data_2HHW
# 
_entry.id   2HHW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HHW         
NDB   PD0829       
RCSB  RCSB038364   
WWPDB D_1000038364 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2HHQ . unspecified 
PDB 2HHS . unspecified 
PDB 2HHT . unspecified 
PDB 2HHU . unspecified 
PDB 2HHV . unspecified 
PDB 2HHX . unspecified 
PDB 2HHY . unspecified 
# 
_pdbx_database_status.entry_id                        2HHW 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-06-28 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Warren, J.J.'   1 
'Forsberg, L.J.' 2 
'Beese, L.S.'    3 
# 
_citation.id                        primary 
_citation.title                     'The structural basis for the mutagenicity of O6-methyl-guanine lesions.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            103 
_citation.page_first                19701 
_citation.page_last                 19706 
_citation.year                      2006 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17179038 
_citation.pdbx_database_id_DOI      10.1073/pnas.0609580103 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Warren, J.J.'   1 ? 
primary 'Forsberg, L.J.' 2 ? 
primary 'Beese, L.S.'    3 ? 
# 
_cell.entry_id           2HHW 
_cell.length_a           93.834 
_cell.length_b           108.897 
_cell.length_c           150.111 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HHW 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*(DDG))-3'"             2675.775  2   ?       ?              ? 'DNA Primer Strand' 
2 polymer     syn "5'-D(*CP*AP*TP*(6OG)P*CP*GP*AP*GP*TP*CP*AP*GP*G)-3'" 4030.650  2   ?       ?              ? 
'DNA Template Strand' 
3 polymer     man 'DNA Polymerase I'                                    66144.836 2   2.7.7.7 'D598A, F710Y' 
'residues 299-876 (analogous to E coli Klenow fragment)' ?                     
4 branched    man 'beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose'   342.297   2   ?       ?              ? ? 
5 non-polymer syn 'MANGANESE (II) ION'                                  54.938    2   ?       ?              ? ? 
6 non-polymer syn 'SULFATE ION'                                         96.063    3   ?       ?              ? ? 
7 non-polymer syn "2',3'-DIDEOXY-THYMIDINE-5'-TRIPHOSPHATE"             466.169   2   ?       ?              ? ? 
8 water       nat water                                                 18.015    794 ?       ?              ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        sucrose 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DC)(DC)(DT)(DG)(DA)(DC)(DT)(DC)(DDG)' CCTGACTCG E,B ? 
2 polydeoxyribonucleotide no yes '(DC)(DA)(DT)(6OG)(DC)(DG)(DA)(DG)(DT)(DC)(DA)(DG)(DG)' CATGCGAGTCAGG F,C ? 
3 'polypeptide(L)'        no no  
;AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWE
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
;AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWE
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
A,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DC  n 
1 3   DT  n 
1 4   DG  n 
1 5   DA  n 
1 6   DC  n 
1 7   DT  n 
1 8   DC  n 
1 9   DDG n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   6OG n 
2 5   DC  n 
2 6   DG  n 
2 7   DA  n 
2 8   DG  n 
2 9   DT  n 
2 10  DC  n 
2 11  DA  n 
2 12  DG  n 
2 13  DG  n 
3 1   ALA n 
3 2   LYS n 
3 3   MET n 
3 4   ALA n 
3 5   PHE n 
3 6   THR n 
3 7   LEU n 
3 8   ALA n 
3 9   ASP n 
3 10  ARG n 
3 11  VAL n 
3 12  THR n 
3 13  GLU n 
3 14  GLU n 
3 15  MET n 
3 16  LEU n 
3 17  ALA n 
3 18  ASP n 
3 19  LYS n 
3 20  ALA n 
3 21  ALA n 
3 22  LEU n 
3 23  VAL n 
3 24  VAL n 
3 25  GLU n 
3 26  VAL n 
3 27  VAL n 
3 28  GLU n 
3 29  GLU n 
3 30  ASN n 
3 31  TYR n 
3 32  HIS n 
3 33  ASP n 
3 34  ALA n 
3 35  PRO n 
3 36  ILE n 
3 37  VAL n 
3 38  GLY n 
3 39  ILE n 
3 40  ALA n 
3 41  VAL n 
3 42  VAL n 
3 43  ASN n 
3 44  GLU n 
3 45  HIS n 
3 46  GLY n 
3 47  ARG n 
3 48  PHE n 
3 49  PHE n 
3 50  LEU n 
3 51  ARG n 
3 52  PRO n 
3 53  GLU n 
3 54  THR n 
3 55  ALA n 
3 56  LEU n 
3 57  ALA n 
3 58  ASP n 
3 59  PRO n 
3 60  GLN n 
3 61  PHE n 
3 62  VAL n 
3 63  ALA n 
3 64  TRP n 
3 65  LEU n 
3 66  GLY n 
3 67  ASP n 
3 68  GLU n 
3 69  THR n 
3 70  LYS n 
3 71  LYS n 
3 72  LYS n 
3 73  SER n 
3 74  MET n 
3 75  PHE n 
3 76  ASP n 
3 77  SER n 
3 78  LYS n 
3 79  ARG n 
3 80  ALA n 
3 81  ALA n 
3 82  VAL n 
3 83  ALA n 
3 84  LEU n 
3 85  LYS n 
3 86  TRP n 
3 87  LYS n 
3 88  GLY n 
3 89  ILE n 
3 90  GLU n 
3 91  LEU n 
3 92  CYS n 
3 93  GLY n 
3 94  VAL n 
3 95  SER n 
3 96  PHE n 
3 97  ASP n 
3 98  LEU n 
3 99  LEU n 
3 100 LEU n 
3 101 ALA n 
3 102 ALA n 
3 103 TYR n 
3 104 LEU n 
3 105 LEU n 
3 106 ASP n 
3 107 PRO n 
3 108 ALA n 
3 109 GLN n 
3 110 GLY n 
3 111 VAL n 
3 112 ASP n 
3 113 ASP n 
3 114 VAL n 
3 115 ALA n 
3 116 ALA n 
3 117 ALA n 
3 118 ALA n 
3 119 LYS n 
3 120 MET n 
3 121 LYS n 
3 122 GLN n 
3 123 TYR n 
3 124 GLU n 
3 125 ALA n 
3 126 VAL n 
3 127 ARG n 
3 128 PRO n 
3 129 ASP n 
3 130 GLU n 
3 131 ALA n 
3 132 VAL n 
3 133 TYR n 
3 134 GLY n 
3 135 LYS n 
3 136 GLY n 
3 137 ALA n 
3 138 LYS n 
3 139 ARG n 
3 140 ALA n 
3 141 VAL n 
3 142 PRO n 
3 143 ASP n 
3 144 GLU n 
3 145 PRO n 
3 146 VAL n 
3 147 LEU n 
3 148 ALA n 
3 149 GLU n 
3 150 HIS n 
3 151 LEU n 
3 152 VAL n 
3 153 ARG n 
3 154 LYS n 
3 155 ALA n 
3 156 ALA n 
3 157 ALA n 
3 158 ILE n 
3 159 TRP n 
3 160 GLU n 
3 161 LEU n 
3 162 GLU n 
3 163 ARG n 
3 164 PRO n 
3 165 PHE n 
3 166 LEU n 
3 167 ASP n 
3 168 GLU n 
3 169 LEU n 
3 170 ARG n 
3 171 ARG n 
3 172 ASN n 
3 173 GLU n 
3 174 GLN n 
3 175 ASP n 
3 176 ARG n 
3 177 LEU n 
3 178 LEU n 
3 179 VAL n 
3 180 GLU n 
3 181 LEU n 
3 182 GLU n 
3 183 GLN n 
3 184 PRO n 
3 185 LEU n 
3 186 SER n 
3 187 SER n 
3 188 ILE n 
3 189 LEU n 
3 190 ALA n 
3 191 GLU n 
3 192 MET n 
3 193 GLU n 
3 194 PHE n 
3 195 ALA n 
3 196 GLY n 
3 197 VAL n 
3 198 LYS n 
3 199 VAL n 
3 200 ASP n 
3 201 THR n 
3 202 LYS n 
3 203 ARG n 
3 204 LEU n 
3 205 GLU n 
3 206 GLN n 
3 207 MET n 
3 208 GLY n 
3 209 LYS n 
3 210 GLU n 
3 211 LEU n 
3 212 ALA n 
3 213 GLU n 
3 214 GLN n 
3 215 LEU n 
3 216 GLY n 
3 217 THR n 
3 218 VAL n 
3 219 GLU n 
3 220 GLN n 
3 221 ARG n 
3 222 ILE n 
3 223 TYR n 
3 224 GLU n 
3 225 LEU n 
3 226 ALA n 
3 227 GLY n 
3 228 GLN n 
3 229 GLU n 
3 230 PHE n 
3 231 ASN n 
3 232 ILE n 
3 233 ASN n 
3 234 SER n 
3 235 PRO n 
3 236 LYS n 
3 237 GLN n 
3 238 LEU n 
3 239 GLY n 
3 240 VAL n 
3 241 ILE n 
3 242 LEU n 
3 243 PHE n 
3 244 GLU n 
3 245 LYS n 
3 246 LEU n 
3 247 GLN n 
3 248 LEU n 
3 249 PRO n 
3 250 VAL n 
3 251 LEU n 
3 252 LYS n 
3 253 LYS n 
3 254 THR n 
3 255 LYS n 
3 256 THR n 
3 257 GLY n 
3 258 TYR n 
3 259 SER n 
3 260 THR n 
3 261 SER n 
3 262 ALA n 
3 263 ASP n 
3 264 VAL n 
3 265 LEU n 
3 266 GLU n 
3 267 LYS n 
3 268 LEU n 
3 269 ALA n 
3 270 PRO n 
3 271 TYR n 
3 272 HIS n 
3 273 GLU n 
3 274 ILE n 
3 275 VAL n 
3 276 GLU n 
3 277 ASN n 
3 278 ILE n 
3 279 LEU n 
3 280 HIS n 
3 281 TYR n 
3 282 ARG n 
3 283 GLN n 
3 284 LEU n 
3 285 GLY n 
3 286 LYS n 
3 287 LEU n 
3 288 GLN n 
3 289 SER n 
3 290 THR n 
3 291 TYR n 
3 292 ILE n 
3 293 GLU n 
3 294 GLY n 
3 295 LEU n 
3 296 LEU n 
3 297 LYS n 
3 298 VAL n 
3 299 VAL n 
3 300 ARG n 
3 301 PRO n 
3 302 ALA n 
3 303 THR n 
3 304 LYS n 
3 305 LYS n 
3 306 VAL n 
3 307 HIS n 
3 308 THR n 
3 309 ILE n 
3 310 PHE n 
3 311 ASN n 
3 312 GLN n 
3 313 ALA n 
3 314 LEU n 
3 315 THR n 
3 316 GLN n 
3 317 THR n 
3 318 GLY n 
3 319 ARG n 
3 320 LEU n 
3 321 SER n 
3 322 SER n 
3 323 THR n 
3 324 GLU n 
3 325 PRO n 
3 326 ASN n 
3 327 LEU n 
3 328 GLN n 
3 329 ASN n 
3 330 ILE n 
3 331 PRO n 
3 332 ILE n 
3 333 ARG n 
3 334 LEU n 
3 335 GLU n 
3 336 GLU n 
3 337 GLY n 
3 338 ARG n 
3 339 LYS n 
3 340 ILE n 
3 341 ARG n 
3 342 GLN n 
3 343 ALA n 
3 344 PHE n 
3 345 VAL n 
3 346 PRO n 
3 347 SER n 
3 348 GLU n 
3 349 SER n 
3 350 ASP n 
3 351 TRP n 
3 352 LEU n 
3 353 ILE n 
3 354 PHE n 
3 355 ALA n 
3 356 ALA n 
3 357 ASP n 
3 358 TYR n 
3 359 SER n 
3 360 GLN n 
3 361 ILE n 
3 362 GLU n 
3 363 LEU n 
3 364 ARG n 
3 365 VAL n 
3 366 LEU n 
3 367 ALA n 
3 368 HIS n 
3 369 ILE n 
3 370 ALA n 
3 371 GLU n 
3 372 ASP n 
3 373 ASP n 
3 374 ASN n 
3 375 LEU n 
3 376 MET n 
3 377 GLU n 
3 378 ALA n 
3 379 PHE n 
3 380 ARG n 
3 381 ARG n 
3 382 ASP n 
3 383 LEU n 
3 384 ASP n 
3 385 ILE n 
3 386 HIS n 
3 387 THR n 
3 388 LYS n 
3 389 THR n 
3 390 ALA n 
3 391 MET n 
3 392 ASP n 
3 393 ILE n 
3 394 PHE n 
3 395 GLN n 
3 396 VAL n 
3 397 SER n 
3 398 GLU n 
3 399 ASP n 
3 400 GLU n 
3 401 VAL n 
3 402 THR n 
3 403 PRO n 
3 404 ASN n 
3 405 MET n 
3 406 ARG n 
3 407 ARG n 
3 408 GLN n 
3 409 ALA n 
3 410 LYS n 
3 411 ALA n 
3 412 VAL n 
3 413 ASN n 
3 414 TYR n 
3 415 GLY n 
3 416 ILE n 
3 417 VAL n 
3 418 TYR n 
3 419 GLY n 
3 420 ILE n 
3 421 SER n 
3 422 ASP n 
3 423 TYR n 
3 424 GLY n 
3 425 LEU n 
3 426 ALA n 
3 427 GLN n 
3 428 ASN n 
3 429 LEU n 
3 430 ASN n 
3 431 ILE n 
3 432 SER n 
3 433 ARG n 
3 434 LYS n 
3 435 GLU n 
3 436 ALA n 
3 437 ALA n 
3 438 GLU n 
3 439 PHE n 
3 440 ILE n 
3 441 GLU n 
3 442 ARG n 
3 443 TYR n 
3 444 PHE n 
3 445 GLU n 
3 446 SER n 
3 447 PHE n 
3 448 PRO n 
3 449 GLY n 
3 450 VAL n 
3 451 LYS n 
3 452 ARG n 
3 453 TYR n 
3 454 MET n 
3 455 GLU n 
3 456 ASN n 
3 457 ILE n 
3 458 VAL n 
3 459 GLN n 
3 460 GLU n 
3 461 ALA n 
3 462 LYS n 
3 463 GLN n 
3 464 LYS n 
3 465 GLY n 
3 466 TYR n 
3 467 VAL n 
3 468 THR n 
3 469 THR n 
3 470 LEU n 
3 471 LEU n 
3 472 HIS n 
3 473 ARG n 
3 474 ARG n 
3 475 ARG n 
3 476 TYR n 
3 477 LEU n 
3 478 PRO n 
3 479 ASP n 
3 480 ILE n 
3 481 THR n 
3 482 SER n 
3 483 ARG n 
3 484 ASN n 
3 485 PHE n 
3 486 ASN n 
3 487 VAL n 
3 488 ARG n 
3 489 SER n 
3 490 PHE n 
3 491 ALA n 
3 492 GLU n 
3 493 ARG n 
3 494 MET n 
3 495 ALA n 
3 496 MET n 
3 497 ASN n 
3 498 THR n 
3 499 PRO n 
3 500 ILE n 
3 501 GLN n 
3 502 GLY n 
3 503 SER n 
3 504 ALA n 
3 505 ALA n 
3 506 ASP n 
3 507 ILE n 
3 508 ILE n 
3 509 LYS n 
3 510 LYS n 
3 511 ALA n 
3 512 MET n 
3 513 ILE n 
3 514 ASP n 
3 515 LEU n 
3 516 ASN n 
3 517 ALA n 
3 518 ARG n 
3 519 LEU n 
3 520 LYS n 
3 521 GLU n 
3 522 GLU n 
3 523 ARG n 
3 524 LEU n 
3 525 GLN n 
3 526 ALA n 
3 527 HIS n 
3 528 LEU n 
3 529 LEU n 
3 530 LEU n 
3 531 GLN n 
3 532 VAL n 
3 533 HIS n 
3 534 ASP n 
3 535 GLU n 
3 536 LEU n 
3 537 ILE n 
3 538 LEU n 
3 539 GLU n 
3 540 ALA n 
3 541 PRO n 
3 542 LYS n 
3 543 GLU n 
3 544 GLU n 
3 545 MET n 
3 546 GLU n 
3 547 ARG n 
3 548 LEU n 
3 549 CYS n 
3 550 ARG n 
3 551 LEU n 
3 552 VAL n 
3 553 PRO n 
3 554 GLU n 
3 555 VAL n 
3 556 MET n 
3 557 GLU n 
3 558 GLN n 
3 559 ALA n 
3 560 VAL n 
3 561 THR n 
3 562 LEU n 
3 563 ARG n 
3 564 VAL n 
3 565 PRO n 
3 566 LEU n 
3 567 LYS n 
3 568 VAL n 
3 569 ASP n 
3 570 TYR n 
3 571 HIS n 
3 572 TYR n 
3 573 GLY n 
3 574 SER n 
3 575 THR n 
3 576 TRP n 
3 577 TYR n 
3 578 ASP n 
3 579 ALA n 
3 580 LYS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Geobacillus 
_entity_src_gen.pdbx_gene_src_gene                 polA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Geobacillus stearothermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PUC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? ? ? ? 'chemically synthesized' 
2 1 sample ? ? ? ? ? 'chemically synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP Q5KWC1_GEOKA Q5KWC1 3 299 ? ? 
2 PDB 2HHW         2HHW   1 ?   ? ? 
3 PDB 2HHW         2HHW   2 ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2HHW A 1 ? 580 ? Q5KWC1 299 ? 878 ? 297 876 
2 1 2HHW D 1 ? 580 ? Q5KWC1 299 ? 878 ? 297 876 
3 2 2HHW E 1 ? 9   ? 2HHW   21  ? 29  ? 21  29  
4 3 2HHW F 1 ? 13  ? 2HHW   0   ? 12  ? 0   12  
5 2 2HHW B 1 ? 9   ? 2HHW   21  ? 29  ? 21  29  
6 3 2HHW C 1 ? 13  ? 2HHW   0   ? 12  ? 0   12  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
6OG 'DNA linking'                 n 
;6-O-METHYL GUANOSINE-5'-MONOPHOSPHATE
;
? 'C11 H16 N5 O7 P'   361.248 
ALA 'L-peptide linking'           y ALANINE                                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking'           y ARGININE                                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking'           y CYSTEINE                                   ? 'C3 H7 N O2 S'      121.158 
D3T 'DNA OH 3 prime terminus'     n "2',3'-DIDEOXY-THYMIDINE-5'-TRIPHOSPHATE"  ? 'C10 H17 N2 O13 P3' 466.169 
DA  'DNA linking'                 y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'                 y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"        ? 'C9 H14 N3 O7 P'    307.197 
DDG 'DNA linking'                 n "2',3'-DIDEOXY-GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DG  'DNA linking'                 y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'                 y "THYMIDINE-5'-MONOPHOSPHATE"               ? 'C10 H15 N2 O8 P'   322.208 
FRU 'D-saccharide, beta linking'  . beta-D-fructofuranose                      ? 'C6 H12 O6'         180.156 
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose                      ? 'C6 H12 O6'         180.156 
GLN 'L-peptide linking'           y GLUTAMINE                                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'             y GLYCINE                                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking'           y HISTIDINE                                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer                   . WATER                                      ? 'H2 O'              18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking'           y LEUCINE                                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking'           y LYSINE                                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking'           y METHIONINE                                 ? 'C5 H11 N O2 S'     149.211 
MN  non-polymer                   . 'MANGANESE (II) ION'                       ? 'Mn 2'              54.938  
PHE 'L-peptide linking'           y PHENYLALANINE                              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking'           y PROLINE                                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking'           y SERINE                                     ? 'C3 H7 N O3'        105.093 
SO4 non-polymer                   . 'SULFATE ION'                              ? 'O4 S -2'           96.063  
THR 'L-peptide linking'           y THREONINE                                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking'           y TYROSINE                                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking'           y VALINE                                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2HHW 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.64 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   53.49 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'50% saturated ammonium sulfate, 2.5% MPD, 100mM MES, pH 5.8, VAPOR DIFFUSION, HANGING DROP, temperature 290K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 'ammonium sulfate' ? ? ? 
1 2 1 MPD                ? ? ? 
1 3 1 MES                ? ? ? 
1 4 1 H2O                ? ? ? 
1 5 2 'ammonium sulfate' ? ? ? 
1 6 2 'ammonium sulfate' ? ? ? 
1 7 2 H2O                ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   CUSTOM-MADE 
_diffrn_detector.pdbx_collection_date   2004-12-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si 111' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.008 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.008 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
# 
_reflns.entry_id                     2HHW 
_reflns.d_resolution_high            1.880 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   120016 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_netI_over_sigmaI        14.2 
_reflns.pdbx_chi_squared             1.046 
_reflns.pdbx_redundancy              4.800 
_reflns.percent_possible_obs         95.600 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3 
_reflns.number_all                   120016 
_reflns.pdbx_Rsym_value              0.111 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.88 
_reflns_shell.d_res_low              1.95 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_Rsym_value        0.782 
_reflns_shell.pdbx_chi_squared       1.025 
_reflns_shell.pdbx_redundancy        4.40 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      11633 
_reflns_shell.percent_possible_all   93.60 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2HHW 
_refine.ls_d_res_high                            1.880 
_refine.ls_d_res_low                             50.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    90.600 
_refine.ls_number_reflns_obs                     113550 
_refine.ls_R_factor_R_work                       0.196 
_refine.ls_R_factor_R_free                       0.225 
_refine.ls_percent_reflns_R_free                 4.500 
_refine.ls_number_reflns_R_free                  5689 
_refine.B_iso_mean                               24.212 
_refine.solvent_model_param_bsol                 45.062 
_refine.aniso_B[1][1]                            0.758 
_refine.aniso_B[2][2]                            -2.216 
_refine.aniso_B[3][3]                            1.458 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     120016 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 1LV5' 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2HHW 
_refine_analyze.Luzzati_coordinate_error_obs    0.21 
_refine_analyze.Luzzati_sigma_a_obs             0.18 
_refine_analyze.Luzzati_d_res_low_obs           5 
_refine_analyze.Luzzati_coordinate_error_free   0.25 
_refine_analyze.Luzzati_sigma_a_free            0.21 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9304 
_refine_hist.pdbx_number_atoms_nucleic_acid   810 
_refine_hist.pdbx_number_atoms_ligand         119 
_refine_hist.number_atoms_solvent             794 
_refine_hist.number_atoms_total               11027 
_refine_hist.d_res_high                       1.880 
_refine_hist.d_res_low                        50.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           ? 0.005 ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d          ? 1.195 ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d ? 22.15 ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d ? 1.15  ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.88 
_refine_ls_shell.d_res_low                        1.95 
_refine_ls_shell.number_reflns_obs                9951 
_refine_ls_shell.number_reflns_R_free             510 
_refine_ls_shell.R_factor_R_work                  0.271 
_refine_ls_shell.R_factor_R_free                  0.2863 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_obs               80.17 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 CNS_TOPPAR:protein_rep.param             ? 'X-RAY DIFFRACTION' 
2 CNS_TOPPAR:water_rep.param               ? 'X-RAY DIFFRACTION' 
3 CNS_TOPPAR:dna-rna-multi-endo-new2.param ? 'X-RAY DIFFRACTION' 
4 d3t.param                                ? 'X-RAY DIFFRACTION' 
5 CNS_TOPPAR:sucrose.par                   ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2HHW 
_struct.title                     'ddTTP:O6-methyl-guanine pair in the polymerase active site, in the closed conformation' 
_struct.pdbx_descriptor           'DNA Polymerase I (E.C.2.7.7.7)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HHW 
_struct_keywords.pdbx_keywords   Transferase/DNA 
_struct_keywords.text            
'DNA polymerase I, DNA replication, Klenow fragment, DNA-protein complex, O6-methyl-guanine, Transferase-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 6 ? 
L N N 7 ? 
M N N 5 ? 
N N N 6 ? 
O N N 7 ? 
P N N 8 ? 
Q N N 8 ? 
R N N 8 ? 
S N N 8 ? 
T N N 8 ? 
U N N 8 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 
;The asymmetric unit contains two biological assemblies, each consisting of one protein molecule, two strands of DNA, and an incoming dideoxy thymidine triphosphate.  Chains A, B, C, and G constitute one assembly, and chains D, E, F, and G constitute the second.
;
? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR E 12  ? ALA E 17  ? THR A 308 ALA A 313 5 ? 6  
HELX_P HELX_P2  2  ARG E 51  ? LEU E 56  ? ARG A 347 LEU A 352 1 ? 6  
HELX_P HELX_P3  3  ASP E 58  ? GLY E 66  ? ASP A 354 GLY A 362 1 ? 9  
HELX_P HELX_P4  4  ASP E 76  ? LYS E 87  ? ASP A 372 LYS A 383 1 ? 12 
HELX_P HELX_P5  5  LEU E 98  ? ASP E 106 ? LEU A 394 ASP A 402 1 ? 9  
HELX_P HELX_P6  6  PRO E 107 ? GLY E 110 ? PRO A 403 GLY A 406 5 ? 4  
HELX_P HELX_P7  7  ASP E 113 ? MET E 120 ? ASP A 409 MET A 416 1 ? 8  
HELX_P HELX_P8  8  PRO E 128 ? GLY E 134 ? PRO A 424 GLY A 430 1 ? 7  
HELX_P HELX_P9  9  LYS E 135 ? ARG E 139 ? LYS A 431 ARG A 435 5 ? 5  
HELX_P HELX_P10 10 ASP E 143 ? ASN E 172 ? ASP A 439 ASN A 468 1 ? 30 
HELX_P HELX_P11 11 GLN E 174 ? LEU E 181 ? GLN A 470 LEU A 477 1 ? 8  
HELX_P HELX_P12 12 LEU E 181 ? GLY E 196 ? LEU A 477 GLY A 492 1 ? 16 
HELX_P HELX_P13 13 ASP E 200 ? GLY E 227 ? ASP A 496 GLY A 523 1 ? 28 
HELX_P HELX_P14 14 SER E 234 ? GLU E 244 ? SER A 530 GLU A 540 1 ? 11 
HELX_P HELX_P15 15 SER E 261 ? ALA E 269 ? SER A 557 ALA A 565 1 ? 9  
HELX_P HELX_P16 16 GLU E 273 ? ILE E 292 ? GLU A 569 ILE A 588 1 ? 20 
HELX_P HELX_P17 17 ILE E 292 ? VAL E 299 ? ILE A 588 VAL A 595 1 ? 8  
HELX_P HELX_P18 18 LEU E 334 ? LYS E 339 ? LEU A 630 LYS A 635 1 ? 6  
HELX_P HELX_P19 19 ILE E 340 ? GLN E 342 ? ILE A 636 GLN A 638 5 ? 3  
HELX_P HELX_P20 20 GLN E 360 ? GLU E 371 ? GLN A 656 GLU A 667 1 ? 12 
HELX_P HELX_P21 21 ASP E 372 ? ARG E 381 ? ASP A 668 ARG A 677 1 ? 10 
HELX_P HELX_P22 22 ASP E 384 ? PHE E 394 ? ASP A 680 PHE A 690 1 ? 11 
HELX_P HELX_P23 23 SER E 397 ? VAL E 401 ? SER A 693 VAL A 697 5 ? 5  
HELX_P HELX_P24 24 THR E 402 ? TYR E 418 ? THR A 698 TYR A 714 1 ? 17 
HELX_P HELX_P25 25 SER E 421 ? LEU E 429 ? SER A 717 LEU A 725 1 ? 9  
HELX_P HELX_P26 26 SER E 432 ? PHE E 447 ? SER A 728 PHE A 743 1 ? 16 
HELX_P HELX_P27 27 PHE E 447 ? GLY E 465 ? PHE A 743 GLY A 761 1 ? 19 
HELX_P HELX_P28 28 PRO E 478 ? SER E 482 ? PRO A 774 SER A 778 5 ? 5  
HELX_P HELX_P29 29 ASN E 484 ? GLU E 522 ? ASN A 780 GLU A 818 1 ? 39 
HELX_P HELX_P30 30 GLU E 544 ? GLN E 558 ? GLU A 840 GLN A 854 1 ? 15 
HELX_P HELX_P31 31 THR F 12  ? ALA F 17  ? THR D 308 ALA D 313 5 ? 6  
HELX_P HELX_P32 32 ARG F 51  ? LEU F 56  ? ARG D 347 LEU D 352 1 ? 6  
HELX_P HELX_P33 33 ASP F 58  ? GLY F 66  ? ASP D 354 GLY D 362 1 ? 9  
HELX_P HELX_P34 34 ASP F 76  ? TRP F 86  ? ASP D 372 TRP D 382 1 ? 11 
HELX_P HELX_P35 35 LEU F 98  ? ASP F 106 ? LEU D 394 ASP D 402 1 ? 9  
HELX_P HELX_P36 36 PRO F 107 ? GLY F 110 ? PRO D 403 GLY D 406 5 ? 4  
HELX_P HELX_P37 37 ASP F 113 ? MET F 120 ? ASP D 409 MET D 416 1 ? 8  
HELX_P HELX_P38 38 PRO F 128 ? GLY F 134 ? PRO D 424 GLY D 430 1 ? 7  
HELX_P HELX_P39 39 LYS F 135 ? ARG F 139 ? LYS D 431 ARG D 435 5 ? 5  
HELX_P HELX_P40 40 ASP F 143 ? ASN F 172 ? ASP D 439 ASN D 468 1 ? 30 
HELX_P HELX_P41 41 GLN F 174 ? LEU F 181 ? GLN D 470 LEU D 477 1 ? 8  
HELX_P HELX_P42 42 LEU F 181 ? GLY F 196 ? LEU D 477 GLY D 492 1 ? 16 
HELX_P HELX_P43 43 ASP F 200 ? GLY F 227 ? ASP D 496 GLY D 523 1 ? 28 
HELX_P HELX_P44 44 SER F 234 ? GLU F 244 ? SER D 530 GLU D 540 1 ? 11 
HELX_P HELX_P45 45 SER F 261 ? LEU F 268 ? SER D 557 LEU D 564 1 ? 8  
HELX_P HELX_P46 46 GLU F 273 ? ILE F 292 ? GLU D 569 ILE D 588 1 ? 20 
HELX_P HELX_P47 47 ILE F 292 ? VAL F 299 ? ILE D 588 VAL D 595 1 ? 8  
HELX_P HELX_P48 48 LEU F 334 ? LYS F 339 ? LEU D 630 LYS D 635 1 ? 6  
HELX_P HELX_P49 49 ILE F 340 ? GLN F 342 ? ILE D 636 GLN D 638 5 ? 3  
HELX_P HELX_P50 50 GLN F 360 ? GLU F 371 ? GLN D 656 GLU D 667 1 ? 12 
HELX_P HELX_P51 51 ASP F 372 ? ARG F 381 ? ASP D 668 ARG D 677 1 ? 10 
HELX_P HELX_P52 52 ASP F 384 ? GLN F 395 ? ASP D 680 GLN D 691 1 ? 12 
HELX_P HELX_P53 53 THR F 402 ? TYR F 418 ? THR D 698 TYR D 714 1 ? 17 
HELX_P HELX_P54 54 SER F 421 ? LEU F 429 ? SER D 717 LEU D 725 1 ? 9  
HELX_P HELX_P55 55 SER F 432 ? PHE F 447 ? SER D 728 PHE D 743 1 ? 16 
HELX_P HELX_P56 56 PHE F 447 ? GLY F 465 ? PHE D 743 GLY D 761 1 ? 19 
HELX_P HELX_P57 57 PRO F 478 ? SER F 482 ? PRO D 774 SER D 778 5 ? 5  
HELX_P HELX_P58 58 ASN F 484 ? GLU F 522 ? ASN D 780 GLU D 818 1 ? 39 
HELX_P HELX_P59 59 GLU F 544 ? GLN F 558 ? GLU D 840 GLN D 854 1 ? 15 
HELX_P HELX_P60 60 THR F 575 ? ALA F 579 ? THR D 871 ALA D 875 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A DC  8   "O3'" ? ? ? 1_555 A DDG 9  P   ? ? E DC  28  E DDG 29  1_555 ? ? ? ? ? ? ?            1.605 ?    
? 
covale2  covale both ? B DT  3   "O3'" ? ? ? 1_555 B 6OG 4  P   ? ? F DT  2   F 6OG 3   1_555 ? ? ? ? ? ? ?            1.604 ?    
? 
covale3  covale one  ? B 6OG 4   "O3'" ? ? ? 1_555 B DC  5  P   ? ? F 6OG 3   F DC  4   1_555 ? ? ? ? ? ? ?            1.609 ?    
? 
covale4  covale both ? C DC  8   "O3'" ? ? ? 1_555 C DDG 9  P   ? ? B DC  28  B DDG 29  1_555 ? ? ? ? ? ? ?            1.609 ?    
? 
covale5  covale both ? D DT  3   "O3'" ? ? ? 1_555 D 6OG 4  P   ? ? C DT  2   C 6OG 3   1_555 ? ? ? ? ? ? ?            1.611 ?    
? 
covale6  covale one  ? D 6OG 4   "O3'" ? ? ? 1_555 D DC  5  P   ? ? C 6OG 3   C DC  4   1_555 ? ? ? ? ? ? ?            1.605 ?    
? 
covale7  covale both ? G GLC .   C1    ? ? ? 1_555 G FRU .  O2  ? ? G GLC 1   G FRU 2   1_555 ? ? ? ? ? ? ?            1.464 sing 
? 
covale8  covale both ? H GLC .   C1    ? ? ? 1_555 H FRU .  O2  ? ? H GLC 1   H FRU 2   1_555 ? ? ? ? ? ? ?            1.460 sing 
? 
metalc1  metalc ?    ? E ASP 357 OD1   ? ? ? 1_555 I MN  .  MN  ? ? A ASP 653 A MN  878 1_555 ? ? ? ? ? ? ?            2.099 ?    
? 
metalc2  metalc ?    ? E TYR 358 O     ? ? ? 1_555 I MN  .  MN  ? ? A TYR 654 A MN  878 1_555 ? ? ? ? ? ? ?            2.176 ?    
? 
metalc3  metalc ?    ? E ASP 534 OD2   ? ? ? 1_555 I MN  .  MN  ? ? A ASP 830 A MN  878 1_555 ? ? ? ? ? ? ?            2.080 ?    
? 
metalc4  metalc ?    ? I MN  .   MN    ? ? ? 1_555 L D3T .  O1A ? ? A MN  878 A D3T 881 1_555 ? ? ? ? ? ? ?            2.183 ?    
? 
metalc5  metalc ?    ? I MN  .   MN    ? ? ? 1_555 L D3T .  O1G ? ? A MN  878 A D3T 881 1_555 ? ? ? ? ? ? ?            2.025 ?    
? 
metalc6  metalc ?    ? I MN  .   MN    ? ? ? 1_555 L D3T .  O2B ? ? A MN  878 A D3T 881 1_555 ? ? ? ? ? ? ?            2.131 ?    
? 
metalc7  metalc ?    ? F ASP 357 OD1   ? ? ? 1_555 M MN  .  MN  ? ? D ASP 653 D MN  878 1_555 ? ? ? ? ? ? ?            2.187 ?    
? 
metalc8  metalc ?    ? F TYR 358 O     ? ? ? 1_555 M MN  .  MN  ? ? D TYR 654 D MN  878 1_555 ? ? ? ? ? ? ?            2.177 ?    
? 
metalc9  metalc ?    ? F ASP 534 OD2   ? ? ? 1_555 M MN  .  MN  ? ? D ASP 830 D MN  878 1_555 ? ? ? ? ? ? ?            2.080 ?    
? 
metalc10 metalc ?    ? M MN  .   MN    ? ? ? 1_555 O D3T .  O2G ? ? D MN  878 D D3T 880 1_555 ? ? ? ? ? ? ?            2.006 ?    
? 
metalc11 metalc ?    ? M MN  .   MN    ? ? ? 1_555 O D3T .  O2A ? ? D MN  878 D D3T 880 1_555 ? ? ? ? ? ? ?            2.165 ?    
? 
metalc12 metalc ?    ? M MN  .   MN    ? ? ? 1_555 O D3T .  O1B ? ? D MN  878 D D3T 880 1_555 ? ? ? ? ? ? ?            2.052 ?    
? 
hydrog1  hydrog ?    ? A DC  1   N3    ? ? ? 1_555 B DG  13 N1  ? ? E DC  21  F DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog2  hydrog ?    ? A DC  1   N4    ? ? ? 1_555 B DG  13 O6  ? ? E DC  21  F DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog3  hydrog ?    ? A DC  1   O2    ? ? ? 1_555 B DG  13 N2  ? ? E DC  21  F DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog4  hydrog ?    ? A DC  2   N3    ? ? ? 1_555 B DG  12 N1  ? ? E DC  22  F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog5  hydrog ?    ? A DC  2   N4    ? ? ? 1_555 B DG  12 O6  ? ? E DC  22  F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog6  hydrog ?    ? A DC  2   O2    ? ? ? 1_555 B DG  12 N2  ? ? E DC  22  F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog7  hydrog ?    ? A DT  3   N3    ? ? ? 1_555 B DA  11 N1  ? ? E DT  23  F DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog8  hydrog ?    ? A DT  3   O4    ? ? ? 1_555 B DA  11 N6  ? ? E DT  23  F DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog9  hydrog ?    ? A DG  4   N1    ? ? ? 1_555 B DC  10 N3  ? ? E DG  24  F DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog10 hydrog ?    ? A DG  4   N2    ? ? ? 1_555 B DC  10 O2  ? ? E DG  24  F DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog11 hydrog ?    ? A DG  4   O6    ? ? ? 1_555 B DC  10 N4  ? ? E DG  24  F DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog12 hydrog ?    ? A DA  5   N1    ? ? ? 1_555 B DT  9  N3  ? ? E DA  25  F DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog13 hydrog ?    ? A DA  5   N6    ? ? ? 1_555 B DT  9  O4  ? ? E DA  25  F DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog14 hydrog ?    ? A DC  6   N3    ? ? ? 1_555 B DG  8  N1  ? ? E DC  26  F DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog15 hydrog ?    ? A DC  6   N4    ? ? ? 1_555 B DG  8  O6  ? ? E DC  26  F DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog16 hydrog ?    ? A DC  6   O2    ? ? ? 1_555 B DG  8  N2  ? ? E DC  26  F DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog17 hydrog ?    ? A DT  7   N3    ? ? ? 1_555 B DA  7  N1  ? ? E DT  27  F DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog18 hydrog ?    ? A DT  7   O4    ? ? ? 1_555 B DA  7  N6  ? ? E DT  27  F DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog19 hydrog ?    ? A DC  8   N3    ? ? ? 1_555 B DG  6  N1  ? ? E DC  28  F DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog20 hydrog ?    ? A DC  8   N4    ? ? ? 1_555 B DG  6  O6  ? ? E DC  28  F DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog21 hydrog ?    ? A DC  8   O2    ? ? ? 1_555 B DG  6  N2  ? ? E DC  28  F DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog22 hydrog ?    ? A DDG 9   N1    ? ? ? 1_555 B DC  5  N3  ? ? E DDG 29  F DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog23 hydrog ?    ? A DDG 9   N2    ? ? ? 1_555 B DC  5  O2  ? ? E DDG 29  F DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog24 hydrog ?    ? A DDG 9   O6    ? ? ? 1_555 B DC  5  N4  ? ? E DDG 29  F DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog25 hydrog ?    ? C DC  1   O2    ? ? ? 1_555 D DG  13 N1  ? ? B DC  21  C DG  12  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ?    
? 
hydrog26 hydrog ?    ? C DC  2   N3    ? ? ? 1_555 D DG  12 N1  ? ? B DC  22  C DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog27 hydrog ?    ? C DC  2   N4    ? ? ? 1_555 D DG  12 O6  ? ? B DC  22  C DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog28 hydrog ?    ? C DC  2   O2    ? ? ? 1_555 D DG  12 N2  ? ? B DC  22  C DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog29 hydrog ?    ? C DT  3   N3    ? ? ? 1_555 D DA  11 N1  ? ? B DT  23  C DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog30 hydrog ?    ? C DT  3   O4    ? ? ? 1_555 D DA  11 N6  ? ? B DT  23  C DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog31 hydrog ?    ? C DG  4   N1    ? ? ? 1_555 D DC  10 N3  ? ? B DG  24  C DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog32 hydrog ?    ? C DG  4   N2    ? ? ? 1_555 D DC  10 O2  ? ? B DG  24  C DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog33 hydrog ?    ? C DG  4   O6    ? ? ? 1_555 D DC  10 N4  ? ? B DG  24  C DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog34 hydrog ?    ? C DA  5   N1    ? ? ? 1_555 D DT  9  N3  ? ? B DA  25  C DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog35 hydrog ?    ? C DA  5   N6    ? ? ? 1_555 D DT  9  O4  ? ? B DA  25  C DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog36 hydrog ?    ? C DC  6   N3    ? ? ? 1_555 D DG  8  N1  ? ? B DC  26  C DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog37 hydrog ?    ? C DC  6   N4    ? ? ? 1_555 D DG  8  O6  ? ? B DC  26  C DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog38 hydrog ?    ? C DC  6   O2    ? ? ? 1_555 D DG  8  N2  ? ? B DC  26  C DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog39 hydrog ?    ? C DT  7   N3    ? ? ? 1_555 D DA  7  N1  ? ? B DT  27  C DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog40 hydrog ?    ? C DT  7   O4    ? ? ? 1_555 D DA  7  N6  ? ? B DT  27  C DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog41 hydrog ?    ? C DC  8   N3    ? ? ? 1_555 D DG  6  N1  ? ? B DC  28  C DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog42 hydrog ?    ? C DC  8   N4    ? ? ? 1_555 D DG  6  O6  ? ? B DC  28  C DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog43 hydrog ?    ? C DC  8   O2    ? ? ? 1_555 D DG  6  N2  ? ? B DC  28  C DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog44 hydrog ?    ? C DDG 9   N1    ? ? ? 1_555 D DC  5  N3  ? ? B DDG 29  C DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog45 hydrog ?    ? C DDG 9   N2    ? ? ? 1_555 D DC  5  O2  ? ? B DDG 29  C DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog46 hydrog ?    ? C DDG 9   O6    ? ? ? 1_555 D DC  5  N4  ? ? B DDG 29  C DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 324 E . ? GLU 620 A PRO 325 E ? PRO 621 A 1 -0.13 
2 GLU 324 F . ? GLU 620 D PRO 325 F ? PRO 621 D 1 -0.16 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 4 ? 
E ? 2 ? 
F ? 6 ? 
G ? 3 ? 
H ? 2 ? 
I ? 2 ? 
J ? 4 ? 
K ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? parallel      
F 5 6 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR E 6   ? LEU E 7   ? THR A 302 LEU A 303 
A 2 GLY E 46  ? LEU E 50  ? GLY A 342 LEU A 346 
A 3 GLY E 38  ? ASN E 43  ? GLY A 334 ASN A 339 
A 4 LYS E 19  ? GLU E 25  ? LYS A 315 GLU A 321 
A 5 LYS E 71  ? MET E 74  ? LYS A 367 MET A 370 
A 6 VAL E 94  ? ASP E 97  ? VAL A 390 ASP A 393 
B 1 LYS E 305 ? VAL E 306 ? LYS A 601 VAL A 602 
B 2 VAL E 197 ? VAL E 199 ? VAL A 493 VAL A 495 
B 3 PHE E 344 ? VAL E 345 ? PHE A 640 VAL A 641 
C 1 ILE E 309 ? ASN E 311 ? ILE A 605 ASN A 607 
C 2 SER E 321 ? THR E 323 ? SER A 617 THR A 619 
D 1 HIS E 527 ? GLN E 531 ? HIS A 823 GLN A 827 
D 2 GLU E 535 ? PRO E 541 ? GLU A 831 PRO A 837 
D 3 TRP E 351 ? TYR E 358 ? TRP A 647 TYR A 654 
D 4 VAL E 568 ? GLY E 573 ? VAL A 864 GLY A 869 
E 1 TYR E 466 ? THR E 468 ? TYR A 762 THR A 764 
E 2 ARG E 474 ? TYR E 476 ? ARG A 770 TYR A 772 
F 1 THR F 6   ? LEU F 7   ? THR D 302 LEU D 303 
F 2 GLY F 46  ? LEU F 50  ? GLY D 342 LEU D 346 
F 3 GLY F 38  ? ASN F 43  ? GLY D 334 ASN D 339 
F 4 LYS F 19  ? GLU F 25  ? LYS D 315 GLU D 321 
F 5 LYS F 71  ? MET F 74  ? LYS D 367 MET D 370 
F 6 VAL F 94  ? ASP F 97  ? VAL D 390 ASP D 393 
G 1 LYS F 305 ? VAL F 306 ? LYS D 601 VAL D 602 
G 2 VAL F 197 ? VAL F 199 ? VAL D 493 VAL D 495 
G 3 PHE F 344 ? VAL F 345 ? PHE D 640 VAL D 641 
H 1 LYS F 253 ? THR F 254 ? LYS D 549 THR D 550 
H 2 GLY F 257 ? TYR F 258 ? GLY D 553 TYR D 554 
I 1 ILE F 309 ? ASN F 311 ? ILE D 605 ASN D 607 
I 2 SER F 321 ? THR F 323 ? SER D 617 THR D 619 
J 1 HIS F 527 ? GLN F 531 ? HIS D 823 GLN D 827 
J 2 GLU F 535 ? PRO F 541 ? GLU D 831 PRO D 837 
J 3 TRP F 351 ? TYR F 358 ? TRP D 647 TYR D 654 
J 4 VAL F 568 ? GLY F 573 ? VAL D 864 GLY D 869 
K 1 TYR F 466 ? THR F 468 ? TYR D 762 THR D 764 
K 2 ARG F 474 ? TYR F 476 ? ARG D 770 TYR D 772 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR E 6   ? N THR A 302 O PHE E 49  ? O PHE A 345 
A 2 3 O PHE E 48  ? O PHE A 344 N VAL E 41  ? N VAL A 337 
A 3 4 O VAL E 42  ? O VAL A 338 N ALA E 21  ? N ALA A 317 
A 4 5 N LEU E 22  ? N LEU A 318 O SER E 73  ? O SER A 369 
A 5 6 N MET E 74  ? N MET A 370 O PHE E 96  ? O PHE A 392 
B 1 2 O VAL E 306 ? O VAL A 602 N VAL E 197 ? N VAL A 493 
B 2 3 N LYS E 198 ? N LYS A 494 O VAL E 345 ? O VAL A 641 
C 1 2 N ILE E 309 ? N ILE A 605 O THR E 323 ? O THR A 619 
D 1 2 N LEU E 529 ? N LEU A 825 O ILE E 537 ? O ILE A 833 
D 2 3 O LEU E 538 ? O LEU A 834 N PHE E 354 ? N PHE A 650 
D 3 4 N ASP E 357 ? N ASP A 653 O ASP E 569 ? O ASP A 865 
E 1 2 N VAL E 467 ? N VAL A 763 O ARG E 475 ? O ARG A 771 
F 1 2 N THR F 6   ? N THR D 302 O ARG F 47  ? O ARG D 343 
F 2 3 O PHE F 48  ? O PHE D 344 N VAL F 41  ? N VAL D 337 
F 3 4 O VAL F 42  ? O VAL D 338 N ALA F 21  ? N ALA D 317 
F 4 5 N LEU F 22  ? N LEU D 318 O SER F 73  ? O SER D 369 
F 5 6 N MET F 74  ? N MET D 370 O PHE F 96  ? O PHE D 392 
G 1 2 O VAL F 306 ? O VAL D 602 N VAL F 197 ? N VAL D 493 
G 2 3 N LYS F 198 ? N LYS D 494 O VAL F 345 ? O VAL D 641 
H 1 2 N THR F 254 ? N THR D 550 O GLY F 257 ? O GLY D 553 
I 1 2 N ILE F 309 ? N ILE D 605 O THR F 323 ? O THR D 619 
J 1 2 N LEU F 529 ? N LEU D 825 O ILE F 537 ? O ILE D 833 
J 2 3 O LEU F 538 ? O LEU D 834 N PHE F 354 ? N PHE D 650 
J 3 4 N ASP F 357 ? N ASP D 653 O ASP F 569 ? O ASP D 865 
K 1 2 N VAL F 467 ? N VAL D 763 O ARG F 475 ? O ARG D 771 
# 
_atom_sites.entry_id                    2HHW 
_atom_sites.fract_transf_matrix[1][1]   0.010657 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009183 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006662 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . DC  A 1 1   ? 142.252 -28.861 -29.894 1.00 67.88 ? 21   DC  E "O5'" 1 
ATOM   2     C  "C5'" . DC  A 1 1   ? 143.573 -28.332 -29.694 1.00 65.87 ? 21   DC  E "C5'" 1 
ATOM   3     C  "C4'" . DC  A 1 1   ? 143.748 -26.960 -30.296 1.00 62.75 ? 21   DC  E "C4'" 1 
ATOM   4     O  "O4'" . DC  A 1 1   ? 143.348 -26.972 -31.680 1.00 61.80 ? 21   DC  E "O4'" 1 
ATOM   5     C  "C3'" . DC  A 1 1   ? 142.874 -25.906 -29.636 1.00 61.18 ? 21   DC  E "C3'" 1 
ATOM   6     O  "O3'" . DC  A 1 1   ? 143.616 -25.336 -28.567 1.00 60.13 ? 21   DC  E "O3'" 1 
ATOM   7     C  "C2'" . DC  A 1 1   ? 142.662 -24.889 -30.742 1.00 60.62 ? 21   DC  E "C2'" 1 
ATOM   8     C  "C1'" . DC  A 1 1   ? 142.787 -25.705 -32.020 1.00 61.12 ? 21   DC  E "C1'" 1 
ATOM   9     N  N1    . DC  A 1 1   ? 141.519 -25.929 -32.711 1.00 61.74 ? 21   DC  E N1    1 
ATOM   10    C  C2    . DC  A 1 1   ? 141.103 -25.005 -33.677 1.00 62.40 ? 21   DC  E C2    1 
ATOM   11    O  O2    . DC  A 1 1   ? 141.797 -23.994 -33.890 1.00 63.20 ? 21   DC  E O2    1 
ATOM   12    N  N3    . DC  A 1 1   ? 139.957 -25.234 -34.348 1.00 62.51 ? 21   DC  E N3    1 
ATOM   13    C  C4    . DC  A 1 1   ? 139.234 -26.321 -34.075 1.00 62.99 ? 21   DC  E C4    1 
ATOM   14    N  N4    . DC  A 1 1   ? 138.124 -26.525 -34.776 1.00 63.09 ? 21   DC  E N4    1 
ATOM   15    C  C5    . DC  A 1 1   ? 139.621 -27.254 -33.077 1.00 62.85 ? 21   DC  E C5    1 
ATOM   16    C  C6    . DC  A 1 1   ? 140.757 -27.024 -32.429 1.00 62.11 ? 21   DC  E C6    1 
ATOM   17    P  P     . DC  A 1 2   ? 142.868 -24.455 -27.463 1.00 55.07 ? 22   DC  E P     1 
ATOM   18    O  OP1   . DC  A 1 2   ? 143.877 -24.170 -26.418 1.00 56.35 ? 22   DC  E OP1   1 
ATOM   19    O  OP2   . DC  A 1 2   ? 141.607 -25.154 -27.100 1.00 56.57 ? 22   DC  E OP2   1 
ATOM   20    O  "O5'" . DC  A 1 2   ? 142.524 -23.096 -28.219 1.00 52.65 ? 22   DC  E "O5'" 1 
ATOM   21    C  "C5'" . DC  A 1 2   ? 143.582 -22.261 -28.722 1.00 47.62 ? 22   DC  E "C5'" 1 
ATOM   22    C  "C4'" . DC  A 1 2   ? 143.022 -21.007 -29.355 1.00 43.36 ? 22   DC  E "C4'" 1 
ATOM   23    O  "O4'" . DC  A 1 2   ? 142.157 -21.336 -30.469 1.00 40.95 ? 22   DC  E "O4'" 1 
ATOM   24    C  "C3'" . DC  A 1 2   ? 142.208 -20.112 -28.423 1.00 41.80 ? 22   DC  E "C3'" 1 
ATOM   25    O  "O3'" . DC  A 1 2   ? 142.540 -18.752 -28.694 1.00 41.37 ? 22   DC  E "O3'" 1 
ATOM   26    C  "C2'" . DC  A 1 2   ? 140.768 -20.406 -28.819 1.00 39.52 ? 22   DC  E "C2'" 1 
ATOM   27    C  "C1'" . DC  A 1 2   ? 140.881 -20.729 -30.302 1.00 36.63 ? 22   DC  E "C1'" 1 
ATOM   28    N  N1    . DC  A 1 2   ? 139.869 -21.682 -30.791 1.00 31.17 ? 22   DC  E N1    1 
ATOM   29    C  C2    . DC  A 1 2   ? 138.996 -21.302 -31.828 1.00 28.72 ? 22   DC  E C2    1 
ATOM   30    O  O2    . DC  A 1 2   ? 139.081 -20.163 -32.313 1.00 28.72 ? 22   DC  E O2    1 
ATOM   31    N  N3    . DC  A 1 2   ? 138.083 -22.192 -32.269 1.00 27.96 ? 22   DC  E N3    1 
ATOM   32    C  C4    . DC  A 1 2   ? 138.019 -23.409 -31.718 1.00 27.19 ? 22   DC  E C4    1 
ATOM   33    N  N4    . DC  A 1 2   ? 137.107 -24.259 -32.178 1.00 26.35 ? 22   DC  E N4    1 
ATOM   34    C  C5    . DC  A 1 2   ? 138.887 -23.811 -30.668 1.00 28.18 ? 22   DC  E C5    1 
ATOM   35    C  C6    . DC  A 1 2   ? 139.783 -22.929 -30.241 1.00 29.55 ? 22   DC  E C6    1 
ATOM   36    P  P     . DT  A 1 3   ? 141.945 -17.573 -27.781 1.00 33.33 ? 23   DT  E P     1 
ATOM   37    O  OP1   . DT  A 1 3   ? 142.981 -16.511 -27.741 1.00 36.10 ? 23   DT  E OP1   1 
ATOM   38    O  OP2   . DT  A 1 3   ? 141.433 -18.156 -26.523 1.00 35.02 ? 23   DT  E OP2   1 
ATOM   39    O  "O5'" . DT  A 1 3   ? 140.728 -17.023 -28.649 1.00 32.17 ? 23   DT  E "O5'" 1 
ATOM   40    C  "C5'" . DT  A 1 3   ? 140.974 -16.508 -29.964 1.00 27.85 ? 23   DT  E "C5'" 1 
ATOM   41    C  "C4'" . DT  A 1 3   ? 139.701 -15.986 -30.589 1.00 25.58 ? 23   DT  E "C4'" 1 
ATOM   42    O  "O4'" . DT  A 1 3   ? 138.859 -17.069 -31.059 1.00 23.46 ? 23   DT  E "O4'" 1 
ATOM   43    C  "C3'" . DT  A 1 3   ? 138.832 -15.090 -29.703 1.00 25.92 ? 23   DT  E "C3'" 1 
ATOM   44    O  "O3'" . DT  A 1 3   ? 138.492 -13.905 -30.429 1.00 27.34 ? 23   DT  E "O3'" 1 
ATOM   45    C  "C2'" . DT  A 1 3   ? 137.621 -15.970 -29.399 1.00 23.65 ? 23   DT  E "C2'" 1 
ATOM   46    C  "C1'" . DT  A 1 3   ? 137.520 -16.865 -30.635 1.00 21.07 ? 23   DT  E "C1'" 1 
ATOM   47    N  N1    . DT  A 1 3   ? 136.904 -18.208 -30.460 1.00 19.38 ? 23   DT  E N1    1 
ATOM   48    C  C2    . DT  A 1 3   ? 136.012 -18.665 -31.416 1.00 17.02 ? 23   DT  E C2    1 
ATOM   49    O  O2    . DT  A 1 3   ? 135.649 -18.002 -32.376 1.00 16.69 ? 23   DT  E O2    1 
ATOM   50    N  N3    . DT  A 1 3   ? 135.556 -19.943 -31.205 1.00 17.09 ? 23   DT  E N3    1 
ATOM   51    C  C4    . DT  A 1 3   ? 135.884 -20.787 -30.157 1.00 16.42 ? 23   DT  E C4    1 
ATOM   52    O  O4    . DT  A 1 3   ? 135.421 -21.929 -30.123 1.00 16.95 ? 23   DT  E O4    1 
ATOM   53    C  C5    . DT  A 1 3   ? 136.790 -20.230 -29.177 1.00 17.46 ? 23   DT  E C5    1 
ATOM   54    C  C7    . DT  A 1 3   ? 137.191 -21.063 -28.001 1.00 17.64 ? 23   DT  E C7    1 
ATOM   55    C  C6    . DT  A 1 3   ? 137.242 -18.988 -29.373 1.00 18.59 ? 23   DT  E C6    1 
ATOM   56    P  P     . DG  A 1 4   ? 137.745 -12.684 -29.696 1.00 23.60 ? 24   DG  E P     1 
ATOM   57    O  OP1   . DG  A 1 4   ? 138.243 -11.428 -30.311 1.00 26.10 ? 24   DG  E OP1   1 
ATOM   58    O  OP2   . DG  A 1 4   ? 137.823 -12.866 -28.231 1.00 24.16 ? 24   DG  E OP2   1 
ATOM   59    O  "O5'" . DG  A 1 4   ? 136.239 -12.872 -30.183 1.00 21.08 ? 24   DG  E "O5'" 1 
ATOM   60    C  "C5'" . DG  A 1 4   ? 135.970 -12.950 -31.591 1.00 19.81 ? 24   DG  E "C5'" 1 
ATOM   61    C  "C4'" . DG  A 1 4   ? 134.552 -13.398 -31.857 1.00 20.68 ? 24   DG  E "C4'" 1 
ATOM   62    O  "O4'" . DG  A 1 4   ? 134.388 -14.808 -31.579 1.00 21.23 ? 24   DG  E "O4'" 1 
ATOM   63    C  "C3'" . DG  A 1 4   ? 133.462 -12.664 -31.075 1.00 20.71 ? 24   DG  E "C3'" 1 
ATOM   64    O  "O3'" . DG  A 1 4   ? 132.333 -12.478 -31.940 1.00 25.46 ? 24   DG  E "O3'" 1 
ATOM   65    C  "C2'" . DG  A 1 4   ? 133.089 -13.666 -29.993 1.00 21.40 ? 24   DG  E "C2'" 1 
ATOM   66    C  "C1'" . DG  A 1 4   ? 133.249 -14.975 -30.748 1.00 18.81 ? 24   DG  E "C1'" 1 
ATOM   67    N  N9    . DG  A 1 4   ? 133.424 -16.182 -29.945 1.00 17.03 ? 24   DG  E N9    1 
ATOM   68    C  C8    . DG  A 1 4   ? 134.142 -16.329 -28.783 1.00 16.22 ? 24   DG  E C8    1 
ATOM   69    N  N7    . DG  A 1 4   ? 134.086 -17.540 -28.297 1.00 16.21 ? 24   DG  E N7    1 
ATOM   70    C  C5    . DG  A 1 4   ? 133.287 -18.234 -29.195 1.00 15.68 ? 24   DG  E C5    1 
ATOM   71    C  C6    . DG  A 1 4   ? 132.881 -19.594 -29.204 1.00 15.03 ? 24   DG  E C6    1 
ATOM   72    O  O6    . DG  A 1 4   ? 133.155 -20.484 -28.389 1.00 16.26 ? 24   DG  E O6    1 
ATOM   73    N  N1    . DG  A 1 4   ? 132.077 -19.882 -30.302 1.00 15.10 ? 24   DG  E N1    1 
ATOM   74    C  C2    . DG  A 1 4   ? 131.712 -18.979 -31.272 1.00 15.58 ? 24   DG  E C2    1 
ATOM   75    N  N2    . DG  A 1 4   ? 130.926 -19.448 -32.249 1.00 15.85 ? 24   DG  E N2    1 
ATOM   76    N  N3    . DG  A 1 4   ? 132.090 -17.709 -31.279 1.00 15.92 ? 24   DG  E N3    1 
ATOM   77    C  C4    . DG  A 1 4   ? 132.870 -17.409 -30.217 1.00 16.30 ? 24   DG  E C4    1 
ATOM   78    P  P     . DA  A 1 5   ? 131.427 -11.156 -31.839 1.00 22.56 ? 25   DA  E P     1 
ATOM   79    O  OP1   . DA  A 1 5   ? 131.943 -10.115 -32.774 1.00 19.64 ? 25   DA  E OP1   1 
ATOM   80    O  OP2   . DA  A 1 5   ? 131.287 -10.841 -30.405 1.00 21.14 ? 25   DA  E OP2   1 
ATOM   81    O  "O5'" . DA  A 1 5   ? 130.023 -11.658 -32.405 1.00 21.36 ? 25   DA  E "O5'" 1 
ATOM   82    C  "C5'" . DA  A 1 5   ? 129.038 -12.266 -31.539 1.00 19.99 ? 25   DA  E "C5'" 1 
ATOM   83    C  "C4'" . DA  A 1 5   ? 128.555 -13.575 -32.118 1.00 20.38 ? 25   DA  E "C4'" 1 
ATOM   84    O  "O4'" . DA  A 1 5   ? 129.545 -14.615 -31.923 1.00 19.07 ? 25   DA  E "O4'" 1 
ATOM   85    C  "C3'" . DA  A 1 5   ? 127.308 -14.083 -31.409 1.00 20.21 ? 25   DA  E "C3'" 1 
ATOM   86    O  "O3'" . DA  A 1 5   ? 126.144 -13.530 -32.014 1.00 23.41 ? 25   DA  E "O3'" 1 
ATOM   87    C  "C2'" . DA  A 1 5   ? 127.391 -15.588 -31.600 1.00 21.53 ? 25   DA  E "C2'" 1 
ATOM   88    C  "C1'" . DA  A 1 5   ? 128.893 -15.843 -31.577 1.00 19.86 ? 25   DA  E "C1'" 1 
ATOM   89    N  N9    . DA  A 1 5   ? 129.398 -16.278 -30.274 1.00 17.28 ? 25   DA  E N9    1 
ATOM   90    C  C8    . DA  A 1 5   ? 130.126 -15.565 -29.348 1.00 16.63 ? 25   DA  E C8    1 
ATOM   91    N  N7    . DA  A 1 5   ? 130.455 -16.259 -28.289 1.00 15.58 ? 25   DA  E N7    1 
ATOM   92    C  C5    . DA  A 1 5   ? 129.902 -17.511 -28.525 1.00 15.59 ? 25   DA  E C5    1 
ATOM   93    C  C6    . DA  A 1 5   ? 129.915 -18.698 -27.784 1.00 14.93 ? 25   DA  E C6    1 
ATOM   94    N  N6    . DA  A 1 5   ? 130.535 -18.824 -26.611 1.00 13.42 ? 25   DA  E N6    1 
ATOM   95    N  N1    . DA  A 1 5   ? 129.271 -19.767 -28.297 1.00 14.88 ? 25   DA  E N1    1 
ATOM   96    C  C2    . DA  A 1 5   ? 128.662 -19.640 -29.482 1.00 15.08 ? 25   DA  E C2    1 
ATOM   97    N  N3    . DA  A 1 5   ? 128.586 -18.577 -30.279 1.00 15.28 ? 25   DA  E N3    1 
ATOM   98    C  C4    . DA  A 1 5   ? 129.237 -17.533 -29.736 1.00 16.40 ? 25   DA  E C4    1 
ATOM   99    P  P     . DC  A 1 6   ? 124.979 -12.932 -31.092 1.00 21.90 ? 26   DC  E P     1 
ATOM   100   O  OP1   . DC  A 1 6   ? 124.075 -12.212 -32.014 1.00 23.01 ? 26   DC  E OP1   1 
ATOM   101   O  OP2   . DC  A 1 6   ? 125.591 -12.215 -29.946 1.00 21.32 ? 26   DC  E OP2   1 
ATOM   102   O  "O5'" . DC  A 1 6   ? 124.218 -14.228 -30.563 1.00 21.92 ? 26   DC  E "O5'" 1 
ATOM   103   C  "C5'" . DC  A 1 6   ? 123.616 -15.141 -31.495 1.00 21.45 ? 26   DC  E "C5'" 1 
ATOM   104   C  "C4'" . DC  A 1 6   ? 123.360 -16.477 -30.842 1.00 22.32 ? 26   DC  E "C4'" 1 
ATOM   105   O  "O4'" . DC  A 1 6   ? 124.615 -17.094 -30.514 1.00 21.96 ? 26   DC  E "O4'" 1 
ATOM   106   C  "C3'" . DC  A 1 6   ? 122.598 -16.437 -29.526 1.00 22.56 ? 26   DC  E "C3'" 1 
ATOM   107   O  "O3'" . DC  A 1 6   ? 121.190 -16.450 -29.719 1.00 24.42 ? 26   DC  E "O3'" 1 
ATOM   108   C  "C2'" . DC  A 1 6   ? 123.019 -17.740 -28.877 1.00 22.89 ? 26   DC  E "C2'" 1 
ATOM   109   C  "C1'" . DC  A 1 6   ? 124.434 -17.942 -29.383 1.00 20.94 ? 26   DC  E "C1'" 1 
ATOM   110   N  N1    . DC  A 1 6   ? 125.447 -17.617 -28.365 1.00 19.36 ? 26   DC  E N1    1 
ATOM   111   C  C2    . DC  A 1 6   ? 125.825 -18.630 -27.484 1.00 16.03 ? 26   DC  E C2    1 
ATOM   112   O  O2    . DC  A 1 6   ? 125.317 -19.750 -27.618 1.00 17.04 ? 26   DC  E O2    1 
ATOM   113   N  N3    . DC  A 1 6   ? 126.723 -18.362 -26.516 1.00 15.28 ? 26   DC  E N3    1 
ATOM   114   C  C4    . DC  A 1 6   ? 127.241 -17.137 -26.411 1.00 14.46 ? 26   DC  E C4    1 
ATOM   115   N  N4    . DC  A 1 6   ? 128.118 -16.916 -25.428 1.00 13.40 ? 26   DC  E N4    1 
ATOM   116   C  C5    . DC  A 1 6   ? 126.882 -16.088 -27.304 1.00 14.55 ? 26   DC  E C5    1 
ATOM   117   C  C6    . DC  A 1 6   ? 125.991 -16.367 -28.255 1.00 16.42 ? 26   DC  E C6    1 
ATOM   118   P  P     . DT  A 1 7   ? 120.218 -16.217 -28.459 1.00 23.08 ? 27   DT  E P     1 
ATOM   119   O  OP1   . DT  A 1 7   ? 118.842 -16.282 -28.970 1.00 22.31 ? 27   DT  E OP1   1 
ATOM   120   O  OP2   . DT  A 1 7   ? 120.666 -15.024 -27.686 1.00 21.71 ? 27   DT  E OP2   1 
ATOM   121   O  "O5'" . DT  A 1 7   ? 120.462 -17.487 -27.522 1.00 18.34 ? 27   DT  E "O5'" 1 
ATOM   122   C  "C5'" . DT  A 1 7   ? 120.056 -18.797 -27.931 1.00 14.56 ? 27   DT  E "C5'" 1 
ATOM   123   C  "C4'" . DT  A 1 7   ? 120.302 -19.789 -26.817 1.00 14.13 ? 27   DT  E "C4'" 1 
ATOM   124   O  "O4'" . DT  A 1 7   ? 121.713 -20.061 -26.685 1.00 11.84 ? 27   DT  E "O4'" 1 
ATOM   125   C  "C3'" . DT  A 1 7   ? 119.889 -19.326 -25.428 1.00 14.31 ? 27   DT  E "C3'" 1 
ATOM   126   O  "O3'" . DT  A 1 7   ? 118.489 -19.411 -25.205 1.00 19.70 ? 27   DT  E "O3'" 1 
ATOM   127   C  "C2'" . DT  A 1 7   ? 120.694 -20.251 -24.538 1.00 11.77 ? 27   DT  E "C2'" 1 
ATOM   128   C  "C1'" . DT  A 1 7   ? 122.002 -20.375 -25.319 1.00 12.94 ? 27   DT  E "C1'" 1 
ATOM   129   N  N1    . DT  A 1 7   ? 123.015 -19.419 -24.818 1.00 13.17 ? 27   DT  E N1    1 
ATOM   130   C  C2    . DT  A 1 7   ? 123.878 -19.868 -23.840 1.00 12.98 ? 27   DT  E C2    1 
ATOM   131   O  O2    . DT  A 1 7   ? 123.861 -21.009 -23.411 1.00 14.34 ? 27   DT  E O2    1 
ATOM   132   N  N3    . DT  A 1 7   ? 124.758 -18.925 -23.376 1.00 12.25 ? 27   DT  E N3    1 
ATOM   133   C  C4    . DT  A 1 7   ? 124.855 -17.606 -23.771 1.00 13.04 ? 27   DT  E C4    1 
ATOM   134   O  O4    . DT  A 1 7   ? 125.689 -16.872 -23.237 1.00 13.22 ? 27   DT  E O4    1 
ATOM   135   C  C5    . DT  A 1 7   ? 123.927 -17.202 -24.812 1.00 12.44 ? 27   DT  E C5    1 
ATOM   136   C  C7    . DT  A 1 7   ? 123.960 -15.791 -25.314 1.00 14.29 ? 27   DT  E C7    1 
ATOM   137   C  C6    . DT  A 1 7   ? 123.073 -18.118 -25.281 1.00 12.73 ? 27   DT  E C6    1 
ATOM   138   P  P     . DC  A 1 8   ? 117.808 -18.438 -24.129 1.00 12.11 ? 28   DC  E P     1 
ATOM   139   O  OP1   . DC  A 1 8   ? 116.340 -18.583 -24.311 1.00 11.65 ? 28   DC  E OP1   1 
ATOM   140   O  OP2   . DC  A 1 8   ? 118.420 -17.090 -24.201 1.00 11.85 ? 28   DC  E OP2   1 
ATOM   141   O  "O5'" . DC  A 1 8   ? 118.200 -19.098 -22.734 1.00 9.51  ? 28   DC  E "O5'" 1 
ATOM   142   C  "C5'" . DC  A 1 8   ? 117.788 -20.437 -22.449 1.00 10.43 ? 28   DC  E "C5'" 1 
ATOM   143   C  "C4'" . DC  A 1 8   ? 118.474 -20.954 -21.207 1.00 8.87  ? 28   DC  E "C4'" 1 
ATOM   144   O  "O4'" . DC  A 1 8   ? 119.899 -21.037 -21.421 1.00 10.04 ? 28   DC  E "O4'" 1 
ATOM   145   C  "C3'" . DC  A 1 8   ? 118.325 -20.123 -19.940 1.00 13.08 ? 28   DC  E "C3'" 1 
ATOM   146   O  "O3'" . DC  A 1 8   ? 117.082 -20.365 -19.287 1.00 15.06 ? 28   DC  E "O3'" 1 
ATOM   147   C  "C2'" . DC  A 1 8   ? 119.495 -20.621 -19.112 1.00 11.07 ? 28   DC  E "C2'" 1 
ATOM   148   C  "C1'" . DC  A 1 8   ? 120.569 -20.878 -20.167 1.00 9.88  ? 28   DC  E "C1'" 1 
ATOM   149   N  N1    . DC  A 1 8   ? 121.506 -19.738 -20.262 1.00 10.20 ? 28   DC  E N1    1 
ATOM   150   C  C2    . DC  A 1 8   ? 122.566 -19.669 -19.340 1.00 10.26 ? 28   DC  E C2    1 
ATOM   151   O  O2    . DC  A 1 8   ? 122.709 -20.591 -18.517 1.00 11.14 ? 28   DC  E O2    1 
ATOM   152   N  N3    . DC  A 1 8   ? 123.400 -18.602 -19.368 1.00 10.15 ? 28   DC  E N3    1 
ATOM   153   C  C4    . DC  A 1 8   ? 123.212 -17.631 -20.266 1.00 10.88 ? 28   DC  E C4    1 
ATOM   154   N  N4    . DC  A 1 8   ? 124.052 -16.584 -20.234 1.00 9.40  ? 28   DC  E N4    1 
ATOM   155   C  C5    . DC  A 1 8   ? 122.158 -17.685 -21.229 1.00 10.19 ? 28   DC  E C5    1 
ATOM   156   C  C6    . DC  A 1 8   ? 121.339 -18.747 -21.193 1.00 10.60 ? 28   DC  E C6    1 
HETATM 157   P  P     . DDG A 1 9   ? 116.595 -19.373 -18.123 1.00 12.54 ? 29   DDG E P     1 
HETATM 158   O  OP1   . DDG A 1 9   ? 115.210 -19.791 -17.771 1.00 12.08 ? 29   DDG E OP1   1 
HETATM 159   O  OP2   . DDG A 1 9   ? 116.861 -17.959 -18.490 1.00 12.45 ? 29   DDG E OP2   1 
HETATM 160   O  "O5'" . DDG A 1 9   ? 117.542 -19.719 -16.889 1.00 10.61 ? 29   DDG E "O5'" 1 
HETATM 161   C  "C5'" . DDG A 1 9   ? 117.614 -21.065 -16.384 1.00 8.47  ? 29   DDG E "C5'" 1 
HETATM 162   C  "C4'" . DDG A 1 9   ? 118.612 -21.146 -15.255 1.00 9.79  ? 29   DDG E "C4'" 1 
HETATM 163   O  "O4'" . DDG A 1 9   ? 119.938 -20.888 -15.764 1.00 9.30  ? 29   DDG E "O4'" 1 
HETATM 164   C  "C3'" . DDG A 1 9   ? 118.394 -20.117 -14.151 1.00 10.11 ? 29   DDG E "C3'" 1 
HETATM 165   C  "C2'" . DDG A 1 9   ? 119.791 -19.937 -13.589 1.00 7.74  ? 29   DDG E "C2'" 1 
HETATM 166   C  "C1'" . DDG A 1 9   ? 120.683 -20.129 -14.813 1.00 9.20  ? 29   DDG E "C1'" 1 
HETATM 167   N  N9    . DDG A 1 9   ? 121.093 -18.879 -15.451 1.00 8.76  ? 29   DDG E N9    1 
HETATM 168   C  C8    . DDG A 1 9   ? 120.535 -18.269 -16.553 1.00 9.05  ? 29   DDG E C8    1 
HETATM 169   N  N7    . DDG A 1 9   ? 121.144 -17.163 -16.888 1.00 8.88  ? 29   DDG E N7    1 
HETATM 170   C  C5    . DDG A 1 9   ? 122.162 -17.034 -15.952 1.00 8.25  ? 29   DDG E C5    1 
HETATM 171   C  C6    . DDG A 1 9   ? 123.168 -16.038 -15.808 1.00 9.28  ? 29   DDG E C6    1 
HETATM 172   O  O6    . DDG A 1 9   ? 123.376 -15.036 -16.517 1.00 9.85  ? 29   DDG E O6    1 
HETATM 173   N  N1    . DDG A 1 9   ? 123.991 -16.297 -14.711 1.00 7.23  ? 29   DDG E N1    1 
HETATM 174   C  C2    . DDG A 1 9   ? 123.868 -17.374 -13.868 1.00 6.39  ? 29   DDG E C2    1 
HETATM 175   N  N2    . DDG A 1 9   ? 124.749 -17.452 -12.855 1.00 4.77  ? 29   DDG E N2    1 
HETATM 176   N  N3    . DDG A 1 9   ? 122.947 -18.309 -14.003 1.00 7.76  ? 29   DDG E N3    1 
HETATM 177   C  C4    . DDG A 1 9   ? 122.136 -18.079 -15.054 1.00 7.37  ? 29   DDG E C4    1 
ATOM   178   O  "O5'" . DT  B 2 3   ? 136.163 -4.303  -17.192 1.00 56.66 ? 2    DT  F "O5'" 1 
ATOM   179   C  "C5'" . DT  B 2 3   ? 136.134 -4.723  -15.826 1.00 53.57 ? 2    DT  F "C5'" 1 
ATOM   180   C  "C4'" . DT  B 2 3   ? 135.004 -4.088  -15.051 1.00 49.40 ? 2    DT  F "C4'" 1 
ATOM   181   O  "O4'" . DT  B 2 3   ? 135.245 -2.667  -14.897 1.00 49.12 ? 2    DT  F "O4'" 1 
ATOM   182   C  "C3'" . DT  B 2 3   ? 133.616 -4.228  -15.681 1.00 48.36 ? 2    DT  F "C3'" 1 
ATOM   183   O  "O3'" . DT  B 2 3   ? 132.652 -4.479  -14.654 1.00 45.94 ? 2    DT  F "O3'" 1 
ATOM   184   C  "C2'" . DT  B 2 3   ? 133.372 -2.860  -16.291 1.00 47.32 ? 2    DT  F "C2'" 1 
ATOM   185   C  "C1'" . DT  B 2 3   ? 134.103 -1.937  -15.330 1.00 48.49 ? 2    DT  F "C1'" 1 
ATOM   186   N  N1    . DT  B 2 3   ? 134.557 -0.655  -15.931 1.00 49.66 ? 2    DT  F N1    1 
ATOM   187   C  C2    . DT  B 2 3   ? 134.572 0.480   -15.139 1.00 50.70 ? 2    DT  F C2    1 
ATOM   188   O  O2    . DT  B 2 3   ? 134.274 0.482   -13.952 1.00 51.21 ? 2    DT  F O2    1 
ATOM   189   N  N3    . DT  B 2 3   ? 134.962 1.626   -15.792 1.00 51.50 ? 2    DT  F N3    1 
ATOM   190   C  C4    . DT  B 2 3   ? 135.349 1.750   -17.115 1.00 51.73 ? 2    DT  F C4    1 
ATOM   191   O  O4    . DT  B 2 3   ? 135.659 2.857   -17.561 1.00 53.81 ? 2    DT  F O4    1 
ATOM   192   C  C5    . DT  B 2 3   ? 135.345 0.517   -17.875 1.00 51.27 ? 2    DT  F C5    1 
ATOM   193   C  C7    . DT  B 2 3   ? 135.812 0.537   -19.297 1.00 51.12 ? 2    DT  F C7    1 
ATOM   194   C  C6    . DT  B 2 3   ? 134.940 -0.601  -17.258 1.00 50.66 ? 2    DT  F C6    1 
HETATM 195   P  P     . 6OG B 2 4   ? 131.083 -4.399  -14.978 1.00 22.89 ? 3    6OG F P     1 
HETATM 196   O  OP1   . 6OG B 2 4   ? 130.816 -4.970  -16.320 1.00 20.48 ? 3    6OG F OP1   1 
HETATM 197   O  OP2   . 6OG B 2 4   ? 130.615 -3.030  -14.658 1.00 21.39 ? 3    6OG F OP2   1 
HETATM 198   O  "O5'" . 6OG B 2 4   ? 130.456 -5.370  -13.888 1.00 20.97 ? 3    6OG F "O5'" 1 
HETATM 199   N  N9    . 6OG B 2 4   ? 127.098 -8.642  -13.216 1.00 13.08 ? 3    6OG F N9    1 
HETATM 200   C  C4    . 6OG B 2 4   ? 126.205 -9.690  -13.259 1.00 13.95 ? 3    6OG F C4    1 
HETATM 201   N  N3    . 6OG B 2 4   ? 126.044 -10.634 -12.313 1.00 12.04 ? 3    6OG F N3    1 
HETATM 202   C  C2    . 6OG B 2 4   ? 125.111 -11.510 -12.645 1.00 11.94 ? 3    6OG F C2    1 
HETATM 203   N  N2    . 6OG B 2 4   ? 124.822 -12.516 -11.809 1.00 12.31 ? 3    6OG F N2    1 
HETATM 204   N  N1    . 6OG B 2 4   ? 124.396 -11.460 -13.817 1.00 12.56 ? 3    6OG F N1    1 
HETATM 205   C  C6    . 6OG B 2 4   ? 124.549 -10.487 -14.809 1.00 15.23 ? 3    6OG F C6    1 
HETATM 206   O  O6    . 6OG B 2 4   ? 123.856 -10.508 -15.850 1.00 16.24 ? 3    6OG F O6    1 
HETATM 207   C  C5    . 6OG B 2 4   ? 125.539 -9.551  -14.459 1.00 14.96 ? 3    6OG F C5    1 
HETATM 208   N  N7    . 6OG B 2 4   ? 125.997 -8.443  -15.152 1.00 16.39 ? 3    6OG F N7    1 
HETATM 209   C  C8    . 6OG B 2 4   ? 126.917 -7.936  -14.381 1.00 14.43 ? 3    6OG F C8    1 
HETATM 210   C  "C2'" . 6OG B 2 4   ? 129.098 -9.425  -11.898 1.00 13.02 ? 3    6OG F "C2'" 1 
HETATM 211   C  "C5'" . 6OG B 2 4   ? 130.697 -6.785  -13.953 1.00 16.51 ? 3    6OG F "C5'" 1 
HETATM 212   C  "C4'" . 6OG B 2 4   ? 130.159 -7.467  -12.719 1.00 14.19 ? 3    6OG F "C4'" 1 
HETATM 213   O  "O4'" . 6OG B 2 4   ? 128.755 -7.163  -12.553 1.00 12.92 ? 3    6OG F "O4'" 1 
HETATM 214   C  "C1'" . 6OG B 2 4   ? 128.049 -8.333  -12.152 1.00 12.20 ? 3    6OG F "C1'" 1 
HETATM 215   C  "C3'" . 6OG B 2 4   ? 130.259 -8.989  -12.780 1.00 14.48 ? 3    6OG F "C3'" 1 
HETATM 216   O  "O3'" . 6OG B 2 4   ? 131.525 -9.372  -12.240 1.00 19.02 ? 3    6OG F "O3'" 1 
HETATM 217   C  C     . 6OG B 2 4   ? 122.940 -11.598 -16.052 1.00 17.03 ? 3    6OG F C     1 
ATOM   218   P  P     . DC  B 2 5   ? 132.388 -10.541 -12.930 1.00 14.36 ? 4    DC  F P     1 
ATOM   219   O  OP1   . DC  B 2 5   ? 133.732 -10.470 -12.304 1.00 15.09 ? 4    DC  F OP1   1 
ATOM   220   O  OP2   . DC  B 2 5   ? 132.253 -10.455 -14.405 1.00 13.16 ? 4    DC  F OP2   1 
ATOM   221   O  "O5'" . DC  B 2 5   ? 131.689 -11.872 -12.415 1.00 13.39 ? 4    DC  F "O5'" 1 
ATOM   222   C  "C5'" . DC  B 2 5   ? 131.528 -12.091 -11.010 1.00 11.63 ? 4    DC  F "C5'" 1 
ATOM   223   C  "C4'" . DC  B 2 5   ? 130.579 -13.236 -10.756 1.00 11.91 ? 4    DC  F "C4'" 1 
ATOM   224   O  "O4'" . DC  B 2 5   ? 129.251 -12.863 -11.163 1.00 13.74 ? 4    DC  F "O4'" 1 
ATOM   225   C  "C3'" . DC  B 2 5   ? 130.871 -14.531 -11.507 1.00 14.56 ? 4    DC  F "C3'" 1 
ATOM   226   O  "O3'" . DC  B 2 5   ? 131.838 -15.312 -10.806 1.00 18.47 ? 4    DC  F "O3'" 1 
ATOM   227   C  "C2'" . DC  B 2 5   ? 129.515 -15.212 -11.499 1.00 13.43 ? 4    DC  F "C2'" 1 
ATOM   228   C  "C1'" . DC  B 2 5   ? 128.531 -14.041 -11.520 1.00 12.42 ? 4    DC  F "C1'" 1 
ATOM   229   N  N1    . DC  B 2 5   ? 127.866 -13.827 -12.822 1.00 13.36 ? 4    DC  F N1    1 
ATOM   230   C  C2    . DC  B 2 5   ? 126.768 -14.636 -13.131 1.00 12.12 ? 4    DC  F C2    1 
ATOM   231   O  O2    . DC  B 2 5   ? 126.399 -15.482 -12.303 1.00 13.74 ? 4    DC  F O2    1 
ATOM   232   N  N3    . DC  B 2 5   ? 126.144 -14.482 -14.314 1.00 12.99 ? 4    DC  F N3    1 
ATOM   233   C  C4    . DC  B 2 5   ? 126.574 -13.565 -15.181 1.00 13.01 ? 4    DC  F C4    1 
ATOM   234   N  N4    . DC  B 2 5   ? 125.925 -13.460 -16.344 1.00 10.81 ? 4    DC  F N4    1 
ATOM   235   C  C5    . DC  B 2 5   ? 127.688 -12.719 -14.895 1.00 11.54 ? 4    DC  F C5    1 
ATOM   236   C  C6    . DC  B 2 5   ? 128.300 -12.884 -13.713 1.00 10.65 ? 4    DC  F C6    1 
ATOM   237   P  P     . DG  B 2 6   ? 132.673 -16.441 -11.585 1.00 11.99 ? 5    DG  F P     1 
ATOM   238   O  OP1   . DG  B 2 6   ? 133.578 -17.049 -10.589 1.00 9.42  ? 5    DG  F OP1   1 
ATOM   239   O  OP2   . DG  B 2 6   ? 133.239 -15.866 -12.833 1.00 10.29 ? 5    DG  F OP2   1 
ATOM   240   O  "O5'" . DG  B 2 6   ? 131.576 -17.527 -11.982 1.00 8.70  ? 5    DG  F "O5'" 1 
ATOM   241   C  "C5'" . DG  B 2 6   ? 130.909 -18.281 -10.960 1.00 9.50  ? 5    DG  F "C5'" 1 
ATOM   242   C  "C4'" . DG  B 2 6   ? 129.946 -19.268 -11.578 1.00 10.22 ? 5    DG  F "C4'" 1 
ATOM   243   O  "O4'" . DG  B 2 6   ? 128.767 -18.588 -12.054 1.00 9.63  ? 5    DG  F "O4'" 1 
ATOM   244   C  "C3'" . DG  B 2 6   ? 130.461 -20.039 -12.784 1.00 11.11 ? 5    DG  F "C3'" 1 
ATOM   245   O  "O3'" . DG  B 2 6   ? 131.292 -21.124 -12.369 1.00 16.22 ? 5    DG  F "O3'" 1 
ATOM   246   C  "C2'" . DG  B 2 6   ? 129.168 -20.489 -13.442 1.00 9.55  ? 5    DG  F "C2'" 1 
ATOM   247   C  "C1'" . DG  B 2 6   ? 128.201 -19.348 -13.123 1.00 10.15 ? 5    DG  F "C1'" 1 
ATOM   248   N  N9    . DG  B 2 6   ? 127.941 -18.454 -14.252 1.00 8.39  ? 5    DG  F N9    1 
ATOM   249   C  C8    . DG  B 2 6   ? 128.587 -17.285 -14.588 1.00 9.18  ? 5    DG  F C8    1 
ATOM   250   N  N7    . DG  B 2 6   ? 128.116 -16.735 -15.678 1.00 8.55  ? 5    DG  F N7    1 
ATOM   251   C  C5    . DG  B 2 6   ? 127.101 -17.587 -16.078 1.00 8.49  ? 5    DG  F C5    1 
ATOM   252   C  C6    . DG  B 2 6   ? 126.229 -17.515 -17.189 1.00 8.67  ? 5    DG  F C6    1 
ATOM   253   O  O6    . DG  B 2 6   ? 126.178 -16.648 -18.072 1.00 8.99  ? 5    DG  F O6    1 
ATOM   254   N  N1    . DG  B 2 6   ? 125.351 -18.595 -17.216 1.00 8.13  ? 5    DG  F N1    1 
ATOM   255   C  C2    . DG  B 2 6   ? 125.320 -19.611 -16.292 1.00 8.74  ? 5    DG  F C2    1 
ATOM   256   N  N2    . DG  B 2 6   ? 124.409 -20.571 -16.480 1.00 10.07 ? 5    DG  F N2    1 
ATOM   257   N  N3    . DG  B 2 6   ? 126.126 -19.685 -15.255 1.00 9.24  ? 5    DG  F N3    1 
ATOM   258   C  C4    . DG  B 2 6   ? 126.982 -18.650 -15.208 1.00 9.58  ? 5    DG  F C4    1 
ATOM   259   P  P     . DA  B 2 7   ? 132.084 -21.980 -13.468 1.00 11.17 ? 6    DA  F P     1 
ATOM   260   O  OP1   . DA  B 2 7   ? 132.938 -22.950 -12.740 1.00 10.13 ? 6    DA  F OP1   1 
ATOM   261   O  OP2   . DA  B 2 7   ? 132.713 -21.036 -14.440 1.00 6.80  ? 6    DA  F OP2   1 
ATOM   262   O  "O5'" . DA  B 2 7   ? 130.907 -22.773 -14.186 1.00 8.18  ? 6    DA  F "O5'" 1 
ATOM   263   C  "C5'" . DA  B 2 7   ? 131.001 -23.152 -15.563 1.00 9.35  ? 6    DA  F "C5'" 1 
ATOM   264   C  "C4'" . DA  B 2 7   ? 129.644 -23.570 -16.068 1.00 10.53 ? 6    DA  F "C4'" 1 
ATOM   265   O  "O4'" . DA  B 2 7   ? 128.746 -22.440 -16.097 1.00 10.03 ? 6    DA  F "O4'" 1 
ATOM   266   C  "C3'" . DA  B 2 7   ? 129.674 -24.109 -17.487 1.00 10.89 ? 6    DA  F "C3'" 1 
ATOM   267   O  "O3'" . DA  B 2 7   ? 129.906 -25.516 -17.405 1.00 12.06 ? 6    DA  F "O3'" 1 
ATOM   268   C  "C2'" . DA  B 2 7   ? 128.277 -23.800 -17.992 1.00 9.80  ? 6    DA  F "C2'" 1 
ATOM   269   C  "C1'" . DA  B 2 7   ? 127.903 -22.521 -17.237 1.00 8.41  ? 6    DA  F "C1'" 1 
ATOM   270   N  N9    . DA  B 2 7   ? 128.042 -21.273 -17.996 1.00 9.70  ? 6    DA  F N9    1 
ATOM   271   C  C8    . DA  B 2 7   ? 128.901 -20.217 -17.770 1.00 10.11 ? 6    DA  F C8    1 
ATOM   272   N  N7    . DA  B 2 7   ? 128.777 -19.240 -18.637 1.00 7.92  ? 6    DA  F N7    1 
ATOM   273   C  C5    . DA  B 2 7   ? 127.773 -19.676 -19.489 1.00 9.86  ? 6    DA  F C5    1 
ATOM   274   C  C6    . DA  B 2 7   ? 127.181 -19.095 -20.620 1.00 9.58  ? 6    DA  F C6    1 
ATOM   275   N  N6    . DA  B 2 7   ? 127.518 -17.889 -21.096 1.00 9.39  ? 6    DA  F N6    1 
ATOM   276   N  N1    . DA  B 2 7   ? 126.215 -19.793 -21.251 1.00 10.90 ? 6    DA  F N1    1 
ATOM   277   C  C2    . DA  B 2 7   ? 125.866 -20.993 -20.766 1.00 11.07 ? 6    DA  F C2    1 
ATOM   278   N  N3    . DA  B 2 7   ? 126.344 -21.645 -19.707 1.00 8.57  ? 6    DA  F N3    1 
ATOM   279   C  C4    . DA  B 2 7   ? 127.309 -20.925 -19.106 1.00 10.56 ? 6    DA  F C4    1 
ATOM   280   P  P     . DG  B 2 8   ? 130.629 -26.297 -18.613 1.00 12.71 ? 7    DG  F P     1 
ATOM   281   O  OP1   . DG  B 2 8   ? 130.655 -27.718 -18.169 1.00 11.06 ? 7    DG  F OP1   1 
ATOM   282   O  OP2   . DG  B 2 8   ? 131.887 -25.631 -19.016 1.00 11.43 ? 7    DG  F OP2   1 
ATOM   283   O  "O5'" . DG  B 2 8   ? 129.616 -26.163 -19.828 1.00 10.29 ? 7    DG  F "O5'" 1 
ATOM   284   C  "C5'" . DG  B 2 8   ? 128.348 -26.822 -19.795 1.00 10.54 ? 7    DG  F "C5'" 1 
ATOM   285   C  "C4'" . DG  B 2 8   ? 127.786 -26.918 -21.193 1.00 12.34 ? 7    DG  F "C4'" 1 
ATOM   286   O  "O4'" . DG  B 2 8   ? 127.415 -25.593 -21.651 1.00 12.49 ? 7    DG  F "O4'" 1 
ATOM   287   C  "C3'" . DG  B 2 8   ? 128.731 -27.501 -22.251 1.00 13.87 ? 7    DG  F "C3'" 1 
ATOM   288   O  "O3'" . DG  B 2 8   ? 127.965 -28.351 -23.109 1.00 15.53 ? 7    DG  F "O3'" 1 
ATOM   289   C  "C2'" . DG  B 2 8   ? 129.231 -26.267 -22.989 1.00 13.10 ? 7    DG  F "C2'" 1 
ATOM   290   C  "C1'" . DG  B 2 8   ? 128.057 -25.302 -22.884 1.00 12.07 ? 7    DG  F "C1'" 1 
ATOM   291   N  N9    . DG  B 2 8   ? 128.411 -23.880 -22.878 1.00 12.12 ? 7    DG  F N9    1 
ATOM   292   C  C8    . DG  B 2 8   ? 129.313 -23.251 -22.050 1.00 11.89 ? 7    DG  F C8    1 
ATOM   293   N  N7    . DG  B 2 8   ? 129.401 -21.966 -22.270 1.00 11.74 ? 7    DG  F N7    1 
ATOM   294   C  C5    . DG  B 2 8   ? 128.510 -21.732 -23.309 1.00 10.70 ? 7    DG  F C5    1 
ATOM   295   C  C6    . DG  B 2 8   ? 128.172 -20.522 -23.973 1.00 11.18 ? 7    DG  F C6    1 
ATOM   296   O  O6    . DG  B 2 8   ? 128.622 -19.386 -23.776 1.00 12.59 ? 7    DG  F O6    1 
ATOM   297   N  N1    . DG  B 2 8   ? 127.208 -20.728 -24.957 1.00 10.55 ? 7    DG  F N1    1 
ATOM   298   C  C2    . DG  B 2 8   ? 126.644 -21.947 -25.264 1.00 10.59 ? 7    DG  F C2    1 
ATOM   299   N  N2    . DG  B 2 8   ? 125.717 -21.946 -26.232 1.00 9.78  ? 7    DG  F N2    1 
ATOM   300   N  N3    . DG  B 2 8   ? 126.962 -23.082 -24.659 1.00 10.85 ? 7    DG  F N3    1 
ATOM   301   C  C4    . DG  B 2 8   ? 127.892 -22.902 -23.698 1.00 10.14 ? 7    DG  F C4    1 
ATOM   302   P  P     . DT  B 2 9   ? 128.666 -29.162 -24.311 1.00 14.68 ? 8    DT  F P     1 
ATOM   303   O  OP1   . DT  B 2 9   ? 127.964 -30.463 -24.359 1.00 15.08 ? 8    DT  F OP1   1 
ATOM   304   O  OP2   . DT  B 2 9   ? 130.148 -29.132 -24.219 1.00 12.27 ? 8    DT  F OP2   1 
ATOM   305   O  "O5'" . DT  B 2 9   ? 128.221 -28.344 -25.601 1.00 13.73 ? 8    DT  F "O5'" 1 
ATOM   306   C  "C5'" . DT  B 2 9   ? 126.826 -28.151 -25.888 1.00 15.18 ? 8    DT  F "C5'" 1 
ATOM   307   C  "C4'" . DT  B 2 9   ? 126.647 -27.470 -27.224 1.00 15.91 ? 8    DT  F "C4'" 1 
ATOM   308   O  "O4'" . DT  B 2 9   ? 126.995 -26.070 -27.118 1.00 16.47 ? 8    DT  F "O4'" 1 
ATOM   309   C  "C3'" . DT  B 2 9   ? 127.489 -28.046 -28.362 1.00 16.57 ? 8    DT  F "C3'" 1 
ATOM   310   O  "O3'" . DT  B 2 9   ? 126.694 -28.067 -29.549 1.00 18.85 ? 8    DT  F "O3'" 1 
ATOM   311   C  "C2'" . DT  B 2 9   ? 128.637 -27.050 -28.482 1.00 15.83 ? 8    DT  F "C2'" 1 
ATOM   312   C  "C1'" . DT  B 2 9   ? 127.968 -25.737 -28.093 1.00 13.42 ? 8    DT  F "C1'" 1 
ATOM   313   N  N1    . DT  B 2 9   ? 128.812 -24.672 -27.517 1.00 12.45 ? 8    DT  F N1    1 
ATOM   314   C  C2    . DT  B 2 9   ? 128.602 -23.376 -27.954 1.00 11.43 ? 8    DT  F C2    1 
ATOM   315   O  O2    . DT  B 2 9   ? 127.800 -23.083 -28.831 1.00 12.55 ? 8    DT  F O2    1 
ATOM   316   N  N3    . DT  B 2 9   ? 129.367 -22.433 -27.325 1.00 12.32 ? 8    DT  F N3    1 
ATOM   317   C  C4    . DT  B 2 9   ? 130.312 -22.645 -26.334 1.00 11.86 ? 8    DT  F C4    1 
ATOM   318   O  O4    . DT  B 2 9   ? 130.901 -21.686 -25.842 1.00 14.13 ? 8    DT  F O4    1 
ATOM   319   C  C5    . DT  B 2 9   ? 130.509 -24.030 -25.954 1.00 12.42 ? 8    DT  F C5    1 
ATOM   320   C  C7    . DT  B 2 9   ? 131.530 -24.362 -24.909 1.00 11.89 ? 8    DT  F C7    1 
ATOM   321   C  C6    . DT  B 2 9   ? 129.760 -24.959 -26.557 1.00 12.00 ? 8    DT  F C6    1 
ATOM   322   P  P     . DC  B 2 10  ? 127.127 -28.980 -30.803 1.00 16.64 ? 9    DC  F P     1 
ATOM   323   O  OP1   . DC  B 2 10  ? 125.923 -29.735 -31.216 1.00 15.45 ? 9    DC  F OP1   1 
ATOM   324   O  OP2   . DC  B 2 10  ? 128.381 -29.702 -30.506 1.00 16.43 ? 9    DC  F OP2   1 
ATOM   325   O  "O5'" . DC  B 2 10  ? 127.391 -27.896 -31.942 1.00 17.63 ? 9    DC  F "O5'" 1 
ATOM   326   C  "C5'" . DC  B 2 10  ? 126.331 -27.012 -32.355 1.00 17.99 ? 9    DC  F "C5'" 1 
ATOM   327   C  "C4'" . DC  B 2 10  ? 126.894 -25.720 -32.902 1.00 20.31 ? 9    DC  F "C4'" 1 
ATOM   328   O  "O4'" . DC  B 2 10  ? 127.556 -24.977 -31.865 1.00 22.05 ? 9    DC  F "O4'" 1 
ATOM   329   C  "C3'" . DC  B 2 10  ? 127.936 -25.897 -34.000 1.00 22.61 ? 9    DC  F "C3'" 1 
ATOM   330   O  "O3'" . DC  B 2 10  ? 127.256 -25.891 -35.251 1.00 25.83 ? 9    DC  F "O3'" 1 
ATOM   331   C  "C2'" . DC  B 2 10  ? 128.778 -24.638 -33.886 1.00 24.30 ? 9    DC  F "C2'" 1 
ATOM   332   C  "C1'" . DC  B 2 10  ? 128.526 -24.139 -32.470 1.00 21.88 ? 9    DC  F "C1'" 1 
ATOM   333   N  N1    . DC  B 2 10  ? 129.668 -24.008 -31.553 1.00 21.62 ? 9    DC  F N1    1 
ATOM   334   C  C2    . DC  B 2 10  ? 130.182 -22.731 -31.338 1.00 19.11 ? 9    DC  F C2    1 
ATOM   335   O  O2    . DC  B 2 10  ? 129.712 -21.782 -31.988 1.00 19.60 ? 9    DC  F O2    1 
ATOM   336   N  N3    . DC  B 2 10  ? 131.170 -22.561 -30.441 1.00 16.62 ? 9    DC  F N3    1 
ATOM   337   C  C4    . DC  B 2 10  ? 131.659 -23.612 -29.782 1.00 17.83 ? 9    DC  F C4    1 
ATOM   338   N  N4    . DC  B 2 10  ? 132.603 -23.385 -28.867 1.00 16.95 ? 9    DC  F N4    1 
ATOM   339   C  C5    . DC  B 2 10  ? 131.191 -24.936 -30.021 1.00 17.05 ? 9    DC  F C5    1 
ATOM   340   C  C6    . DC  B 2 10  ? 130.202 -25.087 -30.907 1.00 18.26 ? 9    DC  F C6    1 
ATOM   341   P  P     . DA  B 2 11  ? 128.062 -26.188 -36.608 1.00 23.35 ? 10   DA  F P     1 
ATOM   342   O  OP1   . DA  B 2 11  ? 127.027 -26.645 -37.563 1.00 23.35 ? 10   DA  F OP1   1 
ATOM   343   O  OP2   . DA  B 2 11  ? 129.235 -27.046 -36.326 1.00 25.00 ? 10   DA  F OP2   1 
ATOM   344   O  "O5'" . DA  B 2 11  ? 128.581 -24.759 -37.064 1.00 23.98 ? 10   DA  F "O5'" 1 
ATOM   345   C  "C5'" . DA  B 2 11  ? 127.646 -23.720 -37.407 1.00 20.83 ? 10   DA  F "C5'" 1 
ATOM   346   C  "C4'" . DA  B 2 11  ? 128.387 -22.496 -37.891 1.00 21.47 ? 10   DA  F "C4'" 1 
ATOM   347   O  "O4'" . DA  B 2 11  ? 129.236 -22.026 -36.820 1.00 19.72 ? 10   DA  F "O4'" 1 
ATOM   348   C  "C3'" . DA  B 2 11  ? 129.299 -22.726 -39.097 1.00 20.42 ? 10   DA  F "C3'" 1 
ATOM   349   O  "O3'" . DA  B 2 11  ? 129.255 -21.568 -39.939 1.00 23.32 ? 10   DA  F "O3'" 1 
ATOM   350   C  "C2'" . DA  B 2 11  ? 130.673 -22.896 -38.471 1.00 19.79 ? 10   DA  F "C2'" 1 
ATOM   351   C  "C1'" . DA  B 2 11  ? 130.601 -22.041 -37.211 1.00 19.52 ? 10   DA  F "C1'" 1 
ATOM   352   N  N9    . DA  B 2 11  ? 131.357 -22.592 -36.085 1.00 18.43 ? 10   DA  F N9    1 
ATOM   353   C  C8    . DA  B 2 11  ? 131.377 -23.905 -35.681 1.00 19.26 ? 10   DA  F C8    1 
ATOM   354   N  N7    . DA  B 2 11  ? 132.106 -24.123 -34.621 1.00 18.05 ? 10   DA  F N7    1 
ATOM   355   C  C5    . DA  B 2 11  ? 132.613 -22.871 -34.301 1.00 16.55 ? 10   DA  F C5    1 
ATOM   356   C  C6    . DA  B 2 11  ? 133.444 -22.432 -33.259 1.00 15.40 ? 10   DA  F C6    1 
ATOM   357   N  N6    . DA  B 2 11  ? 133.932 -23.243 -32.314 1.00 13.54 ? 10   DA  F N6    1 
ATOM   358   N  N1    . DA  B 2 11  ? 133.759 -21.121 -33.214 1.00 13.99 ? 10   DA  F N1    1 
ATOM   359   C  C2    . DA  B 2 11  ? 133.265 -20.313 -34.161 1.00 15.41 ? 10   DA  F C2    1 
ATOM   360   N  N3    . DA  B 2 11  ? 132.467 -20.607 -35.192 1.00 18.05 ? 10   DA  F N3    1 
ATOM   361   C  C4    . DA  B 2 11  ? 132.172 -21.919 -35.203 1.00 18.15 ? 10   DA  F C4    1 
ATOM   362   P  P     . DG  B 2 12  ? 130.191 -21.473 -41.248 1.00 28.18 ? 11   DG  F P     1 
ATOM   363   O  OP1   . DG  B 2 12  ? 129.470 -20.627 -42.231 1.00 27.55 ? 11   DG  F OP1   1 
ATOM   364   O  OP2   . DG  B 2 12  ? 130.620 -22.841 -41.629 1.00 29.08 ? 11   DG  F OP2   1 
ATOM   365   O  "O5'" . DG  B 2 12  ? 131.459 -20.658 -40.739 1.00 26.49 ? 11   DG  F "O5'" 1 
ATOM   366   C  "C5'" . DG  B 2 12  ? 131.285 -19.337 -40.205 1.00 25.60 ? 11   DG  F "C5'" 1 
