1 
ATOM   3815 C  CD1   . PHE C 3 414 ? 13.427  42.752 44.504  1.00 36.85  ? 710  PHE A CD1   1 
ATOM   3816 C  CD2   . PHE C 3 414 ? 11.272  43.736 44.889  1.00 35.40  ? 710  PHE A CD2   1 
ATOM   3817 C  CE1   . PHE C 3 414 ? 13.876  43.949 43.928  1.00 38.43  ? 710  PHE A CE1   1 
ATOM   3818 C  CE2   . PHE C 3 414 ? 11.708  44.937 44.316  1.00 36.25  ? 710  PHE A CE2   1 
ATOM   3819 C  CZ    . PHE C 3 414 ? 13.012  45.043 43.836  1.00 37.77  ? 710  PHE A CZ    1 
ATOM   3820 N  N     . GLY C 3 415 ? 9.815   39.345 47.176  1.00 24.53  ? 711  GLY A N     1 
ATOM   3821 C  CA    . GLY C 3 415 ? 9.480   37.977 47.522  1.00 24.56  ? 711  GLY A CA    1 
ATOM   3822 C  C     . GLY C 3 415 ? 8.039   37.666 47.169  1.00 24.22  ? 711  GLY A C     1 
ATOM   3823 O  O     . GLY C 3 415 ? 7.728   36.577 46.678  1.00 24.68  ? 711  GLY A O     1 
ATOM   3824 N  N     . ILE C 3 416 ? 7.154   38.626 47.420  1.00 23.12  ? 712  ILE A N     1 
ATOM   3825 C  CA    . ILE C 3 416 ? 5.737   38.452 47.119  1.00 22.88  ? 712  ILE A CA    1 
ATOM   3826 C  C     . ILE C 3 416 ? 5.537   38.198 45.626  1.00 22.83  ? 712  ILE A C     1 
ATOM   3827 O  O     . ILE C 3 416 ? 4.788   37.303 45.239  1.00 22.05  ? 712  ILE A O     1 
ATOM   3828 C  CB    . ILE C 3 416 ? 4.917   39.696 47.553  1.00 22.02  ? 712  ILE A CB    1 
ATOM   3829 C  CG1   . ILE C 3 416 ? 4.821   39.750 49.080  1.00 22.02  ? 712  ILE A CG1   1 
ATOM   3830 C  CG2   . ILE C 3 416 ? 3.521   39.654 46.945  1.00 23.63  ? 712  ILE A CG2   1 
ATOM   3831 C  CD1   . ILE C 3 416 ? 4.085   38.562 49.710  1.00 22.72  ? 712  ILE A CD1   1 
ATOM   3832 N  N     . VAL C 3 417 ? 6.221   38.977 44.794  1.00 23.11  ? 713  VAL A N     1 
ATOM   3833 C  CA    . VAL C 3 417 ? 6.119   38.835 43.343  1.00 22.39  ? 713  VAL A CA    1 
ATOM   3834 C  C     . VAL C 3 417 ? 6.789   37.561 42.813  1.00 23.89  ? 713  VAL A C     1 
ATOM   3835 O  O     . VAL C 3 417 ? 6.306   36.943 41.855  1.00 23.78  ? 713  VAL A O     1 
ATOM   3836 C  CB    . VAL C 3 417 ? 6.733   40.065 42.631  1.00 22.50  ? 713  VAL A CB    1 
ATOM   3837 C  CG1   . VAL C 3 417 ? 6.771   39.837 41.125  1.00 23.87  ? 713  VAL A CG1   1 
ATOM   3838 C  CG2   . VAL C 3 417 ? 5.914   41.311 42.955  1.00 22.20  ? 713  VAL A CG2   1 
ATOM   3839 N  N     . TYR C 3 418 ? 7.898   37.172 43.435  1.00 24.66  ? 714  TYR A N     1 
ATOM   3840 C  CA    . TYR C 3 418 ? 8.642   35.975 43.031  1.00 27.40  ? 714  TYR A CA    1 
ATOM   3841 C  C     . TYR C 3 418 ? 8.032   34.691 43.584  1.00 26.98  ? 714  TYR A C     1 
ATOM   3842 O  O     . TYR C 3 418 ? 8.318   33.598 43.096  1.00 26.20  ? 714  TYR A O     1 
ATOM   3843 C  CB    . TYR C 3 418 ? 10.088  36.047 43.531  1.00 30.26  ? 714  TYR A CB    1 
ATOM   3844 C  CG    . TYR C 3 418 ? 10.993  37.035 42.832  1.00 34.17  ? 714  TYR A CG    1 
ATOM   3845 C  CD1   . TYR C 3 418 ? 12.269  37.298 43.336  1.00 36.84  ? 714  TYR A CD1   1 
ATOM   3846 C  CD2   . TYR C 3 418 ? 10.595  37.692 41.667  1.00 33.87  ? 714  TYR A CD2   1 
ATOM   3847 C  CE1   . TYR C 3 418 ? 13.130  38.191 42.700  1.00 38.07  ? 714  TYR A CE1   1 
ATOM   3848 C  CE2   . TYR C 3 418 ? 11.450  38.591 41.020  1.00 36.86  ? 714  TYR A CE2   1 
ATOM   3849 C  CZ    . TYR C 3 418 ? 12.716  38.833 41.545  1.00 38.63  ? 714  TYR A CZ    1 
ATOM   3850 O  OH    . TYR C 3 418 ? 13.576  39.713 40.925  1.00 39.98  ? 714  TYR A OH    1 
ATOM   3851 N  N     . GLY C 3 419 ? 7.194   34.833 44.605  1.00 27.71  ? 715  GLY A N     1 
ATOM   3852 C  CA    . GLY C 3 419 ? 6.598   33.679 45.257  1.00 29.22  ? 715  GLY A CA    1 
ATOM   3853 C  C     . GLY C 3 419 ? 7.247   33.659 46.630  1.00 30.13  ? 715  GLY A C     1 
ATOM   3854 O  O     . GLY C 3 419 ? 8.352   33.139 46.806  1.00 29.88  ? 715  GLY A O     1 
ATOM   3855 N  N     . ILE C 3 420 ? 6.553   34.239 47.602  1.00 30.76  ? 716  ILE A N     1 
ATOM   3856 C  CA    . ILE C 3 420 ? 7.051   34.365 48.968  1.00 31.91  ? 716  ILE A CA    1 
ATOM   3857 C  C     . ILE C 3 420 ? 7.298   33.060 49.729  1.00 32.05  ? 716  ILE A C     1 
ATOM   3858 O  O     . ILE C 3 420 ? 6.517   32.111 49.633  1.00 33.11  ? 716  ILE A O     1 
ATOM   3859 C  CB    . ILE C 3 420 ? 6.082   35.254 49.805  1.00 32.12  ? 716  ILE A CB    1 
ATOM   3860 C  CG1   . ILE C 3 420 ? 6.825   35.880 50.986  1.00 32.35  ? 716  ILE A CG1   1 
ATOM   3861 C  CG2   . ILE C 3 420 ? 4.903   34.428 50.303  1.00 29.86  ? 716  ILE A CG2   1 
ATOM   3862 C  CD1   . ILE C 3 420 ? 7.859   36.904 50.576  1.00 32.59  ? 716  ILE A CD1   1 
ATOM   3863 N  N     . SER C 3 421 ? 8.394   33.034 50.486  1.00 32.42  ? 717  SER A N     1 
ATOM   3864 C  CA    . SER C 3 421 ? 8.771   31.888 51.321  1.00 33.35  ? 717  SER A CA    1 
ATOM   3865 C  C     . SER C 3 421 ? 9.708   32.429 52.402  1.00 33.58  ? 717  SER A C     1 
ATOM   3866 O  O     . SER C 3 421 ? 10.604  33.217 52.099  1.00 33.13  ? 717  SER A O     1 
ATOM   3867 C  CB    . SER C 3 421 ? 9.500   30.819 50.500  1.00 33.65  ? 717  SER A CB    1 
ATOM   3868 O  OG    . SER C 3 421 ? 10.801  31.251 50.136  1.00 33.43  ? 717  SER A OG    1 
ATOM   3869 N  N     . ASP C 3 422 ? 9.512   32.018 53.654  1.00 33.96  ? 718  ASP A N     1 
ATOM   3870 C  CA    . ASP C 3 422 ? 10.371  32.517 54.723  1.00 34.95  ? 718  ASP A CA    1 
ATOM   3871 C  C     . ASP C 3 422 ? 11.849  32.234 54.481  1.00 35.41  ? 718  ASP A C     1 
ATOM   3872 O  O     . ASP C 3 422 ? 12.694  33.084 54.748  1.00 34.30  ? 718  ASP A O     1 
ATOM   3873 C  CB    . ASP C 3 422 ? 9.950   31.963 56.089  1.00 36.43  ? 718  ASP A CB    1 
ATOM   3874 C  CG    . ASP C 3 422 ? 9.628   30.488 56.055  1.00 38.20  ? 718  ASP A CG    1 
ATOM   3875 O  OD1   . ASP C 3 422 ? 10.246  29.753 55.256  1.00 38.34  ? 718  ASP A OD1   1 
ATOM   3876 O  OD2   . ASP C 3 422 ? 8.759   30.064 56.850  1.00 38.48  ? 718  ASP A OD2   1 
ATOM   3877 N  N     . TYR C 3 423 ? 12.163  31.049 53.970  1.00 36.00  ? 719  TYR A N     1 
ATOM   3878 C  CA    . TYR C 3 423 ? 13.552  30.697 53.696  1.00 35.88  ? 719  TYR A CA    1 
ATOM   3879 C  C     . TYR C 3 423 ? 14.139  31.658 52.673  1.00 33.80  ? 719  TYR A C     1 
ATOM   3880 O  O     . TYR C 3 423 ? 15.245  32.167 52.849  1.00 31.63  ? 719  TYR A O     1 
ATOM   3881 C  CB    . TYR C 3 423 ? 13.657  29.270 53.153  1.00 39.02  ? 719  TYR A CB    1 
ATOM   3882 C  CG    . TYR C 3 423 ? 15.048  28.928 52.668  1.00 42.70  ? 719  TYR A CG    1 
ATOM   3883 C  CD1   . TYR C 3 423 ? 16.102  28.757 53.569  1.00 44.90  ? 719  TYR A CD1   1 
ATOM   3884 C  CD2   . TYR C 3 423 ? 15.316  28.795 51.305  1.00 43.54  ? 719  TYR A CD2   1 
ATOM   3885 C  CE1   . TYR C 3 423 ? 17.390  28.465 53.122  1.00 46.36  ? 719  TYR A CE1   1 
ATOM   3886 C  CE2   . TYR C 3 423 ? 16.597  28.506 50.848  1.00 45.69  ? 719  TYR A CE2   1 
ATOM   3887 C  CZ    . TYR C 3 423 ? 17.628  28.343 51.759  1.00 46.52  ? 719  TYR A CZ    1 
ATOM   3888 O  OH    . TYR C 3 423 ? 18.898  28.070 51.302  1.00 49.28  ? 719  TYR A OH    1 
ATOM   3889 N  N     . GLY C 3 424 ? 13.389  31.894 51.600  1.00 32.24  ? 720  GLY A N     1 
ATOM   3890 C  CA    . GLY C 3 424 ? 13.848  32.792 50.555  1.00 30.83  ? 720  GLY A CA    1 
ATOM   3891 C  C     . GLY C 3 424 ? 14.069  34.209 51.048  1.00 29.53  ? 720  GLY A C     1 
ATOM   3892 O  O     . GLY C 3 424 ? 15.083  34.836 50.721  1.00 28.42  ? 720  GLY A O     1 
ATOM   3893 N  N     . LEU C 3 425 ? 13.126  34.721 51.835  1.00 28.44  ? 721  LEU A N     1 
ATOM   3894 C  CA    . LEU C 3 425 ? 13.249  36.076 52.366  1.00 27.63  ? 721  LEU A CA    1 
ATOM   3895 C  C     . LEU C 3 425 ? 14.373  36.147 53.406  1.00 27.76  ? 721  LEU A C     1 
ATOM   3896 O  O     . LEU C 3 425 ? 15.189  37.068 53.384  1.00 27.29  ? 721  LEU A O     1 
ATOM   3897 C  CB    . LEU C 3 425 ? 11.926  36.530 52.994  1.00 25.99  ? 721  LEU A CB    1 
ATOM   3898 C  CG    . LEU C 3 425 ? 11.894  37.976 53.503  1.00 22.90  ? 721  LEU A CG    1 
ATOM   3899 C  CD1   . LEU C 3 425 ? 12.074  38.934 52.329  1.00 23.65  ? 721  LEU A CD1   1 
ATOM   3900 C  CD2   . LEU C 3 425 ? 10.576  38.247 54.217  1.00 23.32  ? 721  LEU A CD2   1 
ATOM   3901 N  N     . ALA C 3 426 ? 14.415  35.171 54.308  1.00 28.42  ? 722  ALA A N     1 
ATOM   3902 C  CA    . ALA C 3 426 ? 15.445  35.130 55.347  1.00 29.63  ? 722  ALA A CA    1 
ATOM   3903 C  C     . ALA C 3 426 ? 16.834  35.175 54.716  1.00 30.53  ? 722  ALA A C     1 
ATOM   3904 O  O     . ALA C 3 426 ? 17.703  35.932 55.145  1.00 30.45  ? 722  ALA A O     1 
ATOM   3905 C  CB    . ALA C 3 426 ? 15.292  33.865 56.187  1.00 27.78  ? 722  ALA A CB    1 
ATOM   3906 N  N     . GLN C 3 427 ? 17.028  34.362 53.685  1.00 32.28  ? 723  GLN A N     1 
ATOM   3907 C  CA    . GLN C 3 427 ? 18.300  34.298 52.982  1.00 34.62  ? 723  GLN A CA    1 
ATOM   3908 C  C     . GLN C 3 427 ? 18.644  35.651 52.369  1.00 34.98  ? 723  GLN A C     1 
ATOM   3909 O  O     . GLN C 3 427 ? 19.798  36.083 52.393  1.00 35.51  ? 723  GLN A O     1 
ATOM   3910 C  CB    . GLN C 3 427 ? 18.224  33.229 51.885  1.00 37.89  ? 723  GLN A CB    1 
ATOM   3911 C  CG    . GLN C 3 427 ? 19.519  33.000 51.114  1.00 41.63  ? 723  GLN A CG    1 
ATOM   3912 C  CD    . GLN C 3 427 ? 19.412  31.841 50.130  1.00 45.54  ? 723  GLN A CD    1 
ATOM   3913 O  OE1   . GLN C 3 427 ? 18.618  31.881 49.186  1.00 47.15  ? 723  GLN A OE1   1 
ATOM   3914 N  NE2   . GLN C 3 427 ? 20.212  30.799 50.351  1.00 46.66  ? 723  GLN A NE2   1 
ATOM   3915 N  N     . ASN C 3 428 ? 17.631  36.327 51.837  1.00 34.71  ? 724  ASN A N     1 
ATOM   3916 C  CA    . ASN C 3 428 ? 17.829  37.619 51.198  1.00 33.88  ? 724  ASN A CA    1 
ATOM   3917 C  C     . ASN C 3 428 ? 18.065  38.786 52.155  1.00 32.73  ? 724  ASN A C     1 
ATOM   3918 O  O     . ASN C 3 428 ? 18.789  39.722 51.821  1.00 31.81  ? 724  ASN A O     1 
ATOM   3919 C  CB    . ASN C 3 428 ? 16.643  37.928 50.287  1.00 35.69  ? 724  ASN A CB    1 
ATOM   3920 C  CG    . ASN C 3 428 ? 16.831  39.207 49.506  1.00 37.04  ? 724  ASN A CG    1 
ATOM   3921 O  OD1   . ASN C 3 428 ? 16.722  40.308 50.053  1.00 37.31  ? 724  ASN A OD1   1 
ATOM   3922 N  ND2   . ASN C 3 428 ? 17.125  39.073 48.216  1.00 38.08  ? 724  ASN A ND2   1 
ATOM   3923 N  N     . LEU C 3 429 ? 17.461  38.740 53.337  1.00 31.15  ? 725  LEU A N     1 
ATOM   3924 C  CA    . LEU C 3 429 ? 17.635  39.816 54.311  1.00 30.71  ? 725  LEU A CA    1 
ATOM   3925 C  C     . LEU C 3 429 ? 18.647  39.464 55.400  1.00 31.93  ? 725  LEU A C     1 
ATOM   3926 O  O     . LEU C 3 429 ? 18.874  40.247 56.326  1.00 31.51  ? 725  LEU A O     1 
ATOM   3927 C  CB    . LEU C 3 429 ? 16.290  40.168 54.959  1.00 28.56  ? 725  LEU A CB    1 
ATOM   3928 C  CG    . LEU C 3 429 ? 15.318  40.977 54.093  1.00 27.35  ? 725  LEU A CG    1 
ATOM   3929 C  CD1   . LEU C 3 429 ? 13.959  41.065 54.771  1.00 27.30  ? 725  LEU A CD1   1 
ATOM   3930 C  CD2   . LEU C 3 429 ? 15.893  42.362 53.855  1.00 25.88  ? 725  LEU A CD2   1 
ATOM   3931 N  N     . ASN C 3 430 ? 19.258  38.290 55.284  1.00 32.68  ? 726  ASN A N     1 
ATOM   3932 C  CA    . ASN C 3 430 ? 20.230  37.838 56.272  1.00 34.34  ? 726  ASN A CA    1 
ATOM   3933 C  C     . ASN C 3 430 ? 19.614  37.862 57.663  1.00 33.52  ? 726  ASN A C     1 
ATOM   3934 O  O     . ASN C 3 430 ? 20.142  38.497 58.571  1.00 33.25  ? 726  ASN A O     1 
ATOM   3935 C  CB    . ASN C 3 430 ? 21.475  38.725 56.243  1.00 37.85  ? 726  ASN A CB    1 
ATOM   3936 C  CG    . ASN C 3 430 ? 22.160  38.718 54.893  1.00 41.47  ? 726  ASN A CG    1 
ATOM   3937 O  OD1   . ASN C 3 430 ? 22.514  37.660 54.368  1.00 44.34  ? 726  ASN A OD1   1 
ATOM   3938 N  ND2   . ASN C 3 430 ? 22.353  39.902 54.322  1.00 43.36  ? 726  ASN A ND2   1 
ATOM   3939 N  N     . ILE C 3 431 ? 18.490  37.168 57.816  1.00 33.35  ? 727  ILE A N     1 
ATOM   3940 C  CA    . ILE C 3 431 ? 17.779  37.085 59.089  1.00 33.12  ? 727  ILE A CA    1 
ATOM   3941 C  C     . ILE C 3 431 ? 17.259  35.660 59.266  1.00 32.88  ? 727  ILE A C     1 
ATOM   3942 O  O     . ILE C 3 431 ? 17.363  34.846 58.349  1.00 33.24  ? 727  ILE A O     1 
ATOM   3943 C  CB    . ILE C 3 431 ? 16.595  38.078 59.129  1.00 33.54  ? 727  ILE A CB    1 
ATOM   3944 C  CG1   . ILE C 3 431 ? 15.691  37.863 57.910  1.00 34.30  ? 727  ILE A CG1   1 
ATOM   3945 C  CG2   . ILE C 3 431 ? 17.120  39.508 59.168  1.00 33.56  ? 727  ILE A CG2   1 
ATOM   3946 C  CD1   . ILE C 3 431 ? 14.522  38.832 57.818  1.00 33.19  ? 727  ILE A CD1   1 
ATOM   3947 N  N     . SER C 3 432 ? 16.703  35.351 60.432  1.00 32.65  ? 728  SER A N     1 
ATOM   3948 C  CA    . SER C 3 432 ? 16.196  34.003 60.677  1.00 33.50  ? 728  SER A CA    1 
ATOM   3949 C  C     . SER C 3 432 ? 14.861  33.760 59.980  1.00 34.10  ? 728  SER A C     1 
ATOM   3950 O  O     . SER C 3 432 ? 14.156  34.700 59.612  1.00 33.61  ? 728  SER A O     1 
ATOM   3951 C  CB    . SER C 3 432 ? 16.034  33.751 62.179  1.00 32.10  ? 728  SER A CB    1 
ATOM   3952 O  OG    . SER C 3 432 ? 14.947  34.492 62.704  1.00 30.50  ? 728  SER A OG    1 
ATOM   3953 N  N     . ARG C 3 433 ? 14.523  32.487 59.802  1.00 35.96  ? 729  ARG A N     1 
ATOM   3954 C  CA    . ARG C 3 433 ? 13.277  32.102 59.159  1.00 36.83  ? 729  ARG A CA    1 
ATOM   3955 C  C     . ARG C 3 433 ? 12.103  32.632 59.971  1.00 37.00  ? 729  ARG A C     1 
ATOM   3956 O  O     . ARG C 3 433 ? 11.155  33.192 59.422  1.00 37.14  ? 729  ARG A O     1 
ATOM   3957 C  CB    . ARG C 3 433 ? 13.199  30.575 59.042  1.00 39.36  ? 729  ARG A CB    1 
ATOM   3958 C  CG    . ARG C 3 433 ? 14.103  29.994 57.958  1.00 43.01  ? 729  ARG A CG    1 
ATOM   3959 C  CD    . ARG C 3 433 ? 14.271  28.478 58.085  1.00 47.27  ? 729  ARG A CD    1 
ATOM   3960 N  NE    . ARG C 3 433 ? 15.110  28.109 59.226  1.00 49.95  ? 729  ARG A NE    1 
ATOM   3961 C  CZ    . ARG C 3 433 ? 15.512  26.869 59.496  1.00 51.50  ? 729  ARG A CZ    1 
ATOM   3962 N  NH1   . ARG C 3 433 ? 15.153  25.864 58.706  1.00 52.61  ? 729  ARG A NH1   1 
ATOM   3963 N  NH2   . ARG C 3 433 ? 16.279  26.633 60.552  1.00 51.28  ? 729  ARG A NH2   1 
ATOM   3964 N  N     . LYS C 3 434 ? 12.182  32.462 61.285  1.00 36.12  ? 730  LYS A N     1 
ATOM   3965 C  CA    . LYS C 3 434 ? 11.134  32.920 62.184  1.00 36.14  ? 730  LYS A CA    1 
ATOM   3966 C  C     . LYS C 3 434 ? 10.836  34.400 61.959  1.00 35.30  ? 730  LYS A C     1 
ATOM   3967 O  O     . LYS C 3 434 ? 9.678   34.806 61.878  1.00 33.82  ? 730  LYS A O     1 
ATOM   3968 C  CB    . LYS C 3 434 ? 11.565  32.682 63.632  1.00 37.62  ? 730  LYS A CB    1 
ATOM   3969 C  CG    . LYS C 3 434 ? 10.561  33.121 64.686  1.00 40.52  ? 730  LYS A CG    1 
ATOM   3970 C  CD    . LYS C 3 434 ? 11.018  32.676 66.077  1.00 42.64  ? 730  LYS A CD    1 
ATOM   3971 C  CE    . LYS C 3 434 ? 10.108  33.216 67.172  1.00 44.02  ? 730  LYS A CE    1 
ATOM   3972 N  NZ    . LYS C 3 434 ? 10.148  34.707 67.242  1.00 45.30  ? 730  LYS A NZ    1 
ATOM   3973 N  N     . GLU C 3 435 ? 11.890  35.202 61.853  1.00 34.86  ? 731  GLU A N     1 
ATOM   3974 C  CA    . GLU C 3 435 ? 11.735  36.634 61.639  1.00 33.88  ? 731  GLU A CA    1 
ATOM   3975 C  C     . GLU C 3 435 ? 11.135  36.924 60.266  1.00 32.75  ? 731  GLU A C     1 
ATOM   3976 O  O     . GLU C 3 435 ? 10.227  37.747 60.139  1.00 31.71  ? 731  GLU A O     1 
ATOM   3977 C  CB    . GLU C 3 435 ? 13.086  37.331 61.777  1.00 33.84  ? 731  GLU A CB    1 
ATOM   3978 C  CG    . GLU C 3 435 ? 13.677  37.227 63.167  1.00 37.32  ? 731  GLU A CG    1 
ATOM   3979 C  CD    . GLU C 3 435 ? 15.015  37.925 63.283  1.00 38.65  ? 731  GLU A CD    1 
ATOM   3980 O  OE1   . GLU C 3 435 ? 15.946  37.569 62.523  1.00 39.44  ? 731  GLU A OE1   1 
ATOM   3981 O  OE2   . GLU C 3 435 ? 15.134  38.828 64.136  1.00 40.10  ? 731  GLU A OE2   1 
ATOM   3982 N  N     . ALA C 3 436 ? 11.649  36.247 59.242  1.00 30.63  ? 732  ALA A N     1 
ATOM   3983 C  CA    . ALA C 3 436 ? 11.153  36.428 57.884  1.00 30.16  ? 732  ALA A CA    1 
ATOM   3984 C  C     . ALA C 3 436 ? 9.669   36.073 57.841  1.00 29.69  ? 732  ALA A C     1 
ATOM   3985 O  O     . ALA C 3 436 ? 8.869   36.781 57.228  1.00 29.64  ? 732  ALA A O     1 
ATOM   3986 C  CB    . ALA C 3 436 ? 11.934  35.549 56.916  1.00 28.02  ? 732  ALA A CB    1 
ATOM   3987 N  N     . ALA C 3 437 ? 9.312   34.980 58.508  1.00 28.43  ? 733  ALA A N     1 
ATOM   3988 C  CA    . ALA C 3 437 ? 7.931   34.520 58.557  1.00 28.66  ? 733  ALA A CA    1 
ATOM   3989 C  C     . ALA C 3 437 ? 7.037   35.570 59.204  1.00 28.57  ? 733  ALA A C     1 
ATOM   3990 O  O     . ALA C 3 437 ? 5.862   35.711 58.847  1.00 27.55  ? 733  ALA A O     1 
ATOM   3991 C  CB    . ALA C 3 437 ? 7.845   33.213 59.331  1.00 27.87  ? 733  ALA A CB    1 
ATOM   3992 N  N     . GLU C 3 438 ? 7.597   36.302 60.162  1.00 28.71  ? 734  GLU A N     1 
ATOM   3993 C  CA    . GLU C 3 438 ? 6.853   37.346 60.851  1.00 30.05  ? 734  GLU A CA    1 
ATOM   3994 C  C     . GLU C 3 438 ? 6.586   38.500 59.885  1.00 28.46  ? 734  GLU A C     1 
ATOM   3995 O  O     . GLU C 3 438 ? 5.493   39.064 59.878  1.00 27.55  ? 734  GLU A O     1 
ATOM   3996 C  CB    . GLU C 3 438 ? 7.636   37.835 62.075  1.00 32.11  ? 734  GLU A CB    1 
ATOM   3997 C  CG    . GLU C 3 438 ? 7.771   36.785 63.173  1.00 38.42  ? 734  GLU A CG    1 
ATOM   3998 C  CD    . GLU C 3 438 ? 8.686   37.219 64.311  1.00 40.94  ? 734  GLU A CD    1 
ATOM   3999 O  OE1   . GLU C 3 438 ? 8.840   36.443 65.279  1.00 43.86  ? 734  GLU A OE1   1 
ATOM   4000 O  OE2   . GLU C 3 438 ? 9.254   38.330 64.238  1.00 42.51  ? 734  GLU A OE2   1 
ATOM   4001 N  N     . PHE C 3 439 ? 7.583   38.839 59.069  1.00 27.03  ? 735  PHE A N     1 
ATOM   4002 C  CA    . PHE C 3 439 ? 7.444   39.912 58.084  1.00 27.30  ? 735  PHE A CA    1 
ATOM   4003 C  C     . PHE C 3 439 ? 6.325   39.581 57.101  1.00 26.31  ? 735  PHE A C     1 
ATOM   4004 O  O     . PHE C 3 439 ? 5.496   40.430 56.774  1.00 25.71  ? 735  PHE A O     1 
ATOM   4005 C  CB    . PHE C 3 439 ? 8.748   40.099 57.295  1.00 29.23  ? 735  PHE A CB    1 
ATOM   4006 C  CG    . PHE C 3 439 ? 9.816   40.867 58.033  1.00 30.60  ? 735  PHE A CG    1 
ATOM   4007 C  CD1   . PHE C 3 439 ? 11.112  40.932 57.523  1.00 32.78  ? 735  PHE A CD1   1 
ATOM   4008 C  CD2   . PHE C 3 439 ? 9.534   41.531 59.221  1.00 30.84  ? 735  PHE A CD2   1 
ATOM   4009 C  CE1   . PHE C 3 439 ? 12.111  41.649 58.187  1.00 31.05  ? 735  PHE A CE1   1 
ATOM   4010 C  CE2   . PHE C 3 439 ? 10.526  42.251 59.893  1.00 31.11  ? 735  PHE A CE2   1 
ATOM   4011 C  CZ    . PHE C 3 439 ? 11.814  42.308 59.374  1.00 29.55  ? 735  PHE A CZ    1 
ATOM   4012 N  N     . ILE C 3 440 ? 6.322   38.335 56.635  1.00 25.98  ? 736  ILE A N     1 
ATOM   4013 C  CA    . ILE C 3 440 ? 5.333   37.847 55.683  1.00 24.79  ? 736  ILE A CA    1 
ATOM   4014 C  C     . ILE C 3 440 ? 3.934   37.860 56.285  1.00 24.94  ? 736  ILE A C     1 
ATOM   4015 O  O     . ILE C 3 440 ? 2.976   38.301 55.648  1.00 23.29  ? 736  ILE A O     1 
ATOM   4016 C  CB    . ILE C 3 440 ? 5.676   36.418 55.236  1.00 24.90  ? 736  ILE A CB    1 
ATOM   4017 C  CG1   . ILE C 3 440 ? 7.030   36.421 54.524  1.00 24.77  ? 736  ILE A CG1   1 
ATOM   4018 C  CG2   . ILE C 3 440 ? 4.580   35.874 54.318  1.00 26.31  ? 736  ILE A CG2   1 
ATOM   4019 C  CD1   . ILE C 3 440 ? 7.535   35.051 54.164  1.00 26.14  ? 736  ILE A CD1   1 
ATOM   4020 N  N     . GLU C 3 441 ? 3.819   37.370 57.513  1.00 24.60  ? 737  GLU A N     1 
ATOM   4021 C  CA    . GLU C 3 441 ? 2.536   37.346 58.193  1.00 27.05  ? 737  GLU A CA    1 
ATOM   4022 C  C     . GLU C 3 441 ? 2.004   38.772 58.273  1.00 25.44  ? 737  GLU A C     1 
ATOM   4023 O  O     . GLU C 3 441 ? 0.829   39.027 58.013  1.00 24.99  ? 737  GLU A O     1 
ATOM   4024 C  CB    . GLU C 3 441 ? 2.701   36.756 59.599  1.00 31.16  ? 737  GLU A CB    1 
ATOM   4025 C  CG    . GLU C 3 441 ? 1.468   36.863 60.482  1.00 36.41  ? 737  GLU A CG    1 
ATOM   4026 C  CD    . GLU C 3 441 ? 1.649   36.163 61.825  1.00 40.40  ? 737  GLU A CD    1 
ATOM   4027 O  OE1   . GLU C 3 441 ? 2.655   36.442 62.519  1.00 40.83  ? 737  GLU A OE1   1 
ATOM   4028 O  OE2   . GLU C 3 441 ? 0.782   35.335 62.186  1.00 41.77  ? 737  GLU A OE2   1 
ATOM   4029 N  N     . ARG C 3 442 ? 2.885   39.702 58.624  1.00 25.17  ? 738  ARG A N     1 
ATOM   4030 C  CA    . ARG C 3 442 ? 2.511   41.108 58.731  1.00 24.93  ? 738  ARG A CA    1 
ATOM   4031 C  C     . ARG C 3 442 ? 2.058   41.648 57.376  1.00 22.37  ? 738  ARG A C     1 
ATOM   4032 O  O     . ARG C 3 442 ? 1.109   42.419 57.297  1.00 22.37  ? 738  ARG A O     1 
ATOM   4033 C  CB    . ARG C 3 442 ? 3.697   41.928 59.241  1.00 25.77  ? 738  ARG A CB    1 
ATOM   4034 C  CG    . ARG C 3 442 ? 4.196   41.516 60.611  1.00 31.96  ? 738  ARG A CG    1 
ATOM   4035 C  CD    . ARG C 3 442 ? 3.141   41.796 61.650  1.00 37.16  ? 738  ARG A CD    1 
ATOM   4036 N  NE    . ARG C 3 442 ? 2.681   43.172 61.522  1.00 42.01  ? 738  ARG A NE    1 
ATOM   4037 C  CZ    . ARG C 3 442 ? 1.632   43.678 62.157  1.00 45.35  ? 738  ARG A CZ    1 
ATOM   4038 N  NH1   . ARG C 3 442 ? 0.917   42.919 62.981  1.00 47.91  ? 738  ARG A NH1   1 
ATOM   4039 N  NH2   . ARG C 3 442 ? 1.295   44.947 61.959  1.00 45.67  ? 738  ARG A NH2   1 
ATOM   4040 N  N     . TYR C 3 443 ? 2.735   41.238 56.308  1.00 19.89  ? 739  TYR A N     1 
ATOM   4041 C  CA    . TYR C 3 443 ? 2.375   41.704 54.973  1.00 19.39  ? 739  TYR A CA    1 
ATOM   4042 C  C     . TYR C 3 443 ? 0.960   41.271 54.596  1.00 19.05  ? 739  TYR A C     1 
ATOM   4043 O  O     . TYR C 3 443 ? 0.154   42.084 54.151  1.00 18.54  ? 739  TYR A O     1 
ATOM   4044 C  CB    . TYR C 3 443 ? 3.356   41.168 53.919  1.00 16.70  ? 739  TYR A CB    1 
ATOM   4045 C  CG    . TYR C 3 443 ? 2.988   41.589 52.515  1.00 15.98  ? 739  TYR A CG    1 
ATOM   4046 C  CD1   . TYR C 3 443 ? 3.480   42.772 51.969  1.00 14.39  ? 739  TYR A CD1   1 
ATOM   4047 C  CD2   . TYR C 3 443 ? 2.107   40.824 51.747  1.00 16.38  ? 739  TYR A CD2   1 
ATOM   4048 C  CE1   . TYR C 3 443 ? 3.103   43.186 50.695  1.00 17.29  ? 739  TYR A CE1   1 
ATOM   4049 C  CE2   . TYR C 3 443 ? 1.719   41.232 50.472  1.00 15.44  ? 739  TYR A CE2   1 
ATOM   4050 C  CZ    . TYR C 3 443 ? 2.218   42.410 49.955  1.00 16.00  ? 739  TYR A CZ    1 
ATOM   4051 O  OH    . TYR C 3 443 ? 1.813   42.832 48.712  1.00 16.81  ? 739  TYR A OH    1 
ATOM   4052 N  N     . PHE C 3 444 ? 0.663   39.988 54.772  1.00 20.31  ? 740  PHE A N     1 
ATOM   4053 C  CA    . PHE C 3 444 ? -0.655  39.472 54.422  1.00 20.52  ? 740  PHE A CA    1 
ATOM   4054 C  C     . PHE C 3 444 ? -1.768  40.062 55.273  1.00 21.90  ? 740  PHE A C     1 
ATOM   4055 O  O     . PHE C 3 444 ? -2.928  40.086 54.867  1.00 22.15  ? 740  PHE A O     1 
ATOM   4056 C  CB    . PHE C 3 444 ? -0.665  37.945 54.516  1.00 19.63  ? 740  PHE A CB    1 
ATOM   4057 C  CG    . PHE C 3 444 ? 0.111   37.269 53.419  1.00 19.70  ? 740  PHE A CG    1 
ATOM   4058 C  CD1   . PHE C 3 444 ? 0.014   37.717 52.105  1.00 20.16  ? 740  PHE A CD1   1 
ATOM   4059 C  CD2   . PHE C 3 444 ? 0.920   36.176 53.692  1.00 20.43  ? 740  PHE A CD2   1 
ATOM   4060 C  CE1   . PHE C 3 444 ? 0.710   37.084 51.080  1.00 20.64  ? 740  PHE A CE1   1 
ATOM   4061 C  CE2   . PHE C 3 444 ? 1.620   35.535 52.673  1.00 21.57  ? 740  PHE A CE2   1 
ATOM   4062 C  CZ    . PHE C 3 444 ? 1.515   35.989 51.366  1.00 20.17  ? 740  PHE A CZ    1 
ATOM   4063 N  N     . GLU C 3 445 ? -1.403  40.552 56.450  1.00 22.74  ? 741  GLU A N     1 
ATOM   4064 C  CA    . GLU C 3 445 ? -2.357  41.159 57.364  1.00 24.33  ? 741  GLU A CA    1 
ATOM   4065 C  C     . GLU C 3 445 ? -2.781  42.520 56.799  1.00 23.16  ? 741  GLU A C     1 
ATOM   4066 O  O     . GLU C 3 445 ? -3.927  42.945 56.964  1.00 23.22  ? 741  GLU A O     1 
ATOM   4067 C  CB    . GLU C 3 445 ? -1.690  41.317 58.733  1.00 29.16  ? 741  GLU A CB    1 
ATOM   4068 C  CG    . GLU C 3 445 ? -2.616  41.558 59.902  1.00 34.13  ? 741  GLU A CG    1 
ATOM   4069 C  CD    . GLU C 3 445 ? -1.887  41.427 61.234  1.00 38.21  ? 741  GLU A CD    1 
ATOM   4070 O  OE1   . GLU C 3 445 ? -2.504  41.705 62.285  1.00 39.89  ? 741  GLU A OE1   1 
ATOM   4071 O  OE2   . GLU C 3 445 ? -0.696  41.039 61.228  1.00 39.35  ? 741  GLU A OE2   1 
ATOM   4072 N  N     . SER C 3 446 ? -1.851  43.188 56.118  1.00 21.08  ? 742  SER A N     1 
ATOM   4073 C  CA    . SER C 3 446 ? -2.105  44.496 55.516  1.00 20.98  ? 742  SER A CA    1 
ATOM   4074 C  C     . SER C 3 446 ? -2.685  44.380 54.104  1.00 19.39  ? 742  SER A C     1 
ATOM   4075 O  O     . SER C 3 446 ? -3.386  45.279 53.638  1.00 18.34  ? 742  SER A O     1 
ATOM   4076 C  CB    . SER C 3 446 ? -0.809  45.304 55.450  1.00 23.08  ? 742  SER A CB    1 
ATOM   4077 O  OG    . SER C 3 446 ? -0.180  45.368 56.716  1.00 27.33  ? 742  SER A OG    1 
ATOM   4078 N  N     . PHE C 3 447 ? -2.383  43.275 53.426  1.00 16.37  ? 743  PHE A N     1 
ATOM   4079 C  CA    . PHE C 3 447 ? -2.879  43.044 52.072  1.00 16.66  ? 743  PHE A CA    1 
ATOM   4080 C  C     . PHE C 3 447 ? -3.600  41.694 51.984  1.00 16.27  ? 743  PHE A C     1 
ATOM   4081 O  O     . PHE C 3 447 ? -3.133  40.770 51.316  1.00 16.21  ? 743  PHE A O     1 
ATOM   4082 C  CB    . PHE C 3 447 ? -1.717  43.084 51.068  1.00 16.68  ? 743  PHE A CB    1 
ATOM   4083 C  CG    . PHE C 3 447 ? -0.930  44.366 51.102  1.00 17.76  ? 743  PHE A CG    1 
ATOM   4084 C  CD1   . PHE C 3 447 ? 0.233   44.467 51.857  1.00 18.86  ? 743  PHE A CD1   1 
ATOM   4085 C  CD2   . PHE C 3 447 ? -1.360  45.480 50.386  1.00 19.20  ? 743  PHE A CD2   1 
ATOM   4086 C  CE1   . PHE C 3 447 ? 0.957   45.660 51.901  1.00 20.00  ? 743  PHE A CE1   1 
ATOM   4087 C  CE2   . PHE C 3 447 ? -0.646  46.677 50.423  1.00 20.29  ? 743  PHE A CE2   1 
ATOM   4088 C  CZ    . PHE C 3 447 ? 0.514   46.767 51.181  1.00 20.80  ? 743  PHE A CZ    1 
ATOM   4089 N  N     . PRO C 3 448 ? -4.755  41.568 52.663  1.00 15.41  ? 744  PRO A N     1 
ATOM   4090 C  CA    . PRO C 3 448 ? -5.544  40.329 52.665  1.00 17.29  ? 744  PRO A CA    1 
ATOM   4091 C  C     . PRO C 3 448 ? -5.961  39.886 51.267  1.00 16.15  ? 744  PRO A C     1 
ATOM   4092 O  O     . PRO C 3 448 ? -6.209  38.703 51.030  1.00 18.14  ? 744  PRO A O     1 
ATOM   4093 C  CB    . PRO C 3 448 ? -6.734  40.673 53.561  1.00 15.53  ? 744  PRO A CB    1 
ATOM   4094 C  CG    . PRO C 3 448 ? -6.898  42.147 53.325  1.00 13.58  ? 744  PRO A CG    1 
ATOM   4095 C  CD    . PRO C 3 448 ? -5.470  42.632 53.392  1.00 15.26  ? 744  PRO A CD    1 
ATOM   4096 N  N     . GLY C 3 449 ? -6.043  40.846 50.352  1.00 16.00  ? 745  GLY A N     1 
ATOM   4097 C  CA    . GLY C 3 449 ? -6.413  40.536 48.981  1.00 15.68  ? 745  GLY A CA    1 
ATOM   4098 C  C     . GLY C 3 449 ? -5.314  39.723 48.318  1.00 15.16  ? 745  GLY A C     1 
ATOM   4099 O  O     . GLY C 3 449 ? -5.579  38.723 47.651  1.00 15.47  ? 745  GLY A O     1 
ATOM   4100 N  N     . VAL C 3 450 ? -4.071  40.155 48.498  1.00 14.36  ? 746  VAL A N     1 
ATOM   4101 C  CA    . VAL C 3 450 ? -2.931  39.443 47.931  1.00 14.41  ? 746  VAL A CA    1 
ATOM   4102 C  C     . VAL C 3 450 ? -2.834  38.041 48.539  1.00 15.36  ? 746  VAL A C     1 
ATOM   4103 O  O     . VAL C 3 450 ? -2.481  37.078 47.855  1.00 15.88  ? 746  VAL A O     1 
ATOM   4104 C  CB    . VAL C 3 450 ? -1.610  40.192 48.203  1.00 13.50  ? 746  VAL A CB    1 
ATOM   4105 C  CG1   . VAL C 3 450 ? -0.423  39.336 47.768  1.00 14.21  ? 746  VAL A CG1   1 
ATOM   4106 C  CG2   . VAL C 3 450 ? -1.599  41.519 47.454  1.00 12.20  ? 746  VAL A CG2   1 
ATOM   4107 N  N     . LYS C 3 451 ? -3.148  37.924 49.826  1.00 15.16  ? 747  LYS A N     1 
ATOM   4108 C  CA    . LYS C 3 451 ? -3.083  36.622 50.486  1.00 16.55  ? 747  LYS A CA    1 
ATOM   4109 C  C     . LYS C 3 451 ? -4.108  35.667 49.877  1.00 16.18  ? 747  LYS A C     1 
ATOM   4110 O  O     . LYS C 3 451 ? -3.802  34.509 49.598  1.00 14.40  ? 747  LYS A O     1 
ATOM   4111 C  CB    . LYS C 3 451 ? -3.344  36.752 51.990  1.00 18.16  ? 747  LYS A CB    1 
ATOM   4112 C  CG    . LYS C 3 451 ? -3.109  35.451 52.743  1.00 18.51  ? 747  LYS A CG    1 
ATOM   4113 C  CD    . LYS C 3 451 ? -3.592  35.518 54.176  1.00 23.20  ? 747  LYS A CD    1 
ATOM   4114 C  CE    . LYS C 3 451 ? -3.319  34.196 54.885  1.00 25.22  ? 747  LYS A CE    1 
ATOM   4115 N  NZ    . LYS C 3 451 ? -3.914  34.163 56.250  1.00 26.49  ? 747  LYS A NZ    1 
ATOM   4116 N  N     . ARG C 3 452 ? -5.325  36.157 49.673  1.00 17.09  ? 748  ARG A N     1 
ATOM   4117 C  CA    . ARG C 3 452 ? -6.381  35.338 49.087  1.00 19.82  ? 748  ARG A CA    1 
ATOM   4118 C  C     . ARG C 3 452 ? -6.002  34.889 47.671  1.00 18.14  ? 748  ARG A C     1 
ATOM   4119 O  O     . ARG C 3 452 ? -6.262  33.752 47.290  1.00 16.98  ? 748  ARG A O     1 
ATOM   4120 C  CB    . ARG C 3 452 ? -7.705  36.115 49.050  1.00 22.16  ? 748  ARG A CB    1 
ATOM   4121 C  CG    . ARG C 3 452 ? -8.874  35.298 48.512  1.00 30.34  ? 748  ARG A CG    1 
ATOM   4122 C  CD    . ARG C 3 452 ? -10.195 36.068 48.518  1.00 36.96  ? 748  ARG A CD    1 
ATOM   4123 N  NE    . ARG C 3 452 ? -10.131 37.295 47.727  1.00 42.90  ? 748  ARG A NE    1 
ATOM   4124 C  CZ    . ARG C 3 452 ? -10.046 38.518 48.246  1.00 46.08  ? 748  ARG A CZ    1 
ATOM   4125 N  NH1   . ARG C 3 452 ? -10.019 38.683 49.564  1.00 48.17  ? 748  ARG A NH1   1 
ATOM   4126 N  NH2   . ARG C 3 452 ? -9.978  39.577 47.446  1.00 47.78  ? 748  ARG A NH2   1 
ATOM   4127 N  N     . TYR C 3 453 ? -5.390  35.784 46.900  1.00 17.53  ? 749  TYR A N     1 
ATOM   4128 C  CA    . TYR C 3 453 ? -4.969  35.463 45.533  1.00 16.46  ? 749  TYR A CA    1 
ATOM   4129 C  C     . TYR C 3 453 ? -3.904  34.370 45.506  1.00 16.06  ? 749  TYR A C     1 
ATOM   4130 O  O     . TYR C 3 453 ? -3.955  33.459 44.674  1.00 15.07  ? 749  TYR A O     1 
ATOM   4131 C  CB    . TYR C 3 453 ? -4.409  36.709 44.819  1.00 16.32  ? 749  TYR A CB    1 
ATOM   4132 C  CG    . TYR C 3 453 ? -3.558  36.359 43.608  1.00 18.52  ? 749  TYR A CG    1 