ATOM   367   C  "C4'" . DG  B 2 12  ? 132.620 -18.714 -39.871 1.00 25.31 ? 11   DG  F "C4'" 1 
ATOM   368   O  "O4'" . DG  B 2 12  ? 133.175 -19.316 -38.683 1.00 24.40 ? 11   DG  F "O4'" 1 
ATOM   369   C  "C3'" . DG  B 2 12  ? 133.696 -18.805 -40.953 1.00 26.93 ? 11   DG  F "C3'" 1 
ATOM   370   O  "O3'" . DG  B 2 12  ? 134.372 -17.553 -40.996 1.00 30.78 ? 11   DG  F "O3'" 1 
ATOM   371   C  "C2'" . DG  B 2 12  ? 134.616 -19.900 -40.440 1.00 25.62 ? 11   DG  F "C2'" 1 
ATOM   372   C  "C1'" . DG  B 2 12  ? 134.503 -19.752 -38.929 1.00 24.25 ? 11   DG  F "C1'" 1 
ATOM   373   N  N9    . DG  B 2 12  ? 134.716 -20.974 -38.153 1.00 22.63 ? 11   DG  F N9    1 
ATOM   374   C  C8    . DG  B 2 12  ? 134.207 -22.225 -38.411 1.00 21.17 ? 11   DG  F C8    1 
ATOM   375   N  N7    . DG  B 2 12  ? 134.557 -23.114 -37.526 1.00 21.88 ? 11   DG  F N7    1 
ATOM   376   C  C5    . DG  B 2 12  ? 135.351 -22.412 -36.628 1.00 21.77 ? 11   DG  F C5    1 
ATOM   377   C  C6    . DG  B 2 12  ? 136.005 -22.847 -35.449 1.00 20.84 ? 11   DG  F C6    1 
ATOM   378   O  O6    . DG  B 2 12  ? 136.024 -23.979 -34.954 1.00 22.73 ? 11   DG  F O6    1 
ATOM   379   N  N1    . DG  B 2 12  ? 136.690 -21.808 -34.830 1.00 20.71 ? 11   DG  F N1    1 
ATOM   380   C  C2    . DG  B 2 12  ? 136.742 -20.516 -35.287 1.00 18.79 ? 11   DG  F C2    1 
ATOM   381   N  N2    . DG  B 2 12  ? 137.448 -19.660 -34.547 1.00 20.46 ? 11   DG  F N2    1 
ATOM   382   N  N3    . DG  B 2 12  ? 136.140 -20.099 -36.389 1.00 20.61 ? 11   DG  F N3    1 
ATOM   383   C  C4    . DG  B 2 12  ? 135.465 -21.093 -37.003 1.00 20.82 ? 11   DG  F C4    1 
ATOM   384   P  P     . DG  B 2 13  ? 135.504 -17.273 -42.097 1.00 30.05 ? 12   DG  F P     1 
ATOM   385   O  OP1   . DG  B 2 13  ? 135.366 -15.848 -42.489 1.00 30.25 ? 12   DG  F OP1   1 
ATOM   386   O  OP2   . DG  B 2 13  ? 135.436 -18.327 -43.135 1.00 30.18 ? 12   DG  F OP2   1 
ATOM   387   O  "O5'" . DG  B 2 13  ? 136.854 -17.429 -41.272 1.00 28.98 ? 12   DG  F "O5'" 1 
ATOM   388   C  "C5'" . DG  B 2 13  ? 137.135 -16.529 -40.185 1.00 32.43 ? 12   DG  F "C5'" 1 
ATOM   389   C  "C4'" . DG  B 2 13  ? 138.468 -16.847 -39.549 1.00 34.31 ? 12   DG  F "C4'" 1 
ATOM   390   O  "O4'" . DG  B 2 13  ? 138.371 -18.062 -38.767 1.00 34.45 ? 12   DG  F "O4'" 1 
ATOM   391   C  "C3'" . DG  B 2 13  ? 139.633 -17.042 -40.523 1.00 35.08 ? 12   DG  F "C3'" 1 
ATOM   392   O  "O3'" . DG  B 2 13  ? 140.846 -16.433 -40.029 1.00 38.28 ? 12   DG  F "O3'" 1 
ATOM   393   C  "C2'" . DG  B 2 13  ? 139.812 -18.551 -40.557 1.00 34.49 ? 12   DG  F "C2'" 1 
ATOM   394   C  "C1'" . DG  B 2 13  ? 139.400 -18.959 -39.148 1.00 32.90 ? 12   DG  F "C1'" 1 
ATOM   395   N  N9    . DG  B 2 13  ? 138.902 -20.327 -38.992 1.00 29.79 ? 12   DG  F N9    1 
ATOM   396   C  C8    . DG  B 2 13  ? 138.145 -21.054 -39.880 1.00 27.97 ? 12   DG  F C8    1 
ATOM   397   N  N7    . DG  B 2 13  ? 137.904 -22.271 -39.473 1.00 28.50 ? 12   DG  F N7    1 
ATOM   398   C  C5    . DG  B 2 13  ? 138.529 -22.350 -38.237 1.00 26.65 ? 12   DG  F C5    1 
ATOM   399   C  C6    . DG  B 2 13  ? 138.624 -23.432 -37.320 1.00 26.37 ? 12   DG  F C6    1 
ATOM   400   O  O6    . DG  B 2 13  ? 138.161 -24.573 -37.420 1.00 26.40 ? 12   DG  F O6    1 
ATOM   401   N  N1    . DG  B 2 13  ? 139.350 -23.080 -36.188 1.00 25.27 ? 12   DG  F N1    1 
ATOM   402   C  C2    . DG  B 2 13  ? 139.909 -21.851 -35.961 1.00 25.21 ? 12   DG  F C2    1 
ATOM   403   N  N2    . DG  B 2 13  ? 140.556 -21.707 -34.796 1.00 24.25 ? 12   DG  F N2    1 
ATOM   404   N  N3    . DG  B 2 13  ? 139.836 -20.837 -36.808 1.00 27.08 ? 12   DG  F N3    1 
ATOM   405   C  C4    . DG  B 2 13  ? 139.137 -21.156 -37.918 1.00 27.15 ? 12   DG  F C4    1 
ATOM   406   O  "O5'" . DC  C 1 1   ? 97.633  -38.737 30.407  1.00 62.50 ? 21   DC  B "O5'" 1 
ATOM   407   C  "C5'" . DC  C 1 1   ? 98.645  -37.759 30.662  1.00 62.61 ? 21   DC  B "C5'" 1 
ATOM   408   C  "C4'" . DC  C 1 1   ? 98.053  -36.389 30.891  1.00 62.77 ? 21   DC  B "C4'" 1 
ATOM   409   O  "O4'" . DC  C 1 1   ? 97.170  -36.422 32.033  1.00 63.01 ? 21   DC  B "O4'" 1 
ATOM   410   C  "C3'" . DC  C 1 1   ? 99.066  -35.291 31.199  1.00 62.38 ? 21   DC  B "C3'" 1 
ATOM   411   O  "O3'" . DC  C 1 1   ? 99.531  -34.704 29.978  1.00 61.06 ? 21   DC  B "O3'" 1 
ATOM   412   C  "C2'" . DC  C 1 1   ? 98.253  -34.305 32.016  1.00 63.17 ? 21   DC  B "C2'" 1 
ATOM   413   C  "C1'" . DC  C 1 1   ? 97.246  -35.191 32.745  1.00 63.49 ? 21   DC  B "C1'" 1 
ATOM   414   N  N1    . DC  C 1 1   ? 97.570  -35.492 34.154  1.00 64.41 ? 21   DC  B N1    1 
ATOM   415   C  C2    . DC  C 1 1   ? 97.051  -34.659 35.155  1.00 65.16 ? 21   DC  B C2    1 
ATOM   416   O  O2    . DC  C 1 1   ? 96.351  -33.687 34.828  1.00 66.13 ? 21   DC  B O2    1 
ATOM   417   N  N3    . DC  C 1 1   ? 97.325  -34.932 36.451  1.00 65.17 ? 21   DC  B N3    1 
ATOM   418   C  C4    . DC  C 1 1   ? 98.086  -35.983 36.765  1.00 65.38 ? 21   DC  B C4    1 
ATOM   419   N  N4    . DC  C 1 1   ? 98.323  -36.217 38.058  1.00 65.74 ? 21   DC  B N4    1 
ATOM   420   C  C5    . DC  C 1 1   ? 98.636  -36.841 35.768  1.00 65.08 ? 21   DC  B C5    1 
ATOM   421   C  C6    . DC  C 1 1   ? 98.355  -36.562 34.488  1.00 64.41 ? 21   DC  B C6    1 
ATOM   422   P  P     . DC  C 1 2   ? 100.911 -33.877 29.957  1.00 60.39 ? 22   DC  B P     1 
ATOM   423   O  OP1   . DC  C 1 2   ? 101.292 -33.666 28.539  1.00 61.18 ? 22   DC  B OP1   1 
ATOM   424   O  OP2   . DC  C 1 2   ? 101.865 -34.548 30.881  1.00 61.31 ? 22   DC  B OP2   1 
ATOM   425   O  "O5'" . DC  C 1 2   ? 100.529 -32.462 30.584  1.00 58.88 ? 22   DC  B "O5'" 1 
ATOM   426   C  "C5'" . DC  C 1 2   ? 99.474  -31.668 30.019  1.00 55.25 ? 22   DC  B "C5'" 1 
ATOM   427   C  "C4'" . DC  C 1 2   ? 99.034  -30.602 30.996  1.00 52.54 ? 22   DC  B "C4'" 1 
ATOM   428   O  "O4'" . DC  C 1 2   ? 98.569  -31.207 32.219  1.00 52.03 ? 22   DC  B "O4'" 1 
ATOM   429   C  "C3'" . DC  C 1 2   ? 100.117 -29.614 31.417  1.00 51.10 ? 22   DC  B "C3'" 1 
ATOM   430   O  "O3'" . DC  C 1 2   ? 100.116 -28.534 30.469  1.00 48.43 ? 22   DC  B "O3'" 1 
ATOM   431   C  "C2'" . DC  C 1 2   ? 99.651  -29.169 32.793  1.00 51.30 ? 22   DC  B "C2'" 1 
ATOM   432   C  "C1'" . DC  C 1 2   ? 98.868  -30.363 33.326  1.00 50.54 ? 22   DC  B "C1'" 1 
ATOM   433   N  N1    . DC  C 1 2   ? 99.499  -31.185 34.381  1.00 49.07 ? 22   DC  B N1    1 
ATOM   434   C  C2    . DC  C 1 2   ? 99.362  -30.788 35.722  1.00 48.26 ? 22   DC  B C2    1 
ATOM   435   O  O2    . DC  C 1 2   ? 98.781  -29.721 35.982  1.00 45.30 ? 22   DC  B O2    1 
ATOM   436   N  N3    . DC  C 1 2   ? 99.871  -31.575 36.699  1.00 47.52 ? 22   DC  B N3    1 
ATOM   437   C  C4    . DC  C 1 2   ? 100.513 -32.702 36.382  1.00 48.66 ? 22   DC  B C4    1 
ATOM   438   N  N4    . DC  C 1 2   ? 100.970 -33.464 37.380  1.00 48.51 ? 22   DC  B N4    1 
ATOM   439   C  C5    . DC  C 1 2   ? 100.707 -33.105 35.029  1.00 48.33 ? 22   DC  B C5    1 
ATOM   440   C  C6    . DC  C 1 2   ? 100.188 -32.326 34.070  1.00 49.14 ? 22   DC  B C6    1 
ATOM   441   P  P     . DT  C 1 3   ? 101.046 -27.244 30.702  1.00 43.84 ? 23   DT  B P     1 
ATOM   442   O  OP1   . DT  C 1 3   ? 100.640 -26.221 29.706  1.00 45.66 ? 23   DT  B OP1   1 
ATOM   443   O  OP2   . DT  C 1 3   ? 102.467 -27.658 30.789  1.00 44.90 ? 23   DT  B OP2   1 
ATOM   444   O  "O5'" . DT  C 1 3   ? 100.593 -26.706 32.123  1.00 41.77 ? 23   DT  B "O5'" 1 
ATOM   445   C  "C5'" . DT  C 1 3   ? 101.473 -25.901 32.877  1.00 35.51 ? 23   DT  B "C5'" 1 
ATOM   446   C  "C4'" . DT  C 1 3   ? 100.783 -25.361 34.103  1.00 31.12 ? 23   DT  B "C4'" 1 
ATOM   447   O  "O4'" . DT  C 1 3   ? 100.480 -26.434 35.030  1.00 28.27 ? 23   DT  B "O4'" 1 
ATOM   448   C  "C3'" . DT  C 1 3   ? 101.732 -24.431 34.835  1.00 27.66 ? 23   DT  B "C3'" 1 
ATOM   449   O  "O3'" . DT  C 1 3   ? 101.051 -23.289 35.327  1.00 26.15 ? 23   DT  B "O3'" 1 
ATOM   450   C  "C2'" . DT  C 1 3   ? 102.320 -25.283 35.943  1.00 26.20 ? 23   DT  B "C2'" 1 
ATOM   451   C  "C1'" . DT  C 1 3   ? 101.230 -26.299 36.234  1.00 25.70 ? 23   DT  B "C1'" 1 
ATOM   452   N  N1    . DT  C 1 3   ? 101.760 -27.639 36.589  1.00 22.42 ? 23   DT  B N1    1 
ATOM   453   C  C2    . DT  C 1 3   ? 101.542 -28.124 37.861  1.00 20.98 ? 23   DT  B C2    1 
ATOM   454   O  O2    . DT  C 1 3   ? 100.965 -27.496 38.733  1.00 21.29 ? 23   DT  B O2    1 
ATOM   455   N  N3    . DT  C 1 3   ? 102.034 -29.387 38.080  1.00 19.84 ? 23   DT  B N3    1 
ATOM   456   C  C4    . DT  C 1 3   ? 102.715 -30.189 37.188  1.00 18.98 ? 23   DT  B C4    1 
ATOM   457   O  O4    . DT  C 1 3   ? 103.078 -31.311 37.530  1.00 19.89 ? 23   DT  B O4    1 
ATOM   458   C  C5    . DT  C 1 3   ? 102.935 -29.609 35.885  1.00 19.93 ? 23   DT  B C5    1 
ATOM   459   C  C7    . DT  C 1 3   ? 103.687 -30.394 34.856  1.00 18.89 ? 23   DT  B C7    1 
ATOM   460   C  C6    . DT  C 1 3   ? 102.451 -28.383 35.653  1.00 21.48 ? 23   DT  B C6    1 
ATOM   461   P  P     . DG  C 1 4   ? 101.899 -21.980 35.674  1.00 23.47 ? 24   DG  B P     1 
ATOM   462   O  OP1   . DG  C 1 4   ? 100.975 -20.819 35.664  1.00 24.41 ? 24   DG  B OP1   1 
ATOM   463   O  OP2   . DG  C 1 4   ? 103.101 -21.972 34.805  1.00 24.03 ? 24   DG  B OP2   1 
ATOM   464   O  "O5'" . DG  C 1 4   ? 102.377 -22.260 37.162  1.00 22.32 ? 24   DG  B "O5'" 1 
ATOM   465   C  "C5'" . DG  C 1 4   ? 101.420 -22.423 38.221  1.00 21.93 ? 24   DG  B "C5'" 1 
ATOM   466   C  "C4'" . DG  C 1 4   ? 102.111 -22.875 39.486  1.00 22.75 ? 24   DG  B "C4'" 1 
ATOM   467   O  "O4'" . DG  C 1 4   ? 102.461 -24.279 39.411  1.00 22.74 ? 24   DG  B "O4'" 1 
ATOM   468   C  "C3'" . DG  C 1 4   ? 103.404 -22.128 39.830  1.00 22.32 ? 24   DG  B "C3'" 1 
ATOM   469   O  "O3'" . DG  C 1 4   ? 103.466 -21.933 41.243  1.00 23.98 ? 24   DG  B "O3'" 1 
ATOM   470   C  "C2'" . DG  C 1 4   ? 104.493 -23.113 39.443  1.00 22.06 ? 24   DG  B "C2'" 1 
ATOM   471   C  "C1'" . DG  C 1 4   ? 103.821 -24.431 39.780  1.00 21.79 ? 24   DG  B "C1'" 1 
ATOM   472   N  N9    . DG  C 1 4   ? 104.342 -25.645 39.158  1.00 19.76 ? 24   DG  B N9    1 
ATOM   473   C  C8    . DG  C 1 4   ? 104.848 -25.807 37.889  1.00 17.67 ? 24   DG  B C8    1 
ATOM   474   N  N7    . DG  C 1 4   ? 105.259 -27.026 37.655  1.00 18.19 ? 24   DG  B N7    1 
ATOM   475   C  C5    . DG  C 1 4   ? 105.007 -27.708 38.838  1.00 17.63 ? 24   DG  B C5    1 
ATOM   476   C  C6    . DG  C 1 4   ? 105.246 -29.064 39.191  1.00 18.21 ? 24   DG  B C6    1 
ATOM   477   O  O6    . DG  C 1 4   ? 105.745 -29.968 38.503  1.00 17.39 ? 24   DG  B O6    1 
ATOM   478   N  N1    . DG  C 1 4   ? 104.836 -29.330 40.494  1.00 15.66 ? 24   DG  B N1    1 
ATOM   479   C  C2    . DG  C 1 4   ? 104.264 -28.417 41.347  1.00 18.05 ? 24   DG  B C2    1 
ATOM   480   N  N2    . DG  C 1 4   ? 103.929 -28.867 42.564  1.00 14.49 ? 24   DG  B N2    1 
ATOM   481   N  N3    . DG  C 1 4   ? 104.038 -27.154 41.030  1.00 16.99 ? 24   DG  B N3    1 
ATOM   482   C  C4    . DG  C 1 4   ? 104.434 -26.870 39.771  1.00 17.86 ? 24   DG  B C4    1 
ATOM   483   P  P     . DA  C 1 5   ? 104.279 -20.689 41.848  1.00 24.75 ? 25   DA  B P     1 
ATOM   484   O  OP1   . DA  C 1 5   ? 103.258 -19.741 42.371  1.00 23.85 ? 25   DA  B OP1   1 
ATOM   485   O  OP2   . DA  C 1 5   ? 105.265 -20.217 40.846  1.00 22.96 ? 25   DA  B OP2   1 
ATOM   486   O  "O5'" . DA  C 1 5   ? 105.131 -21.339 43.034  1.00 25.09 ? 25   DA  B "O5'" 1 
ATOM   487   C  "C5'" . DA  C 1 5   ? 104.494 -21.893 44.190  1.00 25.06 ? 25   DA  B "C5'" 1 
ATOM   488   C  "C4'" . DA  C 1 5   ? 105.136 -23.204 44.598  1.00 22.88 ? 25   DA  B "C4'" 1 
ATOM   489   O  "O4'" . DA  C 1 5   ? 104.993 -24.194 43.555  1.00 21.56 ? 25   DA  B "O4'" 1 
ATOM   490   C  "C3'" . DA  C 1 5   ? 106.627 -23.246 44.925  1.00 23.44 ? 25   DA  B "C3'" 1 
ATOM   491   O  "O3'" . DA  C 1 5   ? 106.916 -22.797 46.252  1.00 23.03 ? 25   DA  B "O3'" 1 
ATOM   492   C  "C2'" . DA  C 1 5   ? 106.916 -24.733 44.858  1.00 23.43 ? 25   DA  B "C2'" 1 
ATOM   493   C  "C1'" . DA  C 1 5   ? 105.909 -25.257 43.838  1.00 20.89 ? 25   DA  B "C1'" 1 
ATOM   494   N  N9    . DA  C 1 5   ? 106.548 -25.686 42.596  1.00 19.12 ? 25   DA  B N9    1 
ATOM   495   C  C8    . DA  C 1 5   ? 106.811 -24.986 41.444  1.00 18.00 ? 25   DA  B C8    1 
ATOM   496   N  N7    . DA  C 1 5   ? 107.430 -25.694 40.528  1.00 18.68 ? 25   DA  B N7    1 
ATOM   497   C  C5    . DA  C 1 5   ? 107.582 -26.944 41.117  1.00 16.27 ? 25   DA  B C5    1 
ATOM   498   C  C6    . DA  C 1 5   ? 108.162 -28.146 40.664  1.00 16.08 ? 25   DA  B C6    1 
ATOM   499   N  N6    . DA  C 1 5   ? 108.724 -28.294 39.463  1.00 16.49 ? 25   DA  B N6    1 
ATOM   500   N  N1    . DA  C 1 5   ? 108.144 -29.208 41.502  1.00 16.34 ? 25   DA  B N1    1 
ATOM   501   C  C2    . DA  C 1 5   ? 107.585 -29.063 42.707  1.00 18.26 ? 25   DA  B C2    1 
ATOM   502   N  N3    . DA  C 1 5   ? 107.012 -27.988 43.246  1.00 17.10 ? 25   DA  B N3    1 
ATOM   503   C  C4    . DA  C 1 5   ? 107.043 -26.952 42.388  1.00 18.38 ? 25   DA  B C4    1 
ATOM   504   P  P     . DC  C 1 6   ? 108.414 -22.330 46.623  1.00 21.93 ? 26   DC  B P     1 
ATOM   505   O  OP1   . DC  C 1 6   ? 108.314 -21.630 47.931  1.00 21.63 ? 26   DC  B OP1   1 
ATOM   506   O  OP2   . DC  C 1 6   ? 108.999 -21.626 45.458  1.00 19.82 ? 26   DC  B OP2   1 
ATOM   507   O  "O5'" . DC  C 1 6   ? 109.226 -23.688 46.823  1.00 18.99 ? 26   DC  B "O5'" 1 
ATOM   508   C  "C5'" . DC  C 1 6   ? 108.990 -24.519 47.969  1.00 21.92 ? 26   DC  B "C5'" 1 
ATOM   509   C  "C4'" . DC  C 1 6   ? 109.655 -25.864 47.794  1.00 22.37 ? 26   DC  B "C4'" 1 
ATOM   510   O  "O4'" . DC  C 1 6   ? 109.137 -26.512 46.612  1.00 24.29 ? 26   DC  B "O4'" 1 
ATOM   511   C  "C3'" . DC  C 1 6   ? 111.166 -25.857 47.591  1.00 22.74 ? 26   DC  B "C3'" 1 
ATOM   512   O  "O3'" . DC  C 1 6   ? 111.861 -25.830 48.840  1.00 24.68 ? 26   DC  B "O3'" 1 
ATOM   513   C  "C2'" . DC  C 1 6   ? 111.399 -27.181 46.894  1.00 23.72 ? 26   DC  B "C2'" 1 
ATOM   514   C  "C1'" . DC  C 1 6   ? 110.137 -27.375 46.074  1.00 22.37 ? 26   DC  B "C1'" 1 
ATOM   515   N  N1    . DC  C 1 6   ? 110.338 -27.060 44.647  1.00 20.66 ? 26   DC  B N1    1 
ATOM   516   C  C2    . DC  C 1 6   ? 110.842 -28.072 43.826  1.00 19.97 ? 26   DC  B C2    1 
ATOM   517   O  O2    . DC  C 1 6   ? 111.080 -29.186 44.325  1.00 20.23 ? 26   DC  B O2    1 
ATOM   518   N  N3    . DC  C 1 6   ? 111.061 -27.819 42.521  1.00 16.03 ? 26   DC  B N3    1 
ATOM   519   C  C4    . DC  C 1 6   ? 110.805 -26.614 42.024  1.00 18.61 ? 26   DC  B C4    1 
ATOM   520   N  N4    . DC  C 1 6   ? 111.054 -26.415 40.727  1.00 17.99 ? 26   DC  B N4    1 
ATOM   521   C  C5    . DC  C 1 6   ? 110.285 -25.559 42.832  1.00 18.19 ? 26   DC  B C5    1 
ATOM   522   C  C6    . DC  C 1 6   ? 110.067 -25.825 44.128  1.00 19.89 ? 26   DC  B C6    1 
ATOM   523   P  P     . DT  C 1 7   ? 113.463 -25.653 48.857  1.00 24.84 ? 27   DT  B P     1 
ATOM   524   O  OP1   . DT  C 1 7   ? 113.902 -25.692 50.270  1.00 25.64 ? 27   DT  B OP1   1 
ATOM   525   O  OP2   . DT  C 1 7   ? 113.828 -24.493 48.004  1.00 25.59 ? 27   DT  B OP2   1 
ATOM   526   O  "O5'" . DT  C 1 7   ? 114.009 -26.947 48.104  1.00 20.94 ? 27   DT  B "O5'" 1 
ATOM   527   C  "C5'" . DT  C 1 7   ? 113.985 -28.236 48.729  1.00 19.31 ? 27   DT  B "C5'" 1 
ATOM   528   C  "C4'" . DT  C 1 7   ? 114.732 -29.238 47.879  1.00 18.23 ? 27   DT  B "C4'" 1 
ATOM   529   O  "O4'" . DT  C 1 7   ? 114.000 -29.543 46.669  1.00 16.79 ? 27   DT  B "O4'" 1 
ATOM   530   C  "C3'" . DT  C 1 7   ? 116.092 -28.776 47.380  1.00 16.75 ? 27   DT  B "C3'" 1 
ATOM   531   O  "O3'" . DT  C 1 7   ? 117.108 -28.895 48.367  1.00 17.23 ? 27   DT  B "O3'" 1 
ATOM   532   C  "C2'" . DT  C 1 7   ? 116.329 -29.681 46.190  1.00 17.25 ? 27   DT  B "C2'" 1 
ATOM   533   C  "C1'" . DT  C 1 7   ? 114.924 -29.835 45.615  1.00 15.53 ? 27   DT  B "C1'" 1 
ATOM   534   N  N1    . DT  C 1 7   ? 114.698 -28.884 44.506  1.00 16.28 ? 27   DT  B N1    1 
ATOM   535   C  C2    . DT  C 1 7   ? 114.940 -29.340 43.228  1.00 14.35 ? 27   DT  B C2    1 
ATOM   536   O  O2    . DT  C 1 7   ? 115.291 -30.483 42.983  1.00 13.18 ? 27   DT  B O2    1 
ATOM   537   N  N3    . DT  C 1 7   ? 114.758 -28.404 42.242  1.00 14.67 ? 27   DT  B N3    1 
ATOM   538   C  C4    . DT  C 1 7   ? 114.374 -27.087 42.398  1.00 16.04 ? 27   DT  B C4    1 
ATOM   539   O  O4    . DT  C 1 7   ? 114.265 -26.362 41.409  1.00 17.98 ? 27   DT  B O4    1 
ATOM   540   C  C5    . DT  C 1 7   ? 114.129 -26.672 43.764  1.00 16.59 ? 27   DT  B C5    1 
ATOM   541   C  C7    . DT  C 1 7   ? 113.709 -25.259 44.031  1.00 16.24 ? 27   DT  B C7    1 
ATOM   542   C  C6    . DT  C 1 7   ? 114.294 -27.580 44.735  1.00 15.49 ? 27   DT  B C6    1 
ATOM   543   P  P     . DC  C 1 8   ? 118.394 -27.940 48.279  1.00 18.56 ? 28   DC  B P     1 
ATOM   544   O  OP1   . DC  C 1 8   ? 119.122 -28.087 49.567  1.00 17.61 ? 28   DC  B OP1   1 
ATOM   545   O  OP2   . DC  C 1 8   ? 117.959 -26.589 47.831  1.00 15.08 ? 28   DC  B OP2   1 
ATOM   546   O  "O5'" . DC  C 1 8   ? 119.266 -28.598 47.116  1.00 16.37 ? 28   DC  B "O5'" 1 
ATOM   547   C  "C5'" . DC  C 1 8   ? 119.700 -29.962 47.226  1.00 16.25 ? 28   DC  B "C5'" 1 
ATOM   548   C  "C4'" . DC  C 1 8   ? 120.290 -30.453 45.924  1.00 17.06 ? 28   DC  B "C4'" 1 
ATOM   549   O  "O4'" . DC  C 1 8   ? 119.288 -30.515 44.885  1.00 16.99 ? 28   DC  B "O4'" 1 
ATOM   550   C  "C3'" . DC  C 1 8   ? 121.411 -29.625 45.313  1.00 16.97 ? 28   DC  B "C3'" 1 
ATOM   551   O  "O3'" . DC  C 1 8   ? 122.673 -29.870 45.929  1.00 16.01 ? 28   DC  B "O3'" 1 
ATOM   552   C  "C2'" . DC  C 1 8   ? 121.401 -30.099 43.872  1.00 16.55 ? 28   DC  B "C2'" 1 
ATOM   553   C  "C1'" . DC  C 1 8   ? 119.920 -30.337 43.612  1.00 16.18 ? 28   DC  B "C1'" 1 
ATOM   554   N  N1    . DC  C 1 8   ? 119.317 -29.171 42.937  1.00 17.19 ? 28   DC  B N1    1 
ATOM   555   C  C2    . DC  C 1 8   ? 119.367 -29.121 41.541  1.00 15.44 ? 28   DC  B C2    1 
ATOM   556   O  O2    . DC  C 1 8   ? 119.896 -30.062 40.930  1.00 14.35 ? 28   DC  B O2    1 
ATOM   557   N  N3    . DC  C 1 8   ? 118.843 -28.051 40.896  1.00 16.53 ? 28   DC  B N3    1 
ATOM   558   C  C4    . DC  C 1 8   ? 118.289 -27.055 41.594  1.00 17.53 ? 28   DC  B C4    1 
ATOM   559   N  N4    . DC  C 1 8   ? 117.795 -26.010 40.916  1.00 15.11 ? 28   DC  B N4    1 
ATOM   560   C  C5    . DC  C 1 8   ? 118.220 -27.082 43.019  1.00 16.69 ? 28   DC  B C5    1 
ATOM   561   C  C6    . DC  C 1 8   ? 118.739 -28.149 43.644  1.00 16.39 ? 28   DC  B C6    1 
HETATM 562   P  P     . DDG C 1 9   ? 123.903 -28.881 45.616  1.00 18.81 ? 29   DDG B P     1 
HETATM 563   O  OP1   . DDG C 1 9   ? 125.017 -29.282 46.499  1.00 16.17 ? 29   DDG B OP1   1 
HETATM 564   O  OP2   . DDG C 1 9   ? 123.414 -27.483 45.635  1.00 17.67 ? 29   DDG B OP2   1 
HETATM 565   O  "O5'" . DDG C 1 9   ? 124.292 -29.222 44.106  1.00 17.00 ? 29   DDG B "O5'" 1 
HETATM 566   C  "C5'" . DDG C 1 9   ? 124.781 -30.527 43.744  1.00 18.77 ? 29   DDG B "C5'" 1 
HETATM 567   C  "C4'" . DDG C 1 9   ? 125.079 -30.582 42.264  1.00 18.04 ? 29   DDG B "C4'" 1 
HETATM 568   O  "O4'" . DDG C 1 9   ? 123.863 -30.332 41.525  1.00 18.28 ? 29   DDG B "O4'" 1 
HETATM 569   C  "C3'" . DDG C 1 9   ? 126.066 -29.527 41.773  1.00 18.81 ? 29   DDG B "C3'" 1 
HETATM 570   C  "C2'" . DDG C 1 9   ? 125.656 -29.336 40.325  1.00 16.69 ? 29   DDG B "C2'" 1 
HETATM 571   C  "C1'" . DDG C 1 9   ? 124.147 -29.566 40.357  1.00 17.35 ? 29   DDG B "C1'" 1 
HETATM 572   N  N9    . DDG C 1 9   ? 123.370 -28.330 40.420  1.00 16.21 ? 29   DDG B N9    1 
HETATM 573   C  C8    . DDG C 1 9   ? 122.863 -27.709 41.538  1.00 16.34 ? 29   DDG B C8    1 
HETATM 574   N  N7    . DDG C 1 9   ? 122.218 -26.608 41.262  1.00 17.33 ? 29   DDG B N7    1 
HETATM 575   C  C5    . DDG C 1 9   ? 122.302 -26.496 39.880  1.00 16.55 ? 29   DDG B C5    1 
HETATM 576   C  C6    . DDG C 1 9   ? 121.791 -25.503 38.998  1.00 16.22 ? 29   DDG B C6    1 
HETATM 577   O  O6    . DDG C 1 9   ? 121.120 -24.495 39.266  1.00 15.35 ? 29   DDG B O6    1 
HETATM 578   N  N1    . DDG C 1 9   ? 122.124 -25.777 37.677  1.00 16.43 ? 29   DDG B N1    1 
HETATM 579   C  C2    . DDG C 1 9   ? 122.844 -26.865 37.253  1.00 15.63 ? 29   DDG B C2    1 
HETATM 580   N  N2    . DDG C 1 9   ? 123.065 -26.956 35.939  1.00 15.68 ? 29   DDG B N2    1 
HETATM 581   N  N3    . DDG C 1 9   ? 123.315 -27.796 38.058  1.00 16.37 ? 29   DDG B N3    1 
HETATM 582   C  C4    . DDG C 1 9   ? 123.011 -27.551 39.348  1.00 16.68 ? 29   DDG B C4    1 
ATOM   583   O  "O5'" . DT  D 2 3   ? 113.151 -15.167 29.894  1.00 48.97 ? 2    DT  C "O5'" 1 
ATOM   584   C  "C5'" . DT  D 2 3   ? 113.391 -13.816 29.487  1.00 46.44 ? 2    DT  C "C5'" 1 
ATOM   585   C  "C4'" . DT  D 2 3   ? 114.847 -13.429 29.621  1.00 45.35 ? 2    DT  C "C4'" 1 
ATOM   586   O  "O4'" . DT  D 2 3   ? 115.038 -12.099 29.078  1.00 46.81 ? 2    DT  C "O4'" 1 
ATOM   587   C  "C3'" . DT  D 2 3   ? 115.379 -13.388 31.056  1.00 42.17 ? 2    DT  C "C3'" 1 
ATOM   588   O  "O3'" . DT  D 2 3   ? 116.727 -13.881 31.097  1.00 35.12 ? 2    DT  C "O3'" 1 
ATOM   589   C  "C2'" . DT  D 2 3   ? 115.360 -11.909 31.398  1.00 45.31 ? 2    DT  C "C2'" 1 
ATOM   590   C  "C1'" . DT  D 2 3   ? 115.631 -11.255 30.052  1.00 48.58 ? 2    DT  C "C1'" 1 
ATOM   591   N  N1    . DT  D 2 3   ? 115.071 -9.892  29.888  1.00 52.67 ? 2    DT  C N1    1 
ATOM   592   C  C2    . DT  D 2 3   ? 115.886 -8.921  29.337  1.00 54.34 ? 2    DT  C C2    1 
ATOM   593   O  O2    . DT  D 2 3   ? 117.032 -9.134  28.965  1.00 55.49 ? 2    DT  C O2    1 
ATOM   594   N  N3    . DT  D 2 3   ? 115.306 -7.681  29.232  1.00 55.41 ? 2    DT  C N3    1 
ATOM   595   C  C4    . DT  D 2 3   ? 114.026 -7.320  29.607  1.00 56.10 ? 2    DT  C C4    1 
ATOM   596   O  O4    . DT  D 2 3   ? 113.649 -6.160  29.450  1.00 57.78 ? 2    DT  C O4    1 
ATOM   597   C  C5    . DT  D 2 3   ? 113.224 -8.386  30.172  1.00 55.44 ? 2    DT  C C5    1 
ATOM   598   C  C7    . DT  D 2 3   ? 111.823 -8.093  30.607  1.00 55.35 ? 2    DT  C C7    1 
ATOM   599   C  C6    . DT  D 2 3   ? 113.779 -9.601  30.280  1.00 54.23 ? 2    DT  C C6    1 
HETATM 600   P  P     . 6OG D 2 4   ? 117.552 -13.850 32.480  1.00 30.49 ? 3    6OG C P     1 
HETATM 601   O  OP1   . 6OG D 2 4   ? 116.708 -14.483 33.523  1.00 28.71 ? 3    6OG C OP1   1 
HETATM 602   O  OP2   . 6OG D 2 4   ? 118.077 -12.474 32.692  1.00 30.63 ? 3    6OG C OP2   1 
HETATM 603   O  "O5'" . 6OG D 2 4   ? 118.798 -14.800 32.209  1.00 28.62 ? 3    6OG C "O5'" 1 
HETATM 604   N  N9    . 6OG D 2 4   ? 121.423 -18.110 34.338  1.00 19.54 ? 3    6OG C N9    1 
HETATM 605   C  C4    . 6OG D 2 4   ? 121.959 -19.171 35.030  1.00 19.20 ? 3    6OG C C4    1 
HETATM 606   N  N3    . 6OG D 2 4   ? 122.809 -20.095 34.535  1.00 20.64 ? 3    6OG C N3    1 
HETATM 607   C  C2    . 6OG D 2 4   ? 123.154 -20.989 35.448  1.00 20.63 ? 3    6OG C C2    1 
HETATM 608   N  N2    . 6OG D 2 4   ? 123.986 -21.987 35.120  1.00 20.41 ? 3    6OG C N2    1 
HETATM 609   N  N1    . 6OG D 2 4   ? 122.705 -20.969 36.750  1.00 21.35 ? 3    6OG C N1    1 
HETATM 610   C  C6    . 6OG D 2 4   ? 121.829 -20.020 37.284  1.00 23.14 ? 3    6OG C C6    1 
HETATM 611   O  O6    . 6OG D 2 4   ? 121.475 -20.068 38.491  1.00 25.21 ? 3    6OG C O6    1 
HETATM 612   C  C5    . 6OG D 2 4   ? 121.446 -19.069 36.308  1.00 20.86 ? 3    6OG C C5    1 
HETATM 613   N  N7    . 6OG D 2 4   ? 120.599 -17.976 36.413  1.00 20.43 ? 3    6OG C N7    1 
HETATM 614   C  C8    . 6OG D 2 4   ? 120.614 -17.439 35.225  1.00 20.22 ? 3    6OG C C8    1 
HETATM 615   C  "C2'" . 6OG D 2 4   ? 121.227 -18.822 31.936  1.00 18.65 ? 3    6OG C "C2'" 1 
HETATM 616   C  "C5'" . 6OG D 2 4   ? 118.607 -16.206 31.997  1.00 24.12 ? 3    6OG C "C5'" 1 
HETATM 617   C  "C4'" . 6OG D 2 4   ? 119.920 -16.865 31.648  1.00 21.60 ? 3    6OG C "C4'" 1 
HETATM 618   O  "O4'" . 6OG D 2 4   ? 120.902 -16.588 32.667  1.00 19.68 ? 3    6OG C "O4'" 1 
HETATM 619   C  "C1'" . 6OG D 2 4   ? 121.666 -17.755 32.941  1.00 19.00 ? 3    6OG C "C1'" 1 
HETATM 620   C  "C3'" . 6OG D 2 4   ? 119.823 -18.381 31.577  1.00 19.97 ? 3    6OG C "C3'" 1 
HETATM 621   O  "O3'" . 6OG D 2 4   ? 119.460 -18.756 30.250  1.00 22.29 ? 3    6OG C "O3'" 1 
HETATM 622   C  C     . 6OG D 2 4   ? 121.980 -21.125 39.325  1.00 26.86 ? 3    6OG C C     1 
ATOM   623   P  P     . DC  D 2 5   ? 118.432 -19.965 30.008  1.00 22.37 ? 4    DC  C P     1 
ATOM   624   O  OP1   . DC  D 2 5   ? 118.076 -19.881 28.562  1.00 20.41 ? 4    DC  C OP1   1 
ATOM   625   O  OP2   . DC  D 2 5   ? 117.355 -19.949 31.028  1.00 21.29 ? 4    DC  C OP2   1 
ATOM   626   O  "O5'" . DC  D 2 5   ? 119.321 -21.262 30.254  1.00 21.01 ? 4    DC  C "O5'" 1 
ATOM   627   C  "C5'" . DC  D 2 5   ? 120.502 -21.496 29.473  1.00 20.26 ? 4    DC  C "C5'" 1 
ATOM   628   C  "C4'" . DC  D 2 5   ? 121.288 -22.655 30.040  1.00 19.74 ? 4    DC  C "C4'" 1 
ATOM   629   O  "O4'" . DC  D 2 5   ? 121.827 -22.326 31.339  1.00 19.44 ? 4    DC  C "O4'" 1 
ATOM   630   C  "C3'" . DC  D 2 5   ? 120.504 -23.941 30.259  1.00 18.28 ? 4    DC  C "C3'" 1 
ATOM   631   O  "O3'" . DC  D 2 5   ? 120.442 -24.686 29.043  1.00 17.40 ? 4    DC  C "O3'" 1 
ATOM   632   C  "C2'" . DC  D 2 5   ? 121.340 -24.659 31.303  1.00 18.74 ? 4    DC  C "C2'" 1 
ATOM   633   C  "C1'" . DC  D 2 5   ? 121.956 -23.519 32.114  1.00 19.36 ? 4    DC  C "C1'" 1 
ATOM   634   N  N1    . DC  D 2 5   ? 121.331 -23.299 33.435  1.00 19.13 ? 4    DC  C N1    1 
ATOM   635   C  C2    . DC  D 2 5   ? 121.735 -24.109 34.506  1.00 19.92 ? 4    DC  C C2    1 
ATOM   636   O  O2    . DC  D 2 5   ? 122.607 -24.975 34.310  1.00 19.98 ? 4    DC  C O2    1 
ATOM   637   N  N3    . DC  D 2 5   ? 121.168 -23.931 35.723  1.00 17.38 ? 4    DC  C N3    1 
ATOM   638   C  C4    . DC  D 2 5   ? 120.233 -22.992 35.893  1.00 18.29 ? 4    DC  C C4    1 
ATOM   639   N  N4    . DC  D 2 5   ? 119.697 -22.858 37.110  1.00 17.52 ? 4    DC  C N4    1 
ATOM   640   C  C5    . DC  D 2 5   ? 119.806 -22.151 34.825  1.00 17.54 ? 4    DC  C C5    1 
ATOM   641   C  C6    . DC  D 2 5   ? 120.375 -22.336 33.624  1.00 18.80 ? 4    DC  C C6    1 
ATOM   642   P  P     . DG  D 2 6   ? 119.336 -25.837 28.866  1.00 17.42 ? 5    DG  C P     1 
ATOM   643   O  OP1   . DG  D 2 6   ? 119.576 -26.438 27.536  1.00 16.71 ? 5    DG  C OP1   1 
ATOM   644   O  OP2   . DG  D 2 6   ? 118.000 -25.290 29.186  1.00 15.05 ? 5    DG  C OP2   1 
ATOM   645   O  "O5'" . DG  D 2 6   ? 119.737 -26.908 29.974  1.00 14.48 ? 5    DG  C "O5'" 1 
ATOM   646   C  "C5'" . DG  D 2 6   ? 120.957 -27.658 29.840  1.00 16.60 ? 5    DG  C "C5'" 1 
ATOM   647   C  "C4'" . DG  D 2 6   ? 121.094 -28.662 30.960  1.00 17.21 ? 5    DG  C "C4'" 1 
ATOM   648   O  "O4'" . DG  D 2 6   ? 121.429 -28.014 32.205  1.00 17.06 ? 5    DG  C "O4'" 1 
ATOM   649   C  "C3'" . DG  D 2 6   ? 119.851 -29.479 31.277  1.00 16.21 ? 5    DG  C "C3'" 1 
ATOM   650   O  "O3'" . DG  D 2 6   ? 119.693 -30.564 30.361  1.00 14.80 ? 5    DG  C "O3'" 1 
ATOM   651   C  "C2'" . DG  D 2 6   ? 120.126 -29.950 32.693  1.00 16.41 ? 5    DG  C "C2'" 1 
ATOM   652   C  "C1'" . DG  D 2 6   ? 120.921 -28.791 33.291  1.00 16.81 ? 5    DG  C "C1'" 1 
ATOM   653   N  N9    . DG  D 2 6   ? 120.136 -27.917 34.163  1.00 14.26 ? 5    DG  C N9    1 
ATOM   654   C  C8    . DG  D 2 6   ? 119.428 -26.785 33.825  1.00 13.99 ? 5    DG  C C8    1 
ATOM   655   N  N7    . DG  D 2 6   ? 118.834 -26.227 34.848  1.00 13.97 ? 5    DG  C N7    1 
ATOM   656   C  C5    . DG  D 2 6   ? 119.170 -27.042 35.923  1.00 14.46 ? 5    DG  C C5    1 
ATOM   657   C  C6    . DG  D 2 6   ? 118.819 -26.951 37.300  1.00 15.95 ? 5    DG  C C6    1 
ATOM   658   O  O6    . DG  D 2 6   ? 118.126 -26.096 37.868  1.00 14.45 ? 5    DG  C O6    1 
ATOM   659   N  N1    . DG  D 2 6   ? 119.368 -27.999 38.035  1.00 14.44 ? 5    DG  C N1    1 
ATOM   660   C  C2    . DG  D 2 6   ? 120.154 -29.002 37.519  1.00 14.03 ? 5    DG  C C2    1 
ATOM   661   N  N2    . DG  D 2 6   ? 120.591 -29.926 38.379  1.00 11.86 ? 5    DG  C N2    1 
ATOM   662   N  N3    . DG  D 2 6   ? 120.489 -29.094 36.246  1.00 15.00 ? 5    DG  C N3    1 
ATOM   663   C  C4    . DG  D 2 6   ? 119.968 -28.090 35.512  1.00 15.05 ? 5    DG  C C4    1 
ATOM   664   P  P     . DA  D 2 7   ? 118.325 -31.405 30.374  1.00 15.95 ? 6    DA  C P     1 
ATOM   665   O  OP1   . DA  D 2 7   ? 118.380 -32.368 29.246  1.00 15.55 ? 6    DA  C OP1   1 
ATOM   666   O  OP2   . DA  D 2 7   ? 117.187 -30.455 30.474  1.00 13.91 ? 6    DA  C OP2   1 
ATOM   667   O  "O5'" . DA  D 2 7   ? 118.453 -32.205 31.744  1.00 13.79 ? 6    DA  C "O5'" 1 
ATOM   668   C  "C5'" . DA  D 2 7   ? 117.303 -32.663 32.458  1.00 14.47 ? 6    DA  C "C5'" 1 
ATOM   669   C  "C4'" . DA  D 2 7   ? 117.698 -33.036 33.868  1.00 12.72 ? 6    DA  C "C4'" 1 
ATOM   670   O  "O4'" . DA  D 2 7   ? 118.187 -31.886 34.597  1.00 14.23 ? 6    DA  C "O4'" 1 
ATOM   671   C  "C3'" . DA  D 2 7   ? 116.552 -33.585 34.701  1.00 13.94 ? 6    DA  C "C3'" 1 
ATOM   672   O  "O3'" . DA  D 2 7   ? 116.466 -34.992 34.453  1.00 14.27 ? 6    DA  C "O3'" 1 
ATOM   673   C  "C2'" . DA  D 2 7   ? 116.983 -33.266 36.123  1.00 12.36 ? 6    DA  C "C2'" 1 
ATOM   674   C  "C1'" . DA  D 2 7   ? 117.797 -31.976 35.968  1.00 14.68 ? 6    DA  C "C1'" 1 
ATOM   675   N  N9    . DA  D 2 7   ? 117.098 -30.738 36.328  1.00 15.26 ? 6    DA  C N9    1 
ATOM   676   C  C8    . DA  D 2 7   ? 116.752 -29.684 35.510  1.00 15.84 ? 6    DA  C C8    1 
ATOM   677   N  N7    . DA  D 2 7   ? 116.151 -28.703 36.137  1.00 14.10 ? 6    DA  C N7    1 
ATOM   678   C  C5    . DA  D 2 7   ? 116.093 -29.135 37.455  1.00 13.31 ? 6    DA  C C5    1 
ATOM   679   C  C6    . DA  D 2 7   ? 115.579 -28.541 38.626  1.00 14.71 ? 6    DA  C C6    1 
ATOM   680   N  N6    . DA  D 2 7   ? 115.028 -27.322 38.666  1.00 12.51 ? 6    DA  C N6    1 
ATOM   681   N  N1    . DA  D 2 7   ? 115.663 -29.247 39.774  1.00 14.17 ? 6    DA  C N1    1 
ATOM   682   C  C2    . DA  D 2 7   ? 116.234 -30.457 39.743  1.00 14.21 ? 6    DA  C C2    1 
ATOM   683   N  N3    . DA  D 2 7   ? 116.765 -31.115 38.713  1.00 14.89 ? 6    DA  C N3    1 
ATOM   684   C  C4    . DA  D 2 7   ? 116.660 -30.391 37.584  1.00 14.58 ? 6    DA  C C4    1 
ATOM   685   P  P     . DG  D 2 8   ? 115.060 -35.745 34.601  1.00 14.87 ? 7    DG  C P     1 
ATOM   686   O  OP1   . DG  D 2 8   ? 115.328 -37.175 34.303  1.00 16.94 ? 7    DG  C OP1   1 
ATOM   687   O  OP2   . DG  D 2 8   ? 114.018 -35.017 33.835  1.00 14.65 ? 7    DG  C OP2   1 
ATOM   688   O  "O5'" . DG  D 2 8   ? 114.728 -35.598 36.150  1.00 14.92 ? 7    DG  C "O5'" 1 
ATOM   689   C  "C5'" . DG  D 2 8   ? 115.530 -36.264 37.139  1.00 14.59 ? 7    DG  C "C5'" 1 
ATOM   690   C  "C4'" . DG  D 2 8   ? 114.762 -36.395 38.433  1.00 14.03 ? 7    DG  C "C4'" 1 
ATOM   691   O  "O4'" . DG  D 2 8   ? 114.586 -35.088 39.030  1.00 13.95 ? 7    DG  C "O4'" 1 
ATOM   692   C  "C3'" . DG  D 2 8   ? 113.365 -37.000 38.300  1.00 15.05 ? 7    DG  C "C3'" 1 
ATOM   693   O  "O3'" . DG  D 2 8   ? 113.147 -37.900 39.395  1.00 16.15 ? 7    DG  C "O3'" 1 
ATOM   694   C  "C2'" . DG  D 2 8   ? 112.443 -35.790 38.361  1.00 14.83 ? 7    DG  C "C2'" 1 
ATOM   695   C  "C1'" . DG  D 2 8   ? 113.212 -34.804 39.233  1.00 15.33 ? 7    DG  C "C1'" 1 
ATOM   696   N  N9    . DG  D 2 8   ? 113.003 -33.388 38.919  1.00 15.87 ? 7    DG  C N9    1 
ATOM   697   C  C8    . DG  D 2 8   ? 113.098 -32.779 37.688  1.00 14.96 ? 7    DG  C C8    1 
ATOM   698   N  N7    . DG  D 2 8   ? 112.865 -31.492 37.732  1.00 15.42 ? 7    DG  C N7    1 
ATOM   699   C  C5    . DG  D 2 8   ? 112.594 -31.236 39.071  1.00 14.87 ? 7    DG  C C5    1 
ATOM   700   C  C6    . DG  D 2 8   ? 112.270 -30.017 39.732  1.00 15.66 ? 7    DG  C C6    1 
ATOM   701   O  O6    . DG  D 2 8   ? 112.153 -28.880 39.251  1.00 17.31 ? 7    DG  C O6    1 
ATOM   702   N  N1    . DG  D 2 8   ? 112.080 -30.211 41.095  1.00 14.56 ? 7    DG  C N1    1 
ATOM   703   C  C2    . DG  D 2 8   ? 112.192 -31.414 41.748  1.00 13.70 ? 7    DG  C C2    1 
ATOM   704   N  N2    . DG  D 2 8   ? 111.986 -31.387 43.076  1.00 12.96 ? 7    DG  C N2    1 
ATOM   705   N  N3    . DG  D 2 8   ? 112.488 -32.555 41.148  1.00 15.40 ? 7    DG  C N3    1 
ATOM   706   C  C4    . DG  D 2 8   ? 112.675 -32.395 39.818  1.00 15.52 ? 7    DG  C C4    1 
ATOM   707   P  P     . DT  D 2 9   ? 111.739 -38.661 39.551  1.00 16.68 ? 8    DT  C P     1 
ATOM   708   O  OP1   . DT  D 2 9   ? 112.046 -39.991 40.147  1.00 18.67 ? 8    DT  C OP1   1 
ATOM   709   O  OP2   . DT  D 2 9   ? 110.953 -38.587 38.294  1.00 16.91 ? 8    DT  C OP2   1 
ATOM   710   O  "O5'" . DT  D 2 9   ? 111.003 -37.796 40.660  1.00 16.25 ? 8    DT  C "O5'" 1 
ATOM   711   C  "C5'" . DT  D 2 9   ? 111.595 -37.635 41.953  1.00 16.64 ? 8    DT  C "C5'" 1 
ATOM   712   C  "C4'" . DT  D 2 9   ? 110.619 -36.988 42.906  1.00 17.17 ? 8    DT  C "C4'" 1 
ATOM   713   O  "O4'" . DT  D 2 9   ? 110.481 -35.578 42.618  1.00 18.12 ? 8    DT  C "O4'" 1 
ATOM   714   C  "C3'" . DT  D 2 9   ? 109.207 -37.572 42.904  1.00 16.84 ? 8    DT  C "C3'" 1 
ATOM   715   O  "O3'" . DT  D 2 9   ? 108.748 -37.638 44.259  1.00 18.08 ? 8    DT  C "O3'" 1 
ATOM   716   C  "C2'" . DT  D 2 9   ? 108.404 -36.553 42.109  1.00 15.51 ? 8    DT  C "C2'" 1 
ATOM   717   C  "C1'" . DT  D 2 9   ? 109.116 -35.243 42.431  1.00 16.37 ? 8    DT  C "C1'" 1 
ATOM   718   N  N1    . DT  D 2 9   ? 109.061 -34.170 41.410  1.00 16.43 ? 8    DT  C N1    1 
ATOM   719   C  C2    . DT  D 2 9   ? 108.851 -32.876 41.853  1.00 16.32 ? 8    DT  C C2    1 
ATOM   720   O  O2    . DT  D 2 9   ? 108.647 -32.591 43.027  1.00 15.59 ? 8    DT  C O2    1 
ATOM   721   N  N3    . DT  D 2 9   ? 108.884 -31.921 40.864  1.00 14.60 ? 8    DT  C N3    1 
ATOM   722   C  C4    . DT  D 2 9   ? 109.080 -32.121 39.513  1.00 14.94 ? 8    DT  C C4    1 
ATOM   723   O  O4    . DT  D 2 9   ? 109.123 -31.156 38.752  1.00 14.60 ? 8    DT  C O4    1 
ATOM   724   C  C5    . DT  D 2 9   ? 109.240 -33.503 39.110  1.00 15.55 ? 8    DT  C C5    1 
ATOM   725   C  C7    . DT  D 2 9   ? 109.402 -33.820 37.656  1.00 15.58 ? 8    DT  C C7    1 
ATOM   726   C  C6    . DT  D 2 9   ? 109.231 -34.444 40.066  1.00 14.84 ? 8    DT  C C6    1 
ATOM   727   P  P     . DC  D 2 10  ? 107.422 -38.476 44.626  1.00 18.47 ? 9    DC  C P     1 
ATOM   728   O  OP1   . DC  D 2 10  ? 107.758 -39.260 45.843  1.00 19.00 ? 9    DC  C OP1   1 
ATOM   729   O  OP2   . DC  D 2 10  ? 106.891 -39.177 43.428  1.00 17.23 ? 9    DC  C OP2   1 
ATOM   730   O  "O5'" . DC  D 2 10  ? 106.390 -37.337 45.044  1.00 18.89 ? 9    DC  C "O5'" 1 
ATOM   731   C  "C5'" . DC  D 2 10  ? 106.618 -36.547 46.227  1.00 18.92 ? 9    DC  C "C5'" 1 
ATOM   732   C  "C4'" . DC  D 2 10  ? 105.862 -35.241 46.147  1.00 21.53 ? 9    DC  C "C4'" 1 
ATOM   733   O  "O4'" . DC  D 2 10  ? 106.318 -34.474 45.019  1.00 20.99 ? 9    DC  C "O4'" 1 
ATOM   734   C  "C3'" . DC  D 2 10  ? 104.351 -35.351 45.974  1.00 23.42 ? 9    DC  C "C3'" 1 
ATOM   735   O  "O3'" . DC  D 2 10  ? 103.780 -35.400 47.287  1.00 24.69 ? 9    DC  C "O3'" 1 
ATOM   736   C  "C2'" . DC  D 2 10  ? 103.990 -34.042 45.291  1.00 24.19 ? 9    DC  C "C2'" 1 
ATOM   737   C  "C1'" . DC  D 2 10  ? 105.286 -33.589 44.625  1.00 21.45 ? 9    DC  C "C1'" 1 
ATOM   738   N  N1    . DC  D 2 10  ? 105.329 -33.440 43.158  1.00 20.65 ? 9    DC  C N1    1 
ATOM   739   C  C2    . DC  D 2 10  ? 105.232 -32.151 42.636  1.00 19.14 ? 9    DC  C C2    1 
ATOM   740   O  O2    . DC  D 2 10  ? 105.048 -31.205 43.414  1.00 19.65 ? 9    DC  C O2    1 
ATOM   741   N  N3    . DC  D 2 10  ? 105.337 -31.963 41.305  1.00 18.04 ? 9    DC  C N3    1 
ATOM   742   C  C4    . DC  D 2 10  ? 105.515 -33.006 40.497  1.00 18.61 ? 9    DC  C C4    1 
ATOM   743   N  N4    . DC  D 2 10  ? 105.651 -32.758 39.190  1.00 17.23 ? 9    DC  C N4    1 
ATOM   744   C  C5    . DC  D 2 10  ? 105.575 -34.344 40.994  1.00 19.35 ? 9    DC  C C5    1 
ATOM   745   C  C6    . DC  D 2 10  ? 105.479 -34.513 42.323  1.00 18.13 ? 9    DC  C C6    1 
ATOM   746   P  P     . DA  D 2 11  ? 102.205 -35.657 47.487  1.00 24.96 ? 10   DA  C P     1 
ATOM   747   O  OP1   . DA  D 2 11  ? 102.070 -36.027 48.921  1.00 24.56 ? 10   DA  C OP1   1 
ATOM   748   O  OP2   . DA  D 2 11  ? 101.693 -36.568 46.438  1.00 23.47 ? 10   DA  C OP2   1 
ATOM   749   O  "O5'" . DA  D 2 11  ? 101.536 -34.225 47.274  1.00 21.26 ? 10   DA  C "O5'" 1 
ATOM   750   C  "C5'" . DA  D 2 11  ? 101.815 -33.135 48.178  1.00 21.22 ? 10   DA  C "C5'" 1 
ATOM   751   C  "C4'" . DA  D 2 11  ? 100.952 -31.940 47.843  1.00 21.12 ? 10   DA  C "C4'" 1 
ATOM   752   O  "O4'" . DA  D 2 11  ? 101.294 -31.469 46.518  1.00 20.76 ? 10   DA  C "O4'" 1 
ATOM   753   C  "C3'" . DA  D 2 11  ? 99.447  -32.213 47.823  1.00 21.32 ? 10   DA  C "C3'" 1 
ATOM   754   O  "O3'" . DA  D 2 11  ? 98.756  -31.095 48.406  1.00 23.06 ? 10   DA  C "O3'" 1 
ATOM   755   C  "C2'" . DA  D 2 11  ? 99.135  -32.392 46.346  1.00 18.50 ? 10   DA  C "C2'" 1 
ATOM   756   C  "C1'" . DA  D 2 11  ? 100.178 -31.531 45.640  1.00 20.42 ? 10   DA  C "C1'" 1 
ATOM   757   N  N9    . DA  D 2 11  ? 100.655 -32.082 44.364  1.00 18.55 ? 10   DA  C N9    1 
ATOM   758   C  C8    . DA  D 2 11  ? 100.972 -33.393 44.093  1.00 19.30 ? 10   DA  C C8    1 
ATOM   759   N  N7    . DA  D 2 11  ? 101.389 -33.597 42.867  1.00 18.12 ? 10   DA  C N7    1 
ATOM   760   C  C5    . DA  D 2 11  ? 101.345 -32.338 42.286  1.00 17.71 ? 10   DA  C C5    1 
ATOM   761   C  C6    . DA  D 2 11  ? 101.674 -31.881 40.995  1.00 16.96 ? 10   DA  C C6    1 
ATOM   762   N  N6    . DA  D 2 11  ? 102.154 -32.670 40.028  1.00 15.94 ? 10   DA  C N6    1 
ATOM   763   N  N1    . DA  D 2 11  ? 101.502 -30.567 40.732  1.00 16.26 ? 10   DA  C N1    1 
ATOM   764   C  C2    . DA  D 2 11  ? 101.044 -29.774 41.710  1.00 16.39 ? 10   DA  C C2    1 
ATOM   765   N  N3    . DA  D 2 11  ? 100.715 -30.081 42.963  1.00 16.47 ? 10   DA  C N3    1 
ATOM   766   C  C4    . DA  D 2 11  ? 100.887 -31.395 43.193  1.00 17.70 ? 10   DA  C C4    1 
ATOM   767   P  P     . DG  D 2 12  ? 97.146  -31.032 48.387  1.00 23.83 ? 11   DG  C P     1 
ATOM   768   O  OP1   . DG  D 2 12  ? 96.731  -30.188 49.534  1.00 23.00 ? 11   DG  C OP1   1 
ATOM   769   O  OP2   . DG  D 2 12  ? 96.573  -32.394 48.233  1.00 23.85 ? 11   DG  C OP2   1 
ATOM   770   O  "O5'" . DG  D 2 12  ? 96.848  -30.215 47.058  1.00 22.74 ? 11   DG  C "O5'" 1 
ATOM   771   C  "C5'" . DG  D 2 12  ? 97.348  -28.875 46.913  1.00 23.29 ? 11   DG  C "C5'" 1 
ATOM   772   C  "C4'" . DG  D 2 12  ? 96.849  -28.258 45.630  1.00 23.14 ? 11   DG  C "C4'" 1 
ATOM   773   O  "O4'" . DG  D 2 12  ? 97.477  -28.892 44.493  1.00 22.75 ? 11   DG  C "O4'" 1 
ATOM   774   C  "C3'" . DG  D 2 12  ? 95.340  -28.337 45.392  1.00 24.61 ? 11   DG  C "C3'" 1 
ATOM   775   O  "O3'" . DG  D 2 12  ? 94.898  -27.090 44.844  1.00 26.55 ? 11   DG  C "O3'" 1 
ATOM   776   C  "C2'" . DG  D 2 12  ? 95.201  -29.454 44.369  1.00 23.74 ? 11   DG  C "C2'" 1 
ATOM   777   C  "C1'" . DG  D 2 12  ? 96.490  -29.328 43.575  1.00 23.70 ? 11   DG  C "C1'" 1 
ATOM   778   N  N9    . DG  D 2 12  ? 96.986  -30.541 42.929  1.00 23.23 ? 11   DG  C N9    1 
ATOM   779   C  C8    . DG  D 2 12  ? 97.065  -31.812 43.449  1.00 23.49 ? 11   DG  C C8    1 
ATOM   780   N  N7    . DG  D 2 12  ? 97.579  -32.675 42.613  1.00 21.66 ? 11   DG  C N7    1 
ATOM   781   C  C5    . DG  D 2 12  ? 97.851  -31.928 41.475  1.00 22.98 ? 11   DG  C C5    1 
ATOM   782   C  C6    . DG  D 2 12  ? 98.417  -32.313 40.234  1.00 23.19 ? 11   DG  C C6    1 
ATOM   783   O  O6    . DG  D 2 12  ? 98.825  -33.428 39.883  1.00 24.69 ? 11   DG  C O6    1 
ATOM   784   N  N1    . DG  D 2 12  ? 98.495  -31.237 39.353  1.00 22.69 ? 11   DG  C N1    1 
ATOM   785   C  C2    . DG  D 2 12  ? 98.089  -29.955 39.633  1.00 21.55 ? 11   DG  C C2    1 
ATOM   786   N  N2    . DG  D 2 12  ? 98.235  -29.051 38.654  1.00 20.77 ? 11   DG  C N2    1 
ATOM   787   N  N3    . DG  D 2 12  ? 97.575  -29.584 40.786  1.00 22.92 ? 11   DG  C N3    1 
ATOM   788   C  C4    . DG  D 2 12  ? 97.483  -30.613 41.654  1.00 23.04 ? 11   DG  C C4    1 
ATOM   789   P  P     . DG  D 2 13  ? 93.327  -26.801 44.650  1.00 28.17 ? 12   DG  C P     1 
ATOM   790   O  OP1   . DG  D 2 13  ? 93.098  -25.374 45.008  1.00 29.34 ? 12   DG  C OP1   1 
ATOM   791   O  OP2   . DG  D 2 13  ? 92.538  -27.860 45.332  1.00 27.84 ? 12   DG  C OP2   1 
ATOM   792   O  "O5'" . DG  D 2 13  ? 93.119  -26.964 43.082  1.00 29.16 ? 12   DG  C "O5'" 1 
ATOM   793   C  "C5'" . DG  D 2 13  ? 93.507  -25.918 42.176  1.00 33.62 ? 12   DG  C "C5'" 1 
ATOM   794   C  "C4'" . DG  D 2 13  ? 93.344  -26.377 40.747  1.00 36.21 ? 12   DG  C "C4'" 1 
ATOM   795   O  "O4'" . DG  D 2 13  ? 94.276  -27.444 40.482  1.00 38.06 ? 12   DG  C "O4'" 1 
ATOM   796   C  "C3'" . DG  D 2 13  ? 91.974  -26.952 40.395  1.00 37.88 ? 12   DG  C "C3'" 1 
ATOM   797   O  "O3'" . DG  D 2 13  ? 91.068  -25.902 39.995  1.00 40.54 ? 12   DG  C "O3'" 1 
ATOM   798   C  "C2'" . DG  D 2 13  ? 92.290  -27.876 39.233  1.00 38.07 ? 12   DG  C "C2'" 1 
ATOM   799   C  "C1'" . DG  D 2 13  ? 93.743  -28.292 39.473  1.00 36.71 ? 12   DG  C "C1'" 1 
ATOM   800   N  N9    . DG  D 2 13  ? 93.996  -29.679 39.855  1.00 34.62 ? 12   DG  C N9    1 
ATOM   801   C  C8    . DG  D 2 13  ? 93.628  -30.324 41.012  1.00 33.29 ? 12   DG  C C8    1 
ATOM   802   N  N7    . DG  D 2 13  ? 94.017  -31.570 41.048  1.00 32.93 ? 12   DG  C N7    1 
ATOM   803   C  C5    . DG  D 2 13  ? 94.678  -31.758 39.841  1.00 32.69 ? 12   DG  C C5    1 
ATOM   804   C  C6    . DG  D 2 13  ? 95.319  -32.910 39.306  1.00 32.23 ? 12   DG  C C6    1 
ATOM   805   O  O6    . DG  D 2 13  ? 95.436  -34.034 39.808  1.00 32.19 ? 12   DG  C O6    1 
ATOM   806   N  N1    . DG  D 2 13  ? 95.863  -32.653 38.051  1.00 31.79 ? 12   DG  C N1    1 
ATOM   807   C  C2    . DG  D 2 13  ? 95.803  -31.449 37.395  1.00 30.56 ? 12   DG  C C2    1 
ATOM   808   N  N2    . DG  D 2 13  ? 96.395  -31.390 36.196  1.00 28.74 ? 12   DG  C N2    1 
ATOM   809   N  N3    . DG  D 2 13  ? 95.210  -30.378 37.879  1.00 32.19 ? 12   DG  C N3    1 
ATOM   810   C  C4    . DG  D 2 13  ? 94.673  -30.601 39.096  1.00 32.51 ? 12   DG  C C4    1 
ATOM   811   N  N     . ALA E 3 1   ? 109.458 -62.544 2.143   1.00 67.51 ? 297  ALA A N     1 
ATOM   812   C  CA    . ALA E 3 1   ? 110.373 -61.458 2.603   1.00 67.13 ? 297  ALA A CA    1 
ATOM   813   C  C     . ALA E 3 1   ? 109.991 -60.993 4.008   1.00 66.73 ? 297  ALA A C     1 
ATOM   814   O  O     . ALA E 3 1   ? 109.784 -59.802 4.248   1.00 66.93 ? 297  ALA A O     1 
ATOM   815   C  CB    . ALA E 3 1   ? 110.317 -60.286 1.625   1.00 67.46 ? 297  ALA A CB    1 
ATOM   816   N  N     . LYS E 3 2   ? 109.903 -61.945 4.933   1.00 65.68 ? 298  LYS A N     1 
ATOM   817   C  CA    . LYS E 3 2   ? 109.542 -61.651 6.316   1.00 63.87 ? 298  LYS A CA    1 
ATOM   818   C  C     . LYS E 3 2   ? 110.766 -61.825 7.211   1.00 61.75 ? 298  LYS A C     1 
ATOM   819   O  O     . LYS E 3 2   ? 111.869 -61.411 6.849   1.00 62.18 ? 298  LYS A O     1 
ATOM   820   C  CB    . LYS E 3 2   ? 108.427 -62.597 6.768   1.00 64.94 ? 298  LYS A CB    1 
ATOM   821   C  CG    . LYS E 3 2   ? 107.237 -62.641 5.819   1.00 66.41 ? 298  LYS A CG    1 
ATOM   822   C  CD    . LYS E 3 2   ? 106.195 -63.650 6.279   1.00 67.71 ? 298  LYS A CD    1 
ATOM   823   C  CE    . LYS E 3 2   ? 104.999 -63.679 5.339   1.00 68.13 ? 298  LYS A CE    1 
ATOM   824   N  NZ    . LYS E 3 2   ? 103.965 -64.655 5.784   1.00 68.77 ? 298  LYS A NZ    1 
ATOM   825   N  N     . MET E 3 3   ? 110.570 -62.434 8.377   1.00 58.72 ? 299  MET A N     1 
ATOM   826   C  CA    . MET E 3 3   ? 111.673 -62.675 9.300   1.00 55.34 ? 299  MET A CA    1 
ATOM   827   C  C     . MET E 3 3   ? 111.492 -63.984 10.056  1.00 53.25 ? 299  MET A C     1 
ATOM   828   O  O     . MET E 3 3   ? 110.819 -64.034 11.086  1.00 52.67 ? 299  MET A O     1 
ATOM   829   C  CB    . MET E 3 3   ? 111.810 -61.531 10.303  1.00 54.92 ? 299  MET A CB    1 
ATOM   830   C  CG    . MET E 3 3   ? 113.021 -61.689 11.210  1.00 54.29 ? 299  MET A CG    1 
ATOM   831   S  SD    . MET E 3 3   ? 113.216 -60.357 12.394  1.00 53.02 ? 299  MET A SD    1 
ATOM   832   C  CE    . MET E 3 3   ? 113.890 -59.075 11.349  1.00 52.92 ? 299  MET A CE    1 
ATOM   833   N  N     . ALA E 3 4   ? 112.104 -65.042 9.537   1.00 50.92 ? 300  ALA A N     1 
ATOM   834   C  CA    . ALA E 3 4   ? 112.020 -66.358 10.155  1.00 48.94 ? 300  ALA A CA    1 
ATOM   835   C  C     . ALA E 3 4   ? 112.896 -66.423 11.401  1.00 47.35 ? 300  ALA A C     1 
ATOM   836   O  O     . ALA E 3 4   ? 113.991 -65.858 11.431  1.00 46.72 ? 300  ALA A O     1 
ATOM   837   C  CB    . ALA E 3 4   ? 112.452 -67.429 9.155   1.00 48.16 ? 300  ALA A CB    1 
ATOM   838   N  N     . PHE E 3 5   ? 112.410 -67.111 12.429  1.00 45.78 ? 301  PHE A N     1 
ATOM   839   C  CA    . PHE E 3 5   ? 113.165 -67.260 13.667  1.00 44.43 ? 301  PHE A CA    1 
ATOM   840   C  C     . PHE E 3 5   ? 112.774 -68.552 14.371  1.00 43.96 ? 301  PHE A C     1 
ATOM   841   O  O     . PHE E 3 5   ? 111.828 -69.230 13.968  1.00 43.70 ? 301  PHE A O     1 
ATOM   842   C  CB    . PHE E 3 5   ? 112.931 -66.057 14.590  1.00 43.71 ? 301  PHE A CB    1 
ATOM   843   C  CG    . PHE E 3 5   ? 111.574 -66.030 15.230  1.00 42.45 ? 301  PHE A CG    1 
ATOM   844   C  CD1   . PHE E 3 5   ? 111.328 -66.742 16.401  1.00 42.61 ? 301  PHE A CD1   1 
ATOM   845   C  CD2   . PHE E 3 5   ? 110.540 -65.294 14.662  1.00 42.45 ? 301  PHE A CD2   1 
ATOM   846   C  CE1   . PHE E 3 5   ? 110.073 -66.721 16.998  1.00 41.87 ? 301  PHE A CE1   1 
ATOM   847   C  CE2   . PHE E 3 5   ? 109.279 -65.266 15.250  1.00 42.29 ? 301  PHE A CE2   1 
ATOM   848   C  CZ    . PHE E 3 5   ? 109.045 -65.980 16.421  1.00 42.24 ? 301  PHE A CZ    1 
ATOM   849   N  N     . THR E 3 6   ? 113.507 -68.883 15.427  1.00 43.40 ? 302  THR A N     1 
ATOM   850   C  CA    . THR E 3 6   ? 113.259 -70.098 16.188  1.00 44.17 ? 302  THR A CA    1 
ATOM   851   C  C     . THR E 3 6   ? 112.763 -69.828 17.599  1.00 43.78 ? 302  THR A C     1 
ATOM   852   O  O     . THR E 3 6   ? 113.373 -69.067 18.350  1.00 43.52 ? 302  THR A O     1 
ATOM   853   C  CB    . THR E 3 6   ? 114.535 -70.945 16.309  1.00 44.32 ? 302  THR A CB    1 
ATOM   854   O  OG1   . THR E 3 6   ? 114.998 -71.304 15.004  1.00 46.57 ? 302  THR A OG1   1 
ATOM   855   C  CG2   . THR E 3 6   ? 114.263 -72.206 17.113  1.00 44.89 ? 302  THR A CG2   1 
ATOM   856   N  N     . LEU E 3 7   ? 111.652 -70.459 17.956  1.00 44.28 ? 303  LEU A N     1 
ATOM   857   C  CA    . LEU E 3 7   ? 111.105 -70.316 19.295  1.00 45.31 ? 303  LEU A CA    1 
ATOM   858   C  C     . LEU E 3 7   ? 111.560 -71.577 20.022  1.00 45.92 ? 303  LEU A C     1 
ATOM   859   O  O     . LEU E 3 7   ? 110.795 -72.522 20.204  1.00 46.38 ? 303  LEU A O     1 
ATOM   860   C  CB    . LEU E 3 7   ? 109.578 -70.231 19.240  1.00 45.98 ? 303  LEU A CB    1 
ATOM   861   C  CG    . LEU E 3 7   ? 108.886 -69.684 20.493  1.00 46.80 ? 303  LEU A CG    1 
ATOM   862   C  CD1   . LEU E 3 7   ? 107.452 -69.328 20.158  1.00 46.97 ? 303  LEU A CD1   1 
ATOM   863   C  CD2   . LEU E 3 7   ? 108.940 -70.703 21.620  1.00 46.91 ? 303  LEU A CD2   1 
ATOM   864   N  N     . ALA E 3 8   ? 112.826 -71.574 20.426  1.00 46.17 ? 304  ALA A N     1 
ATOM   865   C  CA    . ALA E 3 8   ? 113.441 -72.708 21.101  1.00 46.77 ? 304  ALA A CA    1 
ATOM   866   C  C     . ALA E 3 8   ? 112.825 -73.055 22.446  1.00 47.03 ? 304  ALA A C     1 
ATOM   867   O  O     . ALA E 3 8   ? 112.263 -72.198 23.128  1.00 47.36 ? 304  ALA A O     1 
ATOM   868   C  CB    . ALA E 3 8   ? 114.932 -72.450 21.270  1.00 46.94 ? 304  ALA A CB    1 
ATOM   869   N  N     . ASP E 3 9   ? 112.936 -74.328 22.817  1.00 47.28 ? 305  ASP A N     1 
ATOM   870   C  CA    . ASP E 3 9   ? 112.423 -74.808 24.095  1.00 47.44 ? 305  ASP A CA    1 
ATOM   871   C  C     . ASP E 3 9   ? 113.602 -75.255 24.950  1.00 46.33 ? 305  ASP A C     1 
ATOM   872   O  O     . ASP E 3 9   ? 113.430 -75.745 26.067  1.00 46.36 ? 305  ASP A O     1 
ATOM   873   C  CB    . ASP E 3 9   ? 111.443 -75.972 23.893  1.00 50.01 ? 305  ASP A CB    1 
ATOM   874   C  CG    . ASP E 3 9   ? 112.045 -77.122 23.104  1.00 52.67 ? 305  ASP A CG    1 
ATOM   875   O  OD1   . ASP E 3 9   ? 113.144 -77.594 23.469  1.00 54.23 ? 305  ASP A OD1   1 
ATOM   876   O  OD2   . ASP E 3 9   ? 111.410 -77.561 22.119  1.00 54.47 ? 305  ASP A OD2   1 
ATOM   877   N  N     . ARG E 3 10  ? 114.802 -75.079 24.406  1.00 44.98 ? 306  ARG A N     1 
ATOM   878   C  CA    . ARG E 3 10  ? 116.034 -75.442 25.093  1.00 44.21 ? 306  ARG A CA    1 
ATOM   879   C  C     . ARG E 3 10  ? 117.220 -74.753 24.426  1.00 42.63 ? 306  ARG A C     1 
ATOM   880   O  O     . ARG E 3 10  ? 117.176 -74.430 23.240  1.00 40.96 ? 306  ARG A O     1 
ATOM   881   C  CB    . ARG E 3 10  ? 116.231 -76.961 25.073  1.00 46.22 ? 306  ARG A CB    1 
ATOM   882   C  CG    . ARG E 3 10  ? 116.321 -77.567 23.684  1.00 49.04 ? 306  ARG A CG    1 
ATOM   883   C  CD    . ARG E 3 10  ? 116.531 -79.070 23.762  1.00 52.07 ? 306  ARG A CD    1 
ATOM   884   N  NE    . ARG E 3 10  ? 116.633 -79.684 22.439  1.00 55.10 ? 306  ARG A NE    1 
ATOM   885   C  CZ    . ARG E 3 10  ? 115.642 -79.732 21.553  1.00 55.95 ? 306  ARG A CZ    1 
ATOM   886   N  NH1   . ARG E 3 10  ? 114.460 -79.202 21.843  1.00 56.28 ? 306  ARG A NH1   1 
ATOM   887   N  NH2   . ARG E 3 10  ? 115.834 -80.314 20.376  1.00 56.74 ? 306  ARG A NH2   1 
ATOM   888   N  N     . VAL E 3 11  ? 118.280 -74.531 25.196  1.00 41.40 ? 307  VAL A N     1 
ATOM   889   C  CA    . VAL E 3 11  ? 119.474 -73.866 24.687  1.00 41.40 ? 307  VAL A CA    1 
ATOM   890   C  C     . VAL E 3 11  ? 120.347 -74.782 23.835  1.00 41.30 ? 307  VAL A C     1 
ATOM   891   O  O     . VAL E 3 11  ? 120.631 -75.915 24.221  1.00 41.41 ? 307  VAL A O     1 
ATOM   892   C  CB    . VAL E 3 11  ? 120.338 -73.322 25.849  1.00 40.94 ? 307  VAL A CB    1 
ATOM   893   C  CG1   . VAL E 3 11  ? 121.571 -72.615 25.297  1.00 40.09 ? 307  VAL A CG1   1 
ATOM   894   C  CG2   . VAL E 3 11  ? 119.517 -72.372 26.709  1.00 41.00 ? 307  VAL A CG2   1 
ATOM   895   N  N     . THR E 3 12  ? 120.771 -74.286 22.677  1.00 41.12 ? 308  THR A N     1 
ATOM   896   C  CA    . THR E 3 12  ? 121.638 -75.055 21.788  1.00 41.43 ? 308  THR A CA    1 
ATOM   897   C  C     . THR E 3 12  ? 122.991 -74.359 21.657  1.00 41.80 ? 308  THR A C     1 
ATOM   898   O  O     . THR E 3 12  ? 123.121 -73.169 21.947  1.00 41.12 ? 308  THR A O     1 
ATOM   899   C  CB    . THR E 3 12  ? 121.028 -75.217 20.380  1.00 41.14 ? 308  THR A CB    1 
ATOM   900   O  OG1   . THR E 3 12  ? 120.774 -73.927 19.814  1.00 41.59 ? 308  THR A OG1   1 
ATOM   901   C  CG2   . THR E 3 12  ? 119.732 -76.012 20.447  1.00 40.10 ? 308  THR A CG2   1 
ATOM   902   N  N     . GLU E 3 13  ? 123.996 -75.109 21.220  1.00 41.43 ? 309  GLU A N     1 
ATOM   903   C  CA    . GLU E 3 13  ? 125.346 -74.581 21.061  1.00 42.32 ? 309  GLU A CA    1 
ATOM   904   C  C     . GLU E 3 13  ? 125.430 -73.449 20.034  1.00 41.01 ? 309  GLU A C     1 
ATOM   905   O  O     . GLU E 3 13  ? 126.223 -72.521 20.192  1.00 39.96 ? 309  GLU A O     1 
ATOM   906   C  CB    . GLU E 3 13  ? 126.292 -75.715 20.660  1.00 44.55 ? 309  GLU A CB    1 
ATOM   907   C  CG    . GLU E 3 13  ? 127.734 -75.297 20.438  1.00 48.51 ? 309  GLU A CG    1 
ATOM   908   C  CD    . GLU E 3 13  ? 128.580 -76.430 19.878  1.00 51.33 ? 309  GLU A CD    1 
ATOM   909   O  OE1   . GLU E 3 13  ? 128.266 -76.919 18.770  1.00 52.28 ? 309  GLU A OE1   1 
ATOM   910   O  OE2   . GLU E 3 13  ? 129.557 -76.833 20.546  1.00 52.91 ? 309  GLU A OE2   1 
ATOM   911   N  N     . GLU E 3 14  ? 124.607 -73.523 18.993  1.00 40.60 ? 310  GLU A N     1 
ATOM   912   C  CA    . GLU E 3 14  ? 124.617 -72.512 17.937  1.00 40.83 ? 310  GLU A CA    1 
ATOM   913   C  C     . GLU E 3 14  ? 124.218 -71.119 18.426  1.00 39.70 ? 310  GLU A C     1 
ATOM   914   O  O     . GLU E 3 14  ? 124.713 -70.113 17.916  1.00 39.09 ? 310  GLU A O     1 
ATOM   915   C  CB    . GLU E 3 14  ? 123.703 -72.940 16.783  1.00 41.94 ? 310  GLU A CB    1 
ATOM   916   C  CG    . GLU E 3 14  ? 122.216 -72.815 17.074  1.00 45.24 ? 310  GLU A CG    1 
ATOM   917   C  CD    . GLU E 3 14  ? 121.351 -73.363 15.950  1.00 46.98 ? 310  GLU A CD    1 
ATOM   918   O  OE1   . GLU E 3 14  ? 121.667 -73.100 14.769  1.00 46.77 ? 310  GLU A OE1   1 
ATOM   919   O  OE2   . GLU E 3 14  ? 120.351 -74.051 16.251  1.00 48.69 ? 310  GLU A OE2   1 
ATOM   920   N  N     . MET E 3 15  ? 123.325 -71.052 19.408  1.00 38.71 ? 311  MET A N     1 
ATOM   921   C  CA    . MET E 3 15  ? 122.902 -69.758 19.935  1.00 37.39 ? 311  MET A CA    1 
ATOM   922   C  C     . MET E 3 15  ? 123.897 -69.208 20.955  1.00 36.33 ? 311  MET A C     1 
ATOM   923   O  O     . MET E 3 15  ? 123.634 -68.201 21.613  1.00 36.64 ? 311  MET A O     1 
ATOM   924   C  CB    . MET E 3 15  ? 121.492 -69.851 20.546  1.00 36.73 ? 311  MET A CB    1 
ATOM   925   C  CG    . MET E 3 15  ? 121.181 -71.140 21.294  1.00 37.07 ? 311  MET A CG    1 
ATOM   926   S  SD    . MET E 3 15  ? 119.466 -71.226 21.903  1.00 36.92 ? 311  MET A SD    1 
ATOM   927   C  CE    . MET E 3 15  ? 118.607 -71.879 20.489  1.00 38.52 ? 311  MET A CE    1 
ATOM   928   N  N     . LEU E 3 16  ? 125.051 -69.862 21.066  1.00 34.44 ? 312  LEU A N     1 
ATOM   929   C  CA    . LEU E 3 16  ? 126.086 -69.437 22.004  1.00 33.77 ? 312  LEU A CA    1 
ATOM   930   C  C     . LEU E 3 16  ? 127.371 -69.009 21.294  1.00 33.61 ? 312  LEU A C     1 
ATOM   931   O  O     . LEU E 3 16  ? 128.471 -69.235 21.799  1.00 32.47 ? 312  LEU A O     1 
ATOM   932   C  CB    . LEU E 3 16  ? 126.401 -70.566 22.992  1.00 34.26 ? 312  LEU A CB    1 
ATOM   933   C  CG    . LEU E 3 16  ? 125.244 -71.101 23.841  1.00 34.73 ? 312  LEU A CG    1 
ATOM   934   C  CD1   . LEU E 3 16  ? 125.749 -72.228 24.733  1.00 34.46 ? 312  LEU A CD1   1 
ATOM   935   C  CD2   . LEU E 3 16  ? 124.648 -69.973 24.676  1.00 34.76 ? 312  LEU A CD2   1 
ATOM   936   N  N     . ALA E 3 17  ? 127.228 -68.391 20.126  1.00 33.15 ? 313  ALA A N     1 
ATOM   937   C  CA    . ALA E 3 17  ? 128.379 -67.925 19.355  1.00 32.94 ? 313  ALA A CA    1 
ATOM   938   C  C     . ALA E 3 17  ? 129.117 -66.832 20.121  1.00 33.07 ? 313  ALA A C     1 
ATOM   939   O  O     . ALA E 3 17  ? 128.588 -66.271 21.081  1.00 33.39 ? 313  ALA A O     1 
ATOM   940   C  CB    . ALA E 3 17  ? 127.923 -67.399 18.002  1.00 32.97 ? 313  ALA A CB    1 
ATOM   941   N  N     . ASP E 3 18  ? 130.338 -66.523 19.692  1.00 33.14 ? 314  ASP A N     1 
ATOM   942   C  CA    . ASP E 3 18  ? 131.142 -65.507 20.365  1.00 31.99 ? 314  ASP A CA    1 
ATOM   943   C  C     . ASP E 3 18  ? 130.785 -64.085 19.940  1.00 30.58 ? 314  ASP A C     1 
ATOM   944   O  O     . ASP E 3 18  ? 131.492 -63.135 20.272  1.00 29.54 ? 314  ASP A O     1 
ATOM   945   C  CB    . ASP E 3 18  ? 132.629 -65.766 20.119  1.00 34.24 ? 314  ASP A CB    1 
ATOM   946   C  CG    . ASP E 3 18  ? 133.024 -65.557 18.678  1.00 34.99 ? 314  ASP A CG    1 
ATOM   947   O  OD1   . ASP E 3 18  ? 132.353 -66.123 17.791  1.00 38.17 ? 314  ASP A OD1   1 
ATOM   948   O  OD2   . ASP E 3 18  ? 134.006 -64.829 18.431  1.00 37.35 ? 314  ASP A OD2   1 
ATOM   949   N  N     . LYS E 3 19  ? 129.685 -63.951 19.207  1.00 29.71 ? 315  LYS A N     1 
ATOM   950   C  CA    . LYS E 3 19  ? 129.208 -62.651 18.744  1.00 29.57 ? 315  LYS A CA    1 
ATOM   951   C  C     . LYS E 3 19  ? 127.710 -62.723 18.452  1.00 28.33 ? 315  LYS A C     1 
ATOM   952   O  O     . LYS E 3 19  ? 127.257 -63.587 17.698  1.00 26.93 ? 315  LYS A O     1 
ATOM   953   C  CB    . LYS E 3 19  ? 129.961 -62.232 17.480  1.00 31.91 ? 315  LYS A CB    1 
ATOM   954   C  CG    . LYS E 3 19  ? 129.427 -60.969 16.814  1.00 34.99 ? 315  LYS A CG    1 
ATOM   955   C  CD    . LYS E 3 19  ? 129.616 -59.731 17.677  1.00 37.38 ? 315  LYS A CD    1 
ATOM   956   C  CE    . LYS E 3 19  ? 129.181 -58.476 16.924  1.00 39.54 ? 315  LYS A CE    1 
ATOM   957   N  NZ    . LYS E 3 19  ? 129.399 -57.227 17.704  1.00 40.98 ? 315  LYS A NZ    1 
ATOM   958   N  N     . ALA E 3 20  ? 126.938 -61.816 19.046  1.00 24.96 ? 316  ALA A N     1 
ATOM   959   C  CA    . ALA E 3 20  ? 125.497 -61.811 18.824  1.00 25.06 ? 316  ALA A CA    1 
ATOM   960   C  C     . ALA E 3 20  ? 124.798 -60.577 19.372  1.00 24.20 ? 316  ALA A C     1 
ATOM   961   O  O     . ALA E 3 20  ? 125.339 -59.853 20.212  1.00 24.02 ? 316  ALA A O     1 
ATOM   962   C  CB    . ALA E 3 20  ? 124.871 -63.061 19.446  1.00 24.68 ? 316  ALA A CB    1 
ATOM   963   N  N     . ALA E 3 21  ? 123.587 -60.348 18.877  1.00 24.55 ? 317  ALA A N     1 
ATOM   964   C  CA    . ALA E 3 21  ? 122.756 -59.247 19.344  1.00 23.32 ? 317  ALA A CA    1 
ATOM   965   C  C     . ALA E 3 21  ? 121.909 -59.933 20.405  1.00 23.64 ? 317  ALA A C     1 
ATOM   966   O  O     . ALA E 3 21  ? 121.290 -60.960 20.131  1.00 23.15 ? 317  ALA A O     1 
ATOM   967   C  CB    . ALA E 3 21  ? 121.879 -58.725 18.221  1.00 23.87 ? 317  ALA A CB    1 
ATOM   968   N  N     . LEU E 3 22  ? 121.893 -59.377 21.611  1.00 22.17 ? 318  LEU A N     1 
ATOM   969   C  CA    . LEU E 3 22  ? 121.144 -59.967 22.710  1.00 21.95 ? 318  LEU A CA    1 
ATOM   970   C  C     . LEU E 3 22  ? 120.063 -59.046 23.260  1.00 22.31 ? 318  LEU A C     1 
ATOM   971   O  O     . LEU E 3 22  ? 120.294 -57.852 23.483  1.00 20.05 ? 318  LEU A O     1 
ATOM   972   C  CB    . LEU E 3 22  ? 122.103 -60.349 23.842  1.00 23.29 ? 318  LEU A CB    1 
ATOM   973   C  CG    . LEU E 3 22  ? 121.490 -60.818 25.168  1.00 23.94 ? 318  LEU A CG    1 
ATOM   974   C  CD1   . LEU E 3 22  ? 120.774 -62.148 24.974  1.00 24.44 ? 318  LEU A CD1   1 
ATOM   975   C  CD2   . LEU E 3 22  ? 122.589 -60.951 26.210  1.00 23.93 ? 318  LEU A CD2   1 
ATOM   976   N  N     . VAL E 3 23  ? 118.883 -59.617 23.472  1.00 20.53 ? 319  VAL A N     1 
ATOM   977   C  CA    . VAL E 3 23  ? 117.748 -58.888 24.022  1.00 21.33 ? 319  VAL A CA    1 
ATOM   978   C  C     . VAL E 3 23  ? 117.261 -59.619 25.275  1.00 22.20 ? 319  VAL A C     1 
ATOM   979   O  O     . VAL E 3 23  ? 116.815 -60.768 25.203  1.00 21.43 ? 319  VAL A O     1 
ATOM   980   C  CB    . VAL E 3 23  ? 116.574 -58.804 23.013  1.00 22.25 ? 319  VAL A CB    1 
ATOM   981   C  CG1   . VAL E 3 23  ? 115.348 -58.196 23.682  1.00 21.52 ? 319  VAL A CG1   1 
ATOM   982   C  CG2   . VAL E 3 23  ? 116.977 -57.968 21.810  1.00 21.94 ? 319  VAL A CG2   1 
ATOM   983   N  N     . VAL E 3 24  ? 117.368 -58.951 26.417  1.00 20.00 ? 320  VAL A N     1 
ATOM   984   C  CA    . VAL E 3 24  ? 116.911 -59.495 27.695  1.00 20.94 ? 320  VAL A CA    1 
ATOM   985   C  C     . VAL E 3 24  ? 115.863 -58.470 28.106  1.00 21.92 ? 320  VAL A C     1 
ATOM   986   O  O     . VAL E 3 24  ? 116.170 -57.471 28.757  1.00 21.37 ? 320  VAL A O     1 
ATOM   987   C  CB    . VAL E 3 24  ? 118.059 -59.546 28.723  1.00 20.21 ? 320  VAL A CB    1 
ATOM   988   C  CG1   . VAL E 3 24  ? 117.562 -60.135 30.040  1.00 20.56 ? 320  VAL A CG1   1 
ATOM   989   C  CG2   . VAL E 3 24  ? 119.202 -60.387 28.168  1.00 20.94 ? 320  VAL A CG2   1 
ATOM   990   N  N     . GLU E 3 25  ? 114.626 -58.741 27.700  1.00 22.14 ? 321  GLU A N     1 
ATOM   991   C  CA    . GLU E 3 25  ? 113.492 -57.848 27.909  1.00 21.89 ? 321  GLU A CA    1 
ATOM   992   C  C     . GLU E 3 25  ? 112.956 -57.635 29.321  1.00 22.06 ? 321  GLU A C     1 
ATOM   993   O  O     . GLU E 3 25  ? 112.458 -58.559 29.964  1.00 20.85 ? 321  GLU A O     1 
ATOM   994   C  CB    . GLU E 3 25  ? 112.334 -58.290 27.004  1.00 22.31 ? 321  GLU A CB    1 
ATOM   995   C  CG    . GLU E 3 25  ? 111.279 -57.215 26.767  1.00 21.48 ? 321  GLU A CG    1 
ATOM   996   C  CD    . GLU E 3 25  ? 111.681 -56.222 25.687  1.00 22.68 ? 321  GLU A CD    1 
ATOM   997   O  OE1   . GLU E 3 25  ? 112.896 -56.033 25.465  1.00 22.98 ? 321  GLU A OE1   1 
ATOM   998   O  OE2   . GLU E 3 25  ? 110.779 -55.624 25.061  1.00 22.41 ? 321  GLU A OE2   1 
ATOM   999   N  N     . VAL E 3 26  ? 113.054 -56.393 29.784  1.00 22.10 ? 322  VAL A N     1 
ATOM   1000  C  CA    . VAL E 3 26  ? 112.546 -55.992 31.091  1.00 22.14 ? 322  VAL A CA    1 
ATOM   1001  C  C     . VAL E 3 26  ? 111.568 -54.856 30.783  1.00 22.42 ? 322  VAL A C     1 
ATOM   1002  O  O     . VAL E 3 26  ? 111.981 -53.729 30.519  1.00 20.55 ? 322  VAL A O     1 
ATOM   1003  C  CB    . VAL E 3 26  ? 113.680 -55.481 31.997  1.00 23.56 ? 322  VAL A CB    1 
ATOM   1004  C  CG1   . VAL E 3 26  ? 113.119 -55.048 33.347  1.00 22.28 ? 322  VAL A CG1   1 
ATOM   1005  C  CG2   . VAL E 3 26  ? 114.723 -56.580 32.181  1.00 23.59 ? 322  VAL A CG2   1 
ATOM   1006  N  N     . VAL E 3 27  ? 110.274 -55.166 30.813  1.00 22.31 ? 323  VAL A N     1 
ATOM   1007  C  CA    . VAL E 3 27  ? 109.232 -54.195 30.484  1.00 24.21 ? 323  VAL A CA    1 
ATOM   1008  C  C     . VAL E 3 27  ? 108.970 -53.096 31.512  1.00 24.96 ? 323  VAL A C     1 
ATOM   1009  O  O     . VAL E 3 27  ? 108.693 -51.957 31.137  1.00 24.43 ? 323  VAL A O     1 
ATOM   1010  C  CB    . VAL E 3 27  ? 107.905 -54.920 30.164  1.00 24.26 ? 323  VAL A CB    1 
ATOM   1011  C  CG1   . VAL E 3 27  ? 106.816 -53.913 29.841  1.00 25.49 ? 323  VAL A CG1   1 
ATOM   1012  C  CG2   . VAL E 3 27  ? 108.110 -55.855 28.993  1.00 25.46 ? 323  VAL A CG2   1 
ATOM   1013  N  N     . GLU E 3 28  ? 109.047 -53.426 32.797  1.00 24.60 ? 324  GLU A N     1 
ATOM   1014  C  CA    . GLU E 3 28  ? 108.836 -52.431 33.847  1.00 25.33 ? 324  GLU A CA    1 
ATOM   1015  C  C     . GLU E 3 28  ? 109.834 -51.279 33.702  1.00 24.26 ? 324  GLU A C     1 
ATOM   1016  O  O     . GLU E 3 28  ? 111.036 -51.510 33.557  1.00 21.89 ? 324  GLU A O     1 
ATOM   1017  C  CB    . GLU E 3 28  ? 109.008 -53.073 35.228  1.00 27.96 ? 324  GLU A CB    1 
ATOM   1018  C  CG    . GLU E 3 28  ? 107.741 -53.671 35.821  1.00 35.42 ? 324  GLU A CG    1 
ATOM   1019  C  CD    . GLU E 3 28  ? 106.736 -52.605 36.227  1.00 39.67 ? 324  GLU A CD    1 
ATOM   1020  O  OE1   . GLU E 3 28  ? 107.093 -51.725 37.043  1.00 42.72 ? 324  GLU A OE1   1 
ATOM   1021  O  OE2   . GLU E 3 28  ? 105.590 -52.646 35.734  1.00 43.31 ? 324  GLU A OE2   1 
ATOM   1022  N  N     . GLU E 3 29  ? 109.340 -50.042 33.749  1.00 23.40 ? 325  GLU A N     1 
ATOM   1023  C  CA    . GLU E 3 29  ? 110.215 -48.875 33.627  1.00 23.41 ? 325  GLU A CA    1 
ATOM   1024  C  C     . GLU E 3 29  ? 111.356 -48.968 34.635  1.00 21.63 ? 325  GLU A C     1 
ATOM   1025  O  O     . GLU E 3 29  ? 112.522 -48.773 34.289  1.00 20.89 ? 325  GLU A O     1 
ATOM   1026  C  CB    . GLU E 3 29  ? 109.437 -47.576 33.866  1.00 26.46 ? 325  GLU A CB    1 
ATOM   1027  C  CG    . GLU E 3 29  ? 108.413 -47.220 32.794  1.00 34.28 ? 325  GLU A CG    1 
ATOM   1028  C  CD    . GLU E 3 29  ? 107.151 -48.071 32.855  1.00 39.99 ? 325  GLU A CD    1 
ATOM   1029  O  OE1   . GLU E 3 29  ? 106.937 -48.768 33.874  1.00 42.47 ? 325  GLU A OE1   1 
ATOM   1030  O  OE2   . GLU E 3 29  ? 106.361 -48.027 31.884  1.00 43.68 ? 325  GLU A OE2   1 
ATOM   1031  N  N     . ASN E 3 30  ? 111.018 -49.262 35.886  1.00 19.44 ? 326  ASN A N     1 
ATOM   1032  C  CA    . ASN E 3 30  ? 112.032 -49.406 36.924  1.00 19.69 ? 326  ASN A CA    1 
ATOM   1033  C  C     . ASN E 3 30  ? 112.446 -50.870 36.869  1.00 19.21 ? 326  ASN A C     1 
ATOM   1034  O  O     . ASN E 3 30  ? 111.700 -51.742 37.312  1.00 17.64 ? 326  ASN A O     1 
ATOM   1035  C  CB    . ASN E 3 30  ? 111.448 -49.081 38.299  1.00 20.05 ? 326  ASN A CB    1 
ATOM   1036  C  CG    . ASN E 3 30  ? 112.504 -49.060 39.385  1.00 20.93 ? 326  ASN A CG    1 
ATOM   1037  O  OD1   . ASN E 3 30  ? 113.358 -49.941 39.450  1.00 19.09 ? 326  ASN A OD1   1 
ATOM   1038  N  ND2   . ASN E 3 30  ? 112.449 -48.054 40.248  1.00 22.22 ? 326  ASN A ND2   1 
ATOM   1039  N  N     . TYR E 3 31  ? 113.630 -51.140 36.327  1.00 17.50 ? 327  TYR A N     1 
ATOM   1040  C  CA    . TYR E 3 31  ? 114.091 -52.514 36.184  1.00 17.82 ? 327  TYR A CA    1 
ATOM   1041  C  C     . TYR E 3 31  ? 114.643 -53.220 37.422  1.00 18.84 ? 327  TYR A C     1 
ATOM   1042  O  O     . TYR E 3 31  ? 114.985 -54.402 37.351  1.00 18.01 ? 327  TYR A O     1 
ATOM   1043  C  CB    . TYR E 3 31  ? 115.115 -52.595 35.048  1.00 15.63 ? 327  TYR A CB    1 
ATOM   1044  C  CG    . TYR E 3 31  ? 116.226 -51.575 35.150  1.00 16.47 ? 327  TYR A CG    1 
ATOM   1045  C  CD1   . TYR E 3 31  ? 117.203 -51.675 36.139  1.00 15.18 ? 327  TYR A CD1   1 
ATOM   1046  C  CD2   . TYR E 3 31  ? 116.309 -50.517 34.242  1.00 14.42 ? 327  TYR A CD2   1 
ATOM   1047  C  CE1   . TYR E 3 31  ? 118.245 -50.748 36.221  1.00 16.12 ? 327  TYR A CE1   1 
ATOM   1048  C  CE2   . TYR E 3 31  ? 117.343 -49.584 34.317  1.00 17.70 ? 327  TYR A CE2   1 
ATOM   1049  C  CZ    . TYR E 3 31  ? 118.308 -49.706 35.305  1.00 15.59 ? 327  TYR A CZ    1 
ATOM   1050  O  OH    . TYR E 3 31  ? 119.337 -48.795 35.375  1.00 16.59 ? 327  TYR A OH    1 
ATOM   1051  N  N     . HIS E 3 32  ? 114.728 -52.522 38.550  1.00 18.22 ? 328  HIS A N     1 
ATOM   1052  C  CA    . HIS E 3 32  ? 115.240 -53.156 39.758  1.00 19.35 ? 328  HIS A CA    1 
ATOM   1053  C  C     . HIS E 3 32  ? 114.321 -54.278 40.224  1.00 21.06 ? 328  HIS A C     1 
ATOM   1054  O  O     . HIS E 3 32  ? 113.130 -54.065 40.469  1.00 20.36 ? 328  HIS A O     1 
ATOM   1055  C  CB    . HIS E 3 32  ? 115.418 -52.133 40.879  1.00 18.12 ? 328  HIS A CB    1 
ATOM   1056  C  CG    . HIS E 3 32  ? 116.646 -51.290 40.734  1.00 18.08 ? 328  HIS A CG    1 
ATOM   1057  N  ND1   . HIS E 3 32  ? 117.918 -51.821 40.758  1.00 15.89 ? 328  HIS A ND1   1 
ATOM   1058  C  CD2   . HIS E 3 32  ? 116.798 -49.956 40.557  1.00 17.13 ? 328  HIS A CD2   1 
ATOM   1059  C  CE1   . HIS E 3 32  ? 118.800 -50.851 40.603  1.00 17.76 ? 328  HIS A CE1   1 
ATOM   1060  N  NE2   . HIS E 3 32  ? 118.147 -49.708 40.480  1.00 17.28 ? 328  HIS A NE2   1 
ATOM   1061  N  N     . ASP E 3 33  ? 114.893 -55.473 40.340  1.00 21.73 ? 329  ASP A N     1 
ATOM   1062  C  CA    . ASP E 3 33  ? 114.161 -56.656 40.770  1.00 23.81 ? 329  ASP A CA    1 
ATOM   1063  C  C     . ASP E 3 33  ? 112.896 -56.831 39.938  1.00 24.36 ? 329  ASP A C     1 
ATOM   1064  O  O     . ASP E 3 33  ? 111.872 -57.300 40.430  1.00 26.79 ? 329  ASP A O     1 
ATOM   1065  C  CB    . ASP E 3 33  ? 113.818 -56.540 42.258  1.00 26.08 ? 329  ASP A CB    1 
ATOM   1066  C  CG    . ASP E 3 33  ? 113.455 -57.877 42.879  1.00 29.94 ? 329  ASP A CG    1 
ATOM   1067  O  OD1   . ASP E 3 33  ? 113.719 -58.923 42.243  1.00 27.63 ? 329  ASP A OD1   1 
ATOM   1068  O  OD2   . ASP E 3 33  ? 112.918 -57.878 44.007  1.00 31.53 ? 329  ASP A OD2   1 
ATOM   1069  N  N     . ALA E 3 34  ? 112.987 -56.451 38.666  1.00 23.23 ? 330  ALA A N     1 
ATOM   1070  C  CA    . ALA E 3 34  ? 111.871 -56.546 37.737  1.00 22.98 ? 330  ALA A CA    1 
ATOM   1071  C  C     . ALA E 3 34  ? 111.959 -57.851 36.953  1.00 23.25 ? 330  ALA A C     1 
ATOM   1072  O  O     . ALA E 3 34  ? 113.041 -58.395 36.747  1.00 23.05 ? 330  ALA A O     1 
ATOM   1073  C  CB    . ALA E 3 34  ? 111.885 -55.351 36.781  1.00 22.73 ? 330  ALA A CB    1 
ATOM   1074  N  N     . PRO E 3 35  ? 110.813 -58.369 36.496  1.00 23.93 ? 331  PRO A N     1 
ATOM   1075  C  CA    . PRO E 3 35  ? 110.835 -59.622 35.742  1.00 23.79 ? 331  PRO A CA    1 
ATOM   1076  C  C     . PRO E 3 35  ? 111.385 -59.539 34.323  1.00 24.35 ? 331  PRO A C     1 
ATOM   1077  O  O     . PRO E 3 35  ? 111.213 -58.538 33.626  1.00 23.86 ? 331  PRO A O     1 
ATOM   1078  C  CB    . PRO E 3 35  ? 109.380 -60.074 35.784  1.00 25.83 ? 331  PRO A CB    1 
ATOM   1079  C  CG    . PRO E 3 35  ? 108.634 -58.773 35.796  1.00 26.63 ? 331  PRO A CG    1 
ATOM   1080  C  CD    . PRO E 3 35  ? 109.431 -57.933 36.764  1.00 24.39 ? 331  PRO A CD    1 
ATOM   1081  N  N     . ILE E 3 36  ? 112.063 -60.603 33.907  1.00 23.46 ? 332  ILE A N     1 
ATOM   1082  C  CA    . ILE E 3 36  ? 112.593 -60.690 32.554  1.00 23.36 ? 332  ILE A CA    1 
ATOM   1083  C  C     . ILE E 3 36  ? 111.528 -61.510 31.829  1.00 23.45 ? 332  ILE A C     1 
ATOM   1084  O  O     . ILE E 3 36  ? 111.335 -62.689 32.117  1.00 22.79 ? 332  ILE A O     1 
ATOM   1085  C  CB    . ILE E 3 36  ? 113.958 -61.410 32.537  1.00 23.31 ? 332  ILE A CB    1 
ATOM   1086  C  CG1   . ILE E 3 36  ? 114.996 -60.532 33.245  1.00 21.32 ? 332  ILE A CG1   1 
ATOM   1087  C  CG2   . ILE E 3 36  ? 114.378 -61.709 31.100  1.00 22.04 ? 332  ILE A CG2   1 
ATOM   1088  C  CD1   . ILE E 3 36  ? 116.366 -61.164 33.390  1.00 22.89 ? 332  ILE A CD1   1 
ATOM   1089  N  N     . VAL E 3 37  ? 110.832 -60.871 30.897  1.00 23.47 ? 333  VAL A N     1 
ATOM   1090  C  CA    . VAL E 3 37  ? 109.741 -61.511 30.174  1.00 24.23 ? 333  VAL A CA    1 
ATOM   1091  C  C     . VAL E 3 37  ? 110.137 -62.340 28.963  1.00 25.06 ? 333  VAL A C     1 
ATOM   1092  O  O     . VAL E 3 37  ? 109.327 -63.101 28.435  1.00 25.29 ? 333  VAL A O     1 
ATOM   1093  C  CB    . VAL E 3 37  ? 108.714 -60.457 29.722  1.00 24.28 ? 333  VAL A CB    1 
ATOM   1094  C  CG1   . VAL E 3 37  ? 108.248 -59.644 30.928  1.00 25.10 ? 333  VAL A CG1   1 
ATOM   1095  C  CG2   . VAL E 3 37  ? 109.333 -59.545 28.666  1.00 24.04 ? 333  VAL A CG2   1 
ATOM   1096  N  N     . GLY E 3 38  ? 111.375 -62.194 28.512  1.00 25.02 ? 334  GLY A N     1 
ATOM   1097  C  CA    . GLY E 3 38  ? 111.799 -62.956 27.356  1.00 25.26 ? 334  GLY A CA    1 
ATOM   1098  C  C     . GLY E 3 38  ? 113.213 -62.638 26.933  1.00 25.48 ? 334  GLY A C     1 
ATOM   1099  O  O     . GLY E 3 38  ? 113.760 -61.588 27.272  1.00 24.47 ? 334  GLY A O     1 
ATOM   1100  N  N     . ILE E 3 39  ? 113.806 -63.561 26.188  1.00 25.23 ? 335  ILE A N     1 
ATOM   1101  C  CA    . ILE E 3 39  ? 115.164 -63.398 25.700  1.00 25.90 ? 335  ILE A CA    1 
ATOM   1102  C  C     . ILE E 3 39  ? 115.205 -63.663 24.202  1.00 26.19 ? 335  ILE A C     1 
ATOM   1103  O  O     . ILE E 3 39  ? 114.479 -64.517 23.690  1.00 25.77 ? 335  ILE A O     1 
ATOM   1104  C  CB    . ILE E 3 39  ? 116.125 -64.369 26.413  1.00 27.75 ? 335  ILE A CB    1 
ATOM   1105  C  CG1   . ILE E 3 39  ? 116.250 -63.974 27.886  1.00 27.91 ? 335  ILE A CG1   1 
ATOM   1106  C  CG2   . ILE E 3 39  ? 117.486 -64.367 25.729  1.00 27.81 ? 335  ILE A CG2   1 
ATOM   1107  C  CD1   . ILE E 3 39  ? 117.143 -64.879 28.696  1.00 28.85 ? 335  ILE A CD1   1 
ATOM   1108  N  N     . ALA E 3 40  ? 116.052 -62.918 23.501  1.00 24.75 ? 336  ALA A N     1 
ATOM   1109  C  CA    . ALA E 3 40  ? 116.210 -63.088 22.066  1.00 24.85 ? 336  ALA A CA    1 
ATOM   1110  C  C     . ALA E 3 40  ? 117.696 -63.074 21.752  1.00 24.30 ? 336  ALA A C     1 
ATOM   1111  O  O     . ALA E 3 40  ? 118.465 -62.325 22.359  1.00 23.00 ? 336  ALA A O     1 
ATOM   1112  C  CB    . ALA E 3 40  ? 115.505 -61.972 21.313  1.00 24.83 ? 336  ALA A CB    1 
ATOM   1113  N  N     . VAL E 3 41  ? 118.097 -63.914 20.807  1.00 24.35 ? 337  VAL A N     1 
ATOM   1114  C  CA    . VAL E 3 41  ? 119.489 -63.993 20.401  1.00 24.86 ? 337  VAL A CA    1 
ATOM   1115  C  C     . VAL E 3 41  ? 119.564 -64.099 18.888  1.00 26.51 ? 337  VAL A C     1 
ATOM   1116  O  O     . VAL E 3 41  ? 118.885 -64.929 18.277  1.00 26.08 ? 337  VAL A O     1 
ATOM   1117  C  CB    . VAL E 3 41  ? 120.200 -65.221 21.015  1.00 25.04 ? 337  VAL A CB    1 
ATOM   1118  C  CG1   . VAL E 3 41  ? 121.641 -65.280 20.521  1.00 24.18 ? 337  VAL A CG1   1 
ATOM   1119  C  CG2   . VAL E 3 41  ? 120.175 -65.135 22.537  1.00 23.90 ? 337  VAL A CG2   1 
ATOM   1120  N  N     . VAL E 3 42  ? 120.387 -63.245 18.290  1.00 26.72 ? 338  VAL A N     1 
ATOM   1121  C  CA    . VAL E 3 42  ? 120.577 -63.242 16.849  1.00 27.23 ? 338  VAL A CA    1 
ATOM   1122  C  C     . VAL E 3 42  ? 122.068 -63.257 16.554  1.00 27.52 ? 338  VAL A C     1 
ATOM   1123  O  O     . VAL E 3 42  ? 122.798 -62.360 16.970  1.00 26.98 ? 338  VAL A O     1 