ATOM   4133 C  CD1   . TYR C 3 453 ? -4.140  35.946 42.405  1.00 18.44  ? 749  TYR A CD1   1 
ATOM   4134 C  CD2   . TYR C 3 453 ? -2.169  36.385 43.686  1.00 16.69  ? 749  TYR A CD2   1 
ATOM   4135 C  CE1   . TYR C 3 453 ? -3.352  35.561 41.316  1.00 20.01  ? 749  TYR A CE1   1 
ATOM   4136 C  CE2   . TYR C 3 453 ? -1.378  36.000 42.611  1.00 20.32  ? 749  TYR A CE2   1 
ATOM   4137 C  CZ    . TYR C 3 453 ? -1.975  35.587 41.433  1.00 18.13  ? 749  TYR A CZ    1 
ATOM   4138 O  OH    . TYR C 3 453 ? -1.172  35.155 40.397  1.00 24.60  ? 749  TYR A OH    1 
ATOM   4139 N  N     . MET C 3 454 ? -2.936  34.469 46.413  1.00 15.79  ? 750  MET A N     1 
ATOM   4140 C  CA    . MET C 3 454 ? -1.852  33.496 46.481  1.00 14.92  ? 750  MET A CA    1 
ATOM   4141 C  C     . MET C 3 454 ? -2.386  32.119 46.838  1.00 14.95  ? 750  MET A C     1 
ATOM   4142 O  O     . MET C 3 454 ? -1.965  31.110 46.267  1.00 14.41  ? 750  MET A O     1 
ATOM   4143 C  CB    . MET C 3 454 ? -0.811  33.933 47.510  1.00 16.55  ? 750  MET A CB    1 
ATOM   4144 C  CG    . MET C 3 454 ? -0.072  35.210 47.126  1.00 18.55  ? 750  MET A CG    1 
ATOM   4145 S  SD    . MET C 3 454 ? 0.718   35.086 45.505  1.00 20.11  ? 750  MET A SD    1 
ATOM   4146 C  CE    . MET C 3 454 ? 1.445   36.756 45.355  1.00 16.71  ? 750  MET A CE    1 
ATOM   4147 N  N     . GLU C 3 455 ? -3.312  32.085 47.789  1.00 13.07  ? 751  GLU A N     1 
ATOM   4148 C  CA    . GLU C 3 455 ? -3.928  30.838 48.210  1.00 13.73  ? 751  GLU A CA    1 
ATOM   4149 C  C     . GLU C 3 455 ? -4.768  30.293 47.064  1.00 13.17  ? 751  GLU A C     1 
ATOM   4150 O  O     . GLU C 3 455 ? -4.694  29.116 46.729  1.00 13.62  ? 751  GLU A O     1 
ATOM   4151 C  CB    . GLU C 3 455 ? -4.831  31.075 49.431  1.00 16.29  ? 751  GLU A CB    1 
ATOM   4152 C  CG    . GLU C 3 455 ? -4.080  31.310 50.736  1.00 17.86  ? 751  GLU A CG    1 
ATOM   4153 C  CD    . GLU C 3 455 ? -4.989  31.779 51.865  1.00 21.00  ? 751  GLU A CD    1 
ATOM   4154 O  OE1   . GLU C 3 455 ? -4.547  31.761 53.032  1.00 23.17  ? 751  GLU A OE1   1 
ATOM   4155 O  OE2   . GLU C 3 455 ? -6.140  32.177 51.586  1.00 24.36  ? 751  GLU A OE2   1 
ATOM   4156 N  N     . ASN C 3 456 ? -5.569  31.161 46.460  1.00 13.49  ? 752  ASN A N     1 
ATOM   4157 C  CA    . ASN C 3 456 ? -6.440  30.737 45.375  1.00 14.97  ? 752  ASN A CA    1 
ATOM   4158 C  C     . ASN C 3 456 ? -5.743  30.332 44.082  1.00 15.72  ? 752  ASN A C     1 
ATOM   4159 O  O     . ASN C 3 456 ? -6.182  29.391 43.417  1.00 17.74  ? 752  ASN A O     1 
ATOM   4160 C  CB    . ASN C 3 456 ? -7.480  31.820 45.079  1.00 15.50  ? 752  ASN A CB    1 
ATOM   4161 C  CG    . ASN C 3 456 ? -8.526  31.942 46.190  1.00 17.55  ? 752  ASN A CG    1 
ATOM   4162 O  OD1   . ASN C 3 456 ? -8.566  31.130 47.117  1.00 21.92  ? 752  ASN A OD1   1 
ATOM   4163 N  ND2   . ASN C 3 456 ? -9.375  32.955 46.094  1.00 15.31  ? 752  ASN A ND2   1 
ATOM   4164 N  N     . ILE C 3 457 ? -4.657  31.015 43.723  1.00 14.53  ? 753  ILE A N     1 
ATOM   4165 C  CA    . ILE C 3 457 ? -3.961  30.672 42.487  1.00 14.55  ? 753  ILE A CA    1 
ATOM   4166 C  C     . ILE C 3 457 ? -3.297  29.299 42.606  1.00 13.37  ? 753  ILE A C     1 
ATOM   4167 O  O     . ILE C 3 457 ? -3.284  28.525 41.649  1.00 13.45  ? 753  ILE A O     1 
ATOM   4168 C  CB    . ILE C 3 457 ? -2.909  31.753 42.102  1.00 13.56  ? 753  ILE A CB    1 
ATOM   4169 C  CG1   . ILE C 3 457 ? -2.463  31.539 40.658  1.00 14.50  ? 753  ILE A CG1   1 
ATOM   4170 C  CG2   . ILE C 3 457 ? -1.727  31.719 43.054  1.00 10.68  ? 753  ILE A CG2   1 
ATOM   4171 C  CD1   . ILE C 3 457 ? -3.589  31.690 39.652  1.00 16.70  ? 753  ILE A CD1   1 
ATOM   4172 N  N     . VAL C 3 458 ? -2.769  28.988 43.786  1.00 13.67  ? 754  VAL A N     1 
ATOM   4173 C  CA    . VAL C 3 458 ? -2.131  27.696 44.010  1.00 13.51  ? 754  VAL A CA    1 
ATOM   4174 C  C     . VAL C 3 458 ? -3.187  26.586 43.888  1.00 13.95  ? 754  VAL A C     1 
ATOM   4175 O  O     . VAL C 3 458 ? -2.937  25.528 43.301  1.00 11.63  ? 754  VAL A O     1 
ATOM   4176 C  CB    . VAL C 3 458 ? -1.460  27.628 45.411  1.00 15.02  ? 754  VAL A CB    1 
ATOM   4177 C  CG1   . VAL C 3 458 ? -1.056  26.188 45.739  1.00 15.00  ? 754  VAL A CG1   1 
ATOM   4178 C  CG2   . VAL C 3 458 ? -0.220  28.525 45.437  1.00 16.21  ? 754  VAL A CG2   1 
ATOM   4179 N  N     . GLN C 3 459 ? -4.370  26.843 44.431  1.00 15.62  ? 755  GLN A N     1 
ATOM   4180 C  CA    . GLN C 3 459 ? -5.457  25.877 44.373  1.00 17.63  ? 755  GLN A CA    1 
ATOM   4181 C  C     . GLN C 3 459 ? -5.933  25.697 42.934  1.00 17.73  ? 755  GLN A C     1 
ATOM   4182 O  O     . GLN C 3 459 ? -6.241  24.592 42.504  1.00 17.92  ? 755  GLN A O     1 
ATOM   4183 C  CB    . GLN C 3 459 ? -6.615  26.342 45.257  1.00 18.99  ? 755  GLN A CB    1 
ATOM   4184 C  CG    . GLN C 3 459 ? -7.841  25.445 45.209  1.00 27.00  ? 755  GLN A CG    1 
ATOM   4185 C  CD    . GLN C 3 459 ? -8.774  25.676 46.387  1.00 32.58  ? 755  GLN A CD    1 
ATOM   4186 O  OE1   . GLN C 3 459 ? -9.216  26.802 46.637  1.00 35.97  ? 755  GLN A OE1   1 
ATOM   4187 N  NE2   . GLN C 3 459 ? -9.078  24.607 47.120  1.00 35.11  ? 755  GLN A NE2   1 
ATOM   4188 N  N     . GLU C 3 460 ? -5.988  26.792 42.190  1.00 17.50  ? 756  GLU A N     1 
ATOM   4189 C  CA    . GLU C 3 460 ? -6.419  26.746 40.800  1.00 17.54  ? 756  GLU A CA    1 
ATOM   4190 C  C     . GLU C 3 460 ? -5.423  25.936 39.963  1.00 16.99  ? 756  GLU A C     1 
ATOM   4191 O  O     . GLU C 3 460 ? -5.820  25.134 39.107  1.00 15.04  ? 756  GLU A O     1 
ATOM   4192 C  CB    . GLU C 3 460 ? -6.527  28.170 40.258  1.00 20.21  ? 756  GLU A CB    1 
ATOM   4193 C  CG    . GLU C 3 460 ? -7.079  28.274 38.859  1.00 25.18  ? 756  GLU A CG    1 
ATOM   4194 C  CD    . GLU C 3 460 ? -6.992  29.686 38.326  1.00 27.25  ? 756  GLU A CD    1 
ATOM   4195 O  OE1   . GLU C 3 460 ? -7.520  30.609 38.983  1.00 26.59  ? 756  GLU A OE1   1 
ATOM   4196 O  OE2   . GLU C 3 460 ? -6.387  29.874 37.252  1.00 29.92  ? 756  GLU A OE2   1 
ATOM   4197 N  N     . ALA C 3 461 ? -4.131  26.146 40.211  1.00 15.40  ? 757  ALA A N     1 
ATOM   4198 C  CA    . ALA C 3 461 ? -3.097  25.422 39.477  1.00 13.69  ? 757  ALA A CA    1 
ATOM   4199 C  C     . ALA C 3 461 ? -3.264  23.923 39.706  1.00 16.21  ? 757  ALA A C     1 
ATOM   4200 O  O     . ALA C 3 461 ? -3.091  23.124 38.786  1.00 14.16  ? 757  ALA A O     1 
ATOM   4201 C  CB    . ALA C 3 461 ? -1.722  25.870 39.927  1.00 12.51  ? 757  ALA A CB    1 
ATOM   4202 N  N     . LYS C 3 462 ? -3.608  23.541 40.934  1.00 16.08  ? 758  LYS A N     1 
ATOM   4203 C  CA    . LYS C 3 462 ? -3.805  22.131 41.240  1.00 17.88  ? 758  LYS A CA    1 
ATOM   4204 C  C     . LYS C 3 462 ? -5.061  21.587 40.546  1.00 16.76  ? 758  LYS A C     1 
ATOM   4205 O  O     . LYS C 3 462 ? -5.040  20.487 39.994  1.00 16.98  ? 758  LYS A O     1 
ATOM   4206 C  CB    . LYS C 3 462 ? -3.918  21.909 42.754  1.00 20.39  ? 758  LYS A CB    1 
ATOM   4207 C  CG    . LYS C 3 462 ? -4.289  20.466 43.109  1.00 27.12  ? 758  LYS A CG    1 
ATOM   4208 C  CD    . LYS C 3 462 ? -4.425  20.225 44.604  1.00 28.54  ? 758  LYS A CD    1 
ATOM   4209 C  CE    . LYS C 3 462 ? -3.075  20.238 45.305  1.00 31.44  ? 758  LYS A CE    1 
ATOM   4210 N  NZ    . LYS C 3 462 ? -3.193  19.781 46.726  1.00 33.07  ? 758  LYS A NZ    1 
ATOM   4211 N  N     . GLN C 3 463 ? -6.143  22.364 40.563  1.00 16.45  ? 759  GLN A N     1 
ATOM   4212 C  CA    . GLN C 3 463 ? -7.400  21.944 39.943  1.00 16.72  ? 759  GLN A CA    1 
ATOM   4213 C  C     . GLN C 3 463 ? -7.317  21.847 38.427  1.00 16.47  ? 759  GLN A C     1 
ATOM   4214 O  O     . GLN C 3 463 ? -7.744  20.852 37.844  1.00 16.11  ? 759  GLN A O     1 
ATOM   4215 C  CB    . GLN C 3 463 ? -8.540  22.903 40.323  1.00 19.05  ? 759  GLN A CB    1 
ATOM   4216 C  CG    . GLN C 3 463 ? -9.928  22.508 39.763  1.00 21.17  ? 759  GLN A CG    1 
ATOM   4217 C  CD    . GLN C 3 463 ? -10.359 23.331 38.543  1.00 22.22  ? 759  GLN A CD    1 
ATOM   4218 O  OE1   . GLN C 3 463 ? -10.483 24.554 38.621  1.00 22.05  ? 759  GLN A OE1   1 
ATOM   4219 N  NE2   . GLN C 3 463 ? -10.593 22.657 37.413  1.00 21.22  ? 759  GLN A NE2   1 
ATOM   4220 N  N     . LYS C 3 464 ? -6.764  22.875 37.790  1.00 16.63  ? 760  LYS A N     1 
ATOM   4221 C  CA    . LYS C 3 464 ? -6.660  22.897 36.334  1.00 18.08  ? 760  LYS A CA    1 
ATOM   4222 C  C     . LYS C 3 464 ? -5.400  22.254 35.759  1.00 16.93  ? 760  LYS A C     1 
ATOM   4223 O  O     . LYS C 3 464 ? -5.424  21.724 34.647  1.00 16.78  ? 760  LYS A O     1 
ATOM   4224 C  CB    . LYS C 3 464 ? -6.758  24.338 35.823  1.00 19.98  ? 760  LYS A CB    1 
ATOM   4225 C  CG    . LYS C 3 464 ? -8.145  24.952 35.939  1.00 22.16  ? 760  LYS A CG    1 
ATOM   4226 C  CD    . LYS C 3 464 ? -8.195  26.319 35.277  1.00 25.17  ? 760  LYS A CD    1 
ATOM   4227 C  CE    . LYS C 3 464 ? -9.625  26.853 35.208  1.00 28.20  ? 760  LYS A CE    1 
ATOM   4228 N  NZ    . LYS C 3 464 ? -10.272 26.908 36.548  1.00 29.54  ? 760  LYS A NZ    1 
ATOM   4229 N  N     . GLY C 3 465 ? -4.307  22.303 36.513  1.00 15.61  ? 761  GLY A N     1 
ATOM   4230 C  CA    . GLY C 3 465 ? -3.053  21.745 36.035  1.00 14.41  ? 761  GLY A CA    1 
ATOM   4231 C  C     . GLY C 3 465 ? -2.154  22.821 35.439  1.00 15.03  ? 761  GLY A C     1 
ATOM   4232 O  O     . GLY C 3 465 ? -1.020  22.548 35.041  1.00 15.79  ? 761  GLY A O     1 
ATOM   4233 N  N     . TYR C 3 466 ? -2.656  24.053 35.394  1.00 13.65  ? 762  TYR A N     1 
ATOM   4234 C  CA    . TYR C 3 466 ? -1.902  25.172 34.834  1.00 14.71  ? 762  TYR A CA    1 
ATOM   4235 C  C     . TYR C 3 466 ? -2.428  26.502 35.357  1.00 13.49  ? 762  TYR A C     1 
ATOM   4236 O  O     . TYR C 3 466 ? -3.464  26.552 36.023  1.00 13.90  ? 762  TYR A O     1 
ATOM   4237 C  CB    . TYR C 3 466 ? -2.015  25.161 33.298  1.00 13.45  ? 762  TYR A CB    1 
ATOM   4238 C  CG    . TYR C 3 466 ? -3.438  25.352 32.786  1.00 14.26  ? 762  TYR A CG    1 
ATOM   4239 C  CD1   . TYR C 3 466 ? -3.949  26.628 32.521  1.00 15.11  ? 762  TYR A CD1   1 
ATOM   4240 C  CD2   . TYR C 3 466 ? -4.279  24.254 32.582  1.00 14.66  ? 762  TYR A CD2   1 
ATOM   4241 C  CE1   . TYR C 3 466 ? -5.256  26.803 32.067  1.00 13.95  ? 762  TYR A CE1   1 
ATOM   4242 C  CE2   . TYR C 3 466 ? -5.589  24.418 32.129  1.00 13.23  ? 762  TYR A CE2   1 
ATOM   4243 C  CZ    . TYR C 3 466 ? -6.071  25.688 31.874  1.00 15.77  ? 762  TYR A CZ    1 
ATOM   4244 O  OH    . TYR C 3 466 ? -7.362  25.840 31.425  1.00 13.17  ? 762  TYR A OH    1 
ATOM   4245 N  N     . VAL C 3 467 ? -1.701  27.575 35.056  1.00 13.31  ? 763  VAL A N     1 
ATOM   4246 C  CA    . VAL C 3 467 ? -2.108  28.924 35.433  1.00 13.20  ? 763  VAL A CA    1 
ATOM   4247 C  C     . VAL C 3 467 ? -2.053  29.737 34.138  1.00 14.57  ? 763  VAL A C     1 
ATOM   4248 O  O     . VAL C 3 467 ? -1.371  29.356 33.187  1.00 13.89  ? 763  VAL A O     1 
ATOM   4249 C  CB    . VAL C 3 467 ? -1.165  29.563 36.494  1.00 14.82  ? 763  VAL A CB    1 
ATOM   4250 C  CG1   . VAL C 3 467 ? -1.280  28.806 37.814  1.00 13.68  ? 763  VAL A CG1   1 
ATOM   4251 C  CG2   . VAL C 3 467 ? 0.280   29.562 35.992  1.00 12.09  ? 763  VAL A CG2   1 
ATOM   4252 N  N     . THR C 3 468 ? -2.762  30.856 34.095  1.00 14.71  ? 764  THR A N     1 
ATOM   4253 C  CA    . THR C 3 468 ? -2.786  31.657 32.881  1.00 15.95  ? 764  THR A CA    1 
ATOM   4254 C  C     . THR C 3 468 ? -2.517  33.125 33.138  1.00 14.82  ? 764  THR A C     1 
ATOM   4255 O  O     . THR C 3 468 ? -2.572  33.592 34.280  1.00 14.98  ? 764  THR A O     1 
ATOM   4256 C  CB    . THR C 3 468 ? -4.154  31.534 32.185  1.00 16.18  ? 764  THR A CB    1 
ATOM   4257 O  OG1   . THR C 3 468 ? -5.179  31.937 33.096  1.00 21.20  ? 764  THR A OG1   1 
ATOM   4258 C  CG2   . THR C 3 468 ? -4.419  30.105 31.766  1.00 16.80  ? 764  THR A CG2   1 
ATOM   4259 N  N     . THR C 3 469 ? -2.227  33.848 32.061  1.00 14.04  ? 765  THR A N     1 
ATOM   4260 C  CA    . THR C 3 469 ? -1.965  35.279 32.141  1.00 13.42  ? 765  THR A CA    1 
ATOM   4261 C  C     . THR C 3 469 ? -3.160  36.032 31.570  1.00 14.45  ? 765  THR A C     1 
ATOM   4262 O  O     . THR C 3 469 ? -4.088  35.433 31.031  1.00 13.25  ? 765  THR A O     1 
ATOM   4263 C  CB    . THR C 3 469 ? -0.718  35.682 31.324  1.00 13.11  ? 765  THR A CB    1 
ATOM   4264 O  OG1   . THR C 3 469 ? -0.984  35.492 29.927  1.00 10.50  ? 765  THR A OG1   1 
ATOM   4265 C  CG2   . THR C 3 469 ? 0.496   34.836 31.736  1.00 10.72  ? 765  THR A CG2   1 
ATOM   4266 N  N     . LEU C 3 470 ? -3.112  37.351 31.688  1.00 14.48  ? 766  LEU A N     1 
ATOM   4267 C  CA    . LEU C 3 470 ? -4.155  38.246 31.205  1.00 15.59  ? 766  LEU A CA    1 
ATOM   4268 C  C     . LEU C 3 470 ? -4.576  37.964 29.755  1.00 16.34  ? 766  LEU A C     1 
ATOM   4269 O  O     . LEU C 3 470 ? -5.770  37.928 29.443  1.00 14.41  ? 766  LEU A O     1 
ATOM   4270 C  CB    . LEU C 3 470 ? -3.653  39.682 31.314  1.00 18.10  ? 766  LEU A CB    1 
ATOM   4271 C  CG    . LEU C 3 470 ? -4.634  40.842 31.213  1.00 23.11  ? 766  LEU A CG    1 
ATOM   4272 C  CD1   . LEU C 3 470 ? -5.461  40.930 32.507  1.00 23.87  ? 766  LEU A CD1   1 
ATOM   4273 C  CD2   . LEU C 3 470 ? -3.849  42.132 30.995  1.00 23.50  ? 766  LEU A CD2   1 
ATOM   4274 N  N     . LEU C 3 471 ? -3.604  37.773 28.868  1.00 14.78  ? 767  LEU A N     1 
ATOM   4275 C  CA    . LEU C 3 471 ? -3.931  37.515 27.468  1.00 16.69  ? 767  LEU A CA    1 
ATOM   4276 C  C     . LEU C 3 471 ? -4.013  36.030 27.099  1.00 15.79  ? 767  LEU A C     1 
ATOM   4277 O  O     . LEU C 3 471 ? -3.942  35.662 25.924  1.00 16.91  ? 767  LEU A O     1 
ATOM   4278 C  CB    . LEU C 3 471 ? -2.954  38.253 26.546  1.00 14.79  ? 767  LEU A CB    1 
ATOM   4279 C  CG    . LEU C 3 471 ? -2.954  39.785 26.643  1.00 17.75  ? 767  LEU A CG    1 
ATOM   4280 C  CD1   . LEU C 3 471 ? -2.249  40.361 25.417  1.00 16.99  ? 767  LEU A CD1   1 
ATOM   4281 C  CD2   . LEU C 3 471 ? -4.381  40.327 26.704  1.00 18.06  ? 767  LEU A CD2   1 
ATOM   4282 N  N     . HIS C 3 472 ? -4.163  35.193 28.125  1.00 16.72  ? 768  HIS A N     1 
ATOM   4283 C  CA    . HIS C 3 472 ? -4.333  33.745 27.986  1.00 15.35  ? 768  HIS A CA    1 
ATOM   4284 C  C     . HIS C 3 472 ? -3.114  32.881 27.718  1.00 14.94  ? 768  HIS A C     1 
ATOM   4285 O  O     . HIS C 3 472 ? -3.242  31.769 27.204  1.00 12.38  ? 768  HIS A O     1 
ATOM   4286 C  CB    . HIS C 3 472 ? -5.408  33.445 26.935  1.00 19.30  ? 768  HIS A CB    1 
ATOM   4287 C  CG    . HIS C 3 472 ? -6.689  34.183 27.164  1.00 22.01  ? 768  HIS A CG    1 
ATOM   4288 N  ND1   . HIS C 3 472 ? -7.366  34.144 28.364  1.00 24.23  ? 768  HIS A ND1   1 
ATOM   4289 C  CD2   . HIS C 3 472 ? -7.398  35.012 26.360  1.00 24.46  ? 768  HIS A CD2   1 
ATOM   4290 C  CE1   . HIS C 3 472 ? -8.434  34.919 28.291  1.00 23.38  ? 768  HIS A CE1   1 
ATOM   4291 N  NE2   . HIS C 3 472 ? -8.477  35.458 27.086  1.00 25.39  ? 768  HIS A NE2   1 
ATOM   4292 N  N     . ARG C 3 473 ? -1.936  33.387 28.058  1.00 13.96  ? 769  ARG A N     1 
ATOM   4293 C  CA    . ARG C 3 473 ? -0.717  32.614 27.905  1.00 14.30  ? 769  ARG A CA    1 
ATOM   4294 C  C     . ARG C 3 473 ? -0.871  31.535 28.978  1.00 16.03  ? 769  ARG A C     1 
ATOM   4295 O  O     . ARG C 3 473 ? -1.504  31.764 30.012  1.00 15.91  ? 769  ARG A O     1 
ATOM   4296 C  CB    . ARG C 3 473 ? 0.508   33.480 28.194  1.00 13.56  ? 769  ARG A CB    1 
ATOM   4297 C  CG    . ARG C 3 473 ? 1.828   32.815 27.876  1.00 11.61  ? 769  ARG A CG    1 
ATOM   4298 C  CD    . ARG C 3 473 ? 2.964   33.781 28.173  1.00 11.59  ? 769  ARG A CD    1 
ATOM   4299 N  NE    . ARG C 3 473 ? 2.785   35.039 27.454  1.00 11.52  ? 769  ARG A NE    1 
ATOM   4300 C  CZ    . ARG C 3 473 ? 3.042   35.205 26.160  1.00 10.23  ? 769  ARG A CZ    1 
ATOM   4301 N  NH1   . ARG C 3 473 ? 3.499   34.192 25.432  1.00 8.70   ? 769  ARG A NH1   1 
ATOM   4302 N  NH2   . ARG C 3 473 ? 2.830   36.385 25.590  1.00 9.53   ? 769  ARG A NH2   1 
ATOM   4303 N  N     . ARG C 3 474 ? -0.281  30.372 28.747  1.00 15.38  ? 770  ARG A N     1 
ATOM   4304 C  CA    . ARG C 3 474 ? -0.431  29.272 29.684  1.00 16.51  ? 770  ARG A CA    1 
ATOM   4305 C  C     . ARG C 3 474 ? 0.878   28.642 30.154  1.00 15.00  ? 770  ARG A C     1 
ATOM   4306 O  O     . ARG C 3 474 ? 1.866   28.614 29.423  1.00 14.52  ? 770  ARG A O     1 
ATOM   4307 C  CB    . ARG C 3 474 ? -1.319  28.212 29.012  1.00 17.74  ? 770  ARG A CB    1 
ATOM   4308 C  CG    . ARG C 3 474 ? -1.635  26.983 29.824  1.00 21.30  ? 770  ARG A CG    1 
ATOM   4309 C  CD    . ARG C 3 474 ? -2.539  26.030 29.030  1.00 21.77  ? 770  ARG A CD    1 
ATOM   4310 N  NE    . ARG C 3 474 ? -3.871  26.582 28.784  1.00 18.88  ? 770  ARG A NE    1 
ATOM   4311 C  CZ    . ARG C 3 474 ? -4.954  25.845 28.550  1.00 20.34  ? 770  ARG A CZ    1 
ATOM   4312 N  NH1   . ARG C 3 474 ? -4.869  24.516 28.525  1.00 17.60  ? 770  ARG A NH1   1 
ATOM   4313 N  NH2   . ARG C 3 474 ? -6.127  26.434 28.366  1.00 16.54  ? 770  ARG A NH2   1 
ATOM   4314 N  N     . ARG C 3 475 ? 0.878   28.148 31.388  1.00 14.72  ? 771  ARG A N     1 
ATOM   4315 C  CA    . ARG C 3 475 ? 2.039   27.449 31.928  1.00 13.89  ? 771  ARG A CA    1 
ATOM   4316 C  C     . ARG C 3 475 ? 1.546   26.276 32.775  1.00 13.17  ? 771  ARG A C     1 
ATOM   4317 O  O     . ARG C 3 475 ? 0.837   26.460 33.762  1.00 11.78  ? 771  ARG A O     1 
ATOM   4318 C  CB    . ARG C 3 475 ? 2.926   28.365 32.778  1.00 13.22  ? 771  ARG A CB    1 
ATOM   4319 C  CG    . ARG C 3 475 ? 4.244   27.684 33.198  1.00 11.91  ? 771  ARG A CG    1 
ATOM   4320 C  CD    . ARG C 3 475 ? 5.172   28.613 33.997  1.00 14.45  ? 771  ARG A CD    1 
ATOM   4321 N  NE    . ARG C 3 475 ? 6.452   27.971 34.311  1.00 16.26  ? 771  ARG A NE    1 
ATOM   4322 C  CZ    . ARG C 3 475 ? 7.444   28.553 34.983  1.00 15.03  ? 771  ARG A CZ    1 
ATOM   4323 N  NH1   . ARG C 3 475 ? 7.313   29.797 35.423  1.00 14.17  ? 771  ARG A NH1   1 
ATOM   4324 N  NH2   . ARG C 3 475 ? 8.574   27.893 35.211  1.00 13.80  ? 771  ARG A NH2   1 
ATOM   4325 N  N     . TYR C 3 476 ? 1.922   25.068 32.371  1.00 12.71  ? 772  TYR A N     1 
ATOM   4326 C  CA    . TYR C 3 476 ? 1.525   23.866 33.090  1.00 13.89  ? 772  TYR A CA    1 
ATOM   4327 C  C     . TYR C 3 476 ? 2.463   23.648 34.272  1.00 13.96  ? 772  TYR A C     1 
ATOM   4328 O  O     . TYR C 3 476 ? 3.671   23.854 34.158  1.00 14.00  ? 772  TYR A O     1 
ATOM   4329 C  CB    . TYR C 3 476 ? 1.553   22.655 32.149  1.00 14.36  ? 772  TYR A CB    1 
ATOM   4330 C  CG    . TYR C 3 476 ? 0.471   22.696 31.093  1.00 16.09  ? 772  TYR A CG    1 
ATOM   4331 C  CD1   . TYR C 3 476 ? 0.729   23.186 29.810  1.00 16.05  ? 772  TYR A CD1   1 
ATOM   4332 C  CD2   . TYR C 3 476 ? -0.822  22.263 31.385  1.00 15.60  ? 772  TYR A CD2   1 
ATOM   4333 C  CE1   . TYR C 3 476 ? -0.277  23.245 28.847  1.00 15.47  ? 772  TYR A CE1   1 
ATOM   4334 C  CE2   . TYR C 3 476 ? -1.837  22.321 30.432  1.00 15.51  ? 772  TYR A CE2   1 
ATOM   4335 C  CZ    . TYR C 3 476 ? -1.558  22.813 29.168  1.00 16.94  ? 772  TYR A CZ    1 
ATOM   4336 O  OH    . TYR C 3 476 ? -2.572  22.908 28.246  1.00 15.50  ? 772  TYR A OH    1 
ATOM   4337 N  N     . LEU C 3 477 ? 1.905   23.237 35.406  1.00 14.06  ? 773  LEU A N     1 
ATOM   4338 C  CA    . LEU C 3 477 ? 2.698   23.020 36.614  1.00 14.41  ? 773  LEU A CA    1 
ATOM   4339 C  C     . LEU C 3 477 ? 2.428   21.652 37.219  1.00 15.18  ? 773  LEU A C     1 
ATOM   4340 O  O     . LEU C 3 477 ? 1.792   21.542 38.269  1.00 15.18  ? 773  LEU A O     1 
ATOM   4341 C  CB    . LEU C 3 477 ? 2.379   24.105 37.650  1.00 14.66  ? 773  LEU A CB    1 
ATOM   4342 C  CG    . LEU C 3 477 ? 2.668   25.555 37.243  1.00 16.65  ? 773  LEU A CG    1 
ATOM   4343 C  CD1   . LEU C 3 477 ? 2.126   26.498 38.303  1.00 14.97  ? 773  LEU A CD1   1 
ATOM   4344 C  CD2   . LEU C 3 477 ? 4.173   25.750 37.065  1.00 14.23  ? 773  LEU A CD2   1 
ATOM   4345 N  N     . PRO C 3 478 ? 2.929   20.588 36.576  1.00 16.42  ? 774  PRO A N     1 
ATOM   4346 C  CA    . PRO C 3 478 ? 2.713   19.232 37.087  1.00 16.61  ? 774  PRO A CA    1 
ATOM   4347 C  C     . PRO C 3 478 ? 3.303   18.962 38.474  1.00 17.53  ? 774  PRO A C     1 
ATOM   4348 O  O     . PRO C 3 478 ? 2.768   18.146 39.216  1.00 15.62  ? 774  PRO A O     1 
ATOM   4349 C  CB    . PRO C 3 478 ? 3.312   18.350 35.991  1.00 18.62  ? 774  PRO A CB    1 
ATOM   4350 C  CG    . PRO C 3 478 ? 4.407   19.209 35.430  1.00 17.04  ? 774  PRO A CG    1 
ATOM   4351 C  CD    . PRO C 3 478 ? 3.752   20.568 35.353  1.00 16.55  ? 774  PRO A CD    1 
ATOM   4352 N  N     . ASP C 3 479 ? 4.391   19.649 38.822  1.00 18.82  ? 775  ASP A N     1 
ATOM   4353 C  CA    . ASP C 3 479 ? 5.043   19.469 40.127  1.00 18.13  ? 775  ASP A CA    1 
ATOM   4354 C  C     . ASP C 3 479 ? 4.229   20.034 41.288  1.00 18.15  ? 775  ASP A C     1 
ATOM   4355 O  O     . ASP C 3 479 ? 4.598   19.875 42.452  1.00 16.51  ? 775  ASP A O     1 
ATOM   4356 C  CB    . ASP C 3 479 ? 6.424   20.135 40.130  1.00 20.55  ? 775  ASP A CB    1 
ATOM   4357 C  CG    . ASP C 3 479 ? 7.416   19.439 39.216  1.00 23.20  ? 775  ASP A CG    1 
ATOM   4358 O  OD1   . ASP C 3 479 ? 8.528   19.979 39.030  1.00 24.25  ? 775  ASP A OD1   1 
ATOM   4359 O  OD2   . ASP C 3 479 ? 7.090   18.354 38.689  1.00 23.15  ? 775  ASP A OD2   1 
ATOM   4360 N  N     . ILE C 3 480 ? 3.125   20.698 40.972  1.00 17.82  ? 776  ILE A N     1 
ATOM   4361 C  CA    . ILE C 3 480 ? 2.274   21.287 41.996  1.00 19.04  ? 776  ILE A CA    1 
ATOM   4362 C  C     . ILE C 3 480 ? 1.683   20.203 42.903  1.00 19.32  ? 776  ILE A C     1 
ATOM   4363 O  O     . ILE C 3 480 ? 1.301   20.478 44.037  1.00 19.71  ? 776  ILE A O     1 
ATOM   4364 C  CB    . ILE C 3 480 ? 1.113   22.090 41.347  1.00 20.07  ? 776  ILE A CB    1 
ATOM   4365 C  CG1   . ILE C 3 480 ? 0.530   23.089 42.343  1.00 21.17  ? 776  ILE A CG1   1 
ATOM   4366 C  CG2   . ILE C 3 480 ? 0.027   21.145 40.870  1.00 21.25  ? 776  ILE A CG2   1 
ATOM   4367 C  CD1   . ILE C 3 480 ? 1.361   24.343 42.502  1.00 19.86  ? 776  ILE A CD1   1 
ATOM   4368 N  N     . THR C 3 481 ? 1.615   18.970 42.402  1.00 21.56  ? 777  THR A N     1 
ATOM   4369 C  CA    . THR C 3 481 ? 1.044   17.857 43.168  1.00 22.81  ? 777  THR A CA    1 
ATOM   4370 C  C     . THR C 3 481 ? 2.083   16.907 43.765  1.00 23.44  ? 777  THR A C     1 
ATOM   4371 O  O     . THR C 3 481 ? 1.729   15.882 44.349  1.00 24.58  ? 777  THR A O     1 
ATOM   4372 C  CB    . THR C 3 481 ? 0.094   17.022 42.298  1.00 23.33  ? 777  THR A CB    1 
ATOM   4373 O  OG1   . THR C 3 481 ? 0.824   16.457 41.200  1.00 24.97  ? 777  THR A OG1   1 
ATOM   4374 C  CG2   . THR C 3 481 ? -1.032  17.892 41.753  1.00 25.93  ? 777  THR A CG2   1 
ATOM   4375 N  N     . SER C 3 482 ? 3.359   17.253 43.627  1.00 22.87  ? 778  SER A N     1 
ATOM   4376 C  CA    . SER C 3 482 ? 4.446   16.427 44.149  1.00 25.29  ? 778  SER A CA    1 
ATOM   4377 C  C     . SER C 3 482 ? 4.408   16.288 45.671  1.00 25.58  ? 778  SER A C     1 
ATOM   4378 O  O     . SER C 3 482 ? 4.072   17.237 46.381  1.00 24.97  ? 778  SER A O     1 
ATOM   4379 C  CB    . SER C 3 482 ? 5.793   17.021 43.728  1.00 24.66  ? 778  SER A CB    1 
ATOM   4380 O  OG    . SER C 3 482 ? 6.860   16.425 44.442  1.00 27.59  ? 778  SER A OG    1 
ATOM   4381 N  N     . ARG C 3 483 ? 4.752   15.105 46.173  1.00 26.82  ? 779  ARG A N     1 
ATOM   4382 C  CA    . ARG C 3 483 ? 4.762   14.886 47.615  1.00 28.04  ? 779  ARG A CA    1 
ATOM   4383 C  C     . ARG C 3 483 ? 6.123   15.227 48.199  1.00 29.52  ? 779  ARG A C     1 
ATOM   4384 O  O     . ARG C 3 483 ? 6.411   14.917 49.356  1.00 30.53  ? 779  ARG A O     1 
ATOM   4385 C  CB    . ARG C 3 483 ? 4.382   13.443 47.964  1.00 29.25  ? 779  ARG A CB    1 
ATOM   4386 C  CG    . ARG C 3 483 ? 2.876   13.190 47.985  1.00 29.53  ? 779  ARG A CG    1 
ATOM   4387 C  CD    . ARG C 3 483 ? 2.300   13.172 46.581  1.00 30.39  ? 779  ARG A CD    1 
ATOM   4388 N  NE    . ARG C 3 483 ? 2.791   12.023 45.825  1.00 29.52  ? 779  ARG A NE    1 
ATOM   4389 C  CZ    . ARG C 3 483 ? 2.783   11.944 44.500  1.00 29.68  ? 779  ARG A CZ    1 
ATOM   4390 N  NH1   . ARG C 3 483 ? 2.308   12.953 43.784  1.00 29.49  ? 779  ARG A NH1   1 
ATOM   4391 N  NH2   . ARG C 3 483 ? 3.257   10.863 43.891  1.00 27.65  ? 779  ARG A NH2   1 
ATOM   4392 N  N     . ASN C 3 484 ? 6.957   15.867 47.386  1.00 29.36  ? 780  ASN A N     1 
ATOM   4393 C  CA    . ASN C 3 484 ? 8.283   16.295 47.811  1.00 29.16  ? 780  ASN A CA    1 
ATOM   4394 C  C     . ASN C 3 484 ? 8.194   17.803 48.051  1.00 29.40  ? 780  ASN A C     1 
ATOM   4395 O  O     . ASN C 3 484 ? 8.015   18.583 47.114  1.00 28.21  ? 780  ASN A O     1 
ATOM   4396 C  CB    . ASN C 3 484 ? 9.322   15.982 46.731  1.00 29.79  ? 780  ASN A CB    1 
ATOM   4397 C  CG    . ASN C 3 484 ? 10.718  16.452 47.111  1.00 32.26  ? 780  ASN A CG    1 
ATOM   4398 O  OD1   . ASN C 3 484 ? 11.022  17.643 47.053  1.00 34.00  ? 780  ASN A OD1   1 
ATOM   4399 N  ND2   . ASN C 3 484 ? 11.570  15.513 47.514  1.00 31.76  ? 780  ASN A ND2   1 
ATOM   4400 N  N     . PHE C 3 485 ? 8.315   18.197 49.316  1.00 28.33  ? 781  PHE A N     1 
ATOM   4401 C  CA    . PHE C 3 485 ? 8.216   19.595 49.724  1.00 27.27  ? 781  PHE A CA    1 
ATOM   4402 C  C     . PHE C 3 485 ? 9.008   20.601 48.895  1.00 26.83  ? 781  PHE A C     1 
ATOM   4403 O  O     . PHE C 3 485 ? 8.475   21.643 48.511  1.00 27.57  ? 781  PHE A O     1 
ATOM   4404 C  CB    . PHE C 3 485 ? 8.596   19.734 51.205  1.00 25.57  ? 781  PHE A CB    1 
ATOM   4405 C  CG    . PHE C 3 485 ? 8.503   21.144 51.726  1.00 26.06  ? 781  PHE A CG    1 
ATOM   4406 C  CD1   . PHE C 3 485 ? 9.613   21.981 51.709  1.00 24.69  ? 781  PHE A CD1   1 
ATOM   4407 C  CD2   . PHE C 3 485 ? 7.294   21.643 52.206  1.00 25.88  ? 781  PHE A CD2   1 
ATOM   4408 C  CE1   . PHE C 3 485 ? 9.522   23.301 52.163  1.00 24.75  ? 781  PHE A CE1   1 
ATOM   4409 C  CE2   . PHE C 3 485 ? 7.192   22.959 52.662  1.00 27.02  ? 781  PHE A CE2   1 
ATOM   4410 C  CZ    . PHE C 3 485 ? 8.311   23.788 52.639  1.00 24.71  ? 781  PHE A CZ    1 
ATOM   4411 N  N     . ASN C 3 486 ? 10.270  20.310 48.615  1.00 27.20  ? 782  ASN A N     1 
ATOM   4412 C  CA    . ASN C 3 486 ? 11.063  21.254 47.839  1.00 27.76  ? 782  ASN A CA    1 
ATOM   4413 C  C     . ASN C 3 486 ? 10.555  21.378 46.403  1.00 27.05  ? 782  ASN A C     1 
ATOM   4414 O  O     . ASN C 3 486 ? 10.474  22.481 45.860  1.00 25.44  ? 782  ASN A O     1 
ATOM   4415 C  CB    . ASN C 3 486 ? 12.545  20.853 47.830  1.00 29.84  ? 782  ASN A CB    1 
ATOM   4416 C  CG    . ASN C 3 486 ? 13.235  21.112 49.170  1.00 31.74  ? 782  ASN A CG    1 
ATOM   4417 O  OD1   . ASN C 3 486 ? 12.710  21.825 50.034  1.00 34.02  ? 782  ASN A OD1   1 
ATOM   4418 N  ND2   . ASN C 3 486 ? 14.421  20.537 49.343  1.00 30.64  ? 782  ASN A ND2   1 
ATOM   4419 N  N     . VAL C 3 487 ? 10.200  20.251 45.794  1.00 25.44  ? 783  VAL A N     1 
ATOM   4420 C  CA    . VAL C 3 487 ? 9.705   20.264 44.426  1.00 23.63  ? 783  VAL A CA    1 
ATOM   4421 C  C     . VAL C 3 487 ? 8.324   20.923 44.343  1.00 23.05  ? 783  VAL A C     1 
ATOM   4422 O  O     . VAL C 3 487 ? 8.064   21.705 43.429  1.00 24.00  ? 783  VAL A O     1 
ATOM   4423 C  CB    . VAL C 3 487 ? 9.647   18.826 43.854  1.00 24.48  ? 783  VAL A CB    1 
ATOM   4424 C  CG1   . VAL C 3 487 ? 8.973   18.820 42.492  1.00 22.44  ? 783  VAL A CG1   1 
ATOM   4425 C  CG2   . VAL C 3 487 ? 11.064  18.264 43.737  1.00 24.81  ? 783  VAL A CG2   1 
ATOM   4426 N  N     . ARG C 3 488 ? 7.451   20.620 45.301  1.00 21.48  ? 784  ARG A N     1 
ATOM   4427 C  CA    . ARG C 3 488 ? 6.110   21.193 45.316  1.00 21.29  ? 784  ARG A CA    1 
ATOM   4428 C  C     . ARG C 3 488 ? 6.143   22.702 45.579  1.00 20.50  ? 784  ARG A C     1 
ATOM   4429 O  O     . ARG C 3 488 ? 5.418   23.468 44.943  1.00 19.09  ? 784  ARG A O     1 
ATOM   4430 C  CB    . ARG C 3 488 ? 5.235   20.504 46.378  1.00 20.64  ? 784  ARG A CB    1 
ATOM   4431 C  CG    . ARG C 3 488 ? 3.796   21.001 46.386  1.00 23.08  ? 784  ARG A CG    1 
ATOM   4432 C  CD    . ARG C 3 488 ? 2.900   20.245 47.372  1.00 25.28  ? 784  ARG A CD    1 
ATOM   4433 N  NE    . ARG C 3 488 ? 3.266   20.496 48.762  1.00 24.69  ? 784  ARG A NE    1 
ATOM   4434 C  CZ    . ARG C 3 488 ? 3.881   19.614 49.546  1.00 26.66  ? 784  ARG A CZ    1 
ATOM   4435 N  NH1   . ARG C 3 488 ? 4.199   18.409 49.083  1.00 23.86  ? 784  ARG A NH1   1 
ATOM   4436 N  NH2   . ARG C 3 488 ? 4.191   19.943 50.794  1.00 26.92  ? 784  ARG A NH2   1 
ATOM   4437 N  N     . SER C 3 489 ? 6.987   23.125 46.514  1.00 18.51  ? 785  SER A N     1 
ATOM   4438 C  CA    . SER C 3 489 ? 7.108   24.538 46.855  1.00 19.66  ? 785  SER A CA    1 
ATOM   4439 C  C     . SER C 3 489 ? 7.560   25.380 45.668  1.00 18.39  ? 785  SER A C     1 
ATOM   4440 O  O     . SER C 3 489 ? 7.071   26.483 45.470  1.00 17.86  ? 785  SER A O     1 
ATOM   4441 C  CB    . SER C 3 489 ? 8.089   24.726 48.018  1.00 20.65  ? 785  SER A CB    1 
ATOM   4442 O  OG    . SER C 3 489 ? 7.565   24.181 49.221  1.00 23.90  ? 785  SER A OG    1 
ATOM   4443 N  N     . PHE C 3 490 ? 8.498   24.861 44.882  1.00 20.17  ? 786  PHE A N     1 
ATOM   4444 C  CA    . PHE C 3 490 ? 8.985   25.591 43.719  1.00 21.08  ? 786  PHE A CA    1 
ATOM   4445 C  C     . PHE C 3 490 ? 7.847   25.814 42.720  1.00 18.35  ? 786  PHE A C     1 
ATOM   4446 O  O     . PHE C 3 490 ? 7.730   26.887 42.133  1.00 18.21  ? 786  PHE A O     1 
ATOM   4447 C  CB    . PHE C 3 490 ? 10.135  24.819 43.057  1.00 25.22  ? 786  PHE A CB    1 
ATOM   4448 C  CG    . PHE C 3 490 ? 10.903  25.618 42.028  1.00 30.08  ? 786  PHE A CG    1 
ATOM   4449 C  CD1   . PHE C 3 490 ? 10.839  27.011 42.007  1.00 31.94  ? 786  PHE A CD1   1 
ATOM   4450 C  CD2   . PHE C 3 490 ? 11.721  24.974 41.103  1.00 32.73  ? 786  PHE A CD2   1 
ATOM   4451 C  CE1   . PHE C 3 490 ? 11.576  27.752 41.080  1.00 32.17  ? 786  PHE A CE1   1 