ATOM   1124  C  CB    . VAL E 3 42  ? 119.947 -61.992 16.199  1.00 28.25 ? 338  VAL A CB    1 
ATOM   1125  C  CG1   . VAL E 3 42  ? 120.338 -61.912 14.729  1.00 29.33 ? 338  VAL A CG1   1 
ATOM   1126  C  CG2   . VAL E 3 42  ? 118.431 -62.048 16.328  1.00 28.67 ? 338  VAL A CG2   1 
ATOM   1127  N  N     . ASN E 3 43  ? 122.519 -64.288 15.847  1.00 28.35 ? 339  ASN A N     1 
ATOM   1128  C  CA    . ASN E 3 43  ? 123.925 -64.399 15.488  1.00 29.55 ? 339  ASN A CA    1 
ATOM   1129  C  C     . ASN E 3 43  ? 124.070 -64.912 14.056  1.00 30.83 ? 339  ASN A C     1 
ATOM   1130  O  O     . ASN E 3 43  ? 123.095 -64.974 13.308  1.00 29.43 ? 339  ASN A O     1 
ATOM   1131  C  CB    . ASN E 3 43  ? 124.664 -65.320 16.467  1.00 29.22 ? 339  ASN A CB    1 
ATOM   1132  C  CG    . ASN E 3 43  ? 124.015 -66.683 16.597  1.00 29.11 ? 339  ASN A CG    1 
ATOM   1133  O  OD1   . ASN E 3 43  ? 123.687 -67.324 15.601  1.00 30.54 ? 339  ASN A OD1   1 
ATOM   1134  N  ND2   . ASN E 3 43  ? 123.839 -67.139 17.832  1.00 29.62 ? 339  ASN A ND2   1 
ATOM   1135  N  N     . GLU E 3 44  ? 125.292 -65.276 13.682  1.00 33.18 ? 340  GLU A N     1 
ATOM   1136  C  CA    . GLU E 3 44  ? 125.572 -65.770 12.336  1.00 35.80 ? 340  GLU A CA    1 
ATOM   1137  C  C     . GLU E 3 44  ? 124.796 -67.047 12.013  1.00 35.93 ? 340  GLU A C     1 
ATOM   1138  O  O     . GLU E 3 44  ? 124.491 -67.324 10.853  1.00 36.96 ? 340  GLU A O     1 
ATOM   1139  C  CB    . GLU E 3 44  ? 127.070 -66.047 12.189  1.00 37.41 ? 340  GLU A CB    1 
ATOM   1140  C  CG    . GLU E 3 44  ? 127.548 -67.231 13.015  1.00 42.47 ? 340  GLU A CG    1 
ATOM   1141  C  CD    . GLU E 3 44  ? 129.028 -67.519 12.847  1.00 45.05 ? 340  GLU A CD    1 
ATOM   1142  O  OE1   . GLU E 3 44  ? 129.851 -66.708 13.323  1.00 47.78 ? 340  GLU A OE1   1 
ATOM   1143  O  OE2   . GLU E 3 44  ? 129.369 -68.556 12.238  1.00 46.57 ? 340  GLU A OE2   1 
ATOM   1144  N  N     . HIS E 3 45  ? 124.477 -67.815 13.049  1.00 36.70 ? 341  HIS A N     1 
ATOM   1145  C  CA    . HIS E 3 45  ? 123.773 -69.083 12.895  1.00 36.99 ? 341  HIS A CA    1 
ATOM   1146  C  C     . HIS E 3 45  ? 122.257 -68.985 12.770  1.00 37.40 ? 341  HIS A C     1 
ATOM   1147  O  O     . HIS E 3 45  ? 121.620 -69.903 12.255  1.00 38.76 ? 341  HIS A O     1 
ATOM   1148  C  CB    . HIS E 3 45  ? 124.145 -69.998 14.061  1.00 38.24 ? 341  HIS A CB    1 
ATOM   1149  C  CG    . HIS E 3 45  ? 125.612 -70.273 14.158  1.00 39.16 ? 341  HIS A CG    1 
ATOM   1150  N  ND1   . HIS E 3 45  ? 126.270 -70.398 15.363  1.00 39.71 ? 341  HIS A ND1   1 
ATOM   1151  C  CD2   . HIS E 3 45  ? 126.550 -70.450 13.197  1.00 39.29 ? 341  HIS A CD2   1 
ATOM   1152  C  CE1   . HIS E 3 45  ? 127.550 -70.639 15.140  1.00 40.09 ? 341  HIS A CE1   1 
ATOM   1153  N  NE2   . HIS E 3 45  ? 127.746 -70.676 13.835  1.00 39.76 ? 341  HIS A NE2   1 
ATOM   1154  N  N     . GLY E 3 46  ? 121.672 -67.886 13.237  1.00 36.81 ? 342  GLY A N     1 
ATOM   1155  C  CA    . GLY E 3 46  ? 120.230 -67.740 13.131  1.00 36.03 ? 342  GLY A CA    1 
ATOM   1156  C  C     . GLY E 3 46  ? 119.606 -66.814 14.158  1.00 35.43 ? 342  GLY A C     1 
ATOM   1157  O  O     . GLY E 3 46  ? 120.309 -66.090 14.862  1.00 35.13 ? 342  GLY A O     1 
ATOM   1158  N  N     . ARG E 3 47  ? 118.278 -66.839 14.238  1.00 34.57 ? 343  ARG A N     1 
ATOM   1159  C  CA    . ARG E 3 47  ? 117.543 -66.000 15.180  1.00 33.97 ? 343  ARG A CA    1 
ATOM   1160  C  C     . ARG E 3 47  ? 116.793 -66.896 16.162  1.00 33.11 ? 343  ARG A C     1 
ATOM   1161  O  O     . ARG E 3 47  ? 116.064 -67.804 15.755  1.00 33.62 ? 343  ARG A O     1 
ATOM   1162  C  CB    . ARG E 3 47  ? 116.565 -65.099 14.425  1.00 33.93 ? 343  ARG A CB    1 
ATOM   1163  C  CG    . ARG E 3 47  ? 117.186 -64.402 13.230  1.00 33.84 ? 343  ARG A CG    1 
ATOM   1164  C  CD    . ARG E 3 47  ? 116.328 -63.249 12.734  1.00 35.91 ? 343  ARG A CD    1 
ATOM   1165  N  NE    . ARG E 3 47  ? 116.819 -62.729 11.462  1.00 36.68 ? 343  ARG A NE    1 
ATOM   1166  C  CZ    . ARG E 3 47  ? 116.509 -63.243 10.276  1.00 37.77 ? 343  ARG A CZ    1 
ATOM   1167  N  NH1   . ARG E 3 47  ? 115.699 -64.290 10.194  1.00 37.77 ? 343  ARG A NH1   1 
ATOM   1168  N  NH2   . ARG E 3 47  ? 117.015 -62.716 9.170   1.00 37.63 ? 343  ARG A NH2   1 
ATOM   1169  N  N     . PHE E 3 48  ? 116.963 -66.631 17.452  1.00 31.23 ? 344  PHE A N     1 
ATOM   1170  C  CA    . PHE E 3 48  ? 116.336 -67.449 18.482  1.00 31.42 ? 344  PHE A CA    1 
ATOM   1171  C  C     . PHE E 3 48  ? 115.596 -66.689 19.577  1.00 30.95 ? 344  PHE A C     1 
ATOM   1172  O  O     . PHE E 3 48  ? 115.995 -65.593 19.972  1.00 31.52 ? 344  PHE A O     1 
ATOM   1173  C  CB    . PHE E 3 48  ? 117.404 -68.320 19.146  1.00 31.76 ? 344  PHE A CB    1 
ATOM   1174  C  CG    . PHE E 3 48  ? 118.278 -69.051 18.173  1.00 33.48 ? 344  PHE A CG    1 
ATOM   1175  C  CD1   . PHE E 3 48  ? 117.870 -70.262 17.627  1.00 33.71 ? 344  PHE A CD1   1 
ATOM   1176  C  CD2   . PHE E 3 48  ? 119.503 -68.516 17.782  1.00 33.35 ? 344  PHE A CD2   1 
ATOM   1177  C  CE1   . PHE E 3 48  ? 118.665 -70.933 16.705  1.00 34.76 ? 344  PHE A CE1   1 
ATOM   1178  C  CE2   . PHE E 3 48  ? 120.309 -69.181 16.857  1.00 35.22 ? 344  PHE A CE2   1 
ATOM   1179  C  CZ    . PHE E 3 48  ? 119.888 -70.393 16.319  1.00 34.70 ? 344  PHE A CZ    1 
ATOM   1180  N  N     . PHE E 3 49  ? 114.517 -67.294 20.064  1.00 29.67 ? 345  PHE A N     1 
ATOM   1181  C  CA    . PHE E 3 49  ? 113.738 -66.741 21.166  1.00 29.59 ? 345  PHE A CA    1 
ATOM   1182  C  C     . PHE E 3 49  ? 113.757 -67.787 22.274  1.00 30.20 ? 345  PHE A C     1 
ATOM   1183  O  O     . PHE E 3 49  ? 113.514 -68.970 22.024  1.00 28.54 ? 345  PHE A O     1 
ATOM   1184  C  CB    . PHE E 3 49  ? 112.284 -66.490 20.784  1.00 28.92 ? 345  PHE A CB    1 
ATOM   1185  C  CG    . PHE E 3 49  ? 111.410 -66.166 21.966  1.00 28.74 ? 345  PHE A CG    1 
ATOM   1186  C  CD1   . PHE E 3 49  ? 111.427 -64.895 22.533  1.00 28.08 ? 345  PHE A CD1   1 
ATOM   1187  C  CD2   . PHE E 3 49  ? 110.594 -67.142 22.536  1.00 28.81 ? 345  PHE A CD2   1 
ATOM   1188  C  CE1   . PHE E 3 49  ? 110.648 -64.599 23.651  1.00 28.74 ? 345  PHE A CE1   1 
ATOM   1189  C  CE2   . PHE E 3 49  ? 109.810 -66.860 23.656  1.00 29.25 ? 345  PHE A CE2   1 
ATOM   1190  C  CZ    . PHE E 3 49  ? 109.837 -65.585 24.215  1.00 29.38 ? 345  PHE A CZ    1 
ATOM   1191  N  N     . LEU E 3 50  ? 114.035 -67.349 23.495  1.00 30.37 ? 346  LEU A N     1 
ATOM   1192  C  CA    . LEU E 3 50  ? 114.083 -68.255 24.629  1.00 30.86 ? 346  LEU A CA    1 
ATOM   1193  C  C     . LEU E 3 50  ? 113.251 -67.727 25.786  1.00 31.28 ? 346  LEU A C     1 
ATOM   1194  O  O     . LEU E 3 50  ? 113.245 -66.527 26.063  1.00 30.19 ? 346  LEU A O     1 
ATOM   1195  C  CB    . LEU E 3 50  ? 115.527 -68.439 25.090  1.00 32.50 ? 346  LEU A CB    1 
ATOM   1196  C  CG    . LEU E 3 50  ? 116.474 -69.139 24.114  1.00 33.86 ? 346  LEU A CG    1 
ATOM   1197  C  CD1   . LEU E 3 50  ? 117.913 -68.936 24.560  1.00 35.38 ? 346  LEU A CD1   1 
ATOM   1198  C  CD2   . LEU E 3 50  ? 116.128 -70.621 24.044  1.00 34.58 ? 346  LEU A CD2   1 
ATOM   1199  N  N     . ARG E 3 51  ? 112.541 -68.626 26.456  1.00 30.88 ? 347  ARG A N     1 
ATOM   1200  C  CA    . ARG E 3 51  ? 111.739 -68.237 27.604  1.00 31.25 ? 347  ARG A CA    1 
ATOM   1201  C  C     . ARG E 3 51  ? 112.737 -68.068 28.744  1.00 31.51 ? 347  ARG A C     1 
ATOM   1202  O  O     . ARG E 3 51  ? 113.702 -68.826 28.844  1.00 30.81 ? 347  ARG A O     1 
ATOM   1203  C  CB    . ARG E 3 51  ? 110.719 -69.327 27.937  1.00 32.86 ? 347  ARG A CB    1 
ATOM   1204  C  CG    . ARG E 3 51  ? 109.789 -69.673 26.779  1.00 35.80 ? 347  ARG A CG    1 
ATOM   1205  C  CD    . ARG E 3 51  ? 108.764 -70.725 27.180  1.00 39.61 ? 347  ARG A CD    1 
ATOM   1206  N  NE    . ARG E 3 51  ? 107.903 -71.108 26.064  1.00 41.96 ? 347  ARG A NE    1 
ATOM   1207  C  CZ    . ARG E 3 51  ? 108.315 -71.780 24.991  1.00 44.05 ? 347  ARG A CZ    1 
ATOM   1208  N  NH1   . ARG E 3 51  ? 109.583 -72.154 24.879  1.00 45.09 ? 347  ARG A NH1   1 
ATOM   1209  N  NH2   . ARG E 3 51  ? 107.456 -72.076 24.025  1.00 45.45 ? 347  ARG A NH2   1 
ATOM   1210  N  N     . PRO E 3 52  ? 112.524 -67.067 29.611  1.00 31.51 ? 348  PRO A N     1 
ATOM   1211  C  CA    . PRO E 3 52  ? 113.417 -66.799 30.745  1.00 32.01 ? 348  PRO A CA    1 
ATOM   1212  C  C     . PRO E 3 52  ? 113.656 -68.008 31.648  1.00 32.34 ? 348  PRO A C     1 
ATOM   1213  O  O     . PRO E 3 52  ? 114.791 -68.289 32.029  1.00 31.35 ? 348  PRO A O     1 
ATOM   1214  C  CB    . PRO E 3 52  ? 112.726 -65.649 31.472  1.00 31.99 ? 348  PRO A CB    1 
ATOM   1215  C  CG    . PRO E 3 52  ? 112.000 -64.944 30.369  1.00 33.69 ? 348  PRO A CG    1 
ATOM   1216  C  CD    . PRO E 3 52  ? 111.425 -66.088 29.572  1.00 32.31 ? 348  PRO A CD    1 
ATOM   1217  N  N     . GLU E 3 53  ? 112.582 -68.717 31.987  1.00 32.93 ? 349  GLU A N     1 
ATOM   1218  C  CA    . GLU E 3 53  ? 112.689 -69.888 32.850  1.00 34.94 ? 349  GLU A CA    1 
ATOM   1219  C  C     . GLU E 3 53  ? 113.626 -70.926 32.239  1.00 34.63 ? 349  GLU A C     1 
ATOM   1220  O  O     . GLU E 3 53  ? 114.336 -71.634 32.950  1.00 35.44 ? 349  GLU A O     1 
ATOM   1221  C  CB    . GLU E 3 53  ? 111.305 -70.510 33.090  1.00 36.31 ? 349  GLU A CB    1 
ATOM   1222  C  CG    . GLU E 3 53  ? 110.540 -70.882 31.825  1.00 39.42 ? 349  GLU A CG    1 
ATOM   1223  C  CD    . GLU E 3 53  ? 109.750 -69.718 31.246  1.00 42.22 ? 349  GLU A CD    1 
ATOM   1224  O  OE1   . GLU E 3 53  ? 110.007 -68.560 31.639  1.00 42.60 ? 349  GLU A OE1   1 
ATOM   1225  O  OE2   . GLU E 3 53  ? 108.873 -69.964 30.388  1.00 44.06 ? 349  GLU A OE2   1 
ATOM   1226  N  N     . THR E 3 54  ? 113.630 -70.999 30.913  1.00 33.71 ? 350  THR A N     1 
ATOM   1227  C  CA    . THR E 3 54  ? 114.470 -71.944 30.190  1.00 33.32 ? 350  THR A CA    1 
ATOM   1228  C  C     . THR E 3 54  ? 115.935 -71.514 30.170  1.00 32.10 ? 350  THR A C     1 
ATOM   1229  O  O     . THR E 3 54  ? 116.793 -72.148 30.783  1.00 32.85 ? 350  THR A O     1 
ATOM   1230  C  CB    . THR E 3 54  ? 113.988 -72.090 28.731  1.00 34.04 ? 350  THR A CB    1 
ATOM   1231  O  OG1   . THR E 3 54  ? 112.632 -72.549 28.721  1.00 35.70 ? 350  THR A OG1   1 
ATOM   1232  C  CG2   . THR E 3 54  ? 114.862 -73.076 27.969  1.00 35.31 ? 350  THR A CG2   1 
ATOM   1233  N  N     . ALA E 3 55  ? 116.205 -70.423 29.465  1.00 29.95 ? 351  ALA A N     1 
ATOM   1234  C  CA    . ALA E 3 55  ? 117.554 -69.897 29.311  1.00 28.11 ? 351  ALA A CA    1 
ATOM   1235  C  C     . ALA E 3 55  ? 118.309 -69.551 30.592  1.00 27.32 ? 351  ALA A C     1 
ATOM   1236  O  O     . ALA E 3 55  ? 119.479 -69.905 30.743  1.00 25.06 ? 351  ALA A O     1 
ATOM   1237  C  CB    . ALA E 3 55  ? 117.515 -68.678 28.399  1.00 28.68 ? 351  ALA A CB    1 
ATOM   1238  N  N     . LEU E 3 56  ? 117.650 -68.860 31.514  1.00 27.05 ? 352  LEU A N     1 
ATOM   1239  C  CA    . LEU E 3 56  ? 118.316 -68.449 32.743  1.00 27.28 ? 352  LEU A CA    1 
ATOM   1240  C  C     . LEU E 3 56  ? 118.630 -69.577 33.721  1.00 26.08 ? 352  LEU A C     1 
ATOM   1241  O  O     . LEU E 3 56  ? 119.422 -69.395 34.642  1.00 24.97 ? 352  LEU A O     1 
ATOM   1242  C  CB    . LEU E 3 56  ? 117.501 -67.348 33.428  1.00 28.00 ? 352  LEU A CB    1 
ATOM   1243  C  CG    . LEU E 3 56  ? 117.327 -66.106 32.540  1.00 29.68 ? 352  LEU A CG    1 
ATOM   1244  C  CD1   . LEU E 3 56  ? 116.512 -65.049 33.270  1.00 30.02 ? 352  LEU A CD1   1 
ATOM   1245  C  CD2   . LEU E 3 56  ? 118.701 -65.555 32.157  1.00 30.78 ? 352  LEU A CD2   1 
ATOM   1246  N  N     . ALA E 3 57  ? 118.015 -70.737 33.526  1.00 26.60 ? 353  ALA A N     1 
ATOM   1247  C  CA    . ALA E 3 57  ? 118.286 -71.872 34.403  1.00 27.57 ? 353  ALA A CA    1 
ATOM   1248  C  C     . ALA E 3 57  ? 119.261 -72.827 33.716  1.00 26.84 ? 353  ALA A C     1 
ATOM   1249  O  O     . ALA E 3 57  ? 119.625 -73.863 34.275  1.00 27.59 ? 353  ALA A O     1 
ATOM   1250  C  CB    . ALA E 3 57  ? 116.991 -72.599 34.750  1.00 27.49 ? 353  ALA A CB    1 
ATOM   1251  N  N     . ASP E 3 58  ? 119.681 -72.469 32.503  1.00 26.61 ? 354  ASP A N     1 
ATOM   1252  C  CA    . ASP E 3 58  ? 120.615 -73.292 31.733  1.00 26.22 ? 354  ASP A CA    1 
ATOM   1253  C  C     . ASP E 3 58  ? 122.060 -72.960 32.096  1.00 25.66 ? 354  ASP A C     1 
ATOM   1254  O  O     . ASP E 3 58  ? 122.503 -71.818 31.950  1.00 26.04 ? 354  ASP A O     1 
ATOM   1255  C  CB    . ASP E 3 58  ? 120.412 -73.072 30.233  1.00 27.22 ? 354  ASP A CB    1 
ATOM   1256  C  CG    . ASP E 3 58  ? 121.230 -74.034 29.394  1.00 26.17 ? 354  ASP A CG    1 
ATOM   1257  O  OD1   . ASP E 3 58  ? 120.645 -74.982 28.835  1.00 28.20 ? 354  ASP A OD1   1 
ATOM   1258  O  OD2   . ASP E 3 58  ? 122.460 -73.846 29.301  1.00 26.07 ? 354  ASP A OD2   1 
ATOM   1259  N  N     . PRO E 3 59  ? 122.827 -73.964 32.549  1.00 24.88 ? 355  PRO A N     1 
ATOM   1260  C  CA    . PRO E 3 59  ? 124.220 -73.732 32.927  1.00 25.31 ? 355  PRO A CA    1 
ATOM   1261  C  C     . PRO E 3 59  ? 125.089 -73.180 31.802  1.00 25.91 ? 355  PRO A C     1 
ATOM   1262  O  O     . PRO E 3 59  ? 125.997 -72.383 32.049  1.00 25.23 ? 355  PRO A O     1 
ATOM   1263  C  CB    . PRO E 3 59  ? 124.674 -75.100 33.430  1.00 24.84 ? 355  PRO A CB    1 
ATOM   1264  C  CG    . PRO E 3 59  ? 123.860 -76.040 32.606  1.00 24.28 ? 355  PRO A CG    1 
ATOM   1265  C  CD    . PRO E 3 59  ? 122.495 -75.398 32.637  1.00 24.44 ? 355  PRO A CD    1 
ATOM   1266  N  N     . GLN E 3 60  ? 124.807 -73.598 30.572  1.00 26.19 ? 356  GLN A N     1 
ATOM   1267  C  CA    . GLN E 3 60  ? 125.579 -73.131 29.424  1.00 27.39 ? 356  GLN A CA    1 
ATOM   1268  C  C     . GLN E 3 60  ? 125.232 -71.697 29.046  1.00 26.22 ? 356  GLN A C     1 
ATOM   1269  O  O     . GLN E 3 60  ? 126.115 -70.907 28.718  1.00 25.98 ? 356  GLN A O     1 
ATOM   1270  C  CB    . GLN E 3 60  ? 125.366 -74.054 28.217  1.00 28.74 ? 356  GLN A CB    1 
ATOM   1271  C  CG    . GLN E 3 60  ? 126.115 -75.384 28.308  1.00 32.99 ? 356  GLN A CG    1 
ATOM   1272  C  CD    . GLN E 3 60  ? 125.698 -76.205 29.512  1.00 35.09 ? 356  GLN A CD    1 
ATOM   1273  O  OE1   . GLN E 3 60  ? 124.526 -76.555 29.657  1.00 37.79 ? 356  GLN A OE1   1 
ATOM   1274  N  NE2   . GLN E 3 60  ? 126.655 -76.515 30.384  1.00 35.47 ? 356  GLN A NE2   1 
ATOM   1275  N  N     . PHE E 3 61  ? 123.949 -71.357 29.089  1.00 26.39 ? 357  PHE A N     1 
ATOM   1276  C  CA    . PHE E 3 61  ? 123.535 -70.001 28.745  1.00 26.43 ? 357  PHE A CA    1 
ATOM   1277  C  C     . PHE E 3 61  ? 124.077 -69.026 29.787  1.00 25.12 ? 357  PHE A C     1 
ATOM   1278  O  O     . PHE E 3 61  ? 124.620 -67.976 29.447  1.00 25.73 ? 357  PHE A O     1 
ATOM   1279  C  CB    . PHE E 3 61  ? 122.011 -69.896 28.688  1.00 26.53 ? 357  PHE A CB    1 
ATOM   1280  C  CG    . PHE E 3 61  ? 121.521 -68.663 27.987  1.00 27.74 ? 357  PHE A CG    1 
ATOM   1281  C  CD1   . PHE E 3 61  ? 121.559 -68.577 26.597  1.00 29.03 ? 357  PHE A CD1   1 
ATOM   1282  C  CD2   . PHE E 3 61  ? 121.036 -67.579 28.712  1.00 28.75 ? 357  PHE A CD2   1 
ATOM   1283  C  CE1   . PHE E 3 61  ? 121.121 -67.429 25.938  1.00 28.91 ? 357  PHE A CE1   1 
ATOM   1284  C  CE2   . PHE E 3 61  ? 120.596 -66.425 28.062  1.00 28.31 ? 357  PHE A CE2   1 
ATOM   1285  C  CZ    . PHE E 3 61  ? 120.639 -66.351 26.674  1.00 28.94 ? 357  PHE A CZ    1 
ATOM   1286  N  N     . VAL E 3 62  ? 123.930 -69.378 31.060  1.00 24.62 ? 358  VAL A N     1 
ATOM   1287  C  CA    . VAL E 3 62  ? 124.424 -68.524 32.136  1.00 23.84 ? 358  VAL A CA    1 
ATOM   1288  C  C     . VAL E 3 62  ? 125.928 -68.299 31.979  1.00 24.41 ? 358  VAL A C     1 
ATOM   1289  O  O     . VAL E 3 62  ? 126.420 -67.180 32.137  1.00 24.80 ? 358  VAL A O     1 
ATOM   1290  C  CB    . VAL E 3 62  ? 124.140 -69.147 33.522  1.00 22.89 ? 358  VAL A CB    1 
ATOM   1291  C  CG1   . VAL E 3 62  ? 124.817 -68.330 34.614  1.00 22.24 ? 358  VAL A CG1   1 
ATOM   1292  C  CG2   . VAL E 3 62  ? 122.638 -69.204 33.761  1.00 23.43 ? 358  VAL A CG2   1 
ATOM   1293  N  N     . ALA E 3 63  ? 126.655 -69.365 31.660  1.00 25.22 ? 359  ALA A N     1 
ATOM   1294  C  CA    . ALA E 3 63  ? 128.097 -69.267 31.470  1.00 24.56 ? 359  ALA A CA    1 
ATOM   1295  C  C     . ALA E 3 63  ? 128.387 -68.332 30.293  1.00 24.43 ? 359  ALA A C     1 
ATOM   1296  O  O     . ALA E 3 63  ? 129.282 -67.488 30.358  1.00 24.63 ? 359  ALA A O     1 
ATOM   1297  C  CB    . ALA E 3 63  ? 128.680 -70.650 31.202  1.00 26.00 ? 359  ALA A CB    1 
ATOM   1298  N  N     . TRP E 3 64  ? 127.619 -68.488 29.221  1.00 24.27 ? 360  TRP A N     1 
ATOM   1299  C  CA    . TRP E 3 64  ? 127.777 -67.657 28.033  1.00 24.34 ? 360  TRP A CA    1 
ATOM   1300  C  C     . TRP E 3 64  ? 127.550 -66.175 28.364  1.00 24.22 ? 360  TRP A C     1 
ATOM   1301  O  O     . TRP E 3 64  ? 128.351 -65.315 27.988  1.00 23.03 ? 360  TRP A O     1 
ATOM   1302  C  CB    . TRP E 3 64  ? 126.790 -68.103 26.958  1.00 25.16 ? 360  TRP A CB    1 
ATOM   1303  C  CG    . TRP E 3 64  ? 126.865 -67.294 25.697  1.00 26.59 ? 360  TRP A CG    1 
ATOM   1304  C  CD1   . TRP E 3 64  ? 127.847 -67.335 24.747  1.00 26.90 ? 360  TRP A CD1   1 
ATOM   1305  C  CD2   . TRP E 3 64  ? 125.916 -66.312 25.253  1.00 27.11 ? 360  TRP A CD2   1 
ATOM   1306  N  NE1   . TRP E 3 64  ? 127.568 -66.439 23.736  1.00 27.65 ? 360  TRP A NE1   1 
ATOM   1307  C  CE2   . TRP E 3 64  ? 126.389 -65.799 24.022  1.00 26.36 ? 360  TRP A CE2   1 
ATOM   1308  C  CE3   . TRP E 3 64  ? 124.713 -65.817 25.776  1.00 25.77 ? 360  TRP A CE3   1 
ATOM   1309  C  CZ2   . TRP E 3 64  ? 125.699 -64.815 23.305  1.00 26.62 ? 360  TRP A CZ2   1 
ATOM   1310  C  CZ3   . TRP E 3 64  ? 124.025 -64.835 25.060  1.00 26.70 ? 360  TRP A CZ3   1 
ATOM   1311  C  CH2   . TRP E 3 64  ? 124.522 -64.348 23.839  1.00 27.16 ? 360  TRP A CH2   1 
ATOM   1312  N  N     . LEU E 3 65  ? 126.457 -65.881 29.063  1.00 24.68 ? 361  LEU A N     1 
ATOM   1313  C  CA    . LEU E 3 65  ? 126.144 -64.504 29.444  1.00 24.96 ? 361  LEU A CA    1 
ATOM   1314  C  C     . LEU E 3 65  ? 127.299 -63.884 30.222  1.00 24.88 ? 361  LEU A C     1 
ATOM   1315  O  O     . LEU E 3 65  ? 127.618 -62.711 30.043  1.00 24.27 ? 361  LEU A O     1 
ATOM   1316  C  CB    . LEU E 3 65  ? 124.872 -64.453 30.304  1.00 25.12 ? 361  LEU A CB    1 
ATOM   1317  C  CG    . LEU E 3 65  ? 123.514 -64.699 29.633  1.00 25.83 ? 361  LEU A CG    1 
ATOM   1318  C  CD1   . LEU E 3 65  ? 122.429 -64.842 30.699  1.00 25.75 ? 361  LEU A CD1   1 
ATOM   1319  C  CD2   . LEU E 3 65  ? 123.185 -63.557 28.689  1.00 24.35 ? 361  LEU A CD2   1 
ATOM   1320  N  N     . GLY E 3 66  ? 127.928 -64.684 31.081  1.00 25.00 ? 362  GLY A N     1 
ATOM   1321  C  CA    . GLY E 3 66  ? 129.027 -64.187 31.890  1.00 25.34 ? 362  GLY A CA    1 
ATOM   1322  C  C     . GLY E 3 66  ? 130.409 -64.295 31.268  1.00 26.08 ? 362  GLY A C     1 
ATOM   1323  O  O     . GLY E 3 66  ? 131.400 -63.941 31.902  1.00 26.00 ? 362  GLY A O     1 
ATOM   1324  N  N     . ASP E 3 67  ? 130.482 -64.779 30.032  1.00 27.05 ? 363  ASP A N     1 
ATOM   1325  C  CA    . ASP E 3 67  ? 131.762 -64.921 29.339  1.00 28.05 ? 363  ASP A CA    1 
ATOM   1326  C  C     . ASP E 3 67  ? 132.104 -63.631 28.588  1.00 28.15 ? 363  ASP A C     1 
ATOM   1327  O  O     . ASP E 3 67  ? 131.483 -63.316 27.572  1.00 26.69 ? 363  ASP A O     1 
ATOM   1328  C  CB    . ASP E 3 67  ? 131.691 -66.082 28.346  1.00 28.94 ? 363  ASP A CB    1 
ATOM   1329  C  CG    . ASP E 3 67  ? 133.052 -66.452 27.777  1.00 31.40 ? 363  ASP A CG    1 
ATOM   1330  O  OD1   . ASP E 3 67  ? 133.905 -65.549 27.623  1.00 30.29 ? 363  ASP A OD1   1 
ATOM   1331  O  OD2   . ASP E 3 67  ? 133.264 -67.650 27.478  1.00 31.03 ? 363  ASP A OD2   1 
ATOM   1332  N  N     . GLU E 3 68  ? 133.095 -62.894 29.083  1.00 28.58 ? 364  GLU A N     1 
ATOM   1333  C  CA    . GLU E 3 68  ? 133.498 -61.639 28.453  1.00 31.92 ? 364  GLU A CA    1 
ATOM   1334  C  C     . GLU E 3 68  ? 134.005 -61.805 27.020  1.00 31.42 ? 364  GLU A C     1 
ATOM   1335  O  O     . GLU E 3 68  ? 133.978 -60.857 26.234  1.00 31.58 ? 364  GLU A O     1 
ATOM   1336  C  CB    . GLU E 3 68  ? 134.577 -60.945 29.292  1.00 35.01 ? 364  GLU A CB    1 
ATOM   1337  C  CG    . GLU E 3 68  ? 135.868 -61.739 29.426  1.00 41.44 ? 364  GLU A CG    1 
ATOM   1338  C  CD    . GLU E 3 68  ? 136.928 -61.002 30.228  1.00 46.02 ? 364  GLU A CD    1 
ATOM   1339  O  OE1   . GLU E 3 68  ? 136.674 -60.688 31.413  1.00 47.77 ? 364  GLU A OE1   1 
ATOM   1340  O  OE2   . GLU E 3 68  ? 138.018 -60.735 29.673  1.00 48.57 ? 364  GLU A OE2   1 
ATOM   1341  N  N     . THR E 3 69  ? 134.465 -63.004 26.676  1.00 30.64 ? 365  THR A N     1 
ATOM   1342  C  CA    . THR E 3 69  ? 134.973 -63.252 25.329  1.00 30.36 ? 365  THR A CA    1 
ATOM   1343  C  C     . THR E 3 69  ? 133.834 -63.446 24.333  1.00 29.60 ? 365  THR A C     1 
ATOM   1344  O  O     . THR E 3 69  ? 134.055 -63.489 23.125  1.00 29.50 ? 365  THR A O     1 
ATOM   1345  C  CB    . THR E 3 69  ? 135.890 -64.491 25.290  1.00 30.30 ? 365  THR A CB    1 
ATOM   1346  O  OG1   . THR E 3 69  ? 135.124 -65.666 25.576  1.00 28.73 ? 365  THR A OG1   1 
ATOM   1347  C  CG2   . THR E 3 69  ? 137.000 -64.356 26.314  1.00 29.73 ? 365  THR A CG2   1 
ATOM   1348  N  N     . LYS E 3 70  ? 132.616 -63.569 24.849  1.00 28.78 ? 366  LYS A N     1 
ATOM   1349  C  CA    . LYS E 3 70  ? 131.440 -63.729 24.003  1.00 28.53 ? 366  LYS A CA    1 
ATOM   1350  C  C     . LYS E 3 70  ? 130.826 -62.336 23.927  1.00 28.64 ? 366  LYS A C     1 
ATOM   1351  O  O     . LYS E 3 70  ? 130.181 -61.879 24.870  1.00 28.20 ? 366  LYS A O     1 
ATOM   1352  C  CB    . LYS E 3 70  ? 130.464 -64.719 24.640  1.00 28.35 ? 366  LYS A CB    1 
ATOM   1353  C  CG    . LYS E 3 70  ? 131.091 -66.070 24.977  1.00 30.15 ? 366  LYS A CG    1 
ATOM   1354  C  CD    . LYS E 3 70  ? 131.558 -66.806 23.725  1.00 31.19 ? 366  LYS A CD    1 
ATOM   1355  C  CE    . LYS E 3 70  ? 132.285 -68.097 24.084  1.00 32.97 ? 366  LYS A CE    1 
ATOM   1356  N  NZ    . LYS E 3 70  ? 132.793 -68.807 22.878  1.00 34.40 ? 366  LYS A NZ    1 
ATOM   1357  N  N     . LYS E 3 71  ? 131.041 -61.662 22.801  1.00 27.75 ? 367  LYS A N     1 
ATOM   1358  C  CA    . LYS E 3 71  ? 130.558 -60.298 22.615  1.00 27.05 ? 367  LYS A CA    1 
ATOM   1359  C  C     . LYS E 3 71  ? 129.074 -60.168 22.321  1.00 26.11 ? 367  LYS A C     1 
ATOM   1360  O  O     . LYS E 3 71  ? 128.537 -60.863 21.458  1.00 25.72 ? 367  LYS A O     1 
ATOM   1361  C  CB    . LYS E 3 71  ? 131.349 -59.617 21.494  1.00 26.64 ? 367  LYS A CB    1 
ATOM   1362  C  CG    . LYS E 3 71  ? 132.855 -59.664 21.688  1.00 27.81 ? 367  LYS A CG    1 
ATOM   1363  C  CD    . LYS E 3 71  ? 133.253 -59.076 23.032  1.00 29.49 ? 367  LYS A CD    1 
ATOM   1364  C  CE    . LYS E 3 71  ? 134.758 -59.100 23.232  1.00 29.52 ? 367  LYS A CE    1 
ATOM   1365  N  NZ    . LYS E 3 71  ? 135.132 -58.551 24.564  1.00 29.29 ? 367  LYS A NZ    1 
ATOM   1366  N  N     . LYS E 3 72  ? 128.421 -59.256 23.036  1.00 23.81 ? 368  LYS A N     1 
ATOM   1367  C  CA    . LYS E 3 72  ? 126.997 -59.015 22.842  1.00 23.17 ? 368  LYS A CA    1 
ATOM   1368  C  C     . LYS E 3 72  ? 126.736 -57.568 22.444  1.00 21.95 ? 368  LYS A C     1 
ATOM   1369  O  O     . LYS E 3 72  ? 127.365 -56.651 22.967  1.00 21.37 ? 368  LYS A O     1 
ATOM   1370  C  CB    . LYS E 3 72  ? 126.204 -59.301 24.126  1.00 23.22 ? 368  LYS A CB    1 
ATOM   1371  C  CG    . LYS E 3 72  ? 126.279 -60.728 24.648  1.00 23.52 ? 368  LYS A CG    1 
ATOM   1372  C  CD    . LYS E 3 72  ? 127.447 -60.919 25.594  1.00 22.84 ? 368  LYS A CD    1 
ATOM   1373  C  CE    . LYS E 3 72  ? 127.489 -62.345 26.126  1.00 23.84 ? 368  LYS A CE    1 
ATOM   1374  N  NZ    . LYS E 3 72  ? 128.619 -62.544 27.073  1.00 22.83 ? 368  LYS A NZ    1 
ATOM   1375  N  N     . SER E 3 73  ? 125.807 -57.380 21.511  1.00 21.51 ? 369  SER A N     1 
ATOM   1376  C  CA    . SER E 3 73  ? 125.396 -56.048 21.076  1.00 22.41 ? 369  SER A CA    1 
ATOM   1377  C  C     . SER E 3 73  ? 123.976 -55.933 21.620  1.00 22.03 ? 369  SER A C     1 
ATOM   1378  O  O     . SER E 3 73  ? 123.160 -56.837 21.418  1.00 21.51 ? 369  SER A O     1 
ATOM   1379  C  CB    . SER E 3 73  ? 125.386 -55.949 19.549  1.00 22.75 ? 369  SER A CB    1 
ATOM   1380  O  OG    . SER E 3 73  ? 126.702 -56.032 19.032  1.00 29.06 ? 369  SER A OG    1 
ATOM   1381  N  N     . MET E 3 74  ? 123.680 -54.833 22.307  1.00 21.52 ? 370  MET A N     1 
ATOM   1382  C  CA    . MET E 3 74  ? 122.360 -54.652 22.907  1.00 19.63 ? 370  MET A CA    1 
ATOM   1383  C  C     . MET E 3 74  ? 121.848 -53.213 22.844  1.00 20.31 ? 370  MET A C     1 
ATOM   1384  O  O     . MET E 3 74  ? 122.487 -52.325 22.276  1.00 20.55 ? 370  MET A O     1 
ATOM   1385  C  CB    . MET E 3 74  ? 122.407 -55.082 24.377  1.00 20.00 ? 370  MET A CB    1 
ATOM   1386  C  CG    . MET E 3 74  ? 123.112 -56.405 24.638  1.00 18.11 ? 370  MET A CG    1 
ATOM   1387  S  SD    . MET E 3 74  ? 123.215 -56.800 26.408  1.00 19.03 ? 370  MET A SD    1 
ATOM   1388  C  CE    . MET E 3 74  ? 121.467 -57.121 26.751  1.00 18.26 ? 370  MET A CE    1 
ATOM   1389  N  N     . PHE E 3 75  ? 120.675 -53.009 23.436  1.00 18.63 ? 371  PHE A N     1 
ATOM   1390  C  CA    . PHE E 3 75  ? 120.051 -51.695 23.545  1.00 17.93 ? 371  PHE A CA    1 
ATOM   1391  C  C     . PHE E 3 75  ? 119.745 -51.587 25.039  1.00 18.28 ? 371  PHE A C     1 
ATOM   1392  O  O     . PHE E 3 75  ? 118.974 -52.387 25.570  1.00 17.42 ? 371  PHE A O     1 
ATOM   1393  C  CB    . PHE E 3 75  ? 118.744 -51.619 22.755  1.00 17.63 ? 371  PHE A CB    1 
ATOM   1394  C  CG    . PHE E 3 75  ? 118.069 -50.271 22.835  1.00 18.32 ? 371  PHE A CG    1 
ATOM   1395  C  CD1   . PHE E 3 75  ? 118.401 -49.254 21.940  1.00 16.69 ? 371  PHE A CD1   1 
ATOM   1396  C  CD2   . PHE E 3 75  ? 117.111 -50.013 23.815  1.00 17.24 ? 371  PHE A CD2   1 
ATOM   1397  C  CE1   . PHE E 3 75  ? 117.786 -47.996 22.020  1.00 18.27 ? 371  PHE A CE1   1 
ATOM   1398  C  CE2   . PHE E 3 75  ? 116.491 -48.761 23.904  1.00 18.46 ? 371  PHE A CE2   1 
ATOM   1399  C  CZ    . PHE E 3 75  ? 116.830 -47.750 23.004  1.00 17.43 ? 371  PHE A CZ    1 
ATOM   1400  N  N     . ASP E 3 76  ? 120.351 -50.606 25.702  1.00 16.81 ? 372  ASP A N     1 
ATOM   1401  C  CA    . ASP E 3 76  ? 120.183 -50.401 27.140  1.00 17.12 ? 372  ASP A CA    1 
ATOM   1402  C  C     . ASP E 3 76  ? 120.702 -51.636 27.874  1.00 16.85 ? 372  ASP A C     1 
ATOM   1403  O  O     . ASP E 3 76  ? 119.936 -52.355 28.516  1.00 16.86 ? 372  ASP A O     1 
ATOM   1404  C  CB    . ASP E 3 76  ? 118.713 -50.179 27.504  1.00 17.70 ? 372  ASP A CB    1 
ATOM   1405  C  CG    . ASP E 3 76  ? 118.537 -49.649 28.918  1.00 18.18 ? 372  ASP A CG    1 
ATOM   1406  O  OD1   . ASP E 3 76  ? 119.528 -49.625 29.679  1.00 18.26 ? 372  ASP A OD1   1 
ATOM   1407  O  OD2   . ASP E 3 76  ? 117.405 -49.257 29.271  1.00 18.31 ? 372  ASP A OD2   1 
ATOM   1408  N  N     . SER E 3 77  ? 122.005 -51.873 27.768  1.00 14.78 ? 373  SER A N     1 
ATOM   1409  C  CA    . SER E 3 77  ? 122.631 -53.019 28.413  1.00 16.70 ? 373  SER A CA    1 
ATOM   1410  C  C     . SER E 3 77  ? 122.613 -52.889 29.935  1.00 16.11 ? 373  SER A C     1 
ATOM   1411  O  O     . SER E 3 77  ? 122.630 -53.897 30.645  1.00 15.37 ? 373  SER A O     1 
ATOM   1412  C  CB    . SER E 3 77  ? 124.077 -53.176 27.927  1.00 16.32 ? 373  SER A CB    1 
ATOM   1413  O  OG    . SER E 3 77  ? 124.860 -52.050 28.289  1.00 18.77 ? 373  SER A OG    1 
ATOM   1414  N  N     . LYS E 3 78  ? 122.586 -51.658 30.442  1.00 14.76 ? 374  LYS A N     1 
ATOM   1415  C  CA    . LYS E 3 78  ? 122.557 -51.470 31.893  1.00 15.44 ? 374  LYS A CA    1 
ATOM   1416  C  C     . LYS E 3 78  ? 121.253 -52.035 32.458  1.00 15.89 ? 374  LYS A C     1 
ATOM   1417  O  O     . LYS E 3 78  ? 121.243 -52.654 33.525  1.00 17.11 ? 374  LYS A O     1 
ATOM   1418  C  CB    . LYS E 3 78  ? 122.698 -49.987 32.263  1.00 15.12 ? 374  LYS A CB    1 
ATOM   1419  C  CG    . LYS E 3 78  ? 122.519 -49.719 33.764  1.00 15.04 ? 374  LYS A CG    1 
ATOM   1420  C  CD    . LYS E 3 78  ? 123.226 -48.445 34.229  1.00 16.12 ? 374  LYS A CD    1 
ATOM   1421  C  CE    . LYS E 3 78  ? 122.630 -47.176 33.615  1.00 16.07 ? 374  LYS A CE    1 
ATOM   1422  N  NZ    . LYS E 3 78  ? 121.253 -46.905 34.108  1.00 17.20 ? 374  LYS A NZ    1 
ATOM   1423  N  N     . ARG E 3 79  ? 120.156 -51.821 31.737  1.00 15.71 ? 375  ARG A N     1 
ATOM   1424  C  CA    . ARG E 3 79  ? 118.849 -52.331 32.147  1.00 17.77 ? 375  ARG A CA    1 
ATOM   1425  C  C     . ARG E 3 79  ? 118.911 -53.856 32.242  1.00 19.42 ? 375  ARG A C     1 
ATOM   1426  O  O     . ARG E 3 79  ? 118.367 -54.459 33.171  1.00 19.34 ? 375  ARG A O     1 
ATOM   1427  C  CB    . ARG E 3 79  ? 117.785 -51.917 31.121  1.00 18.39 ? 375  ARG A CB    1 
ATOM   1428  C  CG    . ARG E 3 79  ? 116.458 -52.657 31.220  1.00 19.02 ? 375  ARG A CG    1 
ATOM   1429  C  CD    . ARG E 3 79  ? 115.444 -52.067 30.239  1.00 20.15 ? 375  ARG A CD    1 
ATOM   1430  N  NE    . ARG E 3 79  ? 115.067 -50.712 30.639  1.00 20.17 ? 375  ARG A NE    1 
ATOM   1431  C  CZ    . ARG E 3 79  ? 114.063 -50.425 31.459  1.00 21.36 ? 375  ARG A CZ    1 
ATOM   1432  N  NH1   . ARG E 3 79  ? 113.312 -51.400 31.963  1.00 19.00 ? 375  ARG A NH1   1 
ATOM   1433  N  NH2   . ARG E 3 79  ? 113.829 -49.163 31.800  1.00 19.55 ? 375  ARG A NH2   1 
ATOM   1434  N  N     . ALA E 3 80  ? 119.584 -54.472 31.274  1.00 19.31 ? 376  ALA A N     1 
ATOM   1435  C  CA    . ALA E 3 80  ? 119.715 -55.923 31.238  1.00 19.66 ? 376  ALA A CA    1 
ATOM   1436  C  C     . ALA E 3 80  ? 120.656 -56.421 32.329  1.00 19.98 ? 376  ALA A C     1 
ATOM   1437  O  O     . ALA E 3 80  ? 120.338 -57.371 33.049  1.00 21.35 ? 376  ALA A O     1 
ATOM   1438  C  CB    . ALA E 3 80  ? 120.216 -56.364 29.866  1.00 18.37 ? 376  ALA A CB    1 
ATOM   1439  N  N     . ALA E 3 81  ? 121.815 -55.780 32.449  1.00 19.29 ? 377  ALA A N     1 
ATOM   1440  C  CA    . ALA E 3 81  ? 122.802 -56.157 33.455  1.00 19.94 ? 377  ALA A CA    1 
ATOM   1441  C  C     . ALA E 3 81  ? 122.209 -56.123 34.864  1.00 20.25 ? 377  ALA A C     1 
ATOM   1442  O  O     . ALA E 3 81  ? 122.357 -57.075 35.635  1.00 19.64 ? 377  ALA A O     1 
ATOM   1443  C  CB    . ALA E 3 81  ? 124.014 -55.226 33.376  1.00 16.13 ? 377  ALA A CB    1 
ATOM   1444  N  N     . VAL E 3 82  ? 121.533 -55.029 35.200  1.00 19.18 ? 378  VAL A N     1 
ATOM   1445  C  CA    . VAL E 3 82  ? 120.940 -54.903 36.527  1.00 18.75 ? 378  VAL A CA    1 
ATOM   1446  C  C     . VAL E 3 82  ? 119.828 -55.921 36.756  1.00 16.81 ? 378  VAL A C     1 
ATOM   1447  O  O     . VAL E 3 82  ? 119.811 -56.601 37.781  1.00 19.10 ? 378  VAL A O     1 
ATOM   1448  C  CB    . VAL E 3 82  ? 120.402 -53.473 36.765  1.00 17.93 ? 378  VAL A CB    1 
ATOM   1449  C  CG1   . VAL E 3 82  ? 119.743 -53.386 38.139  1.00 17.97 ? 378  VAL A CG1   1 
ATOM   1450  C  CG2   . VAL E 3 82  ? 121.553 -52.474 36.681  1.00 16.49 ? 378  VAL A CG2   1 
ATOM   1451  N  N     . ALA E 3 83  ? 118.908 -56.034 35.807  1.00 17.70 ? 379  ALA A N     1 
ATOM   1452  C  CA    . ALA E 3 83  ? 117.816 -56.993 35.930  1.00 19.09 ? 379  ALA A CA    1 
ATOM   1453  C  C     . ALA E 3 83  ? 118.393 -58.402 36.128  1.00 20.85 ? 379  ALA A C     1 
ATOM   1454  O  O     . ALA E 3 83  ? 117.843 -59.210 36.882  1.00 20.82 ? 379  ALA A O     1 
ATOM   1455  C  CB    . ALA E 3 83  ? 116.943 -56.953 34.689  1.00 18.06 ? 379  ALA A CB    1 
ATOM   1456  N  N     . LEU E 3 84  ? 119.502 -58.691 35.454  1.00 18.56 ? 380  LEU A N     1 
ATOM   1457  C  CA    . LEU E 3 84  ? 120.136 -59.999 35.588  1.00 20.77 ? 380  LEU A CA    1 
ATOM   1458  C  C     . LEU E 3 84  ? 120.816 -60.144 36.947  1.00 21.45 ? 380  LEU A C     1 
ATOM   1459  O  O     . LEU E 3 84  ? 120.834 -61.237 37.519  1.00 21.01 ? 380  LEU A O     1 
ATOM   1460  C  CB    . LEU E 3 84  ? 121.143 -60.227 34.456  1.00 19.95 ? 380  LEU A CB    1 
ATOM   1461  C  CG    . LEU E 3 84  ? 120.512 -60.619 33.117  1.00 21.03 ? 380  LEU A CG    1 
ATOM   1462  C  CD1   . LEU E 3 84  ? 121.583 -60.681 32.035  1.00 20.16 ? 380  LEU A CD1   1 
ATOM   1463  C  CD2   . LEU E 3 84  ? 119.811 -61.966 33.258  1.00 19.50 ? 380  LEU A CD2   1 
ATOM   1464  N  N     . LYS E 3 85  ? 121.374 -59.050 37.465  1.00 21.43 ? 381  LYS A N     1 
ATOM   1465  C  CA    . LYS E 3 85  ? 122.019 -59.092 38.776  1.00 23.24 ? 381  LYS A CA    1 
ATOM   1466  C  C     . LYS E 3 85  ? 120.974 -59.522 39.801  1.00 23.38 ? 381  LYS A C     1 
ATOM   1467  O  O     . LYS E 3 85  ? 121.230 -60.391 40.637  1.00 23.26 ? 381  LYS A O     1 
ATOM   1468  C  CB    . LYS E 3 85  ? 122.576 -57.718 39.173  1.00 24.19 ? 381  LYS A CB    1 
ATOM   1469  C  CG    . LYS E 3 85  ? 123.849 -57.287 38.451  1.00 27.09 ? 381  LYS A CG    1 
ATOM   1470  C  CD    . LYS E 3 85  ? 124.259 -55.875 38.876  1.00 29.19 ? 381  LYS A CD    1 
ATOM   1471  C  CE    . LYS E 3 85  ? 125.437 -55.343 38.066  1.00 30.44 ? 381  LYS A CE    1 
ATOM   1472  N  NZ    . LYS E 3 85  ? 126.685 -56.123 38.283  1.00 31.25 ? 381  LYS A NZ    1 
ATOM   1473  N  N     . TRP E 3 86  ? 119.793 -58.909 39.735  1.00 21.82 ? 382  TRP A N     1 
ATOM   1474  C  CA    . TRP E 3 86  ? 118.722 -59.250 40.664  1.00 22.66 ? 382  TRP A CA    1 
ATOM   1475  C  C     . TRP E 3 86  ? 118.293 -60.706 40.506  1.00 21.91 ? 382  TRP A C     1 
ATOM   1476  O  O     . TRP E 3 86  ? 117.694 -61.285 41.412  1.00 21.45 ? 382  TRP A O     1 
ATOM   1477  C  CB    . TRP E 3 86  ? 117.515 -58.325 40.471  1.00 22.74 ? 382  TRP A CB    1 
ATOM   1478  C  CG    . TRP E 3 86  ? 117.738 -56.954 41.029  1.00 23.58 ? 382  TRP A CG    1 
ATOM   1479  C  CD1   . TRP E 3 86  ? 118.189 -55.853 40.358  1.00 24.58 ? 382  TRP A CD1   1 
ATOM   1480  C  CD2   . TRP E 3 86  ? 117.544 -56.545 42.388  1.00 23.63 ? 382  TRP A CD2   1 
ATOM   1481  N  NE1   . TRP E 3 86  ? 118.288 -54.782 41.216  1.00 22.92 ? 382  TRP A NE1   1 
ATOM   1482  C  CE2   . TRP E 3 86  ? 117.899 -55.180 42.469  1.00 24.03 ? 382  TRP A CE2   1 
ATOM   1483  C  CE3   . TRP E 3 86  ? 117.105 -57.202 43.548  1.00 24.94 ? 382  TRP A CE3   1 
ATOM   1484  C  CZ2   . TRP E 3 86  ? 117.829 -54.456 43.664  1.00 24.23 ? 382  TRP A CZ2   1 
ATOM   1485  C  CZ3   . TRP E 3 86  ? 117.036 -56.480 44.740  1.00 24.00 ? 382  TRP A CZ3   1 
ATOM   1486  C  CH2   . TRP E 3 86  ? 117.397 -55.121 44.786  1.00 24.84 ? 382  TRP A CH2   1 
ATOM   1487  N  N     . LYS E 3 87  ? 118.598 -61.288 39.351  1.00 21.88 ? 383  LYS A N     1 
ATOM   1488  C  CA    . LYS E 3 87  ? 118.270 -62.684 39.092  1.00 23.93 ? 383  LYS A CA    1 
ATOM   1489  C  C     . LYS E 3 87  ? 119.461 -63.568 39.460  1.00 22.88 ? 383  LYS A C     1 
ATOM   1490  O  O     . LYS E 3 87  ? 119.456 -64.771 39.203  1.00 23.31 ? 383  LYS A O     1 
ATOM   1491  C  CB    . LYS E 3 87  ? 117.904 -62.886 37.620  1.00 26.56 ? 383  LYS A CB    1 
ATOM   1492  C  CG    . LYS E 3 87  ? 116.560 -62.290 37.228  1.00 29.54 ? 383  LYS A CG    1 
ATOM   1493  C  CD    . LYS E 3 87  ? 115.439 -62.892 38.060  1.00 32.32 ? 383  LYS A CD    1 
ATOM   1494  C  CE    . LYS E 3 87  ? 114.075 -62.423 37.585  1.00 34.48 ? 383  LYS A CE    1 
ATOM   1495  N  NZ    . LYS E 3 87  ? 112.988 -62.896 38.490  1.00 36.05 ? 383  LYS A NZ    1 
ATOM   1496  N  N     . GLY E 3 88  ? 120.476 -62.954 40.061  1.00 22.06 ? 384  GLY A N     1 
ATOM   1497  C  CA    . GLY E 3 88  ? 121.665 -63.682 40.475  1.00 24.11 ? 384  GLY A CA    1 
ATOM   1498  C  C     . GLY E 3 88  ? 122.605 -64.085 39.351  1.00 26.28 ? 384  GLY A C     1 
ATOM   1499  O  O     . GLY E 3 88  ? 123.468 -64.947 39.536  1.00 25.36 ? 384  GLY A O     1 
ATOM   1500  N  N     . ILE E 3 89  ? 122.455 -63.448 38.193  1.00 25.34 ? 385  ILE A N     1 
ATOM   1501  C  CA    . ILE E 3 89  ? 123.275 -63.757 37.027  1.00 25.22 ? 385  ILE A CA    1 
ATOM   1502  C  C     . ILE E 3 89  ? 124.136 -62.569 36.589  1.00 26.00 ? 385  ILE A C     1 
ATOM   1503  O  O     . ILE E 3 89  ? 123.671 -61.431 36.567  1.00 23.26 ? 385  ILE A O     1 
ATOM   1504  C  CB    . ILE E 3 89  ? 122.369 -64.192 35.857  1.00 24.23 ? 385  ILE A CB    1 
ATOM   1505  C  CG1   . ILE E 3 89  ? 121.580 -65.440 36.267  1.00 22.49 ? 385  ILE A CG1   1 
ATOM   1506  C  CG2   . ILE E 3 89  ? 123.202 -64.454 34.608  1.00 24.59 ? 385  ILE A CG2   1 
ATOM   1507  C  CD1   . ILE E 3 89  ? 120.419 -65.757 35.359  1.00 20.69 ? 385  ILE A CD1   1 
ATOM   1508  N  N     . GLU E 3 90  ? 125.392 -62.844 36.242  1.00 26.42 ? 386  GLU A N     1 
ATOM   1509  C  CA    . GLU E 3 90  ? 126.315 -61.796 35.801  1.00 27.98 ? 386  GLU A CA    1 
ATOM   1510  C  C     . GLU E 3 90  ? 126.403 -61.698 34.278  1.00 26.11 ? 386  GLU A C     1 
ATOM   1511  O  O     . GLU E 3 90  ? 126.555 -62.709 33.590  1.00 26.13 ? 386  GLU A O     1 
ATOM   1512  C  CB    . GLU E 3 90  ? 127.715 -62.049 36.371  1.00 31.01 ? 386  GLU A CB    1 
ATOM   1513  C  CG    . GLU E 3 90  ? 128.821 -61.256 35.677  1.00 36.52 ? 386  GLU A CG    1 
ATOM   1514  C  CD    . GLU E 3 90  ? 130.211 -61.614 36.178  1.00 39.62 ? 386  GLU A CD    1 
ATOM   1515  O  OE1   . GLU E 3 90  ? 130.406 -62.761 36.634  1.00 42.65 ? 386  GLU A OE1   1 
ATOM   1516  O  OE2   . GLU E 3 90  ? 131.115 -60.756 36.101  1.00 42.37 ? 386  GLU A OE2   1 
ATOM   1517  N  N     . LEU E 3 91  ? 126.315 -60.474 33.760  1.00 24.66 ? 387  LEU A N     1 
ATOM   1518  C  CA    . LEU E 3 91  ? 126.395 -60.232 32.320  1.00 22.93 ? 387  LEU A CA    1 
ATOM   1519  C  C     . LEU E 3 91  ? 127.731 -59.581 31.974  1.00 23.24 ? 387  LEU A C     1 
ATOM   1520  O  O     . LEU E 3 91  ? 128.113 -58.588 32.583  1.00 21.62 ? 387  LEU A O     1 
ATOM   1521  C  CB    . LEU E 3 91  ? 125.258 -59.313 31.863  1.00 21.85 ? 387  LEU A CB    1 
ATOM   1522  C  CG    . LEU E 3 91  ? 125.219 -58.934 30.376  1.00 20.75 ? 387  LEU A CG    1 
ATOM   1523  C  CD1   . LEU E 3 91  ? 124.917 -60.164 29.526  1.00 18.79 ? 387  LEU A CD1   1 
ATOM   1524  C  CD2   . LEU E 3 91  ? 124.154 -57.869 30.152  1.00 22.08 ? 387  LEU A CD2   1 
ATOM   1525  N  N     . CYS E 3 92  ? 128.434 -60.146 30.996  1.00 23.09 ? 388  CYS A N     1 
ATOM   1526  C  CA    . CYS E 3 92  ? 129.722 -59.613 30.557  1.00 24.52 ? 388  CYS A CA    1 
ATOM   1527  C  C     . CYS E 3 92  ? 129.799 -59.662 29.033  1.00 23.60 ? 388  CYS A C     1 
ATOM   1528  O  O     . CYS E 3 92  ? 128.981 -60.312 28.383  1.00 23.93 ? 388  CYS A O     1 
ATOM   1529  C  CB    . CYS E 3 92  ? 130.876 -60.443 31.137  1.00 25.63 ? 388  CYS A CB    1 
ATOM   1530  S  SG    . CYS E 3 92  ? 130.957 -60.522 32.938  1.00 31.17 ? 388  CYS A SG    1 
ATOM   1531  N  N     . GLY E 3 93  ? 130.783 -58.970 28.466  1.00 23.94 ? 389  GLY A N     1 
ATOM   1532  C  CA    . GLY E 3 93  ? 130.958 -58.993 27.024  1.00 23.53 ? 389  GLY A CA    1 
ATOM   1533  C  C     . GLY E 3 93  ? 130.115 -58.052 26.182  1.00 24.22 ? 389  GLY A C     1 
ATOM   1534  O  O     . GLY E 3 93  ? 130.025 -58.234 24.966  1.00 23.17 ? 389  GLY A O     1 
ATOM   1535  N  N     . VAL E 3 94  ? 129.491 -57.053 26.801  1.00 23.43 ? 390  VAL A N     1 
ATOM   1536  C  CA    . VAL E 3 94  ? 128.689 -56.104 26.034  1.00 22.70 ? 390  VAL A CA    1 
ATOM   1537  C  C     . VAL E 3 94  ? 129.655 -55.210 25.268  1.00 22.31 ? 390  VAL A C     1 
ATOM   1538  O  O     . VAL E 3 94  ? 130.366 -54.403 25.864  1.00 23.44 ? 390  VAL A O     1 
ATOM   1539  C  CB    . VAL E 3 94  ? 127.800 -55.226 26.946  1.00 21.96 ? 390  VAL A CB    1 
ATOM   1540  C  CG1   . VAL E 3 94  ? 127.160 -54.113 26.126  1.00 20.23 ? 390  VAL A CG1   1 
ATOM   1541  C  CG2   . VAL E 3 94  ? 126.719 -56.084 27.599  1.00 22.46 ? 390  VAL A CG2   1 
ATOM   1542  N  N     . SER E 3 95  ? 129.675 -55.356 23.948  1.00 22.18 ? 391  SER A N     1 
ATOM   1543  C  CA    . SER E 3 95  ? 130.585 -54.581 23.110  1.00 22.06 ? 391  SER A CA    1 
ATOM   1544  C  C     . SER E 3 95  ? 129.944 -53.396 22.406  1.00 20.18 ? 391  SER A C     1 
ATOM   1545  O  O     . SER E 3 95  ? 130.648 -52.513 21.918  1.00 21.66 ? 391  SER A O     1 
ATOM   1546  C  CB    . SER E 3 95  ? 131.231 -55.496 22.066  1.00 21.52 ? 391  SER A CB    1 
ATOM   1547  O  OG    . SER E 3 95  ? 130.238 -56.116 21.267  1.00 23.35 ? 391  SER A OG    1 
ATOM   1548  N  N     . PHE E 3 96  ? 128.615 -53.374 22.351  1.00 19.31 ? 392  PHE A N     1 
ATOM   1549  C  CA    . PHE E 3 96  ? 127.894 -52.288 21.693  1.00 18.03 ? 392  PHE A CA    1 
ATOM   1550  C  C     . PHE E 3 96  ? 126.528 -52.056 22.335  1.00 18.43 ? 392  PHE A C     1 
ATOM   1551  O  O     . PHE E 3 96  ? 125.775 -53.002 22.573  1.00 19.18 ? 392  PHE A O     1 
ATOM   1552  C  CB    . PHE E 3 96  ? 127.708 -52.610 20.207  1.00 18.66 ? 392  PHE A CB    1 
ATOM   1553  C  CG    . PHE E 3 96  ? 126.984 -51.538 19.433  1.00 19.17 ? 392  PHE A CG    1 
ATOM   1554  C  CD1   . PHE E 3 96  ? 127.589 -50.309 19.182  1.00 19.21 ? 392  PHE A CD1   1 
ATOM   1555  C  CD2   . PHE E 3 96  ? 125.694 -51.761 18.955  1.00 19.01 ? 392  PHE A CD2   1 
ATOM   1556  C  CE1   . PHE E 3 96  ? 126.917 -49.317 18.466  1.00 16.86 ? 392  PHE A CE1   1 
ATOM   1557  C  CE2   . PHE E 3 96  ? 125.014 -50.775 18.237  1.00 20.31 ? 392  PHE A CE2   1 
ATOM   1558  C  CZ    . PHE E 3 96  ? 125.628 -49.551 17.993  1.00 18.89 ? 392  PHE A CZ    1 
ATOM   1559  N  N     . ASP E 3 97  ? 126.217 -50.795 22.614  1.00 16.76 ? 393  ASP A N     1 
ATOM   1560  C  CA    . ASP E 3 97  ? 124.934 -50.430 23.208  1.00 17.38 ? 393  ASP A CA    1 
ATOM   1561  C  C     . ASP E 3 97  ? 124.273 -49.402 22.290  1.00 17.00 ? 393  ASP A C     1 
ATOM   1562  O  O     . ASP E 3 97  ? 124.678 -48.246 22.259  1.00 17.44 ? 393  ASP A O     1 
ATOM   1563  C  CB    . ASP E 3 97  ? 125.145 -49.824 24.596  1.00 16.40 ? 393  ASP A CB    1 
ATOM   1564  C  CG    . ASP E 3 97  ? 123.848 -49.660 25.362  1.00 18.35 ? 393  ASP A CG    1 
ATOM   1565  O  OD1   . ASP E 3 97  ? 122.829 -49.282 24.744  1.00 16.14 ? 393  ASP A OD1   1 
ATOM   1566  O  OD2   . ASP E 3 97  ? 123.851 -49.903 26.588  1.00 19.51 ? 393  ASP A OD2   1 
ATOM   1567  N  N     . LEU E 3 98  ? 123.257 -49.834 21.549  1.00 17.75 ? 394  LEU A N     1 
ATOM   1568  C  CA    . LEU E 3 98  ? 122.554 -48.969 20.606  1.00 18.08 ? 394  LEU A CA    1 
ATOM   1569  C  C     . LEU E 3 98  ? 121.924 -47.722 21.224  1.00 18.44 ? 394  LEU A C     1 
ATOM   1570  O  O     . LEU E 3 98  ? 121.853 -46.676 20.577  1.00 18.60 ? 394  LEU A O     1 
ATOM   1571  C  CB    . LEU E 3 98  ? 121.486 -49.775 19.860  1.00 18.58 ? 394  LEU A CB    1 
ATOM   1572  C  CG    . LEU E 3 98  ? 120.713 -49.040 18.763  1.00 16.78 ? 394  LEU A CG    1 
ATOM   1573  C  CD1   . LEU E 3 98  ? 121.680 -48.527 17.694  1.00 18.66 ? 394  LEU A CD1   1 
ATOM   1574  C  CD2   . LEU E 3 98  ? 119.691 -49.983 18.158  1.00 18.75 ? 394  LEU A CD2   1 
ATOM   1575  N  N     . LEU E 3 99  ? 121.469 -47.826 22.470  1.00 17.59 ? 395  LEU A N     1 
ATOM   1576  C  CA    . LEU E 3 99  ? 120.866 -46.679 23.149  1.00 15.96 ? 395  LEU A CA    1 
ATOM   1577  C  C     . LEU E 3 99  ? 121.893 -45.560 23.323  1.00 14.51 ? 395  LEU A C     1 
ATOM   1578  O  O     . LEU E 3 99  ? 121.622 -44.400 23.014  1.00 15.41 ? 395  LEU A O     1 
ATOM   1579  C  CB    . LEU E 3 99  ? 120.323 -47.089 24.525  1.00 16.13 ? 395  LEU A CB    1 
ATOM   1580  C  CG    . LEU E 3 99  ? 119.945 -45.930 25.461  1.00 16.15 ? 395  LEU A CG    1 
ATOM   1581  C  CD1   . LEU E 3 99  ? 118.841 -45.094 24.839  1.00 17.10 ? 395  LEU A CD1   1 
ATOM   1582  C  CD2   . LEU E 3 99  ? 119.509 -46.483 26.809  1.00 17.08 ? 395  LEU A CD2   1 
ATOM   1583  N  N     . LEU E 3 100 ? 123.074 -45.915 23.812  1.00 14.39 ? 396  LEU A N     1 
ATOM   1584  C  CA    . LEU E 3 100 ? 124.138 -44.936 24.024  1.00 14.48 ? 396  LEU A CA    1 
ATOM   1585  C  C     . LEU E 3 100 ? 124.661 -44.405 22.688  1.00 14.99 ? 396  LEU A C     1 
ATOM   1586  O  O     . LEU E 3 100 ? 125.023 -43.234 22.573  1.00 15.69 ? 396  LEU A O     1 
ATOM   1587  C  CB    . LEU E 3 100 ? 125.273 -45.566 24.839  1.00 14.67 ? 396  LEU A CB    1 
ATOM   1588  C  CG    . LEU E 3 100 ? 124.879 -45.910 26.282  1.00 17.58 ? 396  LEU A CG    1 
ATOM   1589  C  CD1   . LEU E 3 100 ? 126.030 -46.614 26.994  1.00 15.75 ? 396  LEU A CD1   1 
ATOM   1590  C  CD2   . LEU E 3 100 ? 124.492 -44.631 27.021  1.00 17.04 ? 396  LEU A CD2   1 
ATOM   1591  N  N     . ALA E 3 101 ? 124.698 -45.268 21.679  1.00 14.87 ? 397  ALA A N     1 
ATOM   1592  C  CA    . ALA E 3 101 ? 125.148 -44.853 20.357  1.00 15.97 ? 397  ALA A CA    1 
ATOM   1593  C  C     . ALA E 3 101 ? 124.199 -43.775 19.824  1.00 15.43 ? 397  ALA A C     1 
ATOM   1594  O  O     . ALA E 3 101 ? 124.639 -42.717 19.372  1.00 15.94 ? 397  ALA A O     1 
ATOM   1595  C  CB    . ALA E 3 101 ? 125.176 -46.050 19.409  1.00 15.86 ? 397  ALA A CB    1 
ATOM   1596  N  N     . ALA E 3 102 ? 122.897 -44.046 19.883  1.00 15.76 ? 398  ALA A N     1 
ATOM   1597  C  CA    . ALA E 3 102 ? 121.887 -43.097 19.413  1.00 16.19 ? 398  ALA A CA    1 
ATOM   1598  C  C     . ALA E 3 102 ? 121.951 -41.796 20.216  1.00 16.63 ? 398  ALA A C     1 
ATOM   1599  O  O     . ALA E 3 102 ? 121.858 -40.698 19.658  1.00 15.22 ? 398  ALA A O     1 
ATOM   1600  C  CB    . ALA E 3 102 ? 120.496 -43.716 19.529  1.00 16.36 ? 398  ALA A CB    1 
ATOM   1601  N  N     . TYR E 3 103 ? 122.109 -41.933 21.528  1.00 16.24 ? 399  TYR A N     1 
ATOM   1602  C  CA    . TYR E 3 103 ? 122.202 -40.791 22.432  1.00 16.06 ? 399  TYR A CA    1 
ATOM   1603  C  C     . TYR E 3 103 ? 123.347 -39.849 22.054  1.00 16.08 ? 399  TYR A C     1 
ATOM   1604  O  O     . TYR E 3 103 ? 123.181 -38.627 22.044  1.00 16.88 ? 399  TYR A O     1 
ATOM   1605  C  CB    . TYR E 3 103 ? 122.403 -41.287 23.867  1.00 15.85 ? 399  TYR A CB    1 
ATOM   1606  C  CG    . TYR E 3 103 ? 122.595 -40.185 24.885  1.00 13.76 ? 399  TYR A CG    1 
ATOM   1607  C  CD1   . TYR E 3 103 ? 121.610 -39.219 25.094  1.00 14.84 ? 399  TYR A CD1   1 
ATOM   1608  C  CD2   . TYR E 3 103 ? 123.755 -40.124 25.656  1.00 13.29 ? 399  TYR A CD2   1 
ATOM   1609  C  CE1   . TYR E 3 103 ? 121.775 -38.217 26.054  1.00 14.16 ? 399  TYR A CE1   1 
ATOM   1610  C  CE2   . TYR E 3 103 ? 123.934 -39.127 26.618  1.00 13.48 ? 399  TYR A CE2   1 
ATOM   1611  C  CZ    . TYR E 3 103 ? 122.941 -38.180 26.813  1.00 14.88 ? 399  TYR A CZ    1 
ATOM   1612  O  OH    . TYR E 3 103 ? 123.113 -37.206 27.772  1.00 14.00 ? 399  TYR A OH    1 
ATOM   1613  N  N     . LEU E 3 104 ? 124.509 -40.413 21.744  1.00 16.63 ? 400  LEU A N     1 
ATOM   1614  C  CA    . LEU E 3 104 ? 125.659 -39.596 21.375  1.00 17.88 ? 400  LEU A CA    1 
ATOM   1615  C  C     . LEU E 3 104 ? 125.481 -38.914 20.013  1.00 18.28 ? 400  LEU A C     1 
ATOM   1616  O  O     . LEU E 3 104 ? 125.876 -37.760 19.835  1.00 17.60 ? 400  LEU A O     1 
ATOM   1617  C  CB    . LEU E 3 104 ? 126.934 -40.444 21.377  1.00 17.49 ? 400  LEU A CB    1 
ATOM   1618  C  CG    . LEU E 3 104 ? 127.375 -40.973 22.749  1.00 18.66 ? 400  LEU A CG    1 
ATOM   1619  C  CD1   . LEU E 3 104 ? 128.640 -41.811 22.593  1.00 18.18 ? 400  LEU A CD1   1 
ATOM   1620  C  CD2   . LEU E 3 104 ? 127.617 -39.801 23.708  1.00 16.81 ? 400  LEU A CD2   1 
ATOM   1621  N  N     . LEU E 3 105 ? 124.883 -39.621 19.059  1.00 18.59 ? 401  LEU A N     1 
ATOM   1622  C  CA    . LEU E 3 105 ? 124.668 -39.047 17.733  1.00 19.56 ? 401  LEU A CA    1 
ATOM   1623  C  C     . LEU E 3 105 ? 123.758 -37.821 17.791  1.00 19.72 ? 401  LEU A C     1 
ATOM   1624  O  O     . LEU E 3 105 ? 123.953 -36.863 17.045  1.00 19.52 ? 401  LEU A O     1 
ATOM   1625  C  CB    . LEU E 3 105 ? 124.072 -40.085 16.782  1.00 19.73 ? 401  LEU A CB    1 
ATOM   1626  C  CG    . LEU E 3 105 ? 125.004 -41.203 16.301  1.00 21.10 ? 401  LEU A CG    1 
ATOM   1627  C  CD1   . LEU E 3 105 ? 124.257 -42.074 15.299  1.00 20.55 ? 401  LEU A CD1   1 
ATOM   1628  C  CD2   . LEU E 3 105 ? 126.258 -40.607 15.661  1.00 21.33 ? 401  LEU A CD2   1 
ATOM   1629  N  N     . ASP E 3 106 ? 122.764 -37.851 18.673  1.00 19.20 ? 402  ASP A N     1 
ATOM   1630  C  CA    . ASP E 3 106 ? 121.845 -36.723 18.821  1.00 18.77 ? 402  ASP A CA    1 
ATOM   1631  C  C     . ASP E 3 106 ? 120.922 -36.888 20.021  1.00 16.89 ? 402  ASP A C     1 
ATOM   1632  O  O     . ASP E 3 106 ? 119.887 -37.551 19.939  1.00 15.40 ? 402  ASP A O     1 
ATOM   1633  C  CB    . ASP E 3 106 ? 121.003 -36.537 17.552  1.00 20.19 ? 402  ASP A CB    1 
ATOM   1634  C  CG    . ASP E 3 106 ? 120.079 -35.331 17.639  1.00 22.36 ? 402  ASP A CG    1 
ATOM   1635  O  OD1   . ASP E 3 106 ? 120.274 -34.490 18.543  1.00 22.93 ? 402  ASP A OD1   1 
ATOM   1636  O  OD2   . ASP E 3 106 ? 119.163 -35.215 16.799  1.00 25.88 ? 402  ASP A OD2   1 
ATOM   1637  N  N     . PRO E 3 107 ? 121.283 -36.269 21.153  1.00 17.47 ? 403  PRO A N     1 
ATOM   1638  C  CA    . PRO E 3 107 ? 120.493 -36.340 22.386  1.00 16.69 ? 403  PRO A CA    1 
ATOM   1639  C  C     . PRO E 3 107 ? 119.053 -35.866 22.195  1.00 17.74 ? 403  PRO A C     1 
ATOM   1640  O  O     . PRO E 3 107 ? 118.138 -36.342 22.865  1.00 15.77 ? 403  PRO A O     1 
ATOM   1641  C  CB    . PRO E 3 107 ? 121.275 -35.458 23.360  1.00 16.37 ? 403  PRO A CB    1 
ATOM   1642  C  CG    . PRO E 3 107 ? 122.682 -35.539 22.852  1.00 19.38 ? 403  PRO A CG    1 
ATOM   1643  C  CD    . PRO E 3 107 ? 122.500 -35.460 21.355  1.00 16.39 ? 403  PRO A CD    1 
ATOM   1644  N  N     . ALA E 3 108 ? 118.866 -34.934 21.266  1.00 17.82 ? 404  ALA A N     1 
ATOM   1645  C  CA    . ALA E 3 108 ? 117.553 -34.360 20.992  1.00 20.13 ? 404  ALA A CA    1 
ATOM   1646  C  C     . ALA E 3 108 ? 116.494 -35.318 20.439  1.00 21.63 ? 404  ALA A C     1 
ATOM   1647  O  O     . ALA E 3 108 ? 115.298 -35.056 20.578  1.00 21.74 ? 404  ALA A O     1 
ATOM   1648  C  CB    . ALA E 3 108 ? 117.705 -33.163 20.054  1.00 18.82 ? 404  ALA A CB    1 
ATOM   1649  N  N     . GLN E 3 109 ? 116.914 -36.415 19.815  1.00 22.93 ? 405  GLN A N     1 
ATOM   1650  C  CA    . GLN E 3 109 ? 115.945 -37.357 19.259  1.00 24.82 ? 405  GLN A CA    1 
ATOM   1651  C  C     . GLN E 3 109 ? 115.148 -38.072 20.344  1.00 25.29 ? 405  GLN A C     1 
ATOM   1652  O  O     . GLN E 3 109 ? 114.076 -38.609 20.078  1.00 25.14 ? 405  GLN A O     1 
ATOM   1653  C  CB    . GLN E 3 109 ? 116.638 -38.388 18.366  1.00 26.26 ? 405  GLN A CB    1 
ATOM   1654  C  CG    . GLN E 3 109 ? 117.224 -37.805 17.090  1.00 31.64 ? 405  GLN A CG    1 
ATOM   1655  C  CD    . GLN E 3 109 ? 116.235 -36.927 16.342  1.00 34.43 ? 405  GLN A CD    1 
ATOM   1656  O  OE1   . GLN E 3 109 ? 115.100 -37.331 16.080  1.00 35.91 ? 405  GLN A OE1   1 
ATOM   1657  N  NE2   . GLN E 3 109 ? 116.665 -35.717 15.992  1.00 35.25 ? 405  GLN A NE2   1 
ATOM   1658  N  N     . GLY E 3 110 ? 115.676 -38.074 21.563  1.00 24.00 ? 406  GLY A N     1 
ATOM   1659  C  CA    . GLY E 3 110 ? 114.994 -38.723 22.669  1.00 24.85 ? 406  GLY A CA    1 
ATOM   1660  C  C     . GLY E 3 110 ? 114.796 -40.217 22.479  1.00 25.03 ? 406  GLY A C     1 
ATOM   1661  O  O     . GLY E 3 110 ? 113.809 -40.780 22.953  1.00 24.70 ? 406  GLY A O     1 
ATOM   1662  N  N     . VAL E 3 111 ? 115.731 -40.862 21.785  1.00 24.66 ? 407  VAL A N     1 
ATOM   1663  C  CA    . VAL E 3 111 ? 115.641 -42.296 21.541  1.00 22.72 ? 407  VAL A CA    1 
ATOM   1664  C  C     . VAL E 3 111 ? 115.423 -43.026 22.857  1.00 23.39 ? 407  VAL A C     1 
ATOM   1665  O  O     . VAL E 3 111 ? 116.222 -42.901 23.786  1.00 22.26 ? 407  VAL A O     1 
ATOM   1666  C  CB    . VAL E 3 111 ? 116.917 -42.820 20.856  1.00 22.86 ? 407  VAL A CB    1 
ATOM   1667  C  CG1   . VAL E 3 111 ? 116.897 -44.345 20.793  1.00 22.44 ? 407  VAL A CG1   1 
ATOM   1668  C  CG2   . VAL E 3 111 ? 117.013 -42.235 19.457  1.00 22.27 ? 407  VAL A CG2   1 
ATOM   1669  N  N     . ASP E 3 112 ? 114.332 -43.784 22.924  1.00 22.53 ? 408  ASP A N     1 
ATOM   1670  C  CA    . ASP E 3 112 ? 113.975 -44.521 24.130  1.00 23.83 ? 408  ASP A CA    1 
ATOM   1671  C  C     . ASP E 3 112 ? 113.671 -45.989 23.842  1.00 22.53 ? 408  ASP A C     1 
ATOM   1672  O  O     . ASP E 3 112 ? 113.347 -46.749 24.748  1.00 21.25 ? 408  ASP A O     1 
ATOM   1673  C  CB    . ASP E 3 112 ? 112.764 -43.857 24.787  1.00 27.38 ? 408  ASP A CB    1 
ATOM   1674  C  CG    . ASP E 3 112 ? 111.545 -43.876 23.893  1.00 29.87 ? 408  ASP A CG    1 
ATOM   1675  O  OD1   . ASP E 3 112 ? 111.709 -43.732 22.660  1.00 33.47 ? 408  ASP A OD1   1 
ATOM   1676  O  OD2   . ASP E 3 112 ? 110.425 -44.030 24.417  1.00 35.35 ? 408  ASP A OD2   1 
ATOM   1677  N  N     . ASP E 3 113 ? 113.758 -46.383 22.576  1.00 22.00 ? 409  ASP A N     1 
ATOM   1678  C  CA    . ASP E 3 113 ? 113.538 -47.776 22.207  1.00 23.26 ? 409  ASP A CA    1 
ATOM   1679  C  C     . ASP E 3 113 ? 114.233 -48.079 20.885  1.00 22.08 ? 409  ASP A C     1 
ATOM   1680  O  O     . ASP E 3 113 ? 114.633 -47.165 20.161  1.00 21.77 ? 409  ASP A O     1 
ATOM   1681  C  CB    . ASP E 3 113 ? 112.034 -48.120 22.136  1.00 23.77 ? 409  ASP A CB    1 
ATOM   1682  C  CG    . ASP E 3 113 ? 111.317 -47.471 20.961  1.00 27.08 ? 409  ASP A CG    1 
ATOM   1683  O  OD1   . ASP E 3 113 ? 110.100 -47.723 20.811  1.00 27.44 ? 409  ASP A OD1   1 
ATOM   1684  O  OD2   . ASP E 3 113 ? 111.946 -46.718 20.190  1.00 28.17 ? 409  ASP A OD2   1 
ATOM   1685  N  N     . VAL E 3 114 ? 114.389 -49.364 20.583  1.00 21.41 ? 410  VAL A N     1 
ATOM   1686  C  CA    . VAL E 3 114 ? 115.051 -49.788 19.354  1.00 21.43 ? 410  VAL A CA    1 
ATOM   1687  C  C     . VAL E 3 114 ? 114.442 -49.145 18.109  1.00 21.49 ? 410  VAL A C     1 
ATOM   1688  O  O     . VAL E 3 114 ? 115.166 -48.679 17.231  1.00 21.30 ? 410  VAL A O     1 
ATOM   1689  C  CB    . VAL E 3 114 ? 115.005 -51.325 19.203  1.00 21.38 ? 410  VAL A CB    1 
ATOM   1690  C  CG1   . VAL E 3 114 ? 115.589 -51.739 17.853  1.00 22.51 ? 410  VAL A CG1   1 
ATOM   1691  C  CG2   . VAL E 3 114 ? 115.783 -51.976 20.338  1.00 21.35 ? 410  VAL A CG2   1 
ATOM   1692  N  N     . ALA E 3 115 ? 113.116 -49.116 18.035  1.00 21.34 ? 411  ALA A N     1 
ATOM   1693  C  CA    . ALA E 3 115 ? 112.439 -48.526 16.883  1.00 22.67 ? 411  ALA A CA    1 
ATOM   1694  C  C     . ALA E 3 115 ? 112.887 -47.083 16.636  1.00 23.01 ? 411  ALA A C     1 
ATOM   1695  O  O     . ALA E 3 115 ? 113.127 -46.686 15.493  1.00 23.70 ? 411  ALA A O     1 
ATOM   1696  C  CB    . ALA E 3 115 ? 110.932 -48.578 17.082  1.00 23.04 ? 411  ALA A CB    1 
ATOM   1697  N  N     . ALA E 3 116 ? 113.009 -46.305 17.706  1.00 21.31 ? 412  ALA A N     1 
ATOM   1698  C  CA    . ALA E 3 116 ? 113.425 -44.912 17.588  1.00 21.59 ? 412  ALA A CA    1 
ATOM   1699  C  C     . ALA E 3 116 ? 114.857 -44.804 17.066  1.00 21.82 ? 412  ALA A C     1 
ATOM   1700  O  O     . ALA E 3 116 ? 115.176 -43.906 16.287  1.00 20.34 ? 412  ALA A O     1 
ATOM   1701  C  CB    . ALA E 3 116 ? 113.300 -44.212 18.937  1.00 21.43 ? 412  ALA A CB    1 
ATOM   1702  N  N     . ALA E 3 117 ? 115.722 -45.717 17.495  1.00 21.52 ? 413  ALA A N     1 
ATOM   1703  C  CA    . ALA E 3 117 ? 117.105 -45.703 17.029  1.00 23.44 ? 413  ALA A CA    1 
ATOM   1704  C  C     . ALA E 3 117 ? 117.127 -46.102 15.554  1.00 24.50 ? 413  ALA A C     1 
ATOM   1705  O  O     . ALA E 3 117 ? 117.797 -45.471 14.734  1.00 25.54 ? 413  ALA A O     1 
ATOM   1706  C  CB    . ALA E 3 117 ? 117.953 -46.672 17.855  1.00 21.65 ? 413  ALA A CB    1 
ATOM   1707  N  N     . ALA E 3 118 ? 116.376 -47.151 15.229  1.00 25.47 ? 414  ALA A N     1 
ATOM   1708  C  CA    . ALA E 3 118 ? 116.285 -47.664 13.869  1.00 26.36 ? 414  ALA A CA    1 
ATOM   1709  C  C     . ALA E 3 118 ? 115.824 -46.598 12.876  1.00 28.17 ? 414  ALA A C     1 
ATOM   1710  O  O     . ALA E 3 118 ? 116.275 -46.571 11.732  1.00 27.64 ? 414  ALA A O     1 
ATOM   1711  C  CB    . ALA E 3 118 ? 115.336 -48.844 13.834  1.00 25.61 ? 414  ALA A CB    1 
ATOM   1712  N  N     . LYS E 3 119 ? 114.923 -45.724 13.317  1.00 29.84 ? 415  LYS A N     1 
ATOM   1713  C  CA    . LYS E 3 119 ? 114.407 -44.665 12.459  1.00 31.87 ? 415  LYS A CA    1 
ATOM   1714  C  C     . LYS E 3 119 ? 115.535 -43.751 11.988  1.00 32.21 ? 415  LYS A C     1 
ATOM   1715  O  O     . LYS E 3 119 ? 115.466 -43.182 10.897  1.00 32.16 ? 415  LYS A O     1 
ATOM   1716  C  CB    . LYS E 3 119 ? 113.351 -43.846 13.208  1.00 34.83 ? 415  LYS A CB    1 
ATOM   1717  C  CG    . LYS E 3 119 ? 112.710 -42.737 12.378  1.00 39.02 ? 415  LYS A CG    1 
ATOM   1718  C  CD    . LYS E 3 119 ? 111.711 -41.932 13.204  1.00 42.63 ? 415  LYS A CD    1 
ATOM   1719  C  CE    . LYS E 3 119 ? 111.066 -40.817 12.386  1.00 44.79 ? 415  LYS A CE    1 
ATOM   1720  N  NZ    . LYS E 3 119 ? 112.069 -39.827 11.890  1.00 47.00 ? 415  LYS A NZ    1 
ATOM   1721  N  N     . MET E 3 120 ? 116.573 -43.615 12.809  1.00 31.80 ? 416  MET A N     1 
ATOM   1722  C  CA    . MET E 3 120 ? 117.711 -42.770 12.459  1.00 31.73 ? 416  MET A CA    1 
ATOM   1723  C  C     . MET E 3 120 ? 118.423 -43.295 11.215  1.00 31.67 ? 416  MET A C     1 
ATOM   1724  O  O     . MET E 3 120 ? 119.165 -42.563 10.563  1.00 30.42 ? 416  MET A O     1 
ATOM   1725  C  CB    . MET E 3 120 ? 118.707 -42.695 13.622  1.00 30.90 ? 416  MET A CB    1 
ATOM   1726  C  CG    . MET E 3 120 ? 118.169 -42.023 14.878  1.00 30.62 ? 416  MET A CG    1 
ATOM   1727  S  SD    . MET E 3 120 ? 119.387 -41.993 16.221  1.00 30.55 ? 416  MET A SD    1 
ATOM   1728  C  CE    . MET E 3 120 ? 120.032 -40.354 16.073  1.00 32.13 ? 416  MET A CE    1 
ATOM   1729  N  N     . LYS E 3 121 ? 118.195 -44.564 10.892  1.00 32.40 ? 417  LYS A N     1 
ATOM   1730  C  CA    . LYS E 3 121 ? 118.818 -45.179 9.725   1.00 33.42 ? 417  LYS A CA    1 
ATOM   1731  C  C     . LYS E 3 121 ? 117.785 -45.761 8.763   1.00 33.44 ? 417  LYS A C     1 
ATOM   1732  O  O     . LYS E 3 121 ? 118.088 -46.665 7.989   1.00 33.07 ? 417  LYS A O     1 
ATOM   1733  C  CB    . LYS E 3 121 ? 119.791 -46.280 10.159  1.00 33.70 ? 417  LYS A CB    1 
ATOM   1734  C  CG    . LYS E 3 121 ? 120.968 -45.784 10.984  1.00 34.87 ? 417  LYS A CG    1 
ATOM   1735  C  CD    . LYS E 3 121 ? 121.808 -44.788 10.204  1.00 36.11 ? 417  LYS A CD    1 
ATOM   1736  C  CE    . LYS E 3 121 ? 122.968 -44.270 11.039  1.00 36.27 ? 417  LYS A CE    1 
ATOM   1737  N  NZ    . LYS E 3 121 ? 123.764 -43.258 10.291  1.00 37.07 ? 417  LYS A NZ    1 
ATOM   1738  N  N     . GLN E 3 122 ? 116.565 -45.240 8.821   1.00 34.71 ? 418  GLN A N     1 
ATOM   1739  C  CA    . GLN E 3 122 ? 115.487 -45.694 7.946   1.00 36.48 ? 418  GLN A CA    1 
ATOM   1740  C  C     . GLN E 3 122 ? 115.231 -47.202 8.009   1.00 37.01 ? 418  GLN A C     1 
ATOM   1741  O  O     . GLN E 3 122 ? 114.758 -47.800 7.040   1.00 37.04 ? 418  GLN A O     1 
ATOM   1742  C  CB    . GLN E 3 122 ? 115.779 -45.286 6.496   1.00 37.70 ? 418  GLN A CB    1 
ATOM   1743  C  CG    . GLN E 3 122 ? 115.824 -43.777 6.253   1.00 40.06 ? 418  GLN A CG    1 
ATOM   1744  C  CD    . GLN E 3 122 ? 116.972 -43.088 6.974   1.00 41.47 ? 418  GLN A CD    1 
ATOM   1745  O  OE1   . GLN E 3 122 ? 118.135 -43.456 6.808   1.00 43.27 ? 418  GLN A OE1   1 
ATOM   1746  N  NE2   . GLN E 3 122 ? 116.648 -42.077 7.773   1.00 41.72 ? 418  GLN A NE2   1 
ATOM   1747  N  N     . TYR E 3 123 ? 115.545 -47.815 9.146   1.00 36.00 ? 419  TYR A N     1 
ATOM   1748  C  CA    . TYR E 3 123 ? 115.321 -49.247 9.325   1.00 35.78 ? 419  TYR A CA    1 
ATOM   1749  C  C     . TYR E 3 123 ? 113.870 -49.391 9.796   1.00 36.78 ? 419  TYR A C     1 
ATOM   1750  O  O     . TYR E 3 123 ? 113.505 -48.850 10.840  1.00 35.52 ? 419  TYR A O     1 
ATOM   1751  C  CB    . TYR E 3 123 ? 116.279 -49.795 10.384  1.00 34.06 ? 419  TYR A CB    1 
ATOM   1752  C  CG    . TYR E 3 123 ? 116.249 -51.298 10.527  1.00 33.02 ? 419  TYR A CG    1 
ATOM   1753  C  CD1   . TYR E 3 123 ? 117.057 -52.113 9.733   1.00 31.68 ? 419  TYR A CD1   1 
ATOM   1754  C  CD2   . TYR E 3 123 ? 115.407 -51.908 11.454  1.00 32.23 ? 419  TYR A CD2   1 
ATOM   1755  C  CE1   . TYR E 3 123 ? 117.028 -53.500 9.860   1.00 31.88 ? 419  TYR A CE1   1 
ATOM   1756  C  CE2   . TYR E 3 123 ? 115.368 -53.293 11.589  1.00 32.03 ? 419  TYR A CE2   1 
ATOM   1757  C  CZ    . TYR E 3 123 ? 116.180 -54.083 10.791  1.00 31.74 ? 419  TYR A CZ    1 
ATOM   1758  O  OH    . TYR E 3 123 ? 116.135 -55.450 10.923  1.00 31.52 ? 419  TYR A OH    1 
ATOM   1759  N  N     . GLU E 3 124 ? 113.051 -50.119 9.038   1.00 37.69 ? 420  GLU A N     1 
ATOM   1760  C  CA    . GLU E 3 124 ? 111.633 -50.274 9.378   1.00 39.77 ? 420  GLU A CA    1 
ATOM   1761  C  C     . GLU E 3 124 ? 111.192 -51.634 9.927   1.00 38.31 ? 420  GLU A C     1 
ATOM   1762  O  O     . GLU E 3 124 ? 110.080 -51.760 10.439  1.00 37.54 ? 420  GLU A O     1 
ATOM   1763  C  CB    . GLU E 3 124 ? 110.768 -49.971 8.148   1.00 42.98 ? 420  GLU A CB    1 
ATOM   1764  C  CG    . GLU E 3 124 ? 111.199 -48.765 7.327   1.00 47.44 ? 420  GLU A CG    1 
ATOM   1765  C  CD    . GLU E 3 124 ? 110.359 -48.596 6.069   1.00 50.22 ? 420  GLU A CD    1 
ATOM   1766  O  OE1   . GLU E 3 124 ? 110.200 -49.585 5.317   1.00 51.70 ? 420  GLU A OE1   1 
ATOM   1767  O  OE2   . GLU E 3 124 ? 109.861 -47.474 5.830   1.00 51.69 ? 420  GLU A OE2   1 
ATOM   1768  N  N     . ALA E 3 125 ? 112.049 -52.643 9.822   1.00 37.01 ? 421  ALA A N     1 
ATOM   1769  C  CA    . ALA E 3 125 ? 111.707 -53.992 10.270  1.00 35.68 ? 421  ALA A CA    1 
ATOM   1770  C  C     . ALA E 3 125 ? 111.552 -54.211 11.776  1.00 34.73 ? 421  ALA A C     1 
ATOM   1771  O  O     . ALA E 3 125 ? 111.905 -55.274 12.285  1.00 34.32 ? 421  ALA A O     1 
ATOM   1772  C  CB    . ALA E 3 125 ? 112.722 -54.986 9.709   1.00 36.54 ? 421  ALA A CB    1 
ATOM   1773  N  N     . VAL E 3 126 ? 111.019 -53.223 12.489  1.00 33.59 ? 422  VAL A N     1 
ATOM   1774  C  CA    . VAL E 3 126 ? 110.820 -53.357 13.931  1.00 32.48 ? 422  VAL A CA    1 
ATOM   1775  C  C     . VAL E 3 126 ? 109.804 -52.337 14.431  1.00 33.00 ? 422  VAL A C     1 
ATOM   1776  O  O     . VAL E 3 126 ? 109.771 -51.198 13.967  1.00 31.96 ? 422  VAL A O     1 
ATOM   1777  C  CB    . VAL E 3 126 ? 112.152 -53.180 14.713  1.00 32.98 ? 422  VAL A CB    1 
ATOM   1778  C  CG1   . VAL E 3 126 ? 112.686 -51.768 14.533  1.00 32.28 ? 422  VAL A CG1   1 
ATOM   1779  C  CG2   . VAL E 3 126 ? 111.936 -53.488 16.190  1.00 30.27 ? 422  VAL A CG2   1 
ATOM   1780  N  N     . ARG E 3 127 ? 108.975 -52.756 15.382  1.00 32.72 ? 423  ARG A N     1 
ATOM   1781  C  CA    . ARG E 3 127 ? 107.946 -51.887 15.935  1.00 33.16 ? 423  ARG A CA    1 
ATOM   1782  C  C     . ARG E 3 127 ? 108.361 -51.231 17.244  1.00 31.57 ? 423  ARG A C     1 
ATOM   1783  O  O     . ARG E 3 127 ? 109.216 -51.743 17.965  1.00 31.53 ? 423  ARG A O     1 
ATOM   1784  C  CB    . ARG E 3 127 ? 106.663 -52.684 16.171  1.00 35.29 ? 423  ARG A CB    1 
ATOM   1785  C  CG    . ARG E 3 127 ? 105.971 -53.175 14.910  1.00 38.12 ? 423  ARG A CG    1 
ATOM   1786  C  CD    . ARG E 3 127 ? 104.804 -54.077 15.276  1.00 41.31 ? 423  ARG A CD    1 
ATOM   1787  N  NE    . ARG E 3 127 ? 103.870 -53.415 16.185  1.00 44.75 ? 423  ARG A NE    1 
ATOM   1788  C  CZ    . ARG E 3 127 ? 102.926 -54.045 16.879  1.00 46.24 ? 423  ARG A CZ    1 
ATOM   1789  N  NH1   . ARG E 3 127 ? 102.785 -55.359 16.773  1.00 47.25 ? 423  ARG A NH1   1 
ATOM   1790  N  NH2   . ARG E 3 127 ? 102.123 -53.361 17.682  1.00 47.09 ? 423  ARG A NH2   1 
ATOM   1791  N  N     . PRO E 3 128 ? 107.759 -50.076 17.562  1.00 30.82 ? 424  PRO A N     1 
ATOM   1792  C  CA    . PRO E 3 128 ? 108.080 -49.374 18.806  1.00 29.69 ? 424  PRO A CA    1 
ATOM   1793  C  C     . PRO E 3 128 ? 107.475 -50.158 19.963  1.00 29.12 ? 424  PRO A C     1 
ATOM   1794  O  O     . PRO E 3 128 ? 106.402 -50.747 19.818  1.00 28.16 ? 424  PRO A O     1 
ATOM   1795  C  CB    . PRO E 3 128 ? 107.454 -47.996 18.604  1.00 30.73 ? 424  PRO A CB    1 
ATOM   1796  C  CG    . PRO E 3 128 ? 106.295 -48.278 17.709  1.00 31.50 ? 424  PRO A CG    1 
ATOM   1797  C  CD    . PRO E 3 128 ? 106.857 -49.269 16.720  1.00 31.21 ? 424  PRO A CD    1 
ATOM   1798  N  N     . ASP E 3 129 ? 108.158 -50.170 21.103  1.00 28.09 ? 425  ASP A N     1 
ATOM   1799  C  CA    . ASP E 3 129 ? 107.670 -50.910 22.260  1.00 28.66 ? 425  ASP A CA    1 
ATOM   1800  C  C     . ASP E 3 129 ? 106.222 -50.599 22.635  1.00 30.05 ? 425  ASP A C     1 
ATOM   1801  O  O     . ASP E 3 129 ? 105.426 -51.515 22.842  1.00 29.61 ? 425  ASP A O     1 
ATOM   1802  C  CB    . ASP E 3 129 ? 108.578 -50.672 23.471  1.00 27.36 ? 425  ASP A CB    1 
ATOM   1803  C  CG    . ASP E 3 129 ? 109.966 -51.258 23.285  1.00 26.90 ? 425  ASP A CG    1 
ATOM   1804  O  OD1   . ASP E 3 129 ? 110.104 -52.263 22.553  1.00 26.43 ? 425  ASP A OD1   1 
ATOM   1805  O  OD2   . ASP E 3 129 ? 110.922 -50.719 23.878  1.00 27.80 ? 425  ASP A OD2   1 
ATOM   1806  N  N     . GLU E 3 130 ? 105.877 -49.316 22.725  1.00 32.18 ? 426  GLU A N     1 
ATOM   1807  C  CA    . GLU E 3 130 ? 104.516 -48.924 23.088  1.00 33.54 ? 426  GLU A CA    1 
ATOM   1808  C  C     . GLU E 3 130 ? 103.441 -49.548 22.209  1.00 32.81 ? 426  GLU A C     1 
ATOM   1809  O  O     . GLU E 3 130 ? 102.345 -49.852 22.680  1.00 32.36 ? 426  GLU A O     1 
ATOM   1810  C  CB    . GLU E 3 130 ? 104.361 -47.401 23.058  1.00 36.29 ? 426  GLU A CB    1 
ATOM   1811  C  CG    . GLU E 3 130 ? 104.901 -46.709 24.294  1.00 41.80 ? 426  GLU A CG    1 
ATOM   1812  C  CD    . GLU E 3 130 ? 104.272 -45.345 24.524  1.00 44.40 ? 426  GLU A CD    1 
ATOM   1813  O  OE1   . GLU E 3 130 ? 104.609 -44.706 25.543  1.00 46.24 ? 426  GLU A OE1   1 
ATOM   1814  O  OE2   . GLU E 3 130 ? 103.444 -44.914 23.690  1.00 45.32 ? 426  GLU A OE2   1 
ATOM   1815  N  N     . ALA E 3 131 ? 103.753 -49.737 20.932  1.00 33.03 ? 427  ALA A N     1 
ATOM   1816  C  CA    . ALA E 3 131 ? 102.802 -50.323 19.998  1.00 32.75 ? 427  ALA A CA    1 
ATOM   1817  C  C     . ALA E 3 131 ? 102.590 -51.799 20.316  1.00 33.14 ? 427  ALA A C     1 
ATOM   1818  O  O     . ALA E 3 131 ? 101.571 -52.382 19.950  1.00 32.14 ? 427  ALA A O     1 
ATOM   1819  C  CB    . ALA E 3 131 ? 103.308 -50.161 18.569  1.00 33.29 ? 427  ALA A CB    1 
ATOM   1820  N  N     . VAL E 3 132 ? 103.558 -52.392 21.009  1.00 32.72 ? 428  VAL A N     1 
ATOM   1821  C  CA    . VAL E 3 132 ? 103.497 -53.802 21.371  1.00 32.20 ? 428  VAL A CA    1 
ATOM   1822  C  C     . VAL E 3 132 ? 102.967 -54.042 22.785  1.00 32.39 ? 428  VAL A C     1 
ATOM   1823  O  O     . VAL E 3 132 ? 102.129 -54.917 22.996  1.00 32.48 ? 428  VAL A O     1 
ATOM   1824  C  CB    . VAL E 3 132 ? 104.900 -54.459 21.251  1.00 32.10 ? 428  VAL A CB    1 
ATOM   1825  C  CG1   . VAL E 3 132 ? 104.846 -55.911 21.702  1.00 31.74 ? 428  VAL A CG1   1 
ATOM   1826  C  CG2   . VAL E 3 132 ? 105.396 -54.367 19.817  1.00 31.43 ? 428  VAL A CG2   1 
ATOM   1827  N  N     . TYR E 3 133 ? 103.446 -53.260 23.748  1.00 31.76 ? 429  TYR A N     1 
ATOM   1828  C  CA    . TYR E 3 133 ? 103.034 -53.434 25.136  1.00 32.03 ? 429  TYR A CA    1 
ATOM   1829  C  C     . TYR E 3 133 ? 101.832 -52.607 25.597  1.00 33.41 ? 429  TYR A C     1 
ATOM   1830  O  O     . TYR E 3 133 ? 101.212 -52.926 26.611  1.00 33.05 ? 429  TYR A O     1 
ATOM   1831  C  CB    . TYR E 3 133 ? 104.228 -53.172 26.059  1.00 29.63 ? 429  TYR A CB    1 
ATOM   1832  C  CG    . TYR E 3 133 ? 105.389 -54.109 25.809  1.00 28.12 ? 429  TYR A CG    1 
ATOM   1833  C  CD1   . TYR E 3 133 ? 106.609 -53.633 25.325  1.00 27.22 ? 429  TYR A CD1   1 
ATOM   1834  C  CD2   . TYR E 3 133 ? 105.263 -55.479 26.041  1.00 28.73 ? 429  TYR A CD2   1 
ATOM   1835  C  CE1   . TYR E 3 133 ? 107.675 -54.500 25.077  1.00 26.52 ? 429  TYR A CE1   1 
ATOM   1836  C  CE2   . TYR E 3 133 ? 106.320 -56.355 25.796  1.00 28.50 ? 429  TYR A CE2   1 
ATOM   1837  C  CZ    . TYR E 3 133 ? 107.521 -55.860 25.314  1.00 28.15 ? 429  TYR A CZ    1 
ATOM   1838  O  OH    . TYR E 3 133 ? 108.555 -56.728 25.062  1.00 28.28 ? 429  TYR A OH    1 
ATOM   1839  N  N     . GLY E 3 134 ? 101.501 -51.550 24.863  1.00 33.93 ? 430  GLY A N     1 
ATOM   1840  C  CA    . GLY E 3 134 ? 100.368 -50.728 25.252  1.00 35.83 ? 430  GLY A CA    1 
ATOM   1841  C  C     . GLY E 3 134 ? 100.734 -49.586 26.183  1.00 36.87 ? 430  GLY A C     1 
ATOM   1842  O  O     . GLY E 3 134 ? 101.878 -49.476 26.626  1.00 37.37 ? 430  GLY A O     1 
ATOM   1843  N  N     . LYS E 3 135 ? 99.752  -48.745 26.495  1.00 37.70 ? 431  LYS A N     1 
ATOM   1844  C  CA    . LYS E 3 135 ? 99.971  -47.589 27.357  1.00 38.46 ? 431  LYS A CA    1 
ATOM   1845  C  C     . LYS E 3 135 ? 99.239  -47.677 28.697  1.00 37.61 ? 431  LYS A C     1 
ATOM   1846  O  O     . LYS E 3 135 ? 98.139  -48.222 28.786  1.00 37.46 ? 431  LYS A O     1 
ATOM   1847  C  CB    . LYS E 3 135 ? 99.520  -46.319 26.630  1.00 40.59 ? 431  LYS A CB    1 
ATOM   1848  C  CG    . LYS E 3 135 ? 99.906  -46.268 25.160  1.00 44.00 ? 431  LYS A CG    1 
ATOM   1849  C  CD    . LYS E 3 135 ? 99.163  -45.144 24.447  1.00 47.47 ? 431  LYS A CD    1 
ATOM   1850  C  CE    . LYS E 3 135 ? 99.356  -45.203 22.938  1.00 48.25 ? 431  LYS A CE    1 
ATOM   1851  N  NZ    . LYS E 3 135 ? 98.575  -44.134 22.246  1.00 48.97 ? 431  LYS A NZ    1 
ATOM   1852  N  N     . GLY E 3 136 ? 99.865  -47.124 29.731  1.00 36.27 ? 432  GLY A N     1 
ATOM   1853  C  CA    . GLY E 3 136 ? 99.280  -47.105 31.060  1.00 36.36 ? 432  GLY A CA    1 
ATOM   1854  C  C     . GLY E 3 136 ? 98.676  -48.395 31.584  1.00 36.15 ? 432  GLY A C     1 
ATOM   1855  O  O     . GLY E 3 136 ? 99.303  -49.452 31.548  1.00 35.73 ? 432  GLY A O     1 
ATOM   1856  N  N     . ALA E 3 137 ? 97.446  -48.298 32.081  1.00 35.70 ? 433  ALA A N     1 
ATOM   1857  C  CA    . ALA E 3 137 ? 96.736  -49.444 32.636  1.00 34.86 ? 433  ALA A CA    1 
ATOM   1858  C  C     . ALA E 3 137 ? 96.523  -50.553 31.615  1.00 34.12 ? 433  ALA A C     1 
ATOM   1859  O  O     . ALA E 3 137 ? 96.157  -51.670 31.975  1.00 32.53 ? 433  ALA A O     1 
ATOM   1860  C  CB    . ALA E 3 137 ? 95.392  -48.995 33.201  1.00 34.80 ? 433  ALA A CB    1 
ATOM   1861  N  N     . LYS E 3 138 ? 96.751  -50.244 30.344  1.00 33.54 ? 434  LYS A N     1 
ATOM   1862  C  CA    . LYS E 3 138 ? 96.578  -51.225 29.279  1.00 34.48 ? 434  LYS A CA    1 
ATOM   1863  C  C     . LYS E 3 138 ? 97.893  -51.935 28.971  1.00 34.90 ? 434  LYS A C     1 
ATOM   1864  O  O     . LYS E 3 138 ? 97.932  -52.898 28.205  1.00 34.57 ? 434  LYS A O     1 
ATOM   1865  C  CB    . LYS E 3 138 ? 96.062  -50.536 28.015  1.00 35.81 ? 434  LYS A CB    1 
ATOM   1866  C  CG    . LYS E 3 138 ? 94.751  -49.794 28.204  1.00 38.14 ? 434  LYS A CG    1 
ATOM   1867  C  CD    . LYS E 3 138 ? 94.256  -49.188 26.897  1.00 40.08 ? 434  LYS A CD    1 
ATOM   1868  C  CE    . LYS E 3 138 ? 94.010  -50.263 25.852  1.00 41.62 ? 434  LYS A CE    1 
ATOM   1869  N  NZ    . LYS E 3 138 ? 93.073  -51.309 26.349  1.00 43.40 ? 434  LYS A NZ    1 
ATOM   1870  N  N     . ARG E 3 139 ? 98.968  -51.451 29.581  1.00 35.86 ? 435  ARG A N     1 
ATOM   1871  C  CA    . ARG E 3 139 ? 100.295 -52.013 29.373  1.00 36.74 ? 435  ARG A CA    1 
ATOM   1872  C  C     . ARG E 3 139 ? 100.360 -53.473 29.812  1.00 35.87 ? 435  ARG A C     1 
ATOM   1873  O  O     . ARG E 3 139 ? 100.076 -53.798 30.964  1.00 35.77 ? 435  ARG A O     1 
ATOM   1874  C  CB    . ARG E 3 139 ? 101.319 -51.184 30.145  1.00 38.51 ? 435  ARG A CB    1 
ATOM   1875  C  CG    . ARG E 3 139 ? 102.712 -51.204 29.558  1.00 41.94 ? 435  ARG A CG    1 
ATOM   1876  C  CD    . ARG E 3 139 ? 103.582 -50.161 30.232  1.00 44.54 ? 435  ARG A CD    1 
ATOM   1877  N  NE    . ARG E 3 139 ? 104.934 -50.152 29.689  1.00 47.77 ? 435  ARG A NE    1 
ATOM   1878  C  CZ    . ARG E 3 139 ? 106.024 -50.423 30.399  1.00 49.30 ? 435  ARG A CZ    1 
ATOM   1879  N  NH1   . ARG E 3 139 ? 105.920 -50.723 31.688  1.00 50.03 ? 435  ARG A NH1   1 