ATOM   4452 C  CE2   . PHE C 3 490 ? 12.467  25.705 40.170  1.00 33.94  ? 786  PHE A CE2   1 
ATOM   4453 C  CZ    . PHE C 3 490 ? 12.392  27.099 40.160  1.00 33.84  ? 786  PHE A CZ    1 
ATOM   4454 N  N     . ALA C 3 491 ? 7.004   24.800 42.540  1.00 16.89  ? 787  ALA A N     1 
ATOM   4455 C  CA    . ALA C 3 491 ? 5.878   24.895 41.613  1.00 14.90  ? 787  ALA A CA    1 
ATOM   4456 C  C     . ALA C 3 491 ? 4.811   25.866 42.125  1.00 14.78  ? 787  ALA A C     1 
ATOM   4457 O  O     . ALA C 3 491 ? 4.139   26.530 41.336  1.00 14.17  ? 787  ALA A O     1 
ATOM   4458 C  CB    . ALA C 3 491 ? 5.271   23.516 41.386  1.00 12.69  ? 787  ALA A CB    1 
ATOM   4459 N  N     . GLU C 3 492 ? 4.658   25.948 43.445  1.00 13.13  ? 788  GLU A N     1 
ATOM   4460 C  CA    . GLU C 3 492 ? 3.686   26.861 44.035  1.00 14.23  ? 788  GLU A CA    1 
ATOM   4461 C  C     . GLU C 3 492 ? 4.138   28.302 43.797  1.00 14.85  ? 788  GLU A C     1 
ATOM   4462 O  O     . GLU C 3 492 ? 3.321   29.181 43.509  1.00 15.17  ? 788  GLU A O     1 
ATOM   4463 C  CB    . GLU C 3 492 ? 3.531   26.574 45.538  1.00 15.73  ? 788  GLU A CB    1 
ATOM   4464 C  CG    . GLU C 3 492 ? 2.784   25.265 45.822  1.00 15.82  ? 788  GLU A CG    1 
ATOM   4465 C  CD    . GLU C 3 492 ? 2.746   24.878 47.299  1.00 17.78  ? 788  GLU A CD    1 
ATOM   4466 O  OE1   . GLU C 3 492 ? 2.004   23.933 47.638  1.00 18.89  ? 788  GLU A OE1   1 
ATOM   4467 O  OE2   . GLU C 3 492 ? 3.450   25.500 48.122  1.00 17.06  ? 788  GLU A OE2   1 
ATOM   4468 N  N     . ARG C 3 493 ? 5.442   28.543 43.903  1.00 14.77  ? 789  ARG A N     1 
ATOM   4469 C  CA    . ARG C 3 493 ? 5.973   29.882 43.672  1.00 16.06  ? 789  ARG A CA    1 
ATOM   4470 C  C     . ARG C 3 493 ? 5.792   30.256 42.200  1.00 14.89  ? 789  ARG A C     1 
ATOM   4471 O  O     . ARG C 3 493 ? 5.479   31.399 41.881  1.00 15.87  ? 789  ARG A O     1 
ATOM   4472 C  CB    . ARG C 3 493 ? 7.447   29.952 44.099  1.00 18.91  ? 789  ARG A CB    1 
ATOM   4473 C  CG    . ARG C 3 493 ? 7.619   29.860 45.625  1.00 23.05  ? 789  ARG A CG    1 
ATOM   4474 C  CD    . ARG C 3 493 ? 8.999   30.302 46.091  1.00 24.38  ? 789  ARG A CD    1 
ATOM   4475 N  NE    . ARG C 3 493 ? 10.040  29.335 45.764  1.00 25.23  ? 789  ARG A NE    1 
ATOM   4476 C  CZ    . ARG C 3 493 ? 10.238  28.196 46.422  1.00 25.60  ? 789  ARG A CZ    1 
ATOM   4477 N  NH1   . ARG C 3 493 ? 9.468   27.870 47.454  1.00 26.02  ? 789  ARG A NH1   1 
ATOM   4478 N  NH2   . ARG C 3 493 ? 11.211  27.381 46.047  1.00 26.23  ? 789  ARG A NH2   1 
ATOM   4479 N  N     . MET C 3 494 ? 5.968   29.291 41.302  1.00 13.83  ? 790  MET A N     1 
ATOM   4480 C  CA    . MET C 3 494 ? 5.760   29.552 39.876  1.00 13.82  ? 790  MET A CA    1 
ATOM   4481 C  C     . MET C 3 494 ? 4.283   29.872 39.611  1.00 12.47  ? 790  MET A C     1 
ATOM   4482 O  O     . MET C 3 494 ? 3.957   30.695 38.752  1.00 11.36  ? 790  MET A O     1 
ATOM   4483 C  CB    . MET C 3 494 ? 6.166   28.336 39.038  1.00 15.06  ? 790  MET A CB    1 
ATOM   4484 C  CG    . MET C 3 494 ? 7.666   28.062 38.988  1.00 20.22  ? 790  MET A CG    1 
ATOM   4485 S  SD    . MET C 3 494 ? 8.001   26.572 38.009  1.00 28.25  ? 790  MET A SD    1 
ATOM   4486 C  CE    . MET C 3 494 ? 9.774   26.332 38.303  1.00 25.00  ? 790  MET A CE    1 
ATOM   4487 N  N     . ALA C 3 495 ? 3.388   29.211 40.344  1.00 12.26  ? 791  ALA A N     1 
ATOM   4488 C  CA    . ALA C 3 495 ? 1.951   29.444 40.182  1.00 12.46  ? 791  ALA A CA    1 
ATOM   4489 C  C     . ALA C 3 495 ? 1.635   30.881 40.573  1.00 12.19  ? 791  ALA A C     1 
ATOM   4490 O  O     . ALA C 3 495 ? 0.784   31.540 39.968  1.00 14.11  ? 791  ALA A O     1 
ATOM   4491 C  CB    . ALA C 3 495 ? 1.152   28.477 41.069  1.00 10.96  ? 791  ALA A CB    1 
ATOM   4492 N  N     . MET C 3 496 ? 2.333   31.354 41.596  1.00 12.29  ? 792  MET A N     1 
ATOM   4493 C  CA    . MET C 3 496 ? 2.153   32.703 42.104  1.00 14.54  ? 792  MET A CA    1 
ATOM   4494 C  C     . MET C 3 496 ? 2.820   33.764 41.229  1.00 13.82  ? 792  MET A C     1 
ATOM   4495 O  O     . MET C 3 496 ? 2.256   34.823 40.993  1.00 13.24  ? 792  MET A O     1 
ATOM   4496 C  CB    . MET C 3 496 ? 2.720   32.804 43.529  1.00 13.93  ? 792  MET A CB    1 
ATOM   4497 C  CG    . MET C 3 496 ? 2.028   31.908 44.557  1.00 18.16  ? 792  MET A CG    1 
ATOM   4498 S  SD    . MET C 3 496 ? 2.599   32.201 46.257  1.00 22.47  ? 792  MET A SD    1 
ATOM   4499 C  CE    . MET C 3 496 ? 3.931   31.012 46.385  1.00 21.28  ? 792  MET A CE    1 
ATOM   4500 N  N     . ASN C 3 497 ? 4.024   33.472 40.750  1.00 14.72  ? 793  ASN A N     1 
ATOM   4501 C  CA    . ASN C 3 497 ? 4.787   34.426 39.948  1.00 15.36  ? 793  ASN A CA    1 
ATOM   4502 C  C     . ASN C 3 497 ? 4.494   34.504 38.447  1.00 15.54  ? 793  ASN A C     1 
ATOM   4503 O  O     . ASN C 3 497 ? 4.547   35.585 37.864  1.00 14.61  ? 793  ASN A O     1 
ATOM   4504 C  CB    . ASN C 3 497 ? 6.286   34.173 40.176  1.00 15.21  ? 793  ASN A CB    1 
ATOM   4505 C  CG    . ASN C 3 497 ? 7.171   34.953 39.213  1.00 18.55  ? 793  ASN A CG    1 
ATOM   4506 O  OD1   . ASN C 3 497 ? 7.454   34.501 38.101  1.00 19.25  ? 793  ASN A OD1   1 
ATOM   4507 N  ND2   . ASN C 3 497 ? 7.597   36.136 39.632  1.00 19.38  ? 793  ASN A ND2   1 
ATOM   4508 N  N     . THR C 3 498 ? 4.172   33.379 37.817  1.00 15.38  ? 794  THR A N     1 
ATOM   4509 C  CA    . THR C 3 498 ? 3.924   33.376 36.374  1.00 13.85  ? 794  THR A CA    1 
ATOM   4510 C  C     . THR C 3 498 ? 2.807   34.289 35.864  1.00 15.11  ? 794  THR A C     1 
ATOM   4511 O  O     . THR C 3 498 ? 2.980   34.962 34.847  1.00 15.62  ? 794  THR A O     1 
ATOM   4512 C  CB    . THR C 3 498 ? 3.719   31.929 35.865  1.00 16.12  ? 794  THR A CB    1 
ATOM   4513 O  OG1   . THR C 3 498 ? 4.969   31.230 35.957  1.00 16.77  ? 794  THR A OG1   1 
ATOM   4514 C  CG2   . THR C 3 498 ? 3.247   31.912 34.406  1.00 14.34  ? 794  THR A CG2   1 
ATOM   4515 N  N     . PRO C 3 499 ? 1.648   34.327 36.547  1.00 14.56  ? 795  PRO A N     1 
ATOM   4516 C  CA    . PRO C 3 499 ? 0.552   35.196 36.099  1.00 15.97  ? 795  PRO A CA    1 
ATOM   4517 C  C     . PRO C 3 499 ? 0.913   36.686 36.206  1.00 17.87  ? 795  PRO A C     1 
ATOM   4518 O  O     . PRO C 3 499 ? 0.312   37.536 35.534  1.00 17.48  ? 795  PRO A O     1 
ATOM   4519 C  CB    . PRO C 3 499 ? -0.608  34.806 37.017  1.00 16.97  ? 795  PRO A CB    1 
ATOM   4520 C  CG    . PRO C 3 499 ? -0.319  33.376 37.342  1.00 15.67  ? 795  PRO A CG    1 
ATOM   4521 C  CD    . PRO C 3 499 ? 1.179   33.401 37.591  1.00 15.37  ? 795  PRO A CD    1 
ATOM   4522 N  N     . ILE C 3 500 ? 1.889   36.992 37.062  1.00 17.35  ? 796  ILE A N     1 
ATOM   4523 C  CA    . ILE C 3 500 ? 2.342   38.372 37.263  1.00 15.12  ? 796  ILE A CA    1 
ATOM   4524 C  C     . ILE C 3 500 ? 3.375   38.750 36.205  1.00 15.21  ? 796  ILE A C     1 
ATOM   4525 O  O     . ILE C 3 500 ? 3.162   39.684 35.424  1.00 14.26  ? 796  ILE A O     1 
ATOM   4526 C  CB    . ILE C 3 500 ? 2.970   38.553 38.676  1.00 15.96  ? 796  ILE A CB    1 
ATOM   4527 C  CG1   . ILE C 3 500 ? 1.907   38.286 39.750  1.00 15.55  ? 796  ILE A CG1   1 
ATOM   4528 C  CG2   . ILE C 3 500 ? 3.547   39.962 38.826  1.00 13.38  ? 796  ILE A CG2   1 
ATOM   4529 C  CD1   . ILE C 3 500 ? 2.432   38.286 41.176  1.00 18.04  ? 796  ILE A CD1   1 
ATOM   4530 N  N     . GLN C 3 501 ? 4.489   38.019 36.185  1.00 13.24  ? 797  GLN A N     1 
ATOM   4531 C  CA    . GLN C 3 501 ? 5.560   38.267 35.225  1.00 14.22  ? 797  GLN A CA    1 
ATOM   4532 C  C     . GLN C 3 501 ? 5.044   38.042 33.803  1.00 13.29  ? 797  GLN A C     1 
ATOM   4533 O  O     . GLN C 3 501 ? 5.391   38.777 32.875  1.00 12.29  ? 797  GLN A O     1 
ATOM   4534 C  CB    . GLN C 3 501 ? 6.759   37.334 35.504  1.00 15.05  ? 797  GLN A CB    1 
ATOM   4535 C  CG    . GLN C 3 501 ? 8.000   37.645 34.646  1.00 18.74  ? 797  GLN A CG    1 
ATOM   4536 C  CD    . GLN C 3 501 ? 9.162   36.664 34.853  1.00 20.96  ? 797  GLN A CD    1 
ATOM   4537 O  OE1   . GLN C 3 501 ? 9.617   36.019 33.905  1.00 22.26  ? 797  GLN A OE1   1 
ATOM   4538 N  NE2   . GLN C 3 501 ? 9.646   36.556 36.092  1.00 20.71  ? 797  GLN A NE2   1 
ATOM   4539 N  N     . GLY C 3 502 ? 4.203   37.023 33.647  1.00 13.16  ? 798  GLY A N     1 
ATOM   4540 C  CA    . GLY C 3 502 ? 3.643   36.706 32.348  1.00 12.30  ? 798  GLY A CA    1 
ATOM   4541 C  C     . GLY C 3 502 ? 2.674   37.752 31.826  1.00 11.88  ? 798  GLY A C     1 
ATOM   4542 O  O     . GLY C 3 502 ? 2.693   38.079 30.640  1.00 12.31  ? 798  GLY A O     1 
ATOM   4543 N  N     . SER C 3 503 ? 1.819   38.281 32.695  1.00 10.48  ? 799  SER A N     1 
ATOM   4544 C  CA    . SER C 3 503 ? 0.875   39.301 32.263  1.00 9.46   ? 799  SER A CA    1 
ATOM   4545 C  C     . SER C 3 503 ? 1.637   40.584 31.924  1.00 10.04  ? 799  SER A C     1 
ATOM   4546 O  O     . SER C 3 503 ? 1.259   41.312 31.012  1.00 8.13   ? 799  SER A O     1 
ATOM   4547 C  CB    . SER C 3 503 ? -0.176  39.556 33.350  1.00 10.63  ? 799  SER A CB    1 
ATOM   4548 O  OG    . SER C 3 503 ? -1.119  38.488 33.399  1.00 10.59  ? 799  SER A OG    1 
ATOM   4549 N  N     . ALA C 3 504 ? 2.724   40.855 32.648  1.00 10.39  ? 800  ALA A N     1 
ATOM   4550 C  CA    . ALA C 3 504 ? 3.523   42.041 32.368  1.00 10.35  ? 800  ALA A CA    1 
ATOM   4551 C  C     . ALA C 3 504 ? 4.169   41.875 30.989  1.00 9.68   ? 800  ALA A C     1 
ATOM   4552 O  O     . ALA C 3 504 ? 4.358   42.849 30.263  1.00 11.13  ? 800  ALA A O     1 
ATOM   4553 C  CB    . ALA C 3 504 ? 4.611   42.234 33.440  1.00 8.81   ? 800  ALA A CB    1 
ATOM   4554 N  N     . ALA C 3 505 ? 4.510   40.640 30.631  1.00 8.78   ? 801  ALA A N     1 
ATOM   4555 C  CA    . ALA C 3 505 ? 5.123   40.390 29.331  1.00 8.37   ? 801  ALA A CA    1 
ATOM   4556 C  C     . ALA C 3 505 ? 4.079   40.616 28.237  1.00 9.54   ? 801  ALA A C     1 
ATOM   4557 O  O     . ALA C 3 505 ? 4.373   41.234 27.207  1.00 9.40   ? 801  ALA A O     1 
ATOM   4558 C  CB    . ALA C 3 505 ? 5.661   38.960 29.264  1.00 9.47   ? 801  ALA A CB    1 
ATOM   4559 N  N     . ASP C 3 506 ? 2.863   40.116 28.470  1.00 8.77   ? 802  ASP A N     1 
ATOM   4560 C  CA    . ASP C 3 506 ? 1.757   40.263 27.522  1.00 9.94   ? 802  ASP A CA    1 
ATOM   4561 C  C     . ASP C 3 506 ? 1.548   41.733 27.190  1.00 9.72   ? 802  ASP A C     1 
ATOM   4562 O  O     . ASP C 3 506 ? 1.417   42.111 26.024  1.00 12.38  ? 802  ASP A O     1 
ATOM   4563 C  CB    . ASP C 3 506 ? 0.445   39.719 28.116  1.00 9.63   ? 802  ASP A CB    1 
ATOM   4564 C  CG    . ASP C 3 506 ? 0.425   38.207 28.236  1.00 11.83  ? 802  ASP A CG    1 
ATOM   4565 O  OD1   . ASP C 3 506 ? -0.482  37.690 28.926  1.00 11.71  ? 802  ASP A OD1   1 
ATOM   4566 O  OD2   . ASP C 3 506 ? 1.295   37.533 27.645  1.00 11.43  ? 802  ASP A OD2   1 
ATOM   4567 N  N     . ILE C 3 507 ? 1.514   42.553 28.235  1.00 9.77   ? 803  ILE A N     1 
ATOM   4568 C  CA    . ILE C 3 507 ? 1.293   43.983 28.108  1.00 10.53  ? 803  ILE A CA    1 
ATOM   4569 C  C     . ILE C 3 507 ? 2.333   44.728 27.278  1.00 10.66  ? 803  ILE A C     1 
ATOM   4570 O  O     . ILE C 3 507 ? 1.976   45.483 26.367  1.00 9.81   ? 803  ILE A O     1 
ATOM   4571 C  CB    . ILE C 3 507 ? 1.196   44.652 29.513  1.00 12.13  ? 803  ILE A CB    1 
ATOM   4572 C  CG1   . ILE C 3 507 ? -0.028  44.115 30.263  1.00 12.80  ? 803  ILE A CG1   1 
ATOM   4573 C  CG2   . ILE C 3 507 ? 1.081   46.177 29.370  1.00 12.10  ? 803  ILE A CG2   1 
ATOM   4574 C  CD1   . ILE C 3 507 ? -0.126  44.588 31.709  1.00 13.91  ? 803  ILE A CD1   1 
ATOM   4575 N  N     . ILE C 3 508 ? 3.614   44.533 27.577  1.00 9.27   ? 804  ILE A N     1 
ATOM   4576 C  CA    . ILE C 3 508 ? 4.632   45.247 26.820  1.00 10.92  ? 804  ILE A CA    1 
ATOM   4577 C  C     . ILE C 3 508 ? 4.710   44.761 25.372  1.00 10.05  ? 804  ILE A C     1 
ATOM   4578 O  O     . ILE C 3 508 ? 5.089   45.526 24.485  1.00 13.19  ? 804  ILE A O     1 
ATOM   4579 C  CB    . ILE C 3 508 ? 6.034   45.184 27.525  1.00 10.98  ? 804  ILE A CB    1 
ATOM   4580 C  CG1   . ILE C 3 508 ? 7.018   46.113 26.804  1.00 13.42  ? 804  ILE A CG1   1 
ATOM   4581 C  CG2   . ILE C 3 508 ? 6.581   43.767 27.533  1.00 11.09  ? 804  ILE A CG2   1 
ATOM   4582 C  CD1   . ILE C 3 508 ? 8.242   46.484 27.643  1.00 11.51  ? 804  ILE A CD1   1 
ATOM   4583 N  N     . LYS C 3 509 ? 4.346   43.506 25.120  1.00 10.79  ? 805  LYS A N     1 
ATOM   4584 C  CA    . LYS C 3 509 ? 4.355   42.993 23.745  1.00 9.47   ? 805  LYS A CA    1 
ATOM   4585 C  C     . LYS C 3 509 ? 3.230   43.665 22.942  1.00 8.52   ? 805  LYS A C     1 
ATOM   4586 O  O     . LYS C 3 509 ? 3.418   44.032 21.785  1.00 8.51   ? 805  LYS A O     1 
ATOM   4587 C  CB    . LYS C 3 509 ? 4.159   41.469 23.715  1.00 10.41  ? 805  LYS A CB    1 
ATOM   4588 C  CG    . LYS C 3 509 ? 5.389   40.643 24.067  1.00 7.51   ? 805  LYS A CG    1 
ATOM   4589 C  CD    . LYS C 3 509 ? 5.061   39.141 24.073  1.00 10.33  ? 805  LYS A CD    1 
ATOM   4590 C  CE    . LYS C 3 509 ? 6.325   38.275 24.101  1.00 9.12   ? 805  LYS A CE    1 
ATOM   4591 N  NZ    . LYS C 3 509 ? 5.986   36.816 24.232  1.00 11.99  ? 805  LYS A NZ    1 
ATOM   4592 N  N     . LYS C 3 510 ? 2.059   43.823 23.551  1.00 10.66  ? 806  LYS A N     1 
ATOM   4593 C  CA    . LYS C 3 510 ? 0.950   44.476 22.860  1.00 10.77  ? 806  LYS A CA    1 
ATOM   4594 C  C     . LYS C 3 510 ? 1.312   45.940 22.660  1.00 10.72  ? 806  LYS A C     1 
ATOM   4595 O  O     . LYS C 3 510 ? 0.975   46.538 21.641  1.00 10.76  ? 806  LYS A O     1 
ATOM   4596 C  CB    . LYS C 3 510 ? -0.359  44.365 23.660  1.00 11.39  ? 806  LYS A CB    1 
ATOM   4597 C  CG    . LYS C 3 510 ? -1.564  45.018 22.941  1.00 13.56  ? 806  LYS A CG    1 
ATOM   4598 C  CD    . LYS C 3 510 ? -2.875  44.801 23.694  1.00 15.49  ? 806  LYS A CD    1 
ATOM   4599 C  CE    . LYS C 3 510 ? -4.056  45.470 22.976  1.00 17.83  ? 806  LYS A CE    1 
ATOM   4600 N  NZ    . LYS C 3 510 ? -3.962  46.972 22.982  1.00 12.94  ? 806  LYS A NZ    1 
ATOM   4601 N  N     . ALA C 3 511 ? 2.012   46.516 23.631  1.00 11.46  ? 807  ALA A N     1 
ATOM   4602 C  CA    . ALA C 3 511 ? 2.429   47.913 23.521  1.00 11.11  ? 807  ALA A CA    1 
ATOM   4603 C  C     . ALA C 3 511 ? 3.351   48.092 22.315  1.00 11.18  ? 807  ALA A C     1 
ATOM   4604 O  O     . ALA C 3 511 ? 3.251   49.085 21.593  1.00 12.37  ? 807  ALA A O     1 
ATOM   4605 C  CB    . ALA C 3 511 ? 3.150   48.364 24.804  1.00 11.41  ? 807  ALA A CB    1 
ATOM   4606 N  N     . MET C 3 512 ? 4.254   47.137 22.096  1.00 11.07  ? 808  MET A N     1 
ATOM   4607 C  CA    . MET C 3 512 ? 5.171   47.239 20.960  1.00 10.85  ? 808  MET A CA    1 
ATOM   4608 C  C     . MET C 3 512 ? 4.368   47.250 19.662  1.00 10.65  ? 808  MET A C     1 
ATOM   4609 O  O     . MET C 3 512 ? 4.633   48.048 18.767  1.00 9.07   ? 808  MET A O     1 
ATOM   4610 C  CB    . MET C 3 512 ? 6.166   46.078 20.969  1.00 10.20  ? 808  MET A CB    1 
ATOM   4611 C  CG    . MET C 3 512 ? 7.174   46.166 22.108  1.00 10.90  ? 808  MET A CG    1 
ATOM   4612 S  SD    . MET C 3 512 ? 8.166   44.682 22.302  1.00 13.66  ? 808  MET A SD    1 
ATOM   4613 C  CE    . MET C 3 512 ? 9.290   44.862 20.921  1.00 7.37   ? 808  MET A CE    1 
ATOM   4614 N  N     . ILE C 3 513 ? 3.374   46.373 19.568  1.00 10.75  ? 809  ILE A N     1 
ATOM   4615 C  CA    . ILE C 3 513 ? 2.533   46.323 18.377  1.00 11.02  ? 809  ILE A CA    1 
ATOM   4616 C  C     . ILE C 3 513 ? 1.783   47.645 18.206  1.00 11.78  ? 809  ILE A C     1 
ATOM   4617 O  O     . ILE C 3 513 ? 1.823   48.248 17.130  1.00 10.80  ? 809  ILE A O     1 
ATOM   4618 C  CB    . ILE C 3 513 ? 1.518   45.166 18.453  1.00 11.59  ? 809  ILE A CB    1 
ATOM   4619 C  CG1   . ILE C 3 513 ? 2.260   43.829 18.405  1.00 11.94  ? 809  ILE A CG1   1 
ATOM   4620 C  CG2   . ILE C 3 513 ? 0.528   45.254 17.285  1.00 14.47  ? 809  ILE A CG2   1 
ATOM   4621 C  CD1   . ILE C 3 513 ? 1.403   42.638 18.814  1.00 12.94  ? 809  ILE A CD1   1 
ATOM   4622 N  N     . ASP C 3 514 ? 1.114   48.105 19.262  1.00 11.63  ? 810  ASP A N     1 
ATOM   4623 C  CA    . ASP C 3 514 ? 0.374   49.360 19.178  1.00 12.59  ? 810  ASP A CA    1 
ATOM   4624 C  C     . ASP C 3 514 ? 1.284   50.526 18.812  1.00 13.58  ? 810  ASP A C     1 
ATOM   4625 O  O     . ASP C 3 514 ? 0.917   51.374 17.997  1.00 15.19  ? 810  ASP A O     1 
ATOM   4626 C  CB    . ASP C 3 514 ? -0.333  49.686 20.499  1.00 13.11  ? 810  ASP A CB    1 
ATOM   4627 C  CG    . ASP C 3 514 ? -1.429  48.697 20.843  1.00 14.61  ? 810  ASP A CG    1 
ATOM   4628 O  OD1   . ASP C 3 514 ? -1.953  48.021 19.937  1.00 15.90  ? 810  ASP A OD1   1 
ATOM   4629 O  OD2   . ASP C 3 514 ? -1.775  48.600 22.033  1.00 16.19  ? 810  ASP A OD2   1 
ATOM   4630 N  N     . LEU C 3 515 ? 2.469   50.570 19.413  1.00 12.91  ? 811  LEU A N     1 
ATOM   4631 C  CA    . LEU C 3 515 ? 3.420   51.646 19.139  1.00 13.44  ? 811  LEU A CA    1 
ATOM   4632 C  C     . LEU C 3 515 ? 3.835   51.710 17.667  1.00 13.71  ? 811  LEU A C     1 
ATOM   4633 O  O     . LEU C 3 515 ? 3.865   52.791 17.070  1.00 13.42  ? 811  LEU A O     1 
ATOM   4634 C  CB    . LEU C 3 515 ? 4.665   51.489 20.015  1.00 13.96  ? 811  LEU A CB    1 
ATOM   4635 C  CG    . LEU C 3 515 ? 5.812   52.482 19.784  1.00 15.73  ? 811  LEU A CG    1 
ATOM   4636 C  CD1   . LEU C 3 515 ? 5.342   53.909 20.066  1.00 12.50  ? 811  LEU A CD1   1 
ATOM   4637 C  CD2   . LEU C 3 515 ? 6.979   52.116 20.693  1.00 15.43  ? 811  LEU A CD2   1 
ATOM   4638 N  N     . ASN C 3 516 ? 4.152   50.562 17.078  1.00 13.31  ? 812  ASN A N     1 
ATOM   4639 C  CA    . ASN C 3 516 ? 4.558   50.543 15.679  1.00 14.65  ? 812  ASN A CA    1 
ATOM   4640 C  C     . ASN C 3 516 ? 3.437   50.961 14.737  1.00 15.12  ? 812  ASN A C     1 
ATOM   4641 O  O     . ASN C 3 516 ? 3.696   51.550 13.684  1.00 12.76  ? 812  ASN A O     1 
ATOM   4642 C  CB    . ASN C 3 516 ? 5.104   49.168 15.297  1.00 16.04  ? 812  ASN A CB    1 
ATOM   4643 C  CG    . ASN C 3 516 ? 6.620   49.113 15.384  1.00 22.39  ? 812  ASN A CG    1 
ATOM   4644 O  OD1   . ASN C 3 516 ? 7.215   49.584 16.356  1.00 24.65  ? 812  ASN A OD1   1 
ATOM   4645 N  ND2   . ASN C 3 516 ? 7.251   48.541 14.370  1.00 22.53  ? 812  ASN A ND2   1 
ATOM   4646 N  N     . ALA C 3 517 ? 2.194   50.665 15.109  1.00 13.35  ? 813  ALA A N     1 
ATOM   4647 C  CA    . ALA C 3 517 ? 1.074   51.069 14.276  1.00 13.46  ? 813  ALA A CA    1 
ATOM   4648 C  C     . ALA C 3 517 ? 0.981   52.598 14.345  1.00 14.53  ? 813  ALA A C     1 
ATOM   4649 O  O     . ALA C 3 517 ? 0.749   53.258 13.334  1.00 15.49  ? 813  ALA A O     1 
ATOM   4650 C  CB    . ALA C 3 517 ? -0.229  50.423 14.773  1.00 15.36  ? 813  ALA A CB    1 
ATOM   4651 N  N     . ARG C 3 518 ? 1.187   53.156 15.536  1.00 13.83  ? 814  ARG A N     1 
ATOM   4652 C  CA    . ARG C 3 518 ? 1.138   54.602 15.727  1.00 14.73  ? 814  ARG A CA    1 
ATOM   4653 C  C     . ARG C 3 518 ? 2.269   55.335 14.997  1.00 13.73  ? 814  ARG A C     1 
ATOM   4654 O  O     . ARG C 3 518 ? 2.045   56.378 14.388  1.00 12.52  ? 814  ARG A O     1 
ATOM   4655 C  CB    . ARG C 3 518 ? 1.196   54.939 17.222  1.00 18.23  ? 814  ARG A CB    1 
ATOM   4656 C  CG    . ARG C 3 518 ? -0.045  54.539 18.003  1.00 23.54  ? 814  ARG A CG    1 
ATOM   4657 C  CD    . ARG C 3 518 ? -1.251  55.379 17.595  1.00 27.91  ? 814  ARG A CD    1 
ATOM   4658 N  NE    . ARG C 3 518 ? -1.120  56.760 18.055  1.00 29.64  ? 814  ARG A NE    1 
ATOM   4659 C  CZ    . ARG C 3 518 ? -1.160  57.822 17.259  1.00 30.83  ? 814  ARG A CZ    1 
ATOM   4660 N  NH1   . ARG C 3 518 ? -1.333  57.670 15.952  1.00 30.37  ? 814  ARG A NH1   1 
ATOM   4661 N  NH2   . ARG C 3 518 ? -1.020  59.037 17.772  1.00 31.12  ? 814  ARG A NH2   1 
ATOM   4662 N  N     . LEU C 3 519 ? 3.482   54.794 15.066  1.00 13.10  ? 815  LEU A N     1 
ATOM   4663 C  CA    . LEU C 3 519 ? 4.626   55.417 14.405  1.00 13.37  ? 815  LEU A CA    1 
ATOM   4664 C  C     . LEU C 3 519 ? 4.399   55.483 12.898  1.00 14.83  ? 815  LEU A C     1 
ATOM   4665 O  O     . LEU C 3 519 ? 4.783   56.455 12.253  1.00 14.32  ? 815  LEU A O     1 
ATOM   4666 C  CB    . LEU C 3 519 ? 5.914   54.646 14.713  1.00 10.91  ? 815  LEU A CB    1 
ATOM   4667 C  CG    . LEU C 3 519 ? 6.388   54.694 16.173  1.00 9.40   ? 815  LEU A CG    1 
ATOM   4668 C  CD1   . LEU C 3 519 ? 7.595   53.790 16.362  1.00 7.97   ? 815  LEU A CD1   1 
ATOM   4669 C  CD2   . LEU C 3 519 ? 6.727   56.128 16.548  1.00 8.52   ? 815  LEU A CD2   1 
ATOM   4670 N  N     . LYS C 3 520 ? 3.756   54.456 12.351  1.00 14.72  ? 816  LYS A N     1 
ATOM   4671 C  CA    . LYS C 3 520 ? 3.467   54.394 10.919  1.00 18.03  ? 816  LYS A CA    1 
ATOM   4672 C  C     . LYS C 3 520 ? 2.368   55.390 10.512  1.00 18.38  ? 816  LYS A C     1 
ATOM   4673 O  O     . LYS C 3 520 ? 2.480   56.066 9.487   1.00 16.94  ? 816  LYS A O     1 
ATOM   4674 C  CB    . LYS C 3 520 ? 3.056   52.967 10.538  1.00 19.42  ? 816  LYS A CB    1 
ATOM   4675 C  CG    . LYS C 3 520 ? 2.779   52.755 9.055   1.00 25.03  ? 816  LYS A CG    1 
ATOM   4676 C  CD    . LYS C 3 520 ? 2.464   51.286 8.771   1.00 29.14  ? 816  LYS A CD    1 
ATOM   4677 C  CE    . LYS C 3 520 ? 2.172   51.043 7.297   1.00 31.77  ? 816  LYS A CE    1 
ATOM   4678 N  NZ    . LYS C 3 520 ? 1.838   49.614 7.044   1.00 33.81  ? 816  LYS A NZ    1 
ATOM   4679 N  N     . GLU C 3 521 ? 1.311   55.485 11.313  1.00 17.75  ? 817  GLU A N     1 
ATOM   4680 C  CA    . GLU C 3 521 ? 0.233   56.417 11.009  1.00 20.23  ? 817  GLU A CA    1 
ATOM   4681 C  C     . GLU C 3 521 ? 0.771   57.846 11.032  1.00 20.28  ? 817  GLU A C     1 
ATOM   4682 O  O     . GLU C 3 521 ? 0.349   58.686 10.239  1.00 19.38  ? 817  GLU A O     1 
ATOM   4683 C  CB    . GLU C 3 521 ? -0.904  56.294 12.031  1.00 21.84  ? 817  GLU A CB    1 
ATOM   4684 C  CG    . GLU C 3 521 ? -1.461  54.897 12.193  1.00 25.19  ? 817  GLU A CG    1 
ATOM   4685 C  CD    . GLU C 3 521 ? -2.592  54.830 13.209  1.00 28.08  ? 817  GLU A CD    1 
ATOM   4686 O  OE1   . GLU C 3 521 ? -2.524  55.538 14.239  1.00 26.09  ? 817  GLU A OE1   1 
ATOM   4687 O  OE2   . GLU C 3 521 ? -3.551  54.060 12.980  1.00 31.09  ? 817  GLU A OE2   1 
ATOM   4688 N  N     . GLU C 3 522 ? 1.705   58.117 11.943  1.00 18.84  ? 818  GLU A N     1 
ATOM   4689 C  CA    . GLU C 3 522 ? 2.287   59.454 12.065  1.00 19.84  ? 818  GLU A CA    1 
ATOM   4690 C  C     . GLU C 3 522 ? 3.474   59.648 11.127  1.00 19.71  ? 818  GLU A C     1 
ATOM   4691 O  O     . GLU C 3 522 ? 4.020   60.744 11.036  1.00 19.43  ? 818  GLU A O     1 
ATOM   4692 C  CB    . GLU C 3 522 ? 2.743   59.701 13.507  1.00 19.85  ? 818  GLU A CB    1 
ATOM   4693 C  CG    . GLU C 3 522 ? 1.641   59.528 14.530  1.00 22.84  ? 818  GLU A CG    1 
ATOM   4694 C  CD    . GLU C 3 522 ? 0.533   60.548 14.360  1.00 26.01  ? 818  GLU A CD    1 
ATOM   4695 O  OE1   . GLU C 3 522 ? -0.640  60.203 14.614  1.00 27.59  ? 818  GLU A OE1   1 
ATOM   4696 O  OE2   . GLU C 3 522 ? 0.836   61.699 13.983  1.00 27.17  ? 818  GLU A OE2   1 
ATOM   4697 N  N     . ARG C 3 523 ? 3.852   58.581 10.427  1.00 18.44  ? 819  ARG A N     1 
ATOM   4698 C  CA    . ARG C 3 523 ? 4.992   58.595 9.516   1.00 19.37  ? 819  ARG A CA    1 
ATOM   4699 C  C     . ARG C 3 523 ? 6.261   59.124 10.188  1.00 19.52  ? 819  ARG A C     1 
ATOM   4700 O  O     . ARG C 3 523 ? 7.017   59.892 9.598   1.00 18.19  ? 819  ARG A O     1 
ATOM   4701 C  CB    . ARG C 3 523 ? 4.689   59.420 8.255   1.00 21.58  ? 819  ARG A CB    1 
ATOM   4702 C  CG    . ARG C 3 523 ? 3.744   58.738 7.255   1.00 20.60  ? 819  ARG A CG    1 
ATOM   4703 C  CD    . ARG C 3 523 ? 2.299   59.068 7.551   1.00 19.51  ? 819  ARG A CD    1 
ATOM   4704 N  NE    . ARG C 3 523 ? 1.401   58.707 6.453   1.00 18.78  ? 819  ARG A NE    1 
ATOM   4705 C  CZ    . ARG C 3 523 ? 0.815   57.521 6.294   1.00 17.77  ? 819  ARG A CZ    1 
ATOM   4706 N  NH1   . ARG C 3 523 ? 1.019   56.538 7.163   1.00 15.98  ? 819  ARG A NH1   1 
ATOM   4707 N  NH2   . ARG C 3 523 ? -0.003  57.328 5.263   1.00 18.58  ? 819  ARG A NH2   1 
ATOM   4708 N  N     . LEU C 3 524 ? 6.486   58.709 11.431  1.00 17.98  ? 820  LEU A N     1 
ATOM   4709 C  CA    . LEU C 3 524 ? 7.682   59.116 12.155  1.00 18.09  ? 820  LEU A CA    1 
ATOM   4710 C  C     . LEU C 3 524 ? 8.824   58.212 11.701  1.00 18.42  ? 820  LEU A C     1 
ATOM   4711 O  O     . LEU C 3 524 ? 8.588   57.067 11.323  1.00 19.50  ? 820  LEU A O     1 
ATOM   4712 C  CB    . LEU C 3 524 ? 7.472   58.957 13.665  1.00 16.23  ? 820  LEU A CB    1 
ATOM   4713 C  CG    . LEU C 3 524 ? 6.576   59.998 14.338  1.00 18.77  ? 820  LEU A CG    1 
ATOM   4714 C  CD1   . LEU C 3 524 ? 6.213   59.547 15.746  1.00 18.22  ? 820  LEU A CD1   1 
ATOM   4715 C  CD2   . LEU C 3 524 ? 7.305   61.342 14.362  1.00 17.41  ? 820  LEU A CD2   1 
ATOM   4716 N  N     . GLN C 3 525 ? 10.051  58.724 11.732  1.00 17.46  ? 821  GLN A N     1 
ATOM   4717 C  CA    . GLN C 3 525 ? 11.212  57.930 11.348  1.00 18.81  ? 821  GLN A CA    1 
ATOM   4718 C  C     . GLN C 3 525 ? 11.680  57.091 12.537  1.00 18.20  ? 821  GLN A C     1 
ATOM   4719 O  O     . GLN C 3 525 ? 12.406  56.108 12.376  1.00 16.58  ? 821  GLN A O     1 
ATOM   4720 C  CB    . GLN C 3 525 ? 12.352  58.838 10.878  1.00 19.91  ? 821  GLN A CB    1 
ATOM   4721 C  CG    . GLN C 3 525 ? 12.127  59.438 9.492   1.00 22.66  ? 821  GLN A CG    1 
ATOM   4722 C  CD    . GLN C 3 525 ? 13.285  60.301 9.033   1.00 24.88  ? 821  GLN A CD    1 
ATOM   4723 O  OE1   . GLN C 3 525 ? 13.365  61.484 9.369   1.00 28.68  ? 821  GLN A OE1   1 
ATOM   4724 N  NE2   . GLN C 3 525 ? 14.197  59.710 8.273   1.00 22.85  ? 821  GLN A NE2   1 
ATOM   4725 N  N     . ALA C 3 526 ? 11.254  57.486 13.730  1.00 16.79  ? 822  ALA A N     1 
ATOM   4726 C  CA    . ALA C 3 526 ? 11.620  56.776 14.950  1.00 16.85  ? 822  ALA A CA    1 
ATOM   4727 C  C     . ALA C 3 526 ? 11.309  55.298 14.816  1.00 15.10  ? 822  ALA A C     1 
ATOM   4728 O  O     . ALA C 3 526 ? 10.321  54.916 14.187  1.00 16.69  ? 822  ALA A O     1 
ATOM   4729 C  CB    . ALA C 3 526 ? 10.854  57.356 16.144  1.00 15.69  ? 822  ALA A CB    1 
ATOM   4730 N  N     . HIS C 3 527 ? 12.154  54.461 15.403  1.00 14.45  ? 823  HIS A N     1 
ATOM   4731 C  CA    . HIS C 3 527 ? 11.917  53.027 15.360  1.00 14.96  ? 823  HIS A CA    1 
ATOM   4732 C  C     . HIS C 3 527 ? 12.464  52.332 16.591  1.00 14.76  ? 823  HIS A C     1 
ATOM   4733 O  O     . HIS C 3 527 ? 13.418  52.802 17.217  1.00 13.36  ? 823  HIS A O     1 
ATOM   4734 C  CB    . HIS C 3 527 ? 12.508  52.400 14.082  1.00 17.50  ? 823  HIS A CB    1 
ATOM   4735 C  CG    . HIS C 3 527 ? 13.979  52.627 13.903  1.00 19.86  ? 823  HIS A CG    1 
ATOM   4736 N  ND1   . HIS C 3 527 ? 14.505  53.226 12.778  1.00 22.26  ? 823  HIS A ND1   1 
ATOM   4737 C  CD2   . HIS C 3 527 ? 15.035  52.327 14.696  1.00 20.73  ? 823  HIS A CD2   1 
ATOM   4738 C  CE1   . HIS C 3 527 ? 15.821  53.284 12.886  1.00 23.58  ? 823  HIS A CE1   1 
ATOM   4739 N  NE2   . HIS C 3 527 ? 16.168  52.745 14.041  1.00 20.56  ? 823  HIS A NE2   1 
ATOM   4740 N  N     . LEU C 3 528 ? 11.839  51.213 16.937  1.00 13.12  ? 824  LEU A N     1 
ATOM   4741 C  CA    . LEU C 3 528 ? 12.256  50.419 18.078  1.00 13.54  ? 824  LEU A CA    1 
ATOM   4742 C  C     . LEU C 3 528 ? 13.625  49.818 17.835  1.00 14.26  ? 824  LEU A C     1 
ATOM   4743 O  O     . LEU C 3 528 ? 13.946  49.449 16.710  1.00 13.29  ? 824  LEU A O     1 
ATOM   4744 C  CB    . LEU C 3 528 ? 11.268  49.287 18.319  1.00 12.35  ? 824  LEU A CB    1 
ATOM   4745 C  CG    . LEU C 3 528 ? 9.966   49.610 19.046  1.00 13.73  ? 824  LEU A CG    1 
ATOM   4746 C  CD1   . LEU C 3 528 ? 8.970   48.475 18.842  1.00 13.31  ? 824  LEU A CD1   1 
ATOM   4747 C  CD2   . LEU C 3 528 ? 10.268  49.829 20.527  1.00 11.55  ? 824  LEU A CD2   1 
ATOM   4748 N  N     . LEU C 3 529 ? 14.425  49.721 18.895  1.00 14.57  ? 825  LEU A N     1 
ATOM   4749 C  CA    . LEU C 3 529 ? 15.750  49.113 18.807  1.00 14.51  ? 825  LEU A CA    1 
ATOM   4750 C  C     . LEU C 3 529 ? 15.842  47.922 19.768  1.00 14.98  ? 825  LEU A C     1 
ATOM   4751 O  O     . LEU C 3 529 ? 16.315  46.847 19.398  1.00 14.79  ? 825  LEU A O     1 
ATOM   4752 C  CB    . LEU C 3 529 ? 16.850  50.118 19.157  1.00 14.14  ? 825  LEU A CB    1 
ATOM   4753 C  CG    . LEU C 3 529 ? 17.157  51.251 18.175  1.00 13.26  ? 825  LEU A CG    1 
ATOM   4754 C  CD1   . LEU C 3 529 ? 18.343  52.047 18.706  1.00 12.61  ? 825  LEU A CD1   1 
ATOM   4755 C  CD2   . LEU C 3 529 ? 17.469  50.696 16.789  1.00 12.75  ? 825  LEU A CD2   1 
ATOM   4756 N  N     . LEU C 3 530 ? 15.382  48.114 20.999  1.00 14.33  ? 826  LEU A N     1 
ATOM   4757 C  CA    . LEU C 3 530 ? 15.448  47.049 21.984  1.00 13.66  ? 826  LEU A CA    1 
ATOM   4758 C  C     . LEU C 3 530 ? 14.262  47.011 22.930  1.00 13.31  ? 826  LEU A C     1 
ATOM   4759 O  O     . LEU C 3 530 ? 13.502  47.969 23.048  1.00 11.85  ? 826  LEU A O     1 
ATOM   4760 C  CB    . LEU C 3 530 ? 16.714  47.191 22.832  1.00 14.45  ? 826  LEU A CB    1 
ATOM   4761 C  CG    . LEU C 3 530 ? 18.077  47.252 22.135  1.00 15.77  ? 826  LEU A CG    1 
ATOM   4762 C  CD1   . LEU C 3 530 ? 19.144  47.643 23.148  1.00 17.49  ? 826  LEU A CD1   1 
ATOM   4763 C  CD2   . LEU C 3 530 ? 18.393  45.906 21.503  1.00 16.41  ? 826  LEU A CD2   1 
ATOM   4764 N  N     . GLN C 3 531 ? 14.129  45.877 23.605  1.00 12.86  ? 827  GLN A N     1 
ATOM   4765 C  CA    . GLN C 3 531 ? 13.104  45.687 24.613  1.00 13.17  ? 827  GLN A CA    1 
ATOM   4766 C  C     . GLN C 3 531 ? 13.826  44.987 25.763  1.00 13.27  ? 827  GLN A C     1 
ATOM   4767 O  O     . GLN C 3 531 ? 14.497  43.972 25.551  1.00 13.05  ? 827  GLN A O     1 
ATOM   4768 C  CB    . GLN C 3 531 ? 11.958  44.817 24.096  1.00 11.51  ? 827  GLN A CB    1 
ATOM   4769 C  CG    . GLN C 3 531 ? 10.802  44.679 25.095  1.00 13.97  ? 827  GLN A CG    1 
ATOM   4770 C  CD    . GLN C 3 531 ? 10.743  43.310 25.743  1.00 16.70  ? 827  GLN A CD    1 
ATOM   4771 O  OE1   . GLN C 3 531 ? 11.737  42.816 26.279  1.00 17.37  ? 827  GLN A OE1   1 
ATOM   4772 N  NE2   . GLN C 3 531 ? 9.570   42.686 25.697  1.00 18.32  ? 827  GLN A NE2   1 
ATOM   4773 N  N     . VAL C 3 532 ? 13.709  45.538 26.968  1.00 13.93  ? 828  VAL A N     1 
ATOM   4774 C  CA    . VAL C 3 532 ? 14.346  44.934 28.133  1.00 16.52  ? 828  VAL A CA    1 
ATOM   4775 C  C     . VAL C 3 532 ? 13.331  44.636 29.237  1.00 17.65  ? 828  VAL A C     1 
ATOM   4776 O  O     . VAL C 3 532 ? 13.368  45.224 30.312  1.00 20.04  ? 828  VAL A O     1 
ATOM   4777 C  CB    . VAL C 3 532 ? 15.484  45.828 28.703  1.00 18.76  ? 828  VAL A CB    1 
ATOM   4778 C  CG1   . VAL C 3 532 ? 16.272  45.052 29.764  1.00 17.28  ? 828  VAL A CG1   1 
ATOM   4779 C  CG2   . VAL C 3 532 ? 16.427  46.258 27.586  1.00 15.76  ? 828  VAL A CG2   1 
ATOM   4780 N  N     . HIS C 3 533 ? 12.420  43.714 28.933  1.00 19.23  ? 829  HIS A N     1 
ATOM   4781 C  CA    . HIS C 3 533 ? 11.376  43.243 29.847  1.00 19.27  ? 829  HIS A CA    1 
ATOM   4782 C  C     . HIS C 3 533 ? 10.258  44.216 30.225  1.00 18.47  ? 829  HIS A C     1 
ATOM   4783 O  O     . HIS C 3 533 ? 9.076   43.906 30.017  1.00 17.39  ? 829  HIS A O     1 
ATOM   4784 C  CB    . HIS C 3 533 ? 12.033  42.656 31.101  1.00 19.26  ? 829  HIS A CB    1 
ATOM   4785 C  CG    . HIS C 3 533 ? 13.107  41.660 30.791  1.00 20.32  ? 829  HIS A CG    1 
ATOM   4786 N  ND1   . HIS C 3 533 ? 12.908  40.595 29.937  1.00 18.85  ? 829  HIS A ND1   1 
ATOM   4787 C  CD2   . HIS C 3 533 ? 14.401  41.589 31.186  1.00 20.53  ? 829  HIS A CD2   1 
ATOM   4788 C  CE1   . HIS C 3 533 ? 14.032  39.912 29.819  1.00 19.84  ? 829  HIS A CE1   1 
ATOM   4789 N  NE2   . HIS C 3 533 ? 14.954  40.494 30.566  1.00 21.04  ? 829  HIS A NE2   1 
ATOM   4790 N  N     . ASP C 3 534 ? 10.606  45.376 30.776  1.00 17.18  ? 830  ASP A N     1 
ATOM   4791 C  CA    . ASP C 3 534 ? 9.588   46.361 31.146  1.00 16.45  ? 830  ASP A CA    1 
ATOM   4792 C  C     . ASP C 3 534 ? 9.961   47.731 30.594  1.00 15.42  ? 830  ASP A C     1 
ATOM   4793 O  O     . ASP C 3 534 ? 9.463   48.760 31.051  1.00 14.64  ? 830  ASP A O     1 
ATOM   4794 C  CB    . ASP C 3 534 ? 9.450   46.432 32.671  1.00 17.84  ? 830  ASP A CB    1 
ATOM   4795 C  CG    . ASP C 3 534 ? 10.669  47.043 33.346  1.00 20.04  ? 830  ASP A CG    1 
ATOM   4796 O  OD1   . ASP C 3 534 ? 11.771  46.998 32.754  1.00 19.49  ? 830  ASP A OD1   1 
ATOM   4797 O  OD2   . ASP C 3 534 ? 10.526  47.564 34.478  1.00 20.46  ? 830  ASP A OD2   1 
ATOM   4798 N  N     . GLU C 3 535 ? 10.819  47.724 29.582  1.00 15.24  ? 831  GLU A N     1 
ATOM   4799 C  CA    . GLU C 3 535 ? 11.316  48.949 28.979  1.00 16.84  ? 831  GLU A CA    1 
ATOM   4800 C  C     . GLU C 3 535 ? 11.524  48.821 27.468  1.00 15.47  ? 831  GLU A C     1 
ATOM   4801 O  O     . GLU C 3 535 ? 11.904  47.760 26.971  1.00 14.81  ? 831  GLU A O     1 
ATOM   4802 C  CB    . GLU C 3 535 ? 12.636  49.315 29.667  1.00 19.23  ? 831  GLU A CB    1 
ATOM   4803 C  CG    . GLU C 3 535 ? 13.442  50.404 29.007  1.00 24.93  ? 831  GLU A CG    1 
ATOM   4804 C  CD    . GLU C 3 535 ? 14.750  50.661 29.742  1.00 28.56  ? 831  GLU A CD    1 
ATOM   4805 O  OE1   . GLU C 3 535 ? 15.466  49.673 30.043  1.00 30.88  ? 831  GLU A OE1   1 
ATOM   4806 O  OE2   . GLU C 3 535 ? 15.059  51.847 30.012  1.00 29.70  ? 831  GLU A OE2   1 
ATOM   4807 N  N     . LEU C 3 536 ? 11.268  49.912 26.749  1.00 13.20  ? 832  LEU A N     1 
ATOM   4808 C  CA    . LEU C 3 536 ? 11.447  49.951 25.300  1.00 12.40  ? 832  LEU A CA    1 
ATOM   4809 C  C     . LEU C 3 536 ? 12.466  51.048 24.957  1.00 13.07  ? 832  LEU A C     1 
ATOM   4810 O  O     . LEU C 3 536 ? 12.366  52.166 25.459  1.00 10.26  ? 832  LEU A O     1 
ATOM   4811 C  CB    . LEU C 3 536 ? 10.118  50.257 24.606  1.00 10.79  ? 832  LEU A CB    1 
ATOM   4812 C  CG    . LEU C 3 536 ? 8.949   49.280 24.784  1.00 9.37   ? 832  LEU A CG    1 
ATOM   4813 C  CD1   . LEU C 3 536 ? 7.733   49.811 24.028  1.00 7.60   ? 832  LEU A CD1   1 
ATOM   4814 C  CD2   . LEU C 3 536 ? 9.333   47.902 24.270  1.00 7.84   ? 832  LEU A CD2   1 
ATOM   4815 N  N     . ILE C 3 537 ? 13.441  50.720 24.109  1.00 13.15  ? 833  ILE A N     1 
ATOM   4816 C  CA    . ILE C 3 537 ? 14.474  51.677 23.701  1.00 13.16  ? 833  ILE A CA    1 
ATOM   4817 C  C     . ILE C 3 537 ? 14.356  51.949 22.207  1.00 12.53  ? 833  ILE A C     1 
ATOM   4818 O  O     . ILE C 3 537 ? 14.349  51.022 21.399  1.00 12.22  ? 833  ILE A O     1 
ATOM   4819 C  CB    . ILE C 3 537 ? 15.901  51.141 23.988  1.00 15.42  ? 833  ILE A CB    1 
ATOM   4820 C  CG1   . ILE C 3 537 ? 16.053  50.800 25.475  1.00 15.13  ? 833  ILE A CG1   1 
ATOM   4821 C  CG2   . ILE C 3 537 ? 16.952  52.192 23.603  1.00 15.51  ? 833  ILE A CG2   1 
ATOM   4822 C  CD1   . ILE C 3 537 ? 15.657  49.383 25.806  1.00 21.10  ? 833  ILE A CD1   1 
ATOM   4823 N  N     . LEU C 3 538 ? 14.250  53.224 21.850  1.00 12.52  ? 834  LEU A N     1 
ATOM   4824 C  CA    . LEU C 3 538 ? 14.137  53.631 20.451  1.00 13.29  ? 834  LEU A CA    1 
ATOM   4825 C  C     . LEU C 3 538 ? 15.232  54.622 20.072  1.00 14.32  ? 834  LEU A C     1 
ATOM   4826 O  O     . LEU C 3 538 ? 15.996  55.083 20.918  1.00 15.33  ? 834  LEU A O     1 
ATOM   4827 C  CB    . LEU C 3 538 ? 12.798  54.320 20.183  1.00 13.21  ? 834  LEU A CB    1 
ATOM   4828 C  CG    . LEU C 3 538 ? 11.453  53.627 20.385  1.00 14.94  ? 834  LEU A CG    1 
ATOM   4829 C  CD1   . LEU C 3 538 ? 11.041  53.643 21.859  1.00 14.76  ? 834  LEU A CD1   1 
ATOM   4830 C  CD2   . LEU C 3 538 ? 10.430  54.362 19.554  1.00 14.21  ? 834  LEU A CD2   1 
ATOM   4831 N  N     . GLU C 3 539 ? 15.301  54.938 18.785  1.00 14.26  ? 835  GLU A N     1 
ATOM   4832 C  CA    . GLU C 3 539 ? 16.232  55.941 18.297  1.00 14.30  ? 835  GLU A CA    1 
ATOM   4833 C  C     . GLU C 3 539 ? 15.425  56.722 17.270  1.00 13.20  ? 835  GLU A C     1 
ATOM   4834 O  O     . GLU C 3 539 ? 14.561  56.161 16.596  1.00 13.06  ? 835  GLU A O     1 
ATOM   4835 C  CB    . GLU C 3 539 ? 17.489  55.319 17.673  1.00 13.61  ? 835  GLU A CB    1 
ATOM   4836 C  CG    . GLU C 3 539 ? 17.333  54.702 16.294  1.00 11.72  ? 835  GLU A CG    1 
ATOM   4837 C  CD    . GLU C 3 539 ? 18.671  54.239 15.734  1.00 15.00  ? 835  GLU A CD    1 
ATOM   4838 O  OE1   . GLU C 3 539 ? 19.722  54.623 16.299  1.00 10.99  ? 835  GLU A OE1   1 
ATOM   4839 O  OE2   . GLU C 3 539 ? 18.676  53.499 14.729  1.00 15.29  ? 835  GLU A OE2   1 
ATOM   4840 N  N     . ALA C 3 540 ? 15.695  58.017 17.160  1.00 13.41  ? 836  ALA A N     1 
ATOM   4841 C  CA    . ALA C 3 540 ? 14.958  58.853 16.229  1.00 13.63  ? 836  ALA A CA    1 
ATOM   4842 C  C     . ALA C 3 540 ? 15.639  60.196 16.045  1.00 13.65  ? 836  ALA A C     1 
ATOM   4843 O  O     . ALA C 3 540 ? 16.528  60.560 16.820  1.00 14.31  ? 836  ALA A O     1 
ATOM   4844 C  CB    . ALA C 3 540 ? 13.531  59.071 16.759  1.00 13.55  ? 836  ALA A CB    1 
ATOM   4845 N  N     . PRO C 3 541 ? 15.233  60.949 15.007  1.00 14.19  ? 837  PRO A N     1 
ATOM   4846 C  CA    . PRO C 3 541 ? 15.802  62.270 14.740  1.00 14.80  ? 837  PRO A CA    1 
ATOM   4847 C  C     . PRO C 3 541 ? 15.547  63.117 15.978  1.00 16.60  ? 837  PRO A C     1 
ATOM   4848 O  O     . PRO C 3 541 ? 14.552  62.911 16.688  1.00 16.58  ? 837  PRO A O     1 
ATOM   4849 C  CB    . PRO C 3 541 ? 15.022  62.754 13.523  1.00 14.92  ? 837  PRO A CB    1 
ATOM   4850 C  CG    . PRO C 3 541 ? 14.698  61.484 12.799  1.00 15.48  ? 837  PRO A CG    1 
ATOM   4851 C  CD    . PRO C 3 541 ? 14.296  60.559 13.936  1.00 15.70  ? 837  PRO A CD    1 
ATOM   4852 N  N     . LYS C 3 542 ? 16.435  64.062 16.249  1.00 16.79  ? 838  LYS A N     1 
ATOM   4853 C  CA    . LYS C 3 542 ? 16.258  64.909 17.413  1.00 18.48  ? 838  LYS A CA    1 
ATOM   4854 C  C     . LYS C 3 542 ? 14.952  65.695 17.289  1.00 17.98  ? 838  LYS A C     1 
ATOM   4855 O  O     . LYS C 3 542 ? 14.341  66.043 18.295  1.00 16.79  ? 838  LYS A O     1 
ATOM   4856 C  CB    . LYS C 3 542 ? 17.450  65.862 17.563  1.00 20.01  ? 838  LYS A CB    1 
ATOM   4857 C  CG    . LYS C 3 542 ? 17.692  66.759 16.362  1.00 22.87  ? 838  LYS A CG    1 
ATOM   4858 C  CD    . LYS C 3 542 ? 18.895  67.663 16.599  1.00 26.75  ? 838  LYS A CD    1 
ATOM   4859 C  CE    . LYS C 3 542 ? 19.194  68.535 15.381  1.00 28.72  ? 838  LYS A CE    1 
ATOM   4860 N  NZ    . LYS C 3 542 ? 20.441  69.346 15.574  1.00 30.81  ? 838  LYS A NZ    1 
ATOM   4861 N  N     . GLU C 3 543 ? 14.520  65.946 16.053  1.00 17.77  ? 839  GLU A N     1 
ATOM   4862 C  CA    . GLU C 3 543 ? 13.290  66.694 15.800  1.00 18.61  ? 839  GLU A CA    1 
ATOM   4863 C  C     . GLU C 3 543 ? 12.011  65.945 16.173  1.00 17.43  ? 839  GLU A C     1 
ATOM   4864 O  O     . GLU C 3 543 ? 10.925  66.530 16.154  1.00 16.80  ? 839  GLU A O     1 
ATOM   4865 C  CB    . GLU C 3 543 ? 13.188  67.092 14.324  1.00 19.97  ? 839  GLU A CB    1 
ATOM   4866 C  CG    . GLU C 3 543 ? 14.260  68.033 13.829  1.00 24.95  ? 839  GLU A CG    1 
ATOM   4867 C  CD    . GLU C 3 543 ? 15.582  67.338 13.550  1.00 27.82  ? 839  GLU A CD    1 
ATOM   4868 O  OE1   . GLU C 3 543 ? 15.619  66.086 13.540  1.00 24.32  ? 839  GLU A OE1   1 
ATOM   4869 O  OE2   . GLU C 3 543 ? 16.581  68.056 13.322  1.00 28.78  ? 839  GLU A OE2   1 
ATOM   4870 N  N     . GLU C 3 544 ? 12.130  64.663 16.505  1.00 14.56  ? 840  GLU A N     1 
ATOM   4871 C  CA    . GLU C 3 544 ? 10.955  63.870 16.868  1.00 13.47  ? 840  GLU A CA    1 
ATOM   4872 C  C     . GLU C 3 544 ? 10.803  63.619 18.371  1.00 13.49  ? 840  GLU A C     1 
ATOM   4873 O  O     . GLU C 3 544 ? 9.818   63.021 18.795  1.00 14.44  ? 840  GLU A O     1 
ATOM   4874 C  CB    . GLU C 3 544 ? 10.975  62.524 16.127  1.00 12.30  ? 840  GLU A CB    1 
ATOM   4875 C  CG    . GLU C 3 544 ? 10.802  62.638 14.613  1.00 12.30  ? 840  GLU A CG    1 
ATOM   4876 C  CD    . GLU C 3 544 ? 10.692  61.290 13.923  1.00 10.91  ? 840  GLU A CD    1 
ATOM   4877 O  OE1   . GLU C 3 544 ? 10.496  61.266 12.690  1.00 12.65  ? 840  GLU A OE1   1 
ATOM   4878 O  OE2   . GLU C 3 544 ? 10.797  60.252 14.608  1.00 11.09  ? 840  GLU A OE2   1 
ATOM   4879 N  N     . MET C 3 545 ? 11.763  64.077 19.172  1.00 12.44  ? 841  MET A N     1 
ATOM   4880 C  CA    . MET C 3 545 ? 11.708  63.864 20.621  1.00 14.71  ? 841  MET A CA    1 
ATOM   4881 C  C     . MET C 3 545 ? 10.444  64.391 21.299  1.00 14.36  ? 841  MET A C     1 
ATOM   4882 O  O     . MET C 3 545 ? 9.805   63.676 22.072  1.00 13.49  ? 841  MET A O     1 
ATOM   4883 C  CB    . MET C 3 545 ? 12.934  64.490 21.315  1.00 14.67  ? 841  MET A CB    1 
ATOM   4884 C  CG    . MET C 3 545 ? 14.276  63.856 20.955  1.00 14.31  ? 841  MET A CG    1 
ATOM   4885 S  SD    . MET C 3 545 ? 14.429  62.104 21.409  1.00 15.86  ? 841  MET A SD    1 
ATOM   4886 C  CE    . MET C 3 545 ? 13.957  61.326 19.887  1.00 11.71  ? 841  MET A CE    1 
ATOM   4887 N  N     . GLU C 3 546 ? 10.075  65.639 21.022  1.00 13.74  ? 842  GLU A N     1 
ATOM   4888 C  CA    . GLU C 3 546 ? 8.892   66.195 21.667  1.00 15.44  ? 842  GLU A CA    1 
ATOM   4889 C  C     . GLU C 3 546 ? 7.643   65.375 21.380  1.00 15.77  ? 842  GLU A C     1 
ATOM   4890 O  O     . GLU C 3 546 ? 6.831   65.161 22.273  1.00 15.94  ? 842  GLU A O     1 
ATOM   4891 C  CB    . GLU C 3 546 ? 8.697   67.656 21.268  1.00 16.02  ? 842  GLU A CB    1 
ATOM   4892 C  CG    . GLU C 3 546 ? 9.844   68.547 21.754  1.00 17.84  ? 842  GLU A CG    1 
ATOM   4893 C  CD    . GLU C 3 546 ? 9.495   70.013 21.722  1.00 19.29  ? 842  GLU A CD    1 
ATOM   4894 O  OE1   . GLU C 3 546 ? 8.622   70.432 22.508  1.00 18.31  ? 842  GLU A OE1   1 
ATOM   4895 O  OE2   . GLU C 3 546 ? 10.092  70.749 20.909  1.00 20.40  ? 842  GLU A OE2   1 
ATOM   4896 N  N     . ARG C 3 547 ? 7.492   64.905 20.144  1.00 15.30  ? 843  ARG A N     1 
ATOM   4897 C  CA    . ARG C 3 547 ? 6.339   64.082 19.803  1.00 15.30  ? 843  ARG A CA    1 
ATOM   4898 C  C     . ARG C 3 547 ? 6.402   62.710 20.483  1.00 14.64  ? 843  ARG A C     1 
ATOM   4899 O  O     . ARG C 3 547 ? 5.377   62.174 20.907  1.00 14.31  ? 843  ARG A O     1 
ATOM   4900 C  CB    . ARG C 3 547 ? 6.229   63.908 18.289  1.00 15.86  ? 843  ARG A CB    1 
ATOM   4901 C  CG    . ARG C 3 547 ? 5.639   65.133 17.595  1.00 22.36  ? 843  ARG A CG    1 
ATOM   4902 C  CD    . ARG C 3 547 ? 4.821   64.728 16.390  1.00 25.91  ? 843  ARG A CD    1 
ATOM   4903 N  NE    . ARG C 3 547 ? 5.646   64.560 15.203  1.00 30.96  ? 843  ARG A NE    1 
ATOM   4904 C  CZ    . ARG C 3 547 ? 5.210   64.038 14.061  1.00 31.74  ? 843  ARG A CZ    1 
ATOM   4905 N  NH1   . ARG C 3 547 ? 3.952   63.624 13.952  1.00 32.73  ? 843  ARG A NH1   1 
ATOM   4906 N  NH2   . ARG C 3 547 ? 6.029   63.949 13.021  1.00 32.62  ? 843  ARG A NH2   1 
ATOM   4907 N  N     . LEU C 3 548 ? 7.600   62.146 20.593  1.00 12.75  ? 844  LEU A N     1 
ATOM   4908 C  CA    . LEU C 3 548 ? 7.759   60.844 21.236  1.00 14.85  ? 844  LEU A CA    1 
ATOM   4909 C  C     . LEU C 3 548 ? 7.475   60.914 22.740  1.00 14.22  ? 844  LEU A C     1 
ATOM   4910 O  O     . LEU C 3 548 ? 6.959   59.961 23.319  1.00 13.89  ? 844  LEU A O     1 
ATOM   4911 C  CB    . LEU C 3 548 ? 9.170   60.292 20.992  1.00 13.31  ? 844  LEU A CB    1 
ATOM   4912 C  CG    . LEU C 3 548 ? 9.502   59.909 19.545  1.00 15.40  ? 844  LEU A CG    1 
ATOM   4913 C  CD1   . LEU C 3 548 ? 10.959  59.486 19.448  1.00 16.46  ? 844  LEU A CD1   1 
ATOM   4914 C  CD2   . LEU C 3 548 ? 8.597   58.781 19.083  1.00 12.81  ? 844  LEU A CD2   1 
ATOM   4915 N  N     . CYS C 3 549 ? 7.810   62.045 23.361  1.00 14.18  ? 845  CYS A N     1 
ATOM   4916 C  CA    . CYS C 3 549 ? 7.584   62.249 24.793  1.00 15.44  ? 845  CYS A CA    1 
ATOM   4917 C  C     . CYS C 3 549 ? 6.113   62.098 25.143  1.00 15.42  ? 845  CYS A C     1 
ATOM   4918 O  O     . CYS C 3 549 ? 5.770   61.736 26.263  1.00 14.66  ? 845  CYS A O     1 
ATOM   4919 C  CB    . CYS C 3 549 ? 8.050   63.647 25.230  1.00 16.27  ? 845  CYS A CB    1 
ATOM   4920 S  SG    . CYS C 3 549 ? 9.841   63.849 25.373  1.00 19.64  ? 845  CYS A SG    1 
ATOM   4921 N  N     . ARG C 3 550 ? 5.245   62.387 24.183  1.00 16.73  ? 846  ARG A N     1 
ATOM   4922 C  CA    . ARG C 3 550 ? 3.812   62.267 24.409  1.00 16.65  ? 846  ARG A CA    1 
ATOM   4923 C  C     . ARG C 3 550 ? 3.271   60.941 23.902  1.00 15.24  ? 846  ARG A C     1 
ATOM   4924 O  O     . ARG C 3 550 ? 2.529   60.267 24.606  1.00 14.34  ? 846  ARG A O     1 
ATOM   4925 C  CB    . ARG C 3 550 ? 3.060   63.420 23.729  1.00 19.20  ? 846  ARG A CB    1 
ATOM   4926 C  CG    . ARG C 3 550 ? 2.958   64.682 24.580  1.00 22.32  ? 846  ARG A CG    1 
ATOM   4927 C  CD    . ARG C 3 550 ? 2.386   65.863 23.801  1.00 25.18  ? 846  ARG A CD    1 
ATOM   4928 N  NE    . ARG C 3 550 ? 1.008   65.676 23.339  1.00 27.82  ? 846  ARG A NE    1 
ATOM   4929 C  CZ    . ARG C 3 550 ? -0.077  65.793 24.106  1.00 30.52  ? 846  ARG A CZ    1 
ATOM   4930 N  NH1   . ARG C 3 550 ? 0.035   66.091 25.393  1.00 29.43  ? 846  ARG A NH1   1 
ATOM   4931 N  NH2   . ARG C 3 550 ? -1.285  65.639 23.578  1.00 31.05  ? 846  ARG A NH2   1 
ATOM   4932 N  N     . LEU C 3 551 ? 3.668   60.563 22.690  1.00 13.66  ? 847  LEU A N     1 
ATOM   4933 C  CA    . LEU C 3 551 ? 3.192   59.340 22.058  1.00 15.65  ? 847  LEU A CA    1 
ATOM   4934 C  C     . LEU C 3 551 ? 3.602   58.013 22.699  1.00 15.93  ? 847  LEU A C     1 
ATOM   4935 O  O     . LEU C 3 551 ? 2.758   57.153 22.928  1.00 14.71  ? 847  LEU A O     1 
ATOM   4936 C  CB    . LEU C 3 551 ? 3.604   59.326 20.581  1.00 17.57  ? 847  LEU A CB    1 
ATOM   4937 C  CG    . LEU C 3 551 ? 3.121   58.130 19.755  1.00 20.49  ? 847  LEU A CG    1 
ATOM   4938 C  CD1   . LEU C 3 551 ? 1.603   58.211 19.582  1.00 19.77  ? 847  LEU A CD1   1 
ATOM   4939 C  CD2   . LEU C 3 551 ? 3.801   58.131 18.395  1.00 21.09  ? 847  LEU A CD2   1 
ATOM   4940 N  N     . VAL C 3 552 ? 4.888   57.838 22.985  1.00 14.78  ? 848  VAL A N     1 
ATOM   4941 C  CA    . VAL C 3 552 ? 5.338   56.582 23.563  1.00 14.98  ? 848  VAL A CA    1 
ATOM   4942 C  C     . VAL C 3 552 ? 4.693   56.223 24.914  1.00 15.30  ? 848  VAL A C     1 
ATOM   4943 O  O     . VAL C 3 552 ? 4.136   55.140 25.059  1.00 13.50  ? 848  VAL A O     1 
ATOM   4944 C  CB    . VAL C 3 552 ? 6.882   56.546 23.683  1.00 14.97  ? 848  VAL A CB    1 
ATOM   4945 C  CG1   . VAL C 3 552 ? 7.331   55.214 24.270  1.00 12.00  ? 848  VAL A CG1   1 
ATOM   4946 C  CG2   . VAL C 3 552 ? 7.515   56.744 22.295  1.00 13.20  ? 848  VAL A CG2   1 
ATOM   4947 N  N     . PRO C 3 553 ? 4.745   57.128 25.911  1.00 15.56  ? 849  PRO A N     1 
ATOM   4948 C  CA    . PRO C 3 553 ? 4.137   56.800 27.208  1.00 15.64  ? 849  PRO A CA    1 
ATOM   4949 C  C     . PRO C 3 553 ? 2.644   56.476 27.095  1.00 16.04  ? 849  PRO A C     1 
ATOM   4950 O  O     . PRO C 3 553 ? 2.160   55.520 27.704  1.00 15.66  ? 849  PRO A O     1 
ATOM   4951 C  CB    . PRO C 3 553 ? 4.412   58.045 28.056  1.00 15.83  ? 849  PRO A CB    1 
ATOM   4952 C  CG    . PRO C 3 553 ? 5.659   58.631 27.420  1.00 18.30  ? 849  PRO A CG    1 
ATOM   4953 C  CD    . PRO C 3 553 ? 5.373   58.461 25.949  1.00 16.07  ? 849  PRO A CD    1 
ATOM   4954 N  N     . GLU C 3 554 ? 1.924   57.277 26.314  1.00 14.94  ? 850  GLU A N     1 
ATOM   4955 C  CA    . GLU C 3 554 ? 0.487   57.083 26.123  1.00 16.45  ? 850  GLU A CA    1 
ATOM   4956 C  C     . GLU C 3 554 ? 0.186   55.703 25.548  1.00 16.56  ? 850  GLU A C     1 
ATOM   4957 O  O     . GLU C 3 554 ? -0.654  54.971 26.078  1.00 15.35  ? 850  GLU A O     1 
ATOM   4958 C  CB    . GLU C 3 554 ? -0.069  58.167 25.196  1.00 17.80  ? 850  GLU A CB    1 
ATOM   4959 C  CG    . GLU C 3 554 ? -1.553  58.032 24.853  1.00 23.07  ? 850  GLU A CG    1 
ATOM   4960 C  CD    . GLU C 3 554 ? -2.475  58.143 26.068  1.00 27.72  ? 850  GLU A CD    1 
ATOM   4961 O  OE1   . GLU C 3 554 ? -2.064  58.717 27.101  1.00 29.69  ? 850  GLU A OE1   1 
ATOM   4962 O  OE2   . GLU C 3 554 ? -3.628  57.669 25.982  1.00 30.66  ? 850  GLU A OE2   1 
ATOM   4963 N  N     . VAL C 3 555 ? 0.870   55.353 24.461  1.00 15.31  ? 851  VAL A N     1 
ATOM   4964 C  CA    . VAL C 3 555 ? 0.674   54.051 23.830  1.00 15.12  ? 851  VAL A CA    1 
ATOM   4965 C  C     . VAL C 3 555 ? 0.939   52.929 24.832  1.00 14.36  ? 851  VAL A C     1 
ATOM   4966 O  O     . VAL C 3 555 ? 0.149   51.989 24.945  1.00 14.86  ? 851  VAL A O     1 
ATOM   4967 C  CB    . VAL C 3 555 ? 1.605   53.872 22.595  1.00 16.38  ? 851  VAL A CB    1 
ATOM   4968 C  CG1   . VAL C 3 555 ? 1.623   52.423 22.154  1.00 15.91  ? 851  VAL A CG1   1 
ATOM   4969 C  CG2   . VAL C 3 555 ? 1.114   54.745 21.444  1.00 14.10  ? 851  VAL A CG2   1 
ATOM   4970 N  N     . MET C 3 556 ? 2.044   53.034 25.568  1.00 12.55  ? 852  MET A N     1 
ATOM   4971 C  CA    . MET C 3 556 ? 2.392   52.012 26.552  1.00 12.81  ? 852  MET A CA    1 
ATOM   4972 C  C     . MET C 3 556 ? 1.414   51.969 27.726  1.00 13.43  ? 852  MET A C     1 
ATOM   4973 O  O     . MET C 3 556 ? 1.124   50.901 28.261  1.00 12.64  ? 852  MET A O     1 
ATOM   4974 C  CB    . MET C 3 556 ? 3.817   52.241 27.073  1.00 12.90  ? 852  MET A CB    1 
ATOM   4975 C  CG    . MET C 3 556 ? 4.907   52.004 26.020  1.00 13.13  ? 852  MET A CG    1 
ATOM   4976 S  SD    . MET C 3 556 ? 6.558   52.450 26.593  1.00 15.39  ? 852  MET A SD    1 
ATOM   4977 C  CE    . MET C 3 556 ? 6.880   51.120 27.782  1.00 13.98  ? 852  MET A CE    1 
ATOM   4978 N  N     . GLU C 3 557 ? 0.906   53.129 28.124  1.00 14.21  ? 853  GLU A N     1 
ATOM   4979 C  CA    . GLU C 3 557 ? -0.030  53.200 29.238  1.00 15.14  ? 853  GLU A CA    1 
ATOM   4980 C  C     . GLU C 3 557 ? -1.422  52.706 28.868  1.00 16.98  ? 853  GLU A C     1 
ATOM   4981 O  O     . GLU C 3 557 ? -2.128  52.170 29.717  1.00 18.00  ? 853  GLU A O     1 
ATOM   4982 C  CB    . GLU C 3 557 ? -0.110  54.639 29.773  1.00 15.98  ? 853  GLU A CB    1 
ATOM   4983 C  CG    . GLU C 3 557 ? 1.121   55.060 30.572  1.00 19.53  ? 853  GLU A CG    1 
ATOM   4984 C  CD    . GLU C 3 557 ? 1.133   56.533 30.950  1.00 22.22  ? 853  GLU A CD    1 
ATOM   4985 O  OE1   . GLU C 3 557 ? 2.034   56.933 31.724  1.00 25.46  ? 853  GLU A OE1   1 
ATOM   4986 O  OE2   . GLU C 3 557 ? 0.260   57.293 30.479  1.00 20.83  ? 853  GLU A OE2   1 
ATOM   4987 N  N     . GLN C 3 558 ? -1.813  52.879 27.607  1.00 15.78  ? 854  GLN A N     1 
ATOM   4988 C  CA    . GLN C 3 558 ? -3.136  52.457 27.159  1.00 16.80  ? 854  GLN A CA    1 
ATOM   4989 C  C     . GLN C 3 558 ? -3.184  51.080 26.500  1.00 16.54  ? 854  GLN A C     1 
ATOM   4990 O  O     . GLN C 3 558 ? -4.228  50.681 25.998  1.00 16.92  ? 854  GLN A O     1 
ATOM   4991 C  CB    . GLN C 3 558 ? -3.725  53.496 26.189  1.00 17.67  ? 854  GLN A CB    1 
ATOM   4992 C  CG    . GLN C 3 558 ? -3.882  54.894 26.786  1.00 22.05  ? 854  GLN A CG    1 
ATOM   4993 C  CD    . GLN C 3 558 ? -4.711  54.901 28.059  1.00 24.83  ? 854  GLN A CD    1 
ATOM   4994 O  OE1   . GLN C 3 558 ? -5.781  54.293 28.117  1.00 27.58  ? 854  GLN A OE1   1 
ATOM   4995 N  NE2   . GLN C 3 558 ? -4.223  55.594 29.087  1.00 26.06  ? 854  GLN A NE2   1 
ATOM   4996 N  N     . ALA C 3 559 ? -2.067  50.357 26.501  1.00 16.60  ? 855  ALA A N     1 
ATOM   4997 C  CA    . ALA C 3 559 ? -2.018  49.025 25.888  1.00 16.89  ? 855  ALA A CA    1 
ATOM   4998 C  C     . ALA C 3 559 ? -3.140  48.116 26.402  1.00 17.05  ? 855  ALA A C     1 
ATOM   4999 O  O     . ALA C 3 559 ? -3.740  47.362 25.632  1.00 16.13  ? 855  ALA A O     1 
ATOM   5000 C  CB    . ALA C 3 559 ? -0.655  48.375 26.147  1.00 15.25  ? 855  ALA A CB    1 
ATOM   5001 N  N     . VAL C 3 560 ? -3.399  48.184 27.708  1.00 16.22  ? 856  VAL A N     1 
ATOM   5002 C  CA    . VAL C 3 560 ? -4.464  47.410 28.345  1.00 17.16  ? 856  VAL A CA    1 
ATOM   5003 C  C     . VAL C 3 560 ? -5.079  48.295 29.418  1.00 18.42  ? 856  VAL A C     1 
ATOM   5004 O  O     . VAL C 3 560 ? -4.475  49.280 29.838  1.00 19.89  ? 856  VAL A O     1 
ATOM   5005 C  CB    . VAL C 3 560 ? -3.949  46.111 29.034  1.00 17.61  ? 856  VAL A CB    1 
ATOM   5006 C  CG1   . VAL C 3 560 ? -3.247  45.214 28.024  1.00 15.18  ? 856  VAL A CG1   1 
ATOM   5007 C  CG2   . VAL C 3 560 ? -3.034  46.461 30.201  1.00 17.87  ? 856  VAL A CG2   1 
ATOM   5008 N  N     . THR C 3 561 ? -6.281  47.952 29.857  1.00 18.98  ? 857  THR A N     1 
ATOM   5009 C  CA    . THR C 3 561 ? -6.949  48.724 30.899  1.00 19.64  ? 857  THR A CA    1 
ATOM   5010 C  C     . THR C 3 561 ? -7.064  47.846 32.134  1.00 17.90  ? 857  THR A C     1 
ATOM   5011 O  O     . THR C 3 561 ? -7.673  46.787 32.081  1.00 18.37  ? 857  THR A O     1 
ATOM   5012 C  CB    . THR C 3 561 ? -8.346  49.169 30.437  1.00 20.72  ? 857  THR A CB    1 
ATOM   5013 O  OG1   . THR C 3 561 ? -8.203  50.050 29.319  1.00 23.54  ? 857  THR A OG1   1 
ATOM   5014 C  CG2   . THR C 3 561 ? -9.085  49.904 31.555  1.00 20.70  ? 857  THR A CG2   1 
ATOM   5015 N  N     . LEU C 3 562 ? -6.465  48.283 33.239  1.00 18.36  ? 858  LEU A N     1 
ATOM   5016 C  CA    . LEU C 3 562 ? -6.494  47.517 34.488  1.00 16.59  ? 858  LEU A CA    1 
ATOM   5017 C  C     . LEU C 3 562 ? -7.240  48.293 35.569  1.00 16.29  ? 858  LEU A C     1 
ATOM   5018 O  O     . LEU C 3 562 ? -7.601  49.453 35.367  1.00 18.42  ? 858  LEU A O     1 
ATOM   5019 C  CB    . LEU C 3 562 ? -5.066  47.238 34.972  1.00 15.05  ? 858  LEU A CB    1 
ATOM   5020 C  CG    . LEU C 3 562 ? -4.072  46.553 34.020  1.00 14.81  ? 858  LEU A CG    1 
ATOM   5021 C  CD1   . LEU C 3 562 ? -2.674  46.589 34.645  1.00 13.75  ? 858  LEU A CD1   1 
ATOM   5022 C  CD2   . LEU C 3 562 ? -4.493  45.118 33.747  1.00 12.98  ? 858  LEU A CD2   1 
ATOM   5023 N  N     . ARG C 3 563 ? -7.454  47.657 36.719  1.00 15.13  ? 859  ARG A N     1 
ATOM   5024 C  CA    . ARG C 3 563 ? -8.148  48.296 37.831  1.00 16.35  ? 859  ARG A CA    1 
ATOM   5025 C  C     . ARG C 3 563 ? -7.325  49.415 38.453  1.00 15.63  ? 859  ARG A C     1 
ATOM   5026 O  O     . ARG C 3 563 ? -7.832  50.195 39.256  1.00 16.60  ? 859  ARG A O     1 
ATOM   5027 C  CB    . ARG C 3 563 ? -8.523  47.256 38.887  1.00 16.46  ? 859  ARG A CB    1 
ATOM   5028 C  CG    . ARG C 3 563 ? -9.588  46.303 38.386  1.00 17.96  ? 859  ARG A CG    1 
ATOM   5029 C  CD    . ARG C 3 563 ? -9.920  45.183 39.366  1.00 20.56  ? 859  ARG A CD    1 
ATOM   5030 N  NE    . ARG C 3 563 ? -10.953 44.328 38.789  1.00 25.64  ? 859  ARG A NE    1 
ATOM   5031 C  CZ    . ARG C 3 563 ? -10.730 43.155 38.200  1.00 25.64  ? 859  ARG A CZ    1 
ATOM   5032 N  NH1   . ARG C 3 563 ? -9.502  42.662 38.113  1.00 23.75  ? 859  ARG A NH1   1 
ATOM   5033 N  NH2   . ARG C 3 563 ? -11.745 42.480 37.681  1.00 28.89  ? 859  ARG A NH2   1 
ATOM   5034 N  N     . VAL C 3 564 ? -6.050  49.482 38.082  1.00 14.39  ? 860  VAL A N     1 
ATOM   5035 C  CA    . VAL C 3 564 ? -5.164  50.538 38.556  1.00 14.72  ? 860  VAL A CA    1 
ATOM   5036 C  C     . VAL C 3 564 ? -4.507  51.127 37.311  1.00 15.72  ? 860  VAL A C     1 
ATOM   5037 O  O     . VAL C 3 564 ? -4.417  50.471 36.277  1.00 15.05  ? 860  VAL A O     1 
ATOM   5038 C  CB    . VAL C 3 564 ? -4.046  50.010 39.493  1.00 14.09  ? 860  VAL A CB    1 
ATOM   5039 C  CG1   . VAL C 3 564 ? -4.658  49.400 40.748  1.00 16.00  ? 860  VAL A CG1   1 
ATOM   5040 C  CG2   . VAL C 3 564 ? -3.178  48.990 38.756  1.00 13.58  ? 860  VAL A CG2   1 
ATOM   5041 N  N     . PRO C 3 565 ? -4.048  52.378 37.387  1.00 15.43  ? 861  PRO A N     1 
ATOM   5042 C  CA    . PRO C 3 565 ? -3.410  52.963 36.205  1.00 16.13  ? 861  PRO A CA    1 
ATOM   5043 C  C     . PRO C 3 565 ? -2.066  52.288 35.929  1.00 16.52  ? 861  PRO A C     1 
ATOM   5044 O  O     . PRO C 3 565 ? -1.539  51.568 36.779  1.00 16.35  ? 861  PRO A O     1 
ATOM   5045 C  CB    . PRO C 3 565 ? -3.246  54.435 36.580  1.00 18.17  ? 861  PRO A CB    1 
ATOM   5046 C  CG    . PRO C 3 565 ? -4.310  54.663 37.630  1.00 16.93  ? 861  PRO A CG    1 
ATOM   5047 C  CD    . PRO C 3 565 ? -4.248  53.390 38.436  1.00 15.91  ? 861  PRO A CD    1 
ATOM   5048 N  N     . LEU C 3 566 ? -1.534  52.514 34.734  1.00 14.76  ? 862  LEU A N     1 
ATOM   5049 C  CA    . LEU C 3 566 ? -0.213  52.018 34.365  1.00 16.33  ? 862  LEU A CA    1 
ATOM   5050 C  C     . LEU C 3 566 ? 0.593   53.306 34.236  1.00 16.15  ? 862  LEU A C     1 
ATOM   5051 O  O     . LEU C 3 566 ? 0.086   54.307 33.719  1.00 17.03  ? 862  LEU A O     1 
ATOM   5052 C  CB    . LEU C 3 566 ? -0.233  51.268 33.026  1.00 15.68  ? 862  LEU A CB    1 
ATOM   5053 C  CG    . LEU C 3 566 ? -0.739  49.824 33.115  1.00 19.20  ? 862  LEU A CG    1 
ATOM   5054 C  CD1   . LEU C 3 566 ? -0.720  49.175 31.743  1.00 17.54  ? 862  LEU A CD1   1 
ATOM   5055 C  CD2   . LEU C 3 566 ? 0.137   49.045 34.092  1.00 17.91  ? 862  LEU A CD2   1 
ATOM   5056 N  N     . LYS C 3 567 ? 1.830   53.286 34.715  1.00 15.80  ? 863  LYS A N     1 
ATOM   5057 C  CA    . LYS C 3 567 ? 2.689   54.465 34.670  1.00 16.13  ? 863  LYS A CA    1 
ATOM   5058 C  C     . LYS C 3 567 ? 3.984   54.168 33.923  1.00 15.05  ? 863  LYS A C     1 
ATOM   5059 O  O     . LYS C 3 567 ? 4.619   53.128 34.139  1.00 12.76  ? 863  LYS A O     1 
ATOM   5060 C  CB    . LYS C 3 567 ? 3.010   54.926 36.096  1.00 18.66  ? 863  LYS A CB    1 
ATOM   5061 C  CG    . LYS C 3 567 ? 3.820   56.208 36.190  1.00 22.04  ? 863  LYS A CG    1 
ATOM   5062 C  CD    . LYS C 3 567 ? 4.178   56.485 37.643  1.00 27.31  ? 863  LYS A CD    1 
ATOM   5063 C  CE    . LYS C 3 567 ? 4.794   57.859 37.833  1.00 27.91  ? 863  LYS A CE    1 
ATOM   5064 N  NZ    . LYS C 3 567 ? 5.108   58.108 39.269  1.00 30.26  ? 863  LYS A NZ    1 
ATOM   5065 N  N     . VAL C 3 568 ? 4.367   55.095 33.053  1.00 15.34  ? 864  VAL A N     1 
ATOM   5066 C  CA    . VAL C 3 568 ? 5.570   54.971 32.246  1.00 14.03  ? 864  VAL A CA    1 
ATOM   5067 C  C     . VAL C 3 568 ? 6.469   56.197 32.385  1.00 17.23  ? 864  VAL A C     1 
ATOM   5068 O  O     . VAL C 3 568 ? 6.022   57.327 32.179  1.00 15.87  ? 864  VAL A O     1 
ATOM   5069 C  CB    . VAL C 3 568 ? 5.208   54.807 30.747  1.00 16.06  ? 864  VAL A CB    1 
ATOM   5070 C  CG1   . VAL C 3 568 ? 6.461   54.886 29.882  1.00 14.35  ? 864  VAL A CG1   1 
ATOM   5071 C  CG2   . VAL C 3 568 ? 4.507   53.478 30.526  1.00 14.33  ? 864  VAL A CG2   1 
ATOM   5072 N  N     . ASP C 3 569 ? 7.732   55.971 32.741  1.00 16.83  ? 865  ASP A N     1 
ATOM   5073 C  CA    . ASP C 3 569 ? 8.703   57.056 32.845  1.00 17.08  ? 865  ASP A CA    1 
ATOM   5074 C  C     . ASP C 3 569 ? 9.516   57.014 31.553  1.00 18.01  ? 865  ASP A C     1 
ATOM   5075 O  O     . ASP C 3 569 ? 9.566   55.980 30.894  1.00 17.23  ? 865  ASP A O     1 
ATOM   5076 C  CB    . ASP C 3 569 ? 9.617   56.865 34.057  1.00 17.59  ? 865  ASP A CB    1 
ATOM   5077 C  CG    . ASP C 3 569 ? 8.853   56.907 35.368  1.00 19.64  ? 865  ASP A CG    1 
ATOM   5078 O  OD1   . ASP C 3 569 ? 7.967   57.775 35.519  1.00 21.03  ? 865  ASP A OD1   1 
ATOM   5079 O  OD2   . ASP C 3 569 ? 9.139   56.076 36.249  1.00 22.22  ? 865  ASP A OD2   1 
ATOM   5080 N  N     . TYR C 3 570 ? 10.147  58.126 31.188  1.00 17.29  ? 866  TYR A N     1 
ATOM   5081 C  CA    . TYR C 3 570 ? 10.913  58.170 29.948  1.00 18.88  ? 866  TYR A CA    1 
ATOM   5082 C  C     . TYR C 3 570 ? 12.054  59.184 29.982  1.00 18.77  ? 866  TYR A C     1 
ATOM   5083 O  O     . TYR C 3 570 ? 12.001  60.168 30.716  1.00 19.28  ? 866  TYR A O     1 
ATOM   5084 C  CB    . TYR C 3 570 ? 9.970   58.483 28.786  1.00 16.32  ? 866  TYR A CB    1 
ATOM   5085 C  CG    . TYR C 3 570 ? 9.150   59.741 28.989  1.00 19.39  ? 866  TYR A CG    1 
ATOM   5086 C  CD1   . TYR C 3 570 ? 9.602   60.978 28.531  1.00 22.51  ? 866  TYR A CD1   1 
ATOM   5087 C  CD2   . TYR C 3 570 ? 7.923   59.692 29.646  1.00 22.21  ? 866  TYR A CD2   1 