ATOM   1880  N  NH2   . ARG E 3 139 ? 107.216 -50.395 29.818  1.00 50.11 ? 435  ARG A NH2   1 
ATOM   1881  N  N     . ALA E 3 140 ? 100.736 -54.351 28.887  1.00 35.48 ? 436  ALA A N     1 
ATOM   1882  C  CA    . ALA E 3 140 ? 100.833 -55.776 29.188  1.00 35.83 ? 436  ALA A CA    1 
ATOM   1883  C  C     . ALA E 3 140 ? 101.685 -56.524 28.166  1.00 35.04 ? 436  ALA A C     1 
ATOM   1884  O  O     . ALA E 3 140 ? 101.852 -56.077 27.032  1.00 33.78 ? 436  ALA A O     1 
ATOM   1885  C  CB    . ALA E 3 140 ? 99.436  -56.388 29.246  1.00 34.75 ? 436  ALA A CB    1 
ATOM   1886  N  N     . VAL E 3 141 ? 102.222 -57.667 28.581  1.00 35.49 ? 437  VAL A N     1 
ATOM   1887  C  CA    . VAL E 3 141 ? 103.040 -58.492 27.702  1.00 35.40 ? 437  VAL A CA    1 
ATOM   1888  C  C     . VAL E 3 141 ? 102.100 -59.285 26.798  1.00 35.88 ? 437  VAL A C     1 
ATOM   1889  O  O     . VAL E 3 141 ? 101.213 -59.990 27.280  1.00 36.95 ? 437  VAL A O     1 
ATOM   1890  C  CB    . VAL E 3 141 ? 103.912 -59.479 28.507  1.00 35.48 ? 437  VAL A CB    1 
ATOM   1891  C  CG1   . VAL E 3 141 ? 104.846 -60.230 27.574  1.00 35.03 ? 437  VAL A CG1   1 
ATOM   1892  C  CG2   . VAL E 3 141 ? 104.703 -58.729 29.566  1.00 35.22 ? 437  VAL A CG2   1 
ATOM   1893  N  N     . PRO E 3 142 ? 102.279 -59.178 25.473  1.00 36.08 ? 438  PRO A N     1 
ATOM   1894  C  CA    . PRO E 3 142 ? 101.422 -59.900 24.526  1.00 36.76 ? 438  PRO A CA    1 
ATOM   1895  C  C     . PRO E 3 142 ? 101.639 -61.413 24.539  1.00 37.81 ? 438  PRO A C     1 
ATOM   1896  O  O     . PRO E 3 142 ? 102.510 -61.923 25.248  1.00 37.22 ? 438  PRO A O     1 
ATOM   1897  C  CB    . PRO E 3 142 ? 101.771 -59.258 23.189  1.00 36.38 ? 438  PRO A CB    1 
ATOM   1898  C  CG    . PRO E 3 142 ? 103.233 -58.960 23.353  1.00 36.35 ? 438  PRO A CG    1 
ATOM   1899  C  CD    . PRO E 3 142 ? 103.296 -58.384 24.759  1.00 35.93 ? 438  PRO A CD    1 
ATOM   1900  N  N     . ASP E 3 143 ? 100.837 -62.124 23.752  1.00 38.19 ? 439  ASP A N     1 
ATOM   1901  C  CA    . ASP E 3 143 ? 100.940 -63.575 23.663  1.00 39.13 ? 439  ASP A CA    1 
ATOM   1902  C  C     . ASP E 3 143 ? 102.340 -63.943 23.163  1.00 39.37 ? 439  ASP A C     1 
ATOM   1903  O  O     . ASP E 3 143 ? 102.912 -63.242 22.325  1.00 38.51 ? 439  ASP A O     1 
ATOM   1904  C  CB    . ASP E 3 143 ? 99.861  -64.108 22.715  1.00 40.54 ? 439  ASP A CB    1 
ATOM   1905  C  CG    . ASP E 3 143 ? 99.728  -65.619 22.767  1.00 41.05 ? 439  ASP A CG    1 
ATOM   1906  O  OD1   . ASP E 3 143 ? 99.765  -66.189 23.878  1.00 40.88 ? 439  ASP A OD1   1 
ATOM   1907  O  OD2   . ASP E 3 143 ? 99.570  -66.232 21.692  1.00 42.81 ? 439  ASP A OD2   1 
ATOM   1908  N  N     . GLU E 3 144 ? 102.884 -65.043 23.677  1.00 38.90 ? 440  GLU A N     1 
ATOM   1909  C  CA    . GLU E 3 144 ? 104.231 -65.484 23.318  1.00 39.00 ? 440  GLU A CA    1 
ATOM   1910  C  C     . GLU E 3 144 ? 104.623 -65.307 21.851  1.00 38.58 ? 440  GLU A C     1 
ATOM   1911  O  O     . GLU E 3 144 ? 105.718 -64.830 21.555  1.00 38.39 ? 440  GLU A O     1 
ATOM   1912  C  CB    . GLU E 3 144 ? 104.442 -66.943 23.731  1.00 39.65 ? 440  GLU A CB    1 
ATOM   1913  C  CG    . GLU E 3 144 ? 105.901 -67.378 23.677  1.00 40.52 ? 440  GLU A CG    1 
ATOM   1914  C  CD    . GLU E 3 144 ? 106.128 -68.739 24.298  1.00 40.92 ? 440  GLU A CD    1 
ATOM   1915  O  OE1   . GLU E 3 144 ? 105.670 -69.744 23.714  1.00 41.90 ? 440  GLU A OE1   1 
ATOM   1916  O  OE2   . GLU E 3 144 ? 106.762 -68.803 25.373  1.00 40.65 ? 440  GLU A OE2   1 
ATOM   1917  N  N     . PRO E 3 145 ? 103.744 -65.690 20.911  1.00 37.89 ? 441  PRO A N     1 
ATOM   1918  C  CA    . PRO E 3 145 ? 104.096 -65.527 19.497  1.00 37.98 ? 441  PRO A CA    1 
ATOM   1919  C  C     . PRO E 3 145 ? 104.453 -64.079 19.161  1.00 37.18 ? 441  PRO A C     1 
ATOM   1920  O  O     . PRO E 3 145 ? 105.479 -63.809 18.537  1.00 37.16 ? 441  PRO A O     1 
ATOM   1921  C  CB    . PRO E 3 145 ? 102.848 -66.021 18.771  1.00 38.03 ? 441  PRO A CB    1 
ATOM   1922  C  CG    . PRO E 3 145 ? 102.327 -67.074 19.698  1.00 37.85 ? 441  PRO A CG    1 
ATOM   1923  C  CD    . PRO E 3 145 ? 102.465 -66.409 21.048  1.00 37.93 ? 441  PRO A CD    1 
ATOM   1924  N  N     . VAL E 3 146 ? 103.596 -63.157 19.590  1.00 36.27 ? 442  VAL A N     1 
ATOM   1925  C  CA    . VAL E 3 146 ? 103.793 -61.731 19.350  1.00 35.73 ? 442  VAL A CA    1 
ATOM   1926  C  C     . VAL E 3 146 ? 105.036 -61.215 20.072  1.00 35.12 ? 442  VAL A C     1 
ATOM   1927  O  O     . VAL E 3 146 ? 105.829 -60.469 19.499  1.00 35.35 ? 442  VAL A O     1 
ATOM   1928  C  CB    . VAL E 3 146 ? 102.566 -60.915 19.824  1.00 36.35 ? 442  VAL A CB    1 
ATOM   1929  C  CG1   . VAL E 3 146 ? 102.795 -59.427 19.576  1.00 36.64 ? 442  VAL A CG1   1 
ATOM   1930  C  CG2   . VAL E 3 146 ? 101.317 -61.389 19.094  1.00 36.28 ? 442  VAL A CG2   1 
ATOM   1931  N  N     . LEU E 3 147 ? 105.196 -61.613 21.331  1.00 34.02 ? 443  LEU A N     1 
ATOM   1932  C  CA    . LEU E 3 147 ? 106.346 -61.202 22.131  1.00 32.25 ? 443  LEU A CA    1 
ATOM   1933  C  C     . LEU E 3 147 ? 107.646 -61.663 21.481  1.00 31.58 ? 443  LEU A C     1 
ATOM   1934  O  O     . LEU E 3 147 ? 108.569 -60.872 21.277  1.00 30.38 ? 443  LEU A O     1 
ATOM   1935  C  CB    . LEU E 3 147 ? 106.252 -61.796 23.539  1.00 31.22 ? 443  LEU A CB    1 
ATOM   1936  C  CG    . LEU E 3 147 ? 107.454 -61.544 24.455  1.00 30.48 ? 443  LEU A CG    1 
ATOM   1937  C  CD1   . LEU E 3 147 ? 107.584 -60.051 24.738  1.00 29.93 ? 443  LEU A CD1   1 
ATOM   1938  C  CD2   . LEU E 3 147 ? 107.285 -62.322 25.750  1.00 29.67 ? 443  LEU A CD2   1 
ATOM   1939  N  N     . ALA E 3 148 ? 107.706 -62.952 21.160  1.00 29.92 ? 444  ALA A N     1 
ATOM   1940  C  CA    . ALA E 3 148 ? 108.884 -63.548 20.541  1.00 29.50 ? 444  ALA A CA    1 
ATOM   1941  C  C     . ALA E 3 148 ? 109.315 -62.822 19.273  1.00 29.03 ? 444  ALA A C     1 
ATOM   1942  O  O     . ALA E 3 148 ? 110.495 -62.509 19.097  1.00 28.68 ? 444  ALA A O     1 
ATOM   1943  C  CB    . ALA E 3 148 ? 108.618 -65.020 20.227  1.00 28.40 ? 444  ALA A CB    1 
ATOM   1944  N  N     . GLU E 3 149 ? 108.359 -62.552 18.390  1.00 29.00 ? 445  GLU A N     1 
ATOM   1945  C  CA    . GLU E 3 149 ? 108.673 -61.874 17.142  1.00 28.56 ? 445  GLU A CA    1 
ATOM   1946  C  C     . GLU E 3 149 ? 109.246 -60.486 17.407  1.00 27.92 ? 445  GLU A C     1 
ATOM   1947  O  O     . GLU E 3 149 ? 110.229 -60.080 16.785  1.00 27.48 ? 445  GLU A O     1 
ATOM   1948  C  CB    . GLU E 3 149 ? 107.427 -61.748 16.273  1.00 31.37 ? 445  GLU A CB    1 
ATOM   1949  C  CG    . GLU E 3 149 ? 107.739 -61.376 14.834  1.00 33.58 ? 445  GLU A CG    1 
ATOM   1950  C  CD    . GLU E 3 149 ? 106.495 -61.073 14.031  1.00 35.91 ? 445  GLU A CD    1 
ATOM   1951  O  OE1   . GLU E 3 149 ? 105.510 -61.830 14.155  1.00 37.49 ? 445  GLU A OE1   1 
ATOM   1952  O  OE2   . GLU E 3 149 ? 106.507 -60.080 13.273  1.00 36.66 ? 445  GLU A OE2   1 
ATOM   1953  N  N     . HIS E 3 150 ? 108.626 -59.759 18.329  1.00 26.12 ? 446  HIS A N     1 
ATOM   1954  C  CA    . HIS E 3 150 ? 109.085 -58.419 18.670  1.00 25.14 ? 446  HIS A CA    1 
ATOM   1955  C  C     . HIS E 3 150 ? 110.518 -58.441 19.193  1.00 23.65 ? 446  HIS A C     1 
ATOM   1956  O  O     . HIS E 3 150 ? 111.374 -57.701 18.707  1.00 23.95 ? 446  HIS A O     1 
ATOM   1957  C  CB    . HIS E 3 150 ? 108.164 -57.790 19.718  1.00 24.18 ? 446  HIS A CB    1 
ATOM   1958  C  CG    . HIS E 3 150 ? 108.573 -56.409 20.129  1.00 22.88 ? 446  HIS A CG    1 
ATOM   1959  N  ND1   . HIS E 3 150 ? 108.765 -55.388 19.223  1.00 23.89 ? 446  HIS A ND1   1 
ATOM   1960  C  CD2   . HIS E 3 150 ? 108.816 -55.877 21.351  1.00 23.10 ? 446  HIS A CD2   1 
ATOM   1961  C  CE1   . HIS E 3 150 ? 109.107 -54.287 19.868  1.00 22.29 ? 446  HIS A CE1   1 
ATOM   1962  N  NE2   . HIS E 3 150 ? 109.144 -54.556 21.160  1.00 20.60 ? 446  HIS A NE2   1 
ATOM   1963  N  N     . LEU E 3 151 ? 110.782 -59.293 20.178  1.00 23.14 ? 447  LEU A N     1 
ATOM   1964  C  CA    . LEU E 3 151 ? 112.120 -59.376 20.748  1.00 22.14 ? 447  LEU A CA    1 
ATOM   1965  C  C     . LEU E 3 151 ? 113.149 -59.783 19.705  1.00 23.91 ? 447  LEU A C     1 
ATOM   1966  O  O     . LEU E 3 151 ? 114.276 -59.283 19.709  1.00 24.51 ? 447  LEU A O     1 
ATOM   1967  C  CB    . LEU E 3 151 ? 112.151 -60.361 21.919  1.00 22.43 ? 447  LEU A CB    1 
ATOM   1968  C  CG    . LEU E 3 151 ? 111.221 -60.074 23.102  1.00 20.76 ? 447  LEU A CG    1 
ATOM   1969  C  CD1   . LEU E 3 151 ? 111.667 -60.915 24.293  1.00 19.38 ? 447  LEU A CD1   1 
ATOM   1970  C  CD2   . LEU E 3 151 ? 111.265 -58.591 23.467  1.00 20.26 ? 447  LEU A CD2   1 
ATOM   1971  N  N     . VAL E 3 152 ? 112.764 -60.687 18.810  1.00 24.45 ? 448  VAL A N     1 
ATOM   1972  C  CA    . VAL E 3 152 ? 113.671 -61.137 17.763  1.00 25.21 ? 448  VAL A CA    1 
ATOM   1973  C  C     . VAL E 3 152 ? 113.921 -59.999 16.775  1.00 24.85 ? 448  VAL A C     1 
ATOM   1974  O  O     . VAL E 3 152 ? 115.061 -59.767 16.364  1.00 24.55 ? 448  VAL A O     1 
ATOM   1975  C  CB    . VAL E 3 152 ? 113.107 -62.370 17.017  1.00 25.80 ? 448  VAL A CB    1 
ATOM   1976  C  CG1   . VAL E 3 152 ? 113.962 -62.684 15.794  1.00 26.75 ? 448  VAL A CG1   1 
ATOM   1977  C  CG2   . VAL E 3 152 ? 113.095 -63.570 17.953  1.00 25.53 ? 448  VAL A CG2   1 
ATOM   1978  N  N     . ARG E 3 153 ? 112.862 -59.284 16.404  1.00 24.82 ? 449  ARG A N     1 
ATOM   1979  C  CA    . ARG E 3 153 ? 113.002 -58.159 15.480  1.00 25.26 ? 449  ARG A CA    1 
ATOM   1980  C  C     . ARG E 3 153 ? 113.884 -57.059 16.074  1.00 25.56 ? 449  ARG A C     1 
ATOM   1981  O  O     . ARG E 3 153 ? 114.611 -56.378 15.348  1.00 24.67 ? 449  ARG A O     1 
ATOM   1982  C  CB    . ARG E 3 153 ? 111.629 -57.591 15.107  1.00 26.54 ? 449  ARG A CB    1 
ATOM   1983  C  CG    . ARG E 3 153 ? 110.901 -58.419 14.052  1.00 29.16 ? 449  ARG A CG    1 
ATOM   1984  C  CD    . ARG E 3 153 ? 109.536 -57.842 13.703  1.00 31.05 ? 449  ARG A CD    1 
ATOM   1985  N  NE    . ARG E 3 153 ? 108.901 -58.564 12.601  1.00 33.86 ? 449  ARG A NE    1 
ATOM   1986  C  CZ    . ARG E 3 153 ? 109.336 -58.550 11.344  1.00 35.46 ? 449  ARG A CZ    1 
ATOM   1987  N  NH1   . ARG E 3 153 ? 110.414 -57.848 11.017  1.00 34.93 ? 449  ARG A NH1   1 
ATOM   1988  N  NH2   . ARG E 3 153 ? 108.694 -59.239 10.408  1.00 35.62 ? 449  ARG A NH2   1 
ATOM   1989  N  N     . LYS E 3 154 ? 113.825 -56.879 17.392  1.00 24.49 ? 450  LYS A N     1 
ATOM   1990  C  CA    . LYS E 3 154 ? 114.660 -55.865 18.023  1.00 24.28 ? 450  LYS A CA    1 
ATOM   1991  C  C     . LYS E 3 154 ? 116.110 -56.339 18.009  1.00 23.81 ? 450  LYS A C     1 
ATOM   1992  O  O     . LYS E 3 154 ? 117.031 -55.545 17.838  1.00 22.04 ? 450  LYS A O     1 
ATOM   1993  C  CB    . LYS E 3 154 ? 114.194 -55.579 19.456  1.00 23.14 ? 450  LYS A CB    1 
ATOM   1994  C  CG    . LYS E 3 154 ? 112.853 -54.848 19.509  1.00 23.41 ? 450  LYS A CG    1 
ATOM   1995  C  CD    . LYS E 3 154 ? 112.670 -54.051 20.791  1.00 22.19 ? 450  LYS A CD    1 
ATOM   1996  C  CE    . LYS E 3 154 ? 112.627 -54.941 22.019  1.00 22.69 ? 450  LYS A CE    1 
ATOM   1997  N  NZ    . LYS E 3 154 ? 112.474 -54.121 23.258  1.00 23.88 ? 450  LYS A NZ    1 
ATOM   1998  N  N     . ALA E 3 155 ? 116.303 -57.645 18.173  1.00 24.37 ? 451  ALA A N     1 
ATOM   1999  C  CA    . ALA E 3 155 ? 117.642 -58.221 18.156  1.00 24.71 ? 451  ALA A CA    1 
ATOM   2000  C  C     . ALA E 3 155 ? 118.199 -58.126 16.736  1.00 24.49 ? 451  ALA A C     1 
ATOM   2001  O  O     . ALA E 3 155 ? 119.384 -57.861 16.543  1.00 25.10 ? 451  ALA A O     1 
ATOM   2002  C  CB    . ALA E 3 155 ? 117.596 -59.681 18.611  1.00 24.63 ? 451  ALA A CB    1 
ATOM   2003  N  N     . ALA E 3 156 ? 117.332 -58.335 15.748  1.00 24.82 ? 452  ALA A N     1 
ATOM   2004  C  CA    . ALA E 3 156 ? 117.735 -58.272 14.344  1.00 24.91 ? 452  ALA A CA    1 
ATOM   2005  C  C     . ALA E 3 156 ? 118.158 -56.852 13.978  1.00 24.82 ? 452  ALA A C     1 
ATOM   2006  O  O     . ALA E 3 156 ? 119.137 -56.653 13.258  1.00 25.63 ? 452  ALA A O     1 
ATOM   2007  C  CB    . ALA E 3 156 ? 116.586 -58.723 13.445  1.00 23.63 ? 452  ALA A CB    1 
ATOM   2008  N  N     . ALA E 3 157 ? 117.415 -55.868 14.474  1.00 24.40 ? 453  ALA A N     1 
ATOM   2009  C  CA    . ALA E 3 157 ? 117.725 -54.467 14.206  1.00 24.07 ? 453  ALA A CA    1 
ATOM   2010  C  C     . ALA E 3 157 ? 119.093 -54.115 14.787  1.00 25.05 ? 453  ALA A C     1 
ATOM   2011  O  O     . ALA E 3 157 ? 119.933 -53.533 14.107  1.00 26.01 ? 453  ALA A O     1 
ATOM   2012  C  CB    . ALA E 3 157 ? 116.654 -53.568 14.808  1.00 24.31 ? 453  ALA A CB    1 
ATOM   2013  N  N     . ILE E 3 158 ? 119.312 -54.476 16.047  1.00 24.57 ? 454  ILE A N     1 
ATOM   2014  C  CA    . ILE E 3 158 ? 120.584 -54.205 16.710  1.00 25.10 ? 454  ILE A CA    1 
ATOM   2015  C  C     . ILE E 3 158 ? 121.727 -54.841 15.919  1.00 25.64 ? 454  ILE A C     1 
ATOM   2016  O  O     . ILE E 3 158 ? 122.797 -54.254 15.766  1.00 25.83 ? 454  ILE A O     1 
ATOM   2017  C  CB    . ILE E 3 158 ? 120.590 -54.774 18.148  1.00 24.36 ? 454  ILE A CB    1 
ATOM   2018  C  CG1   . ILE E 3 158 ? 119.540 -54.046 18.996  1.00 24.18 ? 454  ILE A CG1   1 
ATOM   2019  C  CG2   . ILE E 3 158 ? 121.978 -54.639 18.761  1.00 22.88 ? 454  ILE A CG2   1 
ATOM   2020  C  CD1   . ILE E 3 158 ? 119.265 -54.710 20.338  1.00 22.89 ? 454  ILE A CD1   1 
ATOM   2021  N  N     . TRP E 3 159 ? 121.482 -56.044 15.413  1.00 26.29 ? 455  TRP A N     1 
ATOM   2022  C  CA    . TRP E 3 159 ? 122.476 -56.773 14.633  1.00 26.83 ? 455  TRP A CA    1 
ATOM   2023  C  C     . TRP E 3 159 ? 122.834 -56.034 13.345  1.00 26.42 ? 455  TRP A C     1 
ATOM   2024  O  O     . TRP E 3 159 ? 124.009 -55.904 13.003  1.00 27.18 ? 455  TRP A O     1 
ATOM   2025  C  CB    . TRP E 3 159 ? 121.942 -58.172 14.308  1.00 27.56 ? 455  TRP A CB    1 
ATOM   2026  C  CG    . TRP E 3 159 ? 122.891 -59.046 13.548  1.00 29.32 ? 455  TRP A CG    1 
ATOM   2027  C  CD1   . TRP E 3 159 ? 122.865 -59.316 12.210  1.00 30.63 ? 455  TRP A CD1   1 
ATOM   2028  C  CD2   . TRP E 3 159 ? 123.994 -59.786 14.086  1.00 30.35 ? 455  TRP A CD2   1 
ATOM   2029  N  NE1   . TRP E 3 159 ? 123.880 -60.185 11.881  1.00 29.74 ? 455  TRP A NE1   1 
ATOM   2030  C  CE2   . TRP E 3 159 ? 124.588 -60.490 13.014  1.00 31.18 ? 455  TRP A CE2   1 
ATOM   2031  C  CE3   . TRP E 3 159 ? 124.537 -59.926 15.371  1.00 31.50 ? 455  TRP A CE3   1 
ATOM   2032  C  CZ2   . TRP E 3 159 ? 125.699 -61.324 13.188  1.00 31.09 ? 455  TRP A CZ2   1 
ATOM   2033  C  CZ3   . TRP E 3 159 ? 125.644 -60.757 15.544  1.00 32.58 ? 455  TRP A CZ3   1 
ATOM   2034  C  CH2   . TRP E 3 159 ? 126.211 -61.444 14.456  1.00 32.77 ? 455  TRP A CH2   1 
ATOM   2035  N  N     . GLU E 3 160 ? 121.818 -55.538 12.646  1.00 26.93 ? 456  GLU A N     1 
ATOM   2036  C  CA    . GLU E 3 160 ? 122.013 -54.819 11.386  1.00 28.45 ? 456  GLU A CA    1 
ATOM   2037  C  C     . GLU E 3 160 ? 122.411 -53.349 11.550  1.00 27.71 ? 456  GLU A C     1 
ATOM   2038  O  O     . GLU E 3 160 ? 123.024 -52.765 10.656  1.00 26.88 ? 456  GLU A O     1 
ATOM   2039  C  CB    . GLU E 3 160 ? 120.731 -54.869 10.549  1.00 30.60 ? 456  GLU A CB    1 
ATOM   2040  C  CG    . GLU E 3 160 ? 120.217 -56.262 10.240  1.00 34.37 ? 456  GLU A CG    1 
ATOM   2041  C  CD    . GLU E 3 160 ? 121.045 -56.978 9.192   1.00 36.82 ? 456  GLU A CD    1 
ATOM   2042  O  OE1   . GLU E 3 160 ? 120.763 -58.167 8.933   1.00 39.13 ? 456  GLU A OE1   1 
ATOM   2043  O  OE2   . GLU E 3 160 ? 121.970 -56.355 8.624   1.00 37.85 ? 456  GLU A OE2   1 
ATOM   2044  N  N     . LEU E 3 161 ? 122.064 -52.754 12.687  1.00 26.94 ? 457  LEU A N     1 
ATOM   2045  C  CA    . LEU E 3 161 ? 122.353 -51.339 12.922  1.00 25.82 ? 457  LEU A CA    1 
ATOM   2046  C  C     . LEU E 3 161 ? 123.715 -51.006 13.523  1.00 25.48 ? 457  LEU A C     1 
ATOM   2047  O  O     . LEU E 3 161 ? 124.182 -49.872 13.411  1.00 25.58 ? 457  LEU A O     1 
ATOM   2048  C  CB    . LEU E 3 161 ? 121.254 -50.731 13.800  1.00 25.51 ? 457  LEU A CB    1 
ATOM   2049  C  CG    . LEU E 3 161 ? 119.852 -50.660 13.182  1.00 25.51 ? 457  LEU A CG    1 
ATOM   2050  C  CD1   . LEU E 3 161 ? 118.831 -50.255 14.240  1.00 23.63 ? 457  LEU A CD1   1 
ATOM   2051  C  CD2   . LEU E 3 161 ? 119.855 -49.661 12.030  1.00 25.16 ? 457  LEU A CD2   1 
ATOM   2052  N  N     . GLU E 3 162 ? 124.354 -51.981 14.158  1.00 24.85 ? 458  GLU A N     1 
ATOM   2053  C  CA    . GLU E 3 162 ? 125.651 -51.739 14.777  1.00 24.84 ? 458  GLU A CA    1 
ATOM   2054  C  C     . GLU E 3 162 ? 126.670 -51.067 13.860  1.00 26.55 ? 458  GLU A C     1 
ATOM   2055  O  O     . GLU E 3 162 ? 127.248 -50.035 14.211  1.00 25.33 ? 458  GLU A O     1 
ATOM   2056  C  CB    . GLU E 3 162 ? 126.249 -53.046 15.299  1.00 25.27 ? 458  GLU A CB    1 
ATOM   2057  C  CG    . GLU E 3 162 ? 127.661 -52.879 15.837  1.00 25.33 ? 458  GLU A CG    1 
ATOM   2058  C  CD    . GLU E 3 162 ? 128.173 -54.112 16.545  1.00 28.44 ? 458  GLU A CD    1 
ATOM   2059  O  OE1   . GLU E 3 162 ? 129.321 -54.066 17.039  1.00 29.40 ? 458  GLU A OE1   1 
ATOM   2060  O  OE2   . GLU E 3 162 ? 127.432 -55.119 16.612  1.00 27.58 ? 458  GLU A OE2   1 
ATOM   2061  N  N     . ARG E 3 163 ? 126.895 -51.653 12.688  1.00 26.29 ? 459  ARG A N     1 
ATOM   2062  C  CA    . ARG E 3 163 ? 127.873 -51.105 11.758  1.00 27.88 ? 459  ARG A CA    1 
ATOM   2063  C  C     . ARG E 3 163 ? 127.529 -49.678 11.330  1.00 25.25 ? 459  ARG A C     1 
ATOM   2064  O  O     . ARG E 3 163 ? 128.385 -48.794 11.365  1.00 25.68 ? 459  ARG A O     1 
ATOM   2065  C  CB    . ARG E 3 163 ? 128.002 -52.019 10.538  1.00 30.22 ? 459  ARG A CB    1 
ATOM   2066  C  CG    . ARG E 3 163 ? 129.283 -51.819 9.752   1.00 36.08 ? 459  ARG A CG    1 
ATOM   2067  C  CD    . ARG E 3 163 ? 129.330 -52.767 8.571   1.00 40.55 ? 459  ARG A CD    1 
ATOM   2068  N  NE    . ARG E 3 163 ? 130.466 -52.507 7.690   1.00 43.37 ? 459  ARG A NE    1 
ATOM   2069  C  CZ    . ARG E 3 163 ? 130.496 -52.851 6.406   1.00 44.61 ? 459  ARG A CZ    1 
ATOM   2070  N  NH1   . ARG E 3 163 ? 129.451 -53.465 5.864   1.00 44.54 ? 459  ARG A NH1   1 
ATOM   2071  N  NH2   . ARG E 3 163 ? 131.564 -52.578 5.664   1.00 43.09 ? 459  ARG A NH2   1 
ATOM   2072  N  N     . PRO E 3 164 ? 126.273 -49.433 10.919  1.00 24.34 ? 460  PRO A N     1 
ATOM   2073  C  CA    . PRO E 3 164 ? 125.863 -48.087 10.497  1.00 24.52 ? 460  PRO A CA    1 
ATOM   2074  C  C     . PRO E 3 164 ? 126.075 -47.032 11.586  1.00 23.20 ? 460  PRO A C     1 
ATOM   2075  O  O     . PRO E 3 164 ? 126.541 -45.926 11.309  1.00 23.43 ? 460  PRO A O     1 
ATOM   2076  C  CB    . PRO E 3 164 ? 124.394 -48.270 10.126  1.00 23.51 ? 460  PRO A CB    1 
ATOM   2077  C  CG    . PRO E 3 164 ? 124.358 -49.673 9.621   1.00 25.67 ? 460  PRO A CG    1 
ATOM   2078  C  CD    . PRO E 3 164 ? 125.208 -50.412 10.632  1.00 24.96 ? 460  PRO A CD    1 
ATOM   2079  N  N     . PHE E 3 165 ? 125.734 -47.371 12.827  1.00 22.71 ? 461  PHE A N     1 
ATOM   2080  C  CA    . PHE E 3 165 ? 125.911 -46.422 13.920  1.00 21.83 ? 461  PHE A CA    1 
ATOM   2081  C  C     . PHE E 3 165 ? 127.379 -46.177 14.240  1.00 21.62 ? 461  PHE A C     1 
ATOM   2082  O  O     . PHE E 3 165 ? 127.797 -45.032 14.416  1.00 20.94 ? 461  PHE A O     1 
ATOM   2083  C  CB    . PHE E 3 165 ? 125.161 -46.887 15.173  1.00 20.53 ? 461  PHE A CB    1 
ATOM   2084  C  CG    . PHE E 3 165 ? 123.722 -46.460 15.200  1.00 18.27 ? 461  PHE A CG    1 
ATOM   2085  C  CD1   . PHE E 3 165 ? 122.795 -47.032 14.337  1.00 18.66 ? 461  PHE A CD1   1 
ATOM   2086  C  CD2   . PHE E 3 165 ? 123.297 -45.466 16.075  1.00 19.03 ? 461  PHE A CD2   1 
ATOM   2087  C  CE1   . PHE E 3 165 ? 121.463 -46.620 14.340  1.00 17.92 ? 461  PHE A CE1   1 
ATOM   2088  C  CE2   . PHE E 3 165 ? 121.967 -45.044 16.089  1.00 18.87 ? 461  PHE A CE2   1 
ATOM   2089  C  CZ    . PHE E 3 165 ? 121.048 -45.621 15.220  1.00 20.84 ? 461  PHE A CZ    1 
ATOM   2090  N  N     . LEU E 3 166 ? 128.167 -47.244 14.318  1.00 22.24 ? 462  LEU A N     1 
ATOM   2091  C  CA    . LEU E 3 166 ? 129.589 -47.088 14.597  1.00 23.05 ? 462  LEU A CA    1 
ATOM   2092  C  C     . LEU E 3 166 ? 130.200 -46.227 13.495  1.00 25.10 ? 462  LEU A C     1 
ATOM   2093  O  O     . LEU E 3 166 ? 131.058 -45.380 13.755  1.00 24.30 ? 462  LEU A O     1 
ATOM   2094  C  CB    . LEU E 3 166 ? 130.278 -48.457 14.652  1.00 22.32 ? 462  LEU A CB    1 
ATOM   2095  C  CG    . LEU E 3 166 ? 129.983 -49.260 15.921  1.00 22.74 ? 462  LEU A CG    1 
ATOM   2096  C  CD1   . LEU E 3 166 ? 130.623 -50.643 15.846  1.00 23.33 ? 462  LEU A CD1   1 
ATOM   2097  C  CD2   . LEU E 3 166 ? 130.517 -48.488 17.120  1.00 21.24 ? 462  LEU A CD2   1 
ATOM   2098  N  N     . ASP E 3 167 ? 129.735 -46.440 12.266  1.00 26.11 ? 463  ASP A N     1 
ATOM   2099  C  CA    . ASP E 3 167 ? 130.223 -45.682 11.123  1.00 27.82 ? 463  ASP A CA    1 
ATOM   2100  C  C     . ASP E 3 167 ? 130.016 -44.181 11.312  1.00 26.29 ? 463  ASP A C     1 
ATOM   2101  O  O     . ASP E 3 167 ? 130.964 -43.405 11.217  1.00 25.85 ? 463  ASP A O     1 
ATOM   2102  C  CB    . ASP E 3 167 ? 129.518 -46.134 9.841   1.00 31.15 ? 463  ASP A CB    1 
ATOM   2103  C  CG    . ASP E 3 167 ? 129.902 -45.291 8.638   1.00 34.77 ? 463  ASP A CG    1 
ATOM   2104  O  OD1   . ASP E 3 167 ? 131.076 -45.356 8.215   1.00 35.96 ? 463  ASP A OD1   1 
ATOM   2105  O  OD2   . ASP E 3 167 ? 129.031 -44.558 8.118   1.00 38.48 ? 463  ASP A OD2   1 
ATOM   2106  N  N     . GLU E 3 168 ? 128.781 -43.768 11.582  1.00 26.76 ? 464  GLU A N     1 
ATOM   2107  C  CA    . GLU E 3 168 ? 128.509 -42.347 11.762  1.00 25.35 ? 464  GLU A CA    1 
ATOM   2108  C  C     . GLU E 3 168 ? 129.199 -41.776 12.994  1.00 24.25 ? 464  GLU A C     1 
ATOM   2109  O  O     . GLU E 3 168 ? 129.577 -40.602 13.010  1.00 23.09 ? 464  GLU A O     1 
ATOM   2110  C  CB    . GLU E 3 168 ? 127.005 -42.072 11.845  1.00 28.54 ? 464  GLU A CB    1 
ATOM   2111  C  CG    . GLU E 3 168 ? 126.700 -40.579 11.925  1.00 30.64 ? 464  GLU A CG    1 
ATOM   2112  C  CD    . GLU E 3 168 ? 125.222 -40.255 11.881  1.00 32.35 ? 464  GLU A CD    1 
ATOM   2113  O  OE1   . GLU E 3 168 ? 124.879 -39.055 11.968  1.00 33.26 ? 464  GLU A OE1   1 
ATOM   2114  O  OE2   . GLU E 3 168 ? 124.404 -41.191 11.760  1.00 33.24 ? 464  GLU A OE2   1 
ATOM   2115  N  N     . LEU E 3 169 ? 129.365 -42.595 14.029  1.00 22.17 ? 465  LEU A N     1 
ATOM   2116  C  CA    . LEU E 3 169 ? 130.040 -42.126 15.234  1.00 22.10 ? 465  LEU A CA    1 
ATOM   2117  C  C     . LEU E 3 169 ? 131.494 -41.817 14.900  1.00 21.43 ? 465  LEU A C     1 
ATOM   2118  O  O     . LEU E 3 169 ? 132.031 -40.784 15.307  1.00 18.83 ? 465  LEU A O     1 
ATOM   2119  C  CB    . LEU E 3 169 ? 129.977 -43.182 16.341  1.00 21.67 ? 465  LEU A CB    1 
ATOM   2120  C  CG    . LEU E 3 169 ? 128.648 -43.301 17.089  1.00 21.00 ? 465  LEU A CG    1 
ATOM   2121  C  CD1   . LEU E 3 169 ? 128.642 -44.581 17.918  1.00 20.45 ? 465  LEU A CD1   1 
ATOM   2122  C  CD2   . LEU E 3 169 ? 128.451 -42.075 17.976  1.00 19.97 ? 465  LEU A CD2   1 
ATOM   2123  N  N     . ARG E 3 170 ? 132.128 -42.720 14.157  1.00 22.94 ? 466  ARG A N     1 
ATOM   2124  C  CA    . ARG E 3 170 ? 133.520 -42.535 13.762  1.00 25.03 ? 466  ARG A CA    1 
ATOM   2125  C  C     . ARG E 3 170 ? 133.661 -41.227 12.990  1.00 24.97 ? 466  ARG A C     1 
ATOM   2126  O  O     . ARG E 3 170 ? 134.565 -40.436 13.254  1.00 23.69 ? 466  ARG A O     1 
ATOM   2127  C  CB    . ARG E 3 170 ? 133.986 -43.704 12.890  1.00 28.30 ? 466  ARG A CB    1 
ATOM   2128  C  CG    . ARG E 3 170 ? 133.877 -45.048 13.583  1.00 34.90 ? 466  ARG A CG    1 
ATOM   2129  C  CD    . ARG E 3 170 ? 133.990 -46.200 12.604  1.00 40.55 ? 466  ARG A CD    1 
ATOM   2130  N  NE    . ARG E 3 170 ? 133.732 -47.481 13.257  1.00 45.39 ? 466  ARG A NE    1 
ATOM   2131  C  CZ    . ARG E 3 170 ? 133.673 -48.644 12.619  1.00 48.05 ? 466  ARG A CZ    1 
ATOM   2132  N  NH1   . ARG E 3 170 ? 133.852 -48.690 11.305  1.00 50.38 ? 466  ARG A NH1   1 
ATOM   2133  N  NH2   . ARG E 3 170 ? 133.434 -49.762 13.293  1.00 49.26 ? 466  ARG A NH2   1 
ATOM   2134  N  N     . ARG E 3 171 ? 132.755 -41.000 12.044  1.00 25.69 ? 467  ARG A N     1 
ATOM   2135  C  CA    . ARG E 3 171 ? 132.785 -39.781 11.241  1.00 26.39 ? 467  ARG A CA    1 
ATOM   2136  C  C     . ARG E 3 171 ? 132.686 -38.550 12.135  1.00 26.29 ? 467  ARG A C     1 
ATOM   2137  O  O     . ARG E 3 171 ? 133.286 -37.516 11.843  1.00 26.97 ? 467  ARG A O     1 
ATOM   2138  C  CB    . ARG E 3 171 ? 131.639 -39.780 10.223  1.00 27.23 ? 467  ARG A CB    1 
ATOM   2139  C  CG    . ARG E 3 171 ? 131.746 -40.871 9.165   1.00 29.41 ? 467  ARG A CG    1 
ATOM   2140  C  CD    . ARG E 3 171 ? 130.554 -40.855 8.213   1.00 29.83 ? 467  ARG A CD    1 
ATOM   2141  N  NE    . ARG E 3 171 ? 130.567 -41.985 7.286   1.00 32.52 ? 467  ARG A NE    1 
ATOM   2142  C  CZ    . ARG E 3 171 ? 131.434 -42.136 6.286   1.00 34.45 ? 467  ARG A CZ    1 
ATOM   2143  N  NH1   . ARG E 3 171 ? 132.377 -41.226 6.063   1.00 31.11 ? 467  ARG A NH1   1 
ATOM   2144  N  NH2   . ARG E 3 171 ? 131.359 -43.206 5.504   1.00 35.51 ? 467  ARG A NH2   1 
ATOM   2145  N  N     . ASN E 3 172 ? 131.931 -38.668 13.225  1.00 26.13 ? 468  ASN A N     1 
ATOM   2146  C  CA    . ASN E 3 172 ? 131.758 -37.565 14.171  1.00 26.10 ? 468  ASN A CA    1 
ATOM   2147  C  C     . ASN E 3 172 ? 132.857 -37.559 15.236  1.00 24.65 ? 468  ASN A C     1 
ATOM   2148  O  O     . ASN E 3 172 ? 132.852 -36.716 16.133  1.00 25.16 ? 468  ASN A O     1 
ATOM   2149  C  CB    . ASN E 3 172 ? 130.395 -37.662 14.881  1.00 25.94 ? 468  ASN A CB    1 
ATOM   2150  C  CG    . ASN E 3 172 ? 129.220 -37.379 13.957  1.00 26.76 ? 468  ASN A CG    1 
ATOM   2151  O  OD1   . ASN E 3 172 ? 129.391 -36.947 12.819  1.00 26.68 ? 468  ASN A OD1   1 
ATOM   2152  N  ND2   . ASN E 3 172 ? 128.013 -37.618 14.455  1.00 26.66 ? 468  ASN A ND2   1 
ATOM   2153  N  N     . GLU E 3 173 ? 133.798 -38.493 15.131  1.00 24.51 ? 469  GLU A N     1 
ATOM   2154  C  CA    . GLU E 3 173 ? 134.884 -38.612 16.104  1.00 23.94 ? 469  GLU A CA    1 
ATOM   2155  C  C     . GLU E 3 173 ? 134.310 -38.913 17.491  1.00 23.95 ? 469  GLU A C     1 
ATOM   2156  O  O     . GLU E 3 173 ? 134.814 -38.427 18.505  1.00 22.59 ? 469  GLU A O     1 
ATOM   2157  C  CB    . GLU E 3 173 ? 135.711 -37.322 16.159  1.00 28.08 ? 469  GLU A CB    1 
ATOM   2158  C  CG    . GLU E 3 173 ? 136.438 -36.991 14.868  1.00 30.85 ? 469  GLU A CG    1 
ATOM   2159  C  CD    . GLU E 3 173 ? 137.408 -35.832 15.023  1.00 34.67 ? 469  GLU A CD    1 
ATOM   2160  O  OE1   . GLU E 3 173 ? 136.959 -34.695 15.292  1.00 36.18 ? 469  GLU A OE1   1 
ATOM   2161  O  OE2   . GLU E 3 173 ? 138.625 -36.065 14.875  1.00 36.54 ? 469  GLU A OE2   1 
ATOM   2162  N  N     . GLN E 3 174 ? 133.255 -39.722 17.522  1.00 23.37 ? 470  GLN A N     1 
ATOM   2163  C  CA    . GLN E 3 174 ? 132.586 -40.093 18.769  1.00 23.42 ? 470  GLN A CA    1 
ATOM   2164  C  C     . GLN E 3 174 ? 132.639 -41.593 19.035  1.00 24.26 ? 470  GLN A C     1 
ATOM   2165  O  O     . GLN E 3 174 ? 132.030 -42.076 19.992  1.00 22.97 ? 470  GLN A O     1 
ATOM   2166  C  CB    . GLN E 3 174 ? 131.112 -39.674 18.734  1.00 22.50 ? 470  GLN A CB    1 
ATOM   2167  C  CG    . GLN E 3 174 ? 130.849 -38.198 18.531  1.00 21.72 ? 470  GLN A CG    1 
ATOM   2168  C  CD    . GLN E 3 174 ? 129.361 -37.887 18.471  1.00 22.19 ? 470  GLN A CD    1 
ATOM   2169  O  OE1   . GLN E 3 174 ? 128.623 -38.485 17.688  1.00 23.00 ? 470  GLN A OE1   1 
ATOM   2170  N  NE2   . GLN E 3 174 ? 128.914 -36.948 19.298  1.00 22.36 ? 470  GLN A NE2   1 
ATOM   2171  N  N     . ASP E 3 175 ? 133.355 -42.338 18.198  1.00 24.21 ? 471  ASP A N     1 
ATOM   2172  C  CA    . ASP E 3 175 ? 133.426 -43.779 18.395  1.00 24.81 ? 471  ASP A CA    1 
ATOM   2173  C  C     . ASP E 3 175 ? 134.126 -44.156 19.701  1.00 24.78 ? 471  ASP A C     1 
ATOM   2174  O  O     . ASP E 3 175 ? 133.692 -45.080 20.390  1.00 23.27 ? 471  ASP A O     1 
ATOM   2175  C  CB    . ASP E 3 175 ? 134.101 -44.455 17.194  1.00 26.91 ? 471  ASP A CB    1 
ATOM   2176  C  CG    . ASP E 3 175 ? 135.501 -43.939 16.936  1.00 29.05 ? 471  ASP A CG    1 
ATOM   2177  O  OD1   . ASP E 3 175 ? 135.669 -42.710 16.765  1.00 27.15 ? 471  ASP A OD1   1 
ATOM   2178  O  OD2   . ASP E 3 175 ? 136.433 -44.771 16.902  1.00 31.57 ? 471  ASP A OD2   1 
ATOM   2179  N  N     . ARG E 3 176 ? 135.194 -43.442 20.053  1.00 24.60 ? 472  ARG A N     1 
ATOM   2180  C  CA    . ARG E 3 176 ? 135.910 -43.729 21.295  1.00 25.21 ? 472  ARG A CA    1 
ATOM   2181  C  C     . ARG E 3 176 ? 135.086 -43.235 22.483  1.00 24.89 ? 472  ARG A C     1 
ATOM   2182  O  O     . ARG E 3 176 ? 135.134 -43.808 23.574  1.00 24.19 ? 472  ARG A O     1 
ATOM   2183  C  CB    . ARG E 3 176 ? 137.283 -43.048 21.310  1.00 28.10 ? 472  ARG A CB    1 
ATOM   2184  C  CG    . ARG E 3 176 ? 138.278 -43.600 20.300  1.00 32.33 ? 472  ARG A CG    1 
ATOM   2185  C  CD    . ARG E 3 176 ? 139.649 -42.949 20.463  1.00 35.88 ? 472  ARG A CD    1 
ATOM   2186  N  NE    . ARG E 3 176 ? 140.272 -43.284 21.742  1.00 38.96 ? 472  ARG A NE    1 
ATOM   2187  C  CZ    . ARG E 3 176 ? 141.418 -42.765 22.175  1.00 41.23 ? 472  ARG A CZ    1 
ATOM   2188  N  NH1   . ARG E 3 176 ? 142.072 -41.881 21.433  1.00 41.71 ? 472  ARG A NH1   1 
ATOM   2189  N  NH2   . ARG E 3 176 ? 141.911 -43.128 23.353  1.00 41.21 ? 472  ARG A NH2   1 
ATOM   2190  N  N     . LEU E 3 177 ? 134.336 -42.160 22.266  1.00 22.86 ? 473  LEU A N     1 
ATOM   2191  C  CA    . LEU E 3 177 ? 133.488 -41.611 23.316  1.00 20.95 ? 473  LEU A CA    1 
ATOM   2192  C  C     . LEU E 3 177 ? 132.505 -42.703 23.748  1.00 19.65 ? 473  LEU A C     1 
ATOM   2193  O  O     . LEU E 3 177 ? 132.216 -42.860 24.933  1.00 19.59 ? 473  LEU A O     1 
ATOM   2194  C  CB    . LEU E 3 177 ? 132.737 -40.379 22.796  1.00 19.13 ? 473  LEU A CB    1 
ATOM   2195  C  CG    . LEU E 3 177 ? 131.746 -39.704 23.751  1.00 18.26 ? 473  LEU A CG    1 
ATOM   2196  C  CD1   . LEU E 3 177 ? 132.444 -39.332 25.052  1.00 17.41 ? 473  LEU A CD1   1 
ATOM   2197  C  CD2   . LEU E 3 177 ? 131.159 -38.469 23.079  1.00 17.66 ? 473  LEU A CD2   1 
ATOM   2198  N  N     . LEU E 3 178 ? 132.010 -43.472 22.785  1.00 19.29 ? 474  LEU A N     1 
ATOM   2199  C  CA    . LEU E 3 178 ? 131.081 -44.558 23.086  1.00 20.53 ? 474  LEU A CA    1 
ATOM   2200  C  C     . LEU E 3 178 ? 131.769 -45.763 23.728  1.00 21.06 ? 474  LEU A C     1 
ATOM   2201  O  O     . LEU E 3 178 ? 131.432 -46.160 24.842  1.00 19.67 ? 474  LEU A O     1 
ATOM   2202  C  CB    . LEU E 3 178 ? 130.368 -45.030 21.812  1.00 20.38 ? 474  LEU A CB    1 
ATOM   2203  C  CG    . LEU E 3 178 ? 129.502 -46.294 21.948  1.00 22.52 ? 474  LEU A CG    1 
ATOM   2204  C  CD1   . LEU E 3 178 ? 128.268 -46.000 22.806  1.00 18.41 ? 474  LEU A CD1   1 
ATOM   2205  C  CD2   . LEU E 3 178 ? 129.077 -46.780 20.563  1.00 21.73 ? 474  LEU A CD2   1 
ATOM   2206  N  N     . VAL E 3 179 ? 132.739 -46.331 23.015  1.00 22.08 ? 475  VAL A N     1 
ATOM   2207  C  CA    . VAL E 3 179 ? 133.459 -47.527 23.458  1.00 23.88 ? 475  VAL A CA    1 
ATOM   2208  C  C     . VAL E 3 179 ? 134.384 -47.399 24.671  1.00 23.99 ? 475  VAL A C     1 
ATOM   2209  O  O     . VAL E 3 179 ? 134.519 -48.348 25.450  1.00 23.41 ? 475  VAL A O     1 
ATOM   2210  C  CB    . VAL E 3 179 ? 134.272 -48.127 22.273  1.00 26.03 ? 475  VAL A CB    1 
ATOM   2211  C  CG1   . VAL E 3 179 ? 135.048 -49.355 22.719  1.00 28.17 ? 475  VAL A CG1   1 
ATOM   2212  C  CG2   . VAL E 3 179 ? 133.323 -48.492 21.138  1.00 26.94 ? 475  VAL A CG2   1 
ATOM   2213  N  N     . GLU E 3 180 ? 135.010 -46.240 24.843  1.00 23.55 ? 476  GLU A N     1 
ATOM   2214  C  CA    . GLU E 3 180 ? 135.931 -46.050 25.957  1.00 25.08 ? 476  GLU A CA    1 
ATOM   2215  C  C     . GLU E 3 180 ? 135.388 -45.223 27.118  1.00 24.88 ? 476  GLU A C     1 
ATOM   2216  O  O     . GLU E 3 180 ? 135.999 -45.186 28.185  1.00 24.52 ? 476  GLU A O     1 
ATOM   2217  C  CB    . GLU E 3 180 ? 137.236 -45.428 25.448  1.00 27.63 ? 476  GLU A CB    1 
ATOM   2218  C  CG    . GLU E 3 180 ? 137.879 -46.230 24.329  1.00 30.81 ? 476  GLU A CG    1 
ATOM   2219  C  CD    . GLU E 3 180 ? 139.182 -45.630 23.846  1.00 33.60 ? 476  GLU A CD    1 
ATOM   2220  O  OE1   . GLU E 3 180 ? 139.691 -46.084 22.801  1.00 35.70 ? 476  GLU A OE1   1 
ATOM   2221  O  OE2   . GLU E 3 180 ? 139.697 -44.708 24.511  1.00 35.67 ? 476  GLU A OE2   1 
ATOM   2222  N  N     . LEU E 3 181 ? 134.248 -44.563 26.928  1.00 23.77 ? 477  LEU A N     1 
ATOM   2223  C  CA    . LEU E 3 181 ? 133.688 -43.763 28.009  1.00 23.01 ? 477  LEU A CA    1 
ATOM   2224  C  C     . LEU E 3 181 ? 132.293 -44.219 28.443  1.00 23.12 ? 477  LEU A C     1 
ATOM   2225  O  O     . LEU E 3 181 ? 132.137 -44.835 29.501  1.00 22.44 ? 477  LEU A O     1 
ATOM   2226  C  CB    . LEU E 3 181 ? 133.634 -42.281 27.616  1.00 23.38 ? 477  LEU A CB    1 
ATOM   2227  C  CG    . LEU E 3 181 ? 133.286 -41.348 28.781  1.00 24.85 ? 477  LEU A CG    1 
ATOM   2228  C  CD1   . LEU E 3 181 ? 134.553 -41.058 29.579  1.00 26.28 ? 477  LEU A CD1   1 
ATOM   2229  C  CD2   . LEU E 3 181 ? 132.693 -40.051 28.268  1.00 26.11 ? 477  LEU A CD2   1 
ATOM   2230  N  N     . GLU E 3 182 ? 131.285 -43.923 27.626  1.00 21.50 ? 478  GLU A N     1 
ATOM   2231  C  CA    . GLU E 3 182 ? 129.906 -44.278 27.965  1.00 21.11 ? 478  GLU A CA    1 
ATOM   2232  C  C     . GLU E 3 182 ? 129.676 -45.762 28.249  1.00 20.54 ? 478  GLU A C     1 
ATOM   2233  O  O     . GLU E 3 182 ? 129.082 -46.111 29.266  1.00 20.49 ? 478  GLU A O     1 
ATOM   2234  C  CB    . GLU E 3 182 ? 128.946 -43.817 26.862  1.00 21.31 ? 478  GLU A CB    1 
ATOM   2235  C  CG    . GLU E 3 182 ? 128.933 -42.308 26.605  1.00 21.95 ? 478  GLU A CG    1 
ATOM   2236  C  CD    . GLU E 3 182 ? 128.483 -41.480 27.808  1.00 22.63 ? 478  GLU A CD    1 
ATOM   2237  O  OE1   . GLU E 3 182 ? 128.098 -42.061 28.846  1.00 21.67 ? 478  GLU A OE1   1 
ATOM   2238  O  OE2   . GLU E 3 182 ? 128.516 -40.236 27.709  1.00 22.15 ? 478  GLU A OE2   1 
ATOM   2239  N  N     . GLN E 3 183 ? 130.135 -46.642 27.366  1.00 19.59 ? 479  GLN A N     1 
ATOM   2240  C  CA    . GLN E 3 183 ? 129.917 -48.066 27.602  1.00 20.31 ? 479  GLN A CA    1 
ATOM   2241  C  C     . GLN E 3 183 ? 130.596 -48.568 28.878  1.00 20.24 ? 479  GLN A C     1 
ATOM   2242  O  O     . GLN E 3 183 ? 129.987 -49.304 29.655  1.00 21.39 ? 479  GLN A O     1 
ATOM   2243  C  CB    . GLN E 3 183 ? 130.320 -48.876 26.369  1.00 19.36 ? 479  GLN A CB    1 
ATOM   2244  C  CG    . GLN E 3 183 ? 129.339 -48.625 25.220  1.00 19.90 ? 479  GLN A CG    1 
ATOM   2245  C  CD    . GLN E 3 183 ? 129.588 -49.469 23.989  1.00 20.24 ? 479  GLN A CD    1 
ATOM   2246  O  OE1   . GLN E 3 183 ? 128.806 -49.431 23.040  1.00 19.57 ? 479  GLN A OE1   1 
ATOM   2247  N  NE2   . GLN E 3 183 ? 130.675 -50.233 23.992  1.00 21.28 ? 479  GLN A NE2   1 
ATOM   2248  N  N     . PRO E 3 184 ? 131.859 -48.182 29.116  1.00 20.10 ? 480  PRO A N     1 
ATOM   2249  C  CA    . PRO E 3 184 ? 132.510 -48.646 30.344  1.00 21.73 ? 480  PRO A CA    1 
ATOM   2250  C  C     . PRO E 3 184 ? 131.782 -48.052 31.556  1.00 21.03 ? 480  PRO A C     1 
ATOM   2251  O  O     . PRO E 3 184 ? 131.595 -48.718 32.576  1.00 20.49 ? 480  PRO A O     1 
ATOM   2252  C  CB    . PRO E 3 184 ? 133.941 -48.134 30.197  1.00 22.61 ? 480  PRO A CB    1 
ATOM   2253  C  CG    . PRO E 3 184 ? 134.142 -48.137 28.715  1.00 22.79 ? 480  PRO A CG    1 
ATOM   2254  C  CD    . PRO E 3 184 ? 132.842 -47.562 28.211  1.00 21.68 ? 480  PRO A CD    1 
ATOM   2255  N  N     . LEU E 3 185 ? 131.378 -46.789 31.431  1.00 20.42 ? 481  LEU A N     1 
ATOM   2256  C  CA    . LEU E 3 185 ? 130.662 -46.101 32.502  1.00 18.78 ? 481  LEU A CA    1 
ATOM   2257  C  C     . LEU E 3 185 ? 129.355 -46.824 32.816  1.00 19.21 ? 481  LEU A C     1 
ATOM   2258  O  O     . LEU E 3 185 ? 128.974 -46.967 33.981  1.00 20.24 ? 481  LEU A O     1 
ATOM   2259  C  CB    . LEU E 3 185 ? 130.354 -44.654 32.101  1.00 16.79 ? 481  LEU A CB    1 
ATOM   2260  C  CG    . LEU E 3 185 ? 129.587 -43.839 33.149  1.00 17.79 ? 481  LEU A CG    1 
ATOM   2261  C  CD1   . LEU E 3 185 ? 130.476 -43.605 34.368  1.00 15.75 ? 481  LEU A CD1   1 
ATOM   2262  C  CD2   . LEU E 3 185 ? 129.141 -42.516 32.556  1.00 17.04 ? 481  LEU A CD2   1 
ATOM   2263  N  N     . SER E 3 186 ? 128.673 -47.280 31.769  1.00 19.36 ? 482  SER A N     1 
ATOM   2264  C  CA    . SER E 3 186 ? 127.406 -47.983 31.920  1.00 19.67 ? 482  SER A CA    1 
ATOM   2265  C  C     . SER E 3 186 ? 127.524 -49.172 32.877  1.00 20.56 ? 482  SER A C     1 
ATOM   2266  O  O     . SER E 3 186 ? 126.625 -49.416 33.688  1.00 18.84 ? 482  SER A O     1 
ATOM   2267  C  CB    . SER E 3 186 ? 126.913 -48.457 30.551  1.00 20.56 ? 482  SER A CB    1 
ATOM   2268  O  OG    . SER E 3 186 ? 125.633 -49.051 30.643  1.00 25.67 ? 482  SER A OG    1 
ATOM   2269  N  N     . SER E 3 187 ? 128.627 -49.913 32.782  1.00 19.84 ? 483  SER A N     1 
ATOM   2270  C  CA    . SER E 3 187 ? 128.840 -51.062 33.657  1.00 20.76 ? 483  SER A CA    1 
ATOM   2271  C  C     . SER E 3 187 ? 129.055 -50.605 35.095  1.00 19.58 ? 483  SER A C     1 
ATOM   2272  O  O     . SER E 3 187 ? 128.655 -51.288 36.038  1.00 19.94 ? 483  SER A O     1 
ATOM   2273  C  CB    . SER E 3 187 ? 130.056 -51.877 33.195  1.00 20.94 ? 483  SER A CB    1 
ATOM   2274  O  OG    . SER E 3 187 ? 129.801 -52.490 31.944  1.00 24.00 ? 483  SER A OG    1 
ATOM   2275  N  N     . ILE E 3 188 ? 129.694 -49.451 35.254  1.00 19.41 ? 484  ILE A N     1 
ATOM   2276  C  CA    . ILE E 3 188 ? 129.966 -48.894 36.572  1.00 19.08 ? 484  ILE A CA    1 
ATOM   2277  C  C     . ILE E 3 188 ? 128.674 -48.410 37.229  1.00 20.43 ? 484  ILE A C     1 
ATOM   2278  O  O     . ILE E 3 188 ? 128.469 -48.596 38.435  1.00 20.17 ? 484  ILE A O     1 
ATOM   2279  C  CB    . ILE E 3 188 ? 130.976 -47.728 36.475  1.00 19.69 ? 484  ILE A CB    1 
ATOM   2280  C  CG1   . ILE E 3 188 ? 132.340 -48.273 36.034  1.00 18.46 ? 484  ILE A CG1   1 
ATOM   2281  C  CG2   . ILE E 3 188 ? 131.081 -47.006 37.813  1.00 20.34 ? 484  ILE A CG2   1 
ATOM   2282  C  CD1   . ILE E 3 188 ? 133.398 -47.212 35.843  1.00 18.82 ? 484  ILE A CD1   1 
ATOM   2283  N  N     . LEU E 3 189 ? 127.806 -47.788 36.436  1.00 18.30 ? 485  LEU A N     1 
ATOM   2284  C  CA    . LEU E 3 189 ? 126.527 -47.303 36.945  1.00 18.24 ? 485  LEU A CA    1 
ATOM   2285  C  C     . LEU E 3 189 ? 125.656 -48.495 37.362  1.00 18.20 ? 485  LEU A C     1 
ATOM   2286  O  O     . LEU E 3 189 ? 124.947 -48.443 38.372  1.00 18.83 ? 485  LEU A O     1 
ATOM   2287  C  CB    . LEU E 3 189 ? 125.819 -46.458 35.872  1.00 16.47 ? 485  LEU A CB    1 
ATOM   2288  C  CG    . LEU E 3 189 ? 126.515 -45.149 35.464  1.00 16.17 ? 485  LEU A CG    1 
ATOM   2289  C  CD1   . LEU E 3 189 ? 125.738 -44.466 34.334  1.00 15.04 ? 485  LEU A CD1   1 
ATOM   2290  C  CD2   . LEU E 3 189 ? 126.610 -44.220 36.664  1.00 18.07 ? 485  LEU A CD2   1 
ATOM   2291  N  N     . ALA E 3 190 ? 125.717 -49.578 36.591  1.00 18.44 ? 486  ALA A N     1 
ATOM   2292  C  CA    . ALA E 3 190 ? 124.939 -50.773 36.913  1.00 18.67 ? 486  ALA A CA    1 
ATOM   2293  C  C     . ALA E 3 190 ? 125.329 -51.294 38.299  1.00 20.35 ? 486  ALA A C     1 
ATOM   2294  O  O     . ALA E 3 190 ? 124.469 -51.701 39.084  1.00 20.02 ? 486  ALA A O     1 
ATOM   2295  C  CB    . ALA E 3 190 ? 125.168 -51.856 35.854  1.00 19.86 ? 486  ALA A CB    1 
ATOM   2296  N  N     . GLU E 3 191 ? 126.627 -51.282 38.595  1.00 20.98 ? 487  GLU A N     1 
ATOM   2297  C  CA    . GLU E 3 191 ? 127.126 -51.736 39.893  1.00 22.57 ? 487  GLU A CA    1 
ATOM   2298  C  C     . GLU E 3 191 ? 126.635 -50.821 41.010  1.00 21.17 ? 487  GLU A C     1 
ATOM   2299  O  O     . GLU E 3 191 ? 126.175 -51.287 42.054  1.00 21.11 ? 487  GLU A O     1 
ATOM   2300  C  CB    . GLU E 3 191 ? 128.659 -51.751 39.911  1.00 25.53 ? 487  GLU A CB    1 
ATOM   2301  C  CG    . GLU E 3 191 ? 129.289 -52.951 39.232  1.00 31.57 ? 487  GLU A CG    1 
ATOM   2302  C  CD    . GLU E 3 191 ? 130.805 -52.976 39.380  1.00 35.64 ? 487  GLU A CD    1 
ATOM   2303  O  OE1   . GLU E 3 191 ? 131.413 -54.016 39.050  1.00 38.31 ? 487  GLU A OE1   1 
ATOM   2304  O  OE2   . GLU E 3 191 ? 131.389 -51.959 39.821  1.00 36.41 ? 487  GLU A OE2   1 
ATOM   2305  N  N     . MET E 3 192 ? 126.745 -49.517 40.783  1.00 18.19 ? 488  MET A N     1 
ATOM   2306  C  CA    . MET E 3 192 ? 126.319 -48.531 41.766  1.00 18.68 ? 488  MET A CA    1 
ATOM   2307  C  C     . MET E 3 192 ? 124.832 -48.668 42.083  1.00 18.83 ? 488  MET A C     1 
ATOM   2308  O  O     . MET E 3 192 ? 124.436 -48.668 43.249  1.00 19.29 ? 488  MET A O     1 
ATOM   2309  C  CB    . MET E 3 192 ? 126.615 -47.124 41.249  1.00 18.08 ? 488  MET A CB    1 
ATOM   2310  C  CG    . MET E 3 192 ? 128.095 -46.780 41.212  1.00 19.27 ? 488  MET A CG    1 
ATOM   2311  S  SD    . MET E 3 192 ? 128.462 -45.369 40.149  1.00 19.45 ? 488  MET A SD    1 
ATOM   2312  C  CE    . MET E 3 192 ? 127.760 -44.002 41.102  1.00 18.65 ? 488  MET A CE    1 
ATOM   2313  N  N     . GLU E 3 193 ? 124.015 -48.790 41.041  1.00 17.99 ? 489  GLU A N     1 
ATOM   2314  C  CA    . GLU E 3 193 ? 122.573 -48.924 41.213  1.00 18.83 ? 489  GLU A CA    1 
ATOM   2315  C  C     . GLU E 3 193 ? 122.196 -50.201 41.966  1.00 19.43 ? 489  GLU A C     1 
ATOM   2316  O  O     . GLU E 3 193 ? 121.347 -50.172 42.860  1.00 18.59 ? 489  GLU A O     1 
ATOM   2317  C  CB    . GLU E 3 193 ? 121.881 -48.906 39.848  1.00 19.01 ? 489  GLU A CB    1 
ATOM   2318  C  CG    . GLU E 3 193 ? 122.078 -47.611 39.068  1.00 16.29 ? 489  GLU A CG    1 
ATOM   2319  C  CD    . GLU E 3 193 ? 121.513 -47.692 37.666  1.00 18.00 ? 489  GLU A CD    1 
ATOM   2320  O  OE1   . GLU E 3 193 ? 121.573 -46.676 36.941  1.00 18.45 ? 489  GLU A OE1   1 
ATOM   2321  O  OE2   . GLU E 3 193 ? 121.011 -48.774 37.284  1.00 19.28 ? 489  GLU A OE2   1 
ATOM   2322  N  N     . PHE E 3 194 ? 122.828 -51.316 41.609  1.00 19.20 ? 490  PHE A N     1 
ATOM   2323  C  CA    . PHE E 3 194 ? 122.532 -52.593 42.263  1.00 19.40 ? 490  PHE A CA    1 
ATOM   2324  C  C     . PHE E 3 194 ? 122.976 -52.592 43.723  1.00 19.48 ? 490  PHE A C     1 
ATOM   2325  O  O     . PHE E 3 194 ? 122.305 -53.163 44.583  1.00 19.58 ? 490  PHE A O     1 
ATOM   2326  C  CB    . PHE E 3 194 ? 123.216 -53.749 41.526  1.00 18.42 ? 490  PHE A CB    1 
ATOM   2327  C  CG    . PHE E 3 194 ? 122.849 -55.110 42.060  1.00 19.35 ? 490  PHE A CG    1 
ATOM   2328  C  CD1   . PHE E 3 194 ? 121.549 -55.593 41.933  1.00 19.20 ? 490  PHE A CD1   1 
ATOM   2329  C  CD2   . PHE E 3 194 ? 123.798 -55.902 42.699  1.00 20.46 ? 490  PHE A CD2   1 
ATOM   2330  C  CE1   . PHE E 3 194 ? 121.196 -56.847 42.435  1.00 22.32 ? 490  PHE A CE1   1 
ATOM   2331  C  CE2   . PHE E 3 194 ? 123.457 -57.162 43.207  1.00 20.90 ? 490  PHE A CE2   1 
ATOM   2332  C  CZ    . PHE E 3 194 ? 122.155 -57.634 43.075  1.00 20.09 ? 490  PHE A CZ    1 
ATOM   2333  N  N     . ALA E 3 195 ? 124.108 -51.952 44.000  1.00 19.85 ? 491  ALA A N     1 
ATOM   2334  C  CA    . ALA E 3 195 ? 124.623 -51.887 45.363  1.00 19.60 ? 491  ALA A CA    1 
ATOM   2335  C  C     . ALA E 3 195 ? 123.649 -51.121 46.250  1.00 19.89 ? 491  ALA A C     1 
ATOM   2336  O  O     . ALA E 3 195 ? 123.377 -51.521 47.382  1.00 18.79 ? 491  ALA A O     1 
ATOM   2337  C  CB    . ALA E 3 195 ? 125.991 -51.207 45.377  1.00 19.18 ? 491  ALA A CB    1 
ATOM   2338  N  N     . GLY E 3 196 ? 123.130 -50.014 45.725  1.00 20.41 ? 492  GLY A N     1 
ATOM   2339  C  CA    . GLY E 3 196 ? 122.184 -49.203 46.472  1.00 19.56 ? 492  GLY A CA    1 
ATOM   2340  C  C     . GLY E 3 196 ? 122.804 -48.455 47.636  1.00 19.05 ? 492  GLY A C     1 
ATOM   2341  O  O     . GLY E 3 196 ? 123.993 -48.604 47.920  1.00 19.98 ? 492  GLY A O     1 
ATOM   2342  N  N     . VAL E 3 197 ? 121.991 -47.644 48.308  1.00 18.08 ? 493  VAL A N     1 
ATOM   2343  C  CA    . VAL E 3 197 ? 122.438 -46.864 49.458  1.00 17.31 ? 493  VAL A CA    1 
ATOM   2344  C  C     . VAL E 3 197 ? 121.543 -47.218 50.649  1.00 18.47 ? 493  VAL A C     1 
ATOM   2345  O  O     . VAL E 3 197 ? 120.319 -47.183 50.539  1.00 18.20 ? 493  VAL A O     1 
ATOM   2346  C  CB    . VAL E 3 197 ? 122.326 -45.349 49.180  1.00 17.14 ? 493  VAL A CB    1 
ATOM   2347  C  CG1   . VAL E 3 197 ? 122.909 -44.561 50.343  1.00 18.49 ? 493  VAL A CG1   1 
ATOM   2348  C  CG2   . VAL E 3 197 ? 123.049 -45.000 47.886  1.00 16.83 ? 493  VAL A CG2   1 
ATOM   2349  N  N     . LYS E 3 198 ? 122.150 -47.554 51.784  1.00 20.13 ? 494  LYS A N     1 
ATOM   2350  C  CA    . LYS E 3 198 ? 121.378 -47.931 52.967  1.00 19.41 ? 494  LYS A CA    1 
ATOM   2351  C  C     . LYS E 3 198 ? 120.753 -46.727 53.671  1.00 18.91 ? 494  LYS A C     1 
ATOM   2352  O  O     . LYS E 3 198 ? 121.375 -45.669 53.795  1.00 17.97 ? 494  LYS A O     1 
ATOM   2353  C  CB    . LYS E 3 198 ? 122.267 -48.698 53.951  1.00 22.67 ? 494  LYS A CB    1 
ATOM   2354  C  CG    . LYS E 3 198 ? 121.490 -49.497 54.995  1.00 25.82 ? 494  LYS A CG    1 
ATOM   2355  C  CD    . LYS E 3 198 ? 122.390 -50.510 55.681  1.00 28.72 ? 494  LYS A CD    1 
ATOM   2356  C  CE    . LYS E 3 198 ? 121.583 -51.560 56.431  1.00 30.53 ? 494  LYS A CE    1 
ATOM   2357  N  NZ    . LYS E 3 198 ? 120.830 -50.978 57.568  1.00 33.66 ? 494  LYS A NZ    1 
ATOM   2358  N  N     . VAL E 3 199 ? 119.518 -46.901 54.134  1.00 18.80 ? 495  VAL A N     1 
ATOM   2359  C  CA    . VAL E 3 199 ? 118.798 -45.835 54.817  1.00 19.04 ? 495  VAL A CA    1 
ATOM   2360  C  C     . VAL E 3 199 ? 118.480 -46.199 56.267  1.00 19.75 ? 495  VAL A C     1 
ATOM   2361  O  O     . VAL E 3 199 ? 118.119 -47.338 56.574  1.00 17.23 ? 495  VAL A O     1 
ATOM   2362  C  CB    . VAL E 3 199 ? 117.465 -45.509 54.093  1.00 19.80 ? 495  VAL A CB    1 
ATOM   2363  C  CG1   . VAL E 3 199 ? 116.717 -44.400 54.834  1.00 17.52 ? 495  VAL A CG1   1 
ATOM   2364  C  CG2   . VAL E 3 199 ? 117.745 -45.087 52.654  1.00 20.19 ? 495  VAL A CG2   1 
ATOM   2365  N  N     . ASP E 3 200 ? 118.621 -45.216 57.149  1.00 18.70 ? 496  ASP A N     1 
ATOM   2366  C  CA    . ASP E 3 200 ? 118.325 -45.393 58.567  1.00 19.01 ? 496  ASP A CA    1 
ATOM   2367  C  C     . ASP E 3 200 ? 116.842 -45.033 58.714  1.00 18.14 ? 496  ASP A C     1 
ATOM   2368  O  O     . ASP E 3 200 ? 116.499 -43.895 59.032  1.00 16.59 ? 496  ASP A O     1 
ATOM   2369  C  CB    . ASP E 3 200 ? 119.189 -44.442 59.397  1.00 18.14 ? 496  ASP A CB    1 
ATOM   2370  C  CG    . ASP E 3 200 ? 119.032 -44.656 60.891  1.00 21.52 ? 496  ASP A CG    1 
ATOM   2371  O  OD1   . ASP E 3 200 ? 118.039 -45.291 61.314  1.00 20.87 ? 496  ASP A OD1   1 
ATOM   2372  O  OD2   . ASP E 3 200 ? 119.909 -44.178 61.641  1.00 21.33 ? 496  ASP A OD2   1 
ATOM   2373  N  N     . THR E 3 201 ? 115.969 -46.008 58.472  1.00 18.56 ? 497  THR A N     1 
ATOM   2374  C  CA    . THR E 3 201 ? 114.531 -45.778 58.539  1.00 18.68 ? 497  THR A CA    1 
ATOM   2375  C  C     . THR E 3 201 ? 114.015 -45.344 59.907  1.00 20.13 ? 497  THR A C     1 
ATOM   2376  O  O     . THR E 3 201 ? 113.104 -44.520 59.995  1.00 19.50 ? 497  THR A O     1 
ATOM   2377  C  CB    . THR E 3 201 ? 113.743 -47.020 58.070  1.00 18.77 ? 497  THR A CB    1 
ATOM   2378  O  OG1   . THR E 3 201 ? 114.056 -48.145 58.903  1.00 18.47 ? 497  THR A OG1   1 
ATOM   2379  C  CG2   . THR E 3 201 ? 114.106 -47.348 56.622  1.00 20.64 ? 497  THR A CG2   1 
ATOM   2380  N  N     . LYS E 3 202 ? 114.588 -45.887 60.975  1.00 20.87 ? 498  LYS A N     1 
ATOM   2381  C  CA    . LYS E 3 202 ? 114.151 -45.505 62.312  1.00 21.79 ? 498  LYS A CA    1 
ATOM   2382  C  C     . LYS E 3 202 ? 114.325 -43.998 62.488  1.00 22.12 ? 498  LYS A C     1 
ATOM   2383  O  O     . LYS E 3 202 ? 113.421 -43.308 62.955  1.00 21.12 ? 498  LYS A O     1 
ATOM   2384  C  CB    . LYS E 3 202 ? 114.958 -46.250 63.380  1.00 21.55 ? 498  LYS A CB    1 
ATOM   2385  C  CG    . LYS E 3 202 ? 114.662 -47.740 63.456  1.00 26.26 ? 498  LYS A CG    1 
ATOM   2386  C  CD    . LYS E 3 202 ? 115.519 -48.415 64.521  1.00 29.72 ? 498  LYS A CD    1 
ATOM   2387  C  CE    . LYS E 3 202 ? 115.345 -49.925 64.499  1.00 31.72 ? 498  LYS A CE    1 
ATOM   2388  N  NZ    . LYS E 3 202 ? 113.932 -50.314 64.751  1.00 36.08 ? 498  LYS A NZ    1 
ATOM   2389  N  N     . ARG E 3 203 ? 115.489 -43.494 62.095  1.00 23.09 ? 499  ARG A N     1 
ATOM   2390  C  CA    . ARG E 3 203 ? 115.780 -42.075 62.221  1.00 24.09 ? 499  ARG A CA    1 
ATOM   2391  C  C     . ARG E 3 203 ? 114.949 -41.249 61.244  1.00 24.12 ? 499  ARG A C     1 
ATOM   2392  O  O     . ARG E 3 203 ? 114.424 -40.199 61.603  1.00 25.43 ? 499  ARG A O     1 
ATOM   2393  C  CB    . ARG E 3 203 ? 117.269 -41.826 61.983  1.00 26.49 ? 499  ARG A CB    1 
ATOM   2394  C  CG    . ARG E 3 203 ? 117.727 -40.416 62.303  1.00 30.53 ? 499  ARG A CG    1 
ATOM   2395  C  CD    . ARG E 3 203 ? 119.243 -40.317 62.219  1.00 34.31 ? 499  ARG A CD    1 
ATOM   2396  N  NE    . ARG E 3 203 ? 119.753 -39.104 62.850  1.00 38.50 ? 499  ARG A NE    1 
ATOM   2397  C  CZ    . ARG E 3 203 ? 121.041 -38.864 63.071  1.00 40.19 ? 499  ARG A CZ    1 
ATOM   2398  N  NH1   . ARG E 3 203 ? 121.955 -39.758 62.711  1.00 40.87 ? 499  ARG A NH1   1 
ATOM   2399  N  NH2   . ARG E 3 203 ? 121.416 -37.734 63.658  1.00 41.87 ? 499  ARG A NH2   1 
ATOM   2400  N  N     . LEU E 3 204 ? 114.824 -41.727 60.011  1.00 24.41 ? 500  LEU A N     1 
ATOM   2401  C  CA    . LEU E 3 204 ? 114.052 -41.008 59.007  1.00 23.30 ? 500  LEU A CA    1 
ATOM   2402  C  C     . LEU E 3 204 ? 112.603 -40.885 59.464  1.00 22.26 ? 500  LEU A C     1 
ATOM   2403  O  O     . LEU E 3 204 ? 111.990 -39.819 59.353  1.00 20.83 ? 500  LEU A O     1 
ATOM   2404  C  CB    . LEU E 3 204 ? 114.108 -41.739 57.663  1.00 24.44 ? 500  LEU A CB    1 
ATOM   2405  C  CG    . LEU E 3 204 ? 113.502 -40.971 56.488  1.00 24.58 ? 500  LEU A CG    1 
ATOM   2406  C  CD1   . LEU E 3 204 ? 114.300 -39.689 56.252  1.00 25.46 ? 500  LEU A CD1   1 
ATOM   2407  C  CD2   . LEU E 3 204 ? 113.508 -41.843 55.245  1.00 24.87 ? 500  LEU A CD2   1 
ATOM   2408  N  N     . GLU E 3 205 ? 112.064 -41.982 59.988  1.00 20.11 ? 501  GLU A N     1 
ATOM   2409  C  CA    . GLU E 3 205 ? 110.688 -42.002 60.461  1.00 19.63 ? 501  GLU A CA    1 
ATOM   2410  C  C     . GLU E 3 205 ? 110.486 -41.084 61.660  1.00 20.66 ? 501  GLU A C     1 
ATOM   2411  O  O     . GLU E 3 205 ? 109.446 -40.423 61.781  1.00 21.06 ? 501  GLU A O     1 
ATOM   2412  C  CB    . GLU E 3 205 ? 110.279 -43.436 60.797  1.00 19.66 ? 501  GLU A CB    1 
ATOM   2413  C  CG    . GLU E 3 205 ? 110.039 -44.285 59.546  1.00 20.30 ? 501  GLU A CG    1 
ATOM   2414  C  CD    . GLU E 3 205 ? 109.844 -45.761 59.847  1.00 22.75 ? 501  GLU A CD    1 
ATOM   2415  O  OE1   . GLU E 3 205 ? 109.551 -46.106 61.013  1.00 22.57 ? 501  GLU A OE1   1 
ATOM   2416  O  OE2   . GLU E 3 205 ? 109.971 -46.573 58.904  1.00 21.18 ? 501  GLU A OE2   1 
ATOM   2417  N  N     . GLN E 3 206 ? 111.471 -41.034 62.547  1.00 20.01 ? 502  GLN A N     1 
ATOM   2418  C  CA    . GLN E 3 206 ? 111.359 -40.160 63.708  1.00 22.03 ? 502  GLN A CA    1 
ATOM   2419  C  C     . GLN E 3 206 ? 111.397 -38.707 63.225  1.00 21.05 ? 502  GLN A C     1 
ATOM   2420  O  O     . GLN E 3 206 ? 110.668 -37.856 63.735  1.00 21.43 ? 502  GLN A O     1 
ATOM   2421  C  CB    . GLN E 3 206 ? 112.487 -40.434 64.709  1.00 22.91 ? 502  GLN A CB    1 
ATOM   2422  C  CG    . GLN E 3 206 ? 112.435 -39.553 65.952  1.00 26.19 ? 502  GLN A CG    1 
ATOM   2423  C  CD    . GLN E 3 206 ? 111.105 -39.633 66.691  1.00 29.48 ? 502  GLN A CD    1 
ATOM   2424  O  OE1   . GLN E 3 206 ? 110.594 -38.621 67.176  1.00 31.60 ? 502  GLN A OE1   1 
ATOM   2425  N  NE2   . GLN E 3 206 ? 110.544 -40.833 66.787  1.00 28.40 ? 502  GLN A NE2   1 
ATOM   2426  N  N     . MET E 3 207 ? 112.237 -38.424 62.234  1.00 21.72 ? 503  MET A N     1 
ATOM   2427  C  CA    . MET E 3 207 ? 112.316 -37.071 61.692  1.00 22.30 ? 503  MET A CA    1 
ATOM   2428  C  C     . MET E 3 207 ? 110.952 -36.677 61.123  1.00 20.87 ? 503  MET A C     1 
ATOM   2429  O  O     . MET E 3 207 ? 110.492 -35.556 61.314  1.00 20.02 ? 503  MET A O     1 
ATOM   2430  C  CB    . MET E 3 207 ? 113.376 -36.982 60.587  1.00 24.22 ? 503  MET A CB    1 
ATOM   2431  C  CG    . MET E 3 207 ? 114.813 -37.054 61.084  1.00 27.93 ? 503  MET A CG    1 
ATOM   2432  S  SD    . MET E 3 207 ? 116.030 -36.685 59.792  1.00 33.14 ? 503  MET A SD    1 
ATOM   2433  C  CE    . MET E 3 207 ? 116.202 -38.274 59.006  1.00 31.36 ? 503  MET A CE    1 
ATOM   2434  N  N     . GLY E 3 208 ? 110.307 -37.612 60.430  1.00 19.39 ? 504  GLY A N     1 
ATOM   2435  C  CA    . GLY E 3 208 ? 109.005 -37.337 59.852  1.00 21.28 ? 504  GLY A CA    1 
ATOM   2436  C  C     . GLY E 3 208 ? 107.939 -37.044 60.890  1.00 23.17 ? 504  GLY A C     1 
ATOM   2437  O  O     . GLY E 3 208 ? 107.062 -36.203 60.674  1.00 21.10 ? 504  GLY A O     1 
ATOM   2438  N  N     . LYS E 3 209 ? 108.007 -37.741 62.021  1.00 24.32 ? 505  LYS A N     1 
ATOM   2439  C  CA    . LYS E 3 209 ? 107.041 -37.547 63.094  1.00 26.84 ? 505  LYS A CA    1 
ATOM   2440  C  C     . LYS E 3 209 ? 107.183 -36.135 63.663  1.00 26.74 ? 505  LYS A C     1 
ATOM   2441  O  O     . LYS E 3 209 ? 106.196 -35.422 63.849  1.00 27.04 ? 505  LYS A O     1 
ATOM   2442  C  CB    . LYS E 3 209 ? 107.277 -38.583 64.202  1.00 29.44 ? 505  LYS A CB    1 
ATOM   2443  C  CG    . LYS E 3 209 ? 106.293 -38.512 65.359  1.00 32.84 ? 505  LYS A CG    1 
ATOM   2444  C  CD    . LYS E 3 209 ? 104.892 -38.900 64.917  1.00 35.78 ? 505  LYS A CD    1 
ATOM   2445  C  CE    . LYS E 3 209 ? 103.904 -38.798 66.073  1.00 38.77 ? 505  LYS A CE    1 
ATOM   2446  N  NZ    . LYS E 3 209 ? 102.522 -39.178 65.668  1.00 40.28 ? 505  LYS A NZ    1 
ATOM   2447  N  N     . GLU E 3 210 ? 108.419 -35.734 63.929  1.00 27.14 ? 506  GLU A N     1 
ATOM   2448  C  CA    . GLU E 3 210 ? 108.685 -34.410 64.475  1.00 30.19 ? 506  GLU A CA    1 
ATOM   2449  C  C     . GLU E 3 210 ? 108.391 -33.324 63.445  1.00 30.11 ? 506  GLU A C     1 
ATOM   2450  O  O     . GLU E 3 210 ? 107.865 -32.262 63.783  1.00 29.83 ? 506  GLU A O     1 
ATOM   2451  C  CB    . GLU E 3 210 ? 110.140 -34.323 64.927  1.00 32.43 ? 506  GLU A CB    1 
ATOM   2452  C  CG    . GLU E 3 210 ? 110.591 -35.547 65.712  1.00 38.19 ? 506  GLU A CG    1 
ATOM   2453  C  CD    . GLU E 3 210 ? 112.006 -35.426 66.231  1.00 39.76 ? 506  GLU A CD    1 
ATOM   2454  O  OE1   . GLU E 3 210 ? 112.880 -34.962 65.470  1.00 43.20 ? 506  GLU A OE1   1 
ATOM   2455  O  OE2   . GLU E 3 210 ? 112.245 -35.801 67.398  1.00 42.30 ? 506  GLU A OE2   1 
ATOM   2456  N  N     . LEU E 3 211 ? 108.724 -33.594 62.186  1.00 28.57 ? 507  LEU A N     1 
ATOM   2457  C  CA    . LEU E 3 211 ? 108.490 -32.622 61.124  1.00 29.06 ? 507  LEU A CA    1 
ATOM   2458  C  C     . LEU E 3 211 ? 106.993 -32.352 60.968  1.00 28.61 ? 507  LEU A C     1 
ATOM   2459  O  O     . LEU E 3 211 ? 106.577 -31.218 60.732  1.00 27.02 ? 507  LEU A O     1 
ATOM   2460  C  CB    . LEU E 3 211 ? 109.092 -33.130 59.806  1.00 29.84 ? 507  LEU A CB    1 
ATOM   2461  C  CG    . LEU E 3 211 ? 109.127 -32.158 58.620  1.00 31.32 ? 507  LEU A CG    1 
ATOM   2462  C  CD1   . LEU E 3 211 ? 110.145 -32.630 57.591  1.00 31.74 ? 507  LEU A CD1   1 
ATOM   2463  C  CD2   . LEU E 3 211 ? 107.749 -32.054 58.004  1.00 32.52 ? 507  LEU A CD2   1 
ATOM   2464  N  N     . ALA E 3 212 ? 106.185 -33.397 61.113  1.00 29.29 ? 508  ALA A N     1 
ATOM   2465  C  CA    . ALA E 3 212 ? 104.736 -33.264 60.996  1.00 30.13 ? 508  ALA A CA    1 
ATOM   2466  C  C     . ALA E 3 212 ? 104.184 -32.330 62.076  1.00 31.41 ? 508  ALA A C     1 
ATOM   2467  O  O     . ALA E 3 212 ? 103.233 -31.585 61.838  1.00 30.23 ? 508  ALA A O     1 
ATOM   2468  C  CB    . ALA E 3 212 ? 104.077 -34.634 61.106  1.00 30.69 ? 508  ALA A CB    1 
ATOM   2469  N  N     . GLU E 3 213 ? 104.782 -32.374 63.262  1.00 32.42 ? 509  GLU A N     1 
ATOM   2470  C  CA    . GLU E 3 213 ? 104.341 -31.527 64.366  1.00 34.16 ? 509  GLU A CA    1 
ATOM   2471  C  C     . GLU E 3 213 ? 104.694 -30.067 64.082  1.00 33.09 ? 509  GLU A C     1 
ATOM   2472  O  O     . GLU E 3 213 ? 103.888 -29.164 64.322  1.00 30.99 ? 509  GLU A O     1 
ATOM   2473  C  CB    . GLU E 3 213 ? 104.993 -31.978 65.677  1.00 37.15 ? 509  GLU A CB    1 
ATOM   2474  C  CG    . GLU E 3 213 ? 104.880 -33.476 65.933  1.00 43.10 ? 509  GLU A CG    1 
ATOM   2475  C  CD    . GLU E 3 213 ? 105.368 -33.881 67.313  1.00 46.92 ? 509  GLU A CD    1 
ATOM   2476  O  OE1   . GLU E 3 213 ? 106.408 -33.348 67.760  1.00 49.06 ? 509  GLU A OE1   1 
ATOM   2477  O  OE2   . GLU E 3 213 ? 104.711 -34.739 67.946  1.00 48.63 ? 509  GLU A OE2   1 
ATOM   2478  N  N     . GLN E 3 214 ? 105.901 -29.841 63.571  1.00 31.65 ? 510  GLN A N     1 
ATOM   2479  C  CA    . GLN E 3 214 ? 106.342 -28.489 63.247  1.00 31.84 ? 510  GLN A CA    1 
ATOM   2480  C  C     . GLN E 3 214 ? 105.463 -27.900 62.140  1.00 31.18 ? 510  GLN A C     1 
ATOM   2481  O  O     . GLN E 3 214 ? 105.104 -26.721 62.180  1.00 30.25 ? 510  GLN A O     1 
ATOM   2482  C  CB    . GLN E 3 214 ? 107.813 -28.502 62.815  1.00 34.00 ? 510  GLN A CB    1 
ATOM   2483  C  CG    . GLN E 3 214 ? 108.326 -27.163 62.306  1.00 36.61 ? 510  GLN A CG    1 
ATOM   2484  C  CD    . GLN E 3 214 ? 109.831 -27.153 62.089  1.00 37.81 ? 510  GLN A CD    1 
ATOM   2485  O  OE1   . GLN E 3 214 ? 110.438 -28.190 61.825  1.00 38.86 ? 510  GLN A OE1   1 
ATOM   2486  N  NE2   . GLN E 3 214 ? 110.435 -25.973 62.184  1.00 39.26 ? 510  GLN A NE2   1 
ATOM   2487  N  N     . LEU E 3 215 ? 105.114 -28.725 61.157  1.00 29.78 ? 511  LEU A N     1 
ATOM   2488  C  CA    . LEU E 3 215 ? 104.263 -28.282 60.057  1.00 28.93 ? 511  LEU A CA    1 
ATOM   2489  C  C     . LEU E 3 215 ? 102.916 -27.797 60.582  1.00 28.67 ? 511  LEU A C     1 
ATOM   2490  O  O     . LEU E 3 215 ? 102.447 -26.719 60.214  1.00 27.40 ? 511  LEU A O     1 
ATOM   2491  C  CB    . LEU E 3 215 ? 104.029 -29.423 59.065  1.00 30.46 ? 511  LEU A CB    1 
ATOM   2492  C  CG    . LEU E 3 215 ? 104.999 -29.556 57.894  1.00 31.31 ? 511  LEU A CG    1 
ATOM   2493  C  CD1   . LEU E 3 215 ? 104.687 -30.828 57.120  1.00 32.89 ? 511  LEU A CD1   1 
ATOM   2494  C  CD2   . LEU E 3 215 ? 104.878 -28.333 56.993  1.00 29.52 ? 511  LEU A CD2   1 
ATOM   2495  N  N     . GLY E 3 216 ? 102.297 -28.606 61.437  1.00 26.53 ? 512  GLY A N     1 
ATOM   2496  C  CA    . GLY E 3 216 ? 101.011 -28.240 62.001  1.00 26.69 ? 512  GLY A CA    1 
ATOM   2497  C  C     . GLY E 3 216 ? 101.043 -26.872 62.656  1.00 25.95 ? 512  GLY A C     1 
ATOM   2498  O  O     . GLY E 3 216 ? 100.079 -26.111 62.568  1.00 25.01 ? 512  GLY A O     1 
ATOM   2499  N  N     . THR E 3 217 ? 102.153 -26.557 63.315  1.00 25.95 ? 513  THR A N     1 
ATOM   2500  C  CA    . THR E 3 217 ? 102.306 -25.269 63.987  1.00 27.89 ? 513  THR A CA    1 
ATOM   2501  C  C     . THR E 3 217 ? 102.396 -24.123 62.981  1.00 27.54 ? 513  THR A C     1 
ATOM   2502  O  O     . THR E 3 217 ? 101.678 -23.127 63.096  1.00 28.02 ? 513  THR A O     1 
ATOM   2503  C  CB    . THR E 3 217 ? 103.564 -25.254 64.870  1.00 28.80 ? 513  THR A CB    1 
ATOM   2504  O  OG1   . THR E 3 217 ? 103.443 -26.261 65.882  1.00 31.15 ? 513  THR A OG1   1 
ATOM   2505  C  CG2   . THR E 3 217 ? 103.741 -23.891 65.530  1.00 30.12 ? 513  THR A CG2   1 
ATOM   2506  N  N     . VAL E 3 218 ? 103.281 -24.265 61.998  1.00 27.02 ? 514  VAL A N     1 
ATOM   2507  C  CA    . VAL E 3 218 ? 103.450 -23.244 60.969  1.00 25.31 ? 514  VAL A CA    1 
ATOM   2508  C  C     . VAL E 3 218 ? 102.137 -23.075 60.207  1.00 25.12 ? 514  VAL A C     1 
ATOM   2509  O  O     . VAL E 3 218 ? 101.736 -21.959 59.873  1.00 24.40 ? 514  VAL A O     1 
ATOM   2510  C  CB    . VAL E 3 218 ? 104.562 -23.639 59.972  1.00 26.17 ? 514  VAL A CB    1 
ATOM   2511  C  CG1   . VAL E 3 218 ? 104.691 -22.585 58.887  1.00 24.07 ? 514  VAL A CG1   1 
ATOM   2512  C  CG2   . VAL E 3 218 ? 105.882 -23.800 60.711  1.00 26.31 ? 514  VAL A CG2   1 
ATOM   2513  N  N     . GLU E 3 219 ? 101.472 -24.197 59.941  1.00 24.78 ? 515  GLU A N     1 
ATOM   2514  C  CA    . GLU E 3 219 ? 100.204 -24.191 59.225  1.00 24.84 ? 515  GLU A CA    1 
ATOM   2515  C  C     . GLU E 3 219 ? 99.159  -23.335 59.939  1.00 25.46 ? 515  GLU A C     1 
ATOM   2516  O  O     . GLU E 3 219 ? 98.553  -22.443 59.340  1.00 23.17 ? 515  GLU A O     1 
ATOM   2517  C  CB    . GLU E 3 219 ? 99.673  -25.618 59.079  1.00 26.19 ? 515  GLU A CB    1 
ATOM   2518  C  CG    . GLU E 3 219 ? 98.354  -25.699 58.333  1.00 27.77 ? 515  GLU A CG    1 
ATOM   2519  C  CD    . GLU E 3 219 ? 97.722  -27.079 58.384  1.00 28.05 ? 515  GLU A CD    1 
ATOM   2520  O  OE1   . GLU E 3 219 ? 96.696  -27.285 57.706  1.00 28.37 ? 515  GLU A OE1   1 
ATOM   2521  O  OE2   . GLU E 3 219 ? 98.246  -27.954 59.101  1.00 28.66 ? 515  GLU A OE2   1 
ATOM   2522  N  N     . GLN E 3 220 ? 98.948  -23.612 61.222  1.00 25.92 ? 516  GLN A N     1 
ATOM   2523  C  CA    . GLN E 3 220 ? 97.968  -22.865 62.001  1.00 26.63 ? 516  GLN A CA    1 
ATOM   2524  C  C     . GLN E 3 220 ? 98.344  -21.395 62.092  1.00 25.38 ? 516  GLN A C     1 
ATOM   2525  O  O     . GLN E 3 220 ? 97.481  -20.518 62.042  1.00 25.37 ? 516  GLN A O     1 
ATOM   2526  C  CB    . GLN E 3 220 ? 97.839  -23.463 63.403  1.00 28.99 ? 516  GLN A CB    1 
ATOM   2527  C  CG    . GLN E 3 220 ? 97.194  -24.836 63.418  1.00 31.20 ? 516  GLN A CG    1 
ATOM   2528  C  CD    . GLN E 3 220 ? 95.833  -24.842 62.742  1.00 33.56 ? 516  GLN A CD    1 
ATOM   2529  O  OE1   . GLN E 3 220 ? 94.972  -24.015 63.047  1.00 34.96 ? 516  GLN A OE1   1 
ATOM   2530  N  NE2   . GLN E 3 220 ? 95.630  -25.778 61.820  1.00 34.71 ? 516  GLN A NE2   1 
ATOM   2531  N  N     . ARG E 3 221 ? 99.637  -21.130 62.224  1.00 25.98 ? 517  ARG A N     1 
ATOM   2532  C  CA    . ARG E 3 221 ? 100.120 -19.759 62.309  1.00 25.75 ? 517  ARG A CA    1 
ATOM   2533  C  C     . ARG E 3 221 ? 99.739  -18.997 61.042  1.00 24.90 ? 517  ARG A C     1 
ATOM   2534  O  O     . ARG E 3 221 ? 99.300  -17.848 61.103  1.00 23.78 ? 517  ARG A O     1 
ATOM   2535  C  CB    . ARG E 3 221 ? 101.638 -19.748 62.495  1.00 28.56 ? 517  ARG A CB    1 
ATOM   2536  C  CG    . ARG E 3 221 ? 102.255 -18.360 62.524  1.00 31.01 ? 517  ARG A CG    1 
ATOM   2537  C  CD    . ARG E 3 221 ? 101.604 -17.477 63.577  1.00 33.32 ? 517  ARG A CD    1 
ATOM   2538  N  NE    . ARG E 3 221 ? 102.147 -16.122 63.542  1.00 37.66 ? 517  ARG A NE    1 
ATOM   2539  C  CZ    . ARG E 3 221 ? 101.599 -15.079 64.155  1.00 37.79 ? 517  ARG A CZ    1 
ATOM   2540  N  NH1   . ARG E 3 221 ? 100.484 -15.230 64.860  1.00 37.63 ? 517  ARG A NH1   1 
ATOM   2541  N  NH2   . ARG E 3 221 ? 102.164 -13.883 64.058  1.00 37.64 ? 517  ARG A NH2   1 
ATOM   2542  N  N     . ILE E 3 222 ? 99.901  -19.645 59.893  1.00 22.94 ? 518  ILE A N     1 
ATOM   2543  C  CA    . ILE E 3 222 ? 99.564  -19.022 58.621  1.00 21.49 ? 518  ILE A CA    1 
ATOM   2544  C  C     . ILE E 3 222 ? 98.074  -18.678 58.539  1.00 22.65 ? 518  ILE A C     1 
ATOM   2545  O  O     . ILE E 3 222 ? 97.713  -17.584 58.103  1.00 22.09 ? 518  ILE A O     1 
ATOM   2546  C  CB    . ILE E 3 222 ? 99.975  -19.936 57.436  1.00 21.39 ? 518  ILE A CB    1 
ATOM   2547  C  CG1   . ILE E 3 222 ? 101.508 -20.024 57.378  1.00 20.33 ? 518  ILE A CG1   1 
ATOM   2548  C  CG2   . ILE E 3 222 ? 99.419  -19.391 56.117  1.00 17.90 ? 518  ILE A CG2   1 
ATOM   2549  C  CD1   . ILE E 3 222 ? 102.051 -21.026 56.362  1.00 19.38 ? 518  ILE A CD1   1 
ATOM   2550  N  N     . TYR E 3 223 ? 97.208  -19.596 58.960  1.00 23.06 ? 519  TYR A N     1 
ATOM   2551  C  CA    . TYR E 3 223 ? 95.771  -19.331 58.922  1.00 24.24 ? 519  TYR A CA    1 
ATOM   2552  C  C     . TYR E 3 223 ? 95.437  -18.164 59.842  1.00 25.82 ? 519  TYR A C     1 
ATOM   2553  O  O     . TYR E 3 223 ? 94.573  -17.343 59.536  1.00 26.44 ? 519  TYR A O     1 
ATOM   2554  C  CB    . TYR E 3 223 ? 94.970  -20.558 59.363  1.00 23.71 ? 519  TYR A CB    1 
ATOM   2555  C  CG    . TYR E 3 223 ? 95.213  -21.798 58.534  1.00 24.66 ? 519  TYR A CG    1 
ATOM   2556  C  CD1   . TYR E 3 223 ? 95.436  -21.713 57.158  1.00 23.09 ? 519  TYR A CD1   1 
ATOM   2557  C  CD2   . TYR E 3 223 ? 95.211  -23.061 59.126  1.00 24.31 ? 519  TYR A CD2   1 
ATOM   2558  C  CE1   . TYR E 3 223 ? 95.654  -22.858 56.392  1.00 24.69 ? 519  TYR A CE1   1 
ATOM   2559  C  CE2   . TYR E 3 223 ? 95.425  -24.210 58.370  1.00 25.64 ? 519  TYR A CE2   1 
ATOM   2560  C  CZ    . TYR E 3 223 ? 95.647  -24.102 57.005  1.00 24.95 ? 519  TYR A CZ    1 
ATOM   2561  O  OH    . TYR E 3 223 ? 95.866  -25.237 56.260  1.00 26.56 ? 519  TYR A OH    1 
ATOM   2562  N  N     . GLU E 3 224 ? 96.129  -18.101 60.973  1.00 26.97 ? 520  GLU A N     1 
ATOM   2563  C  CA    . GLU E 3 224 ? 95.922  -17.040 61.949  1.00 29.33 ? 520  GLU A CA    1 
ATOM   2564  C  C     . GLU E 3 224 ? 96.264  -15.699 61.302  1.00 28.50 ? 520  GLU A C     1 
ATOM   2565  O  O     . GLU E 3 224 ? 95.483  -14.748 61.356  1.00 27.83 ? 520  GLU A O     1 
ATOM   2566  C  CB    . GLU E 3 224 ? 96.820  -17.282 63.164  1.00 32.40 ? 520  GLU A CB    1 
ATOM   2567  C  CG    . GLU E 3 224 ? 96.560  -16.366 64.342  1.00 38.94 ? 520  GLU A CG    1 
ATOM   2568  C  CD    . GLU E 3 224 ? 97.567  -16.573 65.456  1.00 42.47 ? 520  GLU A CD    1 
ATOM   2569  O  OE1   . GLU E 3 224 ? 97.751  -17.734 65.885  1.00 44.47 ? 520  GLU A OE1   1 
ATOM   2570  O  OE2   . GLU E 3 224 ? 98.174  -15.576 65.903  1.00 45.66 ? 520  GLU A OE2   1 
ATOM   2571  N  N     . LEU E 3 225 ? 97.438  -15.636 60.685  1.00 27.13 ? 521  LEU A N     1 
ATOM   2572  C  CA    . LEU E 3 225 ? 97.890  -14.423 60.015  1.00 27.82 ? 521  LEU A CA    1 
ATOM   2573  C  C     . LEU E 3 225 ? 96.992  -14.055 58.837  1.00 27.86 ? 521  LEU A C     1 
ATOM   2574  O  O     . LEU E 3 225 ? 96.806  -12.874 58.537  1.00 28.08 ? 521  LEU A O     1 
ATOM   2575  C  CB    . LEU E 3 225 ? 99.327  -14.599 59.524  1.00 27.21 ? 521  LEU A CB    1 
ATOM   2576  C  CG    . LEU E 3 225 ? 100.406 -14.657 60.604  1.00 27.82 ? 521  LEU A CG    1 
ATOM   2577  C  CD1   . LEU E 3 225 ? 101.749 -14.993 59.976  1.00 28.81 ? 521  LEU A CD1   1 
ATOM   2578  C  CD2   . LEU E 3 225 ? 100.471 -13.315 61.325  1.00 29.27 ? 521  LEU A CD2   1 
ATOM   2579  N  N     . ALA E 3 226 ? 96.439  -15.065 58.173  1.00 25.66 ? 522  ALA A N     1 
ATOM   2580  C  CA    . ALA E 3 226 ? 95.568  -14.833 57.027  1.00 26.60 ? 522  ALA A CA    1 
ATOM   2581  C  C     . ALA E 3 226 ? 94.134  -14.564 57.454  1.00 28.09 ? 522  ALA A C     1 
ATOM   2582  O  O     . ALA E 3 226 ? 93.329  -14.069 56.663  1.00 28.03 ? 522  ALA A O     1 
ATOM   2583  C  CB    . ALA E 3 226 ? 95.609  -16.033 56.091  1.00 27.86 ? 522  ALA A CB    1 
ATOM   2584  N  N     . GLY E 3 227 ? 93.822  -14.893 58.706  1.00 27.89 ? 523  GLY A N     1 
ATOM   2585  C  CA    . GLY E 3 227 ? 92.478  -14.699 59.217  1.00 27.81 ? 523  GLY A CA    1 
ATOM   2586  C  C     . GLY E 3 227 ? 91.521  -15.658 58.543  1.00 28.21 ? 523  GLY A C     1 
ATOM   2587  O  O     . GLY E 3 227 ? 90.303  -15.507 58.632  1.00 27.68 ? 523  GLY A O     1 
ATOM   2588  N  N     . GLN E 3 228 ? 92.078  -16.666 57.878  1.00 28.58 ? 524  GLN A N     1 
ATOM   2589  C  CA    . GLN E 3 228 ? 91.275  -17.645 57.158  1.00 28.40 ? 524  GLN A CA    1 
ATOM   2590  C  C     . GLN E 3 228 ? 92.035  -18.952 56.957  1.00 28.53 ? 524  GLN A C     1 
ATOM   2591  O  O     . GLN E 3 228 ? 93.263  -18.978 56.940  1.00 28.11 ? 524  GLN A O     1 
ATOM   2592  C  CB    . GLN E 3 228 ? 90.885  -17.075 55.793  1.00 30.34 ? 524  GLN A CB    1 
ATOM   2593  C  CG    . GLN E 3 228 ? 90.055  -17.997 54.921  1.00 31.69 ? 524  GLN A CG    1 
ATOM   2594  C  CD    . GLN E 3 228 ? 89.918  -17.474 53.504  1.00 33.69 ? 524  GLN A CD    1 
ATOM   2595  O  OE1   . GLN E 3 228 ? 89.614  -16.299 53.287  1.00 34.04 ? 524  GLN A OE1   1 
ATOM   2596  N  NE2   . GLN E 3 228 ? 90.140  -18.348 52.528  1.00 34.63 ? 524  GLN A NE2   1 
ATOM   2597  N  N     . GLU E 3 229 ? 91.290  -20.037 56.803  1.00 28.36 ? 525  GLU A N     1 
ATOM   2598  C  CA    . GLU E 3 229 ? 91.890  -21.340 56.575  1.00 28.08 ? 525  GLU A CA    1 
ATOM   2599  C  C     . GLU E 3 229 ? 91.836  -21.567 55.063  1.00 26.49 ? 525  GLU A C     1 
ATOM   2600  O  O     . GLU E 3 229 ? 90.823  -21.278 54.423  1.00 26.59 ? 525  GLU A O     1 
ATOM   2601  C  CB    . GLU E 3 229 ? 91.085  -22.411 57.312  1.00 30.14 ? 525  GLU A CB    1 
ATOM   2602  C  CG    . GLU E 3 229 ? 91.897  -23.592 57.785  1.00 33.88 ? 525  GLU A CG    1 
ATOM   2603  C  CD    . GLU E 3 229 ? 91.111  -24.499 58.711  1.00 35.26 ? 525  GLU A CD    1 
ATOM   2604  O  OE1   . GLU E 3 229 ? 90.157  -25.155 58.239  1.00 36.24 ? 525  GLU A OE1   1 
ATOM   2605  O  OE2   . GLU E 3 229 ? 91.447  -24.551 59.913  1.00 36.49 ? 525  GLU A OE2   1 
ATOM   2606  N  N     . PHE E 3 230 ? 92.926  -22.065 54.488  1.00 23.56 ? 526  PHE A N     1 
ATOM   2607  C  CA    . PHE E 3 230 ? 92.971  -22.326 53.051  1.00 21.17 ? 526  PHE A CA    1 
ATOM   2608  C  C     . PHE E 3 230 ? 94.073  -23.332 52.741  1.00 20.64 ? 526  PHE A C     1 
ATOM   2609  O  O     . PHE E 3 230 ? 94.875  -23.671 53.613  1.00 20.35 ? 526  PHE A O     1 
ATOM   2610  C  CB    . PHE E 3 230 ? 93.210  -21.028 52.259  1.00 20.22 ? 526  PHE A CB    1 
ATOM   2611  C  CG    . PHE E 3 230 ? 94.559  -20.406 52.491  1.00 20.14 ? 526  PHE A CG    1 
ATOM   2612  C  CD1   . PHE E 3 230 ? 94.834  -19.722 53.671  1.00 20.90 ? 526  PHE A CD1   1 
ATOM   2613  C  CD2   . PHE E 3 230 ? 95.565  -20.524 51.536  1.00 19.88 ? 526  PHE A CD2   1 
ATOM   2614  C  CE1   . PHE E 3 230 ? 96.092  -19.167 53.897  1.00 19.40 ? 526  PHE A CE1   1 
ATOM   2615  C  CE2   . PHE E 3 230 ? 96.829  -19.972 51.754  1.00 20.04 ? 526  PHE A CE2   1 
ATOM   2616  C  CZ    . PHE E 3 230 ? 97.092  -19.293 52.936  1.00 20.33 ? 526  PHE A CZ    1 
ATOM   2617  N  N     . ASN E 3 231 ? 94.108  -23.811 51.502  1.00 19.92 ? 527  ASN A N     1 
ATOM   2618  C  CA    . ASN E 3 231 ? 95.125  -24.777 51.105  1.00 19.54 ? 527  ASN A CA    1 
ATOM   2619  C  C     . ASN E 3 231 ? 96.395  -24.033 50.704  1.00 18.53 ? 527  ASN A C     1 
ATOM   2620  O  O     . ASN E 3 231 ? 96.487  -23.489 49.602  1.00 18.15 ? 527  ASN A O     1 
ATOM   2621  C  CB    . ASN E 3 231 ? 94.638  -25.623 49.932  1.00 19.72 ? 527  ASN A CB    1 
ATOM   2622  C  CG    . ASN E 3 231 ? 95.543  -26.804 49.662  1.00 21.91 ? 527  ASN A CG    1 
ATOM   2623  O  OD1   . ASN E 3 231 ? 96.769  -26.679 49.701  1.00 20.33 ? 527  ASN A OD1   1 
ATOM   2624  N  ND2   . ASN E 3 231 ? 94.947  -27.960 49.385  1.00 19.39 ? 527  ASN A ND2   1 
ATOM   2625  N  N     . ILE E 3 232 ? 97.368  -24.022 51.608  1.00 17.21 ? 528  ILE A N     1 
ATOM   2626  C  CA    . ILE E 3 232 ? 98.639  -23.342 51.389  1.00 16.30 ? 528  ILE A CA    1 
ATOM   2627  C  C     . ILE E 3 232 ? 99.392  -23.909 50.190  1.00 18.68 ? 528  ILE A C     1 
ATOM   2628  O  O     . ILE E 3 232 ? 100.115 -23.184 49.497  1.00 17.39 ? 528  ILE A O     1 
ATOM   2629  C  CB    . ILE E 3 232 ? 99.528  -23.446 52.645  1.00 17.25 ? 528  ILE A CB    1 
ATOM   2630  C  CG1   . ILE E 3 232 ? 98.749  -22.947 53.866  1.00 16.33 ? 528  ILE A CG1   1 
ATOM   2631  C  CG2   . ILE E 3 232 ? 100.801 -22.627 52.461  1.00 16.95 ? 528  ILE A CG2   1 
ATOM   2632  C  CD1   . ILE E 3 232 ? 99.431  -23.228 55.193  1.00 17.30 ? 528  ILE A CD1   1 
ATOM   2633  N  N     . ASN E 3 233 ? 99.212  -25.204 49.942  1.00 17.11 ? 529  ASN A N     1 
ATOM   2634  C  CA    . ASN E 3 233 ? 99.876  -25.862 48.826  1.00 18.40 ? 529  ASN A CA    1 
ATOM   2635  C  C     . ASN E 3 233 ? 99.182  -25.641 47.490  1.00 17.80 ? 529  ASN A C     1 