ATOM   5088 C  CE1   . TYR C 3 570 ? 8.848   62.137 28.723  1.00 25.01  ? 866  TYR A CE1   1 
ATOM   5089 C  CE2   . TYR C 3 570 ? 7.161   60.841 29.843  1.00 24.50  ? 866  TYR A CE2   1 
ATOM   5090 C  CZ    . TYR C 3 570 ? 7.628   62.057 29.381  1.00 25.05  ? 866  TYR A CZ    1 
ATOM   5091 O  OH    . TYR C 3 570 ? 6.872   63.189 29.578  1.00 30.74  ? 866  TYR A OH    1 
ATOM   5092 N  N     . HIS C 3 571 ? 13.083  58.933 29.180  1.00 18.87  ? 867  HIS A N     1 
ATOM   5093 C  CA    . HIS C 3 571 ? 14.254  59.811 29.111  1.00 18.69  ? 867  HIS A CA    1 
ATOM   5094 C  C     . HIS C 3 571 ? 14.891  59.685 27.733  1.00 18.56  ? 867  HIS A C     1 
ATOM   5095 O  O     . HIS C 3 571 ? 14.687  58.692 27.041  1.00 16.40  ? 867  HIS A O     1 
ATOM   5096 C  CB    . HIS C 3 571 ? 15.302  59.403 30.154  1.00 18.32  ? 867  HIS A CB    1 
ATOM   5097 C  CG    . HIS C 3 571 ? 14.767  59.279 31.546  1.00 19.99  ? 867  HIS A CG    1 
ATOM   5098 N  ND1   . HIS C 3 571 ? 14.552  60.369 32.361  1.00 21.57  ? 867  HIS A ND1   1 
ATOM   5099 C  CD2   . HIS C 3 571 ? 14.398  58.192 32.265  1.00 21.17  ? 867  HIS A CD2   1 
ATOM   5100 C  CE1   . HIS C 3 571 ? 14.074  59.959 33.524  1.00 22.04  ? 867  HIS A CE1   1 
ATOM   5101 N  NE2   . HIS C 3 571 ? 13.972  58.642 33.491  1.00 21.80  ? 867  HIS A NE2   1 
ATOM   5102 N  N     . TYR C 3 572 ? 15.674  60.683 27.340  1.00 17.83  ? 868  TYR A N     1 
ATOM   5103 C  CA    . TYR C 3 572 ? 16.358  60.620 26.055  1.00 18.43  ? 868  TYR A CA    1 
ATOM   5104 C  C     . TYR C 3 572 ? 17.706  61.341 26.123  1.00 18.44  ? 868  TYR A C     1 
ATOM   5105 O  O     . TYR C 3 572 ? 17.919  62.175 27.002  1.00 18.25  ? 868  TYR A O     1 
ATOM   5106 C  CB    . TYR C 3 572 ? 15.462  61.184 24.946  1.00 19.02  ? 868  TYR A CB    1 
ATOM   5107 C  CG    . TYR C 3 572 ? 15.178  62.665 25.013  1.00 20.92  ? 868  TYR A CG    1 
ATOM   5108 C  CD1   . TYR C 3 572 ? 16.081  63.591 24.494  1.00 22.55  ? 868  TYR A CD1   1 
ATOM   5109 C  CD2   . TYR C 3 572 ? 13.987  63.139 25.554  1.00 22.23  ? 868  TYR A CD2   1 
ATOM   5110 C  CE1   . TYR C 3 572 ? 15.806  64.954 24.507  1.00 23.32  ? 868  TYR A CE1   1 
ATOM   5111 C  CE2   . TYR C 3 572 ? 13.699  64.505 25.576  1.00 23.72  ? 868  TYR A CE2   1 
ATOM   5112 C  CZ    . TYR C 3 572 ? 14.615  65.404 25.049  1.00 25.04  ? 868  TYR A CZ    1 
ATOM   5113 O  OH    . TYR C 3 572 ? 14.346  66.752 25.069  1.00 25.12  ? 868  TYR A OH    1 
ATOM   5114 N  N     . GLY C 3 573 ? 18.614  61.006 25.205  1.00 16.93  ? 869  GLY A N     1 
ATOM   5115 C  CA    . GLY C 3 573 ? 19.932  61.624 25.201  1.00 16.33  ? 869  GLY A CA    1 
ATOM   5116 C  C     . GLY C 3 573 ? 20.832  61.159 24.064  1.00 15.94  ? 869  GLY A C     1 
ATOM   5117 O  O     . GLY C 3 573 ? 20.399  60.405 23.192  1.00 15.42  ? 869  GLY A O     1 
ATOM   5118 N  N     . SER C 3 574 ? 22.091  61.594 24.093  1.00 14.96  ? 870  SER A N     1 
ATOM   5119 C  CA    . SER C 3 574 ? 23.080  61.269 23.063  1.00 15.75  ? 870  SER A CA    1 
ATOM   5120 C  C     . SER C 3 574 ? 23.554  59.820 23.012  1.00 16.39  ? 870  SER A C     1 
ATOM   5121 O  O     . SER C 3 574 ? 24.005  59.346 21.969  1.00 16.14  ? 870  SER A O     1 
ATOM   5122 C  CB    . SER C 3 574 ? 24.300  62.187 23.210  1.00 16.69  ? 870  SER A CB    1 
ATOM   5123 O  OG    . SER C 3 574 ? 23.957  63.526 22.896  1.00 20.05  ? 870  SER A OG    1 
ATOM   5124 N  N     . THR C 3 575 ? 23.474  59.124 24.138  1.00 16.10  ? 871  THR A N     1 
ATOM   5125 C  CA    . THR C 3 575 ? 23.872  57.725 24.190  1.00 16.69  ? 871  THR A CA    1 
ATOM   5126 C  C     . THR C 3 575 ? 22.857  57.043 25.090  1.00 17.31  ? 871  THR A C     1 
ATOM   5127 O  O     . THR C 3 575 ? 22.036  57.713 25.716  1.00 17.40  ? 871  THR A O     1 
ATOM   5128 C  CB    . THR C 3 575 ? 25.278  57.536 24.809  1.00 15.71  ? 871  THR A CB    1 
ATOM   5129 O  OG1   . THR C 3 575 ? 25.213  57.784 26.217  1.00 18.01  ? 871  THR A OG1   1 
ATOM   5130 C  CG2   . THR C 3 575 ? 26.291  58.499 24.173  1.00 16.11  ? 871  THR A CG2   1 
ATOM   5131 N  N     . TRP C 3 576 ? 22.911  55.719 25.153  1.00 16.75  ? 872  TRP A N     1 
ATOM   5132 C  CA    . TRP C 3 576 ? 21.998  54.959 25.996  1.00 17.65  ? 872  TRP A CA    1 
ATOM   5133 C  C     . TRP C 3 576 ? 22.214  55.358 27.457  1.00 17.86  ? 872  TRP A C     1 
ATOM   5134 O  O     . TRP C 3 576 ? 21.278  55.414 28.252  1.00 18.54  ? 872  TRP A O     1 
ATOM   5135 C  CB    . TRP C 3 576 ? 22.256  53.465 25.815  1.00 16.80  ? 872  TRP A CB    1 
ATOM   5136 C  CG    . TRP C 3 576 ? 21.193  52.581 26.398  1.00 16.07  ? 872  TRP A CG    1 
ATOM   5137 C  CD1   . TRP C 3 576 ? 20.034  52.974 27.009  1.00 16.47  ? 872  TRP A CD1   1 
ATOM   5138 C  CD2   . TRP C 3 576 ? 21.193  51.152 26.419  1.00 16.34  ? 872  TRP A CD2   1 
ATOM   5139 N  NE1   . TRP C 3 576 ? 19.312  51.871 27.410  1.00 14.29  ? 872  TRP A NE1   1 
ATOM   5140 C  CE2   . TRP C 3 576 ? 20.002  50.741 27.060  1.00 16.32  ? 872  TRP A CE2   1 
ATOM   5141 C  CE3   . TRP C 3 576 ? 22.086  50.176 25.958  1.00 17.22  ? 872  TRP A CE3   1 
ATOM   5142 C  CZ2   . TRP C 3 576 ? 19.682  49.394 27.254  1.00 16.56  ? 872  TRP A CZ2   1 
ATOM   5143 C  CZ3   . TRP C 3 576 ? 21.767  48.835 26.150  1.00 18.19  ? 872  TRP A CZ3   1 
ATOM   5144 C  CH2   . TRP C 3 576 ? 20.574  48.459 26.795  1.00 18.03  ? 872  TRP A CH2   1 
ATOM   5145 N  N     . TYR C 3 577 ? 23.459  55.645 27.804  1.00 19.85  ? 873  TYR A N     1 
ATOM   5146 C  CA    . TYR C 3 577 ? 23.798  56.059 29.158  1.00 20.34  ? 873  TYR A CA    1 
ATOM   5147 C  C     . TYR C 3 577 ? 23.060  57.349 29.516  1.00 21.28  ? 873  TYR A C     1 
ATOM   5148 O  O     . TYR C 3 577 ? 22.581  57.518 30.637  1.00 21.74  ? 873  TYR A O     1 
ATOM   5149 C  CB    . TYR C 3 577 ? 25.305  56.298 29.257  1.00 21.83  ? 873  TYR A CB    1 
ATOM   5150 C  CG    . TYR C 3 577 ? 25.780  56.883 30.572  1.00 22.05  ? 873  TYR A CG    1 
ATOM   5151 C  CD1   . TYR C 3 577 ? 26.008  56.069 31.682  1.00 24.27  ? 873  TYR A CD1   1 
ATOM   5152 C  CD2   . TYR C 3 577 ? 26.047  58.248 30.690  1.00 23.63  ? 873  TYR A CD2   1 
ATOM   5153 C  CE1   . TYR C 3 577 ? 26.501  56.597 32.878  1.00 24.11  ? 873  TYR A CE1   1 
ATOM   5154 C  CE2   . TYR C 3 577 ? 26.535  58.789 31.880  1.00 24.45  ? 873  TYR A CE2   1 
ATOM   5155 C  CZ    . TYR C 3 577 ? 26.763  57.958 32.967  1.00 25.97  ? 873  TYR A CZ    1 
ATOM   5156 O  OH    . TYR C 3 577 ? 27.265  58.489 34.137  1.00 27.45  ? 873  TYR A OH    1 
ATOM   5157 N  N     . ASP C 3 578 ? 22.971  58.258 28.553  1.00 22.61  ? 874  ASP A N     1 
ATOM   5158 C  CA    . ASP C 3 578 ? 22.331  59.543 28.786  1.00 24.94  ? 874  ASP A CA    1 
ATOM   5159 C  C     . ASP C 3 578 ? 20.817  59.507 28.806  1.00 26.51  ? 874  ASP A C     1 
ATOM   5160 O  O     . ASP C 3 578 ? 20.184  60.438 29.299  1.00 27.11  ? 874  ASP A O     1 
ATOM   5161 C  CB    . ASP C 3 578 ? 22.812  60.552 27.745  1.00 26.45  ? 874  ASP A CB    1 
ATOM   5162 C  CG    . ASP C 3 578 ? 24.286  60.835 27.868  1.00 28.43  ? 874  ASP A CG    1 
ATOM   5163 O  OD1   . ASP C 3 578 ? 25.027  60.602 26.889  1.00 31.62  ? 874  ASP A OD1   1 
ATOM   5164 O  OD2   . ASP C 3 578 ? 24.704  61.289 28.953  1.00 27.98  ? 874  ASP A OD2   1 
ATOM   5165 N  N     . ALA C 3 579 ? 20.236  58.435 28.276  1.00 27.08  ? 875  ALA A N     1 
ATOM   5166 C  CA    . ALA C 3 579 ? 18.787  58.302 28.247  1.00 28.83  ? 875  ALA A CA    1 
ATOM   5167 C  C     . ALA C 3 579 ? 18.285  57.928 29.633  1.00 30.31  ? 875  ALA A C     1 
ATOM   5168 O  O     . ALA C 3 579 ? 17.628  56.899 29.814  1.00 28.59  ? 875  ALA A O     1 
ATOM   5169 C  CB    . ALA C 3 579 ? 18.372  57.238 27.225  1.00 28.85  ? 875  ALA A CB    1 
ATOM   5170 N  N     . LYS C 3 580 ? 18.607  58.776 30.606  1.00 32.67  ? 876  LYS A N     1 
ATOM   5171 C  CA    . LYS C 3 580 ? 18.203  58.574 31.995  1.00 34.48  ? 876  LYS A CA    1 
ATOM   5172 C  C     . LYS C 3 580 ? 17.875  59.902 32.671  1.00 34.87  ? 876  LYS A C     1 
ATOM   5173 O  O     . LYS C 3 580 ? 17.977  60.953 32.001  1.00 35.22  ? 876  LYS A O     1 
ATOM   5174 C  CB    . LYS C 3 580 ? 19.309  57.854 32.778  1.00 35.51  ? 876  LYS A CB    1 
ATOM   5175 C  CG    . LYS C 3 580 ? 20.704  58.472 32.664  1.00 37.64  ? 876  LYS A CG    1 
ATOM   5176 C  CD    . LYS C 3 580 ? 20.827  59.794 33.397  1.00 38.64  ? 876  LYS A CD    1 
ATOM   5177 C  CE    . LYS C 3 580 ? 22.250  60.341 33.316  1.00 39.46  ? 876  LYS A CE    1 
ATOM   5178 N  NZ    . LYS C 3 580 ? 23.245  59.451 33.976  1.00 37.62  ? 876  LYS A NZ    1 
ATOM   5179 O  OXT   . LYS C 3 580 ? 17.519  59.870 33.866  1.00 35.26  ? 876  LYS A OXT   1 
HETATM 5180 C  C1    . SUC D 4 .   ? 18.480  28.751 17.616  1.00 36.51  ? 901  SUC A C1    1 
HETATM 5181 C  C2    . SUC D 4 .   ? 19.649  27.973 18.285  1.00 36.98  ? 901  SUC A C2    1 
HETATM 5182 C  C3    . SUC D 4 .   ? 19.965  28.774 19.711  1.00 37.52  ? 901  SUC A C3    1 
HETATM 5183 C  C4    . SUC D 4 .   ? 20.408  30.239 19.383  1.00 37.51  ? 901  SUC A C4    1 
HETATM 5184 C  C5    . SUC D 4 .   ? 19.324  30.970 18.498  1.00 36.89  ? 901  SUC A C5    1 
HETATM 5185 C  C6    . SUC D 4 .   ? 19.786  32.326 17.929  1.00 34.67  ? 901  SUC A C6    1 
HETATM 5186 O  O1    . SUC D 4 .   ? 17.289  28.771 18.492  1.00 35.55  ? 901  SUC A O1    1 
HETATM 5187 O  O2    . SUC D 4 .   ? 19.252  26.639 18.598  1.00 37.92  ? 901  SUC A O2    1 
HETATM 5188 O  O3    . SUC D 4 .   ? 21.038  28.074 20.320  1.00 39.42  ? 901  SUC A O3    1 
HETATM 5189 O  O4    . SUC D 4 .   ? 20.639  30.921 20.626  1.00 38.23  ? 901  SUC A O4    1 
HETATM 5190 O  O5    . SUC D 4 .   ? 18.943  30.127 17.340  1.00 36.35  ? 901  SUC A O5    1 
HETATM 5191 O  O6    . SUC D 4 .   ? 20.980  32.180 17.156  1.00 33.02  ? 901  SUC A O6    1 
HETATM 5192 C  "C1'" . SUC D 4 .   ? 15.882  26.990 17.424  1.00 35.97  ? 901  SUC A "C1'" 1 
HETATM 5193 C  "C2'" . SUC D 4 .   ? 15.946  28.452 17.971  1.00 35.34  ? 901  SUC A "C2'" 1 
HETATM 5194 C  "C3'" . SUC D 4 .   ? 14.776  28.834 18.909  1.00 33.95  ? 901  SUC A "C3'" 1 
HETATM 5195 C  "C4'" . SUC D 4 .   ? 14.581  30.330 18.631  1.00 33.25  ? 901  SUC A "C4'" 1 
HETATM 5196 C  "C5'" . SUC D 4 .   ? 14.986  30.468 17.140  1.00 33.62  ? 901  SUC A "C5'" 1 
HETATM 5197 C  "C6'" . SUC D 4 .   ? 15.796  31.715 16.739  1.00 32.29  ? 901  SUC A "C6'" 1 
HETATM 5198 O  "O1'" . SUC D 4 .   ? 14.737  26.760 16.589  1.00 38.00  ? 901  SUC A "O1'" 1 
HETATM 5199 O  "O2'" . SUC D 4 .   ? 15.774  29.298 16.815  1.00 34.45  ? 901  SUC A "O2'" 1 
HETATM 5200 O  "O3'" . SUC D 4 .   ? 15.001  28.574 20.301  1.00 32.20  ? 901  SUC A "O3'" 1 
HETATM 5201 O  "O4'" . SUC D 4 .   ? 13.237  30.729 18.911  1.00 29.60  ? 901  SUC A "O4'" 1 
HETATM 5202 O  "O6'" . SUC D 4 .   ? 16.068  31.649 15.342  1.00 26.25  ? 901  SUC A "O6'" 1 
HETATM 5203 C  C1    . SUC E 4 .   ? -0.521  23.495 51.165  1.00 45.22  ? 902  SUC A C1    1 
HETATM 5204 C  C2    . SUC E 4 .   ? -0.014  22.362 50.215  1.00 44.29  ? 902  SUC A C2    1 
HETATM 5205 C  C3    . SUC E 4 .   ? -1.061  22.364 48.911  1.00 44.45  ? 902  SUC A C3    1 
HETATM 5206 C  C4    . SUC E 4 .   ? -2.504  22.045 49.415  1.00 45.11  ? 902  SUC A C4    1 
HETATM 5207 C  C5    . SUC E 4 .   ? -2.941  23.043 50.554  1.00 45.81  ? 902  SUC A C5    1 
HETATM 5208 C  C6    . SUC E 4 .   ? -4.249  22.640 51.266  1.00 44.33  ? 902  SUC A C6    1 
HETATM 5209 O  O1    . SUC E 4 .   ? -0.529  24.805 50.482  1.00 46.39  ? 902  SUC A O1    1 
HETATM 5210 O  O2    . SUC E 4 .   ? 1.304   22.650 49.741  1.00 40.07  ? 902  SUC A O2    1 
HETATM 5211 O  O3    . SUC E 4 .   ? -0.618  21.326 48.043  1.00 44.47  ? 902  SUC A O3    1 
HETATM 5212 O  O4    . SUC E 4 .   ? -3.390  22.096 48.284  1.00 45.64  ? 902  SUC A O4    1 
HETATM 5213 O  O5    . SUC E 4 .   ? -1.890  23.143 51.599  1.00 45.61  ? 902  SUC A O5    1 
HETATM 5214 O  O6    . SUC E 4 .   ? -4.925  23.789 51.770  1.00 44.62  ? 902  SUC A O6    1 
HETATM 5215 C  "C1'" . SUC E 4 .   ? 1.402   26.249 51.121  1.00 47.55  ? 902  SUC A "C1'" 1 
HETATM 5216 C  "C2'" . SUC E 4 .   ? -0.149  26.060 51.168  1.00 47.37  ? 902  SUC A "C2'" 1 
HETATM 5217 C  "C3'" . SUC E 4 .   ? -0.978  27.298 50.731  1.00 47.83  ? 902  SUC A "C3'" 1 
HETATM 5218 C  "C4'" . SUC E 4 .   ? -2.213  27.194 51.625  1.00 47.60  ? 902  SUC A "C4'" 1 
HETATM 5219 C  "C5'" . SUC E 4 .   ? -1.609  26.702 52.956  1.00 47.84  ? 902  SUC A "C5'" 1 
HETATM 5220 C  "C6'" . SUC E 4 .   ? -2.532  25.871 53.869  1.00 48.17  ? 902  SUC A "C6'" 1 
HETATM 5221 O  "O1'" . SUC E 4 .   ? 1.829   27.589 51.406  1.00 48.49  ? 902  SUC A "O1'" 1 
HETATM 5222 O  "O2'" . SUC E 4 .   ? -0.471  25.883 52.576  1.00 48.00  ? 902  SUC A "O2'" 1 
HETATM 5223 O  "O3'" . SUC E 4 .   ? -1.335  27.324 49.346  1.00 46.47  ? 902  SUC A "O3'" 1 
HETATM 5224 O  "O4'" . SUC E 4 .   ? -2.900  28.438 51.708  1.00 48.18  ? 902  SUC A "O4'" 1 
HETATM 5225 O  "O6'" . SUC E 4 .   ? -1.860  25.590 55.096  1.00 49.84  ? 902  SUC A "O6'" 1 
HETATM 5226 S  S     . SO4 F 5 .   ? 13.259  52.341 44.403  1.00 50.56  ? 910  SO4 A S     1 
HETATM 5227 O  O1    . SO4 F 5 .   ? 13.966  53.563 43.970  1.00 50.40  ? 910  SO4 A O1    1 
HETATM 5228 O  O2    . SO4 F 5 .   ? 13.853  51.846 45.662  1.00 50.33  ? 910  SO4 A O2    1 
HETATM 5229 O  O3    . SO4 F 5 .   ? 13.381  51.304 43.359  1.00 52.43  ? 910  SO4 A O3    1 
HETATM 5230 O  O4    . SO4 F 5 .   ? 11.830  52.639 44.615  1.00 50.82  ? 910  SO4 A O4    1 
HETATM 5231 S  S     . SO4 G 5 .   ? -2.733  55.132 6.541   1.00 50.53  ? 911  SO4 A S     1 
HETATM 5232 O  O1    . SO4 G 5 .   ? -3.184  56.370 5.873   1.00 51.19  ? 911  SO4 A O1    1 
HETATM 5233 O  O2    . SO4 G 5 .   ? -1.334  54.852 6.168   1.00 50.26  ? 911  SO4 A O2    1 
HETATM 5234 O  O3    . SO4 G 5 .   ? -2.826  55.295 8.004   1.00 49.68  ? 911  SO4 A O3    1 
HETATM 5235 O  O4    . SO4 G 5 .   ? -3.586  54.005 6.114   1.00 51.17  ? 911  SO4 A O4    1 
HETATM 5236 S  S     . SO4 H 5 .   ? 4.443   10.019 -1.501  1.00 40.60  ? 912  SO4 A S     1 
HETATM 5237 O  O1    . SO4 H 5 .   ? 5.608   10.695 -0.898  1.00 40.47  ? 912  SO4 A O1    1 
HETATM 5238 O  O2    . SO4 H 5 .   ? 4.139   8.789  -0.746  1.00 41.25  ? 912  SO4 A O2    1 
HETATM 5239 O  O3    . SO4 H 5 .   ? 3.272   10.915 -1.475  1.00 40.12  ? 912  SO4 A O3    1 
HETATM 5240 O  O4    . SO4 H 5 .   ? 4.761   9.660  -2.895  1.00 42.50  ? 912  SO4 A O4    1 
HETATM 5241 S  S     . SO4 I 5 .   ? 17.777  30.246 61.128  1.00 69.10  ? 913  SO4 A S     1 
HETATM 5242 O  O1    . SO4 I 5 .   ? 18.653  31.372 61.510  1.00 67.97  ? 913  SO4 A O1    1 
HETATM 5243 O  O2    . SO4 I 5 .   ? 16.896  29.898 62.261  1.00 67.67  ? 913  SO4 A O2    1 
HETATM 5244 O  O3    . SO4 I 5 .   ? 16.953  30.631 59.965  1.00 68.06  ? 913  SO4 A O3    1 
HETATM 5245 O  O4    . SO4 I 5 .   ? 18.607  29.080 60.770  1.00 68.15  ? 913  SO4 A O4    1 
HETATM 5246 S  S     . SO4 J 5 .   ? 5.072   31.693 54.340  1.00 101.36 ? 914  SO4 A S     1 
HETATM 5247 O  O1    . SO4 J 5 .   ? 5.374   30.257 54.177  1.00 100.96 ? 914  SO4 A O1    1 
HETATM 5248 O  O2    . SO4 J 5 .   ? 3.609   31.888 54.388  1.00 100.77 ? 914  SO4 A O2    1 
HETATM 5249 O  O3    . SO4 J 5 .   ? 5.679   32.183 55.594  1.00 100.54 ? 914  SO4 A O3    1 
HETATM 5250 O  O4    . SO4 J 5 .   ? 5.626   32.443 53.196  1.00 100.84 ? 914  SO4 A O4    1 
HETATM 5251 MG MG    . MG  K 6 .   ? 11.147  50.103 35.547  1.00 30.56  ? 920  MG  A MG    1 
HETATM 5252 O  O     . HOH L 7 .   ? 31.754  40.476 42.295  1.00 40.81  ? 1049 HOH B O     1 
HETATM 5253 O  O     . HOH L 7 .   ? 29.430  46.822 37.006  1.00 29.29  ? 2170 HOH B O     1 
HETATM 5254 O  O     . HOH L 7 .   ? 23.929  32.325 39.980  1.00 46.56  ? 2868 HOH B O     1 
HETATM 5255 O  O     . HOH L 7 .   ? 34.054  30.664 38.586  1.00 37.11  ? 2915 HOH B O     1 
HETATM 5256 O  O     . HOH L 7 .   ? 22.933  36.284 40.379  1.00 34.26  ? 3110 HOH B O     1 
HETATM 5257 O  O     . HOH L 7 .   ? 30.816  44.303 37.031  1.00 32.45  ? 3232 HOH B O     1 
HETATM 5258 O  O     . HOH L 7 .   ? 29.095  17.845 38.122  1.00 47.44  ? 3235 HOH B O     1 
HETATM 5259 O  O     . HOH L 7 .   ? 31.322  36.240 36.099  1.00 46.24  ? 3317 HOH B O     1 
HETATM 5260 O  O     . HOH L 7 .   ? 26.806  47.173 37.565  1.00 37.82  ? 3327 HOH B O     1 
HETATM 5261 O  O     . HOH M 7 .   ? 19.594  37.996 30.425  1.00 21.95  ? 1010 HOH C O     1 
HETATM 5262 O  O     . HOH M 7 .   ? 22.615  31.077 24.684  1.00 26.97  ? 2290 HOH C O     1 
HETATM 5263 O  O     . HOH M 7 .   ? 30.948  37.677 22.670  1.00 28.27  ? 2600 HOH C O     1 
HETATM 5264 O  O     . HOH M 7 .   ? 26.678  32.144 25.857  1.00 32.90  ? 2742 HOH C O     1 
HETATM 5265 O  O     . HOH M 7 .   ? 13.087  27.961 29.185  1.00 24.24  ? 2820 HOH C O     1 
HETATM 5266 O  O     . HOH M 7 .   ? 21.529  30.484 28.344  1.00 35.62  ? 2828 HOH C O     1 
HETATM 5267 O  O     . HOH M 7 .   ? 31.308  35.887 20.796  1.00 34.81  ? 2829 HOH C O     1 
HETATM 5268 O  O     . HOH M 7 .   ? 44.635  31.774 33.666  1.00 48.93  ? 2913 HOH C O     1 
HETATM 5269 O  O     . HOH M 7 .   ? 31.299  32.741 26.592  1.00 34.07  ? 2980 HOH C O     1 
HETATM 5270 O  O     . HOH M 7 .   ? 18.570  32.029 36.916  1.00 36.99  ? 3020 HOH C O     1 
HETATM 5271 O  O     . HOH M 7 .   ? 27.984  37.811 22.594  1.00 44.35  ? 3050 HOH C O     1 
HETATM 5272 O  O     . HOH M 7 .   ? 15.583  31.550 34.551  1.00 37.40  ? 3089 HOH C O     1 
HETATM 5273 O  O     . HOH M 7 .   ? 13.865  31.268 39.833  1.00 49.96  ? 3112 HOH C O     1 
HETATM 5274 O  O     . HOH M 7 .   ? 15.085  41.076 47.496  1.00 46.51  ? 3116 HOH C O     1 
HETATM 5275 O  O     . HOH M 7 .   ? 12.832  31.103 47.118  1.00 41.46  ? 3261 HOH C O     1 
HETATM 5276 O  O     . HOH M 7 .   ? 26.585  39.105 32.814  1.00 41.58  ? 3264 HOH C O     1 
HETATM 5277 O  O     . HOH M 7 .   ? 27.076  35.385 22.758  1.00 46.68  ? 3265 HOH C O     1 
HETATM 5278 O  O     . HOH M 7 .   ? 15.844  27.585 28.693  1.00 33.54  ? 3310 HOH C O     1 
HETATM 5279 O  O     . HOH M 7 .   ? 19.927  30.964 24.797  1.00 49.24  ? 3322 HOH C O     1 
HETATM 5280 O  O     . HOH M 7 .   ? 18.270  28.629 27.299  1.00 39.28  ? 3323 HOH C O     1 
HETATM 5281 O  O     . HOH M 7 .   ? 24.726  32.501 22.312  1.00 44.19  ? 3325 HOH C O     1 
HETATM 5282 O  O     . HOH M 7 .   ? 34.773  33.755 34.468  1.00 41.39  ? 3329 HOH C O     1 
HETATM 5283 O  O     . HOH N 7 .   ? 11.276  33.644 24.933  1.00 14.10  ? 1004 HOH A O     1 
HETATM 5284 O  O     . HOH N 7 .   ? 17.717  40.369 31.235  1.00 24.14  ? 1006 HOH A O     1 
HETATM 5285 O  O     . HOH N 7 .   ? 9.529   27.213 7.540   1.00 10.29  ? 1008 HOH A O     1 
HETATM 5286 O  O     . HOH N 7 .   ? 17.993  37.840 27.812  1.00 20.54  ? 1009 HOH A O     1 
HETATM 5287 O  O     . HOH N 7 .   ? 3.415   51.008 35.172  1.00 15.68  ? 1016 HOH A O     1 
HETATM 5288 O  O     . HOH N 7 .   ? 14.810  36.526 29.501  1.00 19.36  ? 1028 HOH A O     1 
HETATM 5289 O  O     . HOH N 7 .   ? 18.343  45.870 17.541  1.00 12.62  ? 1030 HOH A O     1 
HETATM 5290 O  O     . HOH N 7 .   ? 13.778  33.696 15.341  1.00 14.22  ? 1031 HOH A O     1 
HETATM 5291 O  O     . HOH N 7 .   ? 10.087  34.259 16.527  1.00 14.71  ? 1032 HOH A O     1 
HETATM 5292 O  O     . HOH N 7 .   ? 12.786  30.029 8.747   1.00 23.95  ? 1034 HOH A O     1 
HETATM 5293 O  O     . HOH N 7 .   ? 11.951  28.360 7.010   1.00 16.59  ? 1035 HOH A O     1 
HETATM 5294 O  O     . HOH N 7 .   ? 10.672  40.257 27.818  1.00 22.64  ? 1037 HOH A O     1 
HETATM 5295 O  O     . HOH N 7 .   ? 4.021   31.257 26.008  1.00 17.46  ? 1040 HOH A O     1 
HETATM 5296 O  O     . HOH N 7 .   ? 1.467   29.812 26.672  1.00 16.54  ? 1041 HOH A O     1 
HETATM 5297 O  O     . HOH N 7 .   ? 4.132   24.835 30.451  1.00 14.93  ? 1042 HOH A O     1 
HETATM 5298 O  O     . HOH N 7 .   ? 12.353  33.480 18.030  1.00 15.88  ? 1045 HOH A O     1 
HETATM 5299 O  O     . HOH N 7 .   ? 14.101  37.052 31.820  1.00 30.24  ? 1046 HOH A O     1 
HETATM 5300 O  O     . HOH N 7 .   ? 16.269  25.190 -8.394  1.00 33.33  ? 2001 HOH A O     1 
HETATM 5301 O  O     . HOH N 7 .   ? 2.604   28.400 -3.307  1.00 25.18  ? 2002 HOH A O     1 
HETATM 5302 O  O     . HOH N 7 .   ? 9.628   40.015 -1.976  1.00 21.91  ? 2003 HOH A O     1 
HETATM 5303 O  O     . HOH N 7 .   ? 2.527   14.441 5.293   1.00 19.30  ? 2006 HOH A O     1 
HETATM 5304 O  O     . HOH N 7 .   ? 21.294  36.636 4.638   1.00 17.81  ? 2007 HOH A O     1 
HETATM 5305 O  O     . HOH N 7 .   ? -1.747  24.065 5.905   1.00 34.38  ? 2009 HOH A O     1 
HETATM 5306 O  O     . HOH N 7 .   ? 25.220  27.902 5.591   1.00 18.83  ? 2010 HOH A O     1 
HETATM 5307 O  O     . HOH N 7 .   ? 7.008   15.130 6.587   1.00 14.12  ? 2011 HOH A O     1 
HETATM 5308 O  O     . HOH N 7 .   ? 22.778  28.996 6.585   1.00 14.89  ? 2012 HOH A O     1 
HETATM 5309 O  O     . HOH N 7 .   ? 27.314  41.490 7.801   1.00 14.78  ? 2013 HOH A O     1 
HETATM 5310 O  O     . HOH N 7 .   ? 14.585  47.353 10.208  1.00 20.30  ? 2016 HOH A O     1 
HETATM 5311 O  O     . HOH N 7 .   ? 13.369  19.167 12.337  1.00 15.92  ? 2018 HOH A O     1 
HETATM 5312 O  O     . HOH N 7 .   ? 13.224  22.885 12.243  1.00 22.90  ? 2019 HOH A O     1 
HETATM 5313 O  O     . HOH N 7 .   ? -0.880  36.851 12.214  1.00 17.64  ? 2020 HOH A O     1 
HETATM 5314 O  O     . HOH N 7 .   ? 12.863  48.679 14.259  1.00 15.16  ? 2021 HOH A O     1 
HETATM 5315 O  O     . HOH N 7 .   ? 1.836   47.224 14.473  1.00 17.95  ? 2022 HOH A O     1 
HETATM 5316 O  O     . HOH N 7 .   ? 8.301   14.405 15.018  1.00 15.59  ? 2023 HOH A O     1 
HETATM 5317 O  O     . HOH N 7 .   ? 9.698   50.473 15.258  1.00 14.52  ? 2024 HOH A O     1 
HETATM 5318 O  O     . HOH N 7 .   ? 17.062  19.119 16.348  1.00 20.61  ? 2025 HOH A O     1 
HETATM 5319 O  O     . HOH N 7 .   ? 26.165  41.635 15.899  1.00 32.16  ? 2026 HOH A O     1 
HETATM 5320 O  O     . HOH N 7 .   ? 21.894  52.692 17.104  1.00 12.53  ? 2028 HOH A O     1 
HETATM 5321 O  O     . HOH N 7 .   ? -4.133  15.076 25.071  1.00 29.90  ? 2029 HOH A O     1 
HETATM 5322 O  O     . HOH N 7 .   ? 20.706  44.585 18.124  1.00 11.24  ? 2031 HOH A O     1 
HETATM 5323 O  O     . HOH N 7 .   ? 11.836  67.178 19.200  1.00 16.19  ? 2033 HOH A O     1 
HETATM 5324 O  O     . HOH N 7 .   ? 3.112   62.880 19.942  1.00 13.77  ? 2034 HOH A O     1 
HETATM 5325 O  O     . HOH N 7 .   ? 2.476   65.630 20.307  1.00 23.38  ? 2035 HOH A O     1 
HETATM 5326 O  O     . HOH N 7 .   ? 12.207  27.396 21.012  1.00 23.85  ? 2036 HOH A O     1 
HETATM 5327 O  O     . HOH N 7 .   ? -6.290  34.341 22.460  1.00 14.34  ? 2037 HOH A O     1 
HETATM 5328 O  O     . HOH N 7 .   ? 7.612   24.722 23.363  1.00 25.06  ? 2038 HOH A O     1 
HETATM 5329 O  O     . HOH N 7 .   ? -1.942  51.176 23.353  1.00 12.98  ? 2040 HOH A O     1 
HETATM 5330 O  O     . HOH N 7 .   ? 5.784   67.069 23.703  1.00 15.91  ? 2041 HOH A O     1 
HETATM 5331 O  O     . HOH N 7 .   ? -4.500  29.327 27.839  1.00 19.62  ? 2045 HOH A O     1 
HETATM 5332 O  O     . HOH N 7 .   ? -7.302  22.742 29.031  1.00 14.96  ? 2046 HOH A O     1 
HETATM 5333 O  O     . HOH N 7 .   ? 20.498  45.885 29.243  1.00 20.71  ? 2048 HOH A O     1 
HETATM 5334 O  O     . HOH N 7 .   ? 20.632  53.794 30.477  1.00 22.39  ? 2050 HOH A O     1 
HETATM 5335 O  O     . HOH N 7 .   ? -4.354  20.726 32.338  1.00 12.56  ? 2051 HOH A O     1 
HETATM 5336 O  O     . HOH N 7 .   ? 9.704   60.302 33.291  1.00 20.34  ? 2053 HOH A O     1 
HETATM 5337 O  O     . HOH N 7 .   ? -0.354  19.973 34.629  1.00 15.17  ? 2055 HOH A O     1 
HETATM 5338 O  O     . HOH N 7 .   ? -5.944  28.467 35.112  1.00 26.45  ? 2057 HOH A O     1 
HETATM 5339 O  O     . HOH N 7 .   ? -4.456  31.428 36.085  1.00 28.94  ? 2058 HOH A O     1 
HETATM 5340 O  O     . HOH N 7 .   ? 5.717   21.853 37.395  1.00 14.50  ? 2059 HOH A O     1 
HETATM 5341 O  O     . HOH N 7 .   ? 13.474  15.092 7.620   1.00 13.21  ? 2101 HOH A O     1 
HETATM 5342 O  O     . HOH N 7 .   ? 0.565   8.798  14.018  1.00 15.98  ? 2103 HOH A O     1 
HETATM 5343 O  O     . HOH N 7 .   ? 23.078  37.864 2.866   1.00 14.51  ? 2105 HOH A O     1 
HETATM 5344 O  O     . HOH N 7 .   ? 4.771   52.915 40.397  1.00 19.74  ? 2109 HOH A O     1 
HETATM 5345 O  O     . HOH N 7 .   ? 38.311  43.538 52.736  1.00 25.36  ? 2111 HOH A O     1 
HETATM 5346 O  O     . HOH N 7 .   ? 10.720  12.922 14.295  1.00 19.19  ? 2112 HOH A O     1 
HETATM 5347 O  O     . HOH N 7 .   ? 3.681   43.348 12.634  1.00 15.44  ? 2115 HOH A O     1 
HETATM 5348 O  O     . HOH N 7 .   ? 22.743  63.879 26.123  1.00 22.78  ? 2116 HOH A O     1 
HETATM 5349 O  O     . HOH N 7 .   ? 14.477  27.785 14.147  1.00 22.52  ? 2121 HOH A O     1 
HETATM 5350 O  O     . HOH N 7 .   ? 6.283   53.171 43.888  1.00 29.28  ? 2123 HOH A O     1 
HETATM 5351 O  O     . HOH N 7 .   ? 22.166  55.053 32.267  1.00 23.21  ? 2126 HOH A O     1 
HETATM 5352 O  O     . HOH N 7 .   ? -3.415  21.592 8.079   1.00 17.93  ? 2132 HOH A O     1 
HETATM 5353 O  O     . HOH N 7 .   ? 7.658   6.613  14.921  1.00 22.41  ? 2135 HOH A O     1 
HETATM 5354 O  O     . HOH N 7 .   ? -3.208  53.461 32.447  1.00 32.51  ? 2137 HOH A O     1 
HETATM 5355 O  O     . HOH N 7 .   ? -6.609  45.100 51.128  1.00 18.47  ? 2139 HOH A O     1 
HETATM 5356 O  O     . HOH N 7 .   ? 9.172   22.041 40.950  1.00 22.87  ? 2140 HOH A O     1 
HETATM 5357 O  O     . HOH N 7 .   ? 8.034   40.393 26.955  1.00 31.00  ? 2144 HOH A O     1 
HETATM 5358 O  O     . HOH N 7 .   ? 15.301  28.997 8.281   1.00 20.29  ? 2145 HOH A O     1 
HETATM 5359 O  O     . HOH N 7 .   ? 4.620   35.922 -8.873  1.00 22.09  ? 2149 HOH A O     1 
HETATM 5360 O  O     . HOH N 7 .   ? 16.476  52.697 52.095  1.00 25.37  ? 2154 HOH A O     1 
HETATM 5361 O  O     . HOH N 7 .   ? 17.205  13.797 4.401   1.00 26.38  ? 2156 HOH A O     1 
HETATM 5362 O  O     . HOH N 7 .   ? 9.670   54.292 11.475  1.00 35.77  ? 2159 HOH A O     1 
HETATM 5363 O  O     . HOH N 7 .   ? -2.500  25.442 -2.022  1.00 19.02  ? 2160 HOH A O     1 
HETATM 5364 O  O     . HOH N 7 .   ? -5.138  36.621 23.780  1.00 17.48  ? 2163 HOH A O     1 
HETATM 5365 O  O     . HOH N 7 .   ? -0.190  17.780 23.528  1.00 57.66  ? 2171 HOH A O     1 
HETATM 5366 O  O     . HOH N 7 .   ? 25.348  56.015 9.373   1.00 41.11  ? 2186 HOH A O     1 
HETATM 5367 O  O     . HOH N 7 .   ? 33.228  31.457 54.318  1.00 28.01  ? 2187 HOH A O     1 
HETATM 5368 O  O     . HOH N 7 .   ? 3.150   54.401 42.340  1.00 22.44  ? 2188 HOH A O     1 
HETATM 5369 O  O     . HOH N 7 .   ? 15.548  63.102 29.271  1.00 29.56  ? 2194 HOH A O     1 
HETATM 5370 O  O     . HOH N 7 .   ? 0.624   62.183 20.814  1.00 36.12  ? 2196 HOH A O     1 
HETATM 5371 O  O     . HOH N 7 .   ? -3.912  35.990 35.228  1.00 33.67  ? 2201 HOH A O     1 
HETATM 5372 O  O     . HOH N 7 .   ? 10.409  48.026 14.139  1.00 23.92  ? 2204 HOH A O     1 
HETATM 5373 O  O     . HOH N 7 .   ? -7.687  51.915 36.376  1.00 27.55  ? 2211 HOH A O     1 
HETATM 5374 O  O     . HOH N 7 .   ? -1.758  23.326 25.685  1.00 12.07  ? 2214 HOH A O     1 
HETATM 5375 O  O     . HOH N 7 .   ? 9.391   40.446 8.701   1.00 27.49  ? 2216 HOH A O     1 
HETATM 5376 O  O     . HOH N 7 .   ? 25.890  36.017 11.483  1.00 31.48  ? 2221 HOH A O     1 
HETATM 5377 O  O     . HOH N 7 .   ? 3.460   59.039 32.014  1.00 38.82  ? 2228 HOH A O     1 
HETATM 5378 O  O     . HOH N 7 .   ? 13.421  49.693 11.522  1.00 25.11  ? 2234 HOH A O     1 
HETATM 5379 O  O     . HOH N 7 .   ? 8.930   51.959 13.204  1.00 29.14  ? 2244 HOH A O     1 
HETATM 5380 O  O     . HOH N 7 .   ? 5.603   22.771 -11.751 1.00 25.66  ? 2248 HOH A O     1 
HETATM 5381 O  O     . HOH N 7 .   ? 1.086   30.928 -0.834  1.00 27.92  ? 2249 HOH A O     1 
HETATM 5382 O  O     . HOH N 7 .   ? 13.623  26.615 7.905   1.00 23.20  ? 2250 HOH A O     1 
HETATM 5383 O  O     . HOH N 7 .   ? -0.654  29.673 5.287   1.00 26.81  ? 2254 HOH A O     1 
HETATM 5384 O  O     . HOH N 7 .   ? 7.820   36.675 11.290  1.00 17.88  ? 2255 HOH A O     1 
HETATM 5385 O  O     . HOH N 7 .   ? 7.849   38.595 9.375   1.00 26.77  ? 2256 HOH A O     1 
HETATM 5386 O  O     . HOH N 7 .   ? 3.113   37.469 9.932   1.00 25.40  ? 2258 HOH A O     1 
HETATM 5387 O  O     . HOH N 7 .   ? 3.718   38.360 7.467   1.00 20.10  ? 2259 HOH A O     1 
HETATM 5388 O  O     . HOH N 7 .   ? 6.393   15.321 22.444  1.00 36.64  ? 2262 HOH A O     1 
HETATM 5389 O  O     . HOH N 7 .   ? 11.776  11.300 8.190   1.00 21.92  ? 2264 HOH A O     1 
HETATM 5390 O  O     . HOH N 7 .   ? 14.840  13.455 5.893   1.00 22.89  ? 2266 HOH A O     1 
HETATM 5391 O  O     . HOH N 7 .   ? 18.455  31.757 22.305  1.00 39.63  ? 2268 HOH A O     1 
HETATM 5392 O  O     . HOH N 7 .   ? 2.993   45.291 48.203  1.00 19.03  ? 2302 HOH A O     1 
HETATM 5393 O  O     . HOH N 7 .   ? 15.335  44.024 47.581  1.00 27.06  ? 2304 HOH A O     1 
HETATM 5394 O  O     . HOH N 7 .   ? 11.049  42.516 5.245   1.00 28.66  ? 2307 HOH A O     1 
HETATM 5395 O  O     . HOH N 7 .   ? 1.076   38.636 11.615  1.00 18.23  ? 2308 HOH A O     1 
HETATM 5396 O  O     . HOH N 7 .   ? 5.226   44.896 11.157  1.00 32.10  ? 2309 HOH A O     1 
HETATM 5397 O  O     . HOH N 7 .   ? -2.388  42.764 16.162  1.00 17.93  ? 2313 HOH A O     1 
HETATM 5398 O  O     . HOH N 7 .   ? 7.049   53.701 10.864  1.00 41.52  ? 2315 HOH A O     1 
HETATM 5399 O  O     . HOH N 7 .   ? -3.753  38.563 22.059  1.00 25.87  ? 2319 HOH A O     1 
HETATM 5400 O  O     . HOH N 7 .   ? -2.160  42.591 20.055  1.00 26.95  ? 2321 HOH A O     1 
HETATM 5401 O  O     . HOH N 7 .   ? -2.138  51.814 17.757  1.00 22.41  ? 2323 HOH A O     1 
HETATM 5402 O  O     . HOH N 7 .   ? 19.755  51.169 13.927  1.00 19.57  ? 2324 HOH A O     1 
HETATM 5403 O  O     . HOH N 7 .   ? 18.769  51.443 11.427  1.00 22.92  ? 2325 HOH A O     1 
HETATM 5404 O  O     . HOH N 7 .   ? 13.112  45.975 8.253   1.00 22.50  ? 2326 HOH A O     1 
HETATM 5405 O  O     . HOH N 7 .   ? 27.314  44.424 8.165   1.00 20.35  ? 2327 HOH A O     1 
HETATM 5406 O  O     . HOH N 7 .   ? 25.405  45.954 9.765   1.00 19.90  ? 2328 HOH A O     1 
HETATM 5407 O  O     . HOH N 7 .   ? 23.521  47.226 8.283   1.00 23.10  ? 2329 HOH A O     1 
HETATM 5408 O  O     . HOH N 7 .   ? 15.417  55.325 52.016  1.00 31.99  ? 2331 HOH A O     1 
HETATM 5409 O  O     . HOH N 7 .   ? 16.939  34.634 48.802  1.00 42.66  ? 2333 HOH A O     1 
HETATM 5410 O  O     . HOH N 7 .   ? 7.298   23.570 38.755  1.00 23.98  ? 2340 HOH A O     1 
HETATM 5411 O  O     . HOH N 7 .   ? 7.721   25.828 32.412  1.00 27.84  ? 2341 HOH A O     1 
HETATM 5412 O  O     . HOH N 7 .   ? 9.406   24.520 34.721  1.00 35.47  ? 2342 HOH A O     1 
HETATM 5413 O  O     . HOH N 7 .   ? 7.133   21.255 35.222  1.00 34.30  ? 2344 HOH A O     1 
HETATM 5414 O  O     . HOH N 7 .   ? 39.128  39.945 31.997  1.00 40.08  ? 2346 HOH A O     1 
HETATM 5415 O  O     . HOH N 7 .   ? 0.036   13.696 6.522   1.00 26.50  ? 2358 HOH A O     1 
HETATM 5416 O  O     . HOH N 7 .   ? 24.261  48.232 5.692   1.00 22.76  ? 2364 HOH A O     1 
HETATM 5417 O  O     . HOH N 7 .   ? 26.174  58.357 16.261  1.00 29.25  ? 2368 HOH A O     1 
HETATM 5418 O  O     . HOH N 7 .   ? -10.049 55.957 45.477  1.00 25.68  ? 2373 HOH A O     1 
HETATM 5419 O  O     . HOH N 7 .   ? -8.301  23.610 26.416  1.00 22.82  ? 2377 HOH A O     1 
HETATM 5420 O  O     . HOH N 7 .   ? -7.718  20.779 24.056  1.00 26.15  ? 2378 HOH A O     1 
HETATM 5421 O  O     . HOH N 7 .   ? -0.202  19.932 21.944  1.00 39.10  ? 2379 HOH A O     1 
HETATM 5422 O  O     . HOH N 7 .   ? -0.669  21.193 24.678  1.00 24.01  ? 2380 HOH A O     1 
HETATM 5423 O  O     . HOH N 7 .   ? -2.693  16.702 21.149  1.00 28.82  ? 2381 HOH A O     1 
HETATM 5424 O  O     . HOH N 7 .   ? -1.896  14.314 26.546  1.00 27.16  ? 2383 HOH A O     1 
HETATM 5425 O  O     . HOH N 7 .   ? -3.729  29.586 -5.911  1.00 32.45  ? 2402 HOH A O     1 
HETATM 5426 O  O     . HOH N 7 .   ? 26.786  33.328 8.113   1.00 25.37  ? 2403 HOH A O     1 
HETATM 5427 O  O     . HOH N 7 .   ? 26.005  31.134 13.929  1.00 29.07  ? 2404 HOH A O     1 
HETATM 5428 O  O     . HOH N 7 .   ? 23.772  41.759 3.017   1.00 15.53  ? 2407 HOH A O     1 
HETATM 5429 O  O     . HOH N 7 .   ? 24.667  43.407 1.005   1.00 25.75  ? 2408 HOH A O     1 
HETATM 5430 O  O     . HOH N 7 .   ? 13.726  17.534 17.661  1.00 23.04  ? 2419 HOH A O     1 
HETATM 5431 O  O     . HOH N 7 .   ? -2.057  19.583 26.803  1.00 32.98  ? 2424 HOH A O     1 
HETATM 5432 O  O     . HOH N 7 .   ? -5.370  19.440 18.053  1.00 25.84  ? 2429 HOH A O     1 
HETATM 5433 O  O     . HOH N 7 .   ? -5.080  21.831 25.214  1.00 23.52  ? 2430 HOH A O     1 
HETATM 5434 O  O     . HOH N 7 .   ? 29.895  57.432 22.985  1.00 23.23  ? 2431 HOH A O     1 
HETATM 5435 O  O     . HOH N 7 .   ? 39.664  28.412 57.739  1.00 26.92  ? 2437 HOH A O     1 
HETATM 5436 O  O     . HOH N 7 .   ? -9.276  43.248 49.894  1.00 28.50  ? 2462 HOH A O     1 
HETATM 5437 O  O     . HOH N 7 .   ? -1.227  18.522 36.915  1.00 25.76  ? 2491 HOH A O     1 
HETATM 5438 O  O     . HOH N 7 .   ? 5.585   17.076 51.200  1.00 31.56  ? 2504 HOH A O     1 
HETATM 5439 O  O     . HOH N 7 .   ? 12.203  39.513 4.574   1.00 11.25  ? 2510 HOH A O     1 
HETATM 5440 O  O     . HOH N 7 .   ? 8.206   47.882 36.078  1.00 15.57  ? 2512 HOH A O     1 
HETATM 5441 O  O     . HOH N 7 .   ? 8.476   35.222 24.075  1.00 15.64  ? 2513 HOH A O     1 
HETATM 5442 O  O     . HOH N 7 .   ? -4.965  50.628 33.392  1.00 16.25  ? 2514 HOH A O     1 
HETATM 5443 O  O     . HOH N 7 .   ? 9.132   38.321 38.058  1.00 24.51  ? 2515 HOH A O     1 
HETATM 5444 O  O     . HOH N 7 .   ? 6.674   44.499 31.210  1.00 21.00  ? 2516 HOH A O     1 
HETATM 5445 O  O     . HOH N 7 .   ? 7.606   31.673 37.817  1.00 28.05  ? 2518 HOH A O     1 
HETATM 5446 O  O     . HOH N 7 .   ? 8.271   41.261 29.450  1.00 15.96  ? 2520 HOH A O     1 
HETATM 5447 O  O     . HOH N 7 .   ? 9.823   49.990 38.266  1.00 20.12  ? 2525 HOH A O     1 
HETATM 5448 O  O     . HOH N 7 .   ? 7.868   45.371 37.804  1.00 23.88  ? 2526 HOH A O     1 
HETATM 5449 O  O     . HOH N 7 .   ? 6.664   45.841 40.440  1.00 14.92  ? 2528 HOH A O     1 
HETATM 5450 O  O     . HOH N 7 .   ? 8.427   65.215 13.946  1.00 20.57  ? 2529 HOH A O     1 
HETATM 5451 O  O     . HOH N 7 .   ? -3.220  52.078 11.478  1.00 36.42  ? 2530 HOH A O     1 
HETATM 5452 O  O     . HOH N 7 .   ? 13.355  27.920 10.251  1.00 28.15  ? 2531 HOH A O     1 
HETATM 5453 O  O     . HOH N 7 .   ? 5.723   23.860 32.689  1.00 32.33  ? 2536 HOH A O     1 
HETATM 5454 O  O     . HOH N 7 .   ? 4.562   36.492 11.778  1.00 35.79  ? 2539 HOH A O     1 
HETATM 5455 O  O     . HOH N 7 .   ? 27.794  37.053 9.596   1.00 31.90  ? 2543 HOH A O     1 
HETATM 5456 O  O     . HOH N 7 .   ? 24.817  39.252 15.496  1.00 31.00  ? 2549 HOH A O     1 
HETATM 5457 O  O     . HOH N 7 .   ? 8.938   26.574 22.344  1.00 29.96  ? 2550 HOH A O     1 
HETATM 5458 O  O     . HOH N 7 .   ? 18.759  26.233 11.732  1.00 41.80  ? 2553 HOH A O     1 
HETATM 5459 O  O     . HOH N 7 .   ? 2.604   62.313 17.534  1.00 29.92  ? 2554 HOH A O     1 
HETATM 5460 O  O     . HOH N 7 .   ? 16.157  44.881 3.454   1.00 27.71  ? 2556 HOH A O     1 
HETATM 5461 O  O     . HOH N 7 .   ? 18.086  34.417 20.707  1.00 29.46  ? 2558 HOH A O     1 
HETATM 5462 O  O     . HOH N 7 .   ? 17.962  64.765 12.573  1.00 31.21  ? 2559 HOH A O     1 
HETATM 5463 O  O     . HOH N 7 .   ? -8.913  28.879 43.526  1.00 26.06  ? 2564 HOH A O     1 
HETATM 5464 O  O     . HOH N 7 .   ? 10.902  41.730 37.359  1.00 44.79  ? 2574 HOH A O     1 
HETATM 5465 O  O     . HOH N 7 .   ? 4.647   11.082 18.741  1.00 30.74  ? 2575 HOH A O     1 
HETATM 5466 O  O     . HOH N 7 .   ? 26.209  34.694 3.861   1.00 27.05  ? 2577 HOH A O     1 
HETATM 5467 O  O     . HOH N 7 .   ? 0.708   16.729 38.274  1.00 40.10  ? 2583 HOH A O     1 
HETATM 5468 O  O     . HOH N 7 .   ? -2.796  45.295 19.387  1.00 27.41  ? 2586 HOH A O     1 
HETATM 5469 O  O     . HOH N 7 .   ? 14.732  57.144 8.316   1.00 35.26  ? 2589 HOH A O     1 
HETATM 5470 O  O     . HOH N 7 .   ? 10.595  63.167 10.957  1.00 32.71  ? 2596 HOH A O     1 
HETATM 5471 O  O     . HOH N 7 .   ? -5.932  37.077 34.097  1.00 42.51  ? 2601 HOH A O     1 
HETATM 5472 O  O     . HOH N 7 .   ? -9.205  50.025 46.474  1.00 37.77  ? 2618 HOH A O     1 
HETATM 5473 O  O     . HOH N 7 .   ? -4.017  27.181 48.291  1.00 25.82  ? 2619 HOH A O     1 
HETATM 5474 O  O     . HOH N 7 .   ? -2.680  19.813 38.863  1.00 37.74  ? 2620 HOH A O     1 
HETATM 5475 O  O     . HOH N 7 .   ? 10.553  50.332 10.951  1.00 35.60  ? 2626 HOH A O     1 
HETATM 5476 O  O     . HOH N 7 .   ? -5.808  31.522 12.193  1.00 28.05  ? 2629 HOH A O     1 
HETATM 5477 O  O     . HOH N 7 .   ? 18.456  36.727 47.369  1.00 55.48  ? 2634 HOH A O     1 
HETATM 5478 O  O     . HOH N 7 .   ? 8.170   42.501 33.241  1.00 36.87  ? 2639 HOH A O     1 
HETATM 5479 O  O     . HOH N 7 .   ? -1.020  16.819 4.954   1.00 24.21  ? 2641 HOH A O     1 
HETATM 5480 O  O     . HOH N 7 .   ? 6.384   51.512 12.774  1.00 32.73  ? 2642 HOH A O     1 
HETATM 5481 O  O     . HOH N 7 .   ? 15.878  45.644 49.562  1.00 22.46  ? 2643 HOH A O     1 
HETATM 5482 O  O     . HOH N 7 .   ? 3.941   35.397 47.126  1.00 24.48  ? 2644 HOH A O     1 
HETATM 5483 O  O     . HOH N 7 .   ? 10.315  52.913 39.099  1.00 30.54  ? 2645 HOH A O     1 
HETATM 5484 O  O     . HOH N 7 .   ? 0.322   22.745 46.035  1.00 30.08  ? 2646 HOH A O     1 
HETATM 5485 O  O     . HOH N 7 .   ? -0.547  14.411 44.632  1.00 20.44  ? 2648 HOH A O     1 
HETATM 5486 O  O     . HOH N 7 .   ? 1.742   17.021 4.364   1.00 24.81  ? 2650 HOH A O     1 
HETATM 5487 O  O     . HOH N 7 .   ? 4.730   66.843 26.235  1.00 23.77  ? 2651 HOH A O     1 
HETATM 5488 O  O     . HOH N 7 .   ? 10.143  40.694 -8.074  1.00 28.90  ? 2661 HOH A O     1 
HETATM 5489 O  O     . HOH N 7 .   ? -2.563  62.515 25.463  1.00 52.10  ? 2662 HOH A O     1 
HETATM 5490 O  O     . HOH N 7 .   ? 8.006   14.648 42.261  1.00 45.73  ? 2664 HOH A O     1 
HETATM 5491 O  O     . HOH N 7 .   ? -11.239 54.495 43.521  1.00 30.34  ? 2665 HOH A O     1 
HETATM 5492 O  O     . HOH N 7 .   ? 17.894  54.905 31.894  1.00 41.54  ? 2668 HOH A O     1 
HETATM 5493 O  O     . HOH N 7 .   ? -3.704  15.507 15.005  1.00 34.06  ? 2671 HOH A O     1 
HETATM 5494 O  O     . HOH N 7 .   ? 2.015   12.674 2.867   1.00 35.55  ? 2674 HOH A O     1 
HETATM 5495 O  O     . HOH N 7 .   ? 11.206  42.100 -2.178  1.00 27.84  ? 2678 HOH A O     1 
HETATM 5496 O  O     . HOH N 7 .   ? 2.788   46.039 10.191  1.00 47.46  ? 2679 HOH A O     1 
HETATM 5497 O  O     . HOH N 7 .   ? 11.141  48.376 7.177   1.00 36.96  ? 2689 HOH A O     1 
HETATM 5498 O  O     . HOH N 7 .   ? 30.963  40.769 10.451  1.00 31.95  ? 2693 HOH A O     1 
HETATM 5499 O  O     . HOH N 7 .   ? 11.925  24.530 46.798  1.00 35.00  ? 2700 HOH A O     1 
HETATM 5500 O  O     . HOH N 7 .   ? -11.274 24.159 18.399  1.00 35.15  ? 2703 HOH A O     1 
HETATM 5501 O  O     . HOH N 7 .   ? 33.931  52.393 33.695  1.00 26.87  ? 2705 HOH A O     1 
HETATM 5502 O  O     . HOH N 7 .   ? 9.187   57.822 50.268  1.00 30.97  ? 2706 HOH A O     1 
HETATM 5503 O  O     . HOH N 7 .   ? 7.379   28.946 48.887  1.00 29.71  ? 2708 HOH A O     1 
HETATM 5504 O  O     . HOH N 7 .   ? 4.816   41.257 -4.442  1.00 33.87  ? 2712 HOH A O     1 
HETATM 5505 O  O     . HOH N 7 .   ? 10.540  26.995 25.404  1.00 31.53  ? 2721 HOH A O     1 
HETATM 5506 O  O     . HOH N 7 .   ? 8.663   41.408 5.937   1.00 38.80  ? 2730 HOH A O     1 
HETATM 5507 O  O     . HOH N 7 .   ? -6.517  44.831 56.294  1.00 35.03  ? 2731 HOH A O     1 
HETATM 5508 O  O     . HOH N 7 .   ? 8.483   65.771 6.325   1.00 35.28  ? 2732 HOH A O     1 
HETATM 5509 O  O     . HOH N 7 .   ? 5.823   59.268 34.464  1.00 48.38  ? 2738 HOH A O     1 
HETATM 5510 O  O     . HOH N 7 .   ? 11.970  10.627 10.944  1.00 30.31  ? 2740 HOH A O     1 
HETATM 5511 O  O     . HOH N 7 .   ? -0.721  53.677 8.873   1.00 30.69  ? 2743 HOH A O     1 
HETATM 5512 O  O     . HOH N 7 .   ? -4.932  39.471 2.392   1.00 42.06  ? 2746 HOH A O     1 
HETATM 5513 O  O     . HOH N 7 .   ? 4.128   33.861 57.733  1.00 36.73  ? 2747 HOH A O     1 
HETATM 5514 O  O     . HOH N 7 .   ? 7.603   66.816 10.218  1.00 29.71  ? 2761 HOH A O     1 
HETATM 5515 O  O     . HOH N 7 .   ? 3.642   15.615 40.869  1.00 33.39  ? 2764 HOH A O     1 
HETATM 5516 O  O     . HOH N 7 .   ? 21.832  43.396 43.197  1.00 42.38  ? 2765 HOH A O     1 
HETATM 5517 O  O     . HOH N 7 .   ? 3.417   34.793 -11.021 1.00 49.42  ? 2777 HOH A O     1 
HETATM 5518 O  O     . HOH N 7 .   ? 21.751  47.774 57.162  1.00 38.93  ? 2781 HOH A O     1 
HETATM 5519 O  O     . HOH N 7 .   ? -5.964  26.916 50.135  1.00 42.47  ? 2782 HOH A O     1 
HETATM 5520 O  O     . HOH N 7 .   ? 18.147  56.774 52.237  1.00 41.06  ? 2802 HOH A O     1 
HETATM 5521 O  O     . HOH N 7 .   ? 7.932   40.166 32.405  1.00 15.30  ? 2805 HOH A O     1 
HETATM 5522 O  O     . HOH N 7 .   ? 10.951  32.642 48.023  1.00 32.38  ? 2808 HOH A O     1 
HETATM 5523 O  O     . HOH N 7 .   ? 3.345   22.696 51.618  1.00 23.57  ? 2810 HOH A O     1 
HETATM 5524 O  O     . HOH N 7 .   ? 31.231  51.420 40.289  1.00 37.20  ? 2811 HOH A O     1 
HETATM 5525 O  O     . HOH N 7 .   ? 11.650  70.045 18.810  1.00 26.17  ? 2813 HOH A O     1 
HETATM 5526 O  O     . HOH N 7 .   ? -0.946  65.274 20.822  1.00 32.97  ? 2814 HOH A O     1 
HETATM 5527 O  O     . HOH N 7 .   ? 6.070   13.144 44.773  1.00 24.68  ? 2815 HOH A O     1 
HETATM 5528 O  O     . HOH N 7 .   ? 11.582  49.113 42.933  1.00 25.42  ? 2816 HOH A O     1 
HETATM 5529 O  O     . HOH N 7 .   ? 3.927   30.705 29.641  1.00 28.21  ? 2817 HOH A O     1 
HETATM 5530 O  O     . HOH N 7 .   ? 14.869  51.215 50.049  1.00 25.00  ? 2818 HOH A O     1 
HETATM 5531 O  O     . HOH N 7 .   ? -4.382  24.590 47.481  1.00 33.08  ? 2819 HOH A O     1 
HETATM 5532 O  O     . HOH N 7 .   ? 39.842  29.889 60.729  1.00 25.16  ? 2821 HOH A O     1 
HETATM 5533 O  O     . HOH N 7 .   ? 14.421  31.115 62.563  1.00 41.13  ? 2823 HOH A O     1 
HETATM 5534 O  O     . HOH N 7 .   ? -2.520  23.108 45.184  1.00 47.34  ? 2825 HOH A O     1 
HETATM 5535 O  O     . HOH N 7 .   ? 16.393  48.775 8.836   1.00 19.88  ? 2826 HOH A O     1 
HETATM 5536 O  O     . HOH N 7 .   ? 48.202  38.282 56.184  1.00 55.74  ? 2831 HOH A O     1 
HETATM 5537 O  O     . HOH N 7 .   ? 18.639  44.733 50.714  1.00 34.01  ? 2834 HOH A O     1 
HETATM 5538 O  O     . HOH N 7 .   ? 12.092  15.895 -9.457  1.00 36.78  ? 2836 HOH A O     1 
HETATM 5539 O  O     . HOH N 7 .   ? -7.358  22.812 44.157  1.00 25.22  ? 2838 HOH A O     1 
HETATM 5540 O  O     . HOH N 7 .   ? -2.403  16.718 44.231  1.00 36.18  ? 2841 HOH A O     1 
HETATM 5541 O  O     . HOH N 7 .   ? 20.518  43.627 62.074  1.00 50.73  ? 2842 HOH A O     1 
HETATM 5542 O  O     . HOH N 7 .   ? 10.582  53.998 36.335  1.00 23.94  ? 2845 HOH A O     1 
HETATM 5543 O  O     . HOH N 7 .   ? 30.429  39.950 13.307  1.00 33.56  ? 2847 HOH A O     1 
HETATM 5544 O  O     . HOH N 7 .   ? 11.630  18.132 50.476  1.00 32.53  ? 2849 HOH A O     1 
HETATM 5545 O  O     . HOH N 7 .   ? 1.370   42.643 -0.595  1.00 27.75  ? 2853 HOH A O     1 
HETATM 5546 O  O     . HOH N 7 .   ? 49.165  47.222 43.407  1.00 32.70  ? 2855 HOH A O     1 
HETATM 5547 O  O     . HOH N 7 .   ? 48.833  34.248 37.598  1.00 51.81  ? 2856 HOH A O     1 
HETATM 5548 O  O     . HOH N 7 .   ? -5.143  31.461 1.141   1.00 38.85  ? 2858 HOH A O     1 
HETATM 5549 O  O     . HOH N 7 .   ? 4.499   10.913 41.350  1.00 29.95  ? 2862 HOH A O     1 
HETATM 5550 O  O     . HOH N 7 .   ? -6.567  52.617 30.077  1.00 33.53  ? 2863 HOH A O     1 
HETATM 5551 O  O     . HOH N 7 .   ? 1.683   58.758 57.505  1.00 28.94  ? 2871 HOH A O     1 
HETATM 5552 O  O     . HOH N 7 .   ? 5.753   10.471 51.012  1.00 43.10  ? 2876 HOH A O     1 
HETATM 5553 O  O     . HOH N 7 .   ? 2.628   35.470 -7.018  1.00 32.00  ? 2878 HOH A O     1 
HETATM 5554 O  O     . HOH N 7 .   ? 5.187   13.108 51.467  1.00 32.89  ? 2882 HOH A O     1 
HETATM 5555 O  O     . HOH N 7 .   ? -0.242  18.354 -1.568  1.00 46.78  ? 2889 HOH A O     1 
HETATM 5556 O  O     . HOH N 7 .   ? 28.944  36.890 15.620  1.00 36.73  ? 2890 HOH A O     1 
HETATM 5557 O  O     . HOH N 7 .   ? -2.436  30.568 53.285  1.00 46.85  ? 2892 HOH A O     1 
HETATM 5558 O  O     . HOH N 7 .   ? -5.159  34.286 7.134   1.00 37.05  ? 2895 HOH A O     1 
HETATM 5559 O  O     . HOH N 7 .   ? 33.365  36.431 38.011  1.00 29.61  ? 2897 HOH A O     1 
HETATM 5560 O  O     . HOH N 7 .   ? -2.121  56.654 21.256  1.00 46.13  ? 2899 HOH A O     1 
HETATM 5561 O  O     . HOH N 7 .   ? -5.461  49.769 23.709  1.00 34.14  ? 2900 HOH A O     1 
HETATM 5562 O  O     . HOH N 7 .   ? -6.930  37.223 53.124  1.00 26.20  ? 2904 HOH A O     1 
HETATM 5563 O  O     . HOH N 7 .   ? 5.405   18.079 -6.934  1.00 29.01  ? 2905 HOH A O     1 
HETATM 5564 O  O     . HOH N 7 .   ? 23.167  39.757 -0.048  1.00 32.60  ? 2907 HOH A O     1 
HETATM 5565 O  O     . HOH N 7 .   ? 11.187  9.992  14.288  1.00 34.43  ? 2908 HOH A O     1 
HETATM 5566 O  O     . HOH N 7 .   ? 16.590  26.071 10.567  1.00 44.29  ? 2911 HOH A O     1 
HETATM 5567 O  O     . HOH N 7 .   ? 6.518   15.036 25.583  1.00 33.33  ? 2921 HOH A O     1 
HETATM 5568 O  O     . HOH N 7 .   ? -3.233  27.783 -7.522  1.00 32.92  ? 2924 HOH A O     1 
HETATM 5569 O  O     . HOH N 7 .   ? -4.079  36.052 -4.003  1.00 40.25  ? 2925 HOH A O     1 
HETATM 5570 O  O     . HOH N 7 .   ? 34.394  38.109 15.967  1.00 47.66  ? 2927 HOH A O     1 
HETATM 5571 O  O     . HOH N 7 .   ? 1.713   38.269 -6.773  1.00 34.90  ? 2929 HOH A O     1 
HETATM 5572 O  O     . HOH N 7 .   ? 13.686  48.576 33.259  1.00 40.33  ? 2934 HOH A O     1 
HETATM 5573 O  O     . HOH N 7 .   ? 26.172  60.246 20.222  1.00 30.20  ? 2935 HOH A O     1 
HETATM 5574 O  O     . HOH N 7 .   ? 12.878  30.338 -12.138 1.00 30.44  ? 2936 HOH A O     1 
HETATM 5575 O  O     . HOH N 7 .   ? 22.893  14.247 7.070   1.00 35.46  ? 2937 HOH A O     1 
HETATM 5576 O  O     . HOH N 7 .   ? 17.947  42.400 49.685  1.00 33.65  ? 2946 HOH A O     1 
HETATM 5577 O  O     . HOH N 7 .   ? 9.054   17.502 54.135  1.00 37.97  ? 2948 HOH A O     1 
HETATM 5578 O  O     . HOH N 7 .   ? 46.990  28.488 36.651  1.00 32.84  ? 2950 HOH A O     1 
HETATM 5579 O  O     . HOH N 7 .   ? 26.172  27.402 3.105   1.00 28.66  ? 2974 HOH A O     1 
HETATM 5580 O  O     . HOH N 7 .   ? 22.693  32.474 0.302   1.00 27.18  ? 2975 HOH A O     1 
HETATM 5581 O  O     . HOH N 7 .   ? 4.814   63.271 10.799  1.00 58.11  ? 2985 HOH A O     1 
HETATM 5582 O  O     . HOH N 7 .   ? 26.380  33.537 10.940  1.00 40.64  ? 2987 HOH A O     1 
HETATM 5583 O  O     . HOH N 7 .   ? -7.790  31.594 41.451  1.00 34.84  ? 2994 HOH A O     1 
HETATM 5584 O  O     . HOH N 7 .   ? 27.000  25.321 8.563   1.00 47.40  ? 3002 HOH A O     1 
HETATM 5585 O  O     . HOH N 7 .   ? 8.915   41.983 -6.295  1.00 27.29  ? 3005 HOH A O     1 
HETATM 5586 O  O     . HOH N 7 .   ? 24.118  21.101 -0.539  1.00 33.62  ? 3009 HOH A O     1 
HETATM 5587 O  O     . HOH N 7 .   ? -6.432  42.028 56.977  1.00 45.22  ? 3015 HOH A O     1 
HETATM 5588 O  O     . HOH N 7 .   ? -12.050 21.576 19.247  1.00 51.78  ? 3026 HOH A O     1 
HETATM 5589 O  O     . HOH N 7 .   ? 5.232   43.476 -0.385  1.00 35.81  ? 3036 HOH A O     1 
HETATM 5590 O  O     . HOH N 7 .   ? -0.397  61.667 23.259  1.00 51.62  ? 3039 HOH A O     1 
HETATM 5591 O  O     . HOH N 7 .   ? 37.462  33.494 41.647  1.00 43.17  ? 3058 HOH A O     1 
HETATM 5592 O  O     . HOH N 7 .   ? -2.558  13.342 4.951   1.00 43.23  ? 3060 HOH A O     1 
HETATM 5593 O  O     . HOH N 7 .   ? 27.869  35.853 7.284   1.00 32.47  ? 3061 HOH A O     1 
HETATM 5594 O  O     . HOH N 7 .   ? 28.435  35.715 13.393  1.00 45.98  ? 3063 HOH A O     1 
HETATM 5595 O  O     . HOH N 7 .   ? 12.251  53.641 10.422  1.00 33.33  ? 3064 HOH A O     1 
HETATM 5596 O  O     . HOH N 7 .   ? 11.822  15.456 18.236  1.00 26.57  ? 3065 HOH A O     1 
HETATM 5597 O  O     . HOH N 7 .   ? 10.844  15.714 20.739  1.00 29.53  ? 3066 HOH A O     1 
HETATM 5598 O  O     . HOH N 7 .   ? 3.057   41.433 10.502  1.00 33.48  ? 3067 HOH A O     1 
HETATM 5599 O  O     . HOH N 7 .   ? 2.242   48.537 12.051  1.00 26.48  ? 3068 HOH A O     1 
HETATM 5600 O  O     . HOH N 7 .   ? -0.599  52.057 11.154  1.00 23.20  ? 3069 HOH A O     1 
HETATM 5601 O  O     . HOH N 7 .   ? -8.739  61.067 18.969  1.00 32.09  ? 3071 HOH A O     1 
HETATM 5602 O  O     . HOH N 7 .   ? -3.251  53.143 22.153  1.00 36.00  ? 3074 HOH A O     1 
HETATM 5603 O  O     . HOH N 7 .   ? 18.585  10.366 11.048  1.00 36.13  ? 3079 HOH A O     1 
HETATM 5604 O  O     . HOH N 7 .   ? -9.227  52.557 45.672  1.00 22.45  ? 3081 HOH A O     1 
HETATM 5605 O  O     . HOH N 7 .   ? 15.903  40.748 -5.262  1.00 49.32  ? 3083 HOH A O     1 
HETATM 5606 O  O     . HOH N 7 .   ? 8.981   66.414 17.914  1.00 10.31  ? 3084 HOH A O     1 
HETATM 5607 O  O     . HOH N 7 .   ? 9.096   33.716 14.077  1.00 14.59  ? 3085 HOH A O     1 
HETATM 5608 O  O     . HOH N 7 .   ? 16.091  50.945 10.634  1.00 28.07  ? 3086 HOH A O     1 
HETATM 5609 O  O     . HOH N 7 .   ? 26.529  38.873 24.831  1.00 50.23  ? 3087 HOH A O     1 
HETATM 5610 O  O     . HOH N 7 .   ? 9.617   42.817 9.231   1.00 32.87  ? 3088 HOH A O     1 
HETATM 5611 O  O     . HOH N 7 .   ? -7.954  38.375 46.133  1.00 30.28  ? 3090 HOH A O     1 
HETATM 5612 O  O     . HOH N 7 .   ? 3.861   61.233 58.134  1.00 35.54  ? 3092 HOH A O     1 
HETATM 5613 O  O     . HOH N 7 .   ? 23.646  37.191 0.376   1.00 30.07  ? 3093 HOH A O     1 
HETATM 5614 O  O     . HOH N 7 .   ? 48.068  39.934 54.185  1.00 46.01  ? 3094 HOH A O     1 
HETATM 5615 O  O     . HOH N 7 .   ? 45.702  34.948 35.652  1.00 42.81  ? 3095 HOH A O     1 
HETATM 5616 O  O     . HOH N 7 .   ? 11.184  62.480 32.394  1.00 33.36  ? 3096 HOH A O     1 
HETATM 5617 O  O     . HOH N 7 .   ? -4.489  51.678 31.023  1.00 36.75  ? 3097 HOH A O     1 
HETATM 5618 O  O     . HOH N 7 .   ? -5.123  38.693 55.888  1.00 32.71  ? 3098 HOH A O     1 
HETATM 5619 O  O     . HOH N 7 .   ? 2.873   25.681 -13.499 1.00 30.41  ? 3099 HOH A O     1 
HETATM 5620 O  O     . HOH N 7 .   ? 13.363  21.058 19.664  1.00 47.52  ? 3100 HOH A O     1 
HETATM 5621 O  O     . HOH N 7 .   ? 7.766   56.483 38.612  1.00 35.61  ? 3101 HOH A O     1 
HETATM 5622 O  O     . HOH N 7 .   ? 6.035   47.228 12.458  1.00 33.61  ? 3103 HOH A O     1 
HETATM 5623 O  O     . HOH N 7 .   ? -5.242  30.294 4.628   1.00 35.19  ? 3104 HOH A O     1 
HETATM 5624 O  O     . HOH N 7 .   ? -4.094  52.073 50.631  1.00 31.33  ? 3105 HOH A O     1 
HETATM 5625 O  O     . HOH N 7 .   ? 28.525  33.564 4.233   1.00 49.24  ? 3107 HOH A O     1 
HETATM 5626 O  O     . HOH N 7 .   ? -7.774  46.207 27.957  1.00 29.99  ? 3108 HOH A O     1 
HETATM 5627 O  O     . HOH N 7 .   ? 29.819  42.076 8.578   1.00 30.14  ? 3109 HOH A O     1 
HETATM 5628 O  O     . HOH N 7 .   ? -0.559  48.367 59.773  1.00 35.91  ? 3114 HOH A O     1 
HETATM 5629 O  O     . HOH N 7 .   ? -9.458  19.193 17.287  1.00 42.53  ? 3117 HOH A O     1 
HETATM 5630 O  O     . HOH N 7 .   ? -5.279  18.733 21.739  1.00 40.79  ? 3118 HOH A O     1 
HETATM 5631 O  O     . HOH N 7 .   ? 12.965  55.765 34.120  1.00 32.96  ? 3119 HOH A O     1 
HETATM 5632 O  O     . HOH N 7 .   ? 6.085   38.383 7.317   1.00 35.20  ? 3121 HOH A O     1 
HETATM 5633 O  O     . HOH N 7 .   ? 43.157  35.339 35.002  1.00 39.66  ? 3122 HOH A O     1 
HETATM 5634 O  O     . HOH N 7 .   ? -7.919  28.860 33.066  1.00 40.59  ? 3124 HOH A O     1 
HETATM 5635 O  O     . HOH N 7 .   ? 25.483  17.187 7.776   1.00 34.50  ? 3126 HOH A O     1 
HETATM 5636 O  O     . HOH N 7 .   ? -9.861  46.339 34.264  1.00 31.44  ? 3127 HOH A O     1 
HETATM 5637 O  O     . HOH N 7 .   ? -4.141  33.932 10.192  1.00 54.35  ? 3128 HOH A O     1 
HETATM 5638 O  O     . HOH N 7 .   ? 27.671  59.128 18.226  1.00 31.08  ? 3131 HOH A O     1 
HETATM 5639 O  O     . HOH N 7 .   ? 0.605   53.409 59.217  1.00 32.26  ? 3132 HOH A O     1 
HETATM 5640 O  O     . HOH N 7 .   ? 16.791  50.000 48.672  1.00 36.71  ? 3135 HOH A O     1 
HETATM 5641 O  O     . HOH N 7 .   ? 39.876  45.047 26.780  1.00 46.21  ? 3136 HOH A O     1 
HETATM 5642 O  O     . HOH N 7 .   ? -0.981  46.597 14.181  1.00 29.68  ? 3137 HOH A O     1 
HETATM 5643 O  O     . HOH N 7 .   ? 25.399  18.258 -3.424  1.00 40.98  ? 3139 HOH A O     1 
HETATM 5644 O  O     . HOH N 7 .   ? -0.951  43.932 14.015  1.00 23.69  ? 3140 HOH A O     1 
HETATM 5645 O  O     . HOH N 7 .   ? -3.432  45.082 16.794  1.00 32.28  ? 3141 HOH A O     1 
HETATM 5646 O  O     . HOH N 7 .   ? -7.565  39.107 27.795  1.00 40.95  ? 3143 HOH A O     1 
HETATM 5647 O  O     . HOH N 7 .   ? 9.175   46.057 43.054  1.00 47.43  ? 3145 HOH A O     1 
HETATM 5648 O  O     . HOH N 7 .   ? -10.942 37.448 27.142  1.00 41.72  ? 3146 HOH A O     1 
HETATM 5649 O  O     . HOH N 7 .   ? -9.045  41.204 34.411  1.00 35.81  ? 3147 HOH A O     1 
HETATM 5650 O  O     . HOH N 7 .   ? -3.426  29.956 8.614   1.00 28.12  ? 3150 HOH A O     1 
HETATM 5651 O  O     . HOH N 7 .   ? -2.517  48.530 17.257  1.00 40.82  ? 3152 HOH A O     1 
HETATM 5652 O  O     . HOH N 7 .   ? -11.999 48.133 41.558  1.00 39.55  ? 3153 HOH A O     1 
HETATM 5653 O  O     . HOH N 7 .   ? 25.055  63.375 15.398  1.00 38.11  ? 3154 HOH A O     1 
HETATM 5654 O  O     . HOH N 7 .   ? 13.613  27.006 44.012  1.00 46.76  ? 3156 HOH A O     1 
HETATM 5655 O  O     . HOH N 7 .   ? -12.134 49.291 43.715  1.00 43.42  ? 3158 HOH A O     1 
HETATM 5656 O  O     . HOH N 7 .   ? -1.022  36.994 7.304   1.00 37.03  ? 3161 HOH A O     1 
HETATM 5657 O  O     . HOH N 7 .   ? 10.301  65.758 12.315  1.00 40.47  ? 3163 HOH A O     1 
HETATM 5658 O  O     . HOH N 7 .   ? 39.600  25.357 47.071  1.00 35.17  ? 3166 HOH A O     1 
HETATM 5659 O  O     . HOH N 7 .   ? 8.280   16.944 21.105  1.00 38.05  ? 3167 HOH A O     1 
HETATM 5660 O  O     . HOH N 7 .   ? 10.800  73.263 21.005  1.00 34.12  ? 3174 HOH A O     1 
HETATM 5661 O  O     . HOH N 7 .   ? 22.940  24.448 -0.278  1.00 38.96  ? 3178 HOH A O     1 
HETATM 5662 O  O     . HOH N 7 .   ? -1.227  14.194 13.482  1.00 37.60  ? 3179 HOH A O     1 
HETATM 5663 O  O     . HOH N 7 .   ? 4.331   41.737 8.230   1.00 38.39  ? 3182 HOH A O     1 
HETATM 5664 O  O     . HOH N 7 .   ? -8.737  25.506 28.240  1.00 34.46  ? 3183 HOH A O     1 
HETATM 5665 O  O     . HOH N 7 .   ? 24.985  37.349 29.584  1.00 36.05  ? 3184 HOH A O     1 
HETATM 5666 O  O     . HOH N 7 .   ? -0.537  13.532 2.182   1.00 41.72  ? 3185 HOH A O     1 
HETATM 5667 O  O     . HOH N 7 .   ? 34.027  54.684 17.587  1.00 27.36  ? 3187 HOH A O     1 
HETATM 5668 O  O     . HOH N 7 .   ? 14.066  10.536 6.509   1.00 35.42  ? 3190 HOH A O     1 
HETATM 5669 O  O     . HOH N 7 .   ? 15.998  38.881 -7.173  1.00 44.57  ? 3194 HOH A O     1 
HETATM 5670 O  O     . HOH N 7 .   ? -5.387  35.404 0.305   1.00 44.48  ? 3197 HOH A O     1 
HETATM 5671 O  O     . HOH N 7 .   ? 20.796  25.288 20.602  1.00 42.84  ? 3198 HOH A O     1 
HETATM 5672 O  O     . HOH N 7 .   ? 7.705   42.104 -3.325  1.00 42.81  ? 3211 HOH A O     1 
HETATM 5673 O  O     . HOH N 7 .   ? 16.690  57.778 35.066  1.00 41.17  ? 3213 HOH A O     1 
HETATM 5674 O  O     . HOH N 7 .   ? 14.315  10.453 12.599  1.00 42.62  ? 3216 HOH A O     1 
HETATM 5675 O  O     . HOH N 7 .   ? 25.002  53.632 11.105  1.00 39.87  ? 3217 HOH A O     1 
HETATM 5676 O  O     . HOH N 7 .   ? -3.467  31.080 11.055  1.00 21.44  ? 3218 HOH A O     1 
HETATM 5677 O  O     . HOH N 7 .   ? 14.269  26.269 12.101  1.00 38.61  ? 3219 HOH A O     1 
HETATM 5678 O  O     . HOH N 7 .   ? -0.252  52.519 56.872  1.00 29.66  ? 3220 HOH A O     1 
HETATM 5679 O  O     . HOH N 7 .   ? 17.475  51.336 29.475  1.00 44.38  ? 3221 HOH A O     1 
HETATM 5680 O  O     . HOH N 7 .   ? 43.166  40.146 59.183  1.00 48.97  ? 3222 HOH A O     1 
HETATM 5681 O  O     . HOH N 7 .   ? 0.221   49.423 10.876  1.00 28.55  ? 3223 HOH A O     1 
HETATM 5682 O  O     . HOH N 7 .   ? 14.290  45.522 5.219   1.00 35.43  ? 3224 HOH A O     1 
HETATM 5683 O  O     . HOH N 7 .   ? 33.107  29.727 52.296  1.00 34.40  ? 3225 HOH A O     1 
HETATM 5684 O  O     . HOH N 7 .   ? 0.350   41.203 10.587  1.00 44.99  ? 3226 HOH A O     1 
HETATM 5685 O  O     . HOH N 7 .   ? 17.961  42.797 56.831  1.00 34.11  ? 3227 HOH A O     1 
HETATM 5686 O  O     . HOH N 7 .   ? -9.719  23.556 43.678  1.00 44.52  ? 3228 HOH A O     1 
HETATM 5687 O  O     . HOH N 7 .   ? 2.415   13.121 41.059  1.00 33.78  ? 3229 HOH A O     1 
HETATM 5688 O  O     . HOH N 7 .   ? 24.868  41.941 -1.100  1.00 40.48  ? 3230 HOH A O     1 
HETATM 5689 O  O     . HOH N 7 .   ? -5.376  25.067 -0.422  1.00 37.93  ? 3231 HOH A O     1 
HETATM 5690 O  O     . HOH N 7 .   ? 43.755  47.314 49.833  1.00 45.20  ? 3233 HOH A O     1 
HETATM 5691 O  O     . HOH N 7 .   ? 1.780   44.718 13.820  1.00 34.86  ? 3234 HOH A O     1 
HETATM 5692 O  O     . HOH N 7 .   ? 2.537   16.939 1.718   1.00 31.02  ? 3236 HOH A O     1 
HETATM 5693 O  O     . HOH N 7 .   ? 18.369  25.542 -10.439 1.00 30.92  ? 3237 HOH A O     1 
HETATM 5694 O  O     . HOH N 7 .   ? 13.566  54.845 30.817  1.00 36.64  ? 3238 HOH A O     1 
HETATM 5695 O  O     . HOH N 7 .   ? -11.494 48.781 46.348  1.00 41.26  ? 3239 HOH A O     1 
HETATM 5696 O  O     . HOH N 7 .   ? 45.854  28.545 45.609  1.00 34.69  ? 3240 HOH A O     1 
HETATM 5697 O  O     . HOH N 7 .   ? 17.049  26.807 13.359  1.00 31.18  ? 3241 HOH A O     1 
HETATM 5698 O  O     . HOH N 7 .   ? 17.480  11.925 1.735   1.00 36.26  ? 3242 HOH A O     1 
HETATM 5699 O  O     . HOH N 7 .   ? 5.047   64.847 27.996  1.00 40.25  ? 3243 HOH A O     1 
HETATM 5700 O  O     . HOH N 7 .   ? 20.381  16.476 -6.488  1.00 44.00  ? 3244 HOH A O     1 
HETATM 5701 O  O     . HOH N 7 .   ? 21.184  45.603 8.253   1.00 37.54  ? 3245 HOH A O     1 
HETATM 5702 O  O     . HOH N 7 .   ? 24.485  13.200 5.256   1.00 37.72  ? 3246 HOH A O     1 
HETATM 5703 O  O     . HOH N 7 .   ? 9.279   16.171 51.660  1.00 44.29  ? 3247 HOH A O     1 
HETATM 5704 O  O     . HOH N 7 .   ? 4.223   56.048 50.093  1.00 37.54  ? 3248 HOH A O     1 
HETATM 5705 O  O     . HOH N 7 .   ? -10.947 48.658 34.947  1.00 40.30  ? 3249 HOH A O     1 
HETATM 5706 O  O     . HOH N 7 .   ? -4.253  18.698 8.353   1.00 42.87  ? 3250 HOH A O     1 
HETATM 5707 O  O     . HOH N 7 .   ? 29.960  35.224 5.867   1.00 40.99  ? 3251 HOH A O     1 
HETATM 5708 O  O     . HOH N 7 .   ? 16.662  23.829 14.458  1.00 44.23  ? 3252 HOH A O     1 
HETATM 5709 O  O     . HOH N 7 .   ? 45.148  35.959 38.384  1.00 36.13  ? 3253 HOH A O     1 
HETATM 5710 O  O     . HOH N 7 .   ? -0.168  29.716 48.478  1.00 46.84  ? 3254 HOH A O     1 
HETATM 5711 O  O     . HOH N 7 .   ? 37.352  41.314 21.918  1.00 38.62  ? 3255 HOH A O     1 
HETATM 5712 O  O     . HOH N 7 .   ? -2.461  36.528 9.581   1.00 38.97  ? 3256 HOH A O     1 
HETATM 5713 O  O     . HOH N 7 .   ? 7.137   64.158 8.196   1.00 39.00  ? 3257 HOH A O     1 
HETATM 5714 O  O     . HOH N 7 .   ? 36.178  37.835 26.564  1.00 37.71  ? 3258 HOH A O     1 
HETATM 5715 O  O     . HOH N 7 .   ? 11.092  25.379 8.611   1.00 40.53  ? 3259 HOH A O     1 
HETATM 5716 O  O     . HOH N 7 .   ? 10.585  54.273 63.361  1.00 35.35  ? 3260 HOH A O     1 
HETATM 5717 O  O     . HOH N 7 .   ? -5.746  46.314 54.124  1.00 46.14  ? 3262 HOH A O     1 
HETATM 5718 O  O     . HOH N 7 .   ? -2.317  57.480 29.609  1.00 47.15  ? 3263 HOH A O     1 
HETATM 5719 O  O     . HOH N 7 .   ? -1.957  14.751 19.539  1.00 41.48  ? 3266 HOH A O     1 
HETATM 5720 O  O     . HOH N 7 .   ? 28.375  31.312 6.387   1.00 41.99  ? 3267 HOH A O     1 
HETATM 5721 O  O     . HOH N 7 .   ? 5.718   55.979 40.855  1.00 41.86  ? 3268 HOH A O     1 
HETATM 5722 O  O     . HOH N 7 .   ? -2.931  20.344 -8.861  1.00 42.34  ? 3269 HOH A O     1 
HETATM 5723 O  O     . HOH N 7 .   ? -12.108 45.558 42.264  1.00 44.38  ? 3270 HOH A O     1 
HETATM 5724 O  O     . HOH N 7 .   ? -4.761  56.678 23.915  1.00 48.37  ? 3271 HOH A O     1 