ATOM   2636  O  O     . ASN E 3 233 ? 99.497  -26.297 46.501  1.00 18.25 ? 529  ASN A O     1 
ATOM   2637  C  CB    . ASN E 3 233 ? 100.013 -27.357 49.111  1.00 19.47 ? 529  ASN A CB    1 
ATOM   2638  C  CG    . ASN E 3 233 ? 101.061 -27.640 50.163  1.00 20.81 ? 529  ASN A CG    1 
ATOM   2639  O  OD1   . ASN E 3 233 ? 102.176 -27.130 50.080  1.00 22.68 ? 529  ASN A OD1   1 
ATOM   2640  N  ND2   . ASN E 3 233 ? 100.716 -28.455 51.156  1.00 23.62 ? 529  ASN A ND2   1 
ATOM   2641  N  N     . SER E 3 234 ? 98.234  -24.711 47.468  1.00 17.65 ? 530  SER A N     1 
ATOM   2642  C  CA    . SER E 3 234 ? 97.506  -24.390 46.252  1.00 18.03 ? 530  SER A CA    1 
ATOM   2643  C  C     . SER E 3 234 ? 97.846  -22.971 45.816  1.00 19.58 ? 530  SER A C     1 
ATOM   2644  O  O     . SER E 3 234 ? 97.312  -22.006 46.361  1.00 18.87 ? 530  SER A O     1 
ATOM   2645  C  CB    . SER E 3 234 ? 95.998  -24.493 46.487  1.00 18.36 ? 530  SER A CB    1 
ATOM   2646  O  OG    . SER E 3 234 ? 95.284  -23.983 45.373  1.00 19.82 ? 530  SER A OG    1 
ATOM   2647  N  N     . PRO E 3 235 ? 98.742  -22.822 44.827  1.00 21.41 ? 531  PRO A N     1 
ATOM   2648  C  CA    . PRO E 3 235 ? 99.105  -21.477 44.367  1.00 21.69 ? 531  PRO A CA    1 
ATOM   2649  C  C     . PRO E 3 235 ? 97.880  -20.624 44.042  1.00 22.30 ? 531  PRO A C     1 
ATOM   2650  O  O     . PRO E 3 235 ? 97.875  -19.415 44.270  1.00 21.31 ? 531  PRO A O     1 
ATOM   2651  C  CB    . PRO E 3 235 ? 99.990  -21.752 43.156  1.00 22.01 ? 531  PRO A CB    1 
ATOM   2652  C  CG    . PRO E 3 235 ? 100.696 -23.023 43.561  1.00 21.00 ? 531  PRO A CG    1 
ATOM   2653  C  CD    . PRO E 3 235 ? 99.559  -23.848 44.152  1.00 21.01 ? 531  PRO A CD    1 
ATOM   2654  N  N     . LYS E 3 236 ? 96.839  -21.262 43.518  1.00 21.70 ? 532  LYS A N     1 
ATOM   2655  C  CA    . LYS E 3 236 ? 95.612  -20.555 43.169  1.00 23.10 ? 532  LYS A CA    1 
ATOM   2656  C  C     . LYS E 3 236 ? 94.943  -19.975 44.413  1.00 22.84 ? 532  LYS A C     1 
ATOM   2657  O  O     . LYS E 3 236 ? 94.628  -18.784 44.464  1.00 22.35 ? 532  LYS A O     1 
ATOM   2658  C  CB    . LYS E 3 236 ? 94.644  -21.501 42.455  1.00 24.88 ? 532  LYS A CB    1 
ATOM   2659  C  CG    . LYS E 3 236 ? 93.360  -20.840 41.979  1.00 27.65 ? 532  LYS A CG    1 
ATOM   2660  C  CD    . LYS E 3 236 ? 92.501  -21.826 41.201  1.00 32.24 ? 532  LYS A CD    1 
ATOM   2661  C  CE    . LYS E 3 236 ? 91.220  -21.177 40.696  1.00 34.58 ? 532  LYS A CE    1 
ATOM   2662  N  NZ    . LYS E 3 236 ? 90.369  -22.155 39.957  1.00 36.33 ? 532  LYS A NZ    1 
ATOM   2663  N  N     . GLN E 3 237 ? 94.720  -20.819 45.415  1.00 21.32 ? 533  GLN A N     1 
ATOM   2664  C  CA    . GLN E 3 237 ? 94.102  -20.363 46.652  1.00 19.71 ? 533  GLN A CA    1 
ATOM   2665  C  C     . GLN E 3 237 ? 95.005  -19.350 47.347  1.00 19.67 ? 533  GLN A C     1 
ATOM   2666  O  O     . GLN E 3 237 ? 94.540  -18.320 47.834  1.00 20.67 ? 533  GLN A O     1 
ATOM   2667  C  CB    . GLN E 3 237 ? 93.827  -21.552 47.580  1.00 20.99 ? 533  GLN A CB    1 
ATOM   2668  C  CG    . GLN E 3 237 ? 92.668  -22.429 47.117  1.00 20.93 ? 533  GLN A CG    1 
ATOM   2669  C  CD    . GLN E 3 237 ? 92.299  -23.494 48.131  1.00 21.98 ? 533  GLN A CD    1 
ATOM   2670  O  OE1   . GLN E 3 237 ? 92.159  -23.207 49.316  1.00 21.73 ? 533  GLN A OE1   1 
ATOM   2671  N  NE2   . GLN E 3 237 ? 92.129  -24.727 47.666  1.00 22.09 ? 533  GLN A NE2   1 
ATOM   2672  N  N     . LEU E 3 238 ? 96.301  -19.642 47.386  1.00 18.50 ? 534  LEU A N     1 
ATOM   2673  C  CA    . LEU E 3 238 ? 97.259  -18.747 48.021  1.00 18.60 ? 534  LEU A CA    1 
ATOM   2674  C  C     . LEU E 3 238 ? 97.228  -17.370 47.359  1.00 18.06 ? 534  LEU A C     1 
ATOM   2675  O  O     . LEU E 3 238 ? 97.332  -16.353 48.036  1.00 19.35 ? 534  LEU A O     1 
ATOM   2676  C  CB    . LEU E 3 238 ? 98.678  -19.334 47.940  1.00 16.65 ? 534  LEU A CB    1 
ATOM   2677  C  CG    . LEU E 3 238 ? 99.804  -18.426 48.447  1.00 16.95 ? 534  LEU A CG    1 
ATOM   2678  C  CD1   . LEU E 3 238 ? 99.578  -18.102 49.913  1.00 17.17 ? 534  LEU A CD1   1 
ATOM   2679  C  CD2   . LEU E 3 238 ? 101.155 -19.111 48.250  1.00 15.81 ? 534  LEU A CD2   1 
ATOM   2680  N  N     . GLY E 3 239 ? 97.080  -17.348 46.037  1.00 18.82 ? 535  GLY A N     1 
ATOM   2681  C  CA    . GLY E 3 239 ? 97.037  -16.090 45.310  1.00 19.43 ? 535  GLY A CA    1 
ATOM   2682  C  C     . GLY E 3 239 ? 95.852  -15.233 45.711  1.00 20.20 ? 535  GLY A C     1 
ATOM   2683  O  O     . GLY E 3 239 ? 95.971  -14.016 45.859  1.00 19.99 ? 535  GLY A O     1 
ATOM   2684  N  N     . VAL E 3 240 ? 94.698  -15.867 45.885  1.00 20.02 ? 536  VAL A N     1 
ATOM   2685  C  CA    . VAL E 3 240 ? 93.502  -15.142 46.289  1.00 20.68 ? 536  VAL A CA    1 
ATOM   2686  C  C     . VAL E 3 240 ? 93.761  -14.520 47.656  1.00 20.90 ? 536  VAL A C     1 
ATOM   2687  O  O     . VAL E 3 240 ? 93.447  -13.354 47.892  1.00 21.24 ? 536  VAL A O     1 
ATOM   2688  C  CB    . VAL E 3 240 ? 92.282  -16.086 46.372  1.00 21.88 ? 536  VAL A CB    1 
ATOM   2689  C  CG1   . VAL E 3 240 ? 91.072  -15.338 46.907  1.00 23.11 ? 536  VAL A CG1   1 
ATOM   2690  C  CG2   . VAL E 3 240 ? 91.981  -16.655 44.993  1.00 22.37 ? 536  VAL A CG2   1 
ATOM   2691  N  N     . ILE E 3 241 ? 94.357  -15.299 48.553  1.00 20.17 ? 537  ILE A N     1 
ATOM   2692  C  CA    . ILE E 3 241 ? 94.657  -14.812 49.892  1.00 19.34 ? 537  ILE A CA    1 
ATOM   2693  C  C     . ILE E 3 241 ? 95.611  -13.619 49.863  1.00 19.86 ? 537  ILE A C     1 
ATOM   2694  O  O     . ILE E 3 241 ? 95.333  -12.568 50.444  1.00 19.47 ? 537  ILE A O     1 
ATOM   2695  C  CB    . ILE E 3 241 ? 95.308  -15.918 50.763  1.00 20.25 ? 537  ILE A CB    1 
ATOM   2696  C  CG1   . ILE E 3 241 ? 94.290  -17.023 51.061  1.00 20.54 ? 537  ILE A CG1   1 
ATOM   2697  C  CG2   . ILE E 3 241 ? 95.849  -15.316 52.054  1.00 19.40 ? 537  ILE A CG2   1 
ATOM   2698  C  CD1   . ILE E 3 241 ? 93.104  -16.569 51.900  1.00 21.51 ? 537  ILE A CD1   1 
ATOM   2699  N  N     . LEU E 3 242 ? 96.736  -13.788 49.179  1.00 18.03 ? 538  LEU A N     1 
ATOM   2700  C  CA    . LEU E 3 242 ? 97.742  -12.740 49.112  1.00 18.18 ? 538  LEU A CA    1 
ATOM   2701  C  C     . LEU E 3 242 ? 97.364  -11.495 48.324  1.00 19.13 ? 538  LEU A C     1 
ATOM   2702  O  O     . LEU E 3 242 ? 97.476  -10.377 48.828  1.00 19.30 ? 538  LEU A O     1 
ATOM   2703  C  CB    . LEU E 3 242 ? 99.042  -13.301 48.534  1.00 17.48 ? 538  LEU A CB    1 
ATOM   2704  C  CG    . LEU E 3 242 ? 99.747  -14.404 49.327  1.00 16.09 ? 538  LEU A CG    1 
ATOM   2705  C  CD1   . LEU E 3 242 ? 101.003 -14.815 48.587  1.00 15.57 ? 538  LEU A CD1   1 
ATOM   2706  C  CD2   . LEU E 3 242 ? 100.084 -13.912 50.728  1.00 16.50 ? 538  LEU A CD2   1 
ATOM   2707  N  N     . PHE E 3 243 ? 96.901  -11.692 47.096  1.00 18.84 ? 539  PHE A N     1 
ATOM   2708  C  CA    . PHE E 3 243 ? 96.588  -10.575 46.216  1.00 20.25 ? 539  PHE A CA    1 
ATOM   2709  C  C     . PHE E 3 243 ? 95.165  -10.056 46.176  1.00 22.68 ? 539  PHE A C     1 
ATOM   2710  O  O     . PHE E 3 243 ? 94.906  -9.002  45.593  1.00 23.60 ? 539  PHE A O     1 
ATOM   2711  C  CB    . PHE E 3 243 ? 97.069  -10.939 44.819  1.00 19.85 ? 539  PHE A CB    1 
ATOM   2712  C  CG    . PHE E 3 243 ? 98.455  -11.503 44.816  1.00 19.39 ? 539  PHE A CG    1 
ATOM   2713  C  CD1   . PHE E 3 243 ? 99.525  -10.734 45.265  1.00 18.24 ? 539  PHE A CD1   1 
ATOM   2714  C  CD2   . PHE E 3 243 ? 98.684  -12.824 44.452  1.00 18.11 ? 539  PHE A CD2   1 
ATOM   2715  C  CE1   . PHE E 3 243 ? 100.801 -11.273 45.354  1.00 20.42 ? 539  PHE A CE1   1 
ATOM   2716  C  CE2   . PHE E 3 243 ? 99.957  -13.376 44.536  1.00 19.50 ? 539  PHE A CE2   1 
ATOM   2717  C  CZ    . PHE E 3 243 ? 101.021 -12.600 44.990  1.00 20.27 ? 539  PHE A CZ    1 
ATOM   2718  N  N     . GLU E 3 244 ? 94.236  -10.775 46.790  1.00 22.69 ? 540  GLU A N     1 
ATOM   2719  C  CA    . GLU E 3 244 ? 92.864  -10.300 46.795  1.00 25.05 ? 540  GLU A CA    1 
ATOM   2720  C  C     . GLU E 3 244 ? 92.404  -9.978  48.207  1.00 25.56 ? 540  GLU A C     1 
ATOM   2721  O  O     . GLU E 3 244 ? 91.847  -8.908  48.445  1.00 27.26 ? 540  GLU A O     1 
ATOM   2722  C  CB    . GLU E 3 244 ? 91.950  -11.319 46.111  1.00 25.29 ? 540  GLU A CB    1 
ATOM   2723  C  CG    . GLU E 3 244 ? 92.297  -11.474 44.633  1.00 26.57 ? 540  GLU A CG    1 
ATOM   2724  C  CD    . GLU E 3 244 ? 91.373  -12.406 43.884  1.00 28.16 ? 540  GLU A CD    1 
ATOM   2725  O  OE1   . GLU E 3 244 ? 91.647  -12.667 42.693  1.00 29.31 ? 540  GLU A OE1   1 
ATOM   2726  O  OE2   . GLU E 3 244 ? 90.380  -12.874 44.475  1.00 29.32 ? 540  GLU A OE2   1 
ATOM   2727  N  N     . LYS E 3 245 ? 92.660  -10.882 49.148  1.00 24.67 ? 541  LYS A N     1 
ATOM   2728  C  CA    . LYS E 3 245 ? 92.268  -10.651 50.535  1.00 23.70 ? 541  LYS A CA    1 
ATOM   2729  C  C     . LYS E 3 245 ? 93.227  -9.693  51.248  1.00 23.78 ? 541  LYS A C     1 
ATOM   2730  O  O     . LYS E 3 245 ? 92.795  -8.702  51.842  1.00 23.12 ? 541  LYS A O     1 
ATOM   2731  C  CB    . LYS E 3 245 ? 92.214  -11.973 51.307  1.00 25.59 ? 541  LYS A CB    1 
ATOM   2732  C  CG    . LYS E 3 245 ? 91.712  -11.824 52.741  1.00 27.74 ? 541  LYS A CG    1 
ATOM   2733  C  CD    . LYS E 3 245 ? 91.672  -13.165 53.460  1.00 31.13 ? 541  LYS A CD    1 
ATOM   2734  C  CE    . LYS E 3 245 ? 90.931  -13.064 54.792  1.00 33.52 ? 541  LYS A CE    1 
ATOM   2735  N  NZ    . LYS E 3 245 ? 91.555  -12.076 55.718  1.00 34.39 ? 541  LYS A NZ    1 
ATOM   2736  N  N     . LEU E 3 246 ? 94.524  -9.988  51.185  1.00 21.17 ? 542  LEU A N     1 
ATOM   2737  C  CA    . LEU E 3 246 ? 95.524  -9.156  51.848  1.00 22.86 ? 542  LEU A CA    1 
ATOM   2738  C  C     . LEU E 3 246 ? 95.946  -7.928  51.037  1.00 23.03 ? 542  LEU A C     1 
ATOM   2739  O  O     . LEU E 3 246 ? 96.635  -7.047  51.551  1.00 25.14 ? 542  LEU A O     1 
ATOM   2740  C  CB    . LEU E 3 246 ? 96.747  -10.003 52.220  1.00 22.01 ? 542  LEU A CB    1 
ATOM   2741  C  CG    . LEU E 3 246 ? 96.461  -11.169 53.172  1.00 21.11 ? 542  LEU A CG    1 
ATOM   2742  C  CD1   . LEU E 3 246 ? 97.754  -11.898 53.513  1.00 20.44 ? 542  LEU A CD1   1 
ATOM   2743  C  CD2   . LEU E 3 246 ? 95.800  -10.644 54.440  1.00 21.41 ? 542  LEU A CD2   1 
ATOM   2744  N  N     . GLN E 3 247 ? 95.536  -7.874  49.774  1.00 23.96 ? 543  GLN A N     1 
ATOM   2745  C  CA    . GLN E 3 247 ? 95.833  -6.734  48.907  1.00 25.40 ? 543  GLN A CA    1 
ATOM   2746  C  C     . GLN E 3 247 ? 97.315  -6.475  48.647  1.00 25.24 ? 543  GLN A C     1 
ATOM   2747  O  O     . GLN E 3 247 ? 97.718  -5.326  48.439  1.00 24.49 ? 543  GLN A O     1 
ATOM   2748  C  CB    . GLN E 3 247 ? 95.218  -5.465  49.501  1.00 28.03 ? 543  GLN A CB    1 
ATOM   2749  C  CG    . GLN E 3 247 ? 93.757  -5.595  49.878  1.00 33.58 ? 543  GLN A CG    1 
ATOM   2750  C  CD    . GLN E 3 247 ? 92.823  -5.192  48.760  1.00 36.77 ? 543  GLN A CD    1 
ATOM   2751  O  OE1   . GLN E 3 247 ? 92.854  -5.759  47.667  1.00 40.55 ? 543  GLN A OE1   1 
ATOM   2752  N  NE2   . GLN E 3 247 ? 91.977  -4.203  49.031  1.00 37.94 ? 543  GLN A NE2   1 
ATOM   2753  N  N     . LEU E 3 248 ? 98.130  -7.523  48.659  1.00 23.78 ? 544  LEU A N     1 
ATOM   2754  C  CA    . LEU E 3 248 ? 99.551  -7.347  48.401  1.00 22.76 ? 544  LEU A CA    1 
ATOM   2755  C  C     . LEU E 3 248 ? 99.734  -7.044  46.919  1.00 23.82 ? 544  LEU A C     1 
ATOM   2756  O  O     . LEU E 3 248 ? 98.955  -7.503  46.083  1.00 22.32 ? 544  LEU A O     1 
ATOM   2757  C  CB    . LEU E 3 248 ? 100.324 -8.610  48.791  1.00 23.89 ? 544  LEU A CB    1 
ATOM   2758  C  CG    . LEU E 3 248 ? 100.645 -8.770  50.283  1.00 25.97 ? 544  LEU A CG    1 
ATOM   2759  C  CD1   . LEU E 3 248 ? 99.404  -8.571  51.111  1.00 28.85 ? 544  LEU A CD1   1 
ATOM   2760  C  CD2   . LEU E 3 248 ? 101.241 -10.140 50.537  1.00 26.10 ? 544  LEU A CD2   1 
ATOM   2761  N  N     . PRO E 3 249 ? 100.764 -6.258  46.568  1.00 23.49 ? 545  PRO A N     1 
ATOM   2762  C  CA    . PRO E 3 249 ? 100.957 -5.953  45.147  1.00 23.23 ? 545  PRO A CA    1 
ATOM   2763  C  C     . PRO E 3 249 ? 101.308 -7.175  44.296  1.00 22.84 ? 545  PRO A C     1 
ATOM   2764  O  O     . PRO E 3 249 ? 101.999 -8.088  44.748  1.00 21.75 ? 545  PRO A O     1 
ATOM   2765  C  CB    . PRO E 3 249 ? 102.056 -4.892  45.162  1.00 24.48 ? 545  PRO A CB    1 
ATOM   2766  C  CG    . PRO E 3 249 ? 102.823 -5.207  46.412  1.00 26.09 ? 545  PRO A CG    1 
ATOM   2767  C  CD    . PRO E 3 249 ? 101.734 -5.530  47.405  1.00 23.12 ? 545  PRO A CD    1 
ATOM   2768  N  N     . VAL E 3 250 ? 100.816 -7.179  43.062  1.00 21.25 ? 546  VAL A N     1 
ATOM   2769  C  CA    . VAL E 3 250 ? 101.079 -8.267  42.130  1.00 21.13 ? 546  VAL A CA    1 
ATOM   2770  C  C     . VAL E 3 250 ? 102.363 -7.932  41.374  1.00 20.10 ? 546  VAL A C     1 
ATOM   2771  O  O     . VAL E 3 250 ? 102.381 -7.039  40.535  1.00 18.67 ? 546  VAL A O     1 
ATOM   2772  C  CB    . VAL E 3 250 ? 99.912  -8.434  41.126  1.00 20.35 ? 546  VAL A CB    1 
ATOM   2773  C  CG1   . VAL E 3 250 ? 100.243 -9.517  40.113  1.00 19.18 ? 546  VAL A CG1   1 
ATOM   2774  C  CG2   . VAL E 3 250 ? 98.630  -8.780  41.873  1.00 21.01 ? 546  VAL A CG2   1 
ATOM   2775  N  N     . LEU E 3 251 ? 103.434 -8.655  41.678  1.00 19.96 ? 547  LEU A N     1 
ATOM   2776  C  CA    . LEU E 3 251 ? 104.723 -8.412  41.045  1.00 20.58 ? 547  LEU A CA    1 
ATOM   2777  C  C     . LEU E 3 251 ? 104.927 -9.224  39.775  1.00 22.03 ? 547  LEU A C     1 
ATOM   2778  O  O     . LEU E 3 251 ? 105.785 -8.893  38.951  1.00 22.78 ? 547  LEU A O     1 
ATOM   2779  C  CB    . LEU E 3 251 ? 105.845 -8.737  42.026  1.00 19.80 ? 547  LEU A CB    1 
ATOM   2780  C  CG    . LEU E 3 251 ? 105.741 -8.088  43.408  1.00 21.04 ? 547  LEU A CG    1 
ATOM   2781  C  CD1   . LEU E 3 251 ? 106.884 -8.594  44.284  1.00 21.96 ? 547  LEU A CD1   1 
ATOM   2782  C  CD2   . LEU E 3 251 ? 105.779 -6.571  43.276  1.00 21.14 ? 547  LEU A CD2   1 
ATOM   2783  N  N     . LYS E 3 252 ? 104.139 -10.283 39.618  1.00 21.63 ? 548  LYS A N     1 
ATOM   2784  C  CA    . LYS E 3 252 ? 104.268 -11.152 38.457  1.00 23.55 ? 548  LYS A CA    1 
ATOM   2785  C  C     . LYS E 3 252 ? 103.064 -12.063 38.255  1.00 23.90 ? 548  LYS A C     1 
ATOM   2786  O  O     . LYS E 3 252 ? 102.425 -12.497 39.214  1.00 22.33 ? 548  LYS A O     1 
ATOM   2787  C  CB    . LYS E 3 252 ? 105.532 -12.003 38.597  1.00 24.21 ? 548  LYS A CB    1 
ATOM   2788  C  CG    . LYS E 3 252 ? 105.710 -13.044 37.511  1.00 26.86 ? 548  LYS A CG    1 
ATOM   2789  C  CD    . LYS E 3 252 ? 107.052 -13.731 37.640  1.00 30.88 ? 548  LYS A CD    1 
ATOM   2790  C  CE    . LYS E 3 252 ? 107.241 -14.783 36.558  1.00 32.97 ? 548  LYS A CE    1 
ATOM   2791  N  NZ    . LYS E 3 252 ? 108.598 -15.395 36.617  1.00 33.78 ? 548  LYS A NZ    1 
ATOM   2792  N  N     . LYS E 3 253 ? 102.768 -12.345 36.992  1.00 25.05 ? 549  LYS A N     1 
ATOM   2793  C  CA    . LYS E 3 253 ? 101.660 -13.213 36.619  1.00 27.25 ? 549  LYS A CA    1 
ATOM   2794  C  C     . LYS E 3 253 ? 102.154 -14.251 35.624  1.00 27.53 ? 549  LYS A C     1 
ATOM   2795  O  O     . LYS E 3 253 ? 103.015 -13.957 34.791  1.00 28.21 ? 549  LYS A O     1 
ATOM   2796  C  CB    . LYS E 3 253 ? 100.535 -12.413 35.955  1.00 29.43 ? 549  LYS A CB    1 
ATOM   2797  C  CG    . LYS E 3 253 ? 99.712  -11.532 36.878  1.00 33.04 ? 549  LYS A CG    1 
ATOM   2798  C  CD    . LYS E 3 253 ? 98.568  -10.878 36.099  1.00 35.34 ? 549  LYS A CD    1 
ATOM   2799  C  CE    . LYS E 3 253 ? 97.638  -10.090 37.012  1.00 38.13 ? 549  LYS A CE    1 
ATOM   2800  N  NZ    . LYS E 3 253 ? 96.555  -9.393  36.253  1.00 39.92 ? 549  LYS A NZ    1 
ATOM   2801  N  N     . THR E 3 254 ? 101.614 -15.463 35.716  1.00 26.73 ? 550  THR A N     1 
ATOM   2802  C  CA    . THR E 3 254 ? 101.965 -16.525 34.783  1.00 25.10 ? 550  THR A CA    1 
ATOM   2803  C  C     . THR E 3 254 ? 100.728 -16.730 33.928  1.00 24.35 ? 550  THR A C     1 
ATOM   2804  O  O     . THR E 3 254 ? 99.731  -16.026 34.096  1.00 21.18 ? 550  THR A O     1 
ATOM   2805  C  CB    . THR E 3 254 ? 102.298 -17.852 35.490  1.00 26.20 ? 550  THR A CB    1 
ATOM   2806  O  OG1   . THR E 3 254 ? 101.196 -18.244 36.316  1.00 27.82 ? 550  THR A OG1   1 
ATOM   2807  C  CG2   . THR E 3 254 ? 103.550 -17.710 36.330  1.00 27.47 ? 550  THR A CG2   1 
ATOM   2808  N  N     . LYS E 3 255 ? 100.773 -17.702 33.025  1.00 24.47 ? 551  LYS A N     1 
ATOM   2809  C  CA    . LYS E 3 255 ? 99.634  -17.937 32.160  1.00 25.31 ? 551  LYS A CA    1 
ATOM   2810  C  C     . LYS E 3 255 ? 98.384  -18.384 32.909  1.00 24.33 ? 551  LYS A C     1 
ATOM   2811  O  O     . LYS E 3 255 ? 97.278  -18.241 32.396  1.00 24.14 ? 551  LYS A O     1 
ATOM   2812  C  CB    . LYS E 3 255 ? 99.990  -18.949 31.068  1.00 27.25 ? 551  LYS A CB    1 
ATOM   2813  C  CG    . LYS E 3 255 ? 100.304 -20.344 31.554  1.00 29.80 ? 551  LYS A CG    1 
ATOM   2814  C  CD    . LYS E 3 255 ? 100.591 -21.243 30.363  1.00 33.69 ? 551  LYS A CD    1 
ATOM   2815  C  CE    . LYS E 3 255 ? 100.753 -22.695 30.769  1.00 35.31 ? 551  LYS A CE    1 
ATOM   2816  N  NZ    . LYS E 3 255 ? 100.959 -23.553 29.568  1.00 36.06 ? 551  LYS A NZ    1 
ATOM   2817  N  N     . THR E 3 256 ? 98.543  -18.909 34.122  1.00 23.99 ? 552  THR A N     1 
ATOM   2818  C  CA    . THR E 3 256 ? 97.376  -19.348 34.883  1.00 24.61 ? 552  THR A CA    1 
ATOM   2819  C  C     . THR E 3 256 ? 96.877  -18.315 35.888  1.00 23.42 ? 552  THR A C     1 
ATOM   2820  O  O     . THR E 3 256 ? 95.725  -18.381 36.319  1.00 24.49 ? 552  THR A O     1 
ATOM   2821  C  CB    . THR E 3 256 ? 97.635  -20.679 35.635  1.00 26.25 ? 552  THR A CB    1 
ATOM   2822  O  OG1   . THR E 3 256 ? 98.672  -20.495 36.605  1.00 28.34 ? 552  THR A OG1   1 
ATOM   2823  C  CG2   . THR E 3 256 ? 98.039  -21.774 34.653  1.00 27.13 ? 552  THR A CG2   1 
ATOM   2824  N  N     . GLY E 3 257 ? 97.728  -17.364 36.265  1.00 21.73 ? 553  GLY A N     1 
ATOM   2825  C  CA    . GLY E 3 257 ? 97.302  -16.347 37.216  1.00 21.37 ? 553  GLY A CA    1 
ATOM   2826  C  C     . GLY E 3 257 ? 98.429  -15.679 37.984  1.00 20.97 ? 553  GLY A C     1 
ATOM   2827  O  O     . GLY E 3 257 ? 99.541  -15.563 37.471  1.00 21.07 ? 553  GLY A O     1 
ATOM   2828  N  N     . TYR E 3 258 ? 98.147  -15.240 39.212  1.00 20.26 ? 554  TYR A N     1 
ATOM   2829  C  CA    . TYR E 3 258 ? 99.161  -14.578 40.034  1.00 19.92 ? 554  TYR A CA    1 
ATOM   2830  C  C     . TYR E 3 258 ? 100.281 -15.541 40.394  1.00 19.54 ? 554  TYR A C     1 
ATOM   2831  O  O     . TYR E 3 258 ? 100.032 -16.689 40.746  1.00 19.95 ? 554  TYR A O     1 
ATOM   2832  C  CB    . TYR E 3 258 ? 98.590  -14.068 41.359  1.00 21.30 ? 554  TYR A CB    1 
ATOM   2833  C  CG    . TYR E 3 258 ? 97.280  -13.331 41.297  1.00 24.40 ? 554  TYR A CG    1 
ATOM   2834  C  CD1   . TYR E 3 258 ? 96.115  -13.910 41.804  1.00 24.95 ? 554  TYR A CD1   1 
ATOM   2835  C  CD2   . TYR E 3 258 ? 97.209  -12.033 40.793  1.00 23.80 ? 554  TYR A CD2   1 
ATOM   2836  C  CE1   . TYR E 3 258 ? 94.912  -13.214 41.817  1.00 27.07 ? 554  TYR A CE1   1 
ATOM   2837  C  CE2   . TYR E 3 258 ? 96.009  -11.327 40.799  1.00 25.93 ? 554  TYR A CE2   1 
ATOM   2838  C  CZ    . TYR E 3 258 ? 94.868  -11.921 41.313  1.00 27.00 ? 554  TYR A CZ    1 
ATOM   2839  O  OH    . TYR E 3 258 ? 93.685  -11.224 41.332  1.00 28.57 ? 554  TYR A OH    1 
ATOM   2840  N  N     . SER E 3 259 ? 101.517 -15.065 40.329  1.00 18.78 ? 555  SER A N     1 
ATOM   2841  C  CA    . SER E 3 259 ? 102.654 -15.898 40.694  1.00 20.11 ? 555  SER A CA    1 
ATOM   2842  C  C     . SER E 3 259 ? 102.843 -15.845 42.219  1.00 19.40 ? 555  SER A C     1 
ATOM   2843  O  O     . SER E 3 259 ? 102.654 -14.794 42.833  1.00 18.91 ? 555  SER A O     1 
ATOM   2844  C  CB    . SER E 3 259 ? 103.916 -15.383 39.995  1.00 19.57 ? 555  SER A CB    1 
ATOM   2845  O  OG    . SER E 3 259 ? 105.080 -16.017 40.493  1.00 19.15 ? 555  SER A OG    1 
ATOM   2846  N  N     . THR E 3 260 ? 103.189 -16.979 42.827  1.00 18.75 ? 556  THR A N     1 
ATOM   2847  C  CA    . THR E 3 260 ? 103.456 -17.026 44.266  1.00 19.33 ? 556  THR A CA    1 
ATOM   2848  C  C     . THR E 3 260 ? 104.806 -17.714 44.441  1.00 20.22 ? 556  THR A C     1 
ATOM   2849  O  O     . THR E 3 260 ? 105.058 -18.382 45.443  1.00 22.29 ? 556  THR A O     1 
ATOM   2850  C  CB    . THR E 3 260 ? 102.365 -17.805 45.088  1.00 20.11 ? 556  THR A CB    1 
ATOM   2851  O  OG1   . THR E 3 260 ? 102.306 -19.178 44.670  1.00 18.58 ? 556  THR A OG1   1 
ATOM   2852  C  CG2   . THR E 3 260 ? 101.001 -17.156 44.920  1.00 17.92 ? 556  THR A CG2   1 
ATOM   2853  N  N     . SER E 3 261 ? 105.673 -17.543 43.449  1.00 20.12 ? 557  SER A N     1 
ATOM   2854  C  CA    . SER E 3 261 ? 107.001 -18.142 43.480  1.00 21.60 ? 557  SER A CA    1 
ATOM   2855  C  C     . SER E 3 261 ? 107.780 -17.628 44.686  1.00 21.65 ? 557  SER A C     1 
ATOM   2856  O  O     . SER E 3 261 ? 107.444 -16.585 45.251  1.00 21.16 ? 557  SER A O     1 
ATOM   2857  C  CB    . SER E 3 261 ? 107.763 -17.805 42.197  1.00 20.92 ? 557  SER A CB    1 
ATOM   2858  O  OG    . SER E 3 261 ? 107.959 -16.407 42.082  1.00 22.93 ? 557  SER A OG    1 
ATOM   2859  N  N     . ALA E 3 262 ? 108.817 -18.362 45.074  1.00 21.59 ? 558  ALA A N     1 
ATOM   2860  C  CA    . ALA E 3 262 ? 109.641 -17.975 46.214  1.00 22.63 ? 558  ALA A CA    1 
ATOM   2861  C  C     . ALA E 3 262 ? 110.267 -16.596 46.004  1.00 23.44 ? 558  ALA A C     1 
ATOM   2862  O  O     . ALA E 3 262 ? 110.381 -15.816 46.944  1.00 23.14 ? 558  ALA A O     1 
ATOM   2863  C  CB    . ALA E 3 262 ? 110.729 -19.011 46.447  1.00 23.87 ? 558  ALA A CB    1 
ATOM   2864  N  N     . ASP E 3 263 ? 110.668 -16.299 44.771  1.00 24.77 ? 559  ASP A N     1 
ATOM   2865  C  CA    . ASP E 3 263 ? 111.280 -15.008 44.462  1.00 27.87 ? 559  ASP A CA    1 
ATOM   2866  C  C     . ASP E 3 263 ? 110.283 -13.875 44.690  1.00 26.40 ? 559  ASP A C     1 
ATOM   2867  O  O     . ASP E 3 263 ? 110.634 -12.830 45.242  1.00 27.08 ? 559  ASP A O     1 
ATOM   2868  C  CB    . ASP E 3 263 ? 111.768 -14.974 43.011  1.00 32.52 ? 559  ASP A CB    1 
ATOM   2869  C  CG    . ASP E 3 263 ? 112.479 -13.677 42.668  1.00 38.55 ? 559  ASP A CG    1 
ATOM   2870  O  OD1   . ASP E 3 263 ? 113.542 -13.403 43.269  1.00 42.08 ? 559  ASP A OD1   1 
ATOM   2871  O  OD2   . ASP E 3 263 ? 111.976 -12.928 41.799  1.00 41.76 ? 559  ASP A OD2   1 
ATOM   2872  N  N     . VAL E 3 264 ? 109.042 -14.084 44.260  1.00 23.80 ? 560  VAL A N     1 
ATOM   2873  C  CA    . VAL E 3 264 ? 107.997 -13.084 44.440  1.00 21.44 ? 560  VAL A CA    1 
ATOM   2874  C  C     . VAL E 3 264 ? 107.681 -12.919 45.928  1.00 21.21 ? 560  VAL A C     1 
ATOM   2875  O  O     . VAL E 3 264 ? 107.626 -11.801 46.437  1.00 21.46 ? 560  VAL A O     1 
ATOM   2876  C  CB    . VAL E 3 264 ? 106.704 -13.478 43.676  1.00 20.15 ? 560  VAL A CB    1 
ATOM   2877  C  CG1   . VAL E 3 264 ? 105.517 -12.681 44.194  1.00 18.72 ? 560  VAL A CG1   1 
ATOM   2878  C  CG2   . VAL E 3 264 ? 106.884 -13.213 42.184  1.00 20.95 ? 560  VAL A CG2   1 
ATOM   2879  N  N     . LEU E 3 265 ? 107.494 -14.031 46.630  1.00 20.20 ? 561  LEU A N     1 
ATOM   2880  C  CA    . LEU E 3 265 ? 107.177 -13.963 48.052  1.00 21.90 ? 561  LEU A CA    1 
ATOM   2881  C  C     . LEU E 3 265 ? 108.249 -13.251 48.875  1.00 22.20 ? 561  LEU A C     1 
ATOM   2882  O  O     . LEU E 3 265 ? 107.927 -12.487 49.781  1.00 21.14 ? 561  LEU A O     1 
ATOM   2883  C  CB    . LEU E 3 265 ? 106.923 -15.367 48.618  1.00 22.31 ? 561  LEU A CB    1 
ATOM   2884  C  CG    . LEU E 3 265 ? 105.449 -15.803 48.636  1.00 23.99 ? 561  LEU A CG    1 
ATOM   2885  C  CD1   . LEU E 3 265 ? 104.873 -15.746 47.233  1.00 24.28 ? 561  LEU A CD1   1 
ATOM   2886  C  CD2   . LEU E 3 265 ? 105.332 -17.208 49.205  1.00 22.29 ? 561  LEU A CD2   1 
ATOM   2887  N  N     . GLU E 3 266 ? 109.518 -13.496 48.564  1.00 23.29 ? 562  GLU A N     1 
ATOM   2888  C  CA    . GLU E 3 266 ? 110.597 -12.852 49.302  1.00 25.98 ? 562  GLU A CA    1 
ATOM   2889  C  C     . GLU E 3 266 ? 110.530 -11.338 49.128  1.00 25.40 ? 562  GLU A C     1 
ATOM   2890  O  O     . GLU E 3 266 ? 110.799 -10.586 50.063  1.00 26.79 ? 562  GLU A O     1 
ATOM   2891  C  CB    . GLU E 3 266 ? 111.955 -13.371 48.828  1.00 28.82 ? 562  GLU A CB    1 
ATOM   2892  C  CG    . GLU E 3 266 ? 112.112 -14.873 48.983  1.00 34.62 ? 562  GLU A CG    1 
ATOM   2893  C  CD    . GLU E 3 266 ? 113.494 -15.366 48.611  1.00 38.67 ? 562  GLU A CD    1 
ATOM   2894  O  OE1   . GLU E 3 266 ? 114.215 -14.646 47.884  1.00 42.04 ? 562  GLU A OE1   1 
ATOM   2895  O  OE2   . GLU E 3 266 ? 113.857 -16.481 49.045  1.00 41.46 ? 562  GLU A OE2   1 
ATOM   2896  N  N     . LYS E 3 267 ? 110.169 -10.896 47.928  1.00 24.02 ? 563  LYS A N     1 
ATOM   2897  C  CA    . LYS E 3 267 ? 110.062 -9.472  47.645  1.00 23.10 ? 563  LYS A CA    1 
ATOM   2898  C  C     . LYS E 3 267 ? 108.857 -8.844  48.345  1.00 22.34 ? 563  LYS A C     1 
ATOM   2899  O  O     . LYS E 3 267 ? 108.770 -7.623  48.474  1.00 22.11 ? 563  LYS A O     1 
ATOM   2900  C  CB    . LYS E 3 267 ? 109.962 -9.242  46.136  1.00 24.66 ? 563  LYS A CB    1 
ATOM   2901  C  CG    . LYS E 3 267 ? 111.252 -9.527  45.376  1.00 26.56 ? 563  LYS A CG    1 
ATOM   2902  C  CD    . LYS E 3 267 ? 111.111 -9.163  43.905  1.00 30.69 ? 563  LYS A CD    1 
ATOM   2903  C  CE    . LYS E 3 267 ? 112.441 -9.278  43.168  1.00 31.72 ? 563  LYS A CE    1 
ATOM   2904  N  NZ    . LYS E 3 267 ? 112.990 -10.661 43.216  1.00 34.20 ? 563  LYS A NZ    1 
ATOM   2905  N  N     . LEU E 3 268 ? 107.931 -9.681  48.804  1.00 19.40 ? 564  LEU A N     1 
ATOM   2906  C  CA    . LEU E 3 268 ? 106.734 -9.194  49.483  1.00 18.81 ? 564  LEU A CA    1 
ATOM   2907  C  C     . LEU E 3 268 ? 106.878 -9.176  51.004  1.00 17.48 ? 564  LEU A C     1 
ATOM   2908  O  O     . LEU E 3 268 ? 105.992 -8.697  51.712  1.00 17.52 ? 564  LEU A O     1 
ATOM   2909  C  CB    . LEU E 3 268 ? 105.526 -10.055 49.100  1.00 18.10 ? 564  LEU A CB    1 
ATOM   2910  C  CG    . LEU E 3 268 ? 105.070 -10.007 47.636  1.00 18.64 ? 564  LEU A CG    1 
ATOM   2911  C  CD1   . LEU E 3 268 ? 103.992 -11.065 47.404  1.00 16.29 ? 564  LEU A CD1   1 
ATOM   2912  C  CD2   . LEU E 3 268 ? 104.536 -8.616  47.297  1.00 17.56 ? 564  LEU A CD2   1 
ATOM   2913  N  N     . ALA E 3 269 ? 107.994 -9.696  51.500  1.00 17.31 ? 565  ALA A N     1 
ATOM   2914  C  CA    . ALA E 3 269 ? 108.241 -9.755  52.936  1.00 18.56 ? 565  ALA A CA    1 
ATOM   2915  C  C     . ALA E 3 269 ? 108.071 -8.414  53.655  1.00 19.33 ? 565  ALA A C     1 
ATOM   2916  O  O     . ALA E 3 269 ? 107.631 -8.375  54.803  1.00 19.26 ? 565  ALA A O     1 
ATOM   2917  C  CB    . ALA E 3 269 ? 109.639 -10.316 53.199  1.00 19.61 ? 565  ALA A CB    1 
ATOM   2918  N  N     . PRO E 3 270 ? 108.416 -7.295  52.995  1.00 20.67 ? 566  PRO A N     1 
ATOM   2919  C  CA    . PRO E 3 270 ? 108.254 -6.009  53.682  1.00 21.01 ? 566  PRO A CA    1 
ATOM   2920  C  C     . PRO E 3 270 ? 106.796 -5.601  53.905  1.00 22.14 ? 566  PRO A C     1 
ATOM   2921  O  O     . PRO E 3 270 ? 106.522 -4.698  54.695  1.00 23.28 ? 566  PRO A O     1 
ATOM   2922  C  CB    . PRO E 3 270 ? 109.005 -5.030  52.782  1.00 21.37 ? 566  PRO A CB    1 
ATOM   2923  C  CG    . PRO E 3 270 ? 110.018 -5.897  52.092  1.00 22.37 ? 566  PRO A CG    1 
ATOM   2924  C  CD    . PRO E 3 270 ? 109.213 -7.127  51.768  1.00 20.35 ? 566  PRO A CD    1 
ATOM   2925  N  N     . TYR E 3 271 ? 105.866 -6.261  53.216  1.00 21.21 ? 567  TYR A N     1 
ATOM   2926  C  CA    . TYR E 3 271 ? 104.447 -5.927  53.349  1.00 21.75 ? 567  TYR A CA    1 
ATOM   2927  C  C     . TYR E 3 271 ? 103.671 -6.714  54.400  1.00 22.34 ? 567  TYR A C     1 
ATOM   2928  O  O     . TYR E 3 271 ? 102.790 -6.168  55.068  1.00 22.34 ? 567  TYR A O     1 
ATOM   2929  C  CB    . TYR E 3 271 ? 103.724 -6.084  52.004  1.00 22.20 ? 567  TYR A CB    1 
ATOM   2930  C  CG    . TYR E 3 271 ? 104.252 -5.189  50.910  1.00 23.26 ? 567  TYR A CG    1 
ATOM   2931  C  CD1   . TYR E 3 271 ? 105.389 -5.541  50.183  1.00 24.39 ? 567  TYR A CD1   1 
ATOM   2932  C  CD2   . TYR E 3 271 ? 103.628 -3.975  50.612  1.00 23.58 ? 567  TYR A CD2   1 
ATOM   2933  C  CE1   . TYR E 3 271 ? 105.892 -4.706  49.187  1.00 24.65 ? 567  TYR A CE1   1 
ATOM   2934  C  CE2   . TYR E 3 271 ? 104.125 -3.134  49.622  1.00 23.32 ? 567  TYR A CE2   1 
ATOM   2935  C  CZ    . TYR E 3 271 ? 105.256 -3.506  48.915  1.00 22.90 ? 567  TYR A CZ    1 
ATOM   2936  O  OH    . TYR E 3 271 ? 105.761 -2.673  47.945  1.00 24.84 ? 567  TYR A OH    1 
ATOM   2937  N  N     . HIS E 3 272 ? 103.989 -7.993  54.549  1.00 22.32 ? 568  HIS A N     1 
ATOM   2938  C  CA    . HIS E 3 272 ? 103.269 -8.832  55.497  1.00 23.52 ? 568  HIS A CA    1 
ATOM   2939  C  C     . HIS E 3 272 ? 104.150 -10.003 55.906  1.00 24.05 ? 568  HIS A C     1 
ATOM   2940  O  O     . HIS E 3 272 ? 104.792 -10.627 55.066  1.00 23.29 ? 568  HIS A O     1 
ATOM   2941  C  CB    . HIS E 3 272 ? 101.982 -9.335  54.836  1.00 22.74 ? 568  HIS A CB    1 
ATOM   2942  C  CG    . HIS E 3 272 ? 100.933 -9.782  55.802  1.00 21.36 ? 568  HIS A CG    1 
ATOM   2943  N  ND1   . HIS E 3 272 ? 101.108 -10.853 56.652  1.00 23.29 ? 568  HIS A ND1   1 
ATOM   2944  C  CD2   . HIS E 3 272 ? 99.690  -9.304  56.049  1.00 22.26 ? 568  HIS A CD2   1 
ATOM   2945  C  CE1   . HIS E 3 272 ? 100.018 -11.015 57.381  1.00 23.17 ? 568  HIS A CE1   1 
ATOM   2946  N  NE2   . HIS E 3 272 ? 99.143  -10.088 57.034  1.00 23.98 ? 568  HIS A NE2   1 
ATOM   2947  N  N     . GLU E 3 273 ? 104.177 -10.310 57.195  1.00 25.70 ? 569  GLU A N     1 
ATOM   2948  C  CA    . GLU E 3 273 ? 105.019 -11.402 57.665  1.00 28.04 ? 569  GLU A CA    1 
ATOM   2949  C  C     . GLU E 3 273 ? 104.465 -12.786 57.340  1.00 26.94 ? 569  GLU A C     1 
ATOM   2950  O  O     . GLU E 3 273 ? 105.068 -13.796 57.700  1.00 28.07 ? 569  GLU A O     1 
ATOM   2951  C  CB    . GLU E 3 273 ? 105.256 -11.278 59.172  1.00 29.73 ? 569  GLU A CB    1 
ATOM   2952  C  CG    . GLU E 3 273 ? 104.034 -11.521 60.023  1.00 34.13 ? 569  GLU A CG    1 
ATOM   2953  C  CD    . GLU E 3 273 ? 104.341 -11.410 61.503  1.00 37.13 ? 569  GLU A CD    1 
ATOM   2954  O  OE1   . GLU E 3 273 ? 105.300 -12.070 61.956  1.00 39.04 ? 569  GLU A OE1   1 
ATOM   2955  O  OE2   . GLU E 3 273 ? 103.627 -10.668 62.211  1.00 40.11 ? 569  GLU A OE2   1 
ATOM   2956  N  N     . ILE E 3 274 ? 103.326 -12.842 56.656  1.00 24.56 ? 570  ILE A N     1 
ATOM   2957  C  CA    . ILE E 3 274 ? 102.745 -14.132 56.310  1.00 23.17 ? 570  ILE A CA    1 
ATOM   2958  C  C     . ILE E 3 274 ? 103.529 -14.814 55.189  1.00 22.42 ? 570  ILE A C     1 
ATOM   2959  O  O     . ILE E 3 274 ? 103.620 -16.039 55.156  1.00 22.86 ? 570  ILE A O     1 
ATOM   2960  C  CB    . ILE E 3 274 ? 101.256 -14.001 55.891  1.00 22.22 ? 570  ILE A CB    1 
ATOM   2961  C  CG1   . ILE E 3 274 ? 100.628 -15.392 55.755  1.00 24.59 ? 570  ILE A CG1   1 
ATOM   2962  C  CG2   . ILE E 3 274 ? 101.138 -13.254 54.567  1.00 21.43 ? 570  ILE A CG2   1 
ATOM   2963  C  CD1   . ILE E 3 274 ? 99.136  -15.370 55.439  1.00 21.66 ? 570  ILE A CD1   1 
ATOM   2964  N  N     . VAL E 3 275 ? 104.118 -14.031 54.287  1.00 22.07 ? 571  VAL A N     1 
ATOM   2965  C  CA    . VAL E 3 275 ? 104.868 -14.620 53.176  1.00 22.04 ? 571  VAL A CA    1 
ATOM   2966  C  C     . VAL E 3 275 ? 106.080 -15.431 53.628  1.00 21.81 ? 571  VAL A C     1 
ATOM   2967  O  O     . VAL E 3 275 ? 106.402 -16.453 53.025  1.00 20.72 ? 571  VAL A O     1 
ATOM   2968  C  CB    . VAL E 3 275 ? 105.326 -13.544 52.146  1.00 23.12 ? 571  VAL A CB    1 
ATOM   2969  C  CG1   . VAL E 3 275 ? 104.107 -12.876 51.525  1.00 22.92 ? 571  VAL A CG1   1 
ATOM   2970  C  CG2   . VAL E 3 275 ? 106.216 -12.513 52.811  1.00 22.51 ? 571  VAL A CG2   1 
ATOM   2971  N  N     . GLU E 3 276 ? 106.751 -14.984 54.685  1.00 22.84 ? 572  GLU A N     1 
ATOM   2972  C  CA    . GLU E 3 276 ? 107.911 -15.713 55.193  1.00 23.59 ? 572  GLU A CA    1 
ATOM   2973  C  C     . GLU E 3 276 ? 107.463 -17.044 55.790  1.00 22.59 ? 572  GLU A C     1 
ATOM   2974  O  O     . GLU E 3 276 ? 108.112 -18.070 55.588  1.00 21.49 ? 572  GLU A O     1 
ATOM   2975  C  CB    . GLU E 3 276 ? 108.652 -14.887 56.247  1.00 26.58 ? 572  GLU A CB    1 
ATOM   2976  C  CG    . GLU E 3 276 ? 109.400 -13.697 55.670  1.00 32.65 ? 572  GLU A CG    1 
ATOM   2977  C  CD    . GLU E 3 276 ? 110.212 -12.955 56.713  1.00 35.62 ? 572  GLU A CD    1 
ATOM   2978  O  OE1   . GLU E 3 276 ? 109.607 -12.371 57.635  1.00 39.44 ? 572  GLU A OE1   1 
ATOM   2979  O  OE2   . GLU E 3 276 ? 111.456 -12.961 56.610  1.00 37.54 ? 572  GLU A OE2   1 
ATOM   2980  N  N     . ASN E 3 277 ? 106.355 -17.019 56.526  1.00 21.45 ? 573  ASN A N     1 
ATOM   2981  C  CA    . ASN E 3 277 ? 105.804 -18.231 57.126  1.00 21.22 ? 573  ASN A CA    1 
ATOM   2982  C  C     . ASN E 3 277 ? 105.430 -19.214 56.006  1.00 20.59 ? 573  ASN A C     1 
ATOM   2983  O  O     . ASN E 3 277 ? 105.687 -20.416 56.107  1.00 20.07 ? 573  ASN A O     1 
ATOM   2984  C  CB    . ASN E 3 277 ? 104.563 -17.889 57.960  1.00 23.33 ? 573  ASN A CB    1 
ATOM   2985  C  CG    . ASN E 3 277 ? 104.909 -17.225 59.292  1.00 26.16 ? 573  ASN A CG    1 
ATOM   2986  O  OD1   . ASN E 3 277 ? 105.171 -17.901 60.288  1.00 27.83 ? 573  ASN A OD1   1 
ATOM   2987  N  ND2   . ASN E 3 277 ? 104.923 -15.898 59.306  1.00 25.60 ? 573  ASN A ND2   1 
ATOM   2988  N  N     . ILE E 3 278 ? 104.824 -18.693 54.942  1.00 18.40 ? 574  ILE A N     1 
ATOM   2989  C  CA    . ILE E 3 278 ? 104.428 -19.516 53.798  1.00 19.20 ? 574  ILE A CA    1 
ATOM   2990  C  C     . ILE E 3 278 ? 105.653 -20.170 53.154  1.00 18.81 ? 574  ILE A C     1 
ATOM   2991  O  O     . ILE E 3 278 ? 105.632 -21.359 52.820  1.00 18.07 ? 574  ILE A O     1 
ATOM   2992  C  CB    . ILE E 3 278 ? 103.680 -18.668 52.740  1.00 19.87 ? 574  ILE A CB    1 
ATOM   2993  C  CG1   . ILE E 3 278 ? 102.329 -18.222 53.308  1.00 19.14 ? 574  ILE A CG1   1 
ATOM   2994  C  CG2   . ILE E 3 278 ? 103.487 -19.473 51.450  1.00 18.34 ? 574  ILE A CG2   1 
ATOM   2995  C  CD1   . ILE E 3 278 ? 101.718 -17.048 52.578  1.00 19.85 ? 574  ILE A CD1   1 
ATOM   2996  N  N     . LEU E 3 279 ? 106.720 -19.397 52.978  1.00 18.66 ? 575  LEU A N     1 
ATOM   2997  C  CA    . LEU E 3 279 ? 107.940 -19.943 52.390  1.00 19.34 ? 575  LEU A CA    1 
ATOM   2998  C  C     . LEU E 3 279 ? 108.455 -21.092 53.252  1.00 20.31 ? 575  LEU A C     1 
ATOM   2999  O  O     . LEU E 3 279 ? 108.812 -22.157 52.742  1.00 18.66 ? 575  LEU A O     1 
ATOM   3000  C  CB    . LEU E 3 279 ? 109.015 -18.856 52.281  1.00 20.61 ? 575  LEU A CB    1 
ATOM   3001  C  CG    . LEU E 3 279 ? 108.733 -17.740 51.274  1.00 21.34 ? 575  LEU A CG    1 
ATOM   3002  C  CD1   . LEU E 3 279 ? 109.812 -16.675 51.367  1.00 20.36 ? 575  LEU A CD1   1 
ATOM   3003  C  CD2   . LEU E 3 279 ? 108.671 -18.327 49.871  1.00 21.37 ? 575  LEU A CD2   1 
ATOM   3004  N  N     . HIS E 3 280 ? 108.480 -20.875 54.564  1.00 19.93 ? 576  HIS A N     1 
ATOM   3005  C  CA    . HIS E 3 280 ? 108.956 -21.895 55.492  1.00 20.30 ? 576  HIS A CA    1 
ATOM   3006  C  C     . HIS E 3 280 ? 108.063 -23.135 55.417  1.00 19.95 ? 576  HIS A C     1 
ATOM   3007  O  O     . HIS E 3 280 ? 108.550 -24.268 55.432  1.00 20.95 ? 576  HIS A O     1 
ATOM   3008  C  CB    . HIS E 3 280 ? 108.967 -21.350 56.923  1.00 22.73 ? 576  HIS A CB    1 
ATOM   3009  C  CG    . HIS E 3 280 ? 109.709 -22.217 57.893  1.00 24.13 ? 576  HIS A CG    1 
ATOM   3010  N  ND1   . HIS E 3 280 ? 109.539 -22.122 59.258  1.00 26.71 ? 576  HIS A ND1   1 
ATOM   3011  C  CD2   . HIS E 3 280 ? 110.632 -23.187 57.695  1.00 24.96 ? 576  HIS A CD2   1 
ATOM   3012  C  CE1   . HIS E 3 280 ? 110.326 -22.997 59.859  1.00 26.32 ? 576  HIS A CE1   1 
ATOM   3013  N  NE2   . HIS E 3 280 ? 110.999 -23.656 58.934  1.00 26.98 ? 576  HIS A NE2   1 
ATOM   3014  N  N     . TYR E 3 281 ? 106.757 -22.916 55.325  1.00 18.82 ? 577  TYR A N     1 
ATOM   3015  C  CA    . TYR E 3 281 ? 105.804 -24.017 55.245  1.00 18.50 ? 577  TYR A CA    1 
ATOM   3016  C  C     . TYR E 3 281 ? 106.054 -24.882 54.011  1.00 17.71 ? 577  TYR A C     1 
ATOM   3017  O  O     . TYR E 3 281 ? 106.077 -26.114 54.091  1.00 15.27 ? 577  TYR A O     1 
ATOM   3018  C  CB    . TYR E 3 281 ? 104.365 -23.486 55.193  1.00 18.75 ? 577  TYR A CB    1 
ATOM   3019  C  CG    . TYR E 3 281 ? 103.345 -24.584 55.011  1.00 20.45 ? 577  TYR A CG    1 
ATOM   3020  C  CD1   . TYR E 3 281 ? 102.856 -25.304 56.105  1.00 21.14 ? 577  TYR A CD1   1 
ATOM   3021  C  CD2   . TYR E 3 281 ? 102.894 -24.934 53.738  1.00 21.22 ? 577  TYR A CD2   1 
ATOM   3022  C  CE1   . TYR E 3 281 ? 101.947 -26.345 55.929  1.00 22.10 ? 577  TYR A CE1   1 
ATOM   3023  C  CE2   . TYR E 3 281 ? 101.990 -25.970 53.553  1.00 20.69 ? 577  TYR A CE2   1 
ATOM   3024  C  CZ    . TYR E 3 281 ? 101.521 -26.672 54.648  1.00 22.51 ? 577  TYR A CZ    1 
ATOM   3025  O  OH    . TYR E 3 281 ? 100.644 -27.716 54.455  1.00 23.55 ? 577  TYR A OH    1 
ATOM   3026  N  N     . ARG E 3 282 ? 106.228 -24.231 52.867  1.00 17.06 ? 578  ARG A N     1 
ATOM   3027  C  CA    . ARG E 3 282 ? 106.471 -24.942 51.617  1.00 18.65 ? 578  ARG A CA    1 
ATOM   3028  C  C     . ARG E 3 282 ? 107.758 -25.752 51.668  1.00 19.40 ? 578  ARG A C     1 
ATOM   3029  O  O     . ARG E 3 282 ? 107.856 -26.814 51.051  1.00 20.00 ? 578  ARG A O     1 
ATOM   3030  C  CB    . ARG E 3 282 ? 106.561 -23.959 50.465  1.00 19.38 ? 578  ARG A CB    1 
ATOM   3031  C  CG    . ARG E 3 282 ? 105.256 -23.372 50.027  1.00 22.98 ? 578  ARG A CG    1 
ATOM   3032  C  CD    . ARG E 3 282 ? 105.583 -22.258 49.063  1.00 25.01 ? 578  ARG A CD    1 
ATOM   3033  N  NE    . ARG E 3 282 ? 104.439 -21.821 48.294  1.00 26.14 ? 578  ARG A NE    1 
ATOM   3034  C  CZ    . ARG E 3 282 ? 104.505 -20.880 47.364  1.00 24.56 ? 578  ARG A CZ    1 
ATOM   3035  N  NH1   . ARG E 3 282 ? 105.665 -20.288 47.104  1.00 24.55 ? 578  ARG A NH1   1 
ATOM   3036  N  NH2   . ARG E 3 282 ? 103.417 -20.539 46.696  1.00 23.60 ? 578  ARG A NH2   1 
ATOM   3037  N  N     . GLN E 3 283 ? 108.745 -25.236 52.392  1.00 19.33 ? 579  GLN A N     1 
ATOM   3038  C  CA    . GLN E 3 283 ? 110.020 -25.924 52.542  1.00 22.45 ? 579  GLN A CA    1 
ATOM   3039  C  C     . GLN E 3 283 ? 109.785 -27.228 53.285  1.00 21.60 ? 579  GLN A C     1 
ATOM   3040  O  O     . GLN E 3 283 ? 110.092 -28.317 52.786  1.00 22.80 ? 579  GLN A O     1 
ATOM   3041  C  CB    . GLN E 3 283 ? 110.998 -25.082 53.358  1.00 23.66 ? 579  GLN A CB    1 
ATOM   3042  C  CG    . GLN E 3 283 ? 111.488 -23.816 52.694  1.00 29.11 ? 579  GLN A CG    1 
ATOM   3043  C  CD    . GLN E 3 283 ? 112.289 -22.964 53.660  1.00 30.64 ? 579  GLN A CD    1 
ATOM   3044  O  OE1   . GLN E 3 283 ? 112.944 -23.486 54.566  1.00 33.31 ? 579  GLN A OE1   1 
ATOM   3045  N  NE2   . GLN E 3 283 ? 112.251 -21.651 53.468  1.00 33.41 ? 579  GLN A NE2   1 
ATOM   3046  N  N     . LEU E 3 284 ? 109.239 -27.098 54.490  1.00 21.34 ? 580  LEU A N     1 
ATOM   3047  C  CA    . LEU E 3 284 ? 108.964 -28.243 55.346  1.00 18.79 ? 580  LEU A CA    1 
ATOM   3048  C  C     . LEU E 3 284 ? 108.042 -29.250 54.676  1.00 18.16 ? 580  LEU A C     1 
ATOM   3049  O  O     . LEU E 3 284 ? 108.225 -30.460 54.826  1.00 17.77 ? 580  LEU A O     1 
ATOM   3050  C  CB    . LEU E 3 284 ? 108.342 -27.776 56.664  1.00 19.96 ? 580  LEU A CB    1 
ATOM   3051  C  CG    . LEU E 3 284 ? 109.176 -26.836 57.539  1.00 21.39 ? 580  LEU A CG    1 
ATOM   3052  C  CD1   . LEU E 3 284 ? 108.362 -26.442 58.767  1.00 23.07 ? 580  LEU A CD1   1 
ATOM   3053  C  CD2   . LEU E 3 284 ? 110.474 -27.520 57.959  1.00 22.21 ? 580  LEU A CD2   1 
ATOM   3054  N  N     . GLY E 3 285 ? 107.051 -28.748 53.944  1.00 17.48 ? 581  GLY A N     1 
ATOM   3055  C  CA    . GLY E 3 285 ? 106.111 -29.625 53.264  1.00 17.01 ? 581  GLY A CA    1 
ATOM   3056  C  C     . GLY E 3 285 ? 106.779 -30.477 52.199  1.00 18.81 ? 581  GLY A C     1 
ATOM   3057  O  O     . GLY E 3 285 ? 106.414 -31.638 51.996  1.00 16.91 ? 581  GLY A O     1 
ATOM   3058  N  N     . LYS E 3 286 ? 107.758 -29.894 51.514  1.00 18.47 ? 582  LYS A N     1 
ATOM   3059  C  CA    . LYS E 3 286 ? 108.489 -30.604 50.469  1.00 20.20 ? 582  LYS A CA    1 
ATOM   3060  C  C     . LYS E 3 286 ? 109.337 -31.695 51.113  1.00 19.40 ? 582  LYS A C     1 
ATOM   3061  O  O     . LYS E 3 286 ? 109.397 -32.823 50.623  1.00 19.11 ? 582  LYS A O     1 
ATOM   3062  C  CB    . LYS E 3 286 ? 109.397 -29.639 49.711  1.00 22.29 ? 582  LYS A CB    1 
ATOM   3063  C  CG    . LYS E 3 286 ? 109.321 -29.773 48.200  1.00 27.16 ? 582  LYS A CG    1 
ATOM   3064  C  CD    . LYS E 3 286 ? 109.607 -31.179 47.720  1.00 25.87 ? 582  LYS A CD    1 
ATOM   3065  C  CE    . LYS E 3 286 ? 109.446 -31.264 46.202  1.00 27.86 ? 582  LYS A CE    1 
ATOM   3066  N  NZ    . LYS E 3 286 ? 109.621 -32.642 45.671  1.00 23.85 ? 582  LYS A NZ    1 
ATOM   3067  N  N     . LEU E 3 287 ? 109.995 -31.351 52.215  1.00 18.69 ? 583  LEU A N     1 
ATOM   3068  C  CA    . LEU E 3 287 ? 110.817 -32.323 52.926  1.00 18.76 ? 583  LEU A CA    1 
ATOM   3069  C  C     . LEU E 3 287 ? 109.962 -33.521 53.336  1.00 19.15 ? 583  LEU A C     1 
ATOM   3070  O  O     . LEU E 3 287 ? 110.375 -34.675 53.192  1.00 18.83 ? 583  LEU A O     1 
ATOM   3071  C  CB    . LEU E 3 287 ? 111.430 -31.689 54.175  1.00 18.82 ? 583  LEU A CB    1 
ATOM   3072  C  CG    . LEU E 3 287 ? 112.409 -30.530 53.982  1.00 19.34 ? 583  LEU A CG    1 
ATOM   3073  C  CD1   . LEU E 3 287 ? 112.858 -30.032 55.351  1.00 20.15 ? 583  LEU A CD1   1 
ATOM   3074  C  CD2   . LEU E 3 287 ? 113.616 -30.988 53.155  1.00 18.90 ? 583  LEU A CD2   1 
ATOM   3075  N  N     . GLN E 3 288 ? 108.765 -33.241 53.846  1.00 17.98 ? 584  GLN A N     1 
ATOM   3076  C  CA    . GLN E 3 288 ? 107.858 -34.298 54.287  1.00 18.41 ? 584  GLN A CA    1 
ATOM   3077  C  C     . GLN E 3 288 ? 107.322 -35.167 53.154  1.00 17.47 ? 584  GLN A C     1 
ATOM   3078  O  O     . GLN E 3 288 ? 107.396 -36.392 53.219  1.00 17.53 ? 584  GLN A O     1 
ATOM   3079  C  CB    . GLN E 3 288 ? 106.669 -33.704 55.058  1.00 20.64 ? 584  GLN A CB    1 
ATOM   3080  C  CG    . GLN E 3 288 ? 105.521 -34.695 55.271  1.00 24.27 ? 584  GLN A CG    1 
ATOM   3081  C  CD    . GLN E 3 288 ? 104.317 -34.084 55.971  1.00 27.90 ? 584  GLN A CD    1 
ATOM   3082  O  OE1   . GLN E 3 288 ? 104.193 -34.150 57.197  1.00 29.69 ? 584  GLN A OE1   1 
ATOM   3083  N  NE2   . GLN E 3 288 ? 103.426 -33.478 55.192  1.00 28.28 ? 584  GLN A NE2   1 
ATOM   3084  N  N     . SER E 3 289 ? 106.780 -34.538 52.117  1.00 15.63 ? 585  SER A N     1 
ATOM   3085  C  CA    . SER E 3 289 ? 106.209 -35.294 51.006  1.00 15.68 ? 585  SER A CA    1 
ATOM   3086  C  C     . SER E 3 289 ? 107.233 -36.071 50.194  1.00 16.06 ? 585  SER A C     1 
ATOM   3087  O  O     . SER E 3 289 ? 106.993 -37.209 49.793  1.00 16.16 ? 585  SER A O     1 
ATOM   3088  C  CB    . SER E 3 289 ? 105.470 -34.357 50.052  1.00 15.20 ? 585  SER A CB    1 
ATOM   3089  O  OG    . SER E 3 289 ? 106.398 -33.613 49.280  1.00 16.61 ? 585  SER A OG    1 
ATOM   3090  N  N     . THR E 3 290 ? 108.383 -35.449 49.968  1.00 16.27 ? 586  THR A N     1 
ATOM   3091  C  CA    . THR E 3 290 ? 109.413 -36.044 49.134  1.00 16.92 ? 586  THR A CA    1 
ATOM   3092  C  C     . THR E 3 290 ? 110.587 -36.757 49.791  1.00 16.70 ? 586  THR A C     1 
ATOM   3093  O  O     . THR E 3 290 ? 110.939 -37.871 49.390  1.00 15.79 ? 586  THR A O     1 
ATOM   3094  C  CB    . THR E 3 290 ? 109.986 -34.969 48.187  1.00 17.71 ? 586  THR A CB    1 
ATOM   3095  O  OG1   . THR E 3 290 ? 108.906 -34.339 47.485  1.00 18.36 ? 586  THR A OG1   1 
ATOM   3096  C  CG2   . THR E 3 290 ? 110.954 -35.590 47.183  1.00 17.97 ? 586  THR A CG2   1 
ATOM   3097  N  N     . TYR E 3 291 ? 111.191 -36.130 50.792  1.00 15.80 ? 587  TYR A N     1 
ATOM   3098  C  CA    . TYR E 3 291 ? 112.363 -36.715 51.420  1.00 16.60 ? 587  TYR A CA    1 
ATOM   3099  C  C     . TYR E 3 291 ? 112.116 -37.567 52.657  1.00 17.10 ? 587  TYR A C     1 
ATOM   3100  O  O     . TYR E 3 291 ? 113.051 -38.126 53.232  1.00 17.20 ? 587  TYR A O     1 
ATOM   3101  C  CB    . TYR E 3 291 ? 113.379 -35.606 51.688  1.00 15.47 ? 587  TYR A CB    1 
ATOM   3102  C  CG    . TYR E 3 291 ? 113.741 -34.877 50.407  1.00 16.11 ? 587  TYR A CG    1 
ATOM   3103  C  CD1   . TYR E 3 291 ? 113.237 -33.604 50.136  1.00 14.59 ? 587  TYR A CD1   1 
ATOM   3104  C  CD2   . TYR E 3 291 ? 114.563 -35.478 49.451  1.00 15.96 ? 587  TYR A CD2   1 
ATOM   3105  C  CE1   . TYR E 3 291 ? 113.542 -32.944 48.940  1.00 16.41 ? 587  TYR A CE1   1 
ATOM   3106  C  CE2   . TYR E 3 291 ? 114.874 -34.831 48.251  1.00 17.13 ? 587  TYR A CE2   1 
ATOM   3107  C  CZ    . TYR E 3 291 ? 114.360 -33.564 48.004  1.00 16.89 ? 587  TYR A CZ    1 
ATOM   3108  O  OH    . TYR E 3 291 ? 114.670 -32.922 46.828  1.00 16.50 ? 587  TYR A OH    1 
ATOM   3109  N  N     . ILE E 3 292 ? 110.853 -37.670 53.053  1.00 17.60 ? 588  ILE A N     1 
ATOM   3110  C  CA    . ILE E 3 292 ? 110.468 -38.500 54.186  1.00 18.98 ? 588  ILE A CA    1 
ATOM   3111  C  C     . ILE E 3 292 ? 109.519 -39.575 53.663  1.00 18.75 ? 588  ILE A C     1 
ATOM   3112  O  O     . ILE E 3 292 ? 109.888 -40.745 53.558  1.00 19.32 ? 588  ILE A O     1 
ATOM   3113  C  CB    . ILE E 3 292 ? 109.725 -37.698 55.278  1.00 20.88 ? 588  ILE A CB    1 
ATOM   3114  C  CG1   . ILE E 3 292 ? 110.646 -36.640 55.888  1.00 22.55 ? 588  ILE A CG1   1 
ATOM   3115  C  CG2   . ILE E 3 292 ? 109.226 -38.650 56.356  1.00 21.94 ? 588  ILE A CG2   1 
ATOM   3116  C  CD1   . ILE E 3 292 ? 111.828 -37.204 56.632  1.00 25.42 ? 588  ILE A CD1   1 
ATOM   3117  N  N     . GLU E 3 293 ? 108.301 -39.169 53.318  1.00 17.90 ? 589  GLU A N     1 
ATOM   3118  C  CA    . GLU E 3 293 ? 107.299 -40.105 52.820  1.00 19.14 ? 589  GLU A CA    1 
ATOM   3119  C  C     . GLU E 3 293 ? 107.690 -40.703 51.475  1.00 19.51 ? 589  GLU A C     1 
ATOM   3120  O  O     . GLU E 3 293 ? 107.711 -41.926 51.316  1.00 18.06 ? 589  GLU A O     1 
ATOM   3121  C  CB    . GLU E 3 293 ? 105.936 -39.411 52.714  1.00 21.29 ? 589  GLU A CB    1 
ATOM   3122  C  CG    . GLU E 3 293 ? 105.565 -38.618 53.971  1.00 24.77 ? 589  GLU A CG    1 
ATOM   3123  C  CD    . GLU E 3 293 ? 104.188 -37.982 53.895  1.00 27.50 ? 589  GLU A CD    1 
ATOM   3124  O  OE1   . GLU E 3 293 ? 103.704 -37.736 52.771  1.00 30.35 ? 589  GLU A OE1   1 
ATOM   3125  O  OE2   . GLU E 3 293 ? 103.592 -37.720 54.964  1.00 27.46 ? 589  GLU A OE2   1 
ATOM   3126  N  N     . GLY E 3 294 ? 108.007 -39.840 50.512  1.00 19.81 ? 590  GLY A N     1 
ATOM   3127  C  CA    . GLY E 3 294 ? 108.396 -40.311 49.195  1.00 18.78 ? 590  GLY A CA    1 
ATOM   3128  C  C     . GLY E 3 294 ? 109.596 -41.242 49.224  1.00 18.71 ? 590  GLY A C     1 
ATOM   3129  O  O     . GLY E 3 294 ? 109.622 -42.257 48.526  1.00 19.97 ? 590  GLY A O     1 
ATOM   3130  N  N     . LEU E 3 295 ? 110.593 -40.900 50.032  1.00 17.64 ? 591  LEU A N     1 
ATOM   3131  C  CA    . LEU E 3 295 ? 111.795 -41.716 50.152  1.00 18.37 ? 591  LEU A CA    1 
ATOM   3132  C  C     . LEU E 3 295 ? 111.479 -43.066 50.812  1.00 19.15 ? 591  LEU A C     1 
ATOM   3133  O  O     . LEU E 3 295 ? 111.929 -44.113 50.347  1.00 18.15 ? 591  LEU A O     1 
ATOM   3134  C  CB    . LEU E 3 295 ? 112.858 -40.960 50.959  1.00 18.35 ? 591  LEU A CB    1 
ATOM   3135  C  CG    . LEU E 3 295 ? 114.245 -41.597 51.092  1.00 20.34 ? 591  LEU A CG    1 
ATOM   3136  C  CD1   . LEU E 3 295 ? 114.816 -41.880 49.707  1.00 21.44 ? 591  LEU A CD1   1 
ATOM   3137  C  CD2   . LEU E 3 295 ? 115.167 -40.660 51.863  1.00 20.48 ? 591  LEU A CD2   1 
ATOM   3138  N  N     . LEU E 3 296 ? 110.693 -43.043 51.887  1.00 19.56 ? 592  LEU A N     1 
ATOM   3139  C  CA    . LEU E 3 296 ? 110.329 -44.277 52.580  1.00 20.62 ? 592  LEU A CA    1 
ATOM   3140  C  C     . LEU E 3 296 ? 109.584 -45.243 51.660  1.00 20.64 ? 592  LEU A C     1 
ATOM   3141  O  O     . LEU E 3 296 ? 109.723 -46.463 51.787  1.00 19.88 ? 592  LEU A O     1 
ATOM   3142  C  CB    . LEU E 3 296 ? 109.469 -43.968 53.809  1.00 21.11 ? 592  LEU A CB    1 
ATOM   3143  C  CG    . LEU E 3 296 ? 110.220 -43.378 55.006  1.00 23.21 ? 592  LEU A CG    1 
ATOM   3144  C  CD1   . LEU E 3 296 ? 109.232 -42.871 56.054  1.00 23.68 ? 592  LEU A CD1   1 
ATOM   3145  C  CD2   . LEU E 3 296 ? 111.141 -44.444 55.592  1.00 23.32 ? 592  LEU A CD2   1 
ATOM   3146  N  N     . LYS E 3 297 ? 108.807 -44.693 50.731  1.00 20.69 ? 593  LYS A N     1 
ATOM   3147  C  CA    . LYS E 3 297 ? 108.038 -45.502 49.788  1.00 22.41 ? 593  LYS A CA    1 
ATOM   3148  C  C     . LYS E 3 297 ? 108.894 -46.333 48.840  1.00 22.59 ? 593  LYS A C     1 
ATOM   3149  O  O     . LYS E 3 297 ? 108.443 -47.369 48.350  1.00 23.57 ? 593  LYS A O     1 
ATOM   3150  C  CB    . LYS E 3 297 ? 107.103 -44.619 48.957  1.00 23.81 ? 593  LYS A CB    1 
ATOM   3151  C  CG    . LYS E 3 297 ? 106.046 -43.898 49.768  1.00 27.40 ? 593  LYS A CG    1 
ATOM   3152  C  CD    . LYS E 3 297 ? 105.169 -43.024 48.881  1.00 30.67 ? 593  LYS A CD    1 
ATOM   3153  C  CE    . LYS E 3 297 ? 104.179 -42.223 49.711  1.00 32.66 ? 593  LYS A CE    1 
ATOM   3154  N  NZ    . LYS E 3 297 ? 103.294 -41.373 48.864  1.00 36.99 ? 593  LYS A NZ    1 
ATOM   3155  N  N     . VAL E 3 298 ? 110.119 -45.889 48.571  1.00 22.07 ? 594  VAL A N     1 
ATOM   3156  C  CA    . VAL E 3 298 ? 110.990 -46.630 47.661  1.00 21.36 ? 594  VAL A CA    1 
ATOM   3157  C  C     . VAL E 3 298 ? 112.080 -47.444 48.356  1.00 20.42 ? 594  VAL A C     1 
ATOM   3158  O  O     . VAL E 3 298 ? 112.876 -48.111 47.696  1.00 20.37 ? 594  VAL A O     1 
ATOM   3159  C  CB    . VAL E 3 298 ? 111.649 -45.693 46.606  1.00 21.80 ? 594  VAL A CB    1 
ATOM   3160  C  CG1   . VAL E 3 298 ? 110.584 -45.143 45.669  1.00 22.93 ? 594  VAL A CG1   1 
ATOM   3161  C  CG2   . VAL E 3 298 ? 112.383 -44.554 47.293  1.00 20.71 ? 594  VAL A CG2   1 
ATOM   3162  N  N     . VAL E 3 299 ? 112.119 -47.396 49.682  1.00 19.13 ? 595  VAL A N     1 
ATOM   3163  C  CA    . VAL E 3 299 ? 113.112 -48.170 50.423  1.00 20.49 ? 595  VAL A CA    1 
ATOM   3164  C  C     . VAL E 3 299 ? 112.742 -49.655 50.390  1.00 20.97 ? 595  VAL A C     1 
ATOM   3165  O  O     . VAL E 3 299 ? 111.598 -50.014 50.674  1.00 19.40 ? 595  VAL A O     1 
ATOM   3166  C  CB    . VAL E 3 299 ? 113.182 -47.729 51.903  1.00 20.96 ? 595  VAL A CB    1 
ATOM   3167  C  CG1   . VAL E 3 299 ? 114.110 -48.656 52.681  1.00 21.81 ? 595  VAL A CG1   1 
ATOM   3168  C  CG2   . VAL E 3 299 ? 113.672 -46.296 51.997  1.00 20.86 ? 595  VAL A CG2   1 
ATOM   3169  N  N     . ARG E 3 300 ? 113.695 -50.516 50.037  1.00 21.31 ? 596  ARG A N     1 
ATOM   3170  C  CA    . ARG E 3 300 ? 113.434 -51.957 50.027  1.00 23.33 ? 596  ARG A CA    1 
ATOM   3171  C  C     . ARG E 3 300 ? 113.454 -52.392 51.494  1.00 22.10 ? 596  ARG A C     1 
ATOM   3172  O  O     . ARG E 3 300 ? 114.506 -52.417 52.134  1.00 22.24 ? 596  ARG A O     1 
ATOM   3173  C  CB    . ARG E 3 300 ? 114.506 -52.709 49.233  1.00 24.78 ? 596  ARG A CB    1 
ATOM   3174  C  CG    . ARG E 3 300 ? 114.457 -52.436 47.739  1.00 29.99 ? 596  ARG A CG    1 
ATOM   3175  C  CD    . ARG E 3 300 ? 115.425 -53.331 46.983  1.00 34.36 ? 596  ARG A CD    1 
ATOM   3176  N  NE    . ARG E 3 300 ? 115.068 -54.745 47.070  1.00 39.87 ? 596  ARG A NE    1 
ATOM   3177  C  CZ    . ARG E 3 300 ? 114.000 -55.286 46.492  1.00 40.55 ? 596  ARG A CZ    1 
ATOM   3178  N  NH1   . ARG E 3 300 ? 113.174 -54.531 45.779  1.00 42.43 ? 596  ARG A NH1   1 
ATOM   3179  N  NH2   . ARG E 3 300 ? 113.760 -56.585 46.622  1.00 41.92 ? 596  ARG A NH2   1 
ATOM   3180  N  N     . PRO E 3 301 ? 112.283 -52.747 52.039  1.00 22.38 ? 597  PRO A N     1 
ATOM   3181  C  CA    . PRO E 3 301 ? 112.134 -53.170 53.435  1.00 21.88 ? 597  PRO A CA    1 
ATOM   3182  C  C     . PRO E 3 301 ? 113.169 -54.147 53.985  1.00 21.81 ? 597  PRO A C     1 
ATOM   3183  O  O     . PRO E 3 301 ? 113.774 -53.895 55.029  1.00 22.38 ? 597  PRO A O     1 
ATOM   3184  C  CB    . PRO E 3 301 ? 110.714 -53.730 53.474  1.00 22.32 ? 597  PRO A CB    1 
ATOM   3185  C  CG    . PRO E 3 301 ? 110.001 -52.894 52.447  1.00 22.24 ? 597  PRO A CG    1 
ATOM   3186  C  CD    . PRO E 3 301 ? 111.004 -52.883 51.317  1.00 21.68 ? 597  PRO A CD    1 
ATOM   3187  N  N     . ALA E 3 302 ? 113.375 -55.254 53.280  1.00 21.28 ? 598  ALA A N     1 
ATOM   3188  C  CA    . ALA E 3 302 ? 114.307 -56.290 53.718  1.00 22.34 ? 598  ALA A CA    1 
ATOM   3189  C  C     . ALA E 3 302 ? 115.761 -55.865 53.902  1.00 24.13 ? 598  ALA A C     1 
ATOM   3190  O  O     . ALA E 3 302 ? 116.463 -56.406 54.761  1.00 25.00 ? 598  ALA A O     1 
ATOM   3191  C  CB    . ALA E 3 302 ? 114.236 -57.474 52.763  1.00 22.35 ? 598  ALA A CB    1 
ATOM   3192  N  N     . THR E 3 303 ? 116.220 -54.904 53.106  1.00 21.35 ? 599  THR A N     1 
ATOM   3193  C  CA    . THR E 3 303 ? 117.609 -54.456 53.189  1.00 20.48 ? 599  THR A CA    1 
ATOM   3194  C  C     . THR E 3 303 ? 117.763 -52.999 53.614  1.00 19.23 ? 599  THR A C     1 
ATOM   3195  O  O     . THR E 3 303 ? 118.866 -52.561 53.947  1.00 18.44 ? 599  THR A O     1 
ATOM   3196  C  CB    . THR E 3 303 ? 118.314 -54.620 51.827  1.00 20.27 ? 599  THR A CB    1 
ATOM   3197  O  OG1   . THR E 3 303 ? 117.661 -53.790 50.854  1.00 20.46 ? 599  THR A OG1   1 
ATOM   3198  C  CG2   . THR E 3 303 ? 118.252 -56.071 51.364  1.00 18.02 ? 599  THR A CG2   1 
ATOM   3199  N  N     . LYS E 3 304 ? 116.657 -52.262 53.598  1.00 19.01 ? 600  LYS A N     1 
ATOM   3200  C  CA    . LYS E 3 304 ? 116.645 -50.843 53.946  1.00 19.38 ? 600  LYS A CA    1 
ATOM   3201  C  C     . LYS E 3 304 ? 117.497 -50.019 52.990  1.00 20.19 ? 600  LYS A C     1 
ATOM   3202  O  O     . LYS E 3 304 ? 118.015 -48.962 53.352  1.00 21.42 ? 600  LYS A O     1 
ATOM   3203  C  CB    . LYS E 3 304 ? 117.123 -50.622 55.383  1.00 18.83 ? 600  LYS A CB    1 
ATOM   3204  C  CG    . LYS E 3 304 ? 116.132 -51.114 56.426  1.00 19.37 ? 600  LYS A CG    1 
ATOM   3205  C  CD    . LYS E 3 304 ? 116.395 -50.500 57.787  1.00 20.50 ? 600  LYS A CD    1 
ATOM   3206  C  CE    . LYS E 3 304 ? 115.359 -50.972 58.796  1.00 22.94 ? 600  LYS A CE    1 
ATOM   3207  N  NZ    . LYS E 3 304 ? 115.477 -52.434 59.060  1.00 25.22 ? 600  LYS A NZ    1 
ATOM   3208  N  N     . LYS E 3 305 ? 117.633 -50.510 51.763  1.00 19.85 ? 601  LYS A N     1 
ATOM   3209  C  CA    . LYS E 3 305 ? 118.410 -49.815 50.742  1.00 18.32 ? 601  LYS A CA    1 
ATOM   3210  C  C     . LYS E 3 305 ? 117.508 -49.197 49.683  1.00 18.20 ? 601  LYS A C     1 
ATOM   3211  O  O     . LYS E 3 305 ? 116.409 -49.696 49.418  1.00 16.21 ? 601  LYS A O     1 
ATOM   3212  C  CB    . LYS E 3 305 ? 119.366 -50.782 50.040  1.00 20.91 ? 601  LYS A CB    1 
ATOM   3213  C  CG    . LYS E 3 305 ? 120.641 -51.114 50.786  1.00 23.51 ? 601  LYS A CG    1 
ATOM   3214  C  CD    . LYS E 3 305 ? 121.511 -51.983 49.895  1.00 24.55 ? 601  LYS A CD    1 
ATOM   3215  C  CE    . LYS E 3 305 ? 122.882 -52.237 50.482  1.00 25.39 ? 601  LYS A CE    1 
ATOM   3216  N  NZ    . LYS E 3 305 ? 123.649 -53.136 49.569  1.00 24.04 ? 601  LYS A NZ    1 
ATOM   3217  N  N     . VAL E 3 306 ? 117.974 -48.105 49.084  1.00 17.08 ? 602  VAL A N     1 
ATOM   3218  C  CA    . VAL E 3 306 ? 117.239 -47.465 48.004  1.00 16.97 ? 602  VAL A CA    1 
ATOM   3219  C  C     . VAL E 3 306 ? 118.109 -47.667 46.771  1.00 16.37 ? 602  VAL A C     1 
ATOM   3220  O  O     . VAL E 3 306 ? 119.331 -47.521 46.834  1.00 17.42 ? 602  VAL A O     1 
ATOM   3221  C  CB    . VAL E 3 306 ? 117.018 -45.952 48.249  1.00 18.21 ? 602  VAL A CB    1 
ATOM   3222  C  CG1   . VAL E 3 306 ? 115.998 -45.758 49.357  1.00 19.66 ? 602  VAL A CG1   1 
ATOM   3223  C  CG2   . VAL E 3 306 ? 118.332 -45.276 48.607  1.00 19.32 ? 602  VAL A CG2   1 
ATOM   3224  N  N     . HIS E 3 307 ? 117.484 -48.014 45.656  1.00 16.39 ? 603  HIS A N     1 
ATOM   3225  C  CA    . HIS E 3 307 ? 118.221 -48.257 44.423  1.00 17.20 ? 603  HIS A CA    1 
ATOM   3226  C  C     . HIS E 3 307 ? 117.772 -47.303 43.321  1.00 15.94 ? 603  HIS A C     1 
ATOM   3227  O  O     . HIS E 3 307 ? 116.768 -47.544 42.655  1.00 14.98 ? 603  HIS A O     1 
ATOM   3228  C  CB    . HIS E 3 307 ? 118.003 -49.705 43.978  1.00 18.28 ? 603  HIS A CB    1 
ATOM   3229  C  CG    . HIS E 3 307 ? 118.453 -50.718 44.987  1.00 20.75 ? 603  HIS A CG    1 
ATOM   3230  N  ND1   . HIS E 3 307 ? 119.726 -51.248 44.996  1.00 20.16 ? 603  HIS A ND1   1 
ATOM   3231  C  CD2   . HIS E 3 307 ? 117.809 -51.267 46.045  1.00 20.31 ? 603  HIS A CD2   1 
ATOM   3232  C  CE1   . HIS E 3 307 ? 119.847 -52.081 46.016  1.00 20.88 ? 603  HIS A CE1   1 
ATOM   3233  N  NE2   . HIS E 3 307 ? 118.698 -52.111 46.668  1.00 18.44 ? 603  HIS A NE2   1 
ATOM   3234  N  N     . THR E 3 308 ? 118.520 -46.222 43.132  1.00 15.76 ? 604  THR A N     1 
ATOM   3235  C  CA    . THR E 3 308 ? 118.178 -45.253 42.098  1.00 15.32 ? 604  THR A CA    1 
ATOM   3236  C  C     . THR E 3 308 ? 118.543 -45.810 40.733  1.00 15.70 ? 604  THR A C     1 
ATOM   3237  O  O     . THR E 3 308 ? 119.176 -46.864 40.619  1.00 14.25 ? 604  THR A O     1 
ATOM   3238  C  CB    . THR E 3 308 ? 118.943 -43.920 42.278  1.00 16.15 ? 604  THR A CB    1 
ATOM   3239  O  OG1   . THR E 3 308 ? 118.423 -42.944 41.365  1.00 15.71 ? 604  THR A OG1   1 
ATOM   3240  C  CG2   . THR E 3 308 ? 120.433 -44.113 41.988  1.00 13.69 ? 604  THR A CG2   1 
ATOM   3241  N  N     . ILE E 3 309 ? 118.122 -45.097 39.698  1.00 15.02 ? 605  ILE A N     1 
ATOM   3242  C  CA    . ILE E 3 309 ? 118.446 -45.468 38.331  1.00 14.32 ? 605  ILE A CA    1 
ATOM   3243  C  C     . ILE E 3 309 ? 119.013 -44.205 37.711  1.00 16.26 ? 605  ILE A C     1 
ATOM   3244  O  O     . ILE E 3 309 ? 118.352 -43.163 37.681  1.00 15.23 ? 605  ILE A O     1 
ATOM   3245  C  CB    . ILE E 3 309 ? 117.207 -45.931 37.533  1.00 15.50 ? 605  ILE A CB    1 
ATOM   3246  C  CG1   . ILE E 3 309 ? 116.790 -47.332 38.000  1.00 14.46 ? 605  ILE A CG1   1 
ATOM   3247  C  CG2   . ILE E 3 309 ? 117.522 -45.947 36.030  1.00 15.76 ? 605  ILE A CG2   1 
ATOM   3248  C  CD1   . ILE E 3 309 ? 115.565 -47.883 37.285  1.00 18.02 ? 605  ILE A CD1   1 
ATOM   3249  N  N     . PHE E 3 310 ? 120.249 -44.298 37.238  1.00 15.90 ? 606  PHE A N     1 
ATOM   3250  C  CA    . PHE E 3 310 ? 120.906 -43.170 36.612  1.00 16.00 ? 606  PHE A CA    1 
ATOM   3251  C  C     . PHE E 3 310 ? 120.599 -43.231 35.128  1.00 17.26 ? 606  PHE A C     1 
ATOM   3252  O  O     . PHE E 3 310 ? 121.053 -44.146 34.433  1.00 17.44 ? 606  PHE A O     1 
ATOM   3253  C  CB    . PHE E 3 310 ? 122.419 -43.252 36.837  1.00 16.64 ? 606  PHE A CB    1 
ATOM   3254  C  CG    . PHE E 3 310 ? 122.840 -42.934 38.239  1.00 17.26 ? 606  PHE A CG    1 
ATOM   3255  C  CD1   . PHE E 3 310 ? 122.815 -41.623 38.702  1.00 18.25 ? 606  PHE A CD1   1 
ATOM   3256  C  CD2   . PHE E 3 310 ? 123.249 -43.944 39.106  1.00 18.83 ? 606  PHE A CD2   1 
ATOM   3257  C  CE1   . PHE E 3 310 ? 123.193 -41.318 40.007  1.00 18.69 ? 606  PHE A CE1   1 
ATOM   3258  C  CE2   . PHE E 3 310 ? 123.629 -43.652 40.413  1.00 18.78 ? 606  PHE A CE2   1 
ATOM   3259  C  CZ    . PHE E 3 310 ? 123.601 -42.337 40.865  1.00 19.47 ? 606  PHE A CZ    1 
ATOM   3260  N  N     . ASN E 3 311 ? 119.821 -42.274 34.638  1.00 16.06 ? 607  ASN A N     1 
ATOM   3261  C  CA    . ASN E 3 311 ? 119.506 -42.257 33.220  1.00 16.12 ? 607  ASN A CA    1 
ATOM   3262  C  C     . ASN E 3 311 ? 120.736 -41.674 32.540  1.00 16.59 ? 607  ASN A C     1 
ATOM   3263  O  O     . ASN E 3 311 ? 121.076 -40.504 32.731  1.00 16.12 ? 607  ASN A O     1 
ATOM   3264  C  CB    . ASN E 3 311 ? 118.277 -41.396 32.924  1.00 15.82 ? 607  ASN A CB    1 
ATOM   3265  C  CG    . ASN E 3 311 ? 117.710 -41.668 31.540  1.00 16.86 ? 607  ASN A CG    1 
ATOM   3266  O  OD1   . ASN E 3 311 ? 118.461 -41.854 30.580  1.00 18.44 ? 607  ASN A OD1   1 
ATOM   3267  N  ND2   . ASN E 3 311 ? 116.386 -41.693 31.430  1.00 15.42 ? 607  ASN A ND2   1 
ATOM   3268  N  N     . GLN E 3 312 ? 121.401 -42.508 31.750  1.00 15.52 ? 608  GLN A N     1 
ATOM   3269  C  CA    . GLN E 3 312 ? 122.618 -42.125 31.055  1.00 15.73 ? 608  GLN A CA    1 
ATOM   3270  C  C     . GLN E 3 312 ? 122.370 -41.587 29.641  1.00 16.21 ? 608  GLN A C     1 
ATOM   3271  O  O     . GLN E 3 312 ? 123.293 -41.085 28.999  1.00 16.52 ? 608  GLN A O     1 
ATOM   3272  C  CB    . GLN E 3 312 ? 123.548 -43.342 30.997  1.00 14.28 ? 608  GLN A CB    1 
ATOM   3273  C  CG    . GLN E 3 312 ? 124.932 -43.075 30.462  1.00 16.02 ? 608  GLN A CG    1 
ATOM   3274  C  CD    . GLN E 3 312 ? 125.770 -44.340 30.390  1.00 15.08 ? 608  GLN A CD    1 
ATOM   3275  O  OE1   . GLN E 3 312 ? 125.316 -45.420 30.773  1.00 15.51 ? 608  GLN A OE1   1 
ATOM   3276  N  NE2   . GLN E 3 312 ? 126.999 -44.213 29.899  1.00 14.00 ? 608  GLN A NE2   1 
ATOM   3277  N  N     . ALA E 3 313 ? 121.131 -41.686 29.158  1.00 14.82 ? 609  ALA A N     1 
ATOM   3278  C  CA    . ALA E 3 313 ? 120.808 -41.220 27.807  1.00 15.55 ? 609  ALA A CA    1 
ATOM   3279  C  C     . ALA E 3 313 ? 119.606 -40.272 27.782  1.00 16.24 ? 609  ALA A C     1 
ATOM   3280  O  O     . ALA E 3 313 ? 118.671 -40.457 26.995  1.00 15.11 ? 609  ALA A O     1 
ATOM   3281  C  CB    . ALA E 3 313 ? 120.539 -42.412 26.906  1.00 16.33 ? 609  ALA A CB    1 
ATOM   3282  N  N     . LEU E 3 314 ? 119.639 -39.248 28.625  1.00 14.12 ? 610  LEU A N     1 
ATOM   3283  C  CA    . LEU E 3 314 ? 118.531 -38.310 28.683  1.00 15.76 ? 610  LEU A CA    1 
ATOM   3284  C  C     . LEU E 3 314 ? 118.891 -36.831 28.534  1.00 15.27 ? 610  LEU A C     1 
ATOM   3285  O  O     . LEU E 3 314 ? 118.370 -36.162 27.642  1.00 15.60 ? 610  LEU A O     1 
ATOM   3286  C  CB    . LEU E 3 314 ? 117.743 -38.531 29.985  1.00 15.78 ? 610  LEU A CB    1 
ATOM   3287  C  CG    . LEU E 3 314 ? 116.476 -37.699 30.221  1.00 17.07 ? 610  LEU A CG    1 
ATOM   3288  C  CD1   . LEU E 3 314 ? 115.594 -38.408 31.233  1.00 21.64 ? 610  LEU A CD1   1 
ATOM   3289  C  CD2   . LEU E 3 314 ? 116.838 -36.311 30.725  1.00 19.59 ? 610  LEU A CD2   1 
ATOM   3290  N  N     . THR E 3 315 ? 119.776 -36.316 29.384  1.00 15.58 ? 611  THR A N     1 
ATOM   3291  C  CA    . THR E 3 315 ? 120.116 -34.897 29.317  1.00 15.21 ? 611  THR A CA    1 
ATOM   3292  C  C     . THR E 3 315 ? 120.736 -34.471 27.988  1.00 16.12 ? 611  THR A C     1 
ATOM   3293  O  O     . THR E 3 315 ? 121.434 -35.239 27.322  1.00 16.56 ? 611  THR A O     1 
ATOM   3294  C  CB    . THR E 3 315 ? 121.050 -34.464 30.474  1.00 15.35 ? 611  THR A CB    1 
ATOM   3295  O  OG1   . THR E 3 315 ? 122.388 -34.910 30.223  1.00 14.71 ? 611  THR A OG1   1 
ATOM   3296  C  CG2   . THR E 3 315 ? 120.553 -35.050 31.800  1.00 13.86 ? 611  THR A CG2   1 
ATOM   3297  N  N     . GLN E 3 316 ? 120.471 -33.225 27.618  1.00 15.20 ? 612  GLN A N     1 
ATOM   3298  C  CA    . GLN E 3 316 ? 120.958 -32.671 26.366  1.00 15.78 ? 612  GLN A CA    1 
ATOM   3299  C  C     . GLN E 3 316 ? 122.419 -32.247 26.392  1.00 15.09 ? 612  GLN A C     1 
ATOM   3300  O  O     . GLN E 3 316 ? 122.994 -31.940 25.343  1.00 15.38 ? 612  GLN A O     1 
ATOM   3301  C  CB    . GLN E 3 316 ? 120.089 -31.477 25.976  1.00 14.09 ? 612  GLN A CB    1 
ATOM   3302  C  CG    . GLN E 3 316 ? 118.633 -31.839 25.775  1.00 15.62 ? 612  GLN A CG    1 
ATOM   3303  C  CD    . GLN E 3 316 ? 118.471 -32.958 24.770  1.00 18.19 ? 612  GLN A CD    1 
ATOM   3304  O  OE1   . GLN E 3 316 ? 118.886 -32.829 23.619  1.00 17.64 ? 612  GLN A OE1   1 
ATOM   3305  N  NE2   . GLN E 3 316 ? 117.877 -34.069 25.202  1.00 16.12 ? 612  GLN A NE2   1 
ATOM   3306  N  N     . THR E 3 317 ? 123.017 -32.237 27.580  1.00 14.21 ? 613  THR A N     1 
ATOM   3307  C  CA    . THR E 3 317 ? 124.408 -31.818 27.748  1.00 14.53 ? 613  THR A CA    1 
ATOM   3308  C  C     . THR E 3 317 ? 125.392 -32.941 28.060  1.00 15.77 ? 613  THR A C     1 
ATOM   3309  O  O     . THR E 3 317 ? 126.605 -32.718 28.090  1.00 16.02 ? 613  THR A O     1 
ATOM   3310  C  CB    . THR E 3 317 ? 124.536 -30.794 28.882  1.00 16.23 ? 613  THR A CB    1 
ATOM   3311  O  OG1   . THR E 3 317 ? 124.062 -31.384 30.098  1.00 14.96 ? 613  THR A OG1   1 
ATOM   3312  C  CG2   . THR E 3 317 ? 123.731 -29.547 28.580  1.00 15.24 ? 613  THR A CG2   1 
ATOM   3313  N  N     . GLY E 3 318 ? 124.883 -34.142 28.303  1.00 15.08 ? 614  GLY A N     1 
ATOM   3314  C  CA    . GLY E 3 318 ? 125.777 -35.243 28.610  1.00 14.68 ? 614  GLY A CA    1 
ATOM   3315  C  C     . GLY E 3 318 ? 125.776 -35.605 30.080  1.00 14.41 ? 614  GLY A C     1 
ATOM   3316  O  O     . GLY E 3 318 ? 126.432 -36.566 30.488  1.00 15.63 ? 614  GLY A O     1 
ATOM   3317  N  N     . ARG E 3 319 ? 125.047 -34.836 30.884  1.00 13.56 ? 615  ARG A N     1 
ATOM   3318  C  CA    . ARG E 3 319 ? 124.957 -35.129 32.309  1.00 13.63 ? 615  ARG A CA    1 
ATOM   3319  C  C     . ARG E 3 319 ? 124.097 -36.371 32.516  1.00 14.10 ? 615  ARG A C     1 
ATOM   3320  O  O     . ARG E 3 319 ? 123.417 -36.836 31.599  1.00 14.14 ? 615  ARG A O     1 
ATOM   3321  C  CB    . ARG E 3 319 ? 124.310 -33.969 33.072  1.00 13.80 ? 615  ARG A CB    1 
ATOM   3322  C  CG    . ARG E 3 319 ? 125.244 -32.820 33.432  1.00 13.19 ? 615  ARG A CG    1 
ATOM   3323  C  CD    . ARG E 3 319 ? 124.601 -31.940 34.506  1.00 14.13 ? 615  ARG A CD    1 
ATOM   3324  N  NE    . ARG E 3 319 ? 125.505 -30.918 35.037  1.00 11.98 ? 615  ARG A NE    1 
ATOM   3325  C  CZ    . ARG E 3 319 ? 125.164 -30.063 36.000  1.00 14.19 ? 615  ARG A CZ    1 
ATOM   3326  N  NH1   . ARG E 3 319 ? 123.947 -30.117 36.532  1.00 11.79 ? 615  ARG A NH1   1 
ATOM   3327  N  NH2   . ARG E 3 319 ? 126.031 -29.150 36.429  1.00 13.17 ? 615  ARG A NH2   1 
ATOM   3328  N  N     . LEU E 3 320 ? 124.141 -36.910 33.726  1.00 13.92 ? 616  LEU A N     1 
ATOM   3329  C  CA    . LEU E 3 320 ? 123.313 -38.056 34.080  1.00 14.95 ? 616  LEU A CA    1 
ATOM   3330  C  C     . LEU E 3 320 ? 122.116 -37.446 34.799  1.00 13.73 ? 616  LEU A C     1 
ATOM   3331  O  O     . LEU E 3 320 ? 122.149 -36.273 35.168  1.00 12.16 ? 616  LEU A O     1 
ATOM   3332  C  CB    . LEU E 3 320 ? 124.035 -38.983 35.071  1.00 15.01 ? 616  LEU A CB    1 
ATOM   3333  C  CG    . LEU E 3 320 ? 125.334 -39.695 34.697  1.00 14.53 ? 616  LEU A CG    1 
ATOM   3334  C  CD1   . LEU E 3 320 ? 125.893 -40.422 35.932  1.00 14.21 ? 616  LEU A CD1   1 
ATOM   3335  C  CD2   . LEU E 3 320 ? 125.068 -40.681 33.565  1.00 14.81 ? 616  LEU A CD2   1 
ATOM   3336  N  N     . SER E 3 321 ? 121.056 -38.226 34.981  1.00 13.72 ? 617  SER A N     1 
ATOM   3337  C  CA    . SER E 3 321 ? 119.916 -37.764 35.767  1.00 14.95 ? 617  SER A CA    1 
ATOM   3338  C  C     . SER E 3 321 ? 119.665 -38.951 36.697  1.00 15.84 ? 617  SER A C     1 
ATOM   3339  O  O     . SER E 3 321 ? 120.160 -40.049 36.437  1.00 14.71 ? 617  SER A O     1 
ATOM   3340  C  CB    . SER E 3 321 ? 118.684 -37.438 34.905  1.00 13.51 ? 617  SER A CB    1 
ATOM   3341  O  OG    . SER E 3 321 ? 118.015 -38.586 34.429  1.00 17.37 ? 617  SER A OG    1 
ATOM   3342  N  N     . SER E 3 322 ? 118.919 -38.736 37.773  1.00 15.67 ? 618  SER A N     1 
ATOM   3343  C  CA    . SER E 3 322 ? 118.654 -39.798 38.741  1.00 15.68 ? 618  SER A CA    1 
ATOM   3344  C  C     . SER E 3 322 ? 117.167 -39.866 39.066  1.00 15.86 ? 618  SER A C     1 
ATOM   3345  O  O     . SER E 3 322 ? 116.556 -38.841 39.373  1.00 13.14 ? 618  SER A O     1 
ATOM   3346  C  CB    . SER E 3 322 ? 119.457 -39.532 40.019  1.00 15.98 ? 618  SER A CB    1 
ATOM   3347  O  OG    . SER E 3 322 ? 119.121 -40.444 41.053  1.00 14.81 ? 618  SER A OG    1 
ATOM   3348  N  N     . THR E 3 323 ? 116.585 -41.065 39.002  1.00 15.16 ? 619  THR A N     1 
ATOM   3349  C  CA    . THR E 3 323 ? 115.160 -41.212 39.287  1.00 16.45 ? 619  THR A CA    1 
ATOM   3350  C  C     . THR E 3 323 ? 114.754 -42.371 40.201  1.00 18.43 ? 619  THR A C     1 
ATOM   3351  O  O     . THR E 3 323 ? 115.470 -43.372 40.347  1.00 15.28 ? 619  THR A O     1 
ATOM   3352  C  CB    . THR E 3 323 ? 114.335 -41.370 37.993  1.00 17.42 ? 619  THR A CB    1 
ATOM   3353  O  OG1   . THR E 3 323 ? 114.634 -42.635 37.391  1.00 19.78 ? 619  THR A OG1   1 
ATOM   3354  C  CG2   . THR E 3 323 ? 114.654 -40.254 37.002  1.00 15.61 ? 619  THR A CG2   1 
ATOM   3355  N  N     . GLU E 3 324 ? 113.580 -42.195 40.805  1.00 18.87 ? 620  GLU A N     1 
ATOM   3356  C  CA    . GLU E 3 324 ? 112.934 -43.160 41.690  1.00 20.16 ? 620  GLU A CA    1 
ATOM   3357  C  C     . GLU E 3 324 ? 113.850 -43.990 42.587  1.00 18.35 ? 620  GLU A C     1 
ATOM   3358  O  O     . GLU E 3 324 ? 113.985 -45.199 42.396  1.00 19.96 ? 620  GLU A O     1 
ATOM   3359  C  CB    . GLU E 3 324 ? 112.058 -44.095 40.845  1.00 22.16 ? 620  GLU A CB    1 
ATOM   3360  C  CG    . GLU E 3 324 ? 110.898 -44.723 41.606  1.00 27.94 ? 620  GLU A CG    1 
ATOM   3361  C  CD    . GLU E 3 324 ? 110.025 -45.600 40.725  1.00 30.98 ? 620  GLU A CD    1 
ATOM   3362  O  OE1   . GLU E 3 324 ? 110.291 -46.816 40.631  1.00 33.63 ? 620  GLU A OE1   1 
ATOM   3363  O  OE2   . GLU E 3 324 ? 109.072 -45.069 40.118  1.00 33.82 ? 620  GLU A OE2   1 
ATOM   3364  N  N     . PRO E 3 325 ? 114.471 -43.361 43.594  1.00 17.03 ? 621  PRO A N     1 
ATOM   3365  C  CA    . PRO E 3 325 ? 114.377 -41.939 43.945  1.00 16.46 ? 621  PRO A CA    1 
ATOM   3366  C  C     . PRO E 3 325 ? 115.499 -41.131 43.305  1.00 16.99 ? 621  PRO A C     1 
ATOM   3367  O  O     . PRO E 3 325 ? 116.532 -41.689 42.926  1.00 15.27 ? 621  PRO A O     1 
ATOM   3368  C  CB    . PRO E 3 325 ? 114.483 -41.958 45.456  1.00 15.63 ? 621  PRO A CB    1 
ATOM   3369  C  CG    . PRO E 3 325 ? 115.553 -43.015 45.655  1.00 14.80 ? 621  PRO A CG    1 
ATOM   3370  C  CD    . PRO E 3 325 ? 115.146 -44.113 44.671  1.00 17.20 ? 621  PRO A CD    1 
ATOM   3371  N  N     . ASN E 3 326 ? 115.300 -39.822 43.185  1.00 15.88 ? 622  ASN A N     1 
ATOM   3372  C  CA    . ASN E 3 326 ? 116.350 -38.976 42.642  1.00 16.50 ? 622  ASN A CA    1 
ATOM   3373  C  C     . ASN E 3 326 ? 117.291 -38.764 43.814  1.00 16.80 ? 622  ASN A C     1 
ATOM   3374  O  O     . ASN E 3 326 ? 116.915 -38.144 44.809  1.00 16.61 ? 622  ASN A O     1 
ATOM   3375  C  CB    . ASN E 3 326 ? 115.806 -37.620 42.181  1.00 14.81 ? 622  ASN A CB    1 
ATOM   3376  C  CG    . ASN E 3 326 ? 116.905 -36.699 41.668  1.00 15.78 ? 622  ASN A CG    1 
ATOM   3377  O  OD1   . ASN E 3 326 ? 118.090 -36.947 41.896  1.00 14.22 ? 622  ASN A OD1   1 
ATOM   3378  N  ND2   . ASN E 3 326 ? 116.516 -35.628 40.979  1.00 14.98 ? 622  ASN A ND2   1 
ATOM   3379  N  N     . LEU E 3 327 ? 118.507 -39.283 43.709  1.00 15.89 ? 623  LEU A N     1 
ATOM   3380  C  CA    . LEU E 3 327 ? 119.470 -39.121 44.785  1.00 16.90 ? 623  LEU A CA    1 
ATOM   3381  C  C     . LEU E 3 327 ? 120.468 -38.006 44.485  1.00 16.29 ? 623  LEU A C     1 
ATOM   3382  O  O     . LEU E 3 327 ? 121.473 -37.863 45.179  1.00 17.12 ? 623  LEU A O     1 
ATOM   3383  C  CB    . LEU E 3 327 ? 120.193 -40.445 45.053  1.00 14.90 ? 623  LEU A CB    1 
ATOM   3384  C  CG    . LEU E 3 327 ? 119.253 -41.553 45.549  1.00 16.16 ? 623  LEU A CG    1 
ATOM   3385  C  CD1   . LEU E 3 327 ? 120.047 -42.814 45.859  1.00 15.00 ? 623  LEU A CD1   1 
ATOM   3386  C  CD2   . LEU E 3 327 ? 118.504 -41.070 46.792  1.00 16.72 ? 623  LEU A CD2   1 
ATOM   3387  N  N     . GLN E 3 328 ? 120.178 -37.215 43.453  1.00 15.86 ? 624  GLN A N     1 
ATOM   3388  C  CA    . GLN E 3 328 ? 121.034 -36.089 43.085  1.00 15.16 ? 624  GLN A CA    1 
ATOM   3389  C  C     . GLN E 3 328 ? 120.444 -34.746 43.517  1.00 15.19 ? 624  GLN A C     1 
ATOM   3390  O  O     . GLN E 3 328 ? 120.992 -33.689 43.183  1.00 14.92 ? 624  GLN A O     1 
ATOM   3391  C  CB    . GLN E 3 328 ? 121.288 -36.064 41.576  1.00 13.00 ? 624  GLN A CB    1 