HETATM 5725 O  O     . HOH N 7 .   ? 12.773  24.733 10.497  1.00 36.58  ? 3272 HOH A O     1 
HETATM 5726 O  O     . HOH N 7 .   ? 12.902  40.606 38.728  1.00 41.58  ? 3273 HOH A O     1 
HETATM 5727 O  O     . HOH N 7 .   ? -4.528  31.701 6.618   1.00 38.87  ? 3274 HOH A O     1 
HETATM 5728 O  O     . HOH N 7 .   ? 14.366  24.484 44.775  1.00 36.39  ? 3275 HOH A O     1 
HETATM 5729 O  O     . HOH N 7 .   ? 24.086  53.940 38.740  1.00 44.19  ? 3276 HOH A O     1 
HETATM 5730 O  O     . HOH N 7 .   ? -5.505  33.818 36.291  1.00 48.36  ? 3277 HOH A O     1 
HETATM 5731 O  O     . HOH N 7 .   ? 10.840  39.620 62.186  1.00 35.54  ? 3278 HOH A O     1 
HETATM 5732 O  O     . HOH N 7 .   ? -2.253  47.784 11.991  1.00 41.46  ? 3279 HOH A O     1 
HETATM 5733 O  O     . HOH N 7 .   ? 1.080   33.564 -8.079  1.00 45.74  ? 3280 HOH A O     1 
HETATM 5734 O  O     . HOH N 7 .   ? -3.737  41.424 21.979  1.00 39.55  ? 3281 HOH A O     1 
HETATM 5735 O  O     . HOH N 7 .   ? 3.007   42.802 -2.789  1.00 48.70  ? 3282 HOH A O     1 
HETATM 5736 O  O     . HOH N 7 .   ? 20.686  21.838 13.619  1.00 34.98  ? 3283 HOH A O     1 
HETATM 5737 O  O     . HOH N 7 .   ? 18.489  41.903 62.167  1.00 45.69  ? 3284 HOH A O     1 
HETATM 5738 O  O     . HOH N 7 .   ? -3.408  52.888 15.839  1.00 37.25  ? 3285 HOH A O     1 
HETATM 5739 O  O     . HOH N 7 .   ? 15.533  40.801 61.718  1.00 38.16  ? 3286 HOH A O     1 
HETATM 5740 O  O     . HOH N 7 .   ? 14.316  65.569 11.210  1.00 46.45  ? 3287 HOH A O     1 
HETATM 5741 O  O     . HOH N 7 .   ? 20.689  41.465 58.441  1.00 38.04  ? 3288 HOH A O     1 
HETATM 5742 O  O     . HOH N 7 .   ? 34.165  38.713 37.267  1.00 37.44  ? 3289 HOH A O     1 
HETATM 5743 O  O     . HOH N 7 .   ? 16.221  13.506 -2.433  1.00 40.46  ? 3290 HOH A O     1 
HETATM 5744 O  O     . HOH N 7 .   ? 28.141  52.898 42.068  1.00 41.25  ? 3291 HOH A O     1 
HETATM 5745 O  O     . HOH N 7 .   ? -1.994  32.296 -6.766  1.00 40.16  ? 3292 HOH A O     1 
HETATM 5746 O  O     . HOH N 7 .   ? 12.289  13.657 -5.528  1.00 42.21  ? 3293 HOH A O     1 
HETATM 5747 O  O     . HOH N 7 .   ? 15.137  52.995 9.104   1.00 39.09  ? 3294 HOH A O     1 
HETATM 5748 O  O     . HOH N 7 .   ? 37.231  46.181 53.969  1.00 43.95  ? 3295 HOH A O     1 
HETATM 5749 O  O     . HOH N 7 .   ? 24.224  60.721 16.583  1.00 44.44  ? 3296 HOH A O     1 
HETATM 5750 O  O     . HOH N 7 .   ? 17.332  10.494 13.417  1.00 49.57  ? 3297 HOH A O     1 
HETATM 5751 O  O     . HOH N 7 .   ? 11.203  11.046 18.320  1.00 42.61  ? 3298 HOH A O     1 
HETATM 5752 O  O     . HOH N 7 .   ? 10.515  48.016 39.796  1.00 47.84  ? 3299 HOH A O     1 
HETATM 5753 O  O     . HOH N 7 .   ? 5.709   57.403 43.805  1.00 41.27  ? 3300 HOH A O     1 
HETATM 5754 O  O     . HOH N 7 .   ? 24.908  57.484 36.038  1.00 38.18  ? 3301 HOH A O     1 
HETATM 5755 O  O     . HOH N 7 .   ? 12.060  46.671 36.915  1.00 42.06  ? 3302 HOH A O     1 
HETATM 5756 O  O     . HOH N 7 .   ? -8.533  31.974 49.986  1.00 46.12  ? 3303 HOH A O     1 
HETATM 5757 O  O     . HOH N 7 .   ? 48.468  48.679 36.341  1.00 45.98  ? 3304 HOH A O     1 
HETATM 5758 O  O     . HOH N 7 .   ? 5.205   15.925 -5.528  1.00 46.66  ? 3305 HOH A O     1 
HETATM 5759 O  O     . HOH N 7 .   ? -0.655  28.157 -8.738  1.00 36.86  ? 3306 HOH A O     1 
HETATM 5760 O  O     . HOH N 7 .   ? -9.857  27.652 27.480  1.00 46.31  ? 3307 HOH A O     1 
HETATM 5761 O  O     . HOH N 7 .   ? 6.363   12.524 42.255  1.00 46.89  ? 3308 HOH A O     1 
HETATM 5762 O  O     . HOH N 7 .   ? 12.025  11.641 -3.702  1.00 41.08  ? 3309 HOH A O     1 
HETATM 5763 O  O     . HOH N 7 .   ? 45.289  44.300 33.353  1.00 44.25  ? 3311 HOH A O     1 
HETATM 5764 O  O     . HOH N 7 .   ? 22.279  21.295 17.270  1.00 44.70  ? 3312 HOH A O     1 
HETATM 5765 O  O     . HOH N 7 .   ? 11.890  44.358 3.634   1.00 49.89  ? 3313 HOH A O     1 
HETATM 5766 O  O     . HOH N 7 .   ? 15.220  48.542 5.625   1.00 46.22  ? 3314 HOH A O     1 
HETATM 5767 O  O     . HOH N 7 .   ? -5.309  16.189 21.505  1.00 46.21  ? 3315 HOH A O     1 
HETATM 5768 O  O     . HOH N 7 .   ? 22.354  70.867 13.694  1.00 49.24  ? 3316 HOH A O     1 
HETATM 5769 O  O     . HOH N 7 .   ? 28.145  39.415 14.859  1.00 39.31  ? 3318 HOH A O     1 
HETATM 5770 O  O     . HOH N 7 .   ? -6.352  45.547 25.189  1.00 44.53  ? 3319 HOH A O     1 
HETATM 5771 O  O     . HOH N 7 .   ? 21.981  52.721 9.999   1.00 43.85  ? 3320 HOH A O     1 
HETATM 5772 O  O     . HOH N 7 .   ? 4.712   59.864 42.161  1.00 45.99  ? 3321 HOH A O     1 
HETATM 5773 O  O     . HOH N 7 .   ? 0.485   13.348 22.367  1.00 45.69  ? 3324 HOH A O     1 
HETATM 5774 O  O     . HOH N 7 .   ? -9.019  38.123 42.515  1.00 42.57  ? 3326 HOH A O     1 
HETATM 5775 O  O     . HOH N 7 .   ? 47.023  24.682 52.576  1.00 43.27  ? 3328 HOH A O     1 
HETATM 5776 O  O     . HOH N 7 .   ? -5.415  59.141 27.763  1.00 43.83  ? 3330 HOH A O     1 
HETATM 5777 O  O     . HOH N 7 .   ? 10.640  56.317 52.918  1.00 43.02  ? 3331 HOH A O     1 
HETATM 5778 O  O     . HOH N 7 .   ? 13.788  72.175 19.191  1.00 46.13  ? 3332 HOH A O     1 
HETATM 5779 O  O     . HOH N 7 .   ? -2.918  54.395 51.307  1.00 45.17  ? 3333 HOH A O     1 
HETATM 5780 O  O     . HOH N 7 .   ? 20.665  35.224 -2.593  1.00 44.31  ? 3334 HOH A O     1 
HETATM 5781 O  O     . HOH N 7 .   ? 26.168  57.466 13.822  1.00 48.05  ? 3335 HOH A O     1 
HETATM 5782 O  O     . HOH N 7 .   ? 50.330  46.293 37.578  1.00 49.68  ? 3336 HOH A O     1 
HETATM 5783 O  O     . HOH N 7 .   ? -6.192  23.077 46.620  1.00 43.48  ? 3337 HOH A O     1 
HETATM 5784 O  O     . HOH N 7 .   ? 1.381   34.094 56.656  1.00 46.83  ? 3338 HOH A O     1 
HETATM 5785 O  O     . HOH N 7 .   ? 24.639  34.663 1.781   1.00 42.32  ? 3339 HOH A O     1 
HETATM 5786 O  O     . HOH N 7 .   ? -7.888  37.762 31.470  1.00 46.64  ? 3340 HOH A O     1 
HETATM 5787 O  O     . HOH N 7 .   ? -12.943 48.426 39.171  1.00 49.12  ? 3341 HOH A O     1 
HETATM 5788 O  O     . HOH N 7 .   ? 15.972  44.975 -2.839  1.00 45.70  ? 3342 HOH A O     1 
HETATM 5789 O  O     . HOH N 7 .   ? -6.467  28.098 5.616   1.00 42.67  ? 3343 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   19  19  DG  G   B . n 
A 1 2   DC  2   20  20  DC  C   B . n 
A 1 3   DG  3   21  21  DG  G   B . n 
A 1 4   DA  4   22  22  DA  A   B . n 
A 1 5   DT  5   23  23  DT  T   B . n 
A 1 6   DC  6   24  24  DC  C   B . n 
A 1 7   DA  7   25  25  DA  A   B . n 
A 1 8   DG  8   26  26  DG  G   B . n 
A 1 9   DC  9   27  27  DC  C   B . n 
A 1 10  DT  10  28  28  DT  T   B . n 
A 1 11  DC  11  29  29  DC  C   B . n 
A 1 12  DG  12  30  30  DG  G   B . n 
B 2 1   DG  1   3   ?   ?   ?   C . n 
B 2 2   DT  2   4   ?   ?   ?   C . n 
B 2 3   DA  3   5   5   DA  A   C . n 
B 2 4   DC  4   6   6   DC  C   C . n 
B 2 5   6OG 5   7   7   6OG 6OG C . n 
B 2 6   DA  6   8   8   DA  A   C . n 
B 2 7   DG  7   9   9   DG  G   C . n 
B 2 8   DC  8   10  10  DC  C   C . n 
B 2 9   DT  9   11  11  DT  T   C . n 
B 2 10  DG  10  12  12  DG  G   C . n 
B 2 11  DA  11  13  13  DA  A   C . n 
B 2 12  DT  12  14  14  DT  T   C . n 
B 2 13  DC  13  15  15  DC  C   C . n 
B 2 14  DG  14  16  16  DG  G   C . n 
B 2 15  DC  15  17  17  DC  C   C . n 
B 2 16  DA  16  18  18  DA  A   C . n 
C 3 1   LYS 1   297 297 LYS ALA A . n 
C 3 2   LYS 2   298 298 LYS ALA A . n 
C 3 3   MET 3   299 299 MET MET A . n 
C 3 4   ALA 4   300 300 ALA ALA A . n 
C 3 5   PHE 5   301 301 PHE PHE A . n 
C 3 6   THR 6   302 302 THR THR A . n 
C 3 7   LEU 7   303 303 LEU LEU A . n 
C 3 8   ALA 8   304 304 ALA ALA A . n 
C 3 9   ASP 9   305 305 ASP ASP A . n 
C 3 10  ARG 10  306 306 ARG ARG A . n 
C 3 11  VAL 11  307 307 VAL VAL A . n 
C 3 12  THR 12  308 308 THR THR A . n 
C 3 13  GLU 13  309 309 GLU GLU A . n 
C 3 14  GLU 14  310 310 GLU GLU A . n 
C 3 15  MET 15  311 311 MET MET A . n 
C 3 16  LEU 16  312 312 LEU LEU A . n 
C 3 17  ALA 17  313 313 ALA ALA A . n 
C 3 18  ASP 18  314 314 ASP ASP A . n 
C 3 19  LYS 19  315 315 LYS LYS A . n 
C 3 20  ALA 20  316 316 ALA ALA A . n 
C 3 21  ALA 21  317 317 ALA ALA A . n 
C 3 22  LEU 22  318 318 LEU LEU A . n 
C 3 23  VAL 23  319 319 VAL VAL A . n 
C 3 24  VAL 24  320 320 VAL VAL A . n 
C 3 25  GLU 25  321 321 GLU GLU A . n 
C 3 26  VAL 26  322 322 VAL VAL A . n 
C 3 27  VAL 27  323 323 VAL VAL A . n 
C 3 28  GLU 28  324 324 GLU GLU A . n 
C 3 29  GLU 29  325 325 GLU GLU A . n 
C 3 30  ASN 30  326 326 ASN ASN A . n 
C 3 31  TYR 31  327 327 TYR TYR A . n 
C 3 32  HIS 32  328 328 HIS HIS A . n 
C 3 33  ASP 33  329 329 ASP ASP A . n 
C 3 34  ALA 34  330 330 ALA ALA A . n 
C 3 35  PRO 35  331 331 PRO PRO A . n 
C 3 36  ILE 36  332 332 ILE ILE A . n 
C 3 37  VAL 37  333 333 VAL VAL A . n 
C 3 38  GLY 38  334 334 GLY GLY A . n 
C 3 39  ILE 39  335 335 ILE ILE A . n 
C 3 40  ALA 40  336 336 ALA ALA A . n 
C 3 41  VAL 41  337 337 VAL VAL A . n 
C 3 42  VAL 42  338 338 VAL VAL A . n 
C 3 43  ASN 43  339 339 ASN ASN A . n 
C 3 44  GLU 44  340 340 GLU GLU A . n 
C 3 45  HIS 45  341 341 HIS HIS A . n 
C 3 46  GLY 46  342 342 GLY GLY A . n 
C 3 47  ARG 47  343 343 ARG ARG A . n 
C 3 48  PHE 48  344 344 PHE PHE A . n 
C 3 49  PHE 49  345 345 PHE PHE A . n 
C 3 50  LEU 50  346 346 LEU LEU A . n 
C 3 51  ARG 51  347 347 ARG ARG A . n 
C 3 52  PRO 52  348 348 PRO PRO A . n 
C 3 53  GLU 53  349 349 GLU GLU A . n 
C 3 54  THR 54  350 350 THR THR A . n 
C 3 55  ALA 55  351 351 ALA ALA A . n 
C 3 56  LEU 56  352 352 LEU LEU A . n 
C 3 57  ALA 57  353 353 ALA ALA A . n 
C 3 58  ASP 58  354 354 ASP ASP A . n 
C 3 59  PRO 59  355 355 PRO PRO A . n 
C 3 60  GLN 60  356 356 GLN GLN A . n 
C 3 61  PHE 61  357 357 PHE PHE A . n 
C 3 62  VAL 62  358 358 VAL VAL A . n 
C 3 63  ALA 63  359 359 ALA ALA A . n 
C 3 64  TRP 64  360 360 TRP TRP A . n 
C 3 65  LEU 65  361 361 LEU LEU A . n 
C 3 66  GLY 66  362 362 GLY GLY A . n 
C 3 67  ASP 67  363 363 ASP ASP A . n 
C 3 68  GLU 68  364 364 GLU GLU A . n 
C 3 69  THR 69  365 365 THR THR A . n 
C 3 70  LYS 70  366 366 LYS LYS A . n 
C 3 71  LYS 71  367 367 LYS LYS A . n 
C 3 72  LYS 72  368 368 LYS LYS A . n 
C 3 73  SER 73  369 369 SER SER A . n 
C 3 74  MET 74  370 370 MET MET A . n 
C 3 75  PHE 75  371 371 PHE PHE A . n 
C 3 76  ASP 76  372 372 ASP ASP A . n 
C 3 77  SER 77  373 373 SER SER A . n 
C 3 78  LYS 78  374 374 LYS LYS A . n 
C 3 79  ARG 79  375 375 ARG ARG A . n 
C 3 80  ALA 80  376 376 ALA ALA A . n 
C 3 81  ALA 81  377 377 ALA ALA A . n 
C 3 82  VAL 82  378 378 VAL VAL A . n 
C 3 83  ALA 83  379 379 ALA ALA A . n 
C 3 84  LEU 84  380 380 LEU LEU A . n 
C 3 85  LYS 85  381 381 LYS LYS A . n 
C 3 86  TRP 86  382 382 TRP TRP A . n 
C 3 87  LYS 87  383 383 LYS LYS A . n 
C 3 88  GLY 88  384 384 GLY GLY A . n 
C 3 89  ILE 89  385 385 ILE ILE A . n 
C 3 90  GLU 90  386 386 GLU GLU A . n 
C 3 91  LEU 91  387 387 LEU LEU A . n 
C 3 92  CYS 92  388 388 CYS CYS A . n 
C 3 93  GLY 93  389 389 GLY GLY A . n 
C 3 94  VAL 94  390 390 VAL VAL A . n 
C 3 95  SER 95  391 391 SER SER A . n 
C 3 96  PHE 96  392 392 PHE PHE A . n 
C 3 97  ASP 97  393 393 ASP ASP A . n 
C 3 98  LEU 98  394 394 LEU LEU A . n 
C 3 99  LEU 99  395 395 LEU LEU A . n 
C 3 100 LEU 100 396 396 LEU LEU A . n 
C 3 101 ALA 101 397 397 ALA ALA A . n 
C 3 102 ALA 102 398 398 ALA ALA A . n 
C 3 103 TYR 103 399 399 TYR TYR A . n 
C 3 104 LEU 104 400 400 LEU LEU A . n 
C 3 105 LEU 105 401 401 LEU LEU A . n 
C 3 106 ASP 106 402 402 ASP ASP A . n 
C 3 107 PRO 107 403 403 PRO PRO A . n 
C 3 108 ALA 108 404 404 ALA ALA A . n 
C 3 109 GLN 109 405 405 GLN GLN A . n 
C 3 110 GLY 110 406 406 GLY GLY A . n 
C 3 111 VAL 111 407 407 VAL VAL A . n 
C 3 112 ASP 112 408 408 ASP ASP A . n 
C 3 113 ASP 113 409 409 ASP ASP A . n 
C 3 114 VAL 114 410 410 VAL VAL A . n 
C 3 115 ALA 115 411 411 ALA ALA A . n 
C 3 116 ALA 116 412 412 ALA ALA A . n 
C 3 117 ALA 117 413 413 ALA ALA A . n 
C 3 118 ALA 118 414 414 ALA ALA A . n 
C 3 119 LYS 119 415 415 LYS LYS A . n 
C 3 120 MET 120 416 416 MET MET A . n 
C 3 121 LYS 121 417 417 LYS LYS A . n 
C 3 122 GLN 122 418 418 GLN GLN A . n 
C 3 123 TYR 123 419 419 TYR TYR A . n 
C 3 124 GLU 124 420 420 GLU GLU A . n 
C 3 125 ALA 125 421 421 ALA ALA A . n 
C 3 126 VAL 126 422 422 VAL VAL A . n 
C 3 127 ARG 127 423 423 ARG ARG A . n 
C 3 128 PRO 128 424 424 PRO PRO A . n 
C 3 129 ASP 129 425 425 ASP ASP A . n 
C 3 130 GLU 130 426 426 GLU GLU A . n 
C 3 131 ALA 131 427 427 ALA ALA A . n 
C 3 132 VAL 132 428 428 VAL VAL A . n 
C 3 133 TYR 133 429 429 TYR TYR A . n 
C 3 134 GLY 134 430 430 GLY GLY A . n 
C 3 135 LYS 135 431 431 LYS LYS A . n 
C 3 136 GLY 136 432 432 GLY GLY A . n 
C 3 137 ALA 137 433 433 ALA ALA A . n 
C 3 138 LYS 138 434 434 LYS LYS A . n 
C 3 139 ARG 139 435 435 ARG ARG A . n 
C 3 140 ALA 140 436 436 ALA ALA A . n 
C 3 141 VAL 141 437 437 VAL VAL A . n 
C 3 142 PRO 142 438 438 PRO PRO A . n 
C 3 143 ASP 143 439 439 ASP ASP A . n 
C 3 144 GLU 144 440 440 GLU GLU A . n 
C 3 145 PRO 145 441 441 PRO PRO A . n 
C 3 146 VAL 146 442 442 VAL VAL A . n 
C 3 147 LEU 147 443 443 LEU LEU A . n 
C 3 148 ALA 148 444 444 ALA ALA A . n 
C 3 149 GLU 149 445 445 GLU GLU A . n 
C 3 150 HIS 150 446 446 HIS HIS A . n 
C 3 151 LEU 151 447 447 LEU LEU A . n 
C 3 152 VAL 152 448 448 VAL VAL A . n 
C 3 153 ARG 153 449 449 ARG ARG A . n 
C 3 154 LYS 154 450 450 LYS LYS A . n 
C 3 155 ALA 155 451 451 ALA ALA A . n 
C 3 156 ALA 156 452 452 ALA ALA A . n 
C 3 157 ALA 157 453 453 ALA ALA A . n 
C 3 158 ILE 158 454 454 ILE ILE A . n 
C 3 159 TRP 159 455 455 TRP TRP A . n 
C 3 160 GLU 160 456 456 GLU GLU A . n 
C 3 161 LEU 161 457 457 LEU LEU A . n 
C 3 162 GLU 162 458 458 GLU GLU A . n 
C 3 163 ARG 163 459 459 ARG ARG A . n 
C 3 164 PRO 164 460 460 PRO PRO A . n 
C 3 165 PHE 165 461 461 PHE PHE A . n 
C 3 166 LEU 166 462 462 LEU LEU A . n 
C 3 167 ASP 167 463 463 ASP ASP A . n 
C 3 168 GLU 168 464 464 GLU GLU A . n 
C 3 169 LEU 169 465 465 LEU LEU A . n 
C 3 170 ARG 170 466 466 ARG ARG A . n 
C 3 171 ARG 171 467 467 ARG ARG A . n 
C 3 172 ASN 172 468 468 ASN ASN A . n 
C 3 173 GLU 173 469 469 GLU GLU A . n 
C 3 174 GLN 174 470 470 GLN GLN A . n 
C 3 175 ASP 175 471 471 ASP ASP A . n 
C 3 176 ARG 176 472 472 ARG ARG A . n 
C 3 177 LEU 177 473 473 LEU LEU A . n 
C 3 178 LEU 178 474 474 LEU LEU A . n 
C 3 179 VAL 179 475 475 VAL VAL A . n 
C 3 180 GLU 180 476 476 GLU GLU A . n 
C 3 181 LEU 181 477 477 LEU LEU A . n 
C 3 182 GLU 182 478 478 GLU GLU A . n 
C 3 183 GLN 183 479 479 GLN GLN A . n 
C 3 184 PRO 184 480 480 PRO PRO A . n 
C 3 185 LEU 185 481 481 LEU LEU A . n 
C 3 186 SER 186 482 482 SER SER A . n 
C 3 187 SER 187 483 483 SER SER A . n 
C 3 188 ILE 188 484 484 ILE ILE A . n 
C 3 189 LEU 189 485 485 LEU LEU A . n 
C 3 190 ALA 190 486 486 ALA ALA A . n 
C 3 191 GLU 191 487 487 GLU GLU A . n 
C 3 192 MET 192 488 488 MET MET A . n 
C 3 193 GLU 193 489 489 GLU GLU A . n 
C 3 194 PHE 194 490 490 PHE PHE A . n 
C 3 195 ALA 195 491 491 ALA ALA A . n 
C 3 196 GLY 196 492 492 GLY GLY A . n 
C 3 197 VAL 197 493 493 VAL VAL A . n 
C 3 198 LYS 198 494 494 LYS LYS A . n 
C 3 199 VAL 199 495 495 VAL VAL A . n 
C 3 200 ASP 200 496 496 ASP ASP A . n 
C 3 201 THR 201 497 497 THR THR A . n 
C 3 202 LYS 202 498 498 LYS LYS A . n 
C 3 203 ARG 203 499 499 ARG ARG A . n 
C 3 204 LEU 204 500 500 LEU LEU A . n 
C 3 205 GLU 205 501 501 GLU GLU A . n 
C 3 206 GLN 206 502 502 GLN GLN A . n 
C 3 207 MET 207 503 503 MET MET A . n 
C 3 208 GLY 208 504 504 GLY GLY A . n 
C 3 209 LYS 209 505 505 LYS LYS A . n 
C 3 210 GLU 210 506 506 GLU GLU A . n 
C 3 211 LEU 211 507 507 LEU LEU A . n 
C 3 212 ALA 212 508 508 ALA ALA A . n 
C 3 213 GLU 213 509 509 GLU GLU A . n 
C 3 214 GLN 214 510 510 GLN GLN A . n 
C 3 215 LEU 215 511 511 LEU LEU A . n 
C 3 216 GLY 216 512 512 GLY GLY A . n 
C 3 217 THR 217 513 513 THR THR A . n 
C 3 218 VAL 218 514 514 VAL VAL A . n 
C 3 219 GLU 219 515 515 GLU GLU A . n 
C 3 220 GLN 220 516 516 GLN GLN A . n 
C 3 221 ARG 221 517 517 ARG ARG A . n 
C 3 222 ILE 222 518 518 ILE ILE A . n 
C 3 223 TYR 223 519 519 TYR TYR A . n 
C 3 224 GLU 224 520 520 GLU GLU A . n 
C 3 225 LEU 225 521 521 LEU LEU A . n 
C 3 226 ALA 226 522 522 ALA ALA A . n 
C 3 227 GLY 227 523 523 GLY GLY A . n 
C 3 228 GLN 228 524 524 GLN GLN A . n 
C 3 229 GLU 229 525 525 GLU GLU A . n 
C 3 230 PHE 230 526 526 PHE PHE A . n 
C 3 231 ASN 231 527 527 ASN ASN A . n 
C 3 232 ILE 232 528 528 ILE ILE A . n 
C 3 233 ASN 233 529 529 ASN ASN A . n 
C 3 234 SER 234 530 530 SER SER A . n 
C 3 235 PRO 235 531 531 PRO PRO A . n 
C 3 236 LYS 236 532 532 LYS LYS A . n 
C 3 237 GLN 237 533 533 GLN GLN A . n 
C 3 238 LEU 238 534 534 LEU LEU A . n 
C 3 239 GLY 239 535 535 GLY GLY A . n 
C 3 240 VAL 240 536 536 VAL VAL A . n 
C 3 241 ILE 241 537 537 ILE ILE A . n 
C 3 242 LEU 242 538 538 LEU LEU A . n 
C 3 243 PHE 243 539 539 PHE PHE A . n 
C 3 244 GLU 244 540 540 GLU GLU A . n 
C 3 245 LYS 245 541 541 LYS LYS A . n 
C 3 246 LEU 246 542 542 LEU LEU A . n 
C 3 247 GLN 247 543 543 GLN GLN A . n 
C 3 248 LEU 248 544 544 LEU LEU A . n 
C 3 249 PRO 249 545 545 PRO PRO A . n 
C 3 250 VAL 250 546 546 VAL VAL A . n 
C 3 251 LEU 251 547 547 LEU LEU A . n 
C 3 252 LYS 252 548 548 LYS LYS A . n 
C 3 253 LYS 253 549 549 LYS LYS A . n 
C 3 254 THR 254 550 550 THR THR A . n 
C 3 255 LYS 255 551 551 LYS LYS A . n 
C 3 256 THR 256 552 552 THR THR A . n 
C 3 257 GLY 257 553 553 GLY GLY A . n 
C 3 258 TYR 258 554 554 TYR TYR A . n 
C 3 259 SER 259 555 555 SER SER A . n 
C 3 260 THR 260 556 556 THR THR A . n 
C 3 261 SER 261 557 557 SER SER A . n 
C 3 262 ALA 262 558 558 ALA ALA A . n 
C 3 263 ASP 263 559 559 ASP ASP A . n 
C 3 264 VAL 264 560 560 VAL VAL A . n 
C 3 265 LEU 265 561 561 LEU LEU A . n 
C 3 266 GLU 266 562 562 GLU GLU A . n 
C 3 267 LYS 267 563 563 LYS LYS A . n 
C 3 268 LEU 268 564 564 LEU LEU A . n 
C 3 269 ALA 269 565 565 ALA ALA A . n 
C 3 270 PRO 270 566 566 PRO PRO A . n 
C 3 271 TYR 271 567 567 TYR TYR A . n 
C 3 272 HIS 272 568 568 HIS HIS A . n 
C 3 273 GLU 273 569 569 GLU GLU A . n 
C 3 274 ILE 274 570 570 ILE ILE A . n 
C 3 275 VAL 275 571 571 VAL VAL A . n 
C 3 276 GLU 276 572 572 GLU GLU A . n 
C 3 277 ASN 277 573 573 ASN ASN A . n 
C 3 278 ILE 278 574 574 ILE ILE A . n 
C 3 279 LEU 279 575 575 LEU LEU A . n 
C 3 280 HIS 280 576 576 HIS HIS A . n 
C 3 281 TYR 281 577 577 TYR TYR A . n 
C 3 282 ARG 282 578 578 ARG ARG A . n 
C 3 283 GLN 283 579 579 GLN GLN A . n 
C 3 284 LEU 284 580 580 LEU LEU A . n 
C 3 285 GLY 285 581 581 GLY GLY A . n 
C 3 286 LYS 286 582 582 LYS LYS A . n 
C 3 287 LEU 287 583 583 LEU LEU A . n 
C 3 288 GLN 288 584 584 GLN GLN A . n 
C 3 289 SER 289 585 585 SER SER A . n 
C 3 290 THR 290 586 586 THR THR A . n 
C 3 291 TYR 291 587 587 TYR TYR A . n 
C 3 292 ILE 292 588 588 ILE ILE A . n 
C 3 293 GLU 293 589 589 GLU GLU A . n 
C 3 294 GLY 294 590 590 GLY GLY A . n 
C 3 295 LEU 295 591 591 LEU LEU A . n 
C 3 296 LEU 296 592 592 LEU LEU A . n 
C 3 297 LYS 297 593 593 LYS LYS A . n 
C 3 298 VAL 298 594 594 VAL VAL A . n 
C 3 299 VAL 299 595 595 VAL VAL A . n 
C 3 300 ARG 300 596 596 ARG ARG A . n 
C 3 301 PRO 301 597 597 PRO PRO A . n 
C 3 302 ASP 302 598 598 ASP ASP A . n 
C 3 303 THR 303 599 599 THR THR A . n 
C 3 304 LYS 304 600 600 LYS LYS A . n 
C 3 305 LYS 305 601 601 LYS LYS A . n 
C 3 306 VAL 306 602 602 VAL VAL A . n 
C 3 307 HIS 307 603 603 HIS HIS A . n 
C 3 308 THR 308 604 604 THR THR A . n 
C 3 309 ILE 309 605 605 ILE ILE A . n 
C 3 310 PHE 310 606 606 PHE PHE A . n 
C 3 311 ASN 311 607 607 ASN ASN A . n 
C 3 312 GLN 312 608 608 GLN GLN A . n 
C 3 313 ALA 313 609 609 ALA ALA A . n 
C 3 314 LEU 314 610 610 LEU LEU A . n 
C 3 315 THR 315 611 611 THR THR A . n 
C 3 316 GLN 316 612 612 GLN GLN A . n 
C 3 317 THR 317 613 613 THR THR A . n 
C 3 318 GLY 318 614 614 GLY GLY A . n 
C 3 319 ARG 319 615 615 ARG ARG A . n 
C 3 320 LEU 320 616 616 LEU LEU A . n 
C 3 321 SER 321 617 617 SER SER A . n 
C 3 322 SER 322 618 618 SER SER A . n 
C 3 323 THR 323 619 619 THR THR A . n 
C 3 324 GLU 324 620 620 GLU GLU A . n 
C 3 325 PRO 325 621 621 PRO PRO A . n 
C 3 326 ASN 326 622 622 ASN ASN A . n 
C 3 327 LEU 327 623 623 LEU LEU A . n 
C 3 328 GLN 328 624 624 GLN GLN A . n 
C 3 329 ASN 329 625 625 ASN ASN A . n 
C 3 330 ILE 330 626 626 ILE ILE A . n 
C 3 331 PRO 331 627 627 PRO PRO A . n 
C 3 332 ILE 332 628 628 ILE ILE A . n 
C 3 333 ARG 333 629 629 ARG ARG A . n 
C 3 334 LEU 334 630 630 LEU LEU A . n 
C 3 335 GLU 335 631 631 GLU GLU A . n 
C 3 336 GLU 336 632 632 GLU GLU A . n 
C 3 337 GLY 337 633 633 GLY GLY A . n 
C 3 338 ARG 338 634 634 ARG ARG A . n 
C 3 339 LYS 339 635 635 LYS LYS A . n 
C 3 340 ILE 340 636 636 ILE ILE A . n 
C 3 341 ARG 341 637 637 ARG ARG A . n 
C 3 342 GLN 342 638 638 GLN GLN A . n 
C 3 343 ALA 343 639 639 ALA ALA A . n 
C 3 344 PHE 344 640 640 PHE PHE A . n 
C 3 345 VAL 345 641 641 VAL VAL A . n 
C 3 346 PRO 346 642 642 PRO PRO A . n 
C 3 347 SER 347 643 643 SER SER A . n 
C 3 348 GLU 348 644 644 GLU GLU A . n 
C 3 349 SER 349 645 645 SER SER A . n 
C 3 350 ASP 350 646 646 ASP ASP A . n 
C 3 351 TRP 351 647 647 TRP TRP A . n 
C 3 352 LEU 352 648 648 LEU LEU A . n 
C 3 353 ILE 353 649 649 ILE ILE A . n 
C 3 354 PHE 354 650 650 PHE PHE A . n 
C 3 355 ALA 355 651 651 ALA ALA A . n 
C 3 356 ALA 356 652 652 ALA ALA A . n 
C 3 357 ASP 357 653 653 ASP ASP A . n 
C 3 358 TYR 358 654 654 TYR TYR A . n 
C 3 359 SER 359 655 655 SER SER A . n 
C 3 360 GLN 360 656 656 GLN GLN A . n 
C 3 361 ILE 361 657 657 ILE ILE A . n 
C 3 362 GLU 362 658 658 GLU GLU A . n 
C 3 363 LEU 363 659 659 LEU LEU A . n 
C 3 364 ARG 364 660 660 ARG ARG A . n 
C 3 365 VAL 365 661 661 VAL VAL A . n 
C 3 366 LEU 366 662 662 LEU LEU A . n 
C 3 367 ALA 367 663 663 ALA ALA A . n 
C 3 368 HIS 368 664 664 HIS HIS A . n 
C 3 369 ILE 369 665 665 ILE ILE A . n 
C 3 370 ALA 370 666 666 ALA ALA A . n 
C 3 371 GLU 371 667 667 GLU GLU A . n 
C 3 372 ASP 372 668 668 ASP ASP A . n 
C 3 373 ASP 373 669 669 ASP ASP A . n 
C 3 374 ASN 374 670 670 ASN ASN A . n 
C 3 375 LEU 375 671 671 LEU LEU A . n 
C 3 376 MET 376 672 672 MET MET A . n 
C 3 377 GLU 377 673 673 GLU GLU A . n 
C 3 378 ALA 378 674 674 ALA ALA A . n 
C 3 379 PHE 379 675 675 PHE PHE A . n 
C 3 380 ARG 380 676 676 ARG ARG A . n 
C 3 381 ARG 381 677 677 ARG ARG A . n 
C 3 382 ASP 382 678 678 ASP ASP A . n 
C 3 383 LEU 383 679 679 LEU LEU A . n 
C 3 384 ASP 384 680 680 ASP ASP A . n 
C 3 385 ILE 385 681 681 ILE ILE A . n 
C 3 386 HIS 386 682 682 HIS HIS A . n 
C 3 387 THR 387 683 683 THR THR A . n 
C 3 388 LYS 388 684 684 LYS LYS A . n 
C 3 389 THR 389 685 685 THR THR A . n 
C 3 390 ALA 390 686 686 ALA ALA A . n 
C 3 391 MET 391 687 687 MET MET A . n 
C 3 392 ASP 392 688 688 ASP ASP A . n 
C 3 393 ILE 393 689 689 ILE ILE A . n 
C 3 394 PHE 394 690 690 PHE PHE A . n 
C 3 395 GLN 395 691 691 GLN GLN A . n 
C 3 396 VAL 396 692 692 VAL VAL A . n 
C 3 397 SER 397 693 693 SER SER A . n 
C 3 398 GLU 398 694 694 GLU GLU A . n 
C 3 399 ASP 399 695 695 ASP ASP A . n 
C 3 400 GLU 400 696 696 GLU GLU A . n 
C 3 401 VAL 401 697 697 VAL VAL A . n 
C 3 402 THR 402 698 698 THR THR A . n 
C 3 403 PRO 403 699 699 PRO PRO A . n 
C 3 404 ASN 404 700 700 ASN ASN A . n 
C 3 405 MET 405 701 701 MET MET A . n 
C 3 406 ARG 406 702 702 ARG ARG A . n 
C 3 407 ARG 407 703 703 ARG ARG A . n 
C 3 408 GLN 408 704 704 GLN GLN A . n 
C 3 409 ALA 409 705 705 ALA ALA A . n 
C 3 410 LYS 410 706 706 LYS LYS A . n 
C 3 411 ALA 411 707 707 ALA ALA A . n 
C 3 412 VAL 412 708 708 VAL VAL A . n 
C 3 413 ASN 413 709 709 ASN ASN A . n 
C 3 414 PHE 414 710 710 PHE PHE A . n 
C 3 415 GLY 415 711 711 GLY GLY A . n 
C 3 416 ILE 416 712 712 ILE ILE A . n 
C 3 417 VAL 417 713 713 VAL VAL A . n 
C 3 418 TYR 418 714 714 TYR TYR A . n 
C 3 419 GLY 419 715 715 GLY GLY A . n 
C 3 420 ILE 420 716 716 ILE ILE A . n 
C 3 421 SER 421 717 717 SER SER A . n 
C 3 422 ASP 422 718 718 ASP ASP A . n 
C 3 423 TYR 423 719 719 TYR TYR A . n 
C 3 424 GLY 424 720 720 GLY GLY A . n 
C 3 425 LEU 425 721 721 LEU LEU A . n 
C 3 426 ALA 426 722 722 ALA ALA A . n 
C 3 427 GLN 427 723 723 GLN GLN A . n 
C 3 428 ASN 428 724 724 ASN ASN A . n 
C 3 429 LEU 429 725 725 LEU LEU A . n 
C 3 430 ASN 430 726 726 ASN ASN A . n 
C 3 431 ILE 431 727 727 ILE ILE A . n 
C 3 432 SER 432 728 728 SER SER A . n 
C 3 433 ARG 433 729 729 ARG ARG A . n 
C 3 434 LYS 434 730 730 LYS LYS A . n 
C 3 435 GLU 435 731 731 GLU GLU A . n 
C 3 436 ALA 436 732 732 ALA ALA A . n 
C 3 437 ALA 437 733 733 ALA ALA A . n 
C 3 438 GLU 438 734 734 GLU GLU A . n 
C 3 439 PHE 439 735 735 PHE PHE A . n 
C 3 440 ILE 440 736 736 ILE ILE A . n 
C 3 441 GLU 441 737 737 GLU GLU A . n 
C 3 442 ARG 442 738 738 ARG ARG A . n 
C 3 443 TYR 443 739 739 TYR TYR A . n 
C 3 444 PHE 444 740 740 PHE PHE A . n 
C 3 445 GLU 445 741 741 GLU GLU A . n 
C 3 446 SER 446 742 742 SER SER A . n 
C 3 447 PHE 447 743 743 PHE PHE A . n 
C 3 448 PRO 448 744 744 PRO PRO A . n 
C 3 449 GLY 449 745 745 GLY GLY A . n 
C 3 450 VAL 450 746 746 VAL VAL A . n 
C 3 451 LYS 451 747 747 LYS LYS A . n 
C 3 452 ARG 452 748 748 ARG ARG A . n 
C 3 453 TYR 453 749 749 TYR TYR A . n 
C 3 454 MET 454 750 750 MET MET A . n 
C 3 455 GLU 455 751 751 GLU GLU A . n 
C 3 456 ASN 456 752 752 ASN ASN A . n 
C 3 457 ILE 457 753 753 ILE ILE A . n 
C 3 458 VAL 458 754 754 VAL VAL A . n 
C 3 459 GLN 459 755 755 GLN GLN A . n 
C 3 460 GLU 460 756 756 GLU GLU A . n 
C 3 461 ALA 461 757 757 ALA ALA A . n 
C 3 462 LYS 462 758 758 LYS LYS A . n 
C 3 463 GLN 463 759 759 GLN GLN A . n 
C 3 464 LYS 464 760 760 LYS LYS A . n 
C 3 465 GLY 465 761 761 GLY GLY A . n 
C 3 466 TYR 466 762 762 TYR TYR A . n 
C 3 467 VAL 467 763 763 VAL VAL A . n 
C 3 468 THR 468 764 764 THR THR A . n 
C 3 469 THR 469 765 765 THR THR A . n 
C 3 470 LEU 470 766 766 LEU LEU A . n 
C 3 471 LEU 471 767 767 LEU LEU A . n 
C 3 472 HIS 472 768 768 HIS HIS A . n 
C 3 473 ARG 473 769 769 ARG ARG A . n 
C 3 474 ARG 474 770 770 ARG ARG A . n 
C 3 475 ARG 475 771 771 ARG ARG A . n 
C 3 476 TYR 476 772 772 TYR TYR A . n 
C 3 477 LEU 477 773 773 LEU LEU A . n 
C 3 478 PRO 478 774 774 PRO PRO A . n 
C 3 479 ASP 479 775 775 ASP ASP A . n 
C 3 480 ILE 480 776 776 ILE ILE A . n 
C 3 481 THR 481 777 777 THR THR A . n 
C 3 482 SER 482 778 778 SER SER A . n 
C 3 483 ARG 483 779 779 ARG ARG A . n 
C 3 484 ASN 484 780 780 ASN ASN A . n 
C 3 485 PHE 485 781 781 PHE PHE A . n 
C 3 486 ASN 486 782 782 ASN ASN A . n 
C 3 487 VAL 487 783 783 VAL VAL A . n 
C 3 488 ARG 488 784 784 ARG ARG A . n 
C 3 489 SER 489 785 785 SER SER A . n 
C 3 490 PHE 490 786 786 PHE PHE A . n 
C 3 491 ALA 491 787 787 ALA ALA A . n 
C 3 492 GLU 492 788 788 GLU GLU A . n 
C 3 493 ARG 493 789 789 ARG ARG A . n 
C 3 494 MET 494 790 790 MET MET A . n 
C 3 495 ALA 495 791 791 ALA ALA A . n 
C 3 496 MET 496 792 792 MET MET A . n 
C 3 497 ASN 497 793 793 ASN ASN A . n 
C 3 498 THR 498 794 794 THR THR A . n 
C 3 499 PRO 499 795 795 PRO PRO A . n 
C 3 500 ILE 500 796 796 ILE ILE A . n 
C 3 501 GLN 501 797 797 GLN GLN A . n 
C 3 502 GLY 502 798 798 GLY GLY A . n 
C 3 503 SER 503 799 799 SER SER A . n 
C 3 504 ALA 504 800 800 ALA ALA A . n 
C 3 505 ALA 505 801 801 ALA ALA A . n 
C 3 506 ASP 506 802 802 ASP ASP A . n 
C 3 507 ILE 507 803 803 ILE ILE A . n 
C 3 508 ILE 508 804 804 ILE ILE A . n 
C 3 509 LYS 509 805 805 LYS LYS A . n 
C 3 510 LYS 510 806 806 LYS LYS A . n 
C 3 511 ALA 511 807 807 ALA ALA A . n 
C 3 512 MET 512 808 808 MET MET A . n 
C 3 513 ILE 513 809 809 ILE ILE A . n 
C 3 514 ASP 514 810 810 ASP ASP A . n 
C 3 515 LEU 515 811 811 LEU LEU A . n 
C 3 516 ASN 516 812 812 ASN ASN A . n 
C 3 517 ALA 517 813 813 ALA ALA A . n 
C 3 518 ARG 518 814 814 ARG ARG A . n 
C 3 519 LEU 519 815 815 LEU LEU A . n 
C 3 520 LYS 520 816 816 LYS LYS A . n 
C 3 521 GLU 521 817 817 GLU GLU A . n 
C 3 522 GLU 522 818 818 GLU GLU A . n 
C 3 523 ARG 523 819 819 ARG ARG A . n 
C 3 524 LEU 524 820 820 LEU LEU A . n 
C 3 525 GLN 525 821 821 GLN GLN A . n 
C 3 526 ALA 526 822 822 ALA ALA A . n 
C 3 527 HIS 527 823 823 HIS HIS A . n 
C 3 528 LEU 528 824 824 LEU LEU A . n 
C 3 529 LEU 529 825 825 LEU LEU A . n 
C 3 530 LEU 530 826 826 LEU LEU A . n 
C 3 531 GLN 531 827 827 GLN GLN A . n 
C 3 532 VAL 532 828 828 VAL VAL A . n 
C 3 533 HIS 533 829 829 HIS HIS A . n 
C 3 534 ASP 534 830 830 ASP ASP A . n 
C 3 535 GLU 535 831 831 GLU GLU A . n 
C 3 536 LEU 536 832 832 LEU LEU A . n 
C 3 537 ILE 537 833 833 ILE ILE A . n 
C 3 538 LEU 538 834 834 LEU LEU A . n 
C 3 539 GLU 539 835 835 GLU GLU A . n 
C 3 540 ALA 540 836 836 ALA ALA A . n 
C 3 541 PRO 541 837 837 PRO PRO A . n 
C 3 542 LYS 542 838 838 LYS LYS A . n 
C 3 543 GLU 543 839 839 GLU GLU A . n 
C 3 544 GLU 544 840 840 GLU GLU A . n 
C 3 545 MET 545 841 841 MET MET A . n 
C 3 546 GLU 546 842 842 GLU GLU A . n 
C 3 547 ARG 547 843 843 ARG ARG A . n 
C 3 548 LEU 548 844 844 LEU LEU A . n 
C 3 549 CYS 549 845 845 CYS CYS A . n 
C 3 550 ARG 550 846 846 ARG ARG A . n 
C 3 551 LEU 551 847 847 LEU LEU A . n 
C 3 552 VAL 552 848 848 VAL VAL A . n 
C 3 553 PRO 553 849 849 PRO PRO A . n 
C 3 554 GLU 554 850 850 GLU GLU A . n 
C 3 555 VAL 555 851 851 VAL VAL A . n 
C 3 556 MET 556 852 852 MET MET A . n 
C 3 557 GLU 557 853 853 GLU GLU A . n 
C 3 558 GLN 558 854 854 GLN GLN A . n 
C 3 559 ALA 559 855 855 ALA ALA A . n 
C 3 560 VAL 560 856 856 VAL VAL A . n 
C 3 561 THR 561 857 857 THR THR A . n 
C 3 562 LEU 562 858 858 LEU LEU A . n 
C 3 563 ARG 563 859 859 ARG ARG A . n 
C 3 564 VAL 564 860 860 VAL VAL A . n 
C 3 565 PRO 565 861 861 PRO PRO A . n 
C 3 566 LEU 566 862 862 LEU LEU A . n 
C 3 567 LYS 567 863 863 LYS LYS A . n 
C 3 568 VAL 568 864 864 VAL VAL A . n 
C 3 569 ASP 569 865 865 ASP ASP A . n 
C 3 570 TYR 570 866 866 TYR TYR A . n 
C 3 571 HIS 571 867 867 HIS HIS A . n 
C 3 572 TYR 572 868 868 TYR TYR A . n 
C 3 573 GLY 573 869 869 GLY GLY A . n 
C 3 574 SER 574 870 870 SER SER A . n 
C 3 575 THR 575 871 871 THR THR A . n 
C 3 576 TRP 576 872 872 TRP TRP A . n 
C 3 577 TYR 577 873 873 TYR TYR A . n 
C 3 578 ASP 578 874 874 ASP ASP A . n 
C 3 579 ALA 579 875 875 ALA ALA A . n 
C 3 580 LYS 580 876 876 LYS LYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 SUC 1   901  901  SUC SUC A . 