ATOM   3392  C  CG    . GLN E 3 328 ? 121.998 -37.301 41.053  1.00 12.64 ? 624  GLN A CG    1 
ATOM   3393  C  CD    . GLN E 3 328 ? 122.267 -37.221 39.565  1.00 13.60 ? 624  GLN A CD    1 
ATOM   3394  O  OE1   . GLN E 3 328 ? 121.391 -36.850 38.791  1.00 10.63 ? 624  GLN A OE1   1 
ATOM   3395  N  NE2   . GLN E 3 328 ? 123.483 -37.574 39.159  1.00 15.16 ? 624  GLN A NE2   1 
ATOM   3396  N  N     . ASN E 3 329 ? 119.328 -34.774 44.245  1.00 14.84 ? 625  ASN A N     1 
ATOM   3397  C  CA    . ASN E 3 329 ? 118.731 -33.532 44.728  1.00 15.33 ? 625  ASN A CA    1 
ATOM   3398  C  C     . ASN E 3 329 ? 118.272 -33.636 46.183  1.00 16.70 ? 625  ASN A C     1 
ATOM   3399  O  O     . ASN E 3 329 ? 117.227 -33.106 46.566  1.00 17.43 ? 625  ASN A O     1 
ATOM   3400  C  CB    . ASN E 3 329 ? 117.579 -33.083 43.815  1.00 14.59 ? 625  ASN A CB    1 
ATOM   3401  C  CG    . ASN E 3 329 ? 116.319 -33.913 43.982  1.00 15.94 ? 625  ASN A CG    1 
ATOM   3402  O  OD1   . ASN E 3 329 ? 116.355 -35.047 44.455  1.00 15.52 ? 625  ASN A OD1   1 
ATOM   3403  N  ND2   . ASN E 3 329 ? 115.187 -33.342 43.574  1.00 16.89 ? 625  ASN A ND2   1 
ATOM   3404  N  N     . ILE E 3 330 ? 119.070 -34.328 46.990  1.00 16.72 ? 626  ILE A N     1 
ATOM   3405  C  CA    . ILE E 3 330 ? 118.777 -34.476 48.410  1.00 16.44 ? 626  ILE A CA    1 
ATOM   3406  C  C     . ILE E 3 330 ? 119.194 -33.157 49.064  1.00 17.19 ? 626  ILE A C     1 
ATOM   3407  O  O     . ILE E 3 330 ? 120.256 -32.617 48.754  1.00 18.03 ? 626  ILE A O     1 
ATOM   3408  C  CB    . ILE E 3 330 ? 119.573 -35.662 49.022  1.00 16.45 ? 626  ILE A CB    1 
ATOM   3409  C  CG1   . ILE E 3 330 ? 119.223 -36.965 48.283  1.00 14.55 ? 626  ILE A CG1   1 
ATOM   3410  C  CG2   . ILE E 3 330 ? 119.273 -35.780 50.517  1.00 16.74 ? 626  ILE A CG2   1 
ATOM   3411  C  CD1   . ILE E 3 330 ? 117.721 -37.296 48.246  1.00 15.48 ? 626  ILE A CD1   1 
ATOM   3412  N  N     . PRO E 3 331 ? 118.363 -32.618 49.971  1.00 17.89 ? 627  PRO A N     1 
ATOM   3413  C  CA    . PRO E 3 331 ? 118.620 -31.355 50.674  1.00 18.45 ? 627  PRO A CA    1 
ATOM   3414  C  C     . PRO E 3 331 ? 120.018 -31.183 51.265  1.00 20.14 ? 627  PRO A C     1 
ATOM   3415  O  O     . PRO E 3 331 ? 120.623 -32.141 51.754  1.00 20.25 ? 627  PRO A O     1 
ATOM   3416  C  CB    . PRO E 3 331 ? 117.527 -31.320 51.742  1.00 18.64 ? 627  PRO A CB    1 
ATOM   3417  C  CG    . PRO E 3 331 ? 116.398 -32.060 51.081  1.00 18.95 ? 627  PRO A CG    1 
ATOM   3418  C  CD    . PRO E 3 331 ? 117.112 -33.232 50.448  1.00 17.92 ? 627  PRO A CD    1 
ATOM   3419  N  N     . ILE E 3 332 ? 120.523 -29.950 51.216  1.00 18.66 ? 628  ILE A N     1 
ATOM   3420  C  CA    . ILE E 3 332 ? 121.832 -29.639 51.780  1.00 21.29 ? 628  ILE A CA    1 
ATOM   3421  C  C     . ILE E 3 332 ? 122.032 -28.138 51.992  1.00 20.49 ? 628  ILE A C     1 
ATOM   3422  O  O     . ILE E 3 332 ? 122.791 -27.733 52.869  1.00 21.68 ? 628  ILE A O     1 
ATOM   3423  C  CB    . ILE E 3 332 ? 122.991 -30.168 50.890  1.00 21.52 ? 628  ILE A CB    1 
ATOM   3424  C  CG1   . ILE E 3 332 ? 124.320 -30.049 51.650  1.00 23.95 ? 628  ILE A CG1   1 
ATOM   3425  C  CG2   . ILE E 3 332 ? 123.075 -29.361 49.595  1.00 21.81 ? 628  ILE A CG2   1 
ATOM   3426  C  CD1   . ILE E 3 332 ? 125.501 -30.718 50.965  1.00 23.57 ? 628  ILE A CD1   1 
ATOM   3427  N  N     . ARG E 3 333 ? 121.341 -27.316 51.206  1.00 20.08 ? 629  ARG A N     1 
ATOM   3428  C  CA    . ARG E 3 333 ? 121.484 -25.859 51.303  1.00 21.33 ? 629  ARG A CA    1 
ATOM   3429  C  C     . ARG E 3 333 ? 120.997 -25.220 52.609  1.00 24.02 ? 629  ARG A C     1 
ATOM   3430  O  O     . ARG E 3 333 ? 121.621 -24.283 53.112  1.00 24.24 ? 629  ARG A O     1 
ATOM   3431  C  CB    . ARG E 3 333 ? 120.795 -25.187 50.110  1.00 21.11 ? 629  ARG A CB    1 
ATOM   3432  C  CG    . ARG E 3 333 ? 121.420 -25.556 48.765  1.00 18.65 ? 629  ARG A CG    1 
ATOM   3433  C  CD    . ARG E 3 333 ? 120.768 -24.822 47.595  1.00 19.99 ? 629  ARG A CD    1 
ATOM   3434  N  NE    . ARG E 3 333 ? 121.259 -25.351 46.325  1.00 19.83 ? 629  ARG A NE    1 
ATOM   3435  C  CZ    . ARG E 3 333 ? 120.834 -24.974 45.122  1.00 20.38 ? 629  ARG A CZ    1 
ATOM   3436  N  NH1   . ARG E 3 333 ? 119.891 -24.050 44.988  1.00 18.96 ? 629  ARG A NH1   1 
ATOM   3437  N  NH2   . ARG E 3 333 ? 121.364 -25.533 44.043  1.00 20.27 ? 629  ARG A NH2   1 
ATOM   3438  N  N     . LEU E 3 334 ? 119.887 -25.715 53.148  1.00 23.93 ? 630  LEU A N     1 
ATOM   3439  C  CA    . LEU E 3 334 ? 119.349 -25.196 54.405  1.00 25.79 ? 630  LEU A CA    1 
ATOM   3440  C  C     . LEU E 3 334 ? 119.532 -26.257 55.483  1.00 26.02 ? 630  LEU A C     1 
ATOM   3441  O  O     . LEU E 3 334 ? 119.304 -27.437 55.234  1.00 26.32 ? 630  LEU A O     1 
ATOM   3442  C  CB    . LEU E 3 334 ? 117.865 -24.855 54.252  1.00 25.66 ? 630  LEU A CB    1 
ATOM   3443  C  CG    . LEU E 3 334 ? 117.564 -23.724 53.266  1.00 28.81 ? 630  LEU A CG    1 
ATOM   3444  C  CD1   . LEU E 3 334 ? 116.060 -23.531 53.137  1.00 28.51 ? 630  LEU A CD1   1 
ATOM   3445  C  CD2   . LEU E 3 334 ? 118.236 -22.443 53.743  1.00 27.58 ? 630  LEU A CD2   1 
ATOM   3446  N  N     . GLU E 3 335 ? 119.938 -25.838 56.678  1.00 28.04 ? 631  GLU A N     1 
ATOM   3447  C  CA    . GLU E 3 335 ? 120.169 -26.776 57.774  1.00 29.45 ? 631  GLU A CA    1 
ATOM   3448  C  C     . GLU E 3 335 ? 119.030 -27.763 58.020  1.00 28.97 ? 631  GLU A C     1 
ATOM   3449  O  O     . GLU E 3 335 ? 119.274 -28.962 58.160  1.00 28.85 ? 631  GLU A O     1 
ATOM   3450  C  CB    . GLU E 3 335 ? 120.479 -26.015 59.066  1.00 32.47 ? 631  GLU A CB    1 
ATOM   3451  C  CG    . GLU E 3 335 ? 120.817 -26.910 60.258  1.00 35.58 ? 631  GLU A CG    1 
ATOM   3452  C  CD    . GLU E 3 335 ? 121.902 -27.930 59.951  1.00 37.05 ? 631  GLU A CD    1 
ATOM   3453  O  OE1   . GLU E 3 335 ? 122.962 -27.543 59.415  1.00 38.87 ? 631  GLU A OE1   1 
ATOM   3454  O  OE2   . GLU E 3 335 ? 121.697 -29.125 60.254  1.00 39.79 ? 631  GLU A OE2   1 
ATOM   3455  N  N     . GLU E 3 336 ? 117.793 -27.273 58.073  1.00 27.83 ? 632  GLU A N     1 
ATOM   3456  C  CA    . GLU E 3 336 ? 116.651 -28.154 58.309  1.00 28.79 ? 632  GLU A CA    1 
ATOM   3457  C  C     . GLU E 3 336 ? 116.589 -29.299 57.305  1.00 27.00 ? 632  GLU A C     1 
ATOM   3458  O  O     . GLU E 3 336 ? 116.429 -30.458 57.685  1.00 27.94 ? 632  GLU A O     1 
ATOM   3459  C  CB    . GLU E 3 336 ? 115.333 -27.373 58.261  1.00 30.99 ? 632  GLU A CB    1 
ATOM   3460  C  CG    . GLU E 3 336 ? 115.053 -26.532 59.495  1.00 36.66 ? 632  GLU A CG    1 
ATOM   3461  C  CD    . GLU E 3 336 ? 113.641 -25.967 59.504  1.00 39.50 ? 632  GLU A CD    1 
ATOM   3462  O  OE1   . GLU E 3 336 ? 113.290 -25.220 58.564  1.00 41.67 ? 632  GLU A OE1   1 
ATOM   3463  O  OE2   . GLU E 3 336 ? 112.883 -26.271 60.451  1.00 41.11 ? 632  GLU A OE2   1 
ATOM   3464  N  N     . GLY E 3 337 ? 116.715 -28.975 56.023  1.00 24.88 ? 633  GLY A N     1 
ATOM   3465  C  CA    . GLY E 3 337 ? 116.662 -30.007 55.003  1.00 23.38 ? 633  GLY A CA    1 
ATOM   3466  C  C     . GLY E 3 337 ? 117.894 -30.896 54.988  1.00 21.43 ? 633  GLY A C     1 
ATOM   3467  O  O     . GLY E 3 337 ? 117.798 -32.101 54.761  1.00 22.08 ? 633  GLY A O     1 
ATOM   3468  N  N     . ARG E 3 338 ? 119.053 -30.299 55.235  1.00 20.53 ? 634  ARG A N     1 
ATOM   3469  C  CA    . ARG E 3 338 ? 120.319 -31.027 55.235  1.00 21.57 ? 634  ARG A CA    1 
ATOM   3470  C  C     . ARG E 3 338 ? 120.309 -32.239 56.167  1.00 21.59 ? 634  ARG A C     1 
ATOM   3471  O  O     . ARG E 3 338 ? 120.964 -33.251 55.900  1.00 21.12 ? 634  ARG A O     1 
ATOM   3472  C  CB    . ARG E 3 338 ? 121.450 -30.077 55.634  1.00 22.51 ? 634  ARG A CB    1 
ATOM   3473  C  CG    . ARG E 3 338 ? 122.840 -30.658 55.484  1.00 25.26 ? 634  ARG A CG    1 
ATOM   3474  C  CD    . ARG E 3 338 ? 123.901 -29.597 55.736  1.00 28.02 ? 634  ARG A CD    1 
ATOM   3475  N  NE    . ARG E 3 338 ? 125.218 -30.054 55.305  1.00 33.67 ? 634  ARG A NE    1 
ATOM   3476  C  CZ    . ARG E 3 338 ? 126.294 -29.278 55.223  1.00 36.31 ? 634  ARG A CZ    1 
ATOM   3477  N  NH1   . ARG E 3 338 ? 126.215 -27.994 55.550  1.00 37.28 ? 634  ARG A NH1   1 
ATOM   3478  N  NH2   . ARG E 3 338 ? 127.448 -29.785 54.806  1.00 37.38 ? 634  ARG A NH2   1 
ATOM   3479  N  N     . LYS E 3 339 ? 119.563 -32.132 57.261  1.00 21.63 ? 635  LYS A N     1 
ATOM   3480  C  CA    . LYS E 3 339 ? 119.472 -33.211 58.237  1.00 23.26 ? 635  LYS A CA    1 
ATOM   3481  C  C     . LYS E 3 339 ? 118.963 -34.512 57.626  1.00 22.99 ? 635  LYS A C     1 
ATOM   3482  O  O     . LYS E 3 339 ? 119.219 -35.593 58.155  1.00 23.35 ? 635  LYS A O     1 
ATOM   3483  C  CB    . LYS E 3 339 ? 118.569 -32.785 59.396  1.00 26.52 ? 635  LYS A CB    1 
ATOM   3484  C  CG    . LYS E 3 339 ? 119.214 -31.766 60.323  1.00 29.86 ? 635  LYS A CG    1 
ATOM   3485  C  CD    . LYS E 3 339 ? 119.886 -32.449 61.503  1.00 34.38 ? 635  LYS A CD    1 
ATOM   3486  C  CE    . LYS E 3 339 ? 120.694 -31.456 62.321  1.00 35.61 ? 635  LYS A CE    1 
ATOM   3487  N  NZ    . LYS E 3 339 ? 119.936 -30.198 62.567  1.00 35.35 ? 635  LYS A NZ    1 
ATOM   3488  N  N     . ILE E 3 340 ? 118.240 -34.415 56.515  1.00 21.37 ? 636  ILE A N     1 
ATOM   3489  C  CA    . ILE E 3 340 ? 117.736 -35.614 55.856  1.00 20.06 ? 636  ILE A CA    1 
ATOM   3490  C  C     . ILE E 3 340 ? 118.922 -36.526 55.530  1.00 18.40 ? 636  ILE A C     1 
ATOM   3491  O  O     . ILE E 3 340 ? 118.794 -37.752 55.518  1.00 18.12 ? 636  ILE A O     1 
ATOM   3492  C  CB    . ILE E 3 340 ? 116.989 -35.272 54.530  1.00 20.19 ? 636  ILE A CB    1 
ATOM   3493  C  CG1   . ILE E 3 340 ? 115.683 -34.533 54.833  1.00 21.14 ? 636  ILE A CG1   1 
ATOM   3494  C  CG2   . ILE E 3 340 ? 116.682 -36.545 53.750  1.00 20.81 ? 636  ILE A CG2   1 
ATOM   3495  C  CD1   . ILE E 3 340 ? 114.639 -35.385 55.506  1.00 20.82 ? 636  ILE A CD1   1 
ATOM   3496  N  N     . ARG E 3 341 ? 120.080 -35.922 55.286  1.00 17.33 ? 637  ARG A N     1 
ATOM   3497  C  CA    . ARG E 3 341 ? 121.267 -36.691 54.939  1.00 19.39 ? 637  ARG A CA    1 
ATOM   3498  C  C     . ARG E 3 341 ? 121.801 -37.560 56.073  1.00 20.63 ? 637  ARG A C     1 
ATOM   3499  O  O     . ARG E 3 341 ? 122.641 -38.433 55.846  1.00 20.17 ? 637  ARG A O     1 
ATOM   3500  C  CB    . ARG E 3 341 ? 122.368 -35.761 54.411  1.00 20.26 ? 637  ARG A CB    1 
ATOM   3501  C  CG    . ARG E 3 341 ? 121.977 -35.080 53.096  1.00 18.25 ? 637  ARG A CG    1 
ATOM   3502  C  CD    . ARG E 3 341 ? 123.158 -34.476 52.355  1.00 20.24 ? 637  ARG A CD    1 
ATOM   3503  N  NE    . ARG E 3 341 ? 122.736 -33.940 51.061  1.00 17.68 ? 637  ARG A NE    1 
ATOM   3504  C  CZ    . ARG E 3 341 ? 123.550 -33.712 50.033  1.00 20.39 ? 637  ARG A CZ    1 
ATOM   3505  N  NH1   . ARG E 3 341 ? 124.848 -33.969 50.134  1.00 18.16 ? 637  ARG A NH1   1 
ATOM   3506  N  NH2   . ARG E 3 341 ? 123.058 -33.242 48.890  1.00 19.44 ? 637  ARG A NH2   1 
ATOM   3507  N  N     . GLN E 3 342 ? 121.316 -37.330 57.289  1.00 19.83 ? 638  GLN A N     1 
ATOM   3508  C  CA    . GLN E 3 342 ? 121.764 -38.134 58.421  1.00 21.48 ? 638  GLN A CA    1 
ATOM   3509  C  C     . GLN E 3 342 ? 121.160 -39.529 58.303  1.00 21.49 ? 638  GLN A C     1 
ATOM   3510  O  O     . GLN E 3 342 ? 121.619 -40.469 58.953  1.00 22.67 ? 638  GLN A O     1 
ATOM   3511  C  CB    . GLN E 3 342 ? 121.332 -37.499 59.749  1.00 22.29 ? 638  GLN A CB    1 
ATOM   3512  C  CG    . GLN E 3 342 ? 121.779 -36.048 59.936  1.00 24.64 ? 638  GLN A CG    1 
ATOM   3513  C  CD    . GLN E 3 342 ? 121.362 -35.480 61.284  1.00 27.81 ? 638  GLN A CD    1 
ATOM   3514  O  OE1   . GLN E 3 342 ? 120.289 -35.797 61.794  1.00 30.49 ? 638  GLN A OE1   1 
ATOM   3515  N  NE2   . GLN E 3 342 ? 122.205 -34.632 61.861  1.00 28.01 ? 638  GLN A NE2   1 
ATOM   3516  N  N     . ALA E 3 343 ? 120.138 -39.660 57.459  1.00 20.87 ? 639  ALA A N     1 
ATOM   3517  C  CA    . ALA E 3 343 ? 119.461 -40.938 57.267  1.00 20.63 ? 639  ALA A CA    1 
ATOM   3518  C  C     . ALA E 3 343 ? 120.134 -41.839 56.230  1.00 21.36 ? 639  ALA A C     1 
ATOM   3519  O  O     . ALA E 3 343 ? 119.758 -43.004 56.075  1.00 21.07 ? 639  ALA A O     1 
ATOM   3520  C  CB    . ALA E 3 343 ? 118.005 -40.701 56.887  1.00 20.41 ? 639  ALA A CB    1 
ATOM   3521  N  N     . PHE E 3 344 ? 121.120 -41.296 55.521  1.00 20.63 ? 640  PHE A N     1 
ATOM   3522  C  CA    . PHE E 3 344 ? 121.860 -42.051 54.512  1.00 21.20 ? 640  PHE A CA    1 
ATOM   3523  C  C     . PHE E 3 344 ? 123.149 -42.525 55.174  1.00 21.33 ? 640  PHE A C     1 
ATOM   3524  O  O     . PHE E 3 344 ? 124.044 -41.729 55.461  1.00 20.04 ? 640  PHE A O     1 
ATOM   3525  C  CB    . PHE E 3 344 ? 122.157 -41.159 53.308  1.00 22.52 ? 640  PHE A CB    1 
ATOM   3526  C  CG    . PHE E 3 344 ? 120.959 -40.913 52.434  1.00 23.06 ? 640  PHE A CG    1 
ATOM   3527  C  CD1   . PHE E 3 344 ? 120.616 -41.820 51.434  1.00 24.41 ? 640  PHE A CD1   1 
ATOM   3528  C  CD2   . PHE E 3 344 ? 120.155 -39.794 52.628  1.00 23.71 ? 640  PHE A CD2   1 
ATOM   3529  C  CE1   . PHE E 3 344 ? 119.485 -41.618 50.636  1.00 24.07 ? 640  PHE A CE1   1 
ATOM   3530  C  CE2   . PHE E 3 344 ? 119.022 -39.581 51.837  1.00 25.41 ? 640  PHE A CE2   1 
ATOM   3531  C  CZ    . PHE E 3 344 ? 118.687 -40.498 50.839  1.00 23.34 ? 640  PHE A CZ    1 
ATOM   3532  N  N     . VAL E 3 345 ? 123.237 -43.831 55.403  1.00 22.68 ? 641  VAL A N     1 
ATOM   3533  C  CA    . VAL E 3 345 ? 124.382 -44.409 56.096  1.00 23.38 ? 641  VAL A CA    1 
ATOM   3534  C  C     . VAL E 3 345 ? 125.085 -45.529 55.344  1.00 24.04 ? 641  VAL A C     1 
ATOM   3535  O  O     . VAL E 3 345 ? 124.566 -46.046 54.356  1.00 22.84 ? 641  VAL A O     1 
ATOM   3536  C  CB    . VAL E 3 345 ? 123.938 -44.970 57.462  1.00 23.18 ? 641  VAL A CB    1 
ATOM   3537  C  CG1   . VAL E 3 345 ? 123.232 -43.890 58.264  1.00 24.10 ? 641  VAL A CG1   1 
ATOM   3538  C  CG2   . VAL E 3 345 ? 123.006 -46.160 57.250  1.00 25.13 ? 641  VAL A CG2   1 
ATOM   3539  N  N     . PRO E 3 346 ? 126.289 -45.915 55.809  1.00 25.49 ? 642  PRO A N     1 
ATOM   3540  C  CA    . PRO E 3 346 ? 127.057 -46.991 55.176  1.00 26.54 ? 642  PRO A CA    1 
ATOM   3541  C  C     . PRO E 3 346 ? 126.266 -48.296 55.244  1.00 27.50 ? 642  PRO A C     1 
ATOM   3542  O  O     . PRO E 3 346 ? 125.462 -48.492 56.152  1.00 27.69 ? 642  PRO A O     1 
ATOM   3543  C  CB    . PRO E 3 346 ? 128.343 -47.030 55.991  1.00 26.62 ? 642  PRO A CB    1 
ATOM   3544  C  CG    . PRO E 3 346 ? 128.516 -45.601 56.405  1.00 25.88 ? 642  PRO A CG    1 
ATOM   3545  C  CD    . PRO E 3 346 ? 127.112 -45.213 56.812  1.00 25.92 ? 642  PRO A CD    1 
ATOM   3546  N  N     . SER E 3 347 ? 126.500 -49.188 54.292  1.00 28.28 ? 643  SER A N     1 
ATOM   3547  C  CA    . SER E 3 347 ? 125.785 -50.454 54.258  1.00 30.04 ? 643  SER A CA    1 
ATOM   3548  C  C     . SER E 3 347 ? 126.404 -51.527 55.156  1.00 32.70 ? 643  SER A C     1 
ATOM   3549  O  O     . SER E 3 347 ? 125.792 -52.569 55.385  1.00 30.82 ? 643  SER A O     1 
ATOM   3550  C  CB    . SER E 3 347 ? 125.725 -50.976 52.823  1.00 28.36 ? 643  SER A CB    1 
ATOM   3551  O  OG    . SER E 3 347 ? 127.018 -51.311 52.353  1.00 26.05 ? 643  SER A OG    1 
ATOM   3552  N  N     . GLU E 3 348 ? 127.606 -51.273 55.667  1.00 37.06 ? 644  GLU A N     1 
ATOM   3553  C  CA    . GLU E 3 348 ? 128.286 -52.256 56.510  1.00 41.75 ? 644  GLU A CA    1 
ATOM   3554  C  C     . GLU E 3 348 ? 128.532 -51.860 57.965  1.00 43.40 ? 644  GLU A C     1 
ATOM   3555  O  O     . GLU E 3 348 ? 128.223 -50.749 58.391  1.00 43.18 ? 644  GLU A O     1 
ATOM   3556  C  CB    . GLU E 3 348 ? 129.618 -52.660 55.872  1.00 43.89 ? 644  GLU A CB    1 
ATOM   3557  C  CG    . GLU E 3 348 ? 129.484 -53.409 54.555  1.00 47.86 ? 644  GLU A CG    1 
ATOM   3558  C  CD    . GLU E 3 348 ? 128.626 -54.657 54.675  1.00 50.33 ? 644  GLU A CD    1 
ATOM   3559  O  OE1   . GLU E 3 348 ? 128.931 -55.514 55.531  1.00 52.11 ? 644  GLU A OE1   1 
ATOM   3560  O  OE2   . GLU E 3 348 ? 127.645 -54.781 53.912  1.00 51.68 ? 644  GLU A OE2   1 
ATOM   3561  N  N     . SER E 3 349 ? 129.119 -52.800 58.705  1.00 46.26 ? 645  SER A N     1 
ATOM   3562  C  CA    . SER E 3 349 ? 129.430 -52.668 60.130  1.00 47.59 ? 645  SER A CA    1 
ATOM   3563  C  C     . SER E 3 349 ? 130.224 -51.432 60.586  1.00 46.97 ? 645  SER A C     1 
ATOM   3564  O  O     . SER E 3 349 ? 129.720 -50.624 61.371  1.00 47.46 ? 645  SER A O     1 
ATOM   3565  C  CB    . SER E 3 349 ? 130.151 -53.937 60.594  1.00 48.87 ? 645  SER A CB    1 
ATOM   3566  O  OG    . SER E 3 349 ? 130.291 -53.967 62.002  1.00 52.07 ? 645  SER A OG    1 
ATOM   3567  N  N     . ASP E 3 350 ? 131.459 -51.286 60.115  1.00 45.96 ? 646  ASP A N     1 
ATOM   3568  C  CA    . ASP E 3 350 ? 132.281 -50.144 60.515  1.00 44.52 ? 646  ASP A CA    1 
ATOM   3569  C  C     . ASP E 3 350 ? 132.803 -49.383 59.305  1.00 42.60 ? 646  ASP A C     1 
ATOM   3570  O  O     . ASP E 3 350 ? 133.990 -49.060 59.214  1.00 42.70 ? 646  ASP A O     1 
ATOM   3571  C  CB    . ASP E 3 350 ? 133.459 -50.608 61.375  1.00 47.36 ? 646  ASP A CB    1 
ATOM   3572  C  CG    . ASP E 3 350 ? 133.021 -51.444 62.558  1.00 49.50 ? 646  ASP A CG    1 
ATOM   3573  O  OD1   . ASP E 3 350 ? 132.115 -51.004 63.298  1.00 51.50 ? 646  ASP A OD1   1 
ATOM   3574  O  OD2   . ASP E 3 350 ? 133.584 -52.541 62.751  1.00 51.65 ? 646  ASP A OD2   1 
ATOM   3575  N  N     . TRP E 3 351 ? 131.898 -49.101 58.377  1.00 39.32 ? 647  TRP A N     1 
ATOM   3576  C  CA    . TRP E 3 351 ? 132.231 -48.381 57.160  1.00 36.50 ? 647  TRP A CA    1 
ATOM   3577  C  C     . TRP E 3 351 ? 131.860 -46.913 57.296  1.00 34.25 ? 647  TRP A C     1 
ATOM   3578  O  O     . TRP E 3 351 ? 131.156 -46.525 58.227  1.00 32.55 ? 647  TRP A O     1 
ATOM   3579  C  CB    . TRP E 3 351 ? 131.490 -49.000 55.978  1.00 37.51 ? 647  TRP A CB    1 
ATOM   3580  C  CG    . TRP E 3 351 ? 132.056 -50.309 55.537  1.00 38.94 ? 647  TRP A CG    1 
ATOM   3581  C  CD1   . TRP E 3 351 ? 132.665 -51.249 56.320  1.00 39.69 ? 647  TRP A CD1   1 
ATOM   3582  C  CD2   . TRP E 3 351 ? 132.034 -50.843 54.211  1.00 39.95 ? 647  TRP A CD2   1 
ATOM   3583  N  NE1   . TRP E 3 351 ? 133.023 -52.338 55.561  1.00 40.42 ? 647  TRP A NE1   1 
ATOM   3584  C  CE2   . TRP E 3 351 ? 132.647 -52.115 54.262  1.00 40.94 ? 647  TRP A CE2   1 
ATOM   3585  C  CE3   . TRP E 3 351 ? 131.554 -50.371 52.982  1.00 40.22 ? 647  TRP A CE3   1 
ATOM   3586  C  CZ2   . TRP E 3 351 ? 132.793 -52.924 53.129  1.00 40.95 ? 647  TRP A CZ2   1 
ATOM   3587  C  CZ3   . TRP E 3 351 ? 131.698 -51.174 51.854  1.00 41.47 ? 647  TRP A CZ3   1 
ATOM   3588  C  CH2   . TRP E 3 351 ? 132.314 -52.438 51.938  1.00 41.32 ? 647  TRP A CH2   1 
ATOM   3589  N  N     . LEU E 3 352 ? 132.338 -46.100 56.360  1.00 31.97 ? 648  LEU A N     1 
ATOM   3590  C  CA    . LEU E 3 352 ? 132.063 -44.671 56.382  1.00 30.11 ? 648  LEU A CA    1 
ATOM   3591  C  C     . LEU E 3 352 ? 131.712 -44.146 54.997  1.00 28.80 ? 648  LEU A C     1 
ATOM   3592  O  O     . LEU E 3 352 ? 131.923 -44.824 53.992  1.00 28.61 ? 648  LEU A O     1 
ATOM   3593  C  CB    . LEU E 3 352 ? 133.280 -43.916 56.915  1.00 30.69 ? 648  LEU A CB    1 
ATOM   3594  C  CG    . LEU E 3 352 ? 133.723 -44.309 58.326  1.00 32.51 ? 648  LEU A CG    1 
ATOM   3595  C  CD1   . LEU E 3 352 ? 135.026 -43.606 58.680  1.00 32.35 ? 648  LEU A CD1   1 
ATOM   3596  C  CD2   . LEU E 3 352 ? 132.626 -43.946 59.315  1.00 32.75 ? 648  LEU A CD2   1 
ATOM   3597  N  N     . ILE E 3 353 ? 131.169 -42.934 54.958  1.00 27.39 ? 649  ILE A N     1 
ATOM   3598  C  CA    . ILE E 3 353 ? 130.800 -42.298 53.699  1.00 26.46 ? 649  ILE A CA    1 
ATOM   3599  C  C     . ILE E 3 353 ? 131.889 -41.300 53.333  1.00 26.12 ? 649  ILE A C     1 
ATOM   3600  O  O     . ILE E 3 353 ? 132.298 -40.485 54.158  1.00 25.96 ? 649  ILE A O     1 
ATOM   3601  C  CB    . ILE E 3 353 ? 129.456 -41.542 53.810  1.00 25.69 ? 649  ILE A CB    1 
ATOM   3602  C  CG1   . ILE E 3 353 ? 128.326 -42.523 54.135  1.00 24.87 ? 649  ILE A CG1   1 
ATOM   3603  C  CG2   . ILE E 3 353 ? 129.170 -40.793 52.510  1.00 25.80 ? 649  ILE A CG2   1 
ATOM   3604  C  CD1   . ILE E 3 353 ? 128.106 -43.586 53.082  1.00 24.28 ? 649  ILE A CD1   1 
ATOM   3605  N  N     . PHE E 3 354 ? 132.353 -41.372 52.092  1.00 24.97 ? 650  PHE A N     1 
ATOM   3606  C  CA    . PHE E 3 354 ? 133.400 -40.487 51.600  1.00 25.53 ? 650  PHE A CA    1 
ATOM   3607  C  C     . PHE E 3 354 ? 132.846 -39.730 50.390  1.00 24.68 ? 650  PHE A C     1 
ATOM   3608  O  O     . PHE E 3 354 ? 132.359 -40.347 49.444  1.00 22.90 ? 650  PHE A O     1 
ATOM   3609  C  CB    . PHE E 3 354 ? 134.618 -41.319 51.189  1.00 26.22 ? 650  PHE A CB    1 
ATOM   3610  C  CG    . PHE E 3 354 ? 135.817 -40.501 50.807  1.00 29.70 ? 650  PHE A CG    1 
ATOM   3611  C  CD1   . PHE E 3 354 ? 136.776 -40.163 51.756  1.00 30.14 ? 650  PHE A CD1   1 
ATOM   3612  C  CD2   . PHE E 3 354 ? 135.993 -40.076 49.494  1.00 30.39 ? 650  PHE A CD2   1 
ATOM   3613  C  CE1   . PHE E 3 354 ? 137.897 -39.411 51.401  1.00 31.78 ? 650  PHE A CE1   1 
ATOM   3614  C  CE2   . PHE E 3 354 ? 137.106 -39.327 49.130  1.00 31.94 ? 650  PHE A CE2   1 
ATOM   3615  C  CZ    . PHE E 3 354 ? 138.061 -38.994 50.086  1.00 32.42 ? 650  PHE A CZ    1 
ATOM   3616  N  N     . ALA E 3 355 ? 132.923 -38.403 50.424  1.00 23.66 ? 651  ALA A N     1 
ATOM   3617  C  CA    . ALA E 3 355 ? 132.415 -37.577 49.329  1.00 25.94 ? 651  ALA A CA    1 
ATOM   3618  C  C     . ALA E 3 355 ? 133.471 -36.617 48.785  1.00 26.04 ? 651  ALA A C     1 
ATOM   3619  O  O     . ALA E 3 355 ? 134.117 -35.900 49.548  1.00 27.39 ? 651  ALA A O     1 
ATOM   3620  C  CB    . ALA E 3 355 ? 131.195 -36.791 49.797  1.00 23.15 ? 651  ALA A CB    1 
ATOM   3621  N  N     . ALA E 3 356 ? 133.636 -36.612 47.463  1.00 26.32 ? 652  ALA A N     1 
ATOM   3622  C  CA    . ALA E 3 356 ? 134.603 -35.742 46.794  1.00 25.46 ? 652  ALA A CA    1 
ATOM   3623  C  C     . ALA E 3 356 ? 133.864 -34.815 45.824  1.00 25.78 ? 652  ALA A C     1 
ATOM   3624  O  O     . ALA E 3 356 ? 133.026 -35.269 45.046  1.00 25.38 ? 652  ALA A O     1 
ATOM   3625  C  CB    . ALA E 3 356 ? 135.627 -36.582 46.048  1.00 25.53 ? 652  ALA A CB    1 
ATOM   3626  N  N     . ASP E 3 357 ? 134.194 -33.526 45.868  1.00 24.70 ? 653  ASP A N     1 
ATOM   3627  C  CA    . ASP E 3 357 ? 133.542 -32.505 45.041  1.00 25.04 ? 653  ASP A CA    1 
ATOM   3628  C  C     . ASP E 3 357 ? 134.554 -31.673 44.249  1.00 24.85 ? 653  ASP A C     1 
ATOM   3629  O  O     . ASP E 3 357 ? 135.511 -31.158 44.824  1.00 25.29 ? 653  ASP A O     1 
ATOM   3630  C  CB    . ASP E 3 357 ? 132.735 -31.577 45.959  1.00 24.63 ? 653  ASP A CB    1 
ATOM   3631  C  CG    . ASP E 3 357 ? 131.869 -30.581 45.204  1.00 26.20 ? 653  ASP A CG    1 
ATOM   3632  O  OD1   . ASP E 3 357 ? 132.199 -30.211 44.057  1.00 25.49 ? 653  ASP A OD1   1 
ATOM   3633  O  OD2   . ASP E 3 357 ? 130.846 -30.155 45.780  1.00 25.27 ? 653  ASP A OD2   1 
ATOM   3634  N  N     . TYR E 3 358 ? 134.346 -31.536 42.938  1.00 23.95 ? 654  TYR A N     1 
ATOM   3635  C  CA    . TYR E 3 358 ? 135.245 -30.718 42.120  1.00 23.39 ? 654  TYR A CA    1 
ATOM   3636  C  C     . TYR E 3 358 ? 135.063 -29.250 42.496  1.00 22.68 ? 654  TYR A C     1 
ATOM   3637  O  O     . TYR E 3 358 ? 133.945 -28.745 42.518  1.00 21.68 ? 654  TYR A O     1 
ATOM   3638  C  CB    . TYR E 3 358 ? 134.942 -30.864 40.625  1.00 23.28 ? 654  TYR A CB    1 
ATOM   3639  C  CG    . TYR E 3 358 ? 135.569 -32.057 39.943  1.00 23.33 ? 654  TYR A CG    1 
ATOM   3640  C  CD1   . TYR E 3 358 ? 134.792 -33.148 39.555  1.00 24.36 ? 654  TYR A CD1   1 
ATOM   3641  C  CD2   . TYR E 3 358 ? 136.935 -32.084 39.654  1.00 23.77 ? 654  TYR A CD2   1 
ATOM   3642  C  CE1   . TYR E 3 358 ? 135.355 -34.235 38.893  1.00 23.71 ? 654  TYR A CE1   1 
ATOM   3643  C  CE2   . TYR E 3 358 ? 137.511 -33.169 38.992  1.00 23.69 ? 654  TYR A CE2   1 
ATOM   3644  C  CZ    . TYR E 3 358 ? 136.713 -34.240 38.615  1.00 24.06 ? 654  TYR A CZ    1 
ATOM   3645  O  OH    . TYR E 3 358 ? 137.264 -35.316 37.957  1.00 25.29 ? 654  TYR A OH    1 
ATOM   3646  N  N     . SER E 3 359 ? 136.164 -28.565 42.782  1.00 23.88 ? 655  SER A N     1 
ATOM   3647  C  CA    . SER E 3 359 ? 136.116 -27.152 43.146  1.00 24.27 ? 655  SER A CA    1 
ATOM   3648  C  C     . SER E 3 359 ? 135.862 -26.263 41.924  1.00 24.48 ? 655  SER A C     1 
ATOM   3649  O  O     . SER E 3 359 ? 136.516 -26.426 40.896  1.00 26.09 ? 655  SER A O     1 
ATOM   3650  C  CB    . SER E 3 359 ? 137.438 -26.747 43.810  1.00 24.94 ? 655  SER A CB    1 
ATOM   3651  O  OG    . SER E 3 359 ? 137.520 -25.346 43.978  1.00 23.23 ? 655  SER A OG    1 
ATOM   3652  N  N     . GLN E 3 360 ? 134.912 -25.334 42.044  1.00 24.12 ? 656  GLN A N     1 
ATOM   3653  C  CA    . GLN E 3 360 ? 134.568 -24.393 40.967  1.00 24.85 ? 656  GLN A CA    1 
ATOM   3654  C  C     . GLN E 3 360 ? 134.714 -25.027 39.582  1.00 24.96 ? 656  GLN A C     1 
ATOM   3655  O  O     . GLN E 3 360 ? 135.213 -24.393 38.651  1.00 25.23 ? 656  GLN A O     1 
ATOM   3656  C  CB    . GLN E 3 360 ? 135.482 -23.168 41.042  1.00 25.10 ? 656  GLN A CB    1 
ATOM   3657  C  CG    . GLN E 3 360 ? 135.704 -22.626 42.441  1.00 25.90 ? 656  GLN A CG    1 
ATOM   3658  C  CD    . GLN E 3 360 ? 136.814 -21.590 42.485  1.00 25.79 ? 656  GLN A CD    1 
ATOM   3659  O  OE1   . GLN E 3 360 ? 136.691 -20.506 41.917  1.00 24.23 ? 656  GLN A OE1   1 
ATOM   3660  N  NE2   . GLN E 3 360 ? 137.910 -21.925 43.159  1.00 23.76 ? 656  GLN A NE2   1 
ATOM   3661  N  N     . ILE E 3 361 ? 134.251 -26.263 39.448  1.00 23.88 ? 657  ILE A N     1 
ATOM   3662  C  CA    . ILE E 3 361 ? 134.388 -27.023 38.213  1.00 22.55 ? 657  ILE A CA    1 
ATOM   3663  C  C     . ILE E 3 361 ? 134.148 -26.372 36.849  1.00 22.84 ? 657  ILE A C     1 
ATOM   3664  O  O     . ILE E 3 361 ? 135.044 -26.379 36.003  1.00 22.91 ? 657  ILE A O     1 
ATOM   3665  C  CB    . ILE E 3 361 ? 133.553 -28.325 38.274  1.00 23.70 ? 657  ILE A CB    1 
ATOM   3666  C  CG1   . ILE E 3 361 ? 133.896 -29.202 37.066  1.00 23.62 ? 657  ILE A CG1   1 
ATOM   3667  C  CG2   . ILE E 3 361 ? 132.068 -28.002 38.322  1.00 22.07 ? 657  ILE A CG2   1 
ATOM   3668  C  CD1   . ILE E 3 361 ? 135.380 -29.543 36.969  1.00 24.38 ? 657  ILE A CD1   1 
ATOM   3669  N  N     . GLU E 3 362 ? 132.966 -25.815 36.611  1.00 21.05 ? 658  GLU A N     1 
ATOM   3670  C  CA    . GLU E 3 362 ? 132.714 -25.228 35.302  1.00 21.26 ? 658  GLU A CA    1 
ATOM   3671  C  C     . GLU E 3 362 ? 133.446 -23.914 35.033  1.00 21.20 ? 658  GLU A C     1 
ATOM   3672  O  O     . GLU E 3 362 ? 133.610 -23.520 33.878  1.00 19.31 ? 658  GLU A O     1 
ATOM   3673  C  CB    . GLU E 3 362 ? 131.199 -25.109 35.060  1.00 19.93 ? 658  GLU A CB    1 
ATOM   3674  C  CG    . GLU E 3 362 ? 130.561 -26.500 35.017  1.00 20.79 ? 658  GLU A CG    1 
ATOM   3675  C  CD    . GLU E 3 362 ? 129.103 -26.529 34.582  1.00 21.83 ? 658  GLU A CD    1 
ATOM   3676  O  OE1   . GLU E 3 362 ? 128.477 -27.596 34.759  1.00 19.78 ? 658  GLU A OE1   1 
ATOM   3677  O  OE2   . GLU E 3 362 ? 128.586 -25.513 34.069  1.00 21.67 ? 658  GLU A OE2   1 
ATOM   3678  N  N     . LEU E 3 363 ? 133.896 -23.238 36.086  1.00 22.20 ? 659  LEU A N     1 
ATOM   3679  C  CA    . LEU E 3 363 ? 134.653 -22.007 35.884  1.00 23.81 ? 659  LEU A CA    1 
ATOM   3680  C  C     . LEU E 3 363 ? 136.043 -22.412 35.404  1.00 23.46 ? 659  LEU A C     1 
ATOM   3681  O  O     . LEU E 3 363 ? 136.624 -21.757 34.545  1.00 24.76 ? 659  LEU A O     1 
ATOM   3682  C  CB    . LEU E 3 363 ? 134.765 -21.198 37.179  1.00 23.71 ? 659  LEU A CB    1 
ATOM   3683  C  CG    . LEU E 3 363 ? 133.486 -20.500 37.638  1.00 22.46 ? 659  LEU A CG    1 
ATOM   3684  C  CD1   . LEU E 3 363 ? 133.781 -19.662 38.873  1.00 22.97 ? 659  LEU A CD1   1 
ATOM   3685  C  CD2   . LEU E 3 363 ? 132.947 -19.625 36.517  1.00 23.78 ? 659  LEU A CD2   1 
ATOM   3686  N  N     . ARG E 3 364 ? 136.560 -23.508 35.955  1.00 23.86 ? 660  ARG A N     1 
ATOM   3687  C  CA    . ARG E 3 364 ? 137.874 -24.015 35.566  1.00 24.75 ? 660  ARG A CA    1 
ATOM   3688  C  C     . ARG E 3 364 ? 137.807 -24.511 34.125  1.00 25.08 ? 660  ARG A C     1 
ATOM   3689  O  O     . ARG E 3 364 ? 138.719 -24.272 33.331  1.00 22.56 ? 660  ARG A O     1 
ATOM   3690  C  CB    . ARG E 3 364 ? 138.307 -25.167 36.480  1.00 25.04 ? 660  ARG A CB    1 
ATOM   3691  C  CG    . ARG E 3 364 ? 138.597 -24.769 37.922  1.00 27.13 ? 660  ARG A CG    1 
ATOM   3692  C  CD    . ARG E 3 364 ? 138.979 -25.992 38.752  1.00 27.72 ? 660  ARG A CD    1 
ATOM   3693  N  NE    . ARG E 3 364 ? 139.072 -25.690 40.179  1.00 30.16 ? 660  ARG A NE    1 
ATOM   3694  C  CZ    . ARG E 3 364 ? 140.115 -25.112 40.765  1.00 32.04 ? 660  ARG A CZ    1 
ATOM   3695  N  NH1   . ARG E 3 364 ? 141.179 -24.768 40.048  1.00 31.61 ? 660  ARG A NH1   1 
ATOM   3696  N  NH2   . ARG E 3 364 ? 140.091 -24.870 42.071  1.00 30.98 ? 660  ARG A NH2   1 
ATOM   3697  N  N     . VAL E 3 365 ? 136.721 -25.206 33.795  1.00 23.24 ? 661  VAL A N     1 
ATOM   3698  C  CA    . VAL E 3 365 ? 136.533 -25.715 32.444  1.00 23.14 ? 661  VAL A CA    1 
ATOM   3699  C  C     . VAL E 3 365 ? 136.398 -24.546 31.477  1.00 22.93 ? 661  VAL A C     1 
ATOM   3700  O  O     . VAL E 3 365 ? 136.933 -24.586 30.369  1.00 24.53 ? 661  VAL A O     1 
ATOM   3701  C  CB    . VAL E 3 365 ? 135.273 -26.605 32.340  1.00 21.03 ? 661  VAL A CB    1 
ATOM   3702  C  CG1   . VAL E 3 365 ? 135.002 -26.964 30.881  1.00 22.05 ? 661  VAL A CG1   1 
ATOM   3703  C  CG2   . VAL E 3 365 ? 135.468 -27.871 33.156  1.00 21.62 ? 661  VAL A CG2   1 
ATOM   3704  N  N     . LEU E 3 366 ? 135.688 -23.504 31.898  1.00 22.96 ? 662  LEU A N     1 
ATOM   3705  C  CA    . LEU E 3 366 ? 135.506 -22.326 31.054  1.00 24.15 ? 662  LEU A CA    1 
ATOM   3706  C  C     . LEU E 3 366 ? 136.844 -21.622 30.834  1.00 25.54 ? 662  LEU A C     1 
ATOM   3707  O  O     . LEU E 3 366 ? 137.124 -21.133 29.740  1.00 25.72 ? 662  LEU A O     1 
ATOM   3708  C  CB    . LEU E 3 366 ? 134.516 -21.348 31.691  1.00 23.14 ? 662  LEU A CB    1 
ATOM   3709  C  CG    . LEU E 3 366 ? 134.349 -20.001 30.972  1.00 22.68 ? 662  LEU A CG    1 
ATOM   3710  C  CD1   . LEU E 3 366 ? 133.873 -20.224 29.545  1.00 23.02 ? 662  LEU A CD1   1 
ATOM   3711  C  CD2   . LEU E 3 366 ? 133.358 -19.135 31.728  1.00 21.23 ? 662  LEU A CD2   1 
ATOM   3712  N  N     . ALA E 3 367 ? 137.664 -21.572 31.879  1.00 25.95 ? 663  ALA A N     1 
ATOM   3713  C  CA    . ALA E 3 367 ? 138.972 -20.933 31.789  1.00 27.57 ? 663  ALA A CA    1 
ATOM   3714  C  C     . ALA E 3 367 ? 139.787 -21.618 30.701  1.00 28.15 ? 663  ALA A C     1 
ATOM   3715  O  O     . ALA E 3 367 ? 140.399 -20.962 29.862  1.00 29.29 ? 663  ALA A O     1 
ATOM   3716  C  CB    . ALA E 3 367 ? 139.699 -21.038 33.123  1.00 26.70 ? 663  ALA A CB    1 
ATOM   3717  N  N     . HIS E 3 368 ? 139.783 -22.947 30.729  1.00 28.88 ? 664  HIS A N     1 
ATOM   3718  C  CA    . HIS E 3 368 ? 140.507 -23.755 29.760  1.00 30.04 ? 664  HIS A CA    1 
ATOM   3719  C  C     . HIS E 3 368 ? 140.027 -23.515 28.336  1.00 30.03 ? 664  HIS A C     1 
ATOM   3720  O  O     . HIS E 3 368 ? 140.814 -23.180 27.451  1.00 31.24 ? 664  HIS A O     1 
ATOM   3721  C  CB    . HIS E 3 368 ? 140.340 -25.241 30.084  1.00 30.52 ? 664  HIS A CB    1 
ATOM   3722  C  CG    . HIS E 3 368 ? 140.946 -26.153 29.061  1.00 32.22 ? 664  HIS A CG    1 
ATOM   3723  N  ND1   . HIS E 3 368 ? 142.288 -26.466 29.042  1.00 32.74 ? 664  HIS A ND1   1 
ATOM   3724  C  CD2   . HIS E 3 368 ? 140.393 -26.806 28.011  1.00 32.89 ? 664  HIS A CD2   1 
ATOM   3725  C  CE1   . HIS E 3 368 ? 142.535 -27.274 28.026  1.00 33.93 ? 664  HIS A CE1   1 
ATOM   3726  N  NE2   . HIS E 3 368 ? 141.402 -27.495 27.384  1.00 33.17 ? 664  HIS A NE2   1 
ATOM   3727  N  N     . ILE E 3 369 ? 138.728 -23.692 28.125  1.00 29.48 ? 665  ILE A N     1 
ATOM   3728  C  CA    . ILE E 3 369 ? 138.132 -23.536 26.807  1.00 28.63 ? 665  ILE A CA    1 
ATOM   3729  C  C     . ILE E 3 369 ? 138.197 -22.120 26.256  1.00 29.92 ? 665  ILE A C     1 
ATOM   3730  O  O     . ILE E 3 369 ? 138.424 -21.925 25.058  1.00 28.74 ? 665  ILE A O     1 
ATOM   3731  C  CB    . ILE E 3 369 ? 136.665 -24.016 26.817  1.00 27.72 ? 665  ILE A CB    1 
ATOM   3732  C  CG1   . ILE E 3 369 ? 136.615 -25.490 27.235  1.00 27.59 ? 665  ILE A CG1   1 
ATOM   3733  C  CG2   . ILE E 3 369 ? 136.042 -23.831 25.444  1.00 25.88 ? 665  ILE A CG2   1 
ATOM   3734  C  CD1   . ILE E 3 369 ? 135.215 -26.073 27.306  1.00 28.68 ? 665  ILE A CD1   1 
ATOM   3735  N  N     . ALA E 3 370 ? 138.004 -21.132 27.120  1.00 29.87 ? 666  ALA A N     1 
ATOM   3736  C  CA    . ALA E 3 370 ? 138.044 -19.743 26.686  1.00 32.40 ? 666  ALA A CA    1 
ATOM   3737  C  C     . ALA E 3 370 ? 139.475 -19.219 26.660  1.00 33.63 ? 666  ALA A C     1 
ATOM   3738  O  O     . ALA E 3 370 ? 139.776 -18.243 25.972  1.00 33.17 ? 666  ALA A O     1 
ATOM   3739  C  CB    . ALA E 3 370 ? 137.194 -18.882 27.613  1.00 31.68 ? 666  ALA A CB    1 
ATOM   3740  N  N     . GLU E 3 371 ? 140.350 -19.880 27.410  1.00 35.23 ? 667  GLU A N     1 
ATOM   3741  C  CA    . GLU E 3 371 ? 141.747 -19.474 27.510  1.00 38.27 ? 667  GLU A CA    1 
ATOM   3742  C  C     . GLU E 3 371 ? 141.832 -18.033 28.010  1.00 39.57 ? 667  GLU A C     1 
ATOM   3743  O  O     . GLU E 3 371 ? 142.620 -17.234 27.502  1.00 39.76 ? 667  GLU A O     1 
ATOM   3744  C  CB    . GLU E 3 371 ? 142.453 -19.593 26.154  1.00 38.96 ? 667  GLU A CB    1 
ATOM   3745  C  CG    . GLU E 3 371 ? 142.428 -20.992 25.560  1.00 41.57 ? 667  GLU A CG    1 
ATOM   3746  C  CD    . GLU E 3 371 ? 143.412 -21.161 24.415  1.00 43.15 ? 667  GLU A CD    1 
ATOM   3747  O  OE1   . GLU E 3 371 ? 144.633 -21.203 24.678  1.00 41.38 ? 667  GLU A OE1   1 
ATOM   3748  O  OE2   . GLU E 3 371 ? 142.963 -21.250 23.252  1.00 44.16 ? 667  GLU A OE2   1 
ATOM   3749  N  N     . ASP E 3 372 ? 141.013 -17.707 29.006  1.00 39.88 ? 668  ASP A N     1 
ATOM   3750  C  CA    . ASP E 3 372 ? 141.005 -16.367 29.584  1.00 40.46 ? 668  ASP A CA    1 
ATOM   3751  C  C     . ASP E 3 372 ? 142.169 -16.232 30.562  1.00 40.64 ? 668  ASP A C     1 
ATOM   3752  O  O     . ASP E 3 372 ? 142.200 -16.895 31.599  1.00 40.89 ? 668  ASP A O     1 
ATOM   3753  C  CB    . ASP E 3 372 ? 139.682 -16.108 30.309  1.00 39.59 ? 668  ASP A CB    1 
ATOM   3754  C  CG    . ASP E 3 372 ? 139.625 -14.731 30.945  1.00 38.78 ? 668  ASP A CG    1 
ATOM   3755  O  OD1   . ASP E 3 372 ? 140.374 -14.486 31.913  1.00 38.79 ? 668  ASP A OD1   1 
ATOM   3756  O  OD2   . ASP E 3 372 ? 138.832 -13.893 30.471  1.00 38.89 ? 668  ASP A OD2   1 
ATOM   3757  N  N     . ASP E 3 373 ? 143.123 -15.369 30.221  1.00 41.14 ? 669  ASP A N     1 
ATOM   3758  C  CA    . ASP E 3 373 ? 144.309 -15.146 31.044  1.00 40.99 ? 669  ASP A CA    1 
ATOM   3759  C  C     . ASP E 3 373 ? 144.018 -14.890 32.517  1.00 39.79 ? 669  ASP A C     1 
ATOM   3760  O  O     . ASP E 3 373 ? 144.543 -15.579 33.390  1.00 38.89 ? 669  ASP A O     1 
ATOM   3761  C  CB    . ASP E 3 373 ? 145.123 -13.971 30.490  1.00 42.61 ? 669  ASP A CB    1 
ATOM   3762  C  CG    . ASP E 3 373 ? 145.631 -14.225 29.086  1.00 43.86 ? 669  ASP A CG    1 
ATOM   3763  O  OD1   . ASP E 3 373 ? 146.211 -15.307 28.851  1.00 44.11 ? 669  ASP A OD1   1 
ATOM   3764  O  OD2   . ASP E 3 373 ? 145.455 -13.343 28.220  1.00 46.07 ? 669  ASP A OD2   1 
ATOM   3765  N  N     . ASN E 3 374 ? 143.181 -13.895 32.785  1.00 40.43 ? 670  ASN A N     1 
ATOM   3766  C  CA    . ASN E 3 374 ? 142.833 -13.532 34.151  1.00 40.57 ? 670  ASN A CA    1 
ATOM   3767  C  C     . ASN E 3 374 ? 142.179 -14.672 34.923  1.00 40.31 ? 670  ASN A C     1 
ATOM   3768  O  O     . ASN E 3 374 ? 142.486 -14.893 36.096  1.00 39.37 ? 670  ASN A O     1 
ATOM   3769  C  CB    . ASN E 3 374 ? 141.913 -12.309 34.142  1.00 43.66 ? 670  ASN A CB    1 
ATOM   3770  C  CG    . ASN E 3 374 ? 141.544 -11.849 35.536  1.00 46.62 ? 670  ASN A CG    1 
ATOM   3771  O  OD1   . ASN E 3 374 ? 142.401 -11.755 36.419  1.00 48.69 ? 670  ASN A OD1   1 
ATOM   3772  N  ND2   . ASN E 3 374 ? 140.265 -11.546 35.742  1.00 48.12 ? 670  ASN A ND2   1 
ATOM   3773  N  N     . LEU E 3 375 ? 141.282 -15.401 34.266  1.00 39.23 ? 671  LEU A N     1 
ATOM   3774  C  CA    . LEU E 3 375 ? 140.603 -16.511 34.921  1.00 38.62 ? 671  LEU A CA    1 
ATOM   3775  C  C     . LEU E 3 375 ? 141.562 -17.682 35.134  1.00 38.34 ? 671  LEU A C     1 
ATOM   3776  O  O     . LEU E 3 375 ? 141.553 -18.312 36.191  1.00 38.84 ? 671  LEU A O     1 
ATOM   3777  C  CB    . LEU E 3 375 ? 139.389 -16.955 34.096  1.00 37.25 ? 671  LEU A CB    1 
ATOM   3778  C  CG    . LEU E 3 375 ? 138.431 -17.940 34.773  1.00 36.46 ? 671  LEU A CG    1 
ATOM   3779  C  CD1   . LEU E 3 375 ? 137.974 -17.378 36.113  1.00 34.90 ? 671  LEU A CD1   1 
ATOM   3780  C  CD2   . LEU E 3 375 ? 137.236 -18.201 33.869  1.00 35.20 ? 671  LEU A CD2   1 
ATOM   3781  N  N     . MET E 3 376 ? 142.392 -17.969 34.134  1.00 39.28 ? 672  MET A N     1 
ATOM   3782  C  CA    . MET E 3 376 ? 143.357 -19.062 34.247  1.00 39.94 ? 672  MET A CA    1 
ATOM   3783  C  C     . MET E 3 376 ? 144.362 -18.743 35.350  1.00 41.08 ? 672  MET A C     1 
ATOM   3784  O  O     . MET E 3 376 ? 144.726 -19.608 36.145  1.00 39.70 ? 672  MET A O     1 
ATOM   3785  C  CB    . MET E 3 376 ? 144.101 -19.274 32.924  1.00 40.96 ? 672  MET A CB    1 
ATOM   3786  C  CG    . MET E 3 376 ? 143.215 -19.697 31.757  1.00 40.66 ? 672  MET A CG    1 
ATOM   3787  S  SD    . MET E 3 376 ? 144.160 -20.293 30.331  1.00 41.80 ? 672  MET A SD    1 
ATOM   3788  C  CE    . MET E 3 376 ? 144.580 -18.746 29.523  1.00 40.67 ? 672  MET A CE    1 
ATOM   3789  N  N     . GLU E 3 377 ? 144.805 -17.491 35.391  1.00 42.51 ? 673  GLU A N     1 
ATOM   3790  C  CA    . GLU E 3 377 ? 145.764 -17.050 36.397  1.00 44.39 ? 673  GLU A CA    1 
ATOM   3791  C  C     . GLU E 3 377 ? 145.169 -17.252 37.787  1.00 43.79 ? 673  GLU A C     1 
ATOM   3792  O  O     . GLU E 3 377 ? 145.843 -17.726 38.703  1.00 43.97 ? 673  GLU A O     1 
ATOM   3793  C  CB    . GLU E 3 377 ? 146.098 -15.571 36.180  1.00 46.55 ? 673  GLU A CB    1 
ATOM   3794  C  CG    . GLU E 3 377 ? 147.223 -15.034 37.053  1.00 50.15 ? 673  GLU A CG    1 
ATOM   3795  C  CD    . GLU E 3 377 ? 148.538 -15.758 36.831  1.00 52.12 ? 673  GLU A CD    1 
ATOM   3796  O  OE1   . GLU E 3 377 ? 148.926 -15.939 35.657  1.00 53.49 ? 673  GLU A OE1   1 
ATOM   3797  O  OE2   . GLU E 3 377 ? 149.188 -16.139 37.829  1.00 53.54 ? 673  GLU A OE2   1 
ATOM   3798  N  N     . ALA E 3 378 ? 143.896 -16.898 37.931  1.00 43.14 ? 674  ALA A N     1 
ATOM   3799  C  CA    . ALA E 3 378 ? 143.194 -17.026 39.202  1.00 41.84 ? 674  ALA A CA    1 
ATOM   3800  C  C     . ALA E 3 378 ? 143.280 -18.438 39.771  1.00 41.26 ? 674  ALA A C     1 
ATOM   3801  O  O     . ALA E 3 378 ? 143.548 -18.621 40.959  1.00 40.40 ? 674  ALA A O     1 
ATOM   3802  C  CB    . ALA E 3 378 ? 141.737 -16.621 39.029  1.00 42.20 ? 674  ALA A CB    1 
ATOM   3803  N  N     . PHE E 3 379 ? 143.052 -19.437 38.924  1.00 40.85 ? 675  PHE A N     1 
ATOM   3804  C  CA    . PHE E 3 379 ? 143.109 -20.825 39.366  1.00 40.88 ? 675  PHE A CA    1 
ATOM   3805  C  C     . PHE E 3 379 ? 144.541 -21.284 39.580  1.00 41.62 ? 675  PHE A C     1 
ATOM   3806  O  O     . PHE E 3 379 ? 144.806 -22.147 40.416  1.00 40.66 ? 675  PHE A O     1 
ATOM   3807  C  CB    . PHE E 3 379 ? 142.398 -21.728 38.355  1.00 40.51 ? 675  PHE A CB    1 
ATOM   3808  C  CG    . PHE E 3 379 ? 140.914 -21.508 38.303  1.00 39.08 ? 675  PHE A CG    1 
ATOM   3809  C  CD1   . PHE E 3 379 ? 140.270 -21.288 37.093  1.00 39.22 ? 675  PHE A CD1   1 
ATOM   3810  C  CD2   . PHE E 3 379 ? 140.161 -21.501 39.476  1.00 38.83 ? 675  PHE A CD2   1 
ATOM   3811  C  CE1   . PHE E 3 379 ? 138.896 -21.060 37.050  1.00 38.53 ? 675  PHE A CE1   1 
ATOM   3812  C  CE2   . PHE E 3 379 ? 138.790 -21.274 39.445  1.00 37.99 ? 675  PHE A CE2   1 
ATOM   3813  C  CZ    . PHE E 3 379 ? 138.156 -21.053 38.230  1.00 38.22 ? 675  PHE A CZ    1 
ATOM   3814  N  N     . ARG E 3 380 ? 145.468 -20.707 38.826  1.00 43.52 ? 676  ARG A N     1 
ATOM   3815  C  CA    . ARG E 3 380 ? 146.870 -21.062 38.977  1.00 45.71 ? 676  ARG A CA    1 
ATOM   3816  C  C     . ARG E 3 380 ? 147.356 -20.511 40.310  1.00 45.63 ? 676  ARG A C     1 
ATOM   3817  O  O     . ARG E 3 380 ? 148.332 -20.995 40.875  1.00 45.92 ? 676  ARG A O     1 
ATOM   3818  C  CB    . ARG E 3 380 ? 147.687 -20.498 37.816  1.00 47.68 ? 676  ARG A CB    1 
ATOM   3819  C  CG    . ARG E 3 380 ? 147.433 -21.241 36.515  1.00 50.50 ? 676  ARG A CG    1 
ATOM   3820  C  CD    . ARG E 3 380 ? 148.026 -20.529 35.319  1.00 52.72 ? 676  ARG A CD    1 
ATOM   3821  N  NE    . ARG E 3 380 ? 147.742 -21.256 34.086  1.00 54.64 ? 676  ARG A NE    1 
ATOM   3822  C  CZ    . ARG E 3 380 ? 147.974 -20.781 32.867  1.00 55.93 ? 676  ARG A CZ    1 
ATOM   3823  N  NH1   . ARG E 3 380 ? 148.494 -19.570 32.716  1.00 57.05 ? 676  ARG A NH1   1 
ATOM   3824  N  NH2   . ARG E 3 380 ? 147.685 -21.516 31.801  1.00 56.26 ? 676  ARG A NH2   1 
ATOM   3825  N  N     . ARG E 3 381 ? 146.654 -19.499 40.810  1.00 46.56 ? 677  ARG A N     1 
ATOM   3826  C  CA    . ARG E 3 381 ? 146.981 -18.888 42.093  1.00 47.29 ? 677  ARG A CA    1 
ATOM   3827  C  C     . ARG E 3 381 ? 146.112 -19.524 43.177  1.00 47.20 ? 677  ARG A C     1 
ATOM   3828  O  O     . ARG E 3 381 ? 146.187 -19.159 44.350  1.00 47.44 ? 677  ARG A O     1 
ATOM   3829  C  CB    . ARG E 3 381 ? 146.740 -17.377 42.036  1.00 48.49 ? 677  ARG A CB    1 
ATOM   3830  C  CG    . ARG E 3 381 ? 147.853 -16.606 41.340  1.00 50.69 ? 677  ARG A CG    1 
ATOM   3831  C  CD    . ARG E 3 381 ? 147.507 -15.135 41.153  1.00 52.65 ? 677  ARG A CD    1 
ATOM   3832  N  NE    . ARG E 3 381 ? 148.697 -14.348 40.836  1.00 55.70 ? 677  ARG A NE    1 
ATOM   3833  C  CZ    . ARG E 3 381 ? 148.738 -13.363 39.943  1.00 56.74 ? 677  ARG A CZ    1 
ATOM   3834  N  NH1   . ARG E 3 381 ? 147.651 -13.034 39.260  1.00 57.97 ? 677  ARG A NH1   1 
ATOM   3835  N  NH2   . ARG E 3 381 ? 149.870 -12.705 39.730  1.00 57.84 ? 677  ARG A NH2   1 
ATOM   3836  N  N     . ASP E 3 382 ? 145.292 -20.486 42.764  1.00 46.69 ? 678  ASP A N     1 
ATOM   3837  C  CA    . ASP E 3 382 ? 144.396 -21.210 43.661  1.00 45.88 ? 678  ASP A CA    1 
ATOM   3838  C  C     . ASP E 3 382 ? 143.434 -20.300 44.421  1.00 44.65 ? 678  ASP A C     1 
ATOM   3839  O  O     . ASP E 3 382 ? 143.232 -20.455 45.626  1.00 44.69 ? 678  ASP A O     1 
ATOM   3840  C  CB    . ASP E 3 382 ? 145.206 -22.053 44.649  1.00 47.99 ? 678  ASP A CB    1 
ATOM   3841  C  CG    . ASP E 3 382 ? 144.331 -22.944 45.508  1.00 50.27 ? 678  ASP A CG    1 
ATOM   3842  O  OD1   . ASP E 3 382 ? 143.509 -23.695 44.942  1.00 51.80 ? 678  ASP A OD1   1 
ATOM   3843  O  OD2   . ASP E 3 382 ? 144.465 -22.898 46.749  1.00 52.65 ? 678  ASP A OD2   1 
ATOM   3844  N  N     . LEU E 3 383 ? 142.836 -19.354 43.706  1.00 42.35 ? 679  LEU A N     1 
ATOM   3845  C  CA    . LEU E 3 383 ? 141.883 -18.429 44.303  1.00 40.69 ? 679  LEU A CA    1 
ATOM   3846  C  C     . LEU E 3 383 ? 140.472 -18.998 44.210  1.00 39.13 ? 679  LEU A C     1 
ATOM   3847  O  O     . LEU E 3 383 ? 140.236 -19.979 43.505  1.00 38.81 ? 679  LEU A O     1 
ATOM   3848  C  CB    . LEU E 3 383 ? 141.942 -17.079 43.585  1.00 40.50 ? 679  LEU A CB    1 
ATOM   3849  C  CG    . LEU E 3 383 ? 143.035 -16.095 44.015  1.00 41.44 ? 679  LEU A CG    1 
ATOM   3850  C  CD1   . LEU E 3 383 ? 144.363 -16.809 44.182  1.00 41.70 ? 679  LEU A CD1   1 
ATOM   3851  C  CD2   . LEU E 3 383 ? 143.136 -14.986 42.982  1.00 41.50 ? 679  LEU A CD2   1 
ATOM   3852  N  N     . ASP E 3 384 ? 139.538 -18.381 44.927  1.00 37.37 ? 680  ASP A N     1 
ATOM   3853  C  CA    . ASP E 3 384 ? 138.150 -18.825 44.906  1.00 35.23 ? 680  ASP A CA    1 
ATOM   3854  C  C     . ASP E 3 384 ? 137.274 -17.704 44.360  1.00 34.05 ? 680  ASP A C     1 
ATOM   3855  O  O     . ASP E 3 384 ? 136.898 -16.785 45.088  1.00 33.55 ? 680  ASP A O     1 
ATOM   3856  C  CB    . ASP E 3 384 ? 137.688 -19.207 46.313  1.00 35.56 ? 680  ASP A CB    1 
ATOM   3857  C  CG    . ASP E 3 384 ? 136.319 -19.859 46.317  1.00 36.19 ? 680  ASP A CG    1 
ATOM   3858  O  OD1   . ASP E 3 384 ? 135.372 -19.270 45.753  1.00 36.18 ? 680  ASP A OD1   1 
ATOM   3859  O  OD2   . ASP E 3 384 ? 136.191 -20.963 46.885  1.00 36.00 ? 680  ASP A OD2   1 
ATOM   3860  N  N     . ILE E 3 385 ? 136.953 -17.787 43.073  1.00 32.76 ? 681  ILE A N     1 
ATOM   3861  C  CA    . ILE E 3 385 ? 136.134 -16.777 42.413  1.00 31.78 ? 681  ILE A CA    1 
ATOM   3862  C  C     . ILE E 3 385 ? 134.759 -16.607 43.056  1.00 31.00 ? 681  ILE A C     1 
ATOM   3863  O  O     . ILE E 3 385 ? 134.190 -15.513 43.026  1.00 29.93 ? 681  ILE A O     1 
ATOM   3864  C  CB    . ILE E 3 385 ? 135.965 -17.111 40.912  1.00 32.49 ? 681  ILE A CB    1 
ATOM   3865  C  CG1   . ILE E 3 385 ? 137.342 -17.182 40.247  1.00 33.67 ? 681  ILE A CG1   1 
ATOM   3866  C  CG2   . ILE E 3 385 ? 135.110 -16.057 40.222  1.00 32.47 ? 681  ILE A CG2   1 
ATOM   3867  C  CD1   . ILE E 3 385 ? 138.143 -15.891 40.348  1.00 33.93 ? 681  ILE A CD1   1 
ATOM   3868  N  N     . HIS E 3 386 ? 134.224 -17.682 43.634  1.00 30.11 ? 682  HIS A N     1 
ATOM   3869  C  CA    . HIS E 3 386 ? 132.919 -17.605 44.284  1.00 30.38 ? 682  HIS A CA    1 
ATOM   3870  C  C     . HIS E 3 386 ? 133.034 -16.727 45.529  1.00 30.80 ? 682  HIS A C     1 
ATOM   3871  O  O     . HIS E 3 386 ? 132.197 -15.854 45.772  1.00 31.24 ? 682  HIS A O     1 
ATOM   3872  C  CB    . HIS E 3 386 ? 132.412 -19.000 44.682  1.00 29.38 ? 682  HIS A CB    1 
ATOM   3873  C  CG    . HIS E 3 386 ? 132.148 -19.907 43.519  1.00 28.15 ? 682  HIS A CG    1 
ATOM   3874  N  ND1   . HIS E 3 386 ? 131.578 -19.465 42.344  1.00 25.89 ? 682  HIS A ND1   1 
ATOM   3875  C  CD2   . HIS E 3 386 ? 132.363 -21.235 43.356  1.00 26.86 ? 682  HIS A CD2   1 
ATOM   3876  C  CE1   . HIS E 3 386 ? 131.454 -20.481 41.508  1.00 27.83 ? 682  HIS A CE1   1 
ATOM   3877  N  NE2   . HIS E 3 386 ? 131.921 -21.567 42.098  1.00 27.00 ? 682  HIS A NE2   1 
ATOM   3878  N  N     . THR E 3 387 ? 134.077 -16.965 46.314  1.00 32.30 ? 683  THR A N     1 
ATOM   3879  C  CA    . THR E 3 387 ? 134.312 -16.187 47.524  1.00 33.72 ? 683  THR A CA    1 
ATOM   3880  C  C     . THR E 3 387 ? 134.595 -14.733 47.146  1.00 34.22 ? 683  THR A C     1 
ATOM   3881  O  O     . THR E 3 387 ? 134.037 -13.808 47.740  1.00 33.64 ? 683  THR A O     1 
ATOM   3882  C  CB    . THR E 3 387 ? 135.505 -16.741 48.321  1.00 34.03 ? 683  THR A CB    1 
ATOM   3883  O  OG1   . THR E 3 387 ? 135.250 -18.107 48.676  1.00 34.34 ? 683  THR A OG1   1 
ATOM   3884  C  CG2   . THR E 3 387 ? 135.723 -15.919 49.593  1.00 34.73 ? 683  THR A CG2   1 
ATOM   3885  N  N     . LYS E 3 388 ? 135.458 -14.533 46.154  1.00 35.37 ? 684  LYS A N     1 
ATOM   3886  C  CA    . LYS E 3 388 ? 135.781 -13.182 45.705  1.00 36.59 ? 684  LYS A CA    1 
ATOM   3887  C  C     . LYS E 3 388 ? 134.519 -12.446 45.267  1.00 36.80 ? 684  LYS A C     1 
ATOM   3888  O  O     . LYS E 3 388 ? 134.290 -11.304 45.665  1.00 36.84 ? 684  LYS A O     1 
ATOM   3889  C  CB    . LYS E 3 388 ? 136.788 -13.218 44.549  1.00 39.02 ? 684  LYS A CB    1 
ATOM   3890  C  CG    . LYS E 3 388 ? 138.251 -13.300 44.984  1.00 41.28 ? 684  LYS A CG    1 
ATOM   3891  C  CD    . LYS E 3 388 ? 138.538 -14.556 45.791  1.00 44.39 ? 684  LYS A CD    1 
ATOM   3892  C  CE    . LYS E 3 388 ? 140.000 -14.640 46.218  1.00 44.80 ? 684  LYS A CE    1 
ATOM   3893  N  NZ    . LYS E 3 388 ? 140.279 -15.900 46.970  1.00 44.84 ? 684  LYS A NZ    1 
ATOM   3894  N  N     . THR E 3 389 ? 133.697 -13.100 44.450  1.00 35.41 ? 685  THR A N     1 
ATOM   3895  C  CA    . THR E 3 389 ? 132.458 -12.483 43.986  1.00 35.38 ? 685  THR A CA    1 
ATOM   3896  C  C     . THR E 3 389 ? 131.553 -12.193 45.180  1.00 34.96 ? 685  THR A C     1 
ATOM   3897  O  O     . THR E 3 389 ? 130.826 -11.202 45.192  1.00 34.87 ? 685  THR A O     1 
ATOM   3898  C  CB    . THR E 3 389 ? 131.708 -13.399 42.989  1.00 35.00 ? 685  THR A CB    1 
ATOM   3899  O  OG1   . THR E 3 389 ? 132.538 -13.639 41.847  1.00 34.35 ? 685  THR A OG1   1 
ATOM   3900  C  CG2   . THR E 3 389 ? 130.411 -12.746 42.528  1.00 34.86 ? 685  THR A CG2   1 
ATOM   3901  N  N     . ALA E 3 390 ? 131.603 -13.062 46.185  1.00 35.64 ? 686  ALA A N     1 
ATOM   3902  C  CA    . ALA E 3 390 ? 130.797 -12.878 47.385  1.00 37.60 ? 686  ALA A CA    1 
ATOM   3903  C  C     . ALA E 3 390 ? 131.272 -11.619 48.107  1.00 38.96 ? 686  ALA A C     1 
ATOM   3904  O  O     . ALA E 3 390 ? 130.466 -10.804 48.550  1.00 39.33 ? 686  ALA A O     1 
ATOM   3905  C  CB    . ALA E 3 390 ? 130.931 -14.092 48.298  1.00 37.64 ? 686  ALA A CB    1 
ATOM   3906  N  N     . MET E 3 391 ? 132.587 -11.465 48.211  1.00 40.99 ? 687  MET A N     1 
ATOM   3907  C  CA    . MET E 3 391 ? 133.176 -10.304 48.868  1.00 43.83 ? 687  MET A CA    1 
ATOM   3908  C  C     . MET E 3 391 ? 132.731 -8.999  48.219  1.00 45.09 ? 687  MET A C     1 
ATOM   3909  O  O     . MET E 3 391 ? 132.453 -8.018  48.907  1.00 44.97 ? 687  MET A O     1 
ATOM   3910  C  CB    . MET E 3 391 ? 134.701 -10.407 48.832  1.00 43.66 ? 687  MET A CB    1 
ATOM   3911  C  CG    . MET E 3 391 ? 135.250 -11.530 49.694  1.00 45.23 ? 687  MET A CG    1 
ATOM   3912  S  SD    . MET E 3 391 ? 137.007 -11.806 49.454  1.00 46.01 ? 687  MET A SD    1 
ATOM   3913  C  CE    . MET E 3 391 ? 137.687 -10.319 50.198  1.00 47.42 ? 687  MET A CE    1 
ATOM   3914  N  N     . ASP E 3 392 ? 132.659 -8.992  46.892  1.00 47.14 ? 688  ASP A N     1 
ATOM   3915  C  CA    . ASP E 3 392 ? 132.248 -7.800  46.160  1.00 49.65 ? 688  ASP A CA    1 
ATOM   3916  C  C     . ASP E 3 392 ? 130.752 -7.528  46.316  1.00 50.39 ? 688  ASP A C     1 
ATOM   3917  O  O     . ASP E 3 392 ? 130.351 -6.438  46.721  1.00 50.40 ? 688  ASP A O     1 
ATOM   3918  C  CB    . ASP E 3 392 ? 132.596 -7.950  44.674  1.00 51.10 ? 688  ASP A CB    1 
ATOM   3919  C  CG    . ASP E 3 392 ? 132.254 -6.711  43.864  1.00 53.48 ? 688  ASP A CG    1 
ATOM   3920  O  OD1   . ASP E 3 392 ? 131.737 -5.733  44.447  1.00 55.58 ? 688  ASP A OD1   1 
ATOM   3921  O  OD2   . ASP E 3 392 ? 132.502 -6.712  42.639  1.00 54.96 ? 688  ASP A OD2   1 
ATOM   3922  N  N     . ILE E 3 393 ? 129.931 -8.523  45.994  1.00 51.20 ? 689  ILE A N     1 
ATOM   3923  C  CA    . ILE E 3 393 ? 128.481 -8.385  46.088  1.00 52.38 ? 689  ILE A CA    1 
ATOM   3924  C  C     . ILE E 3 393 ? 128.007 -7.941  47.467  1.00 52.61 ? 689  ILE A C     1 
ATOM   3925  O  O     . ILE E 3 393 ? 127.154 -7.063  47.585  1.00 52.90 ? 689  ILE A O     1 
ATOM   3926  C  CB    . ILE E 3 393 ? 127.772 -9.714  45.733  1.00 53.06 ? 689  ILE A CB    1 
ATOM   3927  C  CG1   . ILE E 3 393 ? 128.034 -10.065 44.267  1.00 53.90 ? 689  ILE A CG1   1 
ATOM   3928  C  CG2   . ILE E 3 393 ? 126.275 -9.596  45.988  1.00 53.08 ? 689  ILE A CG2   1 
ATOM   3929  C  CD1   . ILE E 3 393 ? 127.385 -11.358 43.821  1.00 55.28 ? 689  ILE A CD1   1 
ATOM   3930  N  N     . PHE E 3 394 ? 128.562 -8.552  48.507  1.00 52.89 ? 690  PHE A N     1 
ATOM   3931  C  CA    . PHE E 3 394 ? 128.180 -8.227  49.876  1.00 54.18 ? 690  PHE A CA    1 
ATOM   3932  C  C     . PHE E 3 394 ? 129.079 -7.156  50.484  1.00 55.12 ? 690  PHE A C     1 
ATOM   3933  O  O     . PHE E 3 394 ? 128.872 -6.735  51.623  1.00 55.24 ? 690  PHE A O     1 
ATOM   3934  C  CB    . PHE E 3 394 ? 128.221 -9.495  50.733  1.00 53.90 ? 690  PHE A CB    1 
ATOM   3935  C  CG    . PHE E 3 394 ? 127.286 -10.573 50.260  1.00 54.33 ? 690  PHE A CG    1 
ATOM   3936  C  CD1   . PHE E 3 394 ? 125.913 -10.458 50.457  1.00 54.05 ? 690  PHE A CD1   1 
ATOM   3937  C  CD2   . PHE E 3 394 ? 127.775 -11.690 49.591  1.00 53.97 ? 690  PHE A CD2   1 
ATOM   3938  C  CE1   . PHE E 3 394 ? 125.041 -11.441 49.993  1.00 54.33 ? 690  PHE A CE1   1 
ATOM   3939  C  CE2   . PHE E 3 394 ? 126.912 -12.678 49.124  1.00 53.93 ? 690  PHE A CE2   1 
ATOM   3940  C  CZ    . PHE E 3 394 ? 125.543 -12.553 49.326  1.00 53.99 ? 690  PHE A CZ    1 
ATOM   3941  N  N     . GLN E 3 395 ? 130.072 -6.715  49.718  1.00 55.78 ? 691  GLN A N     1 
ATOM   3942  C  CA    . GLN E 3 395 ? 131.008 -5.697  50.181  1.00 56.48 ? 691  GLN A CA    1 
ATOM   3943  C  C     . GLN E 3 395 ? 131.565 -6.051  51.557  1.00 56.08 ? 691  GLN A C     1 
ATOM   3944  O  O     . GLN E 3 395 ? 131.496 -5.253  52.491  1.00 55.93 ? 691  GLN A O     1 
ATOM   3945  C  CB    . GLN E 3 395 ? 130.322 -4.328  50.235  1.00 57.38 ? 691  GLN A CB    1 
ATOM   3946  C  CG    . GLN E 3 395 ? 129.968 -3.741  48.875  1.00 59.85 ? 691  GLN A CG    1 
ATOM   3947  C  CD    . GLN E 3 395 ? 131.189 -3.511  47.999  1.00 61.38 ? 691  GLN A CD    1 
ATOM   3948  O  OE1   . GLN E 3 395 ? 132.162 -2.889  48.424  1.00 63.05 ? 691  GLN A OE1   1 
ATOM   3949  N  NE2   . GLN E 3 395 ? 131.139 -4.009  46.769  1.00 62.14 ? 691  GLN A NE2   1 
ATOM   3950  N  N     . VAL E 3 396 ? 132.115 -7.255  51.675  1.00 55.90 ? 692  VAL A N     1 
ATOM   3951  C  CA    . VAL E 3 396 ? 132.685 -7.713  52.936  1.00 55.82 ? 692  VAL A CA    1 
ATOM   3952  C  C     . VAL E 3 396 ? 134.072 -8.307  52.722  1.00 55.91 ? 692  VAL A C     1 
ATOM   3953  O  O     . VAL E 3 396 ? 134.511 -8.489  51.586  1.00 55.76 ? 692  VAL A O     1 
ATOM   3954  C  CB    . VAL E 3 396 ? 131.787 -8.779  53.599  1.00 56.07 ? 692  VAL A CB    1 
ATOM   3955  C  CG1   . VAL E 3 396 ? 130.416 -8.194  53.887  1.00 55.93 ? 692  VAL A CG1   1 
ATOM   3956  C  CG2   . VAL E 3 396 ? 131.668 -9.997  52.694  1.00 55.57 ? 692  VAL A CG2   1 
ATOM   3957  N  N     . SER E 3 397 ? 134.758 -8.606  53.821  1.00 56.10 ? 693  SER A N     1 
ATOM   3958  C  CA    . SER E 3 397 ? 136.096 -9.183  53.763  1.00 56.55 ? 693  SER A CA    1 
ATOM   3959  C  C     . SER E 3 397 ? 136.009 -10.693 53.573  1.00 56.90 ? 693  SER A C     1 
ATOM   3960  O  O     . SER E 3 397 ? 134.983 -11.304 53.865  1.00 56.69 ? 693  SER A O     1 
ATOM   3961  C  CB    . SER E 3 397 ? 136.863 -8.867  55.050  1.00 56.55 ? 693  SER A CB    1 
ATOM   3962  O  OG    . SER E 3 397 ? 136.212 -9.416  56.182  1.00 56.02 ? 693  SER A OG    1 
ATOM   3963  N  N     . GLU E 3 398 ? 137.093 -11.291 53.089  1.00 57.55 ? 694  GLU A N     1 
ATOM   3964  C  CA    . GLU E 3 398 ? 137.125 -12.729 52.847  1.00 58.85 ? 694  GLU A CA    1 
ATOM   3965  C  C     . GLU E 3 398 ? 136.740 -13.571 54.060  1.00 59.25 ? 694  GLU A C     1 
ATOM   3966  O  O     . GLU E 3 398 ? 135.949 -14.507 53.941  1.00 59.79 ? 694  GLU A O     1 
ATOM   3967  C  CB    . GLU E 3 398 ? 138.512 -13.154 52.355  1.00 59.25 ? 694  GLU A CB    1 
ATOM   3968  C  CG    . GLU E 3 398 ? 138.631 -14.649 52.089  1.00 60.66 ? 694  GLU A CG    1 
ATOM   3969  C  CD    . GLU E 3 398 ? 139.980 -15.041 51.519  1.00 61.31 ? 694  GLU A CD    1 
ATOM   3970  O  OE1   . GLU E 3 398 ? 140.321 -14.572 50.413  1.00 61.88 ? 694  GLU A OE1   1 
ATOM   3971  O  OE2   . GLU E 3 398 ? 140.701 -15.818 52.179  1.00 62.09 ? 694  GLU A OE2   1 
ATOM   3972  N  N     . ASP E 3 399 ? 137.294 -13.243 55.223  1.00 59.44 ? 695  ASP A N     1 
ATOM   3973  C  CA    . ASP E 3 399 ? 136.996 -14.001 56.434  1.00 59.77 ? 695  ASP A CA    1 
ATOM   3974  C  C     . ASP E 3 399 ? 135.529 -13.931 56.841  1.00 58.72 ? 695  ASP A C     1 
ATOM   3975  O  O     . ASP E 3 399 ? 135.028 -14.830 57.515  1.00 58.65 ? 695  ASP A O     1 
ATOM   3976  C  CB    . ASP E 3 399 ? 137.863 -13.523 57.603  1.00 61.89 ? 695  ASP A CB    1 
ATOM   3977  C  CG    . ASP E 3 399 ? 139.341 -13.793 57.386  1.00 64.17 ? 695  ASP A CG    1 
ATOM   3978  O  OD1   . ASP E 3 399 ? 139.675 -14.819 56.753  1.00 64.91 ? 695  ASP A OD1   1 
ATOM   3979  O  OD2   . ASP E 3 399 ? 140.169 -12.982 57.856  1.00 65.87 ? 695  ASP A OD2   1 
ATOM   3980  N  N     . GLU E 3 400 ? 134.843 -12.870 56.431  1.00 57.86 ? 696  GLU A N     1 
ATOM   3981  C  CA    . GLU E 3 400 ? 133.435 -12.694 56.774  1.00 57.41 ? 696  GLU A CA    1 
ATOM   3982  C  C     . GLU E 3 400 ? 132.481 -13.492 55.885  1.00 56.10 ? 696  GLU A C     1 
ATOM   3983  O  O     . GLU E 3 400 ? 131.358 -13.793 56.289  1.00 56.05 ? 696  GLU A O     1 
ATOM   3984  C  CB    . GLU E 3 400 ? 133.057 -11.212 56.709  1.00 58.43 ? 696  GLU A CB    1 
ATOM   3985  C  CG    . GLU E 3 400 ? 133.824 -10.329 57.676  1.00 60.93 ? 696  GLU A CG    1 
ATOM   3986  C  CD    . GLU E 3 400 ? 133.359 -8.886  57.639  1.00 62.41 ? 696  GLU A CD    1 
ATOM   3987  O  OE1   . GLU E 3 400 ? 133.970 -8.047  58.334  1.00 63.67 ? 696  GLU A OE1   1 
ATOM   3988  O  OE2   . GLU E 3 400 ? 132.382 -8.589  56.918  1.00 63.16 ? 696  GLU A OE2   1 
ATOM   3989  N  N     . VAL E 3 401 ? 132.926 -13.833 54.680  1.00 54.10 ? 697  VAL A N     1 
ATOM   3990  C  CA    . VAL E 3 401 ? 132.092 -14.585 53.747  1.00 52.33 ? 697  VAL A CA    1 
ATOM   3991  C  C     . VAL E 3 401 ? 131.618 -15.915 54.327  1.00 51.37 ? 697  VAL A C     1 
ATOM   3992  O  O     . VAL E 3 401 ? 132.419 -16.811 54.593  1.00 50.31 ? 697  VAL A O     1 
ATOM   3993  C  CB    . VAL E 3 401 ? 132.845 -14.860 52.426  1.00 52.82 ? 697  VAL A CB    1 
ATOM   3994  C  CG1   . VAL E 3 401 ? 131.967 -15.674 51.483  1.00 52.29 ? 697  VAL A CG1   1 
ATOM   3995  C  CG2   . VAL E 3 401 ? 133.244 -13.546 51.774  1.00 51.97 ? 697  VAL A CG2   1 
ATOM   3996  N  N     . THR E 3 402 ? 130.306 -16.034 54.517  1.00 50.53 ? 698  THR A N     1 
ATOM   3997  C  CA    . THR E 3 402 ? 129.707 -17.252 55.057  1.00 50.09 ? 698  THR A CA    1 
ATOM   3998  C  C     . THR E 3 402 ? 129.395 -18.237 53.933  1.00 49.27 ? 698  THR A C     1 
ATOM   3999  O  O     . THR E 3 402 ? 129.290 -17.851 52.770  1.00 48.55 ? 698  THR A O     1 
ATOM   4000  C  CB    . THR E 3 402 ? 128.395 -16.946 55.803  1.00 50.36 ? 698  THR A CB    1 
ATOM   4001  O  OG1   . THR E 3 402 ? 127.441 -16.399 54.885  1.00 50.19 ? 698  THR A OG1   1 
ATOM   4002  C  CG2   . THR E 3 402 ? 128.640 -15.949 56.926  1.00 50.63 ? 698  THR A CG2   1 
ATOM   4003  N  N     . PRO E 3 403 ? 129.244 -19.528 54.269  1.00 48.99 ? 699  PRO A N     1 
ATOM   4004  C  CA    . PRO E 3 403 ? 128.942 -20.561 53.273  1.00 48.08 ? 699  PRO A CA    1 
ATOM   4005  C  C     . PRO E 3 403 ? 127.717 -20.232 52.425  1.00 47.07 ? 699  PRO A C     1 
ATOM   4006  O  O     . PRO E 3 403 ? 127.657 -20.570 51.243  1.00 46.80 ? 699  PRO A O     1 
ATOM   4007  C  CB    . PRO E 3 403 ? 128.761 -21.814 54.120  1.00 48.59 ? 699  PRO A CB    1 
ATOM   4008  C  CG    . PRO E 3 403 ? 129.723 -21.584 55.245  1.00 49.40 ? 699  PRO A CG    1 
ATOM   4009  C  CD    . PRO E 3 403 ? 129.463 -20.134 55.595  1.00 49.69 ? 699  PRO A CD    1 
ATOM   4010  N  N     . ASN E 3 404 ? 126.746 -19.566 53.037  1.00 45.75 ? 700  ASN A N     1 
ATOM   4011  C  CA    . ASN E 3 404 ? 125.521 -19.196 52.346  1.00 44.44 ? 700  ASN A CA    1 
ATOM   4012  C  C     . ASN E 3 404 ? 125.766 -18.031 51.389  1.00 43.25 ? 700  ASN A C     1 
ATOM   4013  O  O     . ASN E 3 404 ? 125.135 -17.939 50.335  1.00 41.82 ? 700  ASN A O     1 
ATOM   4014  C  CB    . ASN E 3 404 ? 124.444 -18.826 53.368  1.00 46.05 ? 700  ASN A CB    1 
ATOM   4015  C  CG    . ASN E 3 404 ? 123.048 -18.892 52.791  1.00 46.76 ? 700  ASN A CG    1 
ATOM   4016  O  OD1   . ASN E 3 404 ? 122.658 -18.058 51.973  1.00 47.73 ? 700  ASN A OD1   1 
ATOM   4017  N  ND2   . ASN E 3 404 ? 122.287 -19.896 53.210  1.00 48.24 ? 700  ASN A ND2   1 
ATOM   4018  N  N     . MET E 3 405 ? 126.684 -17.141 51.759  1.00 41.55 ? 701  MET A N     1 
ATOM   4019  C  CA    . MET E 3 405 ? 127.015 -15.997 50.915  1.00 39.55 ? 701  MET A CA    1 
ATOM   4020  C  C     . MET E 3 405 ? 127.808 -16.467 49.699  1.00 37.31 ? 701  MET A C     1 
ATOM   4021  O  O     . MET E 3 405 ? 127.620 -15.966 48.589  1.00 36.21 ? 701  MET A O     1 
ATOM   4022  C  CB    . MET E 3 405 ? 127.843 -14.972 51.693  1.00 41.98 ? 701  MET A CB    1 
ATOM   4023  C  CG    . MET E 3 405 ? 127.076 -14.220 52.765  1.00 44.75 ? 701  MET A CG    1 
ATOM   4024  S  SD    . MET E 3 405 ? 128.114 -13.008 53.615  1.00 49.21 ? 701  MET A SD    1 
ATOM   4025  C  CE    . MET E 3 405 ? 126.960 -12.405 54.869  1.00 48.62 ? 701  MET A CE    1 
ATOM   4026  N  N     . ARG E 3 406 ? 128.700 -17.427 49.917  1.00 34.74 ? 702  ARG A N     1 
ATOM   4027  C  CA    . ARG E 3 406 ? 129.509 -17.965 48.833  1.00 34.66 ? 702  ARG A CA    1 
ATOM   4028  C  C     . ARG E 3 406 ? 128.592 -18.669 47.842  1.00 34.40 ? 702  ARG A C     1 
ATOM   4029  O  O     . ARG E 3 406 ? 128.766 -18.559 46.628  1.00 33.90 ? 702  ARG A O     1 
ATOM   4030  C  CB    . ARG E 3 406 ? 130.546 -18.955 49.373  1.00 32.83 ? 702  ARG A CB    1 
ATOM   4031  C  CG    . ARG E 3 406 ? 131.411 -19.604 48.290  1.00 30.70 ? 702  ARG A CG    1 
ATOM   4032  C  CD    . ARG E 3 406 ? 132.508 -20.470 48.893  1.00 29.54 ? 702  ARG A CD    1 
ATOM   4033  N  NE    . ARG E 3 406 ? 133.362 -21.088 47.878  1.00 29.05 ? 702  ARG A NE    1 
ATOM   4034  C  CZ    . ARG E 3 406 ? 133.015 -22.131 47.127  1.00 30.12 ? 702  ARG A CZ    1 
ATOM   4035  N  NH1   . ARG E 3 406 ? 131.819 -22.689 47.270  1.00 27.58 ? 702  ARG A NH1   1 
ATOM   4036  N  NH2   . ARG E 3 406 ? 133.867 -22.620 46.232  1.00 27.59 ? 702  ARG A NH2   1 
ATOM   4037  N  N     . ARG E 3 407 ? 127.608 -19.385 48.376  1.00 34.79 ? 703  ARG A N     1 
ATOM   4038  C  CA    . ARG E 3 407 ? 126.660 -20.120 47.554  1.00 35.25 ? 703  ARG A CA    1 
ATOM   4039  C  C     . ARG E 3 407 ? 125.875 -19.154 46.675  1.00 34.28 ? 703  ARG A C     1 
ATOM   4040  O  O     . ARG E 3 407 ? 125.655 -19.418 45.494  1.00 33.73 ? 703  ARG A O     1 
ATOM   4041  C  CB    . ARG E 3 407 ? 125.707 -20.919 48.445  1.00 36.98 ? 703  ARG A CB    1 
ATOM   4042  C  CG    . ARG E 3 407 ? 125.124 -22.157 47.789  1.00 41.36 ? 703  ARG A CG    1 
ATOM   4043  C  CD    . ARG E 3 407 ? 124.161 -22.851 48.735  1.00 43.73 ? 703  ARG A CD    1 
ATOM   4044  N  NE    . ARG E 3 407 ? 124.787 -23.128 50.024  1.00 47.24 ? 703  ARG A NE    1 
ATOM   4045  C  CZ    . ARG E 3 407 ? 124.202 -22.912 51.199  1.00 48.80 ? 703  ARG A CZ    1 
ATOM   4046  N  NH1   . ARG E 3 407 ? 122.973 -22.415 51.250  1.00 50.38 ? 703  ARG A NH1   1 
ATOM   4047  N  NH2   . ARG E 3 407 ? 124.846 -23.188 52.323  1.00 48.82 ? 703  ARG A NH2   1 
ATOM   4048  N  N     . GLN E 3 408 ? 125.455 -18.031 47.250  1.00 34.23 ? 704  GLN A N     1 
ATOM   4049  C  CA    . GLN E 3 408 ? 124.703 -17.048 46.485  1.00 33.69 ? 704  GLN A CA    1 
ATOM   4050  C  C     . GLN E 3 408 ? 125.595 -16.431 45.417  1.00 31.65 ? 704  GLN A C     1 
ATOM   4051  O  O     . GLN E 3 408 ? 125.143 -16.161 44.306  1.00 31.31 ? 704  GLN A O     1 
ATOM   4052  C  CB    . GLN E 3 408 ? 124.145 -15.958 47.402  1.00 36.62 ? 704  GLN A CB    1 
ATOM   4053  C  CG    . GLN E 3 408 ? 123.072 -16.459 48.360  1.00 40.68 ? 704  GLN A CG    1 
ATOM   4054  C  CD    . GLN E 3 408 ? 122.386 -15.334 49.118  1.00 43.73 ? 704  GLN A CD    1 
ATOM   4055  O  OE1   . GLN E 3 408 ? 121.777 -14.445 48.517  1.00 45.98 ? 704  GLN A OE1   1 
ATOM   4056  N  NE2   . GLN E 3 408 ? 122.477 -15.370 50.443  1.00 44.87 ? 704  GLN A NE2   1 
ATOM   4057  N  N     . ALA E 3 409 ? 126.865 -16.222 45.751  1.00 29.60 ? 705  ALA A N     1 
ATOM   4058  C  CA    . ALA E 3 409 ? 127.809 -15.643 44.803  1.00 28.79 ? 705  ALA A CA    1 
ATOM   4059  C  C     . ALA E 3 409 ? 128.080 -16.642 43.687  1.00 26.83 ? 705  ALA A C     1 
ATOM   4060  O  O     . ALA E 3 409 ? 128.247 -16.260 42.529  1.00 25.93 ? 705  ALA A O     1 
ATOM   4061  C  CB    . ALA E 3 409 ? 129.113 -15.276 45.509  1.00 28.18 ? 705  ALA A CB    1 
ATOM   4062  N  N     . LYS E 3 410 ? 128.122 -17.923 44.046  1.00 25.84 ? 706  LYS A N     1 
ATOM   4063  C  CA    . LYS E 3 410 ? 128.359 -18.988 43.078  1.00 26.16 ? 706  LYS A CA    1 
ATOM   4064  C  C     . LYS E 3 410 ? 127.260 -18.948 42.023  1.00 26.00 ? 706  LYS A C     1 
ATOM   4065  O  O     . LYS E 3 410 ? 127.526 -19.061 40.826  1.00 26.13 ? 706  LYS A O     1 
ATOM   4066  C  CB    . LYS E 3 410 ? 128.344 -20.352 43.770  1.00 27.48 ? 706  LYS A CB    1 
ATOM   4067  C  CG    . LYS E 3 410 ? 128.657 -21.512 42.834  1.00 27.37 ? 706  LYS A CG    1 
ATOM   4068  C  CD    . LYS E 3 410 ? 128.137 -22.829 43.367  1.00 29.04 ? 706  LYS A CD    1 
ATOM   4069  C  CE    . LYS E 3 410 ? 128.702 -23.169 44.735  1.00 28.85 ? 706  LYS A CE    1 
ATOM   4070  N  NZ    . LYS E 3 410 ? 128.164 -24.469 45.217  1.00 28.25 ? 706  LYS A NZ    1 
ATOM   4071  N  N     . ALA E 3 411 ? 126.020 -18.786 42.478  1.00 26.17 ? 707  ALA A N     1 
ATOM   4072  C  CA    . ALA E 3 411 ? 124.877 -18.721 41.576  1.00 26.18 ? 707  ALA A CA    1 
ATOM   4073  C  C     . ALA E 3 411 ? 125.018 -17.499 40.677  1.00 26.50 ? 707  ALA A C     1 
ATOM   4074  O  O     . ALA E 3 411 ? 124.657 -17.536 39.502  1.00 26.37 ? 707  ALA A O     1 
ATOM   4075  C  CB    . ALA E 3 411 ? 123.576 -18.641 42.377  1.00 26.92 ? 707  ALA A CB    1 
ATOM   4076  N  N     . VAL E 3 412 ? 125.546 -16.414 41.237  1.00 26.24 ? 708  VAL A N     1 
ATOM   4077  C  CA    . VAL E 3 412 ? 125.741 -15.188 40.471  1.00 24.84 ? 708  VAL A CA    1 
ATOM   4078  C  C     . VAL E 3 412 ? 126.830 -15.395 39.418  1.00 24.79 ? 708  VAL A C     1 
ATOM   4079  O  O     . VAL E 3 412 ? 126.648 -15.031 38.255  1.00 25.53 ? 708  VAL A O     1 
ATOM   4080  C  CB    . VAL E 3 412 ? 126.130 -14.000 41.391  1.00 25.45 ? 708  VAL A CB    1 
ATOM   4081  C  CG1   . VAL E 3 412 ? 126.461 -12.765 40.553  1.00 23.27 ? 708  VAL A CG1   1 
ATOM   4082  C  CG2   . VAL E 3 412 ? 124.980 -13.685 42.341  1.00 25.15 ? 708  VAL A CG2   1 
ATOM   4083  N  N     . ASN E 3 413 ? 127.953 -15.989 39.817  1.00 22.64 ? 709  ASN A N     1 
ATOM   4084  C  CA    . ASN E 3 413 ? 129.045 -16.227 38.879  1.00 22.91 ? 709  ASN A CA    1 
ATOM   4085  C  C     . ASN E 3 413 ? 128.605 -16.996 37.639  1.00 23.52 ? 709  ASN A C     1 
ATOM   4086  O  O     . ASN E 3 413 ? 128.878 -16.582 36.509  1.00 22.72 ? 709  ASN A O     1 
ATOM   4087  C  CB    . ASN E 3 413 ? 130.194 -16.987 39.550  1.00 23.51 ? 709  ASN A CB    1 
ATOM   4088  C  CG    . ASN E 3 413 ? 131.112 -16.078 40.334  1.00 24.16 ? 709  ASN A CG    1 
ATOM   4089  O  OD1   . ASN E 3 413 ? 131.346 -14.935 39.944  1.00 23.64 ? 709  ASN A OD1   1 
ATOM   4090  N  ND2   . ASN E 3 413 ? 131.648 -16.583 41.439  1.00 23.49 ? 709  ASN A ND2   1 
ATOM   4091  N  N     . TYR E 3 414 ? 127.924 -18.117 37.849  1.00 22.46 ? 710  TYR A N     1 
ATOM   4092  C  CA    . TYR E 3 414 ? 127.472 -18.926 36.728  1.00 21.66 ? 710  TYR A CA    1 
ATOM   4093  C  C     . TYR E 3 414 ? 126.357 -18.260 35.931  1.00 22.41 ? 710  TYR A C     1 
ATOM   4094  O  O     . TYR E 3 414 ? 126.276 -18.418 34.712  1.00 22.18 ? 710  TYR A O     1 
ATOM   4095  C  CB    . TYR E 3 414 ? 127.051 -20.308 37.229  1.00 19.64 ? 710  TYR A CB    1 
ATOM   4096  C  CG    . TYR E 3 414 ? 128.240 -21.165 37.600  1.00 18.45 ? 710  TYR A CG    1 
ATOM   4097  C  CD1   . TYR E 3 414 ? 129.235 -21.439 36.661  1.00 16.78 ? 710  TYR A CD1   1 
ATOM   4098  C  CD2   . TYR E 3 414 ? 128.380 -21.695 38.882  1.00 17.17 ? 710  TYR A CD2   1 
ATOM   4099  C  CE1   . TYR E 3 414 ? 130.338 -22.218 36.986  1.00 16.55 ? 710  TYR A CE1   1 
ATOM   4100  C  CE2   . TYR E 3 414 ? 129.484 -22.481 39.221  1.00 17.63 ? 710  TYR A CE2   1 
ATOM   4101  C  CZ    . TYR E 3 414 ? 130.459 -22.738 38.263  1.00 18.30 ? 710  TYR A CZ    1 
ATOM   4102  O  OH    . TYR E 3 414 ? 131.550 -23.518 38.571  1.00 20.39 ? 710  TYR A OH    1 
ATOM   4103  N  N     . GLY E 3 415 ? 125.507 -17.501 36.613  1.00 21.91 ? 711  GLY A N     1 
ATOM   4104  C  CA    . GLY E 3 415 ? 124.434 -16.816 35.919  1.00 22.89 ? 711  GLY A CA    1 
ATOM   4105  C  C     . GLY E 3 415 ? 125.002 -15.812 34.930  1.00 24.41 ? 711  GLY A C     1 
ATOM   4106  O  O     . GLY E 3 415 ? 124.514 -15.680 33.804  1.00 23.70 ? 711  GLY A O     1 
ATOM   4107  N  N     . ILE E 3 416 ? 126.051 -15.108 35.347  1.00 24.76 ? 712  ILE A N     1 
ATOM   4108  C  CA    . ILE E 3 416 ? 126.681 -14.108 34.494  1.00 24.81 ? 712  ILE A CA    1 
ATOM   4109  C  C     . ILE E 3 416 ? 127.441 -14.723 33.315  1.00 24.37 ? 712  ILE A C     1 
ATOM   4110  O  O     . ILE E 3 416 ? 127.214 -14.344 32.165  1.00 24.35 ? 712  ILE A O     1 
ATOM   4111  C  CB    . ILE E 3 416 ? 127.643 -13.205 35.308  1.00 25.02 ? 712  ILE A CB    1 
ATOM   4112  C  CG1   . ILE E 3 416 ? 126.850 -12.437 36.374  1.00 25.54 ? 712  ILE A CG1   1 
ATOM   4113  C  CG2   . ILE E 3 416 ? 128.348 -12.217 34.380  1.00 23.80 ? 712  ILE A CG2   1 
ATOM   4114  C  CD1   . ILE E 3 416 ? 127.696 -11.534 37.263  1.00 23.95 ? 712  ILE A CD1   1 
ATOM   4115  N  N     . VAL E 3 417 ? 128.332 -15.671 33.590  1.00 24.69 ? 713  VAL A N     1 
ATOM   4116  C  CA    . VAL E 3 417 ? 129.094 -16.296 32.518  1.00 24.58 ? 713  VAL A CA    1 
ATOM   4117  C  C     . VAL E 3 417 ? 128.169 -16.973 31.514  1.00 25.33 ? 713  VAL A C     1 
ATOM   4118  O  O     . VAL E 3 417 ? 128.507 -17.094 30.337  1.00 24.27 ? 713  VAL A O     1 
ATOM   4119  C  CB    . VAL E 3 417 ? 130.108 -17.350 33.049  1.00 26.29 ? 713  VAL A CB    1 
ATOM   4120  C  CG1   . VAL E 3 417 ? 131.051 -16.706 34.054  1.00 26.48 ? 713  VAL A CG1   1 
ATOM   4121  C  CG2   . VAL E 3 417 ? 129.379 -18.531 33.666  1.00 24.65 ? 713  VAL A CG2   1 
ATOM   4122  N  N     . TYR E 3 418 ? 126.997 -17.405 31.973  1.00 23.30 ? 714  TYR A N     1 
ATOM   4123  C  CA    . TYR E 3 418 ? 126.063 -18.071 31.079  1.00 22.64 ? 714  TYR A CA    1 
ATOM   4124  C  C     . TYR E 3 418 ? 124.974 -17.186 30.472  1.00 22.41 ? 714  TYR A C     1 
ATOM   4125  O  O     . TYR E 3 418 ? 123.943 -17.679 30.010  1.00 20.60 ? 714  TYR A O     1 
ATOM   4126  C  CB    . TYR E 3 418 ? 125.452 -19.291 31.770  1.00 21.82 ? 714  TYR A CB    1 
ATOM   4127  C  CG    . TYR E 3 418 ? 126.455 -20.401 31.990  1.00 20.47 ? 714  TYR A CG    1 
ATOM   4128  C  CD1   . TYR E 3 418 ? 127.360 -20.756 30.986  1.00 21.72 ? 714  TYR A CD1   1 
ATOM   4129  C  CD2   . TYR E 3 418 ? 126.499 -21.103 33.194  1.00 20.41 ? 714  TYR A CD2   1 
ATOM   4130  C  CE1   . TYR E 3 418 ? 128.284 -21.782 31.176  1.00 21.86 ? 714  TYR A CE1   1 
ATOM   4131  C  CE2   . TYR E 3 418 ? 127.418 -22.134 33.396  1.00 20.43 ? 714  TYR A CE2   1 
ATOM   4132  C  CZ    . TYR E 3 418 ? 128.307 -22.469 32.382  1.00 22.37 ? 714  TYR A CZ    1 
ATOM   4133  O  OH    . TYR E 3 418 ? 129.201 -23.504 32.564  1.00 21.92 ? 714  TYR A OH    1 
ATOM   4134  N  N     . GLY E 3 419 ? 125.210 -15.877 30.480  1.00 21.82 ? 715  GLY A N     1 
ATOM   4135  C  CA    . GLY E 3 419 ? 124.280 -14.953 29.857  1.00 21.37 ? 715  GLY A CA    1 
ATOM   4136  C  C     . GLY E 3 419 ? 123.076 -14.366 30.562  1.00 22.58 ? 715  GLY A C     1 
ATOM   4137  O  O     . GLY E 3 419 ? 122.119 -13.982 29.894  1.00 22.36 ? 715  GLY A O     1 
ATOM   4138  N  N     . ILE E 3 420 ? 123.095 -14.278 31.888  1.00 24.49 ? 716  ILE A N     1 
ATOM   4139  C  CA    . ILE E 3 420 ? 121.954 -13.696 32.589  1.00 23.35 ? 716  ILE A CA    1 
ATOM   4140  C  C     . ILE E 3 420 ? 121.882 -12.231 32.158  1.00 23.79 ? 716  ILE A C     1 
ATOM   4141  O  O     . ILE E 3 420 ? 122.913 -11.620 31.877  1.00 23.91 ? 716  ILE A O     1 
ATOM   4142  C  CB    . ILE E 3 420 ? 122.132 -13.789 34.127  1.00 23.83 ? 716  ILE A CB    1 
ATOM   4143  C  CG1   . ILE E 3 420 ? 120.803 -13.505 34.828  1.00 25.15 ? 716  ILE A CG1   1 
ATOM   4144  C  CG2   . ILE E 3 420 ? 123.200 -12.802 34.597  1.00 23.83 ? 716  ILE A CG2   1 
ATOM   4145  C  CD1   . ILE E 3 420 ? 120.827 -13.816 36.320  1.00 25.00 ? 716  ILE A CD1   1 
ATOM   4146  N  N     . SER E 3 421 ? 120.677 -11.671 32.092  1.00 23.24 ? 717  SER A N     1 
ATOM   4147  C  CA    . SER E 3 421 ? 120.521 -10.276 31.692  1.00 23.43 ? 717  SER A CA    1 
ATOM   4148  C  C     . SER E 3 421 ? 120.605 -9.373  32.914  1.00 24.22 ? 717  SER A C     1 
ATOM   4149  O  O     . SER E 3 421 ? 120.592 -9.848  34.052  1.00 21.49 ? 717  SER A O     1 
ATOM   4150  C  CB    . SER E 3 421 ? 119.174 -10.055 30.999  1.00 23.54 ? 717  SER A CB    1 
ATOM   4151  O  OG    . SER E 3 421 ? 118.109 -10.021 31.934  1.00 21.83 ? 717  SER A OG    1 
ATOM   4152  N  N     . ASP E 3 422 ? 120.686 -8.068  32.680  1.00 24.71 ? 718  ASP A N     1 
ATOM   4153  C  CA    . ASP E 3 422 ? 120.758 -7.122  33.784  1.00 26.20 ? 718  ASP A CA    1 
ATOM   4154  C  C     . ASP E 3 422 ? 119.443 -7.179  34.558  1.00 26.67 ? 718  ASP A C     1 
ATOM   4155  O  O     . ASP E 3 422 ? 119.409 -6.957  35.771  1.00 25.24 ? 718  ASP A O     1 
ATOM   4156  C  CB    . ASP E 3 422 ? 121.037 -5.706  33.258  1.00 27.99 ? 718  ASP A CB    1 
ATOM   4157  C  CG    . ASP E 3 422 ? 119.965 -5.203  32.304  1.00 31.06 ? 718  ASP A CG    1 
ATOM   4158  O  OD1   . ASP E 3 422 ? 119.180 -6.020  31.781  1.00 33.92 ? 718  ASP A OD1   1 
ATOM   4159  O  OD2   . ASP E 3 422 ? 119.914 -3.978  32.070  1.00 33.72 ? 718  ASP A OD2   1 
ATOM   4160  N  N     . TYR E 3 423 ? 118.363 -7.503  33.853  1.00 26.80 ? 719  TYR A N     1 
ATOM   4161  C  CA    . TYR E 3 423 ? 117.051 -7.613  34.478  1.00 27.56 ? 719  TYR A CA    1 
ATOM   4162  C  C     . TYR E 3 423 ? 117.043 -8.799  35.438  1.00 28.12 ? 719  TYR A C     1 
ATOM   4163  O  O     . TYR E 3 423 ? 116.639 -8.675  36.594  1.00 28.51 ? 719  TYR A O     1 
ATOM   4164  C  CB    . TYR E 3 423 ? 115.969 -7.823  33.419  1.00 29.56 ? 719  TYR A CB    1 
ATOM   4165  C  CG    . TYR E 3 423 ? 114.575 -7.980  33.994  1.00 30.56 ? 719  TYR A CG    1 
ATOM   4166  C  CD1   . TYR E 3 423 ? 113.818 -6.864  34.356  1.00 30.82 ? 719  TYR A CD1   1 
ATOM   4167  C  CD2   . TYR E 3 423 ? 114.017 -9.246  34.184  1.00 31.06 ? 719  TYR A CD2   1 
ATOM   4168  C  CE1   . TYR E 3 423 ? 112.538 -7.004  34.892  1.00 31.38 ? 719  TYR A CE1   1 
ATOM   4169  C  CE2   . TYR E 3 423 ? 112.739 -9.400  34.721  1.00 31.41 ? 719  TYR A CE2   1 
ATOM   4170  C  CZ    . TYR E 3 423 ? 112.005 -8.274  35.072  1.00 32.53 ? 719  TYR A CZ    1 
ATOM   4171  O  OH    . TYR E 3 423 ? 110.741 -8.417  35.599  1.00 32.60 ? 719  TYR A OH    1 
ATOM   4172  N  N     . GLY E 3 424 ? 117.491 -9.950  34.942  1.00 28.12 ? 720  GLY A N     1 
ATOM   4173  C  CA    . GLY E 3 424 ? 117.523 -11.154 35.752  1.00 27.45 ? 720  GLY A CA    1 
ATOM   4174  C  C     . GLY E 3 424 ? 118.387 -11.031 36.989  1.00 27.87 ? 720  GLY A C     1 
ATOM   4175  O  O     . GLY E 3 424 ? 118.001 -11.475 38.074  1.00 27.54 ? 720  GLY A O     1 
ATOM   4176  N  N     . LEU E 3 425 ? 119.560 -10.426 36.828  1.00 27.65 ? 721  LEU A N     1 
ATOM   4177  C  CA    . LEU E 3 425 ? 120.487 -10.249 37.936  1.00 27.74 ? 721  LEU A CA    1 
ATOM   4178  C  C     . LEU E 3 425 ? 119.947 -9.259  38.965  1.00 27.86 ? 721  LEU A C     1 
ATOM   4179  O  O     . LEU E 3 425 ? 120.080 -9.472  40.171  1.00 26.97 ? 721  LEU A O     1 
ATOM   4180  C  CB    . LEU E 3 425 ? 121.843 -9.766  37.418  1.00 27.34 ? 721  LEU A CB    1 
ATOM   4181  C  CG    . LEU E 3 425 ? 122.926 -9.575  38.480  1.00 26.95 ? 721  LEU A CG    1 
ATOM   4182  C  CD1   . LEU E 3 425 ? 123.194 -10.902 39.177  1.00 26.57 ? 721  LEU A CD1   1 
ATOM   4183  C  CD2   . LEU E 3 425 ? 124.197 -9.035  37.830  1.00 26.46 ? 721  LEU A CD2   1 
ATOM   4184  N  N     . ALA E 3 426 ? 119.343 -8.178  38.486  1.00 28.01 ? 722  ALA A N     1 
ATOM   4185  C  CA    . ALA E 3 426 ? 118.787 -7.169  39.381  1.00 30.52 ? 722  ALA A CA    1 
ATOM   4186  C  C     . ALA E 3 426 ? 117.638 -7.782  40.181  1.00 32.08 ? 722  ALA A C     1 
ATOM   4187  O  O     . ALA E 3 426 ? 117.434 -7.451  41.346  1.00 31.16 ? 722  ALA A O     1 
ATOM   4188  C  CB    . ALA E 3 426 ? 118.297 -5.969  38.579  1.00 28.47 ? 722  ALA A CB    1 
ATOM   4189  N  N     . GLN E 3 427 ? 116.895 -8.683  39.546  1.00 34.76 ? 723  GLN A N     1 
ATOM   4190  C  CA    . GLN E 3 427 ? 115.778 -9.351  40.204  1.00 37.18 ? 723  GLN A CA    1 
ATOM   4191  C  C     . GLN E 3 427 ? 116.270 -10.362 41.233  1.00 38.76 ? 723  GLN A C     1 
ATOM   4192  O  O     . GLN E 3 427 ? 115.720 -10.452 42.332  1.00 40.04 ? 723  GLN A O     1 
ATOM   4193  C  CB    . GLN E 3 427 ? 114.899 -10.061 39.170  1.00 36.73 ? 723  GLN A CB    1 
ATOM   4194  C  CG    . GLN E 3 427 ? 114.112 -9.119  38.276  1.00 38.41 ? 723  GLN A CG    1 
ATOM   4195  C  CD    . GLN E 3 427 ? 113.058 -8.340  39.038  1.00 38.98 ? 723  GLN A CD    1 
ATOM   4196  O  OE1   . GLN E 3 427 ? 112.145 -8.921  39.622  1.00 41.42 ? 723  GLN A OE1   1 
ATOM   4197  N  NE2   . GLN E 3 427 ? 113.179 -7.019  39.036  1.00 38.96 ? 723  GLN A NE2   1 
ATOM   4198  N  N     . ASN E 3 428 ? 117.305 -11.119 40.882  1.00 40.49 ? 724  ASN A N     1 
ATOM   4199  C  CA    . ASN E 3 428 ? 117.849 -12.122 41.793  1.00 41.95 ? 724  ASN A CA    1 
ATOM   4200  C  C     . ASN E 3 428 ? 118.473 -11.513 43.043  1.00 42.54 ? 724  ASN A C     1 
ATOM   4201  O  O     . ASN E 3 428 ? 118.272 -12.013 44.149  1.00 43.25 ? 724  ASN A O     1 
ATOM   4202  C  CB    . ASN E 3 428 ? 118.894 -12.993 41.089  1.00 43.25 ? 724  ASN A CB    1 
ATOM   4203  C  CG    . ASN E 3 428 ? 118.295 -13.860 39.998  1.00 44.97 ? 724  ASN A CG    1 
ATOM   4204  O  OD1   . ASN E 3 428 ? 117.163 -14.328 40.111  1.00 45.94 ? 724  ASN A OD1   1 
ATOM   4205  N  ND2   . ASN E 3 428 ? 119.060 -14.085 38.936  1.00 46.19 ? 724  ASN A ND2   1 
ATOM   4206  N  N     . LEU E 3 429 ? 119.232 -10.438 42.866  1.00 42.50 ? 725  LEU A N     1 
ATOM   4207  C  CA    . LEU E 3 429 ? 119.884 -9.781  43.991  1.00 42.82 ? 725  LEU A CA    1 
ATOM   4208  C  C     . LEU E 3 429 ? 119.045 -8.613  44.489  1.00 43.94 ? 725  LEU A C     1 
ATOM   4209  O  O     . LEU E 3 429 ? 119.497 -7.816  45.310  1.00 44.12 ? 725  LEU A O     1 
ATOM   4210  C  CB    . LEU E 3 429 ? 121.269 -9.280  43.575  1.00 42.24 ? 725  LEU A CB    1 
ATOM   4211  C  CG    . LEU E 3 429 ? 122.243 -10.340 43.055  1.00 41.07 ? 725  LEU A CG    1 
ATOM   4212  C  CD1   . LEU E 3 429 ? 123.536 -9.676  42.634  1.00 40.58 ? 725  LEU A CD1   1 
ATOM   4213  C  CD2   . LEU E 3 429 ? 122.504 -11.375 44.134  1.00 41.49 ? 725  LEU A CD2   1 
ATOM   4214  N  N     . ASN E 3 430 ? 117.818 -8.529  43.983  1.00 44.32 ? 726  ASN A N     1 
ATOM   4215  C  CA    . ASN E 3 430 ? 116.887 -7.467  44.343  1.00 44.08 ? 726  ASN A CA    1 
ATOM   4216  C  C     . ASN E 3 430 ? 117.604 -6.122  44.412  1.00 43.14 ? 726  ASN A C     1 
ATOM   4217  O  O     . ASN E 3 430 ? 117.478 -5.392  45.394  1.00 42.45 ? 726  ASN A O     1 
ATOM   4218  C  CB    . ASN E 3 430 ? 116.226 -7.764  45.691  1.00 46.40 ? 726  ASN A CB    1 
ATOM   4219  C  CG    . ASN E 3 430 ? 114.786 -7.282  45.750  1.00 48.33 ? 726  ASN A CG    1 
ATOM   4220  O  OD1   . ASN E 3 430 ? 114.396 -6.357  45.033  1.00 49.70 ? 726  ASN A OD1   1 
ATOM   4221  N  ND2   . ASN E 3 430 ? 113.990 -7.906  46.611  1.00 49.19 ? 726  ASN A ND2   1 
ATOM   4222  N  N     . ILE E 3 431 ? 118.357 -5.806  43.364  1.00 42.06 ? 727  ILE A N     1 
ATOM   4223  C  CA    . ILE E 3 431 ? 119.100 -4.555  43.293  1.00 40.45 ? 727  ILE A CA    1 
ATOM   4224  C  C     . ILE E 3 431 ? 118.736 -3.773  42.038  1.00 39.52 ? 727  ILE A C     1 
ATOM   4225  O  O     . ILE E 3 431 ? 117.999 -4.259  41.182  1.00 39.07 ? 727  ILE A O     1 
ATOM   4226  C  CB    . ILE E 3 431 ? 120.616 -4.807  43.267  1.00 41.63 ? 727  ILE A CB    1 
ATOM   4227  C  CG1   . ILE E 3 431 ? 120.964 -5.698  42.070  1.00 42.72 ? 727  ILE A CG1   1 
ATOM   4228  C  CG2   . ILE E 3 431 ? 121.062 -5.445  44.576  1.00 42.04 ? 727  ILE A CG2   1 
ATOM   4229  C  CD1   . ILE E 3 431 ? 122.447 -5.932  41.878  1.00 41.57 ? 727  ILE A CD1   1 
ATOM   4230  N  N     . SER E 3 432 ? 119.267 -2.561  41.935  1.00 38.30 ? 728  SER A N     1 
ATOM   4231  C  CA    . SER E 3 432 ? 119.017 -1.700  40.788  1.00 37.90 ? 728  SER A CA    1 
ATOM   4232  C  C     . SER E 3 432 ? 119.451 -2.351  39.482  1.00 38.05 ? 728  SER A C     1 
ATOM   4233  O  O     . SER E 3 432 ? 120.517 -2.963  39.403  1.00 36.11 ? 728  SER A O     1 
ATOM   4234  C  CB    . SER E 3 432 ? 119.761 -0.380  40.953  1.00 37.47 ? 728  SER A CB    1 
ATOM   4235  O  OG    . SER E 3 432 ? 119.978 0.225   39.693  1.00 36.27 ? 728  SER A OG    1 
ATOM   4236  N  N     . ARG E 3 433 ? 118.626 -2.196  38.452  1.00 38.65 ? 729  ARG A N     1 
ATOM   4237  C  CA    . ARG E 3 433 ? 118.924 -2.771  37.149  1.00 39.33 ? 729  ARG A CA    1 
ATOM   4238  C  C     . ARG E 3 433 ? 120.163 -2.126  36.536  1.00 40.04 ? 729  ARG A C     1 
ATOM   4239  O  O     . ARG E 3 433 ? 120.938 -2.790  35.846  1.00 40.07 ? 729  ARG A O     1 
ATOM   4240  C  CB    . ARG E 3 433 ? 117.722 -2.608  36.217  1.00 39.30 ? 729  ARG A CB    1 
ATOM   4241  C  CG    . ARG E 3 433 ? 117.866 -3.346  34.900  1.00 38.88 ? 729  ARG A CG    1 
ATOM   4242  C  CD    . ARG E 3 433 ? 116.538 -3.450  34.175  1.00 36.68 ? 729  ARG A CD    1 
ATOM   4243  N  NE    . ARG E 3 433 ? 116.703 -4.041  32.852  1.00 34.76 ? 729  ARG A NE    1 
ATOM   4244  C  CZ    . ARG E 3 433 ? 115.709 -4.255  32.000  1.00 32.68 ? 729  ARG A CZ    1 
ATOM   4245  N  NH1   . ARG E 3 433 ? 114.465 -3.929  32.330  1.00 31.05 ? 729  ARG A NH1   1 
ATOM   4246  N  NH2   . ARG E 3 433 ? 115.962 -4.787  30.812  1.00 33.15 ? 729  ARG A NH2   1 
ATOM   4247  N  N     . LYS E 3 434 ? 120.354 -0.834  36.791  1.00 40.72 ? 730  LYS A N     1 
ATOM   4248  C  CA    . LYS E 3 434 ? 121.520 -0.130  36.268  1.00 41.91 ? 730  LYS A CA    1 
ATOM   4249  C  C     . LYS E 3 434 ? 122.791 -0.684  36.902  1.00 40.94 ? 730  LYS A C     1 
ATOM   4250  O  O     . LYS E 3 434 ? 123.775 -0.949  36.213  1.00 42.02 ? 730  LYS A O     1 
ATOM   4251  C  CB    . LYS E 3 434 ? 121.420 1.374   36.550  1.00 43.72 ? 730  LYS A CB    1 
ATOM   4252  C  CG    . LYS E 3 434 ? 120.376 2.097   35.715  1.00 47.23 ? 730  LYS A CG    1 
ATOM   4253  C  CD    . LYS E 3 434 ? 120.353 3.597   36.009  1.00 49.86 ? 730  LYS A CD    1 
ATOM   4254  C  CE    . LYS E 3 434 ? 121.645 4.290   35.582  1.00 52.01 ? 730  LYS A CE    1 
ATOM   4255  N  NZ    . LYS E 3 434 ? 121.825 4.311   34.100  1.00 53.61 ? 730  LYS A NZ    1 
ATOM   4256  N  N     . GLU E 3 435 ? 122.762 -0.861  38.219  1.00 40.58 ? 731  GLU A N     1 
ATOM   4257  C  CA    . GLU E 3 435 ? 123.913 -1.386  38.942  1.00 40.32 ? 731  GLU A CA    1 
ATOM   4258  C  C     . GLU E 3 435 ? 124.218 -2.806  38.481  1.00 38.49 ? 731  GLU A C     1 
ATOM   4259  O  O     . GLU E 3 435 ? 125.379 -3.197  38.366  1.00 37.80 ? 731  GLU A O     1 
ATOM   4260  C  CB    . GLU E 3 435 ? 123.639 -1.380  40.446  1.00 42.15 ? 731  GLU A CB    1 
ATOM   4261  C  CG    . GLU E 3 435 ? 123.128 -0.048  40.968  1.00 45.88 ? 731  GLU A CG    1 
ATOM   4262  C  CD    . GLU E 3 435 ? 123.008 -0.022  42.479  1.00 47.62 ? 731  GLU A CD    1 
ATOM   4263  O  OE1   . GLU E 3 435 ? 122.493 -1.006  43.055  1.00 49.33 ? 731  GLU A OE1   1 
ATOM   4264  O  OE2   . GLU E 3 435 ? 123.425 0.985   43.090  1.00 49.43 ? 731  GLU A OE2   1 
ATOM   4265  N  N     . ALA E 3 436 ? 123.163 -3.573  38.220  1.00 36.68 ? 732  ALA A N     1 
ATOM   4266  C  CA    . ALA E 3 436 ? 123.311 -4.949  37.760  1.00 35.67 ? 732  ALA A CA    1 
ATOM   4267  C  C     . ALA E 3 436 ? 124.021 -4.943  36.412  1.00 34.84 ? 732  ALA A C     1 
ATOM   4268  O  O     . ALA E 3 436 ? 124.944 -5.726  36.178  1.00 35.27 ? 732  ALA A O     1 
ATOM   4269  C  CB    . ALA E 3 436 ? 121.941 -5.605  37.630  1.00 33.78 ? 732  ALA A CB    1 
ATOM   4270  N  N     . ALA E 3 437 ? 123.585 -4.048  35.532  1.00 33.98 ? 733  ALA A N     1 
ATOM   4271  C  CA    . ALA E 3 437 ? 124.175 -3.925  34.206  1.00 35.20 ? 733  ALA A CA    1 
ATOM   4272  C  C     . ALA E 3 437 ? 125.653 -3.572  34.322  1.00 36.16 ? 733  ALA A C     1 
ATOM   4273  O  O     . ALA E 3 437 ? 126.496 -4.163  33.647  1.00 36.27 ? 733  ALA A O     1 
ATOM   4274  C  CB    . ALA E 3 437 ? 123.442 -2.855  33.405  1.00 33.63 ? 733  ALA A CB    1 
ATOM   4275  N  N     . GLU E 3 438 ? 125.958 -2.607  35.187  1.00 37.08 ? 734  GLU A N     1 
ATOM   4276  C  CA    . GLU E 3 438 ? 127.334 -2.169  35.399  1.00 37.28 ? 734  GLU A CA    1 
ATOM   4277  C  C     . GLU E 3 438 ? 128.180 -3.321  35.925  1.00 36.31 ? 734  GLU A C     1 
ATOM   4278  O  O     . GLU E 3 438 ? 129.316 -3.520  35.490  1.00 35.83 ? 734  GLU A O     1 
ATOM   4279  C  CB    . GLU E 3 438 ? 127.374 -1.005  36.394  1.00 38.79 ? 734  GLU A CB    1 
ATOM   4280  C  CG    . GLU E 3 438 ? 126.492 0.174   36.008  1.00 42.60 ? 734  GLU A CG    1 
ATOM   4281  C  CD    . GLU E 3 438 ? 126.590 1.331   36.992  1.00 45.03 ? 734  GLU A CD    1 
ATOM   4282  O  OE1   . GLU E 3 438 ? 126.418 1.100   38.209  1.00 47.06 ? 734  GLU A OE1   1 
ATOM   4283  O  OE2   . GLU E 3 438 ? 126.836 2.473   36.546  1.00 45.92 ? 734  GLU A OE2   1 
ATOM   4284  N  N     . PHE E 3 439 ? 127.618 -4.075  36.866  1.00 34.80 ? 735  PHE A N     1 
ATOM   4285  C  CA    . PHE E 3 439 ? 128.309 -5.214  37.462  1.00 33.81 ? 735  PHE A CA    1 
ATOM   4286  C  C     . PHE E 3 439 ? 128.649 -6.254  36.391  1.00 33.27 ? 735  PHE A C     1 
ATOM   4287  O  O     . PHE E 3 439 ? 129.749 -6.803  36.374  1.00 32.93 ? 735  PHE A O     1 
ATOM   4288  C  CB    . PHE E 3 439 ? 127.428 -5.857  38.535  1.00 33.48 ? 735  PHE A CB    1 
ATOM   4289  C  CG    . PHE E 3 439 ? 128.130 -6.902  39.350  1.00 34.99 ? 735  PHE A CG    1 
ATOM   4290  C  CD1   . PHE E 3 439 ? 128.912 -6.540  40.442  1.00 34.88 ? 735  PHE A CD1   1 
ATOM   4291  C  CD2   . PHE E 3 439 ? 128.019 -8.251  39.023  1.00 34.94 ? 735  PHE A CD2   1 
ATOM   4292  C  CE1   . PHE E 3 439 ? 129.575 -7.506  41.196  1.00 35.99 ? 735  PHE A CE1   1 
ATOM   4293  C  CE2   . PHE E 3 439 ? 128.677 -9.225  39.769  1.00 35.15 ? 735  PHE A CE2   1 
ATOM   4294  C  CZ    . PHE E 3 439 ? 129.457 -8.854  40.857  1.00 36.58 ? 735  PHE A CZ    1 
ATOM   4295  N  N     . ILE E 3 440 ? 127.696 -6.524  35.504  1.00 33.29 ? 736  ILE A N     1 
ATOM   4296  C  CA    . ILE E 3 440 ? 127.904 -7.493  34.431  1.00 33.81 ? 736  ILE A CA    1 
ATOM   4297  C  C     . ILE E 3 440 ? 128.979 -6.978  33.485  1.00 35.64 ? 736  ILE A C     1 
ATOM   4298  O  O     . ILE E 3 440 ? 129.932 -7.688  33.165  1.00 34.78 ? 736  ILE A O     1 
ATOM   4299  C  CB    . ILE E 3 440 ? 126.610 -7.726  33.617  1.00 32.44 ? 736  ILE A CB    1 
ATOM   4300  C  CG1   . ILE E 3 440 ? 125.560 -8.423  34.484  1.00 31.15 ? 736  ILE A CG1   1 
ATOM   4301  C  CG2   . ILE E 3 440 ? 126.914 -8.567  32.384  1.00 32.06 ? 736  ILE A CG2   1 
ATOM   4302  C  CD1   . ILE E 3 440 ? 124.210 -8.574  33.802  1.00 29.55 ? 736  ILE A CD1   1 
ATOM   4303  N  N     . GLU E 3 441 ? 128.812 -5.736  33.041  1.00 38.03 ? 737  GLU A N     1 
ATOM   4304  C  CA    . GLU E 3 441 ? 129.761 -5.108  32.131  1.00 40.62 ? 737  GLU A CA    1 
ATOM   4305  C  C     . GLU E 3 441 ? 131.159 -5.203  32.722  1.00 40.67 ? 737  GLU A C     1 
ATOM   4306  O  O     . GLU E 3 441 ? 132.097 -5.649  32.062  1.00 40.92 ? 737  GLU A O     1 
ATOM   4307  C  CB    . GLU E 3 441 ? 129.382 -3.642  31.912  1.00 42.85 ? 737  GLU A CB    1 
ATOM   4308  C  CG    . GLU E 3 441 ? 130.288 -2.895  30.949  1.00 47.46 ? 737  GLU A CG    1 
ATOM   4309  C  CD    . GLU E 3 441 ? 129.798 -1.487  30.668  1.00 49.88 ? 737  GLU A CD    1 
ATOM   4310  O  OE1   . GLU E 3 441 ? 128.681 -1.343  30.127  1.00 51.67 ? 737  GLU A OE1   1 
ATOM   4311  O  OE2   . GLU E 3 441 ? 130.527 -0.524  30.990  1.00 52.02 ? 737  GLU A OE2   1 
ATOM   4312  N  N     . ARG E 3 442 ? 131.284 -4.790  33.977  1.00 40.72 ? 738  ARG A N     1 
ATOM   4313  C  CA    . ARG E 3 442 ? 132.560 -4.823  34.675  1.00 41.29 ? 738  ARG A CA    1 
ATOM   4314  C  C     . ARG E 3 442 ? 133.081 -6.252  34.811  1.00 40.39 ? 738  ARG A C     1 
ATOM   4315  O  O     . ARG E 3 442 ? 134.288 -6.490  34.758  1.00 39.98 ? 738  ARG A O     1 
ATOM   4316  C  CB    . ARG E 3 442 ? 132.402 -4.197  36.060  1.00 43.94 ? 738  ARG A CB    1 
ATOM   4317  C  CG    . ARG E 3 442 ? 133.635 -4.298  36.932  1.00 48.48 ? 738  ARG A CG    1 
ATOM   4318  C  CD    . ARG E 3 442 ? 133.317 -3.873  38.351  1.00 51.95 ? 738  ARG A CD    1 
ATOM   4319  N  NE    . ARG E 3 442 ? 134.377 -4.255  39.278  1.00 55.43 ? 738  ARG A NE    1 
ATOM   4320  C  CZ    . ARG E 3 442 ? 134.177 -4.526  40.563  1.00 56.88 ? 738  ARG A CZ    1 
ATOM   4321  N  NH1   . ARG E 3 442 ? 132.953 -4.456  41.071  1.00 57.70 ? 738  ARG A NH1   1 
ATOM   4322  N  NH2   . ARG E 3 442 ? 135.195 -4.873  41.339  1.00 57.28 ? 738  ARG A NH2   1 
ATOM   4323  N  N     . TYR E 3 443 ? 132.165 -7.198  34.986  1.00 38.87 ? 739  TYR A N     1 
ATOM   4324  C  CA    . TYR E 3 443 ? 132.529 -8.602  35.137  1.00 37.66 ? 739  TYR A CA    1 
ATOM   4325  C  C     . TYR E 3 443 ? 133.291 -9.097  33.911  1.00 38.06 ? 739  TYR A C     1 
ATOM   4326  O  O     . TYR E 3 443 ? 134.326 -9.751  34.033  1.00 36.88 ? 739  TYR A O     1 
ATOM   4327  C  CB    . TYR E 3 443 ? 131.273 -9.455  35.319  1.00 35.98 ? 739  TYR A CB    1 
ATOM   4328  C  CG    . TYR E 3 443 ? 131.544 -10.847 35.838  1.00 34.12 ? 739  TYR A CG    1 
ATOM   4329  C  CD1   . TYR E 3 443 ? 131.614 -11.096 37.208  1.00 33.41 ? 739  TYR A CD1   1 
ATOM   4330  C  CD2   . TYR E 3 443 ? 131.717 -11.919 34.963  1.00 33.10 ? 739  TYR A CD2   1 
ATOM   4331  C  CE1   . TYR E 3 443 ? 131.842 -12.378 37.695  1.00 33.20 ? 739  TYR A CE1   1 
ATOM   4332  C  CE2   . TYR E 3 443 ? 131.950 -13.206 35.441  1.00 32.29 ? 739  TYR A CE2   1 
ATOM   4333  C  CZ    . TYR E 3 443 ? 132.008 -13.428 36.808  1.00 31.62 ? 739  TYR A CZ    1 
ATOM   4334  O  OH    . TYR E 3 443 ? 132.221 -14.698 37.291  1.00 31.03 ? 739  TYR A OH    1 
ATOM   4335  N  N     . PHE E 3 444 ? 132.767 -8.784  32.729  1.00 38.68 ? 740  PHE A N     1 
ATOM   4336  C  CA    . PHE E 3 444 ? 133.395 -9.208  31.486  1.00 40.84 ? 740  PHE A CA    1 
ATOM   4337  C  C     . PHE E 3 444 ? 134.615 -8.371  31.118  1.00 42.15 ? 740  PHE A C     1 
ATOM   4338  O  O     . PHE E 3 444 ? 135.438 -8.790  30.303  1.00 42.52 ? 740  PHE A O     1 
ATOM   4339  C  CB    . PHE E 3 444 ? 132.369 -9.199  30.349  1.00 40.39 ? 740  PHE A CB    1 
ATOM   4340  C  CG    . PHE E 3 444 ? 131.363 -10.317 30.440  1.00 40.58 ? 740  PHE A CG    1 
ATOM   4341  C  CD1   . PHE E 3 444 ? 131.780 -11.646 30.406  1.00 40.47 ? 740  PHE A CD1   1 
ATOM   4342  C  CD2   . PHE E 3 444 ? 130.006 -10.045 30.571  1.00 39.81 ? 740  PHE A CD2   1 
ATOM   4343  C  CE1   . PHE E 3 444 ? 130.859 -12.688 30.502  1.00 39.75 ? 740  PHE A CE1   1 
ATOM   4344  C  CE2   . PHE E 3 444 ? 129.076 -11.081 30.668  1.00 40.66 ? 740  PHE A CE2   1 
ATOM   4345  C  CZ    . PHE E 3 444 ? 129.506 -12.406 30.633  1.00 39.89 ? 740  PHE A CZ    1 
ATOM   4346  N  N     . GLU E 3 445 ? 134.737 -7.189  31.715  1.00 43.36 ? 741  GLU A N     1 
ATOM   4347  C  CA    . GLU E 3 445 ? 135.891 -6.343  31.446  1.00 44.83 ? 741  GLU A CA    1 
ATOM   4348  C  C     . GLU E 3 445 ? 137.078 -6.983  32.155  1.00 44.49 ? 741  GLU A C     1 
ATOM   4349  O  O     . GLU E 3 445 ? 138.226 -6.834  31.735  1.00 45.07 ? 741  GLU A O     1 
ATOM   4350  C  CB    . GLU E 3 445 ? 135.670 -4.925  31.980  1.00 46.07 ? 741  GLU A CB    1 
ATOM   4351  C  CG    . GLU E 3 445 ? 134.524 -4.179  31.312  1.00 48.44 ? 741  GLU A CG    1 
ATOM   4352  C  CD    . GLU E 3 445 ? 134.429 -2.729  31.758  1.00 50.08 ? 741  GLU A CD    1 
ATOM   4353  O  OE1   . GLU E 3 445 ? 134.484 -2.475  32.981  1.00 49.17 ? 741  GLU A OE1   1 
ATOM   4354  O  OE2   . GLU E 3 445 ? 134.295 -1.845  30.884  1.00 50.57 ? 741  GLU A OE2   1 
ATOM   4355  N  N     . SER E 3 446 ? 136.784 -7.708  33.230  1.00 43.97 ? 742  SER A N     1 
ATOM   4356  C  CA    . SER E 3 446 ? 137.809 -8.387  34.014  1.00 43.88 ? 742  SER A CA    1 
ATOM   4357  C  C     . SER E 3 446 ? 138.124 -9.747  33.406  1.00 42.83 ? 742  SER A C     1 
ATOM   4358  O  O     . SER E 3 446 ? 139.232 -10.267 33.550  1.00 42.37 ? 742  SER A O     1 
ATOM   4359  C  CB    . SER E 3 446 ? 137.331 -8.563  35.454  1.00 45.03 ? 742  SER A CB    1 
ATOM   4360  O  OG    . SER E 3 446 ? 136.968 -7.315  36.017  1.00 47.82 ? 742  SER A OG    1 
ATOM   4361  N  N     . PHE E 3 447 ? 137.136 -10.318 32.728  1.00 41.36 ? 743  PHE A N     1 
ATOM   4362  C  CA    . PHE E 3 447 ? 137.294 -11.610 32.072  1.00 39.71 ? 743  PHE A CA    1 
ATOM   4363  C  C     . PHE E 3 447 ? 136.940 -11.425 30.602  1.00 38.52 ? 743  PHE A C     1 
ATOM   4364  O  O     . PHE E 3 447 ? 135.956 -11.982 30.113  1.00 38.65 ? 743  PHE A O     1 
ATOM   4365  C  CB    . PHE E 3 447 ? 136.367 -12.647 32.710  1.00 39.76 ? 743  PHE A CB    1 
ATOM   4366  C  CG    . PHE E 3 447 ? 136.687 -12.943 34.148  1.00 39.62 ? 743  PHE A CG    1 
ATOM   4367  C  CD1   . PHE E 3 447 ? 137.914 -13.495 34.501  1.00 38.93 ? 743  PHE A CD1   1 
ATOM   4368  C  CD2   . PHE E 3 447 ? 135.759 -12.673 35.151  1.00 39.21 ? 743  PHE A CD2   1 
ATOM   4369  C  CE1   . PHE E 3 447 ? 138.217 -13.776 35.834  1.00 39.83 ? 743  PHE A CE1   1 
ATOM   4370  C  CE2   . PHE E 3 447 ? 136.049 -12.950 36.488  1.00 39.36 ? 743  PHE A CE2   1 
ATOM   4371  C  CZ    . PHE E 3 447 ? 137.281 -13.503 36.830  1.00 39.72 ? 743  PHE A CZ    1 
ATOM   4372  N  N     . PRO E 3 448 ? 137.746 -10.633 29.876  1.00 37.26 ? 744  PRO A N     1 
ATOM   4373  C  CA    . PRO E 3 448 ? 137.527 -10.359 28.453  1.00 35.39 ? 744  PRO A CA    1 
ATOM   4374  C  C     . PRO E 3 448 ? 137.642 -11.600 27.573  1.00 33.50 ? 744  PRO A C     1 
ATOM   4375  O  O     . PRO E 3 448 ? 137.019 -11.678 26.514  1.00 33.36 ? 744  PRO A O     1 
ATOM   4376  C  CB    . PRO E 3 448 ? 138.578 -9.299  28.140  1.00 35.21 ? 744  PRO A CB    1 
ATOM   4377  C  CG    . PRO E 3 448 ? 139.707 -9.696  29.041  1.00 35.73 ? 744  PRO A CG    1 
ATOM   4378  C  CD    . PRO E 3 448 ? 138.991 -9.992  30.341  1.00 37.16 ? 744  PRO A CD    1 
ATOM   4379  N  N     . GLY E 3 449 ? 138.443 -12.564 28.014  1.00 31.69 ? 745  GLY A N     1 
ATOM   4380  C  CA    . GLY E 3 449 ? 138.606 -13.788 27.254  1.00 31.21 ? 745  GLY A CA    1 
ATOM   4381  C  C     . GLY E 3 449 ? 137.305 -14.568 27.227  1.00 30.38 ? 745  GLY A C     1 
ATOM   4382  O  O     . GLY E 3 449 ? 136.916 -15.121 26.196  1.00 29.50 ? 745  GLY A O     1 
ATOM   4383  N  N     . VAL E 3 450 ? 136.630 -14.613 28.371  1.00 29.91 ? 746  VAL A N     1 
ATOM   4384  C  CA    . VAL E 3 450 ? 135.358 -15.316 28.482  1.00 29.13 ? 746  VAL A CA    1 
ATOM   4385  C  C     . VAL E 3 450 ? 134.316 -14.654 27.593  1.00 30.12 ? 746  VAL A C     1 
ATOM   4386  O  O     . VAL E 3 450 ? 133.556 -15.330 26.896  1.00 30.26 ? 746  VAL A O     1 
ATOM   4387  C  CB    . VAL E 3 450 ? 134.847 -15.316 29.941  1.00 28.73 ? 746  VAL A CB    1 
ATOM   4388  C  CG1   . VAL E 3 450 ? 133.445 -15.919 30.011  1.00 28.27 ? 746  VAL A CG1   1 
ATOM   4389  C  CG2   . VAL E 3 450 ? 135.799 -16.105 30.815  1.00 26.22 ? 746  VAL A CG2   1 
ATOM   4390  N  N     . LYS E 3 451 ? 134.289 -13.327 27.614  1.00 30.19 ? 747  LYS A N     1 
ATOM   4391  C  CA    . LYS E 3 451 ? 133.337 -12.576 26.811  1.00 32.08 ? 747  LYS A CA    1 
ATOM   4392  C  C     . LYS E 3 451 ? 133.471 -12.885 25.322  1.00 31.90 ? 747  LYS A C     1 
ATOM   4393  O  O     . LYS E 3 451 ? 132.478 -13.155 24.651  1.00 30.89 ? 747  LYS A O     1 
ATOM   4394  C  CB    . LYS E 3 451 ? 133.518 -11.074 27.038  1.00 33.99 ? 747  LYS A CB    1 
ATOM   4395  C  CG    . LYS E 3 451 ? 132.455 -10.226 26.367  1.00 36.68 ? 747  LYS A CG    1 
ATOM   4396  C  CD    . LYS E 3 451 ? 131.072 -10.573 26.902  1.00 40.56 ? 747  LYS A CD    1 
ATOM   4397  C  CE    . LYS E 3 451 ? 129.989 -9.718  26.261  1.00 41.95 ? 747  LYS A CE    1 
ATOM   4398  N  NZ    . LYS E 3 451 ? 128.636 -10.074 26.783  1.00 44.00 ? 747  LYS A NZ    1 
ATOM   4399  N  N     . ARG E 3 452 ? 134.693 -12.848 24.802  1.00 32.76 ? 748  ARG A N     1 
ATOM   4400  C  CA    . ARG E 3 452 ? 134.890 -13.124 23.384  1.00 34.02 ? 748  ARG A CA    1 
ATOM   4401  C  C     . ARG E 3 452 ? 134.617 -14.589 23.051  1.00 32.11 ? 748  ARG A C     1 
ATOM   4402  O  O     . ARG E 3 452 ? 134.140 -14.900 21.962  1.00 32.63 ? 748  ARG A O     1 
ATOM   4403  C  CB    . ARG E 3 452 ? 136.304 -12.719 22.940  1.00 37.11 ? 748  ARG A CB    1 
ATOM   4404  C  CG    . ARG E 3 452 ? 137.439 -13.481 23.597  1.00 41.15 ? 748  ARG A CG    1 
ATOM   4405  C  CD    . ARG E 3 452 ? 138.795 -12.963 23.120  1.00 44.20 ? 748  ARG A CD    1 
ATOM   4406  N  NE    . ARG E 3 452 ? 139.106 -11.634 23.647  1.00 46.68 ? 748  ARG A NE    1 
ATOM   4407  C  CZ    . ARG E 3 452 ? 140.151 -11.367 24.426  1.00 47.14 ? 748  ARG A CZ    1 
ATOM   4408  N  NH1   . ARG E 3 452 ? 140.988 -12.338 24.770  1.00 47.70 ? 748  ARG A NH1   1 
ATOM   4409  N  NH2   . ARG E 3 452 ? 140.360 -10.132 24.863  1.00 47.72 ? 748  ARG A NH2   1 
ATOM   4410  N  N     . TYR E 3 453 ? 134.914 -15.490 23.984  1.00 31.38 ? 749  TYR A N     1 
ATOM   4411  C  CA    . TYR E 3 453 ? 134.654 -16.905 23.747  1.00 31.02 ? 749  TYR A CA    1 
ATOM   4412  C  C     . TYR E 3 453 ? 133.156 -17.095 23.551  1.00 30.72 ? 749  TYR A C     1 
ATOM   4413  O  O     . TYR E 3 453 ? 132.715 -17.764 22.615  1.00 30.98 ? 749  TYR A O     1 
ATOM   4414  C  CB    . TYR E 3 453 ? 135.099 -17.770 24.929  1.00 31.30 ? 749  TYR A CB    1 
ATOM   4415  C  CG    . TYR E 3 453 ? 134.519 -19.168 24.844  1.00 31.40 ? 749  TYR A CG    1 
ATOM   4416  C  CD1   . TYR E 3 453 ? 135.037 -20.106 23.950  1.00 32.31 ? 749  TYR A CD1   1 
ATOM   4417  C  CD2   . TYR E 3 453 ? 133.412 -19.536 25.617  1.00 31.13 ? 749  TYR A CD2   1 
ATOM   4418  C  CE1   . TYR E 3 453 ? 134.466 -21.374 23.820  1.00 31.75 ? 749  TYR A CE1   1 
ATOM   4419  C  CE2   . TYR E 3 453 ? 132.831 -20.801 25.491  1.00 30.68 ? 749  TYR A CE2   1 
ATOM   4420  C  CZ    . TYR E 3 453 ? 133.364 -21.712 24.590  1.00 31.98 ? 749  TYR A CZ    1 
ATOM   4421  O  OH    . TYR E 3 453 ? 132.788 -22.954 24.438  1.00 32.49 ? 749  TYR A OH    1 
ATOM   4422  N  N     . MET E 3 454 ? 132.375 -16.502 24.447  1.00 30.97 ? 750  MET A N     1 
ATOM   4423  C  CA    . MET E 3 454 ? 130.926 -16.615 24.375  1.00 30.90 ? 750  MET A CA    1 
ATOM   4424  C  C     . MET E 3 454 ? 130.389 -16.022 23.081  1.00 31.25 ? 750  MET A C     1 
ATOM   4425  O  O     . MET E 3 454 ? 129.432 -16.541 22.504  1.00 31.45 ? 750  MET A O     1 
ATOM   4426  C  CB    . MET E 3 454 ? 130.281 -15.929 25.579  1.00 30.71 ? 750  MET A CB    1 
ATOM   4427  C  CG    . MET E 3 454 ? 130.525 -16.655 26.891  1.00 31.14 ? 750  MET A CG    1 
ATOM   4428  S  SD    . MET E 3 454 ? 129.949 -18.373 26.821  1.00 30.79 ? 750  MET A SD    1 
ATOM   4429  C  CE    . MET E 3 454 ? 130.751 -19.074 28.265  1.00 30.91 ? 750  MET A CE    1 
ATOM   4430  N  N     . GLU E 3 455 ? 131.005 -14.938 22.621  1.00 30.63 ? 751  GLU A N     1 
ATOM   4431  C  CA    . GLU E 3 455 ? 130.568 -14.313 21.380  1.00 30.47 ? 751  GLU A CA    1 
ATOM   4432  C  C     . GLU E 3 455 ? 130.952 -15.192 20.189  1.00 28.91 ? 751  GLU A C     1 
ATOM   4433  O  O     . GLU E 3 455 ? 130.186 -15.316 19.234  1.00 29.61 ? 751  GLU A O     1 
ATOM   4434  C  CB    . GLU E 3 455 ? 131.194 -12.923 21.231  1.00 34.23 ? 751  GLU A CB    1 
ATOM   4435  C  CG    . GLU E 3 455 ? 130.912 -11.996 22.405  1.00 36.76 ? 751  GLU A CG    1 
ATOM   4436  C  CD    . GLU E 3 455 ? 131.434 -10.587 22.183  1.00 40.75 ? 751  GLU A CD    1 
ATOM   4437  O  OE1   . GLU E 3 455 ? 132.539 -10.444 21.614  1.00 41.63 ? 751  GLU A OE1   1 
ATOM   4438  O  OE2   . GLU E 3 455 ? 130.743 -9.624  22.582  1.00 41.87 ? 751  GLU A OE2   1 
ATOM   4439  N  N     . ASN E 3 456 ? 132.130 -15.808 20.253  1.00 27.01 ? 752  ASN A N     1 
ATOM   4440  C  CA    . ASN E 3 456 ? 132.598 -16.671 19.170  1.00 27.15 ? 752  ASN A CA    1 
ATOM   4441  C  C     . ASN E 3 456 ? 131.870 -18.012 19.091  1.00 26.21 ? 752  ASN A C     1 
ATOM   4442  O  O     . ASN E 3 456 ? 131.557 -18.486 17.998  1.00 25.79 ? 752  ASN A O     1 
ATOM   4443  C  CB    . ASN E 3 456 ? 134.103 -16.931 19.293  1.00 26.17 ? 752  ASN A CB    1 
ATOM   4444  C  CG    . ASN E 3 456 ? 134.936 -15.681 19.057  1.00 27.91 ? 752  ASN A CG    1 
ATOM   4445  O  OD1   . ASN E 3 456 ? 134.501 -14.751 18.379  1.00 29.11 ? 752  ASN A OD1   1 
ATOM   4446  N  ND2   . ASN E 3 456 ? 136.145 -15.660 19.611  1.00 27.64 ? 752  ASN A ND2   1 
ATOM   4447  N  N     . ILE E 3 457 ? 131.602 -18.619 20.245  1.00 25.30 ? 753  ILE A N     1 
ATOM   4448  C  CA    . ILE E 3 457 ? 130.924 -19.913 20.283  1.00 22.90 ? 753  ILE A CA    1 
ATOM   4449  C  C     . ILE E 3 457 ? 129.521 -19.798 19.703  1.00 22.65 ? 753  ILE A C     1 
ATOM   4450  O  O     . ILE E 3 457 ? 129.018 -20.733 19.071  1.00 20.82 ? 753  ILE A O     1 
ATOM   4451  C  CB    . ILE E 3 457 ? 130.852 -20.478 21.732  1.00 23.76 ? 753  ILE A CB    1 
ATOM   4452  C  CG1   . ILE E 3 457 ? 130.376 -21.930 21.694  1.00 23.55 ? 753  ILE A CG1   1 
ATOM   4453  C  CG2   . ILE E 3 457 ? 129.915 -19.644 22.593  1.00 24.32 ? 753  ILE A CG2   1 
ATOM   4454  C  CD1   . ILE E 3 457 ? 131.311 -22.850 20.941  1.00 21.87 ? 753  ILE A CD1   1 
ATOM   4455  N  N     . VAL E 3 458 ? 128.895 -18.644 19.909  1.00 21.05 ? 754  VAL A N     1 
ATOM   4456  C  CA    . VAL E 3 458 ? 127.560 -18.406 19.380  1.00 22.14 ? 754  VAL A CA    1 
ATOM   4457  C  C     . VAL E 3 458 ? 127.613 -18.302 17.853  1.00 22.55 ? 754  VAL A C     1 
ATOM   4458  O  O     . VAL E 3 458 ? 126.743 -18.824 17.155  1.00 22.60 ? 754  VAL A O     1 
ATOM   4459  C  CB    . VAL E 3 458 ? 126.956 -17.107 19.959  1.00 22.29 ? 754  VAL A CB    1 
ATOM   4460  C  CG1   . VAL E 3 458 ? 125.700 -16.722 19.189  1.00 22.78 ? 754  VAL A CG1   1 
ATOM   4461  C  CG2   . VAL E 3 458 ? 126.627 -17.307 21.441  1.00 23.02 ? 754  VAL A CG2   1 
ATOM   4462  N  N     . GLN E 3 459 ? 128.638 -17.633 17.337  1.00 23.32 ? 755  GLN A N     1 
ATOM   4463  C  CA    . GLN E 3 459 ? 128.775 -17.477 15.892  1.00 25.57 ? 755  GLN A CA    1 
ATOM   4464  C  C     . GLN E 3 459 ? 129.082 -18.832 15.257  1.00 24.25 ? 755  GLN A C     1 
ATOM   4465  O  O     . GLN E 3 459 ? 128.568 -19.163 14.187  1.00 22.39 ? 755  GLN A O     1 
ATOM   4466  C  CB    . GLN E 3 459 ? 129.890 -16.480 15.570  1.00 29.16 ? 755  GLN A CB    1 
ATOM   4467  C  CG    . GLN E 3 459 ? 129.808 -15.926 14.162  1.00 35.56 ? 755  GLN A CG    1 
ATOM   4468  C  CD    . GLN E 3 459 ? 128.449 -15.315 13.870  1.00 39.14 ? 755  GLN A CD    1 
ATOM   4469  O  OE1   . GLN E 3 459 ? 127.729 -15.772 12.981  1.00 43.40 ? 755  GLN A OE1   1 
ATOM   4470  N  NE2   . GLN E 3 459 ? 128.088 -14.284 14.625  1.00 40.86 ? 755  GLN A NE2   1 
ATOM   4471  N  N     . GLU E 3 460 ? 129.920 -19.611 15.932  1.00 24.65 ? 756  GLU A N     1 
ATOM   4472  C  CA    . GLU E 3 460 ? 130.293 -20.938 15.457  1.00 26.41 ? 756  GLU A CA    1 
ATOM   4473  C  C     . GLU E 3 460 ? 129.068 -21.850 15.383  1.00 24.98 ? 756  GLU A C     1 
ATOM   4474  O  O     . GLU E 3 460 ? 128.900 -22.606 14.423  1.00 25.53 ? 756  GLU A O     1 
ATOM   4475  C  CB    . GLU E 3 460 ? 131.342 -21.558 16.385  1.00 28.18 ? 756  GLU A CB    1 
ATOM   4476  C  CG    . GLU E 3 460 ? 131.666 -23.004 16.050  1.00 32.85 ? 756  GLU A CG    1 
ATOM   4477  C  CD    . GLU E 3 460 ? 132.815 -23.560 16.867  1.00 34.85 ? 756  GLU A CD    1 
ATOM   4478  O  OE1   . GLU E 3 460 ? 133.077 -24.774 16.762  1.00 39.40 ? 756  GLU A OE1   1 
ATOM   4479  O  OE2   . GLU E 3 460 ? 133.462 -22.791 17.608  1.00 38.90 ? 756  GLU A OE2   1 
ATOM   4480  N  N     . ALA E 3 461 ? 128.212 -21.778 16.396  1.00 23.31 ? 757  ALA A N     1 
ATOM   4481  C  CA    . ALA E 3 461 ? 127.010 -22.605 16.426  1.00 23.23 ? 757  ALA A CA    1 
ATOM   4482  C  C     . ALA E 3 461 ? 126.076 -22.227 15.280  1.00 23.29 ? 757  ALA A C     1 
ATOM   4483  O  O     . ALA E 3 461 ? 125.434 -23.086 14.677  1.00 23.97 ? 757  ALA A O     1 
ATOM   4484  C  CB    . ALA E 3 461 ? 126.294 -22.444 17.766  1.00 22.15 ? 757  ALA A CB    1 
ATOM   4485  N  N     . LYS E 3 462 ? 125.998 -20.935 14.981  1.00 22.53 ? 758  LYS A N     1 
ATOM   4486  C  CA    . LYS E 3 462 ? 125.134 -20.470 13.905  1.00 23.11 ? 758  LYS A CA    1 
ATOM   4487  C  C     . LYS E 3 462 ? 125.622 -20.992 12.560  1.00 21.73 ? 758  LYS A C     1 
ATOM   4488  O  O     . LYS E 3 462 ? 124.824 -21.270 11.664  1.00 20.75 ? 758  LYS A O     1 
ATOM   4489  C  CB    . LYS E 3 462 ? 125.094 -18.938 13.872  1.00 24.33 ? 758  LYS A CB    1 
ATOM   4490  C  CG    . LYS E 3 462 ? 124.413 -18.304 15.078  1.00 26.71 ? 758  LYS A CG    1 
ATOM   4491  C  CD    . LYS E 3 462 ? 124.379 -16.785 14.963  1.00 27.03 ? 758  LYS A CD    1 
ATOM   4492  C  CE    . LYS E 3 462 ? 123.670 -16.143 16.153  1.00 27.95 ? 758  LYS A CE    1 
ATOM   4493  N  NZ    . LYS E 3 462 ? 122.208 -16.467 16.219  1.00 27.05 ? 758  LYS A NZ    1 
ATOM   4494  N  N     . GLN E 3 463 ? 126.935 -21.127 12.428  1.00 20.71 ? 759  GLN A N     1 
ATOM   4495  C  CA    . GLN E 3 463 ? 127.527 -21.597 11.187  1.00 23.22 ? 759  GLN A CA    1 
ATOM   4496  C  C     . GLN E 3 463 ? 127.483 -23.117 11.047  1.00 22.70 ? 759  GLN A C     1 
ATOM   4497  O  O     . GLN E 3 463 ? 127.168 -23.631 9.975   1.00 22.91 ? 759  GLN A O     1 
ATOM   4498  C  CB    . GLN E 3 463 ? 128.973 -21.104 11.086  1.00 25.40 ? 759  GLN A CB    1 
ATOM   4499  C  CG    . GLN E 3 463 ? 129.111 -19.591 11.225  1.00 29.84 ? 759  GLN A CG    1 
ATOM   4500  C  CD    . GLN E 3 463 ? 130.556 -19.123 11.186  1.00 32.50 ? 759  GLN A CD    1 
ATOM   4501  O  OE1   . GLN E 3 463 ? 131.431 -19.714 11.819  1.00 34.26 ? 759  GLN A OE1   1 
ATOM   4502  N  NE2   . GLN E 3 463 ? 130.811 -18.050 10.444  1.00 34.14 ? 759  GLN A NE2   1 
ATOM   4503  N  N     . LYS E 3 464 ? 127.781 -23.831 12.131  1.00 21.61 ? 760  LYS A N     1 
ATOM   4504  C  CA    . LYS E 3 464 ? 127.794 -25.295 12.101  1.00 22.24 ? 760  LYS A CA    1 
ATOM   4505  C  C     . LYS E 3 464 ? 126.461 -25.957 12.423  1.00 20.49 ? 760  LYS A C     1 
ATOM   4506  O  O     . LYS E 3 464 ? 126.166 -27.041 11.919  1.00 19.43 ? 760  LYS A O     1 
ATOM   4507  C  CB    . LYS E 3 464 ? 128.859 -25.831 13.055  1.00 24.78 ? 760  LYS A CB    1 
ATOM   4508  C  CG    . LYS E 3 464 ? 130.278 -25.475 12.662  1.00 26.82 ? 760  LYS A CG    1 
ATOM   4509  C  CD    . LYS E 3 464 ? 131.278 -26.050 13.649  1.00 28.59 ? 760  LYS A CD    1 
ATOM   4510  C  CE    . LYS E 3 464 ? 132.701 -25.737 13.221  1.00 32.88 ? 760  LYS A CE    1 
ATOM   4511  N  NZ    . LYS E 3 464 ? 133.704 -26.233 14.209  1.00 34.93 ? 760  LYS A NZ    1 
ATOM   4512  N  N     . GLY E 3 465 ? 125.659 -25.309 13.258  1.00 17.71 ? 761  GLY A N     1 
ATOM   4513  C  CA    . GLY E 3 465 ? 124.371 -25.871 13.617  1.00 19.66 ? 761  GLY A CA    1 
ATOM   4514  C  C     . GLY E 3 465 ? 124.420 -26.768 14.843  1.00 20.56 ? 761  GLY A C     1 
ATOM   4515  O  O     . GLY E 3 465 ? 123.419 -27.397 15.197  1.00 21.23 ? 761  GLY A O     1 
ATOM   4516  N  N     . TYR E 3 466 ? 125.579 -26.822 15.491  1.00 20.21 ? 762  TYR A N     1 
ATOM   4517  C  CA    . TYR E 3 466 ? 125.768 -27.636 16.688  1.00 21.11 ? 762  TYR A CA    1 
ATOM   4518  C  C     . TYR E 3 466 ? 127.035 -27.193 17.418  1.00 21.78 ? 762  TYR A C     1 
ATOM   4519  O  O     . TYR E 3 466 ? 127.858 -26.472 16.859  1.00 21.72 ? 762  TYR A O     1 
ATOM   4520  C  CB    . TYR E 3 466 ? 125.889 -29.117 16.297  1.00 20.70 ? 762  TYR A CB    1 
ATOM   4521  C  CG    . TYR E 3 466 ? 127.129 -29.447 15.483  1.00 22.35 ? 762  TYR A CG    1 
ATOM   4522  C  CD1   . TYR E 3 466 ? 128.356 -29.679 16.106  1.00 19.91 ? 762  TYR A CD1   1 
ATOM   4523  C  CD2   . TYR E 3 466 ? 127.078 -29.515 14.089  1.00 20.79 ? 762  TYR A CD2   1 
ATOM   4524  C  CE1   . TYR E 3 466 ? 129.498 -29.970 15.366  1.00 21.68 ? 762  TYR A CE1   1 
ATOM   4525  C  CE2   . TYR E 3 466 ? 128.223 -29.805 13.337  1.00 20.95 ? 762  TYR A CE2   1 
ATOM   4526  C  CZ    . TYR E 3 466 ? 129.425 -30.032 13.985  1.00 20.82 ? 762  TYR A CZ    1 
ATOM   4527  O  OH    . TYR E 3 466 ? 130.556 -30.323 13.263  1.00 21.60 ? 762  TYR A OH    1 
ATOM   4528  N  N     . VAL E 3 467 ? 127.180 -27.618 18.670  1.00 21.68 ? 763  VAL A N     1 
ATOM   4529  C  CA    . VAL E 3 467 ? 128.364 -27.312 19.466  1.00 21.07 ? 763  VAL A CA    1 
ATOM   4530  C  C     . VAL E 3 467 ? 128.885 -28.636 20.004  1.00 22.25 ? 763  VAL A C     1 
ATOM   4531  O  O     . VAL E 3 467 ? 128.169 -29.637 19.991  1.00 21.74 ? 763  VAL A O     1 
ATOM   4532  C  CB    . VAL E 3 467 ? 128.057 -26.353 20.652  1.00 22.38 ? 763  VAL A CB    1 
ATOM   4533  C  CG1   . VAL E 3 467 ? 127.724 -24.973 20.122  1.00 21.03 ? 763  VAL A CG1   1 
ATOM   4534  C  CG2   . VAL E 3 467 ? 126.912 -26.899 21.500  1.00 18.67 ? 763  VAL A CG2   1 
ATOM   4535  N  N     . THR E 3 468 ? 130.127 -28.645 20.475  1.00 21.80 ? 764  THR A N     1 
ATOM   4536  C  CA    . THR E 3 468 ? 130.734 -29.870 20.973  1.00 21.92 ? 764  THR A CA    1 
ATOM   4537  C  C     . THR E 3 468 ? 131.454 -29.683 22.303  1.00 22.95 ? 764  THR A C     1 
ATOM   4538  O  O     . THR E 3 468 ? 131.714 -28.555 22.729  1.00 22.37 ? 764  THR A O     1 
ATOM   4539  C  CB    . THR E 3 468 ? 131.747 -30.417 19.948  1.00 24.26 ? 764  THR A CB    1 
ATOM   4540  O  OG1   . THR E 3 468 ? 132.725 -29.409 19.667  1.00 23.42 ? 764  THR A OG1   1 
ATOM   4541  C  CG2   . THR E 3 468 ? 131.043 -30.802 18.649  1.00 23.81 ? 764  THR A CG2   1 
ATOM   4542  N  N     . THR E 3 469 ? 131.779 -30.799 22.950  1.00 21.76 ? 765  THR A N     1 
ATOM   4543  C  CA    . THR E 3 469 ? 132.475 -30.776 24.230  1.00 21.59 ? 765  THR A CA    1 
ATOM   4544  C  C     . THR E 3 469 ? 133.910 -31.266 24.063  1.00 22.82 ? 765  THR A C     1 
ATOM   4545  O  O     . THR E 3 469 ? 134.299 -31.722 22.987  1.00 21.63 ? 765  THR A O     1 
ATOM   4546  C  CB    . THR E 3 469 ? 131.783 -31.688 25.265  1.00 20.43 ? 765  THR A CB    1 
ATOM   4547  O  OG1   . THR E 3 469 ? 131.875 -33.050 24.830  1.00 18.98 ? 765  THR A OG1   1 
ATOM   4548  C  CG2   . THR E 3 469 ? 130.312 -31.299 25.426  1.00 18.24 ? 765  THR A CG2   1 
ATOM   4549  N  N     . LEU E 3 470 ? 134.685 -31.184 25.140  1.00 23.78 ? 766  LEU A N     1 
ATOM   4550  C  CA    . LEU E 3 470 ? 136.077 -31.625 25.126  1.00 24.71 ? 766  LEU A CA    1 
ATOM   4551  C  C     . LEU E 3 470 ? 136.261 -33.038 24.575  1.00 24.64 ? 766  LEU A C     1 
ATOM   4552  O  O     . LEU E 3 470 ? 137.189 -33.283 23.805  1.00 24.08 ? 766  LEU A O     1 
ATOM   4553  C  CB    . LEU E 3 470 ? 136.667 -31.557 26.538  1.00 26.83 ? 766  LEU A CB    1 
ATOM   4554  C  CG    . LEU E 3 470 ? 137.122 -30.185 27.040  1.00 29.85 ? 766  LEU A CG    1 
ATOM   4555  C  CD1   . LEU E 3 470 ? 137.494 -30.274 28.515  1.00 30.69 ? 766  LEU A CD1   1 
ATOM   4556  C  CD2   . LEU E 3 470 ? 138.315 -29.714 26.217  1.00 30.35 ? 766  LEU A CD2   1 
ATOM   4557  N  N     . LEU E 3 471 ? 135.390 -33.969 24.966  1.00 23.32 ? 767  LEU A N     1 
ATOM   4558  C  CA    . LEU E 3 471 ? 135.506 -35.344 24.489  1.00 23.84 ? 767  LEU A CA    1 
ATOM   4559  C  C     . LEU E 3 471 ? 134.629 -35.645 23.280  1.00 23.55 ? 767  LEU A C     1 
ATOM   4560  O  O     . LEU E 3 471 ? 134.304 -36.802 23.006  1.00 23.44 ? 767  LEU A O     1 
ATOM   4561  C  CB    . LEU E 3 471 ? 135.214 -36.340 25.618  1.00 24.24 ? 767  LEU A CB    1 
ATOM   4562  C  CG    . LEU E 3 471 ? 136.153 -36.243 26.826  1.00 25.35 ? 767  LEU A CG    1 
ATOM   4563  C  CD1   . LEU E 3 471 ? 135.923 -37.426 27.756  1.00 26.53 ? 767  LEU A CD1   1 
ATOM   4564  C  CD2   . LEU E 3 471 ? 137.605 -36.224 26.356  1.00 26.57 ? 767  LEU A CD2   1 
ATOM   4565  N  N     . HIS E 3 472 ? 134.254 -34.584 22.567  1.00 23.07 ? 768  HIS A N     1 
ATOM   4566  C  CA    . HIS E 3 472 ? 133.460 -34.668 21.344  1.00 24.02 ? 768  HIS A CA    1 
ATOM   4567  C  C     . HIS E 3 472 ? 131.974 -34.974 21.455  1.00 24.35 ? 768  HIS A C     1 
ATOM   4568  O  O     . HIS E 3 472 ? 131.356 -35.420 20.485  1.00 23.41 ? 768  HIS A O     1 
ATOM   4569  C  CB    . HIS E 3 472 ? 134.110 -35.651 20.366  1.00 27.02 ? 768  HIS A CB    1 
ATOM   4570  C  CG    . HIS E 3 472 ? 135.525 -35.303 20.025  1.00 30.21 ? 768  HIS A CG    1 
ATOM   4571  N  ND1   . HIS E 3 472 ? 136.607 -35.939 20.595  1.00 32.74 ? 768  HIS A ND1   1 
ATOM   4572  C  CD2   . HIS E 3 472 ? 136.036 -34.362 19.196  1.00 32.22 ? 768  HIS A CD2   1 
ATOM   4573  C  CE1   . HIS E 3 472 ? 137.724 -35.405 20.133  1.00 32.08 ? 768  HIS A CE1   1 
ATOM   4574  N  NE2   . HIS E 3 472 ? 137.405 -34.445 19.283  1.00 32.82 ? 768  HIS A NE2   1 
ATOM   4575  N  N     . ARG E 3 473 ? 131.393 -34.740 22.626  1.00 22.98 ? 769  ARG A N     1 
ATOM   4576  C  CA    . ARG E 3 473 ? 129.963 -34.952 22.776  1.00 21.59 ? 769  ARG A CA    1 
ATOM   4577  C  C     . ARG E 3 473 ? 129.381 -33.848 21.903  1.00 20.49 ? 769  ARG A C     1 
ATOM   4578  O  O     . ARG E 3 473 ? 130.027 -32.823 21.696  1.00 21.40 ? 769  ARG A O     1 
ATOM   4579  C  CB    . ARG E 3 473 ? 129.540 -34.760 24.229  1.00 20.61 ? 769  ARG A CB    1 
ATOM   4580  C  CG    . ARG E 3 473 ? 128.084 -35.087 24.507  1.00 20.23 ? 769  ARG A CG    1 
ATOM   4581  C  CD    . ARG E 3 473 ? 127.800 -34.905 25.985  1.00 17.38 ? 769  ARG A CD    1 
ATOM   4582  N  NE    . ARG E 3 473 ? 128.732 -35.680 26.799  1.00 18.67 ? 769  ARG A NE    1 
ATOM   4583  C  CZ    . ARG E 3 473 ? 128.657 -36.995 26.979  1.00 18.16 ? 769  ARG A CZ    1 
ATOM   4584  N  NH1   . ARG E 3 473 ? 127.682 -37.690 26.406  1.00 18.15 ? 769  ARG A NH1   1 
ATOM   4585  N  NH2   . ARG E 3 473 ? 129.562 -37.617 27.722  1.00 19.97 ? 769  ARG A NH2   1 
ATOM   4586  N  N     . ARG E 3 474 ? 128.172 -34.043 21.392  1.00 20.45 ? 770  ARG A N     1 
ATOM   4587  C  CA    . ARG E 3 474 ? 127.576 -33.046 20.518  1.00 20.54 ? 770  ARG A CA    1 
ATOM   4588  C  C     . ARG E 3 474 ? 126.123 -32.699 20.843  1.00 19.93 ? 770  ARG A C     1 
ATOM   4589  O  O     . ARG E 3 474 ? 125.378 -33.515 21.390  1.00 20.48 ? 770  ARG A O     1 
ATOM   4590  C  CB    . ARG E 3 474 ? 127.679 -33.546 19.068  1.00 22.95 ? 770  ARG A CB    1 
ATOM   4591  C  CG    . ARG E 3 474 ? 127.201 -32.572 18.015  1.00 24.78 ? 770  ARG A CG    1 
ATOM   4592  C  CD    . ARG E 3 474 ? 127.299 -33.164 16.603  1.00 25.68 ? 770  ARG A CD    1 
ATOM   4593  N  NE    . ARG E 3 474 ? 128.671 -33.477 16.203  1.00 25.00 ? 770  ARG A NE    1 
ATOM   4594  C  CZ    . ARG E 3 474 ? 129.064 -33.639 14.940  1.00 25.95 ? 770  ARG A CZ    1 
ATOM   4595  N  NH1   . ARG E 3 474 ? 128.190 -33.517 13.950  1.00 23.15 ? 770  ARG A NH1   1 
ATOM   4596  N  NH2   . ARG E 3 474 ? 130.333 -33.912 14.662  1.00 25.62 ? 770  ARG A NH2   1 
ATOM   4597  N  N     . ARG E 3 475 ? 125.732 -31.471 20.509  1.00 18.09 ? 771  ARG A N     1 
ATOM   4598  C  CA    . ARG E 3 475 ? 124.356 -31.022 20.691  1.00 17.98 ? 771  ARG A CA    1 
ATOM   4599  C  C     . ARG E 3 475 ? 124.001 -30.113 19.521  1.00 18.46 ? 771  ARG A C     1 
ATOM   4600  O  O     . ARG E 3 475 ? 124.690 -29.124 19.270  1.00 17.29 ? 771  ARG A O     1 
ATOM   4601  C  CB    . ARG E 3 475 ? 124.168 -30.252 22.005  1.00 16.96 ? 771  ARG A CB    1 
ATOM   4602  C  CG    . ARG E 3 475 ? 122.705 -29.863 22.238  1.00 17.53 ? 771  ARG A CG    1 
ATOM   4603  C  CD    . ARG E 3 475 ? 122.481 -29.100 23.538  1.00 16.61 ? 771  ARG A CD    1 
ATOM   4604  N  NE    . ARG E 3 475 ? 121.053 -28.918 23.805  1.00 14.20 ? 771  ARG A NE    1 
ATOM   4605  C  CZ    . ARG E 3 475 ? 120.571 -28.291 24.874  1.00 14.84 ? 771  ARG A CZ    1 
ATOM   4606  N  NH1   . ARG E 3 475 ? 121.403 -27.785 25.772  1.00 13.62 ? 771  ARG A NH1   1 
ATOM   4607  N  NH2   . ARG E 3 475 ? 119.261 -28.177 25.051  1.00 15.54 ? 771  ARG A NH2   1 
ATOM   4608  N  N     . TYR E 3 476 ? 122.933 -30.449 18.803  1.00 18.76 ? 772  TYR A N     1 
ATOM   4609  C  CA    . TYR E 3 476 ? 122.501 -29.638 17.668  1.00 19.97 ? 772  TYR A CA    1 
ATOM   4610  C  C     . TYR E 3 476 ? 121.576 -28.524 18.130  1.00 20.28 ? 772  TYR A C     1 
ATOM   4611  O  O     . TYR E 3 476 ? 120.777 -28.710 19.044  1.00 19.47 ? 772  TYR A O     1 
ATOM   4612  C  CB    . TYR E 3 476 ? 121.790 -30.503 16.625  1.00 22.08 ? 772  TYR A CB    1 
ATOM   4613  C  CG    . TYR E 3 476 ? 122.714 -31.488 15.956  1.00 22.35 ? 772  TYR A CG    1 
ATOM   4614  C  CD1   . TYR E 3 476 ? 122.892 -32.770 16.470  1.00 23.27 ? 772  TYR A CD1   1 
ATOM   4615  C  CD2   . TYR E 3 476 ? 123.441 -31.124 14.821  1.00 23.08 ? 772  TYR A CD2   1 
ATOM   4616  C  CE1   . TYR E 3 476 ? 123.776 -33.667 15.873  1.00 23.91 ? 772  TYR A CE1   1 
ATOM   4617  C  CE2   . TYR E 3 476 ? 124.329 -32.008 14.219  1.00 23.55 ? 772  TYR A CE2   1 
ATOM   4618  C  CZ    . TYR E 3 476 ? 124.493 -33.275 14.749  1.00 23.88 ? 772  TYR A CZ    1 
ATOM   4619  O  OH    . TYR E 3 476 ? 125.390 -34.138 14.172  1.00 22.79 ? 772  TYR A OH    1 
ATOM   4620  N  N     . LEU E 3 477 ? 121.690 -27.366 17.489  1.00 20.96 ? 773  LEU A N     1 
ATOM   4621  C  CA    . LEU E 3 477 ? 120.876 -26.212 17.840  1.00 21.59 ? 773  LEU A CA    1 
ATOM   4622  C  C     . LEU E 3 477 ? 120.278 -25.586 16.578  1.00 23.93 ? 773  LEU A C     1 
ATOM   4623  O  O     . LEU E 3 477 ? 120.685 -24.509 16.153  1.00 24.78 ? 773  LEU A O     1 
ATOM   4624  C  CB    . LEU E 3 477 ? 121.743 -25.193 18.584  1.00 20.65 ? 773  LEU A CB    1 
ATOM   4625  C  CG    . LEU E 3 477 ? 122.413 -25.721 19.862  1.00 21.38 ? 773  LEU A CG    1 
ATOM   4626  C  CD1   . LEU E 3 477 ? 123.439 -24.718 20.374  1.00 21.34 ? 773  LEU A CD1   1 
ATOM   4627  C  CD2   . LEU E 3 477 ? 121.354 -25.998 20.922  1.00 21.01 ? 773  LEU A CD2   1 
ATOM   4628  N  N     . PRO E 3 478 ? 119.290 -26.257 15.967  1.00 25.98 ? 774  PRO A N     1 
ATOM   4629  C  CA    . PRO E 3 478 ? 118.658 -25.737 14.751  1.00 27.63 ? 774  PRO A CA    1 
ATOM   4630  C  C     . PRO E 3 478 ? 118.009 -24.358 14.906  1.00 28.91 ? 774  PRO A C     1 
ATOM   4631  O  O     . PRO E 3 478 ? 117.987 -23.573 13.961  1.00 30.48 ? 774  PRO A O     1 
ATOM   4632  C  CB    . PRO E 3 478 ? 117.663 -26.836 14.385  1.00 26.89 ? 774  PRO A CB    1 
ATOM   4633  C  CG    . PRO E 3 478 ? 117.296 -27.409 15.717  1.00 26.60 ? 774  PRO A CG    1 
ATOM   4634  C  CD    . PRO E 3 478 ? 118.638 -27.505 16.398  1.00 25.11 ? 774  PRO A CD    1 
ATOM   4635  N  N     . ASP E 3 479 ? 117.494 -24.065 16.097  1.00 29.80 ? 775  ASP A N     1 
ATOM   4636  C  CA    . ASP E 3 479 ? 116.839 -22.783 16.370  1.00 30.32 ? 775  ASP A CA    1 
ATOM   4637  C  C     . ASP E 3 479 ? 117.792 -21.587 16.415  1.00 29.79 ? 775  ASP A C     1 
ATOM   4638  O  O     . ASP E 3 479 ? 117.350 -20.438 16.436  1.00 28.98 ? 775  ASP A O     1 
ATOM   4639  C  CB    . ASP E 3 479 ? 116.098 -22.849 17.707  1.00 32.99 ? 775  ASP A CB    1 
ATOM   4640  C  CG    . ASP E 3 479 ? 114.900 -23.768 17.667  1.00 36.40 ? 775  ASP A CG    1 
ATOM   4641  O  OD1   . ASP E 3 479 ? 114.294 -23.993 18.739  1.00 37.67 ? 775  ASP A OD1   1 
ATOM   4642  O  OD2   . ASP E 3 479 ? 114.561 -24.258 16.568  1.00 37.92 ? 775  ASP A OD2   1 
ATOM   4643  N  N     . ILE E 3 480 ? 119.091 -21.865 16.431  1.00 28.31 ? 776  ILE A N     1 
ATOM   4644  C  CA    . ILE E 3 480 ? 120.116 -20.829 16.515  1.00 29.03 ? 776  ILE A CA    1 
ATOM   4645  C  C     . ILE E 3 480 ? 120.028 -19.730 15.446  1.00 30.34 ? 776  ILE A C     1 
ATOM   4646  O  O     . ILE E 3 480 ? 120.582 -18.642 15.622  1.00 29.77 ? 776  ILE A O     1 
ATOM   4647  C  CB    . ILE E 3 480 ? 121.529 -21.467 16.467  1.00 28.57 ? 776  ILE A CB    1 
ATOM   4648  C  CG1   . ILE E 3 480 ? 122.590 -20.450 16.886  1.00 29.15 ? 776  ILE A CG1   1 
ATOM   4649  C  CG2   . ILE E 3 480 ? 121.817 -21.992 15.075  1.00 28.50 ? 776  ILE A CG2   1 
ATOM   4650  C  CD1   . ILE E 3 480 ? 122.655 -20.210 18.377  1.00 27.58 ? 776  ILE A CD1   1 
ATOM   4651  N  N     . THR E 3 481 ? 119.339 -20.007 14.343  1.00 30.24 ? 777  THR A N     1 
ATOM   4652  C  CA    . THR E 3 481 ? 119.209 -19.018 13.275  1.00 31.46 ? 777  THR A CA    1 
ATOM   4653  C  C     . THR E 3 481 ? 117.757 -18.614 13.046  1.00 33.03 ? 777  THR A C     1 
ATOM   4654  O  O     . THR E 3 481 ? 117.406 -18.085 11.989  1.00 34.19 ? 777  THR A O     1 
ATOM   4655  C  CB    . THR E 3 481 ? 119.804 -19.547 11.944  1.00 31.73 ? 777  THR A CB    1 
ATOM   4656  O  OG1   . THR E 3 481 ? 119.206 -20.805 11.609  1.00 31.76 ? 777  THR A OG1   1 
ATOM   4657  C  CG2   . THR E 3 481 ? 121.312 -19.727 12.069  1.00 29.45 ? 777  THR A CG2   1 
ATOM   4658  N  N     . SER E 3 482 ? 116.919 -18.854 14.049  1.00 32.60 ? 778  SER A N     1 
ATOM   4659  C  CA    . SER E 3 482 ? 115.499 -18.527 13.960  1.00 34.13 ? 778  SER A CA    1 
ATOM   4660  C  C     . SER E 3 482 ? 115.197 -17.034 13.881  1.00 34.86 ? 778  SER A C     1 
ATOM   4661  O  O     . SER E 3 482 ? 115.908 -16.203 14.451  1.00 33.93 ? 778  SER A O     1 
ATOM   4662  C  CB    . SER E 3 482 ? 114.743 -19.117 15.153  1.00 32.69 ? 778  SER A CB    1 
ATOM   4663  O  OG    . SER E 3 482 ? 113.391 -18.688 15.150  1.00 32.65 ? 778  SER A OG    1 
ATOM   4664  N  N     . ARG E 3 483 ? 114.119 -16.720 13.170  1.00 36.89 ? 779  ARG A N     1 
ATOM   4665  C  CA    . ARG E 3 483 ? 113.639 -15.354 12.989  1.00 39.03 ? 779  ARG A CA    1 
ATOM   4666  C  C     . ARG E 3 483 ? 113.214 -14.784 14.340  1.00 38.66 ? 779  ARG A C     1 
ATOM   4667  O  O     . ARG E 3 483 ? 113.500 -13.632 14.661  1.00 38.32 ? 779  ARG A O     1 
ATOM   4668  C  CB    . ARG E 3 483 ? 112.436 -15.356 12.040  1.00 42.44 ? 779  ARG A CB    1 
ATOM   4669  C  CG    . ARG E 3 483 ? 111.316 -16.278 12.522  1.00 46.92 ? 779  ARG A CG    1 
ATOM   4670  C  CD    . ARG E 3 483 ? 110.151 -16.390 11.548  1.00 51.63 ? 779  ARG A CD    1 
ATOM   4671  N  NE    . ARG E 3 483 ? 109.130 -17.308 12.058  1.00 54.49 ? 779  ARG A NE    1 
ATOM   4672  C  CZ    . ARG E 3 483 ? 108.019 -17.640 11.406  1.00 55.61 ? 779  ARG A CZ    1 
ATOM   4673  N  NH1   . ARG E 3 483 ? 107.770 -17.130 10.208  1.00 55.65 ? 779  ARG A NH1   1 
ATOM   4674  N  NH2   . ARG E 3 483 ? 107.156 -18.487 11.953  1.00 56.26 ? 779  ARG A NH2   1 
ATOM   4675  N  N     . ASN E 3 484 ? 112.527 -15.609 15.126  1.00 38.60 ? 780  ASN A N     1 
ATOM   4676  C  CA    . ASN E 3 484 ? 112.038 -15.205 16.438  1.00 38.65 ? 780  ASN A CA    1 
ATOM   4677  C  C     . ASN E 3 484 ? 113.181 -14.953 17.414  1.00 38.22 ? 780  ASN A C     1 
ATOM   4678  O  O     . ASN E 3 484 ? 114.022 -15.824 17.645  1.00 35.50 ? 780  ASN A O     1 
ATOM   4679  C  CB    . ASN E 3 484 ? 111.097 -16.273 16.998  1.00 40.18 ? 780  ASN A CB    1 
ATOM   4680  C  CG    . ASN E 3 484 ? 110.509 -15.885 18.340  1.00 42.81 ? 780  ASN A CG    1 
ATOM   4681  O  OD1   . ASN E 3 484 ? 111.193 -15.913 19.363  1.00 43.98 ? 780  ASN A OD1   1 
ATOM   4682  N  ND2   . ASN E 3 484 ? 109.233 -15.509 18.340  1.00 44.28 ? 780  ASN A ND2   1 
ATOM   4683  N  N     . PHE E 3 485 ? 113.195 -13.749 17.980  1.00 37.67 ? 781  PHE A N     1 
ATOM   4684  C  CA    . PHE E 3 485 ? 114.224 -13.337 18.927  1.00 38.28 ? 781  PHE A CA    1 
ATOM   4685  C  C     . PHE E 3 485 ? 114.293 -14.235 20.156  1.00 37.20 ? 781  PHE A C     1 
ATOM   4686  O  O     . PHE E 3 485 ? 115.380 -14.591 20.614  1.00 36.29 ? 781  PHE A O     1 
ATOM   4687  C  CB    . PHE E 3 485 ? 113.971 -11.899 19.380  1.00 40.43 ? 781  PHE A CB    1 
ATOM   4688  C  CG    . PHE E 3 485 ? 114.897 -11.438 20.468  1.00 42.65 ? 781  PHE A CG    1 
ATOM   4689  C  CD1   . PHE E 3 485 ? 116.248 -11.231 20.208  1.00 43.80 ? 781  PHE A CD1   1 
ATOM   4690  C  CD2   . PHE E 3 485 ? 114.419 -11.218 21.755  1.00 43.58 ? 781  PHE A CD2   1 
ATOM   4691  C  CE1   . PHE E 3 485 ? 117.115 -10.810 21.217  1.00 44.55 ? 781  PHE A CE1   1 
ATOM   4692  C  CE2   . PHE E 3 485 ? 115.275 -10.798 22.771  1.00 44.64 ? 781  PHE A CE2   1 
ATOM   4693  C  CZ    . PHE E 3 485 ? 116.626 -10.593 22.501  1.00 44.94 ? 781  PHE A CZ    1 
ATOM   4694  N  N     . ASN E 3 486 ? 113.132 -14.596 20.688  1.00 36.31 ? 782  ASN A N     1 
ATOM   4695  C  CA    . ASN E 3 486 ? 113.079 -15.437 21.873  1.00 36.11 ? 782  ASN A CA    1 
ATOM   4696  C  C     . ASN E 3 486 ? 113.622 -16.830 21.573  1.00 34.15 ? 782  ASN A C     1 
ATOM   4697  O  O     . ASN E 3 486 ? 114.482 -17.334 22.294  1.00 34.93 ? 782  ASN A O     1 
ATOM   4698  C  CB    . ASN E 3 486 ? 111.640 -15.515 22.393  1.00 39.54 ? 782  ASN A CB    1 
ATOM   4699  C  CG    . ASN E 3 486 ? 111.569 -15.503 23.909  1.00 42.85 ? 782  ASN A CG    1 
ATOM   4700  O  OD1   . ASN E 3 486 ? 112.328 -14.792 24.569  1.00 45.55 ? 782  ASN A OD1   1 
ATOM   4701  N  ND2   . ASN E 3 486 ? 110.645 -16.278 24.469  1.00 45.15 ? 782  ASN A ND2   1 
ATOM   4702  N  N     . VAL E 3 487 ? 113.131 -17.444 20.501  1.00 31.57 ? 783  VAL A N     1 
ATOM   4703  C  CA    . VAL E 3 487 ? 113.587 -18.772 20.115  1.00 28.84 ? 783  VAL A CA    1 
ATOM   4704  C  C     . VAL E 3 487 ? 115.100 -18.784 19.894  1.00 27.74 ? 783  VAL A C     1 
ATOM   4705  O  O     . VAL E 3 487 ? 115.800 -19.671 20.387  1.00 26.09 ? 783  VAL A O     1 
ATOM   4706  C  CB    . VAL E 3 487 ? 112.889 -19.249 18.819  1.00 29.48 ? 783  VAL A CB    1 
ATOM   4707  C  CG1   . VAL E 3 487 ? 113.537 -20.528 18.317  1.00 28.13 ? 783  VAL A CG1   1 
ATOM   4708  C  CG2   . VAL E 3 487 ? 111.412 -19.487 19.085  1.00 29.60 ? 783  VAL A CG2   1 
ATOM   4709  N  N     . ARG E 3 488 ? 115.596 -17.790 19.161  1.00 25.67 ? 784  ARG A N     1 
ATOM   4710  C  CA    . ARG E 3 488 ? 117.022 -17.677 18.860  1.00 24.45 ? 784  ARG A CA    1 
ATOM   4711  C  C     . ARG E 3 488 ? 117.883 -17.467 20.098  1.00 22.80 ? 784  ARG A C     1 
ATOM   4712  O  O     . ARG E 3 488 ? 118.910 -18.120 20.265  1.00 22.55 ? 784  ARG A O     1 
ATOM   4713  C  CB    . ARG E 3 488 ? 117.273 -16.513 17.896  1.00 27.15 ? 784  ARG A CB    1 
ATOM   4714  C  CG    . ARG E 3 488 ? 118.698 -16.443 17.365  1.00 27.62 ? 784  ARG A CG    1 
ATOM   4715  C  CD    . ARG E 3 488 ? 119.000 -15.087 16.733  1.00 31.52 ? 784  ARG A CD    1 
ATOM   4716  N  NE    . ARG E 3 488 ? 117.876 -14.596 15.947  1.00 33.52 ? 784  ARG A NE    1 
ATOM   4717  C  CZ    . ARG E 3 488 ? 117.223 -13.467 16.203  1.00 34.74 ? 784  ARG A CZ    1 
ATOM   4718  N  NH1   . ARG E 3 488 ? 117.589 -12.702 17.224  1.00 34.69 ? 784  ARG A NH1   1 
ATOM   4719  N  NH2   . ARG E 3 488 ? 116.198 -13.106 15.443  1.00 34.95 ? 784  ARG A NH2   1 
ATOM   4720  N  N     . SER E 3 489 ? 117.464 -16.544 20.957  1.00 23.10 ? 785  SER A N     1 
ATOM   4721  C  CA    . SER E 3 489 ? 118.207 -16.237 22.173  1.00 23.06 ? 785  SER A CA    1 
ATOM   4722  C  C     . SER E 3 489 ? 118.412 -17.476 23.034  1.00 21.74 ? 785  SER A C     1 
ATOM   4723  O  O     . SER E 3 489 ? 119.503 -17.701 23.557  1.00 21.60 ? 785  SER A O     1 
ATOM   4724  C  CB    . SER E 3 489 ? 117.477 -15.159 22.979  1.00 24.30 ? 785  SER A CB    1 
ATOM   4725  O  OG    . SER E 3 489 ? 117.392 -13.948 22.242  1.00 27.18 ? 785  SER A OG    1 
ATOM   4726  N  N     . PHE E 3 490 ? 117.365 -18.278 23.185  1.00 21.46 ? 786  PHE A N     1 
ATOM   4727  C  CA    . PHE E 3 490 ? 117.472 -19.493 23.980  1.00 21.44 ? 786  PHE A CA    1 
ATOM   4728  C  C     . PHE E 3 490 ? 118.526 -20.417 23.384  1.00 20.78 ? 786  PHE A C     1 
ATOM   4729  O  O     . PHE E 3 490 ? 119.332 -21.001 24.105  1.00 19.92 ? 786  PHE A O     1 
ATOM   4730  C  CB    . PHE E 3 490 ? 116.119 -20.203 24.047  1.00 23.61 ? 786  PHE A CB    1 
ATOM   4731  C  CG    . PHE E 3 490 ? 115.259 -19.741 25.185  1.00 25.33 ? 786  PHE A CG    1 
ATOM   4732  C  CD1   . PHE E 3 490 ? 115.562 -20.116 26.491  1.00 25.61 ? 786  PHE A CD1   1 
ATOM   4733  C  CD2   . PHE E 3 490 ? 114.170 -18.905 24.962  1.00 27.16 ? 786  PHE A CD2   1 
ATOM   4734  C  CE1   . PHE E 3 490 ? 114.794 -19.667 27.561  1.00 26.89 ? 786  PHE A CE1   1 
ATOM   4735  C  CE2   . PHE E 3 490 ? 113.393 -18.447 26.027  1.00 28.46 ? 786  PHE A CE2   1 
ATOM   4736  C  CZ    . PHE E 3 490 ? 113.707 -18.830 27.331  1.00 28.74 ? 786  PHE A CZ    1 
ATOM   4737  N  N     . ALA E 3 491 ? 118.533 -20.530 22.060  1.00 19.71 ? 787  ALA A N     1 
ATOM   4738  C  CA    . ALA E 3 491 ? 119.499 -21.387 21.386  1.00 19.39 ? 787  ALA A CA    1 
ATOM   4739  C  C     . ALA E 3 491 ? 120.909 -20.837 21.565  1.00 19.22 ? 787  ALA A C     1 
ATOM   4740  O  O     . ALA E 3 491 ? 121.859 -21.596 21.755  1.00 18.93 ? 787  ALA A O     1 
ATOM   4741  C  CB    . ALA E 3 491 ? 119.159 -21.499 19.894  1.00 20.76 ? 787  ALA A CB    1 
ATOM   4742  N  N     . GLU E 3 492 ? 121.047 -19.514 21.511  1.00 18.25 ? 788  GLU A N     1 
ATOM   4743  C  CA    . GLU E 3 492 ? 122.360 -18.900 21.673  1.00 18.75 ? 788  GLU A CA    1 
ATOM   4744  C  C     . GLU E 3 492 ? 122.905 -19.176 23.072  1.00 19.03 ? 788  GLU A C     1 
ATOM   4745  O  O     . GLU E 3 492 ? 124.088 -19.468 23.240  1.00 17.87 ? 788  GLU A O     1 
ATOM   4746  C  CB    . GLU E 3 492 ? 122.279 -17.391 21.426  1.00 19.91 ? 788  GLU A CB    1 
ATOM   4747  C  CG    . GLU E 3 492 ? 121.688 -17.045 20.065  1.00 24.81 ? 788  GLU A CG    1 
ATOM   4748  C  CD    . GLU E 3 492 ? 121.674 -15.555 19.785  1.00 26.76 ? 788  GLU A CD    1 
ATOM   4749  O  OE1   . GLU E 3 492 ? 121.476 -14.768 20.733  1.00 26.56 ? 788  GLU A OE1   1 
ATOM   4750  O  OE2   . GLU E 3 492 ? 121.853 -15.172 18.611  1.00 27.66 ? 788  GLU A OE2   1 
ATOM   4751  N  N     . ARG E 3 493 ? 122.041 -19.088 24.078  1.00 18.79 ? 789  ARG A N     1 
ATOM   4752  C  CA    . ARG E 3 493 ? 122.476 -19.345 25.444  1.00 17.56 ? 789  ARG A CA    1 
ATOM   4753  C  C     . ARG E 3 493 ? 122.861 -20.813 25.637  1.00 17.66 ? 789  ARG A C     1 
ATOM   4754  O  O     . ARG E 3 493 ? 123.743 -21.126 26.437  1.00 17.33 ? 789  ARG A O     1 
ATOM   4755  C  CB    . ARG E 3 493 ? 121.391 -18.911 26.433  1.00 19.23 ? 789  ARG A CB    1 
ATOM   4756  C  CG    . ARG E 3 493 ? 121.228 -17.385 26.491  1.00 19.90 ? 789  ARG A CG    1 
ATOM   4757  C  CD    . ARG E 3 493 ? 120.494 -16.927 27.746  1.00 20.91 ? 789  ARG A CD    1 
ATOM   4758  N  NE    . ARG E 3 493 ? 119.090 -17.320 27.738  1.00 20.12 ? 789  ARG A NE    1 
ATOM   4759  C  CZ    . ARG E 3 493 ? 118.131 -16.679 27.080  1.00 22.84 ? 789  ARG A CZ    1 
ATOM   4760  N  NH1   . ARG E 3 493 ? 118.415 -15.593 26.368  1.00 24.57 ? 789  ARG A NH1   1 
ATOM   4761  N  NH2   . ARG E 3 493 ? 116.884 -17.130 27.129  1.00 22.54 ? 789  ARG A NH2   1 
ATOM   4762  N  N     . MET E 3 494 ? 122.212 -21.713 24.901  1.00 16.12 ? 790  MET A N     1 
ATOM   4763  C  CA    . MET E 3 494 ? 122.560 -23.129 24.992  1.00 17.37 ? 790  MET A CA    1 
ATOM   4764  C  C     . MET E 3 494 ? 123.971 -23.302 24.424  1.00 16.88 ? 790  MET A C     1 
ATOM   4765  O  O     . MET E 3 494 ? 124.765 -24.104 24.919  1.00 14.75 ? 790  MET A O     1 
ATOM   4766  C  CB    . MET E 3 494 ? 121.574 -23.993 24.194  1.00 17.37 ? 790  MET A CB    1 
ATOM   4767  C  CG    . MET E 3 494 ? 120.153 -24.024 24.754  1.00 17.14 ? 790  MET A CG    1 
ATOM   4768  S  SD    . MET E 3 494 ? 119.056 -25.102 23.799  1.00 19.51 ? 790  MET A SD    1 
ATOM   4769  C  CE    . MET E 3 494 ? 117.527 -24.920 24.707  1.00 18.21 ? 790  MET A CE    1 
ATOM   4770  N  N     . ALA E 3 495 ? 124.280 -22.538 23.379  1.00 18.22 ? 791  ALA A N     1 
ATOM   4771  C  CA    . ALA E 3 495 ? 125.596 -22.608 22.757  1.00 18.85 ? 791  ALA A CA    1 
ATOM   4772  C  C     . ALA E 3 495 ? 126.657 -22.140 23.741  1.00 18.50 ? 791  ALA A C     1 
ATOM   4773  O  O     . ALA E 3 495 ? 127.792 -22.610 23.712  1.00 19.53 ? 791  ALA A O     1 
ATOM   4774  C  CB    . ALA E 3 495 ? 125.636 -21.740 21.492  1.00 18.98 ? 791  ALA A CB    1 
ATOM   4775  N  N     . MET E 3 496 ? 126.281 -21.210 24.614  1.00 18.67 ? 792  MET A N     1 
ATOM   4776  C  CA    . MET E 3 496 ? 127.207 -20.676 25.610  1.00 19.36 ? 792  MET A CA    1 
ATOM   4777  C  C     . MET E 3 496 ? 127.439 -21.653 26.758  1.00 19.24 ? 792  MET A C     1 
ATOM   4778  O  O     . MET E 3 496 ? 128.551 -21.784 27.267  1.00 20.14 ? 792  MET A O     1 
ATOM   4779  C  CB    . MET E 3 496 ? 126.666 -19.375 26.208  1.00 20.56 ? 792  MET A CB    1 
ATOM   4780  C  CG    . MET E 3 496 ? 126.469 -18.221 25.237  1.00 24.48 ? 792  MET A CG    1 
ATOM   4781  S  SD    . MET E 3 496 ? 125.771 -16.791 26.112  1.00 27.26 ? 792  MET A SD    1 
ATOM   4782  C  CE    . MET E 3 496 ? 124.327 -16.464 25.157  1.00 29.45 ? 792  MET A CE    1 
ATOM   4783  N  N     . ASN E 3 497 ? 126.376 -22.338 27.161  1.00 17.52 ? 793  ASN A N     1 
ATOM   4784  C  CA    . ASN E 3 497 ? 126.443 -23.254 28.293  1.00 17.14 ? 793  ASN A CA    1 
ATOM   4785  C  C     . ASN E 3 497 ? 126.777 -24.718 28.015  1.00 16.45 ? 793  ASN A C     1 
ATOM   4786  O  O     . ASN E 3 497 ? 127.629 -25.294 28.687  1.00 18.21 ? 793  ASN A O     1 
ATOM   4787  C  CB    . ASN E 3 497 ? 125.122 -23.149 29.075  1.00 17.10 ? 793  ASN A CB    1 
ATOM   4788  C  CG    . ASN E 3 497 ? 124.997 -24.193 30.168  1.00 16.46 ? 793  ASN A CG    1 
ATOM   4789  O  OD1   . ASN E 3 497 ? 124.587 -25.324 29.914  1.00 15.87 ? 793  ASN A OD1   1 
ATOM   4790  N  ND2   . ASN E 3 497 ? 125.360 -23.820 31.389  1.00 17.76 ? 793  ASN A ND2   1 
ATOM   4791  N  N     . THR E 3 498 ? 126.124 -25.321 27.028  1.00 16.88 ? 794  THR A N     1 
ATOM   4792  C  CA    . THR E 3 498 ? 126.348 -26.737 26.737  1.00 17.05 ? 794  THR A CA    1 
ATOM   4793  C  C     . THR E 3 498 ? 127.808 -27.196 26.652  1.00 16.99 ? 794  THR A C     1 
ATOM   4794  O  O     . THR E 3 498 ? 128.181 -28.195 27.273  1.00 17.09 ? 794  THR A O     1 
ATOM   4795  C  CB    . THR E 3 498 ? 125.575 -27.164 25.465  1.00 17.34 ? 794  THR A CB    1 
ATOM   4796  O  OG1   . THR E 3 498 ? 124.170 -27.155 25.753  1.00 18.95 ? 794  THR A OG1   1 
ATOM   4797  C  CG2   . THR E 3 498 ? 125.977 -28.563 25.018  1.00 15.09 ? 794  THR A CG2   1 
ATOM   4798  N  N     . PRO E 3 499 ? 128.659 -26.479 25.900  1.00 17.02 ? 795  PRO A N     1 
ATOM   4799  C  CA    . PRO E 3 499 ? 130.052 -26.935 25.832  1.00 17.47 ? 795  PRO A CA    1 
ATOM   4800  C  C     . PRO E 3 499 ? 130.744 -27.012 27.197  1.00 17.78 ? 795  PRO A C     1 
ATOM   4801  O  O     . PRO E 3 499 ? 131.556 -27.902 27.440  1.00 18.55 ? 795  PRO A O     1 
ATOM   4802  C  CB    . PRO E 3 499 ? 130.705 -25.924 24.892  1.00 18.35 ? 795  PRO A CB    1 
ATOM   4803  C  CG    . PRO E 3 499 ? 129.568 -25.522 23.988  1.00 17.22 ? 795  PRO A CG    1 
ATOM   4804  C  CD    . PRO E 3 499 ? 128.436 -25.345 24.988  1.00 17.38 ? 795  PRO A CD    1 
ATOM   4805  N  N     . ILE E 3 500 ? 130.418 -26.079 28.087  1.00 17.34 ? 796  ILE A N     1 
ATOM   4806  C  CA    . ILE E 3 500 ? 131.034 -26.050 29.411  1.00 18.15 ? 796  ILE A CA    1 
ATOM   4807  C  C     . ILE E 3 500 ? 130.474 -27.136 30.334  1.00 17.68 ? 796  ILE A C     1 
ATOM   4808  O  O     . ILE E 3 500 ? 131.216 -27.973 30.850  1.00 18.63 ? 796  ILE A O     1 
ATOM   4809  C  CB    . ILE E 3 500 ? 130.838 -24.672 30.074  1.00 18.33 ? 796  ILE A CB    1 
ATOM   4810  C  CG1   . ILE E 3 500 ? 131.171 -23.564 29.072  1.00 19.80 ? 796  ILE A CG1   1 
ATOM   4811  C  CG2   . ILE E 3 500 ? 131.738 -24.550 31.293  1.00 19.70 ? 796  ILE A CG2   1 
ATOM   4812  C  CD1   . ILE E 3 500 ? 132.563 -23.678 28.469  1.00 23.23 ? 796  ILE A CD1   1 
ATOM   4813  N  N     . GLN E 3 501 ? 129.162 -27.121 30.537  1.00 17.97 ? 797  GLN A N     1 
ATOM   4814  C  CA    . GLN E 3 501 ? 128.520 -28.114 31.390  1.00 16.69 ? 797  GLN A CA    1 
ATOM   4815  C  C     . GLN E 3 501 ? 128.800 -29.499 30.818  1.00 17.32 ? 797  GLN A C     1 
ATOM   4816  O  O     . GLN E 3 501 ? 129.082 -30.446 31.553  1.00 18.80 ? 797  GLN A O     1 
ATOM   4817  C  CB    . GLN E 3 501 ? 127.007 -27.872 31.439  1.00 16.29 ? 797  GLN A CB    1 
ATOM   4818  C  CG    . GLN E 3 501 ? 126.284 -28.716 32.484  1.00 16.09 ? 797  GLN A CG    1 
ATOM   4819  C  CD    . GLN E 3 501 ? 124.779 -28.620 32.372  1.00 15.53 ? 797  GLN A CD    1 
ATOM   4820  O  OE1   . GLN E 3 501 ? 124.123 -29.528 31.860  1.00 16.46 ? 797  GLN A OE1   1 
ATOM   4821  N  NE2   . GLN E 3 501 ? 124.220 -27.512 32.847  1.00 14.05 ? 797  GLN A NE2   1 
ATOM   4822  N  N     . GLY E 3 502 ? 128.735 -29.602 29.495  1.00 17.12 ? 798  GLY A N     1 
ATOM   4823  C  CA    . GLY E 3 502 ? 128.977 -30.871 28.835  1.00 17.11 ? 798  GLY A CA    1 
ATOM   4824  C  C     . GLY E 3 502 ? 130.389 -31.389 29.016  1.00 17.63 ? 798  GLY A C     1 
ATOM   4825  O  O     . GLY E 3 502 ? 130.588 -32.586 29.213  1.00 18.02 ? 798  GLY A O     1 
ATOM   4826  N  N     . SER E 3 503 ? 131.378 -30.501 28.945  1.00 18.47 ? 799  SER A N     1 
ATOM   4827  C  CA    . SER E 3 503 ? 132.764 -30.927 29.123  1.00 18.33 ? 799  SER A CA    1 
ATOM   4828  C  C     . SER E 3 503 ? 132.979 -31.336 30.580  1.00 16.20 ? 799  SER A C     1 
ATOM   4829  O  O     . SER E 3 503 ? 133.735 -32.262 30.871  1.00 17.23 ? 799  SER A O     1 
ATOM   4830  C  CB    . SER E 3 503 ? 133.727 -29.800 28.729  1.00 19.76 ? 799  SER A CB    1 
ATOM   4831  O  OG    . SER E 3 503 ? 133.666 -29.558 27.330  1.00 21.70 ? 799  SER A OG    1 
ATOM   4832  N  N     . ALA E 3 504 ? 132.303 -30.647 31.494  1.00 16.98 ? 800  ALA A N     1 
ATOM   4833  C  CA    . ALA E 3 504 ? 132.408 -30.966 32.915  1.00 16.26 ? 800  ALA A CA    1 
ATOM   4834  C  C     . ALA E 3 504 ? 131.852 -32.369 33.146  1.00 16.13 ? 800  ALA A C     1 
ATOM   4835  O  O     . ALA E 3 504 ? 132.337 -33.106 34.003  1.00 17.00 ? 800  ALA A O     1 
ATOM   4836  C  CB    . ALA E 3 504 ? 131.627 -29.948 33.743  1.00 17.30 ? 800  ALA A CB    1 
ATOM   4837  N  N     . ALA E 3 505 ? 130.832 -32.734 32.373  1.00 16.25 ? 801  ALA A N     1 
ATOM   4838  C  CA    . ALA E 3 505 ? 130.221 -34.056 32.492  1.00 16.91 ? 801  ALA A CA    1 
ATOM   4839  C  C     . ALA E 3 505 ? 131.187 -35.109 31.945  1.00 17.49 ? 801  ALA A C     1 
ATOM   4840  O  O     . ALA E 3 505 ? 131.333 -36.191 32.518  1.00 17.87 ? 801  ALA A O     1 
ATOM   4841  C  CB    . ALA E 3 505 ? 128.896 -34.099 31.726  1.00 16.70 ? 801  ALA A CB    1 
ATOM   4842  N  N     . ASP E 3 506 ? 131.847 -34.782 30.836  1.00 17.71 ? 802  ASP A N     1 
ATOM   4843  C  CA    . ASP E 3 506 ? 132.815 -35.690 30.218  1.00 19.19 ? 802  ASP A CA    1 
ATOM   4844  C  C     . ASP E 3 506 ? 133.909 -36.031 31.223  1.00 18.74 ? 802  ASP A C     1 
ATOM   4845  O  O     . ASP E 3 506 ? 134.292 -37.190 31.386  1.00 20.23 ? 802  ASP A O     1 
ATOM   4846  C  CB    . ASP E 3 506 ? 133.468 -35.035 28.999  1.00 19.06 ? 802  ASP A CB    1 
ATOM   4847  C  CG    . ASP E 3 506 ? 132.521 -34.893 27.821  1.00 22.29 ? 802  ASP A CG    1 
ATOM   4848  O  OD1   . ASP E 3 506 ? 132.877 -34.153 26.880  1.00 21.55 ? 802  ASP A OD1   1 
ATOM   4849  O  OD2   . ASP E 3 506 ? 131.438 -35.520 27.824  1.00 20.99 ? 802  ASP A OD2   1 
ATOM   4850  N  N     . ILE E 3 507 ? 134.403 -34.998 31.891  1.00 19.14 ? 803  ILE A N     1 
ATOM   4851  C  CA    . ILE E 3 507 ? 135.470 -35.138 32.865  1.00 19.99 ? 803  ILE A CA    1 
ATOM   4852  C  C     . ILE E 3 507 ? 135.115 -36.052 34.029  1.00 20.00 ? 803  ILE A C     1 
ATOM   4853  O  O     . ILE E 3 507 ? 135.833 -37.017 34.297  1.00 20.85 ? 803  ILE A O     1 
ATOM   4854  C  CB    . ILE E 3 507 ? 135.893 -33.749 33.401  1.00 20.42 ? 803  ILE A CB    1 
ATOM   4855  C  CG1   . ILE E 3 507 ? 136.401 -32.890 32.239  1.00 19.51 ? 803  ILE A CG1   1 
ATOM   4856  C  CG2   . ILE E 3 507 ? 136.985 -33.896 34.457  1.00 20.11 ? 803  ILE A CG2   1 
ATOM   4857  C  CD1   . ILE E 3 507 ? 136.761 -31.473 32.629  1.00 19.08 ? 803  ILE A CD1   1 
ATOM   4858  N  N     . ILE E 3 508 ? 134.010 -35.774 34.716  1.00 19.09 ? 804  ILE A N     1 
ATOM   4859  C  CA    . ILE E 3 508 ? 133.654 -36.622 35.846  1.00 19.44 ? 804  ILE A CA    1 
ATOM   4860  C  C     . ILE E 3 508 ? 133.384 -38.056 35.408  1.00 17.75 ? 804  ILE A C     1 
ATOM   4861  O  O     . ILE E 3 508 ? 133.686 -38.997 36.138  1.00 18.50 ? 804  ILE A O     1 
ATOM   4862  C  CB    . ILE E 3 508 ? 132.444 -36.077 36.634  1.00 18.69 ? 804  ILE A CB    1 
ATOM   4863  C  CG1   . ILE E 3 508 ? 132.307 -36.866 37.942  1.00 20.22 ? 804  ILE A CG1   1 
ATOM   4864  C  CG2   . ILE E 3 508 ? 131.173 -36.182 35.805  1.00 19.11 ? 804  ILE A CG2   1 
ATOM   4865  C  CD1   . ILE E 3 508 ? 131.357 -36.243 38.952  1.00 21.08 ? 804  ILE A CD1   1 
ATOM   4866  N  N     . LYS E 3 509 ? 132.834 -38.233 34.212  1.00 18.74 ? 805  LYS A N     1 
ATOM   4867  C  CA    . LYS E 3 509 ? 132.571 -39.580 33.717  1.00 19.65 ? 805  LYS A CA    1 
ATOM   4868  C  C     . LYS E 3 509 ? 133.883 -40.348 33.548  1.00 20.86 ? 805  LYS A C     1 
ATOM   4869  O  O     . LYS E 3 509 ? 133.970 -41.530 33.888  1.00 19.70 ? 805  LYS A O     1 
ATOM   4870  C  CB    . LYS E 3 509 ? 131.821 -39.531 32.383  1.00 20.10 ? 805  LYS A CB    1 
ATOM   4871  C  CG    . LYS E 3 509 ? 130.342 -39.186 32.518  1.00 19.90 ? 805  LYS A CG    1 
ATOM   4872  C  CD    . LYS E 3 509 ? 129.636 -39.256 31.169  1.00 19.14 ? 805  LYS A CD    1 
ATOM   4873  C  CE    . LYS E 3 509 ? 128.129 -39.076 31.321  1.00 19.17 ? 805  LYS A CE    1 
ATOM   4874  N  NZ    . LYS E 3 509 ? 127.431 -39.113 30.000  1.00 19.88 ? 805  LYS A NZ    1 
ATOM   4875  N  N     . LYS E 3 510 ? 134.901 -39.675 33.023  1.00 21.50 ? 806  LYS A N     1 
ATOM   4876  C  CA    . LYS E 3 510 ? 136.200 -40.311 32.831  1.00 23.64 ? 806  LYS A CA    1 
ATOM   4877  C  C     . LYS E 3 510 ? 136.823 -40.593 34.195  1.00 22.90 ? 806  LYS A C     1 
ATOM   4878  O  O     . LYS E 3 510 ? 137.502 -41.602 34.387  1.00 23.82 ? 806  LYS A O     1 
ATOM   4879  C  CB    . LYS E 3 510 ? 137.130 -39.408 32.016  1.00 23.11 ? 806  LYS A CB    1 
ATOM   4880  C  CG    . LYS E 3 510 ? 138.482 -40.049 31.729  1.00 27.78 ? 806  LYS A CG    1 
ATOM   4881  C  CD    . LYS E 3 510 ? 139.321 -39.213 30.779  1.00 30.16 ? 806  LYS A CD    1 
ATOM   4882  C  CE    . LYS E 3 510 ? 140.606 -39.948 30.412  1.00 33.24 ? 806  LYS A CE    1 
ATOM   4883  N  NZ    . LYS E 3 510 ? 141.419 -40.283 31.620  1.00 33.55 ? 806  LYS A NZ    1 
ATOM   4884  N  N     . ALA E 3 511 ? 136.582 -39.691 35.140  1.00 22.19 ? 807  ALA A N     1 
ATOM   4885  C  CA    . ALA E 3 511 ? 137.102 -39.840 36.490  1.00 21.62 ? 807  ALA A CA    1 
ATOM   4886  C  C     . ALA E 3 511 ? 136.555 -41.114 37.129  1.00 22.58 ? 807  ALA A C     1 
ATOM   4887  O  O     . ALA E 3 511 ? 137.291 -41.864 37.773  1.00 23.10 ? 807  ALA A O     1 
ATOM   4888  C  CB    . ALA E 3 511 ? 136.724 -38.629 37.326  1.00 21.47 ? 807  ALA A CB    1 
ATOM   4889  N  N     . MET E 3 512 ? 135.262 -41.358 36.940  1.00 21.22 ? 808  MET A N     1 
ATOM   4890  C  CA    . MET E 3 512 ? 134.616 -42.538 37.493  1.00 22.33 ? 808  MET A CA    1 
ATOM   4891  C  C     . MET E 3 512 ? 135.243 -43.823 36.959  1.00 22.96 ? 808  MET A C     1 
ATOM   4892  O  O     . MET E 3 512 ? 135.434 -44.787 37.703  1.00 22.47 ? 808  MET A O     1 
ATOM   4893  C  CB    . MET E 3 512 ? 133.116 -42.513 37.172  1.00 21.25 ? 808  MET A CB    1 
ATOM   4894  C  CG    . MET E 3 512 ? 132.352 -41.417 37.906  1.00 20.64 ? 808  MET A CG    1 
ATOM   4895  S  SD    . MET E 3 512 ? 130.608 -41.325 37.422  1.00 19.03 ? 808  MET A SD    1 
ATOM   4896  C  CE    . MET E 3 512 ? 129.979 -42.795 38.198  1.00 18.80 ? 808  MET A CE    1 
ATOM   4897  N  N     . ILE E 3 513 ? 135.563 -43.835 35.669  1.00 23.55 ? 809  ILE A N     1 
ATOM   4898  C  CA    . ILE E 3 513 ? 136.177 -45.010 35.054  1.00 24.17 ? 809  ILE A CA    1 
ATOM   4899  C  C     . ILE E 3 513 ? 137.577 -45.237 35.624  1.00 25.13 ? 809  ILE A C     1 
ATOM   4900  O  O     . ILE E 3 513 ? 137.932 -46.357 35.991  1.00 24.62 ? 809  ILE A O     1 
ATOM   4901  C  CB    . ILE E 3 513 ? 136.283 -44.850 33.525  1.00 23.67 ? 809  ILE A CB    1 
ATOM   4902  C  CG1   . ILE E 3 513 ? 134.885 -44.693 32.923  1.00 24.02 ? 809  ILE A CG1   1 
ATOM   4903  C  CG2   . ILE E 3 513 ? 136.983 -46.062 32.922  1.00 24.41 ? 809  ILE A CG2   1 
ATOM   4904  C  CD1   . ILE E 3 513 ? 134.887 -44.264 31.478  1.00 24.63 ? 809  ILE A CD1   1 