E 4 SUC 1   902  902  SUC SUC A . 
F 5 SO4 1   910  910  SO4 SO4 A . 
G 5 SO4 1   911  911  SO4 SO4 A . 
H 5 SO4 1   912  912  SO4 SO4 A . 
I 5 SO4 1   913  913  SO4 SO4 A . 
J 5 SO4 1   914  914  SO4 SO4 A . 
K 6 MG  1   920  920  MG  MG  A . 
L 7 HOH 1   1049 1049 HOH WAT B . 
L 7 HOH 2   2170 2170 HOH WAT B . 
L 7 HOH 3   2868 2868 HOH WAT B . 
L 7 HOH 4   2915 2915 HOH WAT B . 
L 7 HOH 5   3110 3110 HOH WAT B . 
L 7 HOH 6   3232 3232 HOH WAT B . 
L 7 HOH 7   3235 3235 HOH WAT B . 
L 7 HOH 8   3317 3317 HOH WAT B . 
L 7 HOH 9   3327 3327 HOH WAT B . 
M 7 HOH 1   1010 1010 HOH WAT C . 
M 7 HOH 2   2290 2290 HOH WAT C . 
M 7 HOH 3   2600 2600 HOH WAT C . 
M 7 HOH 4   2742 2742 HOH WAT C . 
M 7 HOH 5   2820 2820 HOH WAT C . 
M 7 HOH 6   2828 2828 HOH WAT C . 
M 7 HOH 7   2829 2829 HOH WAT C . 
M 7 HOH 8   2913 2913 HOH WAT C . 
M 7 HOH 9   2980 2980 HOH WAT C . 
M 7 HOH 10  3020 3020 HOH WAT C . 
M 7 HOH 11  3050 3050 HOH WAT C . 
M 7 HOH 12  3089 3089 HOH WAT C . 
M 7 HOH 13  3112 3112 HOH WAT C . 
M 7 HOH 14  3116 3116 HOH WAT C . 
M 7 HOH 15  3261 3261 HOH WAT C . 
M 7 HOH 16  3264 3264 HOH WAT C . 
M 7 HOH 17  3265 3265 HOH WAT C . 
M 7 HOH 18  3310 3310 HOH WAT C . 
M 7 HOH 19  3322 3322 HOH WAT C . 
M 7 HOH 20  3323 3323 HOH WAT C . 
M 7 HOH 21  3325 3325 HOH WAT C . 
M 7 HOH 22  3329 3329 HOH WAT C . 
N 7 HOH 1   1004 1004 HOH WAT A . 
N 7 HOH 2   1006 1006 HOH WAT A . 
N 7 HOH 3   1008 1008 HOH WAT A . 
N 7 HOH 4   1009 1009 HOH WAT A . 
N 7 HOH 5   1016 1016 HOH WAT A . 
N 7 HOH 6   1028 1028 HOH WAT A . 
N 7 HOH 7   1030 1030 HOH WAT A . 
N 7 HOH 8   1031 1031 HOH WAT A . 
N 7 HOH 9   1032 1032 HOH WAT A . 
N 7 HOH 10  1034 1034 HOH WAT A . 
N 7 HOH 11  1035 1035 HOH WAT A . 
N 7 HOH 12  1037 1037 HOH WAT A . 
N 7 HOH 13  1040 1040 HOH WAT A . 
N 7 HOH 14  1041 1041 HOH WAT A . 
N 7 HOH 15  1042 1042 HOH WAT A . 
N 7 HOH 16  1045 1045 HOH WAT A . 
N 7 HOH 17  1046 1046 HOH WAT A . 
N 7 HOH 18  2001 2001 HOH WAT A . 
N 7 HOH 19  2002 2002 HOH WAT A . 
N 7 HOH 20  2003 2003 HOH WAT A . 
N 7 HOH 21  2006 2006 HOH WAT A . 
N 7 HOH 22  2007 2007 HOH WAT A . 
N 7 HOH 23  2009 2009 HOH WAT A . 
N 7 HOH 24  2010 2010 HOH WAT A . 
N 7 HOH 25  2011 2011 HOH WAT A . 
N 7 HOH 26  2012 2012 HOH WAT A . 
N 7 HOH 27  2013 2013 HOH WAT A . 
N 7 HOH 28  2016 2016 HOH WAT A . 
N 7 HOH 29  2018 2018 HOH WAT A . 
N 7 HOH 30  2019 2019 HOH WAT A . 
N 7 HOH 31  2020 2020 HOH WAT A . 
N 7 HOH 32  2021 2021 HOH WAT A . 
N 7 HOH 33  2022 2022 HOH WAT A . 
N 7 HOH 34  2023 2023 HOH WAT A . 
N 7 HOH 35  2024 2024 HOH WAT A . 
N 7 HOH 36  2025 2025 HOH WAT A . 
N 7 HOH 37  2026 2026 HOH WAT A . 
N 7 HOH 38  2028 2028 HOH WAT A . 
N 7 HOH 39  2029 2029 HOH WAT A . 
N 7 HOH 40  2031 2031 HOH WAT A . 
N 7 HOH 41  2033 2033 HOH WAT A . 
N 7 HOH 42  2034 2034 HOH WAT A . 
N 7 HOH 43  2035 2035 HOH WAT A . 
N 7 HOH 44  2036 2036 HOH WAT A . 
N 7 HOH 45  2037 2037 HOH WAT A . 
N 7 HOH 46  2038 2038 HOH WAT A . 
N 7 HOH 47  2040 2040 HOH WAT A . 
N 7 HOH 48  2041 2041 HOH WAT A . 
N 7 HOH 49  2045 2045 HOH WAT A . 
N 7 HOH 50  2046 2046 HOH WAT A . 
N 7 HOH 51  2048 2048 HOH WAT A . 
N 7 HOH 52  2050 2050 HOH WAT A . 
N 7 HOH 53  2051 2051 HOH WAT A . 
N 7 HOH 54  2053 2053 HOH WAT A . 
N 7 HOH 55  2055 2055 HOH WAT A . 
N 7 HOH 56  2057 2057 HOH WAT A . 
N 7 HOH 57  2058 2058 HOH WAT A . 
N 7 HOH 58  2059 2059 HOH WAT A . 
N 7 HOH 59  2101 2101 HOH WAT A . 
N 7 HOH 60  2103 2103 HOH WAT A . 
N 7 HOH 61  2105 2105 HOH WAT A . 
N 7 HOH 62  2109 2109 HOH WAT A . 
N 7 HOH 63  2111 2111 HOH WAT A . 
N 7 HOH 64  2112 2112 HOH WAT A . 
N 7 HOH 65  2115 2115 HOH WAT A . 
N 7 HOH 66  2116 2116 HOH WAT A . 
N 7 HOH 67  2121 2121 HOH WAT A . 
N 7 HOH 68  2123 2123 HOH WAT A . 
N 7 HOH 69  2126 2126 HOH WAT A . 
N 7 HOH 70  2132 2132 HOH WAT A . 
N 7 HOH 71  2135 2135 HOH WAT A . 
N 7 HOH 72  2137 2137 HOH WAT A . 
N 7 HOH 73  2139 2139 HOH WAT A . 
N 7 HOH 74  2140 2140 HOH WAT A . 
N 7 HOH 75  2144 2144 HOH WAT A . 
N 7 HOH 76  2145 2145 HOH WAT A . 
N 7 HOH 77  2149 2149 HOH WAT A . 
N 7 HOH 78  2154 2154 HOH WAT A . 
N 7 HOH 79  2156 2156 HOH WAT A . 
N 7 HOH 80  2159 2159 HOH WAT A . 
N 7 HOH 81  2160 2160 HOH WAT A . 
N 7 HOH 82  2163 2163 HOH WAT A . 
N 7 HOH 83  2171 2171 HOH WAT A . 
N 7 HOH 84  2186 2186 HOH WAT A . 
N 7 HOH 85  2187 2187 HOH WAT A . 
N 7 HOH 86  2188 2188 HOH WAT A . 
N 7 HOH 87  2194 2194 HOH WAT A . 
N 7 HOH 88  2196 2196 HOH WAT A . 
N 7 HOH 89  2201 2201 HOH WAT A . 
N 7 HOH 90  2204 2204 HOH WAT A . 
N 7 HOH 91  2211 2211 HOH WAT A . 
N 7 HOH 92  2214 2214 HOH WAT A . 
N 7 HOH 93  2216 2216 HOH WAT A . 
N 7 HOH 94  2221 2221 HOH WAT A . 
N 7 HOH 95  2228 2228 HOH WAT A . 
N 7 HOH 96  2234 2234 HOH WAT A . 
N 7 HOH 97  2244 2244 HOH WAT A . 
N 7 HOH 98  2248 2248 HOH WAT A . 
N 7 HOH 99  2249 2249 HOH WAT A . 
N 7 HOH 100 2250 2250 HOH WAT A . 
N 7 HOH 101 2254 2254 HOH WAT A . 
N 7 HOH 102 2255 2255 HOH WAT A . 
N 7 HOH 103 2256 2256 HOH WAT A . 
N 7 HOH 104 2258 2258 HOH WAT A . 
N 7 HOH 105 2259 2259 HOH WAT A . 
N 7 HOH 106 2262 2262 HOH WAT A . 
N 7 HOH 107 2264 2264 HOH WAT A . 
N 7 HOH 108 2266 2266 HOH WAT A . 
N 7 HOH 109 2268 2268 HOH WAT A . 
N 7 HOH 110 2302 2302 HOH WAT A . 
N 7 HOH 111 2304 2304 HOH WAT A . 
N 7 HOH 112 2307 2307 HOH WAT A . 
N 7 HOH 113 2308 2308 HOH WAT A . 
N 7 HOH 114 2309 2309 HOH WAT A . 
N 7 HOH 115 2313 2313 HOH WAT A . 
N 7 HOH 116 2315 2315 HOH WAT A . 
N 7 HOH 117 2319 2319 HOH WAT A . 
N 7 HOH 118 2321 2321 HOH WAT A . 
N 7 HOH 119 2323 2323 HOH WAT A . 
N 7 HOH 120 2324 2324 HOH WAT A . 
N 7 HOH 121 2325 2325 HOH WAT A . 
N 7 HOH 122 2326 2326 HOH WAT A . 
N 7 HOH 123 2327 2327 HOH WAT A . 
N 7 HOH 124 2328 2328 HOH WAT A . 
N 7 HOH 125 2329 2329 HOH WAT A . 
N 7 HOH 126 2331 2331 HOH WAT A . 
N 7 HOH 127 2333 2333 HOH WAT A . 
N 7 HOH 128 2340 2340 HOH WAT A . 
N 7 HOH 129 2341 2341 HOH WAT A . 
N 7 HOH 130 2342 2342 HOH WAT A . 
N 7 HOH 131 2344 2344 HOH WAT A . 
N 7 HOH 132 2346 2346 HOH WAT A . 
N 7 HOH 133 2358 2358 HOH WAT A . 
N 7 HOH 134 2364 2364 HOH WAT A . 
N 7 HOH 135 2368 2368 HOH WAT A . 
N 7 HOH 136 2373 2373 HOH WAT A . 
N 7 HOH 137 2377 2377 HOH WAT A . 
N 7 HOH 138 2378 2378 HOH WAT A . 
N 7 HOH 139 2379 2379 HOH WAT A . 
N 7 HOH 140 2380 2380 HOH WAT A . 
N 7 HOH 141 2381 2381 HOH WAT A . 
N 7 HOH 142 2383 2383 HOH WAT A . 
N 7 HOH 143 2402 2402 HOH WAT A . 
N 7 HOH 144 2403 2403 HOH WAT A . 
N 7 HOH 145 2404 2404 HOH WAT A . 
N 7 HOH 146 2407 2407 HOH WAT A . 
N 7 HOH 147 2408 2408 HOH WAT A . 
N 7 HOH 148 2419 2419 HOH WAT A . 
N 7 HOH 149 2424 2424 HOH WAT A . 
N 7 HOH 150 2429 2429 HOH WAT A . 
N 7 HOH 151 2430 2430 HOH WAT A . 
N 7 HOH 152 2431 2431 HOH WAT A . 
N 7 HOH 153 2437 2437 HOH WAT A . 
N 7 HOH 154 2462 2462 HOH WAT A . 
N 7 HOH 155 2491 2491 HOH WAT A . 
N 7 HOH 156 2504 2504 HOH WAT A . 
N 7 HOH 157 2510 2510 HOH WAT A . 
N 7 HOH 158 2512 2512 HOH WAT A . 
N 7 HOH 159 2513 2513 HOH WAT A . 
N 7 HOH 160 2514 2514 HOH WAT A . 
N 7 HOH 161 2515 2515 HOH WAT A . 
N 7 HOH 162 2516 2516 HOH WAT A . 
N 7 HOH 163 2518 2518 HOH WAT A . 
N 7 HOH 164 2520 2520 HOH WAT A . 
N 7 HOH 165 2525 2525 HOH WAT A . 
N 7 HOH 166 2526 2526 HOH WAT A . 
N 7 HOH 167 2528 2528 HOH WAT A . 
N 7 HOH 168 2529 2529 HOH WAT A . 
N 7 HOH 169 2530 2530 HOH WAT A . 
N 7 HOH 170 2531 2531 HOH WAT A . 
N 7 HOH 171 2536 2536 HOH WAT A . 
N 7 HOH 172 2539 2539 HOH WAT A . 
N 7 HOH 173 2543 2543 HOH WAT A . 
N 7 HOH 174 2549 2549 HOH WAT A . 
N 7 HOH 175 2550 2550 HOH WAT A . 
N 7 HOH 176 2553 2553 HOH WAT A . 
N 7 HOH 177 2554 2554 HOH WAT A . 
N 7 HOH 178 2556 2556 HOH WAT A . 
N 7 HOH 179 2558 2558 HOH WAT A . 
N 7 HOH 180 2559 2559 HOH WAT A . 
N 7 HOH 181 2564 2564 HOH WAT A . 
N 7 HOH 182 2574 2574 HOH WAT A . 
N 7 HOH 183 2575 2575 HOH WAT A . 
N 7 HOH 184 2577 2577 HOH WAT A . 
N 7 HOH 185 2583 2583 HOH WAT A . 
N 7 HOH 186 2586 2586 HOH WAT A . 
N 7 HOH 187 2589 2589 HOH WAT A . 
N 7 HOH 188 2596 2596 HOH WAT A . 
N 7 HOH 189 2601 2601 HOH WAT A . 
N 7 HOH 190 2618 2618 HOH WAT A . 
N 7 HOH 191 2619 2619 HOH WAT A . 
N 7 HOH 192 2620 2620 HOH WAT A . 
N 7 HOH 193 2626 2626 HOH WAT A . 
N 7 HOH 194 2629 2629 HOH WAT A . 
N 7 HOH 195 2634 2634 HOH WAT A . 
N 7 HOH 196 2639 2639 HOH WAT A . 
N 7 HOH 197 2641 2641 HOH WAT A . 
N 7 HOH 198 2642 2642 HOH WAT A . 
N 7 HOH 199 2643 2643 HOH WAT A . 
N 7 HOH 200 2644 2644 HOH WAT A . 
N 7 HOH 201 2645 2645 HOH WAT A . 
N 7 HOH 202 2646 2646 HOH WAT A . 
N 7 HOH 203 2648 2648 HOH WAT A . 
N 7 HOH 204 2650 2650 HOH WAT A . 
N 7 HOH 205 2651 2651 HOH WAT A . 
N 7 HOH 206 2661 2661 HOH WAT A . 
N 7 HOH 207 2662 2662 HOH WAT A . 
N 7 HOH 208 2664 2664 HOH WAT A . 
N 7 HOH 209 2665 2665 HOH WAT A . 
N 7 HOH 210 2668 2668 HOH WAT A . 
N 7 HOH 211 2671 2671 HOH WAT A . 
N 7 HOH 212 2674 2674 HOH WAT A . 
N 7 HOH 213 2678 2678 HOH WAT A . 
N 7 HOH 214 2679 2679 HOH WAT A . 
N 7 HOH 215 2689 2689 HOH WAT A . 
N 7 HOH 216 2693 2693 HOH WAT A . 
N 7 HOH 217 2700 2700 HOH WAT A . 
N 7 HOH 218 2703 2703 HOH WAT A . 
N 7 HOH 219 2705 2705 HOH WAT A . 
N 7 HOH 220 2706 2706 HOH WAT A . 
N 7 HOH 221 2708 2708 HOH WAT A . 
N 7 HOH 222 2712 2712 HOH WAT A . 
N 7 HOH 223 2721 2721 HOH WAT A . 
N 7 HOH 224 2730 2730 HOH WAT A . 
N 7 HOH 225 2731 2731 HOH WAT A . 
N 7 HOH 226 2732 2732 HOH WAT A . 
N 7 HOH 227 2738 2738 HOH WAT A . 
N 7 HOH 228 2740 2740 HOH WAT A . 
N 7 HOH 229 2743 2743 HOH WAT A . 
N 7 HOH 230 2746 2746 HOH WAT A . 
N 7 HOH 231 2747 2747 HOH WAT A . 
N 7 HOH 232 2761 2761 HOH WAT A . 
N 7 HOH 233 2764 2764 HOH WAT A . 
N 7 HOH 234 2765 2765 HOH WAT A . 
N 7 HOH 235 2777 2777 HOH WAT A . 
N 7 HOH 236 2781 2781 HOH WAT A . 
N 7 HOH 237 2782 2782 HOH WAT A . 
N 7 HOH 238 2802 2802 HOH WAT A . 
N 7 HOH 239 2805 2805 HOH WAT A . 
N 7 HOH 240 2808 2808 HOH WAT A . 
N 7 HOH 241 2810 2810 HOH WAT A . 
N 7 HOH 242 2811 2811 HOH WAT A . 
N 7 HOH 243 2813 2813 HOH WAT A . 
N 7 HOH 244 2814 2814 HOH WAT A . 
N 7 HOH 245 2815 2815 HOH WAT A . 
N 7 HOH 246 2816 2816 HOH WAT A . 
N 7 HOH 247 2817 2817 HOH WAT A . 
N 7 HOH 248 2818 2818 HOH WAT A . 
N 7 HOH 249 2819 2819 HOH WAT A . 
N 7 HOH 250 2821 2821 HOH WAT A . 
N 7 HOH 251 2823 2823 HOH WAT A . 
N 7 HOH 252 2825 2825 HOH WAT A . 
N 7 HOH 253 2826 2826 HOH WAT A . 
N 7 HOH 254 2831 2831 HOH WAT A . 
N 7 HOH 255 2834 2834 HOH WAT A . 
N 7 HOH 256 2836 2836 HOH WAT A . 
N 7 HOH 257 2838 2838 HOH WAT A . 
N 7 HOH 258 2841 2841 HOH WAT A . 
N 7 HOH 259 2842 2842 HOH WAT A . 
N 7 HOH 260 2845 2845 HOH WAT A . 
N 7 HOH 261 2847 2847 HOH WAT A . 
N 7 HOH 262 2849 2849 HOH WAT A . 
N 7 HOH 263 2853 2853 HOH WAT A . 
N 7 HOH 264 2855 2855 HOH WAT A . 
N 7 HOH 265 2856 2856 HOH WAT A . 
N 7 HOH 266 2858 2858 HOH WAT A . 
N 7 HOH 267 2862 2862 HOH WAT A . 
N 7 HOH 268 2863 2863 HOH WAT A . 
N 7 HOH 269 2871 2871 HOH WAT A . 
N 7 HOH 270 2876 2876 HOH WAT A . 
N 7 HOH 271 2878 2878 HOH WAT A . 
N 7 HOH 272 2882 2882 HOH WAT A . 
N 7 HOH 273 2889 2889 HOH WAT A . 
N 7 HOH 274 2890 2890 HOH WAT A . 
N 7 HOH 275 2892 2892 HOH WAT A . 
N 7 HOH 276 2895 2895 HOH WAT A . 
N 7 HOH 277 2897 2897 HOH WAT A . 
N 7 HOH 278 2899 2899 HOH WAT A . 
N 7 HOH 279 2900 2900 HOH WAT A . 
N 7 HOH 280 2904 2904 HOH WAT A . 
N 7 HOH 281 2905 2905 HOH WAT A . 
N 7 HOH 282 2907 2907 HOH WAT A . 
N 7 HOH 283 2908 2908 HOH WAT A . 
N 7 HOH 284 2911 2911 HOH WAT A . 
N 7 HOH 285 2921 2921 HOH WAT A . 
N 7 HOH 286 2924 2924 HOH WAT A . 
N 7 HOH 287 2925 2925 HOH WAT A . 
N 7 HOH 288 2927 2927 HOH WAT A . 
N 7 HOH 289 2929 2929 HOH WAT A . 
N 7 HOH 290 2934 2934 HOH WAT A . 
N 7 HOH 291 2935 2935 HOH WAT A . 
N 7 HOH 292 2936 2936 HOH WAT A . 
N 7 HOH 293 2937 2937 HOH WAT A . 
N 7 HOH 294 2946 2946 HOH WAT A . 
N 7 HOH 295 2948 2948 HOH WAT A . 
N 7 HOH 296 2950 2950 HOH WAT A . 
N 7 HOH 297 2974 2974 HOH WAT A . 
N 7 HOH 298 2975 2975 HOH WAT A . 
N 7 HOH 299 2985 2985 HOH WAT A . 
N 7 HOH 300 2987 2987 HOH WAT A . 
N 7 HOH 301 2994 2994 HOH WAT A . 
N 7 HOH 302 3002 3002 HOH WAT A . 
N 7 HOH 303 3005 3005 HOH WAT A . 
N 7 HOH 304 3009 3009 HOH WAT A . 
N 7 HOH 305 3015 3015 HOH WAT A . 
N 7 HOH 306 3026 3026 HOH WAT A . 
N 7 HOH 307 3036 3036 HOH WAT A . 
N 7 HOH 308 3039 3039 HOH WAT A . 
N 7 HOH 309 3058 3058 HOH WAT A . 
N 7 HOH 310 3060 3060 HOH WAT A . 
N 7 HOH 311 3061 3061 HOH WAT A . 
N 7 HOH 312 3063 3063 HOH WAT A . 
N 7 HOH 313 3064 3064 HOH WAT A . 
N 7 HOH 314 3065 3065 HOH WAT A . 
N 7 HOH 315 3066 3066 HOH WAT A . 
N 7 HOH 316 3067 3067 HOH WAT A . 
N 7 HOH 317 3068 3068 HOH WAT A . 
N 7 HOH 318 3069 3069 HOH WAT A . 
N 7 HOH 319 3071 3071 HOH WAT A . 
N 7 HOH 320 3074 3074 HOH WAT A . 
N 7 HOH 321 3079 3079 HOH WAT A . 
N 7 HOH 322 3081 3081 HOH WAT A . 
N 7 HOH 323 3083 3083 HOH WAT A . 
N 7 HOH 324 3084 3084 HOH WAT A . 
N 7 HOH 325 3085 3085 HOH WAT A . 
N 7 HOH 326 3086 3086 HOH WAT A . 
N 7 HOH 327 3087 3087 HOH WAT A . 
N 7 HOH 328 3088 3088 HOH WAT A . 
N 7 HOH 329 3090 3090 HOH WAT A . 
N 7 HOH 330 3092 3092 HOH WAT A . 
N 7 HOH 331 3093 3093 HOH WAT A . 
N 7 HOH 332 3094 3094 HOH WAT A . 
N 7 HOH 333 3095 3095 HOH WAT A . 
N 7 HOH 334 3096 3096 HOH WAT A . 
N 7 HOH 335 3097 3097 HOH WAT A . 
N 7 HOH 336 3098 3098 HOH WAT A . 
N 7 HOH 337 3099 3099 HOH WAT A . 
N 7 HOH 338 3100 3100 HOH WAT A . 
N 7 HOH 339 3101 3101 HOH WAT A . 
N 7 HOH 340 3103 3103 HOH WAT A . 
N 7 HOH 341 3104 3104 HOH WAT A . 
N 7 HOH 342 3105 3105 HOH WAT A . 
N 7 HOH 343 3107 3107 HOH WAT A . 
N 7 HOH 344 3108 3108 HOH WAT A . 
N 7 HOH 345 3109 3109 HOH WAT A . 
N 7 HOH 346 3114 3114 HOH WAT A . 
N 7 HOH 347 3117 3117 HOH WAT A . 
N 7 HOH 348 3118 3118 HOH WAT A . 
N 7 HOH 349 3119 3119 HOH WAT A . 
N 7 HOH 350 3121 3121 HOH WAT A . 
N 7 HOH 351 3122 3122 HOH WAT A . 
N 7 HOH 352 3124 3124 HOH WAT A . 
N 7 HOH 353 3126 3126 HOH WAT A . 
N 7 HOH 354 3127 3127 HOH WAT A . 
N 7 HOH 355 3128 3128 HOH WAT A . 
N 7 HOH 356 3131 3131 HOH WAT A . 
N 7 HOH 357 3132 3132 HOH WAT A . 
N 7 HOH 358 3135 3135 HOH WAT A . 
N 7 HOH 359 3136 3136 HOH WAT A . 
N 7 HOH 360 3137 3137 HOH WAT A . 
N 7 HOH 361 3139 3139 HOH WAT A . 
N 7 HOH 362 3140 3140 HOH WAT A . 
N 7 HOH 363 3141 3141 HOH WAT A . 
N 7 HOH 364 3143 3143 HOH WAT A . 
N 7 HOH 365 3145 3145 HOH WAT A . 
N 7 HOH 366 3146 3146 HOH WAT A . 
N 7 HOH 367 3147 3147 HOH WAT A . 
N 7 HOH 368 3150 3150 HOH WAT A . 
N 7 HOH 369 3152 3152 HOH WAT A . 
N 7 HOH 370 3153 3153 HOH WAT A . 
N 7 HOH 371 3154 3154 HOH WAT A . 
N 7 HOH 372 3156 3156 HOH WAT A . 
N 7 HOH 373 3158 3158 HOH WAT A . 
N 7 HOH 374 3161 3161 HOH WAT A . 
N 7 HOH 375 3163 3163 HOH WAT A . 
N 7 HOH 376 3166 3166 HOH WAT A . 
N 7 HOH 377 3167 3167 HOH WAT A . 
N 7 HOH 378 3174 3174 HOH WAT A . 
N 7 HOH 379 3178 3178 HOH WAT A . 
N 7 HOH 380 3179 3179 HOH WAT A . 
N 7 HOH 381 3182 3182 HOH WAT A . 
N 7 HOH 382 3183 3183 HOH WAT A . 
N 7 HOH 383 3184 3184 HOH WAT A . 
N 7 HOH 384 3185 3185 HOH WAT A . 
N 7 HOH 385 3187 3187 HOH WAT A . 
N 7 HOH 386 3190 3190 HOH WAT A . 
N 7 HOH 387 3194 3194 HOH WAT A . 
N 7 HOH 388 3197 3197 HOH WAT A . 
N 7 HOH 389 3198 3198 HOH WAT A . 
N 7 HOH 390 3211 3211 HOH WAT A . 
N 7 HOH 391 3213 3213 HOH WAT A . 
N 7 HOH 392 3216 3216 HOH WAT A . 
N 7 HOH 393 3217 3217 HOH WAT A . 
N 7 HOH 394 3218 3218 HOH WAT A . 
N 7 HOH 395 3219 3219 HOH WAT A . 
N 7 HOH 396 3220 3220 HOH WAT A . 
N 7 HOH 397 3221 3221 HOH WAT A . 
N 7 HOH 398 3222 3222 HOH WAT A . 
N 7 HOH 399 3223 3223 HOH WAT A . 
N 7 HOH 400 3224 3224 HOH WAT A . 
N 7 HOH 401 3225 3225 HOH WAT A . 
N 7 HOH 402 3226 3226 HOH WAT A . 
N 7 HOH 403 3227 3227 HOH WAT A . 
N 7 HOH 404 3228 3228 HOH WAT A . 
N 7 HOH 405 3229 3229 HOH WAT A . 
N 7 HOH 406 3230 3230 HOH WAT A . 
N 7 HOH 407 3231 3231 HOH WAT A . 
N 7 HOH 408 3233 3233 HOH WAT A . 
N 7 HOH 409 3234 3234 HOH WAT A . 
N 7 HOH 410 3236 3236 HOH WAT A . 
N 7 HOH 411 3237 3237 HOH WAT A . 
N 7 HOH 412 3238 3238 HOH WAT A . 
N 7 HOH 413 3239 3239 HOH WAT A . 
N 7 HOH 414 3240 3240 HOH WAT A . 
N 7 HOH 415 3241 3241 HOH WAT A . 
N 7 HOH 416 3242 3242 HOH WAT A . 
N 7 HOH 417 3243 3243 HOH WAT A . 
N 7 HOH 418 3244 3244 HOH WAT A . 
N 7 HOH 419 3245 3245 HOH WAT A . 
N 7 HOH 420 3246 3246 HOH WAT A . 
N 7 HOH 421 3247 3247 HOH WAT A . 
N 7 HOH 422 3248 3248 HOH WAT A . 
N 7 HOH 423 3249 3249 HOH WAT A . 
N 7 HOH 424 3250 3250 HOH WAT A . 
N 7 HOH 425 3251 3251 HOH WAT A . 
N 7 HOH 426 3252 3252 HOH WAT A . 
N 7 HOH 427 3253 3253 HOH WAT A . 
N 7 HOH 428 3254 3254 HOH WAT A . 
N 7 HOH 429 3255 3255 HOH WAT A . 
N 7 HOH 430 3256 3256 HOH WAT A . 
N 7 HOH 431 3257 3257 HOH WAT A . 
N 7 HOH 432 3258 3258 HOH WAT A . 
N 7 HOH 433 3259 3259 HOH WAT A . 
N 7 HOH 434 3260 3260 HOH WAT A . 
N 7 HOH 435 3262 3262 HOH WAT A . 
N 7 HOH 436 3263 3263 HOH WAT A . 
N 7 HOH 437 3266 3266 HOH WAT A . 
N 7 HOH 438 3267 3267 HOH WAT A . 
N 7 HOH 439 3268 3268 HOH WAT A . 
N 7 HOH 440 3269 3269 HOH WAT A . 
N 7 HOH 441 3270 3270 HOH WAT A . 
N 7 HOH 442 3271 3271 HOH WAT A . 
N 7 HOH 443 3272 3272 HOH WAT A . 
N 7 HOH 444 3273 3273 HOH WAT A . 
N 7 HOH 445 3274 3274 HOH WAT A . 
N 7 HOH 446 3275 3275 HOH WAT A . 
N 7 HOH 447 3276 3276 HOH WAT A . 
N 7 HOH 448 3277 3277 HOH WAT A . 
N 7 HOH 449 3278 3278 HOH WAT A . 
N 7 HOH 450 3279 3279 HOH WAT A . 
N 7 HOH 451 3280 3280 HOH WAT A . 
N 7 HOH 452 3281 3281 HOH WAT A . 
N 7 HOH 453 3282 3282 HOH WAT A . 
N 7 HOH 454 3283 3283 HOH WAT A . 
N 7 HOH 455 3284 3284 HOH WAT A . 
N 7 HOH 456 3285 3285 HOH WAT A . 
N 7 HOH 457 3286 3286 HOH WAT A . 
N 7 HOH 458 3287 3287 HOH WAT A . 
N 7 HOH 459 3288 3288 HOH WAT A . 
N 7 HOH 460 3289 3289 HOH WAT A . 
N 7 HOH 461 3290 3290 HOH WAT A . 
N 7 HOH 462 3291 3291 HOH WAT A . 
N 7 HOH 463 3292 3292 HOH WAT A . 
N 7 HOH 464 3293 3293 HOH WAT A . 
N 7 HOH 465 3294 3294 HOH WAT A . 
N 7 HOH 466 3295 3295 HOH WAT A . 
N 7 HOH 467 3296 3296 HOH WAT A . 
N 7 HOH 468 3297 3297 HOH WAT A . 
N 7 HOH 469 3298 3298 HOH WAT A . 
N 7 HOH 470 3299 3299 HOH WAT A . 
N 7 HOH 471 3300 3300 HOH WAT A . 
N 7 HOH 472 3301 3301 HOH WAT A . 
N 7 HOH 473 3302 3302 HOH WAT A . 
N 7 HOH 474 3303 3303 HOH WAT A . 
N 7 HOH 475 3304 3304 HOH WAT A . 
N 7 HOH 476 3305 3305 HOH WAT A . 
N 7 HOH 477 3306 3306 HOH WAT A . 
N 7 HOH 478 3307 3307 HOH WAT A . 
N 7 HOH 479 3308 3308 HOH WAT A . 
N 7 HOH 480 3309 3309 HOH WAT A . 
N 7 HOH 481 3311 3311 HOH WAT A . 
N 7 HOH 482 3312 3312 HOH WAT A . 
N 7 HOH 483 3313 3313 HOH WAT A . 
N 7 HOH 484 3314 3314 HOH WAT A . 
N 7 HOH 485 3315 3315 HOH WAT A . 
N 7 HOH 486 3316 3316 HOH WAT A . 
N 7 HOH 487 3318 3318 HOH WAT A . 
N 7 HOH 488 3319 3319 HOH WAT A . 
N 7 HOH 489 3320 3320 HOH WAT A . 
N 7 HOH 490 3321 3321 HOH WAT A . 
N 7 HOH 491 3324 3324 HOH WAT A . 
N 7 HOH 492 3326 3326 HOH WAT A . 
N 7 HOH 493 3328 3328 HOH WAT A . 
N 7 HOH 494 3330 3330 HOH WAT A . 
N 7 HOH 495 3331 3331 HOH WAT A . 
N 7 HOH 496 3332 3332 HOH WAT A . 
N 7 HOH 497 3333 3333 HOH WAT A . 
N 7 HOH 498 3334 3334 HOH WAT A . 
N 7 HOH 499 3335 3335 HOH WAT A . 
N 7 HOH 500 3336 3336 HOH WAT A . 
N 7 HOH 501 3337 3337 HOH WAT A . 
N 7 HOH 502 3338 3338 HOH WAT A . 
N 7 HOH 503 3339 3339 HOH WAT A . 
N 7 HOH 504 3340 3340 HOH WAT A . 
N 7 HOH 505 3341 3341 HOH WAT A . 
N 7 HOH 506 3342 3342 HOH WAT A . 
N 7 HOH 507 3343 3343 HOH WAT A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    6OG 
_pdbx_struct_mod_residue.label_seq_id     5 
_pdbx_struct_mod_residue.auth_asym_id     C 
_pdbx_struct_mod_residue.auth_comp_id     6OG 
_pdbx_struct_mod_residue.auth_seq_id      7 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DG 
_pdbx_struct_mod_residue.details          
;6-O-METHYL GUANOSINE-5'-MONOPHOSPHATE
;
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OD1 ? C ASP 357 ? A ASP 653  ? 1_555 MG ? K MG . ? A MG 920 ? 1_555 O   ? N HOH .   ? A HOH 2525 ? 1_555 116.8 ? 
2 OD1 ? C ASP 357 ? A ASP 653  ? 1_555 MG ? K MG . ? A MG 920 ? 1_555 OD2 ? C ASP 534 ? A ASP 830  ? 1_555 128.1 ? 
3 O   ? N HOH .   ? A HOH 2525 ? 1_555 MG ? K MG . ? A MG 920 ? 1_555 OD2 ? C ASP 534 ? A ASP 830  ? 1_555 102.1 ? 
4 OD1 ? C ASP 357 ? A ASP 653  ? 1_555 MG ? K MG . ? A MG 920 ? 1_555 O   ? C TYR 358 ? A TYR 654  ? 1_555 76.9  ? 
5 O   ? N HOH .   ? A HOH 2525 ? 1_555 MG ? K MG . ? A MG 920 ? 1_555 O   ? C TYR 358 ? A TYR 654  ? 1_555 78.9  ? 
6 OD2 ? C ASP 534 ? A ASP 830  ? 1_555 MG ? K MG . ? A MG 920 ? 1_555 O   ? C TYR 358 ? A TYR 654  ? 1_555 78.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-12-12 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
XSCALE      .     ?                package 'Wolfgang Kabsch' ?                        'data processing' 
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/xscale_program.html ?          ? 1 
CNS         .     ?                package 'Axel T. Brunger' axel.brunger@yale.edu    refinement        
http://cns.csb.yale.edu/v1.1/                                      Fortran_77 ? 2 
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                                   C++        ? 3 
XDS         .     ?                ?       ?                 ?                        'data reduction'  ? ?          ? 4 
XSCALE      .     ?                ?       ?                 ?                        'data scaling'    ? ?          ? 5 
CNS         .     ?                ?       ?                 ?                        phasing           ? ?          ? 6 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE

THE DNA POLYMERASE GENE WAS CLONED FROM AN
ORGANISM THAT WAS CLASSIFIED AS A THERMOSTABLE 
STRAIN OF BACILLUS STEAROTHERMOPHILUS BY 
RIBOSOMAL RNA SEQUENCING.  HOWEVER, THIS
PARTICULAR GENE HAS MUCH GREATER HOMOLOGY WITH
THE ANALOGOUS GENE FROM GEOBACILLUS KAUSTOPHILUS, 
UNP ACCESSION, Q5KWC1_GEOKA.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 312 ? ? -109.33 40.31  
2  1 ASP A 402 ? ? -163.34 92.68  
3  1 ALA A 421 ? ? -84.94  39.70  
4  1 LEU A 477 ? ? -117.74 -72.31 
5  1 THR A 550 ? ? -127.40 -84.33 
6  1 LYS A 551 ? ? -154.25 -73.18 
7  1 ILE A 588 ? ? -106.58 -65.33 
8  1 LEU A 610 ? ? -129.85 -56.13 
9  1 GLU A 620 ? ? 38.09   63.34  
10 1 ILE A 628 ? ? -161.01 -28.21 
11 1 HIS A 829 ? ? 68.70   -56.82 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 C DA  5   ? P   ? B DA  3 P   
2  1 Y 1 C DA  5   ? OP1 ? B DA  3 OP1 
3  1 Y 1 C DA  5   ? OP2 ? B DA  3 OP2 
4  1 Y 1 A LYS 297 ? CG  ? C LYS 1 CG  
5  1 Y 1 A LYS 297 ? CD  ? C LYS 1 CD  
6  1 Y 1 A LYS 297 ? CE  ? C LYS 1 CE  
7  1 Y 1 A LYS 297 ? NZ  ? C LYS 1 NZ  
8  1 Y 1 A LYS 298 ? CG  ? C LYS 2 CG  
9  1 Y 1 A LYS 298 ? CD  ? C LYS 2 CD  
10 1 Y 1 A LYS 298 ? CE  ? C LYS 2 CE  
11 1 Y 1 A LYS 298 ? NZ  ? C LYS 2 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 C DG 3 ? B DG 1 
2 1 Y 1 C DT 4 ? B DT 2 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2HHT 'double helix'        
2HHT 'a-form double helix' 
2HHT 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1  1_555 B DC  15 1_555 -1.630 0.030  0.408  -3.224  -5.941  10.293 1  B_DG19:DC17_C B 19 ? C 17 ? ?  1 
1 A DC 2  1_555 B DG  14 1_555 1.351  -0.522 1.425  -9.824  -16.960 8.023  2  B_DC20:DG16_C B 20 ? C 16 ? ?  1 
1 A DG 3  1_555 B DC  13 1_555 -0.282 1.142  0.358  0.238   -19.856 13.007 3  B_DG21:DC15_C B 21 ? C 15 ? ?  ? 
1 A DA 4  1_555 B DT  12 1_555 -0.651 0.343  0.423  2.027   -10.276 8.188  4  B_DA22:DT14_C B 22 ? C 14 ? ?  ? 
1 A DT 5  1_555 B DA  11 1_555 -0.162 0.170  -0.164 2.671   -13.815 1.509  5  B_DT23:DA13_C B 23 ? C 13 ? 20 1 
1 A DC 6  1_555 B DG  10 1_555 -0.204 0.566  0.298  -10.703 -11.267 7.168  6  B_DC24:DG12_C B 24 ? C 12 ? ?  1 
1 A DA 7  1_555 B DT  9  1_555 0.377  -0.053 -0.601 -9.465  -13.462 -2.508 7  B_DA25:DT11_C B 25 ? C 11 ? 20 1 
1 A DG 8  1_555 B DC  8  1_555 0.461  0.092  -0.013 -7.597  -8.453  5.095  8  B_DG26:DC10_C B 26 ? C 10 ? 19 1 
1 A DC 9  1_555 B DG  7  1_555 0.580  0.030  -0.084 -2.924  -7.338  7.938  9  B_DC27:DG9_C  B 27 ? C 9  ? 19 1 
1 A DT 10 1_555 B DA  6  1_555 -0.030 -0.023 -0.011 11.521  -9.280  3.746  10 B_DT28:DA8_C  B 28 ? C 8  ? 20 1 
1 A DC 11 1_555 B 6OG 5  1_555 -0.607 0.653  0.193  21.589  -4.958  15.397 11 B_DC29:6OG7_C B 29 ? C 7  ? ?  1 
1 A DG 12 1_555 B DC  4  1_555 -0.351 -0.287 -0.474 15.016  -9.191  7.211  12 B_DG30:DC6_C  B 30 ? C 6  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1  1_555 B DC  15 1_555 A DC 2  1_555 B DG  14 1_555 -0.485 0.444  3.923 -4.449 8.645  41.678 -0.449 0.122  3.963 11.955 
6.152   42.748 1  BB_DG19DC20:DG16DC17_CC B 19 ? C 17 ? B 20 ? C 16 ? 
1 A DC 2  1_555 B DG  14 1_555 A DG 3  1_555 B DC  13 1_555 -0.075 -1.444 2.716 10.666 4.523  23.704 -4.122 2.417  2.173 10.262 
-24.201 26.348 2  BB_DC20DG21:DC15DG16_CC B 20 ? C 16 ? B 21 ? C 15 ? 
1 A DG 3  1_555 B DC  13 1_555 A DA 4  1_555 B DT  12 1_555 -0.002 0.395  3.089 -2.542 -3.286 39.439 0.943  -0.275 3.042 -4.853 
3.754   39.649 3  BB_DG21DA22:DT14DC15_CC B 21 ? C 15 ? B 22 ? C 14 ? 
1 A DA 4  1_555 B DT  12 1_555 A DT 5  1_555 B DA  11 1_555 -0.733 -0.384 3.274 2.700  -0.271 35.668 -0.587 1.579  3.214 -0.442 
-4.400  35.767 4  BB_DA22DT23:DA13DT14_CC B 22 ? C 14 ? B 23 ? C 13 ? 
1 A DT 5  1_555 B DA  11 1_555 A DC 6  1_555 B DG  10 1_555 0.185  -0.247 3.575 -3.322 3.113  35.203 -0.901 -0.832 3.509 5.120  
5.465   35.487 5  BB_DT23DC24:DG12DA13_CC B 23 ? C 13 ? B 24 ? C 12 ? 
1 A DC 6  1_555 B DG  10 1_555 A DA 7  1_555 B DT  9  1_555 -0.028 0.382  3.377 5.630  8.520  38.106 -0.489 0.738  3.346 12.771 
-8.439  39.401 6  BB_DC24DA25:DT11DG12_CC B 24 ? C 12 ? B 25 ? C 11 ? 
1 A DA 7  1_555 B DT  9  1_555 A DG 8  1_555 B DC  8  1_555 0.693  -0.375 3.191 -4.147 4.162  31.145 -1.420 -2.000 3.002 7.665  
7.639   31.681 7  BB_DA25DG26:DC10DT11_CC B 25 ? C 11 ? B 26 ? C 10 ? 
1 A DG 8  1_555 B DC  8  1_555 A DC 9  1_555 B DG  7  1_555 0.511  -0.543 3.346 2.078  2.193  31.988 -1.382 -0.542 3.328 3.968  
-3.761  32.126 8  BB_DG26DC27:DG9DC10_CC  B 26 ? C 10 ? B 27 ? C 9  ? 
1 A DC 9  1_555 B DG  7  1_555 A DT 10 1_555 B DA  6  1_555 -0.270 -0.764 3.133 -4.579 10.228 31.048 -2.965 -0.248 2.762 18.374 
8.225   32.962 9  BB_DC27DT28:DA8DG9_CC   B 27 ? C 9  ? B 28 ? C 8  ? 
1 A DT 10 1_555 B DA  6  1_555 A DC 11 1_555 B 6OG 5  1_555 0.130  -1.939 3.265 -5.969 9.657  19.971 -7.824 -2.149 2.006 25.368 
15.679  22.943 10 BB_DT28DC29:6OG7DA8_CC  B 28 ? C 8  ? B 29 ? C 7  ? 
1 A DC 11 1_555 B 6OG 5  1_555 A DG 12 1_555 B DC  4  1_555 -0.702 -0.777 3.394 2.102  13.955 32.315 -3.339 1.471  2.784 23.712 
-3.572  35.186 11 BB_DC29DG30:DC66OG7_CC  B 29 ? C 7  ? B 30 ? C 6  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 SUCROSE         SUC 
5 'SULFATE ION'   SO4 
6 'MAGNESIUM ION' MG  
7 water           HOH 
#