ATOM   4905  N  N     . ASP E 3 514 ? 138.365 -44.170 35.705  1.00 26.02 ? 810  ASP A N     1 
ATOM   4906  C  CA    . ASP E 3 514 ? 139.717 -44.279 36.237  1.00 27.47 ? 810  ASP A CA    1 
ATOM   4907  C  C     . ASP E 3 514 ? 139.711 -44.695 37.706  1.00 28.62 ? 810  ASP A C     1 
ATOM   4908  O  O     . ASP E 3 514 ? 140.531 -45.511 38.127  1.00 27.91 ? 810  ASP A O     1 
ATOM   4909  C  CB    . ASP E 3 514 ? 140.468 -42.953 36.080  1.00 28.49 ? 810  ASP A CB    1 
ATOM   4910  C  CG    . ASP E 3 514 ? 140.624 -42.540 34.628  1.00 28.51 ? 810  ASP A CG    1 
ATOM   4911  O  OD1   . ASP E 3 514 ? 140.605 -43.432 33.757  1.00 29.77 ? 810  ASP A OD1   1 
ATOM   4912  O  OD2   . ASP E 3 514 ? 140.770 -41.328 34.358  1.00 29.35 ? 810  ASP A OD2   1 
ATOM   4913  N  N     . LEU E 3 515 ? 138.784 -44.137 38.481  1.00 28.55 ? 811  LEU A N     1 
ATOM   4914  C  CA    . LEU E 3 515 ? 138.690 -44.457 39.901  1.00 29.58 ? 811  LEU A CA    1 
ATOM   4915  C  C     . LEU E 3 515 ? 138.303 -45.912 40.118  1.00 30.86 ? 811  LEU A C     1 
ATOM   4916  O  O     . LEU E 3 515 ? 138.942 -46.623 40.893  1.00 31.21 ? 811  LEU A O     1 
ATOM   4917  C  CB    . LEU E 3 515 ? 137.669 -43.545 40.589  1.00 29.51 ? 811  LEU A CB    1 
ATOM   4918  C  CG    . LEU E 3 515 ? 137.414 -43.823 42.077  1.00 30.05 ? 811  LEU A CG    1 
ATOM   4919  C  CD1   . LEU E 3 515 ? 138.733 -43.800 42.853  1.00 28.64 ? 811  LEU A CD1   1 
ATOM   4920  C  CD2   . LEU E 3 515 ? 136.445 -42.783 42.625  1.00 29.41 ? 811  LEU A CD2   1 
ATOM   4921  N  N     . ASN E 3 516 ? 137.254 -46.352 39.431  1.00 31.34 ? 812  ASN A N     1 
ATOM   4922  C  CA    . ASN E 3 516 ? 136.787 -47.724 39.551  1.00 33.37 ? 812  ASN A CA    1 
ATOM   4923  C  C     . ASN E 3 516 ? 137.934 -48.691 39.259  1.00 35.14 ? 812  ASN A C     1 
ATOM   4924  O  O     . ASN E 3 516 ? 138.077 -49.721 39.923  1.00 35.15 ? 812  ASN A O     1 
ATOM   4925  C  CB    . ASN E 3 516 ? 135.622 -47.964 38.584  1.00 34.06 ? 812  ASN A CB    1 
ATOM   4926  C  CG    . ASN E 3 516 ? 134.991 -49.331 38.753  1.00 35.46 ? 812  ASN A CG    1 
ATOM   4927  O  OD1   . ASN E 3 516 ? 135.134 -50.204 37.897  1.00 37.81 ? 812  ASN A OD1   1 
ATOM   4928  N  ND2   . ASN E 3 516 ? 134.291 -49.526 39.864  1.00 36.54 ? 812  ASN A ND2   1 
ATOM   4929  N  N     . ALA E 3 517 ? 138.757 -48.345 38.274  1.00 35.79 ? 813  ALA A N     1 
ATOM   4930  C  CA    . ALA E 3 517 ? 139.895 -49.175 37.889  1.00 37.28 ? 813  ALA A CA    1 
ATOM   4931  C  C     . ALA E 3 517 ? 140.986 -49.161 38.959  1.00 37.71 ? 813  ALA A C     1 
ATOM   4932  O  O     . ALA E 3 517 ? 141.599 -50.187 39.242  1.00 36.47 ? 813  ALA A O     1 
ATOM   4933  C  CB    . ALA E 3 517 ? 140.461 -48.695 36.559  1.00 37.47 ? 813  ALA A CB    1 
ATOM   4934  N  N     . ARG E 3 518 ? 141.228 -47.995 39.549  1.00 39.18 ? 814  ARG A N     1 
ATOM   4935  C  CA    . ARG E 3 518 ? 142.243 -47.875 40.589  1.00 41.58 ? 814  ARG A CA    1 
ATOM   4936  C  C     . ARG E 3 518 ? 141.818 -48.631 41.846  1.00 42.31 ? 814  ARG A C     1 
ATOM   4937  O  O     . ARG E 3 518 ? 142.637 -49.286 42.491  1.00 42.19 ? 814  ARG A O     1 
ATOM   4938  C  CB    . ARG E 3 518 ? 142.493 -46.402 40.925  1.00 43.06 ? 814  ARG A CB    1 
ATOM   4939  C  CG    . ARG E 3 518 ? 143.090 -45.601 39.775  1.00 45.93 ? 814  ARG A CG    1 
ATOM   4940  C  CD    . ARG E 3 518 ? 144.466 -46.132 39.388  1.00 48.42 ? 814  ARG A CD    1 
ATOM   4941  N  NE    . ARG E 3 518 ? 145.464 -45.878 40.424  1.00 49.54 ? 814  ARG A NE    1 
ATOM   4942  C  CZ    . ARG E 3 518 ? 145.996 -44.685 40.672  1.00 50.45 ? 814  ARG A CZ    1 
ATOM   4943  N  NH1   . ARG E 3 518 ? 145.629 -43.631 39.954  1.00 50.26 ? 814  ARG A NH1   1 
ATOM   4944  N  NH2   . ARG E 3 518 ? 146.892 -44.546 41.641  1.00 50.66 ? 814  ARG A NH2   1 
ATOM   4945  N  N     . LEU E 3 519 ? 140.535 -48.545 42.184  1.00 42.86 ? 815  LEU A N     1 
ATOM   4946  C  CA    . LEU E 3 519 ? 140.009 -49.226 43.363  1.00 44.65 ? 815  LEU A CA    1 
ATOM   4947  C  C     . LEU E 3 519 ? 140.161 -50.742 43.256  1.00 46.47 ? 815  LEU A C     1 
ATOM   4948  O  O     . LEU E 3 519 ? 140.657 -51.392 44.177  1.00 46.74 ? 815  LEU A O     1 
ATOM   4949  C  CB    . LEU E 3 519 ? 138.531 -48.876 43.567  1.00 43.19 ? 815  LEU A CB    1 
ATOM   4950  C  CG    . LEU E 3 519 ? 138.177 -47.416 43.865  1.00 42.95 ? 815  LEU A CG    1 
ATOM   4951  C  CD1   . LEU E 3 519 ? 136.662 -47.265 43.939  1.00 42.67 ? 815  LEU A CD1   1 
ATOM   4952  C  CD2   . LEU E 3 519 ? 138.823 -46.980 45.169  1.00 41.93 ? 815  LEU A CD2   1 
ATOM   4953  N  N     . LYS E 3 520 ? 139.735 -51.301 42.128  1.00 48.87 ? 816  LYS A N     1 
ATOM   4954  C  CA    . LYS E 3 520 ? 139.818 -52.742 41.908  1.00 51.53 ? 816  LYS A CA    1 
ATOM   4955  C  C     . LYS E 3 520 ? 141.258 -53.248 41.945  1.00 52.36 ? 816  LYS A C     1 
ATOM   4956  O  O     . LYS E 3 520 ? 141.549 -54.268 42.572  1.00 51.96 ? 816  LYS A O     1 
ATOM   4957  C  CB    . LYS E 3 520 ? 139.183 -53.108 40.563  1.00 52.96 ? 816  LYS A CB    1 
ATOM   4958  C  CG    . LYS E 3 520 ? 139.171 -54.602 40.275  1.00 55.41 ? 816  LYS A CG    1 
ATOM   4959  C  CD    . LYS E 3 520 ? 138.532 -54.909 38.929  1.00 57.18 ? 816  LYS A CD    1 
ATOM   4960  C  CE    . LYS E 3 520 ? 138.495 -56.408 38.666  1.00 57.98 ? 816  LYS A CE    1 
ATOM   4961  N  NZ    . LYS E 3 520 ? 137.727 -57.134 39.719  1.00 58.24 ? 816  LYS A NZ    1 
ATOM   4962  N  N     . GLU E 3 521 ? 142.153 -52.533 41.270  1.00 53.31 ? 817  GLU A N     1 
ATOM   4963  C  CA    . GLU E 3 521 ? 143.560 -52.915 41.225  1.00 54.70 ? 817  GLU A CA    1 
ATOM   4964  C  C     . GLU E 3 521 ? 144.157 -53.022 42.623  1.00 54.16 ? 817  GLU A C     1 
ATOM   4965  O  O     . GLU E 3 521 ? 144.889 -53.967 42.922  1.00 54.68 ? 817  GLU A O     1 
ATOM   4966  C  CB    . GLU E 3 521 ? 144.355 -51.900 40.399  1.00 56.21 ? 817  GLU A CB    1 
ATOM   4967  C  CG    . GLU E 3 521 ? 143.970 -51.874 38.930  1.00 59.51 ? 817  GLU A CG    1 
ATOM   4968  C  CD    . GLU E 3 521 ? 144.631 -50.740 38.171  1.00 61.37 ? 817  GLU A CD    1 
ATOM   4969  O  OE1   . GLU E 3 521 ? 144.411 -49.567 38.540  1.00 63.05 ? 817  GLU A OE1   1 
ATOM   4970  O  OE2   . GLU E 3 521 ? 145.369 -51.021 37.203  1.00 62.82 ? 817  GLU A OE2   1 
ATOM   4971  N  N     . GLU E 3 522 ? 143.836 -52.056 43.478  1.00 52.80 ? 818  GLU A N     1 
ATOM   4972  C  CA    . GLU E 3 522 ? 144.352 -52.051 44.840  1.00 51.72 ? 818  GLU A CA    1 
ATOM   4973  C  C     . GLU E 3 522 ? 143.494 -52.902 45.771  1.00 51.05 ? 818  GLU A C     1 
ATOM   4974  O  O     . GLU E 3 522 ? 143.631 -52.836 46.992  1.00 51.00 ? 818  GLU A O     1 
ATOM   4975  C  CB    . GLU E 3 522 ? 144.433 -50.619 45.366  1.00 51.45 ? 818  GLU A CB    1 
ATOM   4976  C  CG    . GLU E 3 522 ? 145.063 -49.647 44.386  1.00 51.54 ? 818  GLU A CG    1 
ATOM   4977  C  CD    . GLU E 3 522 ? 145.398 -48.320 45.024  1.00 51.88 ? 818  GLU A CD    1 
ATOM   4978  O  OE1   . GLU E 3 522 ? 144.728 -47.954 46.011  1.00 52.88 ? 818  GLU A OE1   1 
ATOM   4979  O  OE2   . GLU E 3 522 ? 146.327 -47.640 44.537  1.00 52.07 ? 818  GLU A OE2   1 
ATOM   4980  N  N     . ARG E 3 523 ? 142.609 -53.700 45.181  1.00 50.87 ? 819  ARG A N     1 
ATOM   4981  C  CA    . ARG E 3 523 ? 141.731 -54.591 45.934  1.00 50.75 ? 819  ARG A CA    1 
ATOM   4982  C  C     . ARG E 3 523 ? 140.974 -53.932 47.086  1.00 49.54 ? 819  ARG A C     1 
ATOM   4983  O  O     . ARG E 3 523 ? 140.520 -54.618 48.005  1.00 49.19 ? 819  ARG A O     1 
ATOM   4984  C  CB    . ARG E 3 523 ? 142.538 -55.778 46.470  1.00 52.64 ? 819  ARG A CB    1 
ATOM   4985  C  CG    . ARG E 3 523 ? 142.950 -56.785 45.405  1.00 55.94 ? 819  ARG A CG    1 
ATOM   4986  C  CD    . ARG E 3 523 ? 141.750 -57.591 44.924  1.00 58.37 ? 819  ARG A CD    1 
ATOM   4987  N  NE    . ARG E 3 523 ? 142.098 -58.541 43.869  1.00 61.46 ? 819  ARG A NE    1 
ATOM   4988  C  CZ    . ARG E 3 523 ? 142.480 -58.196 42.642  1.00 62.57 ? 819  ARG A CZ    1 
ATOM   4989  N  NH1   . ARG E 3 523 ? 142.566 -56.917 42.305  1.00 63.85 ? 819  ARG A NH1   1 
ATOM   4990  N  NH2   . ARG E 3 523 ? 142.775 -59.131 41.749  1.00 63.14 ? 819  ARG A NH2   1 
ATOM   4991  N  N     . LEU E 3 524 ? 140.837 -52.610 47.042  1.00 46.82 ? 820  LEU A N     1 
ATOM   4992  C  CA    . LEU E 3 524 ? 140.118 -51.895 48.091  1.00 44.24 ? 820  LEU A CA    1 
ATOM   4993  C  C     . LEU E 3 524 ? 138.654 -52.323 48.099  1.00 42.51 ? 820  LEU A C     1 
ATOM   4994  O  O     . LEU E 3 524 ? 138.101 -52.688 47.061  1.00 41.45 ? 820  LEU A O     1 
ATOM   4995  C  CB    . LEU E 3 524 ? 140.203 -50.384 47.866  1.00 44.57 ? 820  LEU A CB    1 
ATOM   4996  C  CG    . LEU E 3 524 ? 141.568 -49.708 48.003  1.00 44.62 ? 820  LEU A CG    1 
ATOM   4997  C  CD1   . LEU E 3 524 ? 141.448 -48.244 47.611  1.00 45.06 ? 820  LEU A CD1   1 
ATOM   4998  C  CD2   . LEU E 3 524 ? 142.069 -49.838 49.432  1.00 44.84 ? 820  LEU A CD2   1 
ATOM   4999  N  N     . GLN E 3 525 ? 138.033 -52.282 49.274  1.00 40.68 ? 821  GLN A N     1 
ATOM   5000  C  CA    . GLN E 3 525 ? 136.628 -52.653 49.412  1.00 39.22 ? 821  GLN A CA    1 
ATOM   5001  C  C     . GLN E 3 525 ? 135.741 -51.458 49.092  1.00 37.66 ? 821  GLN A C     1 
ATOM   5002  O  O     . GLN E 3 525 ? 134.546 -51.609 48.840  1.00 37.25 ? 821  GLN A O     1 
ATOM   5003  C  CB    . GLN E 3 525 ? 136.335 -53.125 50.833  1.00 40.18 ? 821  GLN A CB    1 
ATOM   5004  C  CG    . GLN E 3 525 ? 136.911 -54.481 51.179  1.00 41.84 ? 821  GLN A CG    1 
ATOM   5005  C  CD    . GLN E 3 525 ? 136.534 -54.915 52.578  1.00 42.44 ? 821  GLN A CD    1 
ATOM   5006  O  OE1   . GLN E 3 525 ? 137.013 -54.357 53.564  1.00 43.17 ? 821  GLN A OE1   1 
ATOM   5007  N  NE2   . GLN E 3 525 ? 135.659 -55.910 52.672  1.00 43.50 ? 821  GLN A NE2   1 
ATOM   5008  N  N     . ALA E 3 526 ? 136.341 -50.271 49.111  1.00 35.65 ? 822  ALA A N     1 
ATOM   5009  C  CA    . ALA E 3 526 ? 135.631 -49.031 48.823  1.00 33.67 ? 822  ALA A CA    1 
ATOM   5010  C  C     . ALA E 3 526 ? 134.986 -49.099 47.446  1.00 32.97 ? 822  ALA A C     1 
ATOM   5011  O  O     . ALA E 3 526 ? 135.600 -49.566 46.486  1.00 32.51 ? 822  ALA A O     1 
ATOM   5012  C  CB    . ALA E 3 526 ? 136.597 -47.855 48.881  1.00 33.32 ? 822  ALA A CB    1 
ATOM   5013  N  N     . HIS E 3 527 ? 133.746 -48.634 47.345  1.00 31.80 ? 823  HIS A N     1 
ATOM   5014  C  CA    . HIS E 3 527 ? 133.060 -48.647 46.062  1.00 30.03 ? 823  HIS A CA    1 
ATOM   5015  C  C     . HIS E 3 527 ? 132.136 -47.447 45.908  1.00 27.83 ? 823  HIS A C     1 
ATOM   5016  O  O     . HIS E 3 527 ? 131.626 -46.905 46.890  1.00 25.61 ? 823  HIS A O     1 
ATOM   5017  C  CB    . HIS E 3 527 ? 132.277 -49.952 45.893  1.00 32.14 ? 823  HIS A CB    1 
ATOM   5018  C  CG    . HIS E 3 527 ? 131.140 -50.105 46.851  1.00 35.03 ? 823  HIS A CG    1 
ATOM   5019  N  ND1   . HIS E 3 527 ? 129.822 -49.980 46.467  1.00 36.74 ? 823  HIS A ND1   1 
ATOM   5020  C  CD2   . HIS E 3 527 ? 131.122 -50.365 48.179  1.00 36.63 ? 823  HIS A CD2   1 
ATOM   5021  C  CE1   . HIS E 3 527 ? 129.042 -50.157 47.518  1.00 37.47 ? 823  HIS A CE1   1 
ATOM   5022  N  NE2   . HIS E 3 527 ? 129.806 -50.392 48.569  1.00 36.15 ? 823  HIS A NE2   1 
ATOM   5023  N  N     . LEU E 3 528 ? 131.937 -47.033 44.663  1.00 25.64 ? 824  LEU A N     1 
ATOM   5024  C  CA    . LEU E 3 528 ? 131.080 -45.900 44.349  1.00 22.87 ? 824  LEU A CA    1 
ATOM   5025  C  C     . LEU E 3 528 ? 129.618 -46.186 44.675  1.00 21.08 ? 824  LEU A C     1 
ATOM   5026  O  O     . LEU E 3 528 ? 129.121 -47.292 44.450  1.00 20.28 ? 824  LEU A O     1 
ATOM   5027  C  CB    . LEU E 3 528 ? 131.212 -45.543 42.863  1.00 21.92 ? 824  LEU A CB    1 
ATOM   5028  C  CG    . LEU E 3 528 ? 132.479 -44.791 42.448  1.00 21.87 ? 824  LEU A CG    1 
ATOM   5029  C  CD1   . LEU E 3 528 ? 132.664 -44.845 40.939  1.00 21.67 ? 824  LEU A CD1   1 
ATOM   5030  C  CD2   . LEU E 3 528 ? 132.379 -43.361 42.922  1.00 20.90 ? 824  LEU A CD2   1 
ATOM   5031  N  N     . LEU E 3 529 ? 128.937 -45.177 45.208  1.00 20.46 ? 825  LEU A N     1 
ATOM   5032  C  CA    . LEU E 3 529 ? 127.521 -45.288 45.540  1.00 20.03 ? 825  LEU A CA    1 
ATOM   5033  C  C     . LEU E 3 529 ? 126.715 -44.320 44.675  1.00 18.42 ? 825  LEU A C     1 
ATOM   5034  O  O     . LEU E 3 529 ? 125.699 -44.693 44.090  1.00 18.70 ? 825  LEU A O     1 
ATOM   5035  C  CB    . LEU E 3 529 ? 127.278 -44.959 47.021  1.00 20.38 ? 825  LEU A CB    1 
ATOM   5036  C  CG    . LEU E 3 529 ? 127.723 -45.994 48.061  1.00 21.54 ? 825  LEU A CG    1 
ATOM   5037  C  CD1   . LEU E 3 529 ? 127.461 -45.465 49.464  1.00 21.78 ? 825  LEU A CD1   1 
ATOM   5038  C  CD2   . LEU E 3 529 ? 126.974 -47.300 47.834  1.00 22.08 ? 825  LEU A CD2   1 
ATOM   5039  N  N     . LEU E 3 530 ? 127.186 -43.081 44.584  1.00 17.08 ? 826  LEU A N     1 
ATOM   5040  C  CA    . LEU E 3 530 ? 126.481 -42.059 43.817  1.00 18.85 ? 826  LEU A CA    1 
ATOM   5041  C  C     . LEU E 3 530 ? 127.383 -41.071 43.098  1.00 18.88 ? 826  LEU A C     1 
ATOM   5042  O  O     . LEU E 3 530 ? 128.535 -40.871 43.471  1.00 19.51 ? 826  LEU A O     1 
ATOM   5043  C  CB    . LEU E 3 530 ? 125.560 -41.252 44.741  1.00 17.68 ? 826  LEU A CB    1 
ATOM   5044  C  CG    . LEU E 3 530 ? 124.525 -41.994 45.584  1.00 19.35 ? 826  LEU A CG    1 
ATOM   5045  C  CD1   . LEU E 3 530 ? 123.928 -41.032 46.607  1.00 19.49 ? 826  LEU A CD1   1 
ATOM   5046  C  CD2   . LEU E 3 530 ? 123.443 -42.579 44.680  1.00 19.01 ? 826  LEU A CD2   1 
ATOM   5047  N  N     . GLN E 3 531 ? 126.826 -40.453 42.061  1.00 18.25 ? 827  GLN A N     1 
ATOM   5048  C  CA    . GLN E 3 531 ? 127.506 -39.413 41.299  1.00 17.09 ? 827  GLN A CA    1 
ATOM   5049  C  C     . GLN E 3 531 ? 126.500 -38.273 41.339  1.00 16.47 ? 827  GLN A C     1 
ATOM   5050  O  O     . GLN E 3 531 ? 125.319 -38.483 41.067  1.00 15.48 ? 827  GLN A O     1 
ATOM   5051  C  CB    . GLN E 3 531 ? 127.754 -39.840 39.843  1.00 17.26 ? 827  GLN A CB    1 
ATOM   5052  C  CG    . GLN E 3 531 ? 128.425 -38.750 38.998  1.00 17.93 ? 827  GLN A CG    1 
ATOM   5053  C  CD    . GLN E 3 531 ? 127.436 -37.920 38.179  1.00 21.88 ? 827  GLN A CD    1 
ATOM   5054  O  OE1   . GLN E 3 531 ? 126.327 -37.622 38.626  1.00 22.66 ? 827  GLN A OE1   1 
ATOM   5055  N  NE2   . GLN E 3 531 ? 127.847 -37.536 36.975  1.00 19.88 ? 827  GLN A NE2   1 
ATOM   5056  N  N     . VAL E 3 532 ? 126.948 -37.076 41.697  1.00 15.69 ? 828  VAL A N     1 
ATOM   5057  C  CA    . VAL E 3 532 ? 126.041 -35.939 41.746  1.00 17.16 ? 828  VAL A CA    1 
ATOM   5058  C  C     . VAL E 3 532 ? 126.575 -34.793 40.881  1.00 16.46 ? 828  VAL A C     1 
ATOM   5059  O  O     . VAL E 3 532 ? 126.861 -33.701 41.370  1.00 17.29 ? 828  VAL A O     1 
ATOM   5060  C  CB    . VAL E 3 532 ? 125.816 -35.454 43.210  1.00 17.63 ? 828  VAL A CB    1 
ATOM   5061  C  CG1   . VAL E 3 532 ? 124.692 -34.430 43.258  1.00 16.81 ? 828  VAL A CG1   1 
ATOM   5062  C  CG2   . VAL E 3 532 ? 125.478 -36.638 44.102  1.00 18.34 ? 828  VAL A CG2   1 
ATOM   5063  N  N     . HIS E 3 533 ? 126.713 -35.081 39.588  1.00 15.92 ? 829  HIS A N     1 
ATOM   5064  C  CA    . HIS E 3 533 ? 127.168 -34.135 38.569  1.00 15.98 ? 829  HIS A CA    1 
ATOM   5065  C  C     . HIS E 3 533 ? 128.649 -33.767 38.601  1.00 18.41 ? 829  HIS A C     1 
ATOM   5066  O  O     . HIS E 3 533 ? 129.333 -33.887 37.586  1.00 17.32 ? 829  HIS A O     1 
ATOM   5067  C  CB    . HIS E 3 533 ? 126.295 -32.880 38.607  1.00 15.76 ? 829  HIS A CB    1 
ATOM   5068  C  CG    . HIS E 3 533 ? 124.828 -33.183 38.587  1.00 17.25 ? 829  HIS A CG    1 
ATOM   5069  N  ND1   . HIS E 3 533 ? 124.250 -33.985 37.626  1.00 16.33 ? 829  HIS A ND1   1 
ATOM   5070  C  CD2   . HIS E 3 533 ? 123.834 -32.845 39.442  1.00 16.63 ? 829  HIS A CD2   1 
ATOM   5071  C  CE1   . HIS E 3 533 ? 122.964 -34.131 37.893  1.00 18.17 ? 829  HIS A CE1   1 
ATOM   5072  N  NE2   . HIS E 3 533 ? 122.686 -33.450 38.990  1.00 17.78 ? 829  HIS A NE2   1 
ATOM   5073  N  N     . ASP E 3 534 ? 129.151 -33.317 39.746  1.00 19.13 ? 830  ASP A N     1 
ATOM   5074  C  CA    . ASP E 3 534 ? 130.566 -32.974 39.844  1.00 20.16 ? 830  ASP A CA    1 
ATOM   5075  C  C     . ASP E 3 534 ? 131.139 -33.471 41.168  1.00 21.74 ? 830  ASP A C     1 
ATOM   5076  O  O     . ASP E 3 534 ? 132.167 -32.990 41.638  1.00 21.48 ? 830  ASP A O     1 
ATOM   5077  C  CB    . ASP E 3 534 ? 130.769 -31.461 39.693  1.00 19.26 ? 830  ASP A CB    1 
ATOM   5078  C  CG    . ASP E 3 534 ? 130.547 -30.700 40.985  1.00 20.77 ? 830  ASP A CG    1 
ATOM   5079  O  OD1   . ASP E 3 534 ? 129.575 -31.008 41.709  1.00 20.03 ? 830  ASP A OD1   1 
ATOM   5080  O  OD2   . ASP E 3 534 ? 131.352 -29.784 41.269  1.00 20.46 ? 830  ASP A OD2   1 
ATOM   5081  N  N     . GLU E 3 535 ? 130.462 -34.449 41.759  1.00 23.62 ? 831  GLU A N     1 
ATOM   5082  C  CA    . GLU E 3 535 ? 130.905 -35.027 43.016  1.00 25.60 ? 831  GLU A CA    1 
ATOM   5083  C  C     . GLU E 3 535 ? 130.668 -36.534 43.013  1.00 25.10 ? 831  GLU A C     1 
ATOM   5084  O  O     . GLU E 3 535 ? 129.689 -37.019 42.444  1.00 24.75 ? 831  GLU A O     1 
ATOM   5085  C  CB    . GLU E 3 535 ? 130.176 -34.368 44.198  1.00 28.51 ? 831  GLU A CB    1 
ATOM   5086  C  CG    . GLU E 3 535 ? 128.675 -34.597 44.240  1.00 32.56 ? 831  GLU A CG    1 
ATOM   5087  C  CD    . GLU E 3 535 ? 127.995 -33.930 45.440  1.00 34.50 ? 831  GLU A CD    1 
ATOM   5088  O  OE1   . GLU E 3 535 ? 127.899 -32.683 45.472  1.00 35.09 ? 831  GLU A OE1   1 
ATOM   5089  O  OE2   . GLU E 3 535 ? 127.554 -34.659 46.354  1.00 33.81 ? 831  GLU A OE2   1 
ATOM   5090  N  N     . LEU E 3 536 ? 131.579 -37.269 43.640  1.00 23.83 ? 832  LEU A N     1 
ATOM   5091  C  CA    . LEU E 3 536 ? 131.471 -38.718 43.729  1.00 23.52 ? 832  LEU A CA    1 
ATOM   5092  C  C     . LEU E 3 536 ? 131.340 -39.093 45.195  1.00 23.02 ? 832  LEU A C     1 
ATOM   5093  O  O     . LEU E 3 536 ? 132.013 -38.522 46.052  1.00 23.76 ? 832  LEU A O     1 
ATOM   5094  C  CB    . LEU E 3 536 ? 132.706 -39.394 43.124  1.00 23.09 ? 832  LEU A CB    1 
ATOM   5095  C  CG    . LEU E 3 536 ? 132.924 -39.172 41.623  1.00 22.70 ? 832  LEU A CG    1 
ATOM   5096  C  CD1   . LEU E 3 536 ? 134.202 -39.879 41.180  1.00 21.31 ? 832  LEU A CD1   1 
ATOM   5097  C  CD2   . LEU E 3 536 ? 131.722 -39.698 40.846  1.00 21.76 ? 832  LEU A CD2   1 
ATOM   5098  N  N     . ILE E 3 537 ? 130.467 -40.052 45.476  1.00 22.21 ? 833  ILE A N     1 
ATOM   5099  C  CA    . ILE E 3 537 ? 130.229 -40.495 46.841  1.00 20.80 ? 833  ILE A CA    1 
ATOM   5100  C  C     . ILE E 3 537 ? 130.490 -41.987 46.956  1.00 21.06 ? 833  ILE A C     1 
ATOM   5101  O  O     . ILE E 3 537 ? 129.964 -42.788 46.181  1.00 20.89 ? 833  ILE A O     1 
ATOM   5102  C  CB    . ILE E 3 537 ? 128.778 -40.198 47.260  1.00 22.39 ? 833  ILE A CB    1 
ATOM   5103  C  CG1   . ILE E 3 537 ? 128.494 -38.711 47.058  1.00 22.80 ? 833  ILE A CG1   1 
ATOM   5104  C  CG2   . ILE E 3 537 ? 128.549 -40.603 48.717  1.00 20.21 ? 833  ILE A CG2   1 
ATOM   5105  C  CD1   . ILE E 3 537 ? 127.072 -38.333 47.296  1.00 27.92 ? 833  ILE A CD1   1 
ATOM   5106  N  N     . LEU E 3 538 ? 131.310 -42.359 47.930  1.00 21.45 ? 834  LEU A N     1 
ATOM   5107  C  CA    . LEU E 3 538 ? 131.637 -43.760 48.131  1.00 21.21 ? 834  LEU A CA    1 
ATOM   5108  C  C     . LEU E 3 538 ? 131.443 -44.157 49.582  1.00 21.35 ? 834  LEU A C     1 
ATOM   5109  O  O     . LEU E 3 538 ? 131.258 -43.308 50.455  1.00 19.92 ? 834  LEU A O     1 
ATOM   5110  C  CB    . LEU E 3 538 ? 133.094 -44.033 47.746  1.00 22.38 ? 834  LEU A CB    1 
ATOM   5111  C  CG    . LEU E 3 538 ? 133.631 -43.600 46.381  1.00 22.85 ? 834  LEU A CG    1 
ATOM   5112  C  CD1   . LEU E 3 538 ? 133.957 -42.109 46.389  1.00 21.20 ? 834  LEU A CD1   1 
ATOM   5113  C  CD2   . LEU E 3 538 ? 134.887 -44.399 46.077  1.00 22.94 ? 834  LEU A CD2   1 
ATOM   5114  N  N     . GLU E 3 539 ? 131.481 -45.460 49.828  1.00 22.06 ? 835  GLU A N     1 
ATOM   5115  C  CA    . GLU E 3 539 ? 131.377 -45.979 51.179  1.00 23.57 ? 835  GLU A CA    1 
ATOM   5116  C  C     . GLU E 3 539 ? 132.532 -46.961 51.274  1.00 26.13 ? 835  GLU A C     1 
ATOM   5117  O  O     . GLU E 3 539 ? 132.882 -47.615 50.285  1.00 25.39 ? 835  GLU A O     1 
ATOM   5118  C  CB    . GLU E 3 539 ? 130.039 -46.683 51.415  1.00 22.35 ? 835  GLU A CB    1 
ATOM   5119  C  CG    . GLU E 3 539 ? 129.867 -48.038 50.759  1.00 24.08 ? 835  GLU A CG    1 
ATOM   5120  C  CD    . GLU E 3 539 ? 128.548 -48.678 51.147  1.00 24.74 ? 835  GLU A CD    1 
ATOM   5121  O  OE1   . GLU E 3 539 ? 127.950 -48.222 52.145  1.00 24.89 ? 835  GLU A OE1   1 
ATOM   5122  O  OE2   . GLU E 3 539 ? 128.109 -49.632 50.470  1.00 24.34 ? 835  GLU A OE2   1 
ATOM   5123  N  N     . ALA E 3 540 ? 133.133 -47.062 52.451  1.00 26.71 ? 836  ALA A N     1 
ATOM   5124  C  CA    . ALA E 3 540 ? 134.259 -47.962 52.623  1.00 28.89 ? 836  ALA A CA    1 
ATOM   5125  C  C     . ALA E 3 540 ? 134.596 -48.150 54.088  1.00 30.51 ? 836  ALA A C     1 
ATOM   5126  O  O     . ALA E 3 540 ? 134.298 -47.291 54.922  1.00 30.31 ? 836  ALA A O     1 
ATOM   5127  C  CB    . ALA E 3 540 ? 135.473 -47.411 51.889  1.00 27.04 ? 836  ALA A CB    1 
ATOM   5128  N  N     . PRO E 3 541 ? 135.224 -49.285 54.422  1.00 33.19 ? 837  PRO A N     1 
ATOM   5129  C  CA    . PRO E 3 541 ? 135.596 -49.544 55.813  1.00 35.11 ? 837  PRO A CA    1 
ATOM   5130  C  C     . PRO E 3 541 ? 136.518 -48.433 56.311  1.00 36.98 ? 837  PRO A C     1 
ATOM   5131  O  O     . PRO E 3 541 ? 137.360 -47.935 55.563  1.00 37.27 ? 837  PRO A O     1 
ATOM   5132  C  CB    . PRO E 3 541 ? 136.260 -50.922 55.748  1.00 35.38 ? 837  PRO A CB    1 
ATOM   5133  C  CG    . PRO E 3 541 ? 136.762 -51.006 54.327  1.00 35.24 ? 837  PRO A CG    1 
ATOM   5134  C  CD    . PRO E 3 541 ? 135.622 -50.405 53.552  1.00 33.06 ? 837  PRO A CD    1 
ATOM   5135  N  N     . LYS E 3 542 ? 136.344 -48.044 57.569  1.00 39.54 ? 838  LYS A N     1 
ATOM   5136  C  CA    . LYS E 3 542 ? 137.139 -46.981 58.179  1.00 42.25 ? 838  LYS A CA    1 
ATOM   5137  C  C     . LYS E 3 542 ? 138.634 -47.050 57.864  1.00 42.83 ? 838  LYS A C     1 
ATOM   5138  O  O     . LYS E 3 542 ? 139.280 -46.021 57.647  1.00 41.98 ? 838  LYS A O     1 
ATOM   5139  C  CB    . LYS E 3 542 ? 136.946 -46.999 59.699  1.00 44.36 ? 838  LYS A CB    1 
ATOM   5140  C  CG    . LYS E 3 542 ? 137.841 -46.021 60.450  1.00 47.85 ? 838  LYS A CG    1 
ATOM   5141  C  CD    . LYS E 3 542 ? 137.676 -46.151 61.960  1.00 50.56 ? 838  LYS A CD    1 
ATOM   5142  C  CE    . LYS E 3 542 ? 136.277 -45.752 62.407  1.00 51.66 ? 838  LYS A CE    1 
ATOM   5143  N  NZ    . LYS E 3 542 ? 135.974 -44.329 62.085  1.00 52.70 ? 838  LYS A NZ    1 
ATOM   5144  N  N     . GLU E 3 543 ? 139.174 -48.264 57.838  1.00 43.50 ? 839  GLU A N     1 
ATOM   5145  C  CA    . GLU E 3 543 ? 140.595 -48.478 57.580  1.00 44.37 ? 839  GLU A CA    1 
ATOM   5146  C  C     . GLU E 3 543 ? 141.064 -48.010 56.204  1.00 44.27 ? 839  GLU A C     1 
ATOM   5147  O  O     . GLU E 3 543 ? 142.263 -47.837 55.984  1.00 43.46 ? 839  GLU A O     1 
ATOM   5148  C  CB    . GLU E 3 543 ? 140.940 -49.960 57.750  1.00 45.64 ? 839  GLU A CB    1 
ATOM   5149  C  CG    . GLU E 3 543 ? 140.440 -50.569 59.051  1.00 48.83 ? 839  GLU A CG    1 
ATOM   5150  C  CD    . GLU E 3 543 ? 138.926 -50.721 59.079  1.00 50.69 ? 839  GLU A CD    1 
ATOM   5151  O  OE1   . GLU E 3 543 ? 138.392 -51.530 58.290  1.00 50.96 ? 839  GLU A OE1   1 
ATOM   5152  O  OE2   . GLU E 3 543 ? 138.272 -50.029 59.887  1.00 52.34 ? 839  GLU A OE2   1 
ATOM   5153  N  N     . GLU E 3 544 ? 140.128 -47.802 55.282  1.00 43.41 ? 840  GLU A N     1 
ATOM   5154  C  CA    . GLU E 3 544 ? 140.490 -47.370 53.935  1.00 42.85 ? 840  GLU A CA    1 
ATOM   5155  C  C     . GLU E 3 544 ? 140.409 -45.862 53.721  1.00 42.57 ? 840  GLU A C     1 
ATOM   5156  O  O     . GLU E 3 544 ? 140.775 -45.364 52.659  1.00 41.74 ? 840  GLU A O     1 
ATOM   5157  C  CB    . GLU E 3 544 ? 139.617 -48.083 52.899  1.00 42.52 ? 840  GLU A CB    1 
ATOM   5158  C  CG    . GLU E 3 544 ? 139.821 -49.590 52.862  1.00 43.97 ? 840  GLU A CG    1 
ATOM   5159  C  CD    . GLU E 3 544 ? 139.084 -50.257 51.719  1.00 44.02 ? 840  GLU A CD    1 
ATOM   5160  O  OE1   . GLU E 3 544 ? 139.209 -51.491 51.571  1.00 44.05 ? 840  GLU A OE1   1 
ATOM   5161  O  OE2   . GLU E 3 544 ? 138.382 -49.549 50.967  1.00 44.47 ? 840  GLU A OE2   1 
ATOM   5162  N  N     . MET E 3 545 ? 139.942 -45.136 54.730  1.00 43.14 ? 841  MET A N     1 
ATOM   5163  C  CA    . MET E 3 545 ? 139.823 -43.687 54.625  1.00 43.61 ? 841  MET A CA    1 
ATOM   5164  C  C     . MET E 3 545 ? 141.148 -43.001 54.297  1.00 44.67 ? 841  MET A C     1 
ATOM   5165  O  O     . MET E 3 545 ? 141.182 -42.042 53.527  1.00 43.95 ? 841  MET A O     1 
ATOM   5166  C  CB    . MET E 3 545 ? 139.249 -43.109 55.921  1.00 42.91 ? 841  MET A CB    1 
ATOM   5167  C  CG    . MET E 3 545 ? 137.791 -43.466 56.164  1.00 41.67 ? 841  MET A CG    1 
ATOM   5168  S  SD    . MET E 3 545 ? 136.704 -42.882 54.835  1.00 41.04 ? 841  MET A SD    1 
ATOM   5169  C  CE    . MET E 3 545 ? 136.470 -44.389 53.906  1.00 38.38 ? 841  MET A CE    1 
ATOM   5170  N  N     . GLU E 3 546 ? 142.237 -43.494 54.879  1.00 46.46 ? 842  GLU A N     1 
ATOM   5171  C  CA    . GLU E 3 546 ? 143.555 -42.912 54.645  1.00 47.46 ? 842  GLU A CA    1 
ATOM   5172  C  C     . GLU E 3 546 ? 143.922 -42.933 53.165  1.00 47.06 ? 842  GLU A C     1 
ATOM   5173  O  O     . GLU E 3 546 ? 144.342 -41.919 52.608  1.00 46.43 ? 842  GLU A O     1 
ATOM   5174  C  CB    . GLU E 3 546 ? 144.625 -43.667 55.440  1.00 50.50 ? 842  GLU A CB    1 
ATOM   5175  C  CG    . GLU E 3 546 ? 144.328 -43.812 56.924  1.00 54.34 ? 842  GLU A CG    1 
ATOM   5176  C  CD    . GLU E 3 546 ? 145.470 -44.461 57.689  1.00 56.90 ? 842  GLU A CD    1 
ATOM   5177  O  OE1   . GLU E 3 546 ? 146.095 -45.399 57.146  1.00 57.95 ? 842  GLU A OE1   1 
ATOM   5178  O  OE2   . GLU E 3 546 ? 145.739 -44.036 58.834  1.00 58.35 ? 842  GLU A OE2   1 
ATOM   5179  N  N     . ARG E 3 547 ? 143.763 -44.091 52.530  1.00 46.61 ? 843  ARG A N     1 
ATOM   5180  C  CA    . ARG E 3 547 ? 144.087 -44.226 51.115  1.00 46.61 ? 843  ARG A CA    1 
ATOM   5181  C  C     . ARG E 3 547 ? 143.167 -43.365 50.253  1.00 45.84 ? 843  ARG A C     1 
ATOM   5182  O  O     . ARG E 3 547 ? 143.629 -42.639 49.374  1.00 46.22 ? 843  ARG A O     1 
ATOM   5183  C  CB    . ARG E 3 547 ? 143.970 -45.686 50.675  1.00 47.87 ? 843  ARG A CB    1 
ATOM   5184  C  CG    . ARG E 3 547 ? 144.478 -45.941 49.260  1.00 49.72 ? 843  ARG A CG    1 
ATOM   5185  C  CD    . ARG E 3 547 ? 145.997 -45.845 49.195  1.00 51.63 ? 843  ARG A CD    1 
ATOM   5186  N  NE    . ARG E 3 547 ? 146.507 -45.964 47.831  1.00 52.75 ? 843  ARG A NE    1 
ATOM   5187  C  CZ    . ARG E 3 547 ? 146.617 -44.950 46.979  1.00 53.03 ? 843  ARG A CZ    1 
ATOM   5188  N  NH1   . ARG E 3 547 ? 146.257 -43.727 47.347  1.00 53.80 ? 843  ARG A NH1   1 
ATOM   5189  N  NH2   . ARG E 3 547 ? 147.086 -45.159 45.756  1.00 53.24 ? 843  ARG A NH2   1 
ATOM   5190  N  N     . LEU E 3 548 ? 141.864 -43.450 50.509  1.00 44.92 ? 844  LEU A N     1 
ATOM   5191  C  CA    . LEU E 3 548 ? 140.880 -42.680 49.753  1.00 43.23 ? 844  LEU A CA    1 
ATOM   5192  C  C     . LEU E 3 548 ? 141.162 -41.181 49.766  1.00 42.73 ? 844  LEU A C     1 
ATOM   5193  O  O     . LEU E 3 548 ? 141.042 -40.512 48.739  1.00 42.29 ? 844  LEU A O     1 
ATOM   5194  C  CB    . LEU E 3 548 ? 139.471 -42.948 50.297  1.00 42.83 ? 844  LEU A CB    1 
ATOM   5195  C  CG    . LEU E 3 548 ? 138.608 -43.982 49.563  1.00 42.71 ? 844  LEU A CG    1 
ATOM   5196  C  CD1   . LEU E 3 548 ? 139.398 -45.250 49.294  1.00 42.13 ? 844  LEU A CD1   1 
ATOM   5197  C  CD2   . LEU E 3 548 ? 137.368 -44.279 50.392  1.00 41.80 ? 844  LEU A CD2   1 
ATOM   5198  N  N     . CYS E 3 549 ? 141.541 -40.655 50.926  1.00 42.36 ? 845  CYS A N     1 
ATOM   5199  C  CA    . CYS E 3 549 ? 141.832 -39.231 51.056  1.00 42.64 ? 845  CYS A CA    1 
ATOM   5200  C  C     . CYS E 3 549 ? 142.877 -38.760 50.051  1.00 42.44 ? 845  CYS A C     1 
ATOM   5201  O  O     . CYS E 3 549 ? 142.994 -37.566 49.783  1.00 41.82 ? 845  CYS A O     1 
ATOM   5202  C  CB    . CYS E 3 549 ? 142.311 -38.911 52.474  1.00 43.09 ? 845  CYS A CB    1 
ATOM   5203  S  SG    . CYS E 3 549 ? 141.029 -39.024 53.742  1.00 43.52 ? 845  CYS A SG    1 
ATOM   5204  N  N     . ARG E 3 550 ? 143.633 -39.701 49.496  1.00 43.23 ? 846  ARG A N     1 
ATOM   5205  C  CA    . ARG E 3 550 ? 144.665 -39.361 48.526  1.00 43.94 ? 846  ARG A CA    1 
ATOM   5206  C  C     . ARG E 3 550 ? 144.364 -39.920 47.139  1.00 42.26 ? 846  ARG A C     1 
ATOM   5207  O  O     . ARG E 3 550 ? 144.589 -39.254 46.133  1.00 42.96 ? 846  ARG A O     1 
ATOM   5208  C  CB    . ARG E 3 550 ? 146.023 -39.884 49.003  1.00 46.48 ? 846  ARG A CB    1 
ATOM   5209  C  CG    . ARG E 3 550 ? 147.182 -39.519 48.090  1.00 50.98 ? 846  ARG A CG    1 
ATOM   5210  C  CD    . ARG E 3 550 ? 148.498 -40.076 48.615  1.00 54.78 ? 846  ARG A CD    1 
ATOM   5211  N  NE    . ARG E 3 550 ? 149.628 -39.701 47.768  1.00 58.31 ? 846  ARG A NE    1 
ATOM   5212  C  CZ    . ARG E 3 550 ? 150.886 -40.067 47.994  1.00 60.53 ? 846  ARG A CZ    1 
ATOM   5213  N  NH1   . ARG E 3 550 ? 151.182 -40.822 49.045  1.00 61.58 ? 846  ARG A NH1   1 
ATOM   5214  N  NH2   . ARG E 3 550 ? 151.851 -39.680 47.168  1.00 61.11 ? 846  ARG A NH2   1 
ATOM   5215  N  N     . LEU E 3 551 ? 143.845 -41.142 47.091  1.00 41.06 ? 847  LEU A N     1 
ATOM   5216  C  CA    . LEU E 3 551 ? 143.536 -41.795 45.825  1.00 39.63 ? 847  LEU A CA    1 
ATOM   5217  C  C     . LEU E 3 551 ? 142.373 -41.171 45.057  1.00 39.39 ? 847  LEU A C     1 
ATOM   5218  O  O     . LEU E 3 551 ? 142.454 -40.988 43.842  1.00 37.59 ? 847  LEU A O     1 
ATOM   5219  C  CB    . LEU E 3 551 ? 143.241 -43.278 46.061  1.00 39.55 ? 847  LEU A CB    1 
ATOM   5220  C  CG    . LEU E 3 551 ? 142.878 -44.090 44.815  1.00 39.67 ? 847  LEU A CG    1 
ATOM   5221  C  CD1   . LEU E 3 551 ? 144.070 -44.154 43.870  1.00 40.15 ? 847  LEU A CD1   1 
ATOM   5222  C  CD2   . LEU E 3 551 ? 142.452 -45.486 45.228  1.00 40.59 ? 847  LEU A CD2   1 
ATOM   5223  N  N     . VAL E 3 552 ? 141.292 -40.849 45.761  1.00 37.66 ? 848  VAL A N     1 
ATOM   5224  C  CA    . VAL E 3 552 ? 140.123 -40.266 45.112  1.00 36.72 ? 848  VAL A CA    1 
ATOM   5225  C  C     . VAL E 3 552 ? 140.398 -38.883 44.527  1.00 37.01 ? 848  VAL A C     1 
ATOM   5226  O  O     . VAL E 3 552 ? 140.086 -38.621 43.363  1.00 37.03 ? 848  VAL A O     1 
ATOM   5227  C  CB    . VAL E 3 552 ? 138.928 -40.176 46.088  1.00 35.59 ? 848  VAL A CB    1 
ATOM   5228  C  CG1   . VAL E 3 552 ? 137.709 -39.613 45.371  1.00 33.62 ? 848  VAL A CG1   1 
ATOM   5229  C  CG2   . VAL E 3 552 ? 138.625 -41.550 46.655  1.00 34.22 ? 848  VAL A CG2   1 
ATOM   5230  N  N     . PRO E 3 553 ? 140.983 -37.976 45.323  1.00 37.88 ? 849  PRO A N     1 
ATOM   5231  C  CA    . PRO E 3 553 ? 141.265 -36.637 44.797  1.00 38.12 ? 849  PRO A CA    1 
ATOM   5232  C  C     . PRO E 3 553 ? 142.228 -36.683 43.612  1.00 39.05 ? 849  PRO A C     1 
ATOM   5233  O  O     . PRO E 3 553 ? 142.036 -35.994 42.610  1.00 39.62 ? 849  PRO A O     1 
ATOM   5234  C  CB    . PRO E 3 553 ? 141.840 -35.901 46.004  1.00 38.07 ? 849  PRO A CB    1 
ATOM   5235  C  CG    . PRO E 3 553 ? 141.198 -36.606 47.170  1.00 38.13 ? 849  PRO A CG    1 
ATOM   5236  C  CD    . PRO E 3 553 ? 141.293 -38.048 46.762  1.00 37.34 ? 849  PRO A CD    1 
ATOM   5237  N  N     . GLU E 3 554 ? 143.260 -37.512 43.739  1.00 39.30 ? 850  GLU A N     1 
ATOM   5238  C  CA    . GLU E 3 554 ? 144.276 -37.658 42.703  1.00 39.58 ? 850  GLU A CA    1 
ATOM   5239  C  C     . GLU E 3 554 ? 143.695 -38.109 41.366  1.00 38.35 ? 850  GLU A C     1 
ATOM   5240  O  O     . GLU E 3 554 ? 143.960 -37.499 40.330  1.00 38.59 ? 850  GLU A O     1 
ATOM   5241  C  CB    . GLU E 3 554 ? 145.341 -38.654 43.165  1.00 41.72 ? 850  GLU A CB    1 
ATOM   5242  C  CG    . GLU E 3 554 ? 146.505 -38.818 42.204  1.00 46.19 ? 850  GLU A CG    1 
ATOM   5243  C  CD    . GLU E 3 554 ? 147.521 -39.831 42.697  1.00 48.86 ? 850  GLU A CD    1 
ATOM   5244  O  OE1   . GLU E 3 554 ? 147.152 -41.013 42.874  1.00 49.81 ? 850  GLU A OE1   1 
ATOM   5245  O  OE2   . GLU E 3 554 ? 148.690 -39.444 42.908  1.00 51.44 ? 850  GLU A OE2   1 
ATOM   5246  N  N     . VAL E 3 555 ? 142.905 -39.176 41.389  1.00 36.43 ? 851  VAL A N     1 
ATOM   5247  C  CA    . VAL E 3 555 ? 142.300 -39.692 40.167  1.00 35.56 ? 851  VAL A CA    1 
ATOM   5248  C  C     . VAL E 3 555 ? 141.349 -38.679 39.527  1.00 34.99 ? 851  VAL A C     1 
ATOM   5249  O  O     . VAL E 3 555 ? 141.368 -38.488 38.313  1.00 35.48 ? 851  VAL A O     1 
ATOM   5250  C  CB    . VAL E 3 555 ? 141.535 -41.003 40.440  1.00 35.76 ? 851  VAL A CB    1 
ATOM   5251  C  CG1   . VAL E 3 555 ? 140.896 -41.515 39.156  1.00 35.69 ? 851  VAL A CG1   1 
ATOM   5252  C  CG2   . VAL E 3 555 ? 142.488 -42.044 41.006  1.00 35.28 ? 851  VAL A CG2   1 
ATOM   5253  N  N     . MET E 3 556 ? 140.522 -38.029 40.342  1.00 34.63 ? 852  MET A N     1 
ATOM   5254  C  CA    . MET E 3 556 ? 139.576 -37.039 39.831  1.00 34.12 ? 852  MET A CA    1 
ATOM   5255  C  C     . MET E 3 556 ? 140.289 -35.820 39.257  1.00 34.28 ? 852  MET A C     1 
ATOM   5256  O  O     . MET E 3 556 ? 139.880 -35.275 38.229  1.00 33.94 ? 852  MET A O     1 
ATOM   5257  C  CB    . MET E 3 556 ? 138.611 -36.601 40.939  1.00 32.78 ? 852  MET A CB    1 
ATOM   5258  C  CG    . MET E 3 556 ? 137.630 -37.686 41.376  1.00 31.78 ? 852  MET A CG    1 
ATOM   5259  S  SD    . MET E 3 556 ? 136.546 -37.155 42.728  1.00 30.98 ? 852  MET A SD    1 
ATOM   5260  C  CE    . MET E 3 556 ? 135.553 -35.904 41.896  1.00 30.01 ? 852  MET A CE    1 
ATOM   5261  N  N     . GLU E 3 557 ? 141.357 -35.397 39.924  1.00 35.20 ? 853  GLU A N     1 
ATOM   5262  C  CA    . GLU E 3 557 ? 142.130 -34.240 39.479  1.00 35.48 ? 853  GLU A CA    1 
ATOM   5263  C  C     . GLU E 3 557 ? 142.951 -34.530 38.222  1.00 35.07 ? 853  GLU A C     1 
ATOM   5264  O  O     . GLU E 3 557 ? 143.221 -33.627 37.429  1.00 33.61 ? 853  GLU A O     1 
ATOM   5265  C  CB    . GLU E 3 557 ? 143.056 -33.767 40.604  1.00 36.67 ? 853  GLU A CB    1 
ATOM   5266  C  CG    . GLU E 3 557 ? 142.317 -33.169 41.793  1.00 38.59 ? 853  GLU A CG    1 
ATOM   5267  C  CD    . GLU E 3 557 ? 143.237 -32.832 42.951  1.00 41.10 ? 853  GLU A CD    1 
ATOM   5268  O  OE1   . GLU E 3 557 ? 142.744 -32.277 43.958  1.00 40.49 ? 853  GLU A OE1   1 
ATOM   5269  O  OE2   . GLU E 3 557 ? 144.450 -33.122 42.855  1.00 41.87 ? 853  GLU A OE2   1 
ATOM   5270  N  N     . GLN E 3 558 ? 143.337 -35.790 38.039  1.00 34.88 ? 854  GLN A N     1 
ATOM   5271  C  CA    . GLN E 3 558 ? 144.136 -36.187 36.880  1.00 35.89 ? 854  GLN A CA    1 
ATOM   5272  C  C     . GLN E 3 558 ? 143.319 -36.803 35.745  1.00 35.71 ? 854  GLN A C     1 
ATOM   5273  O  O     . GLN E 3 558 ? 143.884 -37.278 34.758  1.00 35.02 ? 854  GLN A O     1 
ATOM   5274  C  CB    . GLN E 3 558 ? 145.227 -37.174 37.309  1.00 36.84 ? 854  GLN A CB    1 
ATOM   5275  C  CG    . GLN E 3 558 ? 146.286 -36.582 38.229  1.00 38.73 ? 854  GLN A CG    1 
ATOM   5276  C  CD    . GLN E 3 558 ? 147.025 -35.416 37.592  1.00 39.75 ? 854  GLN A CD    1 
ATOM   5277  O  OE1   . GLN E 3 558 ? 147.601 -35.545 36.509  1.00 40.77 ? 854  GLN A OE1   1 
ATOM   5278  N  NE2   . GLN E 3 558 ? 147.013 -34.270 38.263  1.00 39.98 ? 854  GLN A NE2   1 
ATOM   5279  N  N     . ALA E 3 559 ? 141.995 -36.795 35.883  1.00 35.55 ? 855  ALA A N     1 
ATOM   5280  C  CA    . ALA E 3 559 ? 141.111 -37.359 34.863  1.00 34.58 ? 855  ALA A CA    1 
ATOM   5281  C  C     . ALA E 3 559 ? 141.462 -36.815 33.481  1.00 34.02 ? 855  ALA A C     1 
ATOM   5282  O  O     . ALA E 3 559 ? 141.597 -37.569 32.517  1.00 32.94 ? 855  ALA A O     1 
ATOM   5283  C  CB    . ALA E 3 559 ? 139.659 -37.044 35.202  1.00 34.49 ? 855  ALA A CB    1 
ATOM   5284  N  N     . VAL E 3 560 ? 141.604 -35.498 33.394  1.00 34.58 ? 856  VAL A N     1 
ATOM   5285  C  CA    . VAL E 3 560 ? 141.969 -34.839 32.147  1.00 35.34 ? 856  VAL A CA    1 
ATOM   5286  C  C     . VAL E 3 560 ? 142.974 -33.751 32.493  1.00 36.30 ? 856  VAL A C     1 
ATOM   5287  O  O     . VAL E 3 560 ? 143.059 -33.322 33.645  1.00 37.72 ? 856  VAL A O     1 
ATOM   5288  C  CB    . VAL E 3 560 ? 140.749 -34.184 31.453  1.00 35.61 ? 856  VAL A CB    1 
ATOM   5289  C  CG1   . VAL E 3 560 ? 139.735 -35.246 31.061  1.00 35.21 ? 856  VAL A CG1   1 
ATOM   5290  C  CG2   . VAL E 3 560 ? 140.120 -33.150 32.373  1.00 36.35 ? 856  VAL A CG2   1 
ATOM   5291  N  N     . THR E 3 561 ? 143.738 -33.309 31.502  1.00 36.18 ? 857  THR A N     1 
ATOM   5292  C  CA    . THR E 3 561 ? 144.725 -32.263 31.723  1.00 35.89 ? 857  THR A CA    1 
ATOM   5293  C  C     . THR E 3 561 ? 144.306 -30.993 31.001  1.00 35.59 ? 857  THR A C     1 
ATOM   5294  O  O     . THR E 3 561 ? 144.281 -30.943 29.771  1.00 35.60 ? 857  THR A O     1 
ATOM   5295  C  CB    . THR E 3 561 ? 146.115 -32.692 31.224  1.00 36.54 ? 857  THR A CB    1 
ATOM   5296  O  OG1   . THR E 3 561 ? 146.544 -33.847 31.957  1.00 37.24 ? 857  THR A OG1   1 
ATOM   5297  C  CG2   . THR E 3 561 ? 147.125 -31.566 31.421  1.00 35.34 ? 857  THR A CG2   1 
ATOM   5298  N  N     . LEU E 3 562 ? 143.976 -29.969 31.777  1.00 35.46 ? 858  LEU A N     1 
ATOM   5299  C  CA    . LEU E 3 562 ? 143.548 -28.690 31.228  1.00 36.38 ? 858  LEU A CA    1 
ATOM   5300  C  C     . LEU E 3 562 ? 144.661 -27.658 31.364  1.00 36.82 ? 858  LEU A C     1 
ATOM   5301  O  O     . LEU E 3 562 ? 145.732 -27.958 31.891  1.00 36.70 ? 858  LEU A O     1 
ATOM   5302  C  CB    . LEU E 3 562 ? 142.304 -28.197 31.969  1.00 35.29 ? 858  LEU A CB    1 
ATOM   5303  C  CG    . LEU E 3 562 ? 141.110 -29.153 32.011  1.00 35.69 ? 858  LEU A CG    1 
ATOM   5304  C  CD1   . LEU E 3 562 ? 140.014 -28.548 32.877  1.00 35.23 ? 858  LEU A CD1   1 
ATOM   5305  C  CD2   . LEU E 3 562 ? 140.606 -29.417 30.598  1.00 34.16 ? 858  LEU A CD2   1 
ATOM   5306  N  N     . ARG E 3 563 ? 144.400 -26.445 30.886  1.00 37.87 ? 859  ARG A N     1 
ATOM   5307  C  CA    . ARG E 3 563 ? 145.380 -25.369 30.972  1.00 39.14 ? 859  ARG A CA    1 
ATOM   5308  C  C     . ARG E 3 563 ? 145.463 -24.920 32.426  1.00 38.56 ? 859  ARG A C     1 
ATOM   5309  O  O     . ARG E 3 563 ? 146.452 -24.325 32.848  1.00 37.61 ? 859  ARG A O     1 
ATOM   5310  C  CB    . ARG E 3 563 ? 144.966 -24.190 30.088  1.00 41.59 ? 859  ARG A CB    1 
ATOM   5311  C  CG    . ARG E 3 563 ? 144.710 -24.554 28.635  1.00 45.16 ? 859  ARG A CG    1 
ATOM   5312  C  CD    . ARG E 3 563 ? 144.363 -23.317 27.821  1.00 48.49 ? 859  ARG A CD    1 
ATOM   5313  N  NE    . ARG E 3 563 ? 143.775 -23.644 26.524  1.00 52.37 ? 859  ARG A NE    1 
ATOM   5314  C  CZ    . ARG E 3 563 ? 144.375 -24.366 25.582  1.00 53.50 ? 859  ARG A CZ    1 
ATOM   5315  N  NH1   . ARG E 3 563 ? 145.593 -24.850 25.782  1.00 54.97 ? 859  ARG A NH1   1 
ATOM   5316  N  NH2   . ARG E 3 563 ? 143.753 -24.604 24.436  1.00 55.13 ? 859  ARG A NH2   1 
ATOM   5317  N  N     . VAL E 3 564 ? 144.408 -25.207 33.184  1.00 37.69 ? 860  VAL A N     1 
ATOM   5318  C  CA    . VAL E 3 564 ? 144.358 -24.861 34.600  1.00 36.50 ? 860  VAL A CA    1 
ATOM   5319  C  C     . VAL E 3 564 ? 144.249 -26.151 35.398  1.00 36.09 ? 860  VAL A C     1 
ATOM   5320  O  O     . VAL E 3 564 ? 143.777 -27.167 34.892  1.00 36.70 ? 860  VAL A O     1 
ATOM   5321  C  CB    . VAL E 3 564 ? 143.140 -23.967 34.942  1.00 35.96 ? 860  VAL A CB    1 
ATOM   5322  C  CG1   . VAL E 3 564 ? 143.182 -22.690 34.116  1.00 35.62 ? 860  VAL A CG1   1 
ATOM   5323  C  CG2   . VAL E 3 564 ? 141.843 -24.730 34.699  1.00 34.35 ? 860  VAL A CG2   1 
ATOM   5324  N  N     . PRO E 3 565 ? 144.690 -26.131 36.660  1.00 36.69 ? 861  PRO A N     1 
ATOM   5325  C  CA    . PRO E 3 565 ? 144.615 -27.337 37.488  1.00 36.44 ? 861  PRO A CA    1 
ATOM   5326  C  C     . PRO E 3 565 ? 143.202 -27.636 37.991  1.00 35.74 ? 861  PRO A C     1 
ATOM   5327  O  O     . PRO E 3 565 ? 142.385 -26.731 38.155  1.00 35.48 ? 861  PRO A O     1 
ATOM   5328  C  CB    . PRO E 3 565 ? 145.595 -27.038 38.616  1.00 36.91 ? 861  PRO A CB    1 
ATOM   5329  C  CG    . PRO E 3 565 ? 145.430 -25.557 38.792  1.00 36.66 ? 861  PRO A CG    1 
ATOM   5330  C  CD    . PRO E 3 565 ? 145.402 -25.050 37.366  1.00 35.97 ? 861  PRO A CD    1 
ATOM   5331  N  N     . LEU E 3 566 ? 142.922 -28.912 38.226  1.00 35.62 ? 862  LEU A N     1 
ATOM   5332  C  CA    . LEU E 3 566 ? 141.627 -29.321 38.752  1.00 36.47 ? 862  LEU A CA    1 
ATOM   5333  C  C     . LEU E 3 566 ? 141.837 -29.555 40.241  1.00 36.13 ? 862  LEU A C     1 
ATOM   5334  O  O     . LEU E 3 566 ? 142.814 -30.190 40.640  1.00 37.16 ? 862  LEU A O     1 
ATOM   5335  C  CB    . LEU E 3 566 ? 141.144 -30.609 38.081  1.00 35.00 ? 862  LEU A CB    1 
ATOM   5336  C  CG    . LEU E 3 566 ? 140.681 -30.488 36.626  1.00 35.18 ? 862  LEU A CG    1 
ATOM   5337  C  CD1   . LEU E 3 566 ? 140.281 -31.859 36.101  1.00 34.57 ? 862  LEU A CD1   1 
ATOM   5338  C  CD2   . LEU E 3 566 ? 139.510 -29.521 36.537  1.00 34.84 ? 862  LEU A CD2   1 
ATOM   5339  N  N     . LYS E 3 567 ? 140.927 -29.037 41.057  1.00 35.30 ? 863  LYS A N     1 
ATOM   5340  C  CA    . LYS E 3 567 ? 141.030 -29.182 42.504  1.00 33.90 ? 863  LYS A CA    1 
ATOM   5341  C  C     . LYS E 3 567 ? 139.803 -29.911 43.043  1.00 33.41 ? 863  LYS A C     1 
ATOM   5342  O  O     . LYS E 3 567 ? 138.680 -29.652 42.608  1.00 33.72 ? 863  LYS A O     1 
ATOM   5343  C  CB    . LYS E 3 567 ? 141.149 -27.800 43.145  1.00 34.15 ? 863  LYS A CB    1 
ATOM   5344  C  CG    . LYS E 3 567 ? 141.471 -27.814 44.625  1.00 34.35 ? 863  LYS A CG    1 
ATOM   5345  C  CD    . LYS E 3 567 ? 141.503 -26.399 45.181  1.00 33.87 ? 863  LYS A CD    1 
ATOM   5346  C  CE    . LYS E 3 567 ? 141.790 -26.403 46.674  1.00 35.28 ? 863  LYS A CE    1 
ATOM   5347  N  NZ    . LYS E 3 567 ? 141.795 -25.022 47.229  1.00 34.28 ? 863  LYS A NZ    1 
ATOM   5348  N  N     . VAL E 3 568 ? 140.021 -30.817 43.993  1.00 32.58 ? 864  VAL A N     1 
ATOM   5349  C  CA    . VAL E 3 568 ? 138.936 -31.596 44.580  1.00 31.52 ? 864  VAL A CA    1 
ATOM   5350  C  C     . VAL E 3 568 ? 138.845 -31.488 46.103  1.00 32.07 ? 864  VAL A C     1 
ATOM   5351  O  O     . VAL E 3 568 ? 139.824 -31.725 46.815  1.00 31.24 ? 864  VAL A O     1 
ATOM   5352  C  CB    . VAL E 3 568 ? 139.080 -33.093 44.218  1.00 31.35 ? 864  VAL A CB    1 
ATOM   5353  C  CG1   . VAL E 3 568 ? 138.015 -33.908 44.932  1.00 31.70 ? 864  VAL A CG1   1 
ATOM   5354  C  CG2   . VAL E 3 568 ? 138.969 -33.280 42.711  1.00 31.29 ? 864  VAL A CG2   1 
ATOM   5355  N  N     . ASP E 3 569 ? 137.663 -31.126 46.595  1.00 31.85 ? 865  ASP A N     1 
ATOM   5356  C  CA    . ASP E 3 569 ? 137.423 -31.018 48.031  1.00 32.31 ? 865  ASP A CA    1 
ATOM   5357  C  C     . ASP E 3 569 ? 136.812 -32.353 48.447  1.00 33.11 ? 865  ASP A C     1 
ATOM   5358  O  O     . ASP E 3 569 ? 136.059 -32.955 47.681  1.00 31.96 ? 865  ASP A O     1 
ATOM   5359  C  CB    . ASP E 3 569 ? 136.442 -29.882 48.330  1.00 33.57 ? 865  ASP A CB    1 
ATOM   5360  C  CG    . ASP E 3 569 ? 136.900 -28.551 47.768  1.00 35.99 ? 865  ASP A CG    1 
ATOM   5361  O  OD1   . ASP E 3 569 ? 138.026 -28.116 48.096  1.00 37.48 ? 865  ASP A OD1   1 
ATOM   5362  O  OD2   . ASP E 3 569 ? 136.132 -27.936 46.999  1.00 36.51 ? 865  ASP A OD2   1 
ATOM   5363  N  N     . TYR E 3 570 ? 137.127 -32.819 49.651  1.00 32.73 ? 866  TYR A N     1 
ATOM   5364  C  CA    . TYR E 3 570 ? 136.599 -34.099 50.109  1.00 33.32 ? 866  TYR A CA    1 
ATOM   5365  C  C     . TYR E 3 570 ? 136.462 -34.183 51.623  1.00 33.03 ? 866  TYR A C     1 
ATOM   5366  O  O     . TYR E 3 570 ? 137.155 -33.481 52.360  1.00 33.36 ? 866  TYR A O     1 
ATOM   5367  C  CB    . TYR E 3 570 ? 137.504 -35.226 49.614  1.00 34.53 ? 866  TYR A CB    1 
ATOM   5368  C  CG    . TYR E 3 570 ? 138.949 -35.024 50.000  1.00 37.37 ? 866  TYR A CG    1 
ATOM   5369  C  CD1   . TYR E 3 570 ? 139.458 -35.551 51.188  1.00 38.13 ? 866  TYR A CD1   1 
ATOM   5370  C  CD2   . TYR E 3 570 ? 139.805 -34.281 49.187  1.00 38.25 ? 866  TYR A CD2   1 
ATOM   5371  C  CE1   . TYR E 3 570 ? 140.786 -35.340 51.557  1.00 40.38 ? 866  TYR A CE1   1 
ATOM   5372  C  CE2   . TYR E 3 570 ? 141.131 -34.063 49.546  1.00 40.47 ? 866  TYR A CE2   1 
ATOM   5373  C  CZ    . TYR E 3 570 ? 141.616 -34.594 50.731  1.00 40.61 ? 866  TYR A CZ    1 
ATOM   5374  O  OH    . TYR E 3 570 ? 142.928 -34.376 51.083  1.00 42.63 ? 866  TYR A OH    1 
ATOM   5375  N  N     . HIS E 3 571 ? 135.556 -35.047 52.071  1.00 31.81 ? 867  HIS A N     1 
ATOM   5376  C  CA    . HIS E 3 571 ? 135.304 -35.263 53.490  1.00 31.44 ? 867  HIS A CA    1 
ATOM   5377  C  C     . HIS E 3 571 ? 134.689 -36.646 53.670  1.00 30.95 ? 867  HIS A C     1 
ATOM   5378  O  O     . HIS E 3 571 ? 134.291 -37.286 52.697  1.00 29.43 ? 867  HIS A O     1 
ATOM   5379  C  CB    . HIS E 3 571 ? 134.338 -34.208 54.042  1.00 32.87 ? 867  HIS A CB    1 
ATOM   5380  C  CG    . HIS E 3 571 ? 134.722 -32.799 53.712  1.00 34.57 ? 867  HIS A CG    1 
ATOM   5381  N  ND1   . HIS E 3 571 ? 134.376 -32.192 52.524  1.00 35.69 ? 867  HIS A ND1   1 
ATOM   5382  C  CD2   . HIS E 3 571 ? 135.430 -31.880 54.411  1.00 35.65 ? 867  HIS A CD2   1 
ATOM   5383  C  CE1   . HIS E 3 571 ? 134.853 -30.960 52.506  1.00 35.84 ? 867  HIS A CE1   1 
ATOM   5384  N  NE2   . HIS E 3 571 ? 135.497 -30.746 53.639  1.00 36.57 ? 867  HIS A NE2   1 
ATOM   5385  N  N     . TYR E 3 572 ? 134.617 -37.106 54.915  1.00 30.77 ? 868  TYR A N     1 
ATOM   5386  C  CA    . TYR E 3 572 ? 134.032 -38.409 55.210  1.00 30.97 ? 868  TYR A CA    1 
ATOM   5387  C  C     . TYR E 3 572 ? 133.423 -38.424 56.610  1.00 29.49 ? 868  TYR A C     1 
ATOM   5388  O  O     . TYR E 3 572 ? 133.703 -37.544 57.423  1.00 29.03 ? 868  TYR A O     1 
ATOM   5389  C  CB    . TYR E 3 572 ? 135.084 -39.518 55.057  1.00 33.36 ? 868  TYR A CB    1 
ATOM   5390  C  CG    . TYR E 3 572 ? 136.280 -39.404 55.977  1.00 37.13 ? 868  TYR A CG    1 
ATOM   5391  C  CD1   . TYR E 3 572 ? 136.223 -39.867 57.293  1.00 38.68 ? 868  TYR A CD1   1 
ATOM   5392  C  CD2   . TYR E 3 572 ? 137.472 -38.834 55.530  1.00 38.72 ? 868  TYR A CD2   1 
ATOM   5393  C  CE1   . TYR E 3 572 ? 137.327 -39.766 58.142  1.00 39.87 ? 868  TYR A CE1   1 
ATOM   5394  C  CE2   . TYR E 3 572 ? 138.581 -38.727 56.370  1.00 40.41 ? 868  TYR A CE2   1 
ATOM   5395  C  CZ    . TYR E 3 572 ? 138.500 -39.195 57.672  1.00 40.26 ? 868  TYR A CZ    1 
ATOM   5396  O  OH    . TYR E 3 572 ? 139.591 -39.085 58.502  1.00 42.58 ? 868  TYR A OH    1 
ATOM   5397  N  N     . GLY E 3 573 ? 132.584 -39.419 56.885  1.00 27.42 ? 869  GLY A N     1 
ATOM   5398  C  CA    . GLY E 3 573 ? 131.948 -39.501 58.187  1.00 26.24 ? 869  GLY A CA    1 
ATOM   5399  C  C     . GLY E 3 573 ? 131.023 -40.694 58.317  1.00 26.37 ? 869  GLY A C     1 
ATOM   5400  O  O     . GLY E 3 573 ? 130.902 -41.501 57.391  1.00 25.12 ? 869  GLY A O     1 
ATOM   5401  N  N     . SER E 3 574 ? 130.356 -40.800 59.463  1.00 25.94 ? 870  SER A N     1 
ATOM   5402  C  CA    . SER E 3 574 ? 129.452 -41.911 59.721  1.00 26.28 ? 870  SER A CA    1 
ATOM   5403  C  C     . SER E 3 574 ? 128.172 -41.868 58.894  1.00 25.53 ? 870  SER A C     1 
ATOM   5404  O  O     . SER E 3 574 ? 127.520 -42.893 58.717  1.00 25.82 ? 870  SER A O     1 
ATOM   5405  C  CB    . SER E 3 574 ? 129.114 -41.976 61.213  1.00 27.47 ? 870  SER A CB    1 
ATOM   5406  O  OG    . SER E 3 574 ? 128.659 -40.722 61.684  1.00 32.38 ? 870  SER A OG    1 
ATOM   5407  N  N     . THR E 3 575 ? 127.810 -40.688 58.396  1.00 25.29 ? 871  THR A N     1 
ATOM   5408  C  CA    . THR E 3 575 ? 126.617 -40.547 57.559  1.00 24.82 ? 871  THR A CA    1 
ATOM   5409  C  C     . THR E 3 575 ? 126.923 -39.577 56.424  1.00 24.41 ? 871  THR A C     1 
ATOM   5410  O  O     . THR E 3 575 ? 127.900 -38.834 56.478  1.00 23.94 ? 871  THR A O     1 
ATOM   5411  C  CB    . THR E 3 575 ? 125.404 -39.983 58.336  1.00 23.62 ? 871  THR A CB    1 
ATOM   5412  O  OG1   . THR E 3 575 ? 125.619 -38.593 58.604  1.00 23.58 ? 871  THR A OG1   1 
ATOM   5413  C  CG2   . THR E 3 575 ? 125.199 -40.730 59.648  1.00 22.26 ? 871  THR A CG2   1 
ATOM   5414  N  N     . TRP E 3 576 ? 126.081 -39.582 55.398  1.00 23.71 ? 872  TRP A N     1 
ATOM   5415  C  CA    . TRP E 3 576 ? 126.275 -38.684 54.266  1.00 24.29 ? 872  TRP A CA    1 
ATOM   5416  C  C     . TRP E 3 576 ? 126.356 -37.250 54.799  1.00 24.28 ? 872  TRP A C     1 
ATOM   5417  O  O     . TRP E 3 576 ? 127.167 -36.447 54.341  1.00 24.00 ? 872  TRP A O     1 
ATOM   5418  C  CB    . TRP E 3 576 ? 125.104 -38.830 53.286  1.00 23.33 ? 872  TRP A CB    1 
ATOM   5419  C  CG    . TRP E 3 576 ? 125.295 -38.148 51.955  1.00 23.00 ? 872  TRP A CG    1 
ATOM   5420  C  CD1   . TRP E 3 576 ? 126.371 -37.406 51.551  1.00 24.16 ? 872  TRP A CD1   1 
ATOM   5421  C  CD2   . TRP E 3 576 ? 124.378 -38.158 50.854  1.00 22.74 ? 872  TRP A CD2   1 
ATOM   5422  N  NE1   . TRP E 3 576 ? 126.179 -36.956 50.264  1.00 23.52 ? 872  TRP A NE1   1 
ATOM   5423  C  CE2   . TRP E 3 576 ? 124.964 -37.402 49.814  1.00 23.61 ? 872  TRP A CE2   1 
ATOM   5424  C  CE3   . TRP E 3 576 ? 123.116 -38.733 50.646  1.00 22.07 ? 872  TRP A CE3   1 
ATOM   5425  C  CZ2   . TRP E 3 576 ? 124.328 -37.207 48.578  1.00 22.15 ? 872  TRP A CZ2   1 
ATOM   5426  C  CZ3   . TRP E 3 576 ? 122.485 -38.539 49.419  1.00 21.54 ? 872  TRP A CZ3   1 
ATOM   5427  C  CH2   . TRP E 3 576 ? 123.096 -37.781 48.401  1.00 21.87 ? 872  TRP A CH2   1 
ATOM   5428  N  N     . TYR E 3 577 ? 125.517 -36.947 55.786  1.00 26.01 ? 873  TYR A N     1 
ATOM   5429  C  CA    . TYR E 3 577 ? 125.476 -35.625 56.406  1.00 27.55 ? 873  TYR A CA    1 
ATOM   5430  C  C     . TYR E 3 577 ? 126.849 -35.198 56.918  1.00 29.87 ? 873  TYR A C     1 
ATOM   5431  O  O     . TYR E 3 577 ? 127.272 -34.059 56.720  1.00 30.36 ? 873  TYR A O     1 
ATOM   5432  C  CB    . TYR E 3 577 ? 124.494 -35.632 57.580  1.00 26.30 ? 873  TYR A CB    1 
ATOM   5433  C  CG    . TYR E 3 577 ? 124.444 -34.340 58.367  1.00 25.76 ? 873  TYR A CG    1 
ATOM   5434  C  CD1   . TYR E 3 577 ? 123.635 -33.280 57.961  1.00 26.26 ? 873  TYR A CD1   1 
ATOM   5435  C  CD2   . TYR E 3 577 ? 125.203 -34.178 59.527  1.00 26.66 ? 873  TYR A CD2   1 
ATOM   5436  C  CE1   . TYR E 3 577 ? 123.579 -32.094 58.691  1.00 26.67 ? 873  TYR A CE1   1 
ATOM   5437  C  CE2   . TYR E 3 577 ? 125.157 -32.996 60.262  1.00 26.78 ? 873  TYR A CE2   1 
ATOM   5438  C  CZ    . TYR E 3 577 ? 124.342 -31.960 59.839  1.00 27.29 ? 873  TYR A CZ    1 
ATOM   5439  O  OH    . TYR E 3 577 ? 124.288 -30.790 60.565  1.00 28.59 ? 873  TYR A OH    1 
ATOM   5440  N  N     . ASP E 3 578 ? 127.537 -36.122 57.579  1.00 32.62 ? 874  ASP A N     1 
ATOM   5441  C  CA    . ASP E 3 578 ? 128.850 -35.845 58.153  1.00 35.88 ? 874  ASP A CA    1 
ATOM   5442  C  C     . ASP E 3 578 ? 129.976 -35.783 57.130  1.00 37.57 ? 874  ASP A C     1 
ATOM   5443  O  O     . ASP E 3 578 ? 131.090 -35.378 57.456  1.00 38.29 ? 874  ASP A O     1 
ATOM   5444  C  CB    . ASP E 3 578 ? 129.175 -36.890 59.225  1.00 36.79 ? 874  ASP A CB    1 
ATOM   5445  C  CG    . ASP E 3 578 ? 128.149 -36.912 60.340  1.00 36.56 ? 874  ASP A CG    1 
ATOM   5446  O  OD1   . ASP E 3 578 ? 127.500 -37.961 60.534  1.00 38.81 ? 874  ASP A OD1   1 
ATOM   5447  O  OD2   . ASP E 3 578 ? 127.988 -35.878 61.021  1.00 37.63 ? 874  ASP A OD2   1 
ATOM   5448  N  N     . ALA E 3 579 ? 129.690 -36.183 55.897  1.00 39.59 ? 875  ALA A N     1 
ATOM   5449  C  CA    . ALA E 3 579 ? 130.699 -36.147 54.845  1.00 41.68 ? 875  ALA A CA    1 
ATOM   5450  C  C     . ALA E 3 579 ? 130.830 -34.709 54.361  1.00 43.37 ? 875  ALA A C     1 
ATOM   5451  O  O     . ALA E 3 579 ? 130.755 -34.436 53.165  1.00 44.36 ? 875  ALA A O     1 
ATOM   5452  C  CB    . ALA E 3 579 ? 130.290 -37.056 53.697  1.00 40.61 ? 875  ALA A CB    1 
ATOM   5453  N  N     . LYS E 3 580 ? 131.026 -33.798 55.311  1.00 45.39 ? 876  LYS A N     1 
ATOM   5454  C  CA    . LYS E 3 580 ? 131.153 -32.368 55.030  1.00 47.55 ? 876  LYS A CA    1 
ATOM   5455  C  C     . LYS E 3 580 ? 132.367 -31.762 55.734  1.00 48.25 ? 876  LYS A C     1 
ATOM   5456  O  O     . LYS E 3 580 ? 132.902 -30.754 55.222  1.00 49.00 ? 876  LYS A O     1 
ATOM   5457  C  CB    . LYS E 3 580 ? 129.887 -31.637 55.482  1.00 48.23 ? 876  LYS A CB    1 
ATOM   5458  C  CG    . LYS E 3 580 ? 129.549 -31.873 56.946  1.00 48.29 ? 876  LYS A CG    1 
ATOM   5459  C  CD    . LYS E 3 580 ? 128.313 -31.108 57.380  1.00 47.54 ? 876  LYS A CD    1 
ATOM   5460  C  CE    . LYS E 3 580 ? 127.965 -31.427 58.823  1.00 48.27 ? 876  LYS A CE    1 
ATOM   5461  N  NZ    . LYS E 3 580 ? 129.100 -31.133 59.744  1.00 48.71 ? 876  LYS A NZ    1 
ATOM   5462  O  OXT   . LYS E 3 580 ? 132.764 -32.293 56.795  1.00 49.08 ? 876  LYS A OXT   1 
ATOM   5463  N  N     . ALA F 3 1   ? 159.595 -51.350 -7.992  1.00 47.76 ? 297  ALA D N     1 
ATOM   5464  C  CA    . ALA F 3 1   ? 158.955 -50.261 -8.785  1.00 46.85 ? 297  ALA D CA    1 
ATOM   5465  C  C     . ALA F 3 1   ? 157.645 -50.747 -9.389  1.00 46.17 ? 297  ALA D C     1 
ATOM   5466  O  O     . ALA F 3 1   ? 157.173 -50.210 -10.393 1.00 47.63 ? 297  ALA D O     1 
ATOM   5467  C  CB    . ALA F 3 1   ? 159.899 -49.793 -9.890  1.00 48.07 ? 297  ALA D CB    1 
ATOM   5468  N  N     . LYS F 3 2   ? 157.061 -51.768 -8.772  1.00 43.60 ? 298  LYS D N     1 
ATOM   5469  C  CA    . LYS F 3 2   ? 155.806 -52.324 -9.250  1.00 40.84 ? 298  LYS D CA    1 
ATOM   5470  C  C     . LYS F 3 2   ? 154.828 -52.540 -8.101  1.00 37.27 ? 298  LYS D C     1 
ATOM   5471  O  O     . LYS F 3 2   ? 155.126 -52.209 -6.952  1.00 36.23 ? 298  LYS D O     1 
ATOM   5472  C  CB    . LYS F 3 2   ? 156.060 -53.644 -9.982  1.00 43.21 ? 298  LYS D CB    1 
ATOM   5473  C  CG    . LYS F 3 2   ? 156.897 -53.483 -11.241 1.00 46.43 ? 298  LYS D CG    1 
ATOM   5474  C  CD    . LYS F 3 2   ? 157.045 -54.795 -11.996 1.00 48.28 ? 298  LYS D CD    1 
ATOM   5475  C  CE    . LYS F 3 2   ? 157.869 -54.604 -13.260 1.00 50.57 ? 298  LYS D CE    1 
ATOM   5476  N  NZ    . LYS F 3 2   ? 158.019 -55.872 -14.031 1.00 51.22 ? 298  LYS D NZ    1 
ATOM   5477  N  N     . MET F 3 3   ? 153.661 -53.091 -8.424  1.00 31.77 ? 299  MET D N     1 
ATOM   5478  C  CA    . MET F 3 3   ? 152.626 -53.348 -7.431  1.00 27.01 ? 299  MET D CA    1 
ATOM   5479  C  C     . MET F 3 3   ? 152.015 -54.719 -7.662  1.00 25.04 ? 299  MET D C     1 
ATOM   5480  O  O     . MET F 3 3   ? 151.507 -55.005 -8.743  1.00 24.73 ? 299  MET D O     1 
ATOM   5481  C  CB    . MET F 3 3   ? 151.533 -52.276 -7.512  1.00 24.04 ? 299  MET D CB    1 
ATOM   5482  C  CG    . MET F 3 3   ? 150.401 -52.478 -6.513  1.00 20.11 ? 299  MET D CG    1 
ATOM   5483  S  SD    . MET F 3 3   ? 149.224 -51.109 -6.485  1.00 17.84 ? 299  MET D SD    1 
ATOM   5484  C  CE    . MET F 3 3   ? 150.093 -49.943 -5.432  1.00 16.14 ? 299  MET D CE    1 
ATOM   5485  N  N     . ALA F 3 4   ? 152.054 -55.555 -6.630  1.00 23.79 ? 300  ALA D N     1 
ATOM   5486  C  CA    . ALA F 3 4   ? 151.530 -56.911 -6.710  1.00 23.00 ? 300  ALA D CA    1 
ATOM   5487  C  C     . ALA F 3 4   ? 150.015 -56.983 -6.785  1.00 22.30 ? 300  ALA D C     1 
ATOM   5488  O  O     . ALA F 3 4   ? 149.307 -56.320 -6.028  1.00 22.91 ? 300  ALA D O     1 
ATOM   5489  C  CB    . ALA F 3 4   ? 152.016 -57.720 -5.517  1.00 22.51 ? 300  ALA D CB    1 
ATOM   5490  N  N     . PHE F 3 5   ? 149.520 -57.799 -7.706  1.00 21.55 ? 301  PHE D N     1 
ATOM   5491  C  CA    . PHE F 3 5   ? 148.087 -57.989 -7.854  1.00 21.46 ? 301  PHE D CA    1 
ATOM   5492  C  C     . PHE F 3 5   ? 147.806 -59.272 -8.618  1.00 21.70 ? 301  PHE D C     1 
ATOM   5493  O  O     . PHE F 3 5   ? 148.664 -59.784 -9.339  1.00 20.35 ? 301  PHE D O     1 
ATOM   5494  C  CB    . PHE F 3 5   ? 147.445 -56.784 -8.560  1.00 20.88 ? 301  PHE D CB    1 
ATOM   5495  C  CG    . PHE F 3 5   ? 147.794 -56.659 -10.017 1.00 21.07 ? 301  PHE D CG    1 
ATOM   5496  C  CD1   . PHE F 3 5   ? 147.097 -57.385 -10.980 1.00 21.61 ? 301  PHE D CD1   1 
ATOM   5497  C  CD2   . PHE F 3 5   ? 148.800 -55.791 -10.429 1.00 22.09 ? 301  PHE D CD2   1 
ATOM   5498  C  CE1   . PHE F 3 5   ? 147.397 -57.245 -12.334 1.00 21.34 ? 301  PHE D CE1   1 
ATOM   5499  C  CE2   . PHE F 3 5   ? 149.110 -55.644 -11.784 1.00 22.76 ? 301  PHE D CE2   1 
ATOM   5500  C  CZ    . PHE F 3 5   ? 148.404 -56.373 -12.738 1.00 21.19 ? 301  PHE D CZ    1 
ATOM   5501  N  N     . THR F 3 6   ? 146.599 -59.790 -8.448  1.00 21.72 ? 302  THR D N     1 
ATOM   5502  C  CA    . THR F 3 6   ? 146.200 -61.010 -9.120  1.00 22.63 ? 302  THR D CA    1 
ATOM   5503  C  C     . THR F 3 6   ? 145.369 -60.698 -10.357 1.00 23.02 ? 302  THR D C     1 
ATOM   5504  O  O     . THR F 3 6   ? 144.365 -59.991 -10.273 1.00 22.11 ? 302  THR D O     1 
ATOM   5505  C  CB    . THR F 3 6   ? 145.356 -61.897 -8.191  1.00 22.81 ? 302  THR D CB    1 
ATOM   5506  O  OG1   . THR F 3 6   ? 146.106 -62.200 -7.010  1.00 26.40 ? 302  THR D OG1   1 
ATOM   5507  C  CG2   . THR F 3 6   ? 144.961 -63.184 -8.897  1.00 23.06 ? 302  THR D CG2   1 
ATOM   5508  N  N     . LEU F 3 7   ? 145.788 -61.216 -11.507 1.00 23.36 ? 303  LEU D N     1 
ATOM   5509  C  CA    . LEU F 3 7   ? 145.015 -61.016 -12.727 1.00 25.51 ? 303  LEU D CA    1 
ATOM   5510  C  C     . LEU F 3 7   ? 144.115 -62.245 -12.713 1.00 26.49 ? 303  LEU D C     1 
ATOM   5511  O  O     . LEU F 3 7   ? 144.483 -63.309 -13.214 1.00 26.73 ? 303  LEU D O     1 
ATOM   5512  C  CB    . LEU F 3 7   ? 145.924 -61.010 -13.960 1.00 27.29 ? 303  LEU D CB    1 
ATOM   5513  C  CG    . LEU F 3 7   ? 145.351 -60.270 -15.176 1.00 28.85 ? 303  LEU D CG    1 
ATOM   5514  C  CD1   . LEU F 3 7   ? 146.417 -60.129 -16.244 1.00 30.81 ? 303  LEU D CD1   1 
ATOM   5515  C  CD2   . LEU F 3 7   ? 144.136 -61.010 -15.714 1.00 30.49 ? 303  LEU D CD2   1 
ATOM   5516  N  N     . ALA F 3 8   ? 142.935 -62.088 -12.121 1.00 26.05 ? 304  ALA D N     1 
ATOM   5517  C  CA    . ALA F 3 8   ? 141.989 -63.187 -11.967 1.00 27.69 ? 304  ALA D CA    1 
ATOM   5518  C  C     . ALA F 3 8   ? 141.277 -63.665 -13.224 1.00 29.22 ? 304  ALA D C     1 
ATOM   5519  O  O     . ALA F 3 8   ? 140.961 -62.881 -14.116 1.00 29.46 ? 304  ALA D O     1 
ATOM   5520  C  CB    . ALA F 3 8   ? 140.959 -62.824 -10.905 1.00 26.99 ? 304  ALA D CB    1 
ATOM   5521  N  N     . ASP F 3 9   ? 141.024 -64.970 -13.268 1.00 29.53 ? 305  ASP D N     1 
ATOM   5522  C  CA    . ASP F 3 9   ? 140.332 -65.598 -14.385 1.00 31.26 ? 305  ASP D CA    1 
ATOM   5523  C  C     . ASP F 3 9   ? 138.905 -65.939 -13.957 1.00 29.99 ? 305  ASP D C     1 
ATOM   5524  O  O     . ASP F 3 9   ? 138.067 -66.288 -14.784 1.00 29.74 ? 305  ASP D O     1 
ATOM   5525  C  CB    . ASP F 3 9   ? 141.060 -66.875 -14.808 1.00 35.48 ? 305  ASP D CB    1 
ATOM   5526  C  CG    . ASP F 3 9   ? 141.269 -67.834 -13.653 1.00 40.05 ? 305  ASP D CG    1 
ATOM   5527  O  OD1   . ASP F 3 9   ? 140.300 -68.084 -12.903 1.00 43.00 ? 305  ASP D OD1   1 
ATOM   5528  O  OD2   . ASP F 3 9   ? 142.401 -68.344 -13.497 1.00 44.59 ? 305  ASP D OD2   1 
ATOM   5529  N  N     . ARG F 3 10  ? 138.642 -65.836 -12.657 1.00 28.13 ? 306  ARG D N     1 
ATOM   5530  C  CA    . ARG F 3 10  ? 137.318 -66.114 -12.108 1.00 27.50 ? 306  ARG D CA    1 
ATOM   5531  C  C     . ARG F 3 10  ? 137.140 -65.360 -10.794 1.00 25.93 ? 306  ARG D C     1 
ATOM   5532  O  O     . ARG F 3 10  ? 138.117 -64.960 -10.164 1.00 25.42 ? 306  ARG D O     1 
ATOM   5533  C  CB    . ARG F 3 10  ? 137.143 -67.614 -11.859 1.00 28.68 ? 306  ARG D CB    1 
ATOM   5534  C  CG    . ARG F 3 10  ? 137.889 -68.132 -10.642 1.00 31.27 ? 306  ARG D CG    1 
ATOM   5535  C  CD    . ARG F 3 10  ? 137.831 -69.652 -10.561 1.00 34.96 ? 306  ARG D CD    1 
ATOM   5536  N  NE    . ARG F 3 10  ? 138.457 -70.150 -9.340  1.00 37.31 ? 306  ARG D NE    1 
ATOM   5537  C  CZ    . ARG F 3 10  ? 137.925 -70.034 -8.127  1.00 38.83 ? 306  ARG D CZ    1 
ATOM   5538  N  NH1   . ARG F 3 10  ? 136.750 -69.438 -7.970  1.00 39.33 ? 306  ARG D NH1   1 
ATOM   5539  N  NH2   . ARG F 3 10  ? 138.571 -70.509 -7.071  1.00 39.79 ? 306  ARG D NH2   1 
ATOM   5540  N  N     . VAL F 3 11  ? 135.892 -65.180 -10.378 1.00 23.91 ? 307  VAL D N     1 
ATOM   5541  C  CA    . VAL F 3 11  ? 135.596 -64.467 -9.142  1.00 22.55 ? 307  VAL D CA    1 
ATOM   5542  C  C     . VAL F 3 11  ? 135.731 -65.384 -7.933  1.00 22.63 ? 307  VAL D C     1 
ATOM   5543  O  O     . VAL F 3 11  ? 135.221 -66.506 -7.936  1.00 23.16 ? 307  VAL D O     1 
ATOM   5544  C  CB    . VAL F 3 11  ? 134.159 -63.882 -9.170  1.00 22.03 ? 307  VAL D CB    1 
ATOM   5545  C  CG1   . VAL F 3 11  ? 133.858 -63.158 -7.857  1.00 19.69 ? 307  VAL D CG1   1 
ATOM   5546  C  CG2   . VAL F 3 11  ? 134.010 -62.933 -10.349 1.00 18.54 ? 307  VAL D CG2   1 
ATOM   5547  N  N     . THR F 3 12  ? 136.421 -64.908 -6.902  1.00 22.77 ? 308  THR D N     1 
ATOM   5548  C  CA    . THR F 3 12  ? 136.602 -65.694 -5.687  1.00 22.98 ? 308  THR D CA    1 
ATOM   5549  C  C     . THR F 3 12  ? 135.992 -64.954 -4.504  1.00 23.87 ? 308  THR D C     1 
ATOM   5550  O  O     . THR F 3 12  ? 135.800 -63.734 -4.548  1.00 22.33 ? 308  THR D O     1 
ATOM   5551  C  CB    . THR F 3 12  ? 138.092 -65.959 -5.390  1.00 23.03 ? 308  THR D CB    1 
ATOM   5552  O  OG1   . THR F 3 12  ? 138.735 -64.731 -5.032  1.00 23.65 ? 308  THR D OG1   1 
ATOM   5553  C  CG2   . THR F 3 12  ? 138.783 -66.551 -6.612  1.00 24.81 ? 308  THR D CG2   1 
ATOM   5554  N  N     . GLU F 3 13  ? 135.699 -65.699 -3.446  1.00 24.20 ? 309  GLU D N     1 
ATOM   5555  C  CA    . GLU F 3 13  ? 135.087 -65.142 -2.250  1.00 25.92 ? 309  GLU D CA    1 
ATOM   5556  C  C     . GLU F 3 13  ? 135.844 -63.973 -1.620  1.00 24.30 ? 309  GLU D C     1 
ATOM   5557  O  O     . GLU F 3 13  ? 135.221 -63.013 -1.170  1.00 22.82 ? 309  GLU D O     1 
ATOM   5558  C  CB    . GLU F 3 13  ? 134.891 -66.249 -1.211  1.00 29.79 ? 309  GLU D CB    1 
ATOM   5559  C  CG    . GLU F 3 13  ? 134.157 -65.820 0.054   1.00 36.32 ? 309  GLU D CG    1 
ATOM   5560  C  CD    . GLU F 3 13  ? 132.780 -65.239 -0.225  1.00 40.65 ? 309  GLU D CD    1 
ATOM   5561  O  OE1   . GLU F 3 13  ? 132.085 -65.756 -1.130  1.00 43.68 ? 309  GLU D OE1   1 
ATOM   5562  O  OE2   . GLU F 3 13  ? 132.387 -64.275 0.470   1.00 43.12 ? 309  GLU D OE2   1 
ATOM   5563  N  N     . GLU F 3 14  ? 137.175 -64.037 -1.592  1.00 23.16 ? 310  GLU D N     1 
ATOM   5564  C  CA    . GLU F 3 14  ? 137.941 -62.954 -0.979  1.00 24.12 ? 310  GLU D CA    1 
ATOM   5565  C  C     . GLU F 3 14  ? 137.844 -61.630 -1.733  1.00 23.16 ? 310  GLU D C     1 
ATOM   5566  O  O     . GLU F 3 14  ? 138.229 -60.581 -1.212  1.00 22.96 ? 310  GLU D O     1 
ATOM   5567  C  CB    . GLU F 3 14  ? 139.412 -63.349 -0.793  1.00 25.87 ? 310  GLU D CB    1 
ATOM   5568  C  CG    . GLU F 3 14  ? 140.137 -63.853 -2.028  1.00 29.00 ? 310  GLU D CG    1 
ATOM   5569  C  CD    . GLU F 3 14  ? 141.622 -64.052 -1.765  1.00 30.56 ? 310  GLU D CD    1 
ATOM   5570  O  OE1   . GLU F 3 14  ? 141.977 -64.421 -0.626  1.00 33.10 ? 310  GLU D OE1   1 
ATOM   5571  O  OE2   . GLU F 3 14  ? 142.434 -63.851 -2.691  1.00 32.60 ? 310  GLU D OE2   1 
ATOM   5572  N  N     . MET F 3 15  ? 137.323 -61.686 -2.954  1.00 21.37 ? 311  MET D N     1 
ATOM   5573  C  CA    . MET F 3 15  ? 137.145 -60.491 -3.774  1.00 20.71 ? 311  MET D CA    1 
ATOM   5574  C  C     . MET F 3 15  ? 135.846 -59.799 -3.388  1.00 19.50 ? 311  MET D C     1 
ATOM   5575  O  O     . MET F 3 15  ? 135.607 -58.653 -3.774  1.00 19.68 ? 311  MET D O     1 
ATOM   5576  C  CB    . MET F 3 15  ? 137.069 -60.861 -5.256  1.00 19.37 ? 311  MET D CB    1 
ATOM   5577  C  CG    . MET F 3 15  ? 138.329 -61.457 -5.832  1.00 20.22 ? 311  MET D CG    1 
ATOM   5578  S  SD    . MET F 3 15  ? 138.112 -61.909 -7.567  1.00 20.94 ? 311  MET D SD    1 
ATOM   5579  C  CE    . MET F 3 15  ? 139.654 -62.813 -7.833  1.00 21.58 ? 311  MET D CE    1 
ATOM   5580  N  N     . LEU F 3 16  ? 135.010 -60.501 -2.628  1.00 17.45 ? 312  LEU D N     1 
ATOM   5581  C  CA    . LEU F 3 16  ? 133.715 -59.965 -2.222  1.00 17.78 ? 312  LEU D CA    1 
ATOM   5582  C  C     . LEU F 3 16  ? 133.631 -59.554 -0.751  1.00 18.78 ? 312  LEU D C     1 
ATOM   5583  O  O     . LEU F 3 16  ? 132.627 -59.811 -0.088  1.00 18.53 ? 312  LEU D O     1 
ATOM   5584  C  CB    . LEU F 3 16  ? 132.618 -60.990 -2.538  1.00 18.35 ? 312  LEU D CB    1 
ATOM   5585  C  CG    . LEU F 3 16  ? 132.747 -61.684 -3.902  1.00 19.71 ? 312  LEU D CG    1 
ATOM   5586  C  CD1   . LEU F 3 16  ? 131.610 -62.674 -4.072  1.00 20.54 ? 312  LEU D CD1   1 
ATOM   5587  C  CD2   . LEU F 3 16  ? 132.737 -60.655 -5.032  1.00 18.07 ? 312  LEU D CD2   1 
ATOM   5588  N  N     . ALA F 3 17  ? 134.679 -58.901 -0.252  1.00 18.87 ? 313  ALA D N     1 
ATOM   5589  C  CA    . ALA F 3 17  ? 134.722 -58.440 1.137   1.00 18.88 ? 313  ALA D CA    1 
ATOM   5590  C  C     . ALA F 3 17  ? 133.698 -57.322 1.365   1.00 18.30 ? 313  ALA D C     1 
ATOM   5591  O  O     . ALA F 3 17  ? 133.218 -56.716 0.409   1.00 18.61 ? 313  ALA D O     1 
ATOM   5592  C  CB    . ALA F 3 17  ? 136.129 -57.947 1.472   1.00 17.96 ? 313  ALA D CB    1 
ATOM   5593  N  N     . ASP F 3 18  ? 133.373 -57.034 2.625   1.00 17.46 ? 314  ASP D N     1 
ATOM   5594  C  CA    . ASP F 3 18  ? 132.379 -56.000 2.909   1.00 18.51 ? 314  ASP D CA    1 
ATOM   5595  C  C     . ASP F 3 18  ? 132.870 -54.556 2.797   1.00 17.80 ? 314  ASP D C     1 
ATOM   5596  O  O     . ASP F 3 18  ? 132.123 -53.618 3.075   1.00 16.16 ? 314  ASP D O     1 
ATOM   5597  C  CB    . ASP F 3 18  ? 131.740 -56.235 4.283   1.00 22.62 ? 314  ASP D CB    1 
ATOM   5598  C  CG    . ASP F 3 18  ? 132.736 -56.150 5.417   1.00 25.93 ? 314  ASP D CG    1 
ATOM   5599  O  OD1   . ASP F 3 18  ? 132.349 -56.484 6.559   1.00 30.06 ? 314  ASP D OD1   1 
ATOM   5600  O  OD2   . ASP F 3 18  ? 133.894 -55.753 5.173   1.00 27.21 ? 314  ASP D OD2   1 
ATOM   5601  N  N     . LYS F 3 19  ? 134.124 -54.387 2.392   1.00 15.77 ? 315  LYS D N     1 
ATOM   5602  C  CA    . LYS F 3 19  ? 134.707 -53.067 2.197   1.00 15.98 ? 315  LYS D CA    1 
ATOM   5603  C  C     . LYS F 3 19  ? 135.818 -53.204 1.166   1.00 15.78 ? 315  LYS D C     1 
ATOM   5604  O  O     . LYS F 3 19  ? 136.718 -54.028 1.321   1.00 16.15 ? 315  LYS D O     1 
ATOM   5605  C  CB    . LYS F 3 19  ? 135.281 -52.518 3.505   1.00 20.00 ? 315  LYS D CB    1 
ATOM   5606  C  CG    . LYS F 3 19  ? 136.044 -51.205 3.352   1.00 25.19 ? 315  LYS D CG    1 
ATOM   5607  C  CD    . LYS F 3 19  ? 135.156 -50.090 2.813   1.00 29.69 ? 315  LYS D CD    1 
ATOM   5608  C  CE    . LYS F 3 19  ? 135.921 -48.773 2.684   1.00 31.70 ? 315  LYS D CE    1 
ATOM   5609  N  NZ    . LYS F 3 19  ? 136.565 -48.388 3.967   1.00 30.86 ? 315  LYS D NZ    1 
ATOM   5610  N  N     . ALA F 3 20  ? 135.754 -52.400 0.112   1.00 14.00 ? 316  ALA D N     1 
ATOM   5611  C  CA    . ALA F 3 20  ? 136.767 -52.459 -0.931  1.00 13.41 ? 316  ALA D CA    1 
ATOM   5612  C  C     . ALA F 3 20  ? 136.805 -51.194 -1.769  1.00 12.76 ? 316  ALA D C     1 
ATOM   5613  O  O     . ALA F 3 20  ? 135.830 -50.444 -1.813  1.00 11.15 ? 316  ALA D O     1 
ATOM   5614  C  CB    . ALA F 3 20  ? 136.496 -53.646 -1.843  1.00 14.07 ? 316  ALA D CB    1 
ATOM   5615  N  N     . ALA F 3 21  ? 137.947 -50.963 -2.415  1.00 10.03 ? 317  ALA D N     1 
ATOM   5616  C  CA    . ALA F 3 21  ? 138.089 -49.849 -3.346  1.00 9.85  ? 317  ALA D CA    1 
ATOM   5617  C  C     . ALA F 3 21  ? 137.709 -50.569 -4.638  1.00 11.01 ? 317  ALA D C     1 
ATOM   5618  O  O     . ALA F 3 21  ? 138.196 -51.679 -4.897  1.00 12.22 ? 317  ALA D O     1 
ATOM   5619  C  CB    . ALA F 3 21  ? 139.537 -49.362 -3.410  1.00 9.60  ? 317  ALA D CB    1 
ATOM   5620  N  N     . LEU F 3 22  ? 136.838 -49.961 -5.437  1.00 9.75  ? 318  LEU D N     1 
ATOM   5621  C  CA    . LEU F 3 22  ? 136.390 -50.578 -6.677  1.00 10.07 ? 318  LEU D CA    1 
ATOM   5622  C  C     . LEU F 3 22  ? 136.592 -49.660 -7.866  1.00 10.69 ? 318  LEU D C     1 
ATOM   5623  O  O     . LEU F 3 22  ? 136.326 -48.454 -7.793  1.00 9.47  ? 318  LEU D O     1 
ATOM   5624  C  CB    . LEU F 3 22  ? 134.896 -50.950 -6.589  1.00 8.68  ? 318  LEU D CB    1 
ATOM   5625  C  CG    . LEU F 3 22  ? 134.233 -51.482 -7.877  1.00 11.93 ? 318  LEU D CG    1 
ATOM   5626  C  CD1   . LEU F 3 22  ? 134.719 -52.905 -8.157  1.00 7.79  ? 318  LEU D CD1   1 
ATOM   5627  C  CD2   . LEU F 3 22  ? 132.701 -51.474 -7.744  1.00 8.18  ? 318  LEU D CD2   1 
ATOM   5628  N  N     . VAL F 3 23  ? 137.067 -50.238 -8.962  1.00 10.38 ? 319  VAL D N     1 
ATOM   5629  C  CA    . VAL F 3 23  ? 137.265 -49.491 -10.195 1.00 11.07 ? 319  VAL D CA    1 
ATOM   5630  C  C     . VAL F 3 23  ? 136.525 -50.229 -11.309 1.00 11.87 ? 319  VAL D C     1 
ATOM   5631  O  O     . VAL F 3 23  ? 136.798 -51.396 -11.579 1.00 12.80 ? 319  VAL D O     1 
ATOM   5632  C  CB    . VAL F 3 23  ? 138.771 -49.367 -10.569 1.00 11.22 ? 319  VAL D CB    1 
ATOM   5633  C  CG1   . VAL F 3 23  ? 138.921 -48.801 -11.990 1.00 9.39  ? 319  VAL D CG1   1 
ATOM   5634  C  CG2   . VAL F 3 23  ? 139.482 -48.442 -9.578  1.00 11.39 ? 319  VAL D CG2   1 
ATOM   5635  N  N     . VAL F 3 24  ? 135.573 -49.542 -11.931 1.00 12.16 ? 320  VAL D N     1 
ATOM   5636  C  CA    . VAL F 3 24  ? 134.792 -50.080 -13.043 1.00 11.44 ? 320  VAL D CA    1 
ATOM   5637  C  C     . VAL F 3 24  ? 135.133 -49.065 -14.125 1.00 13.21 ? 320  VAL D C     1 
ATOM   5638  O  O     . VAL F 3 24  ? 134.493 -48.019 -14.233 1.00 14.04 ? 320  VAL D O     1 
ATOM   5639  C  CB    . VAL F 3 24  ? 133.275 -50.060 -12.730 1.00 11.76 ? 320  VAL D CB    1 
ATOM   5640  C  CG1   . VAL F 3 24  ? 132.477 -50.497 -13.960 1.00 11.33 ? 320  VAL D CG1   1 
ATOM   5641  C  CG2   . VAL F 3 24  ? 132.973 -50.997 -11.556 1.00 11.98 ? 320  VAL D CG2   1 
ATOM   5642  N  N     . GLU F 3 25  ? 136.151 -49.386 -14.918 1.00 12.54 ? 321  GLU D N     1 
ATOM   5643  C  CA    . GLU F 3 25  ? 136.668 -48.476 -15.935 1.00 13.38 ? 321  GLU D CA    1 
ATOM   5644  C  C     . GLU F 3 25  ? 135.883 -48.290 -17.228 1.00 13.07 ? 321  GLU D C     1 
ATOM   5645  O  O     . GLU F 3 25  ? 135.686 -49.231 -17.997 1.00 12.29 ? 321  GLU D O     1 
ATOM   5646  C  CB    . GLU F 3 25  ? 138.115 -48.868 -16.283 1.00 13.13 ? 321  GLU D CB    1 
ATOM   5647  C  CG    . GLU F 3 25  ? 138.912 -47.781 -17.010 1.00 12.56 ? 321  GLU D CG    1 
ATOM   5648  C  CD    . GLU F 3 25  ? 139.538 -46.775 -16.050 1.00 15.50 ? 321  GLU D CD    1 
ATOM   5649  O  OE1   . GLU F 3 25  ? 139.028 -46.641 -14.922 1.00 16.31 ? 321  GLU D OE1   1 
ATOM   5650  O  OE2   . GLU F 3 25  ? 140.534 -46.116 -16.420 1.00 13.72 ? 321  GLU D OE2   1 
ATOM   5651  N  N     . VAL F 3 26  ? 135.444 -47.053 -17.449 1.00 12.69 ? 322  VAL D N     1 
ATOM   5652  C  CA    . VAL F 3 26  ? 134.722 -46.666 -18.656 1.00 12.46 ? 322  VAL D CA    1 
ATOM   5653  C  C     . VAL F 3 26  ? 135.553 -45.508 -19.216 1.00 12.57 ? 322  VAL D C     1 
ATOM   5654  O  O     . VAL F 3 26  ? 135.545 -44.408 -18.667 1.00 11.16 ? 322  VAL D O     1 
ATOM   5655  C  CB    . VAL F 3 26  ? 133.299 -46.164 -18.334 1.00 13.67 ? 322  VAL D CB    1 
ATOM   5656  C  CG1   . VAL F 3 26  ? 132.581 -45.805 -19.618 1.00 13.66 ? 322  VAL D CG1   1 
ATOM   5657  C  CG2   . VAL F 3 26  ? 132.527 -47.229 -17.572 1.00 14.30 ? 322  VAL D CG2   1 
ATOM   5658  N  N     . VAL F 3 27  ? 136.265 -45.762 -20.311 1.00 13.32 ? 323  VAL D N     1 
ATOM   5659  C  CA    . VAL F 3 27  ? 137.146 -44.765 -20.904 1.00 14.48 ? 323  VAL D CA    1 
ATOM   5660  C  C     . VAL F 3 27  ? 136.503 -43.695 -21.787 1.00 15.16 ? 323  VAL D C     1 
ATOM   5661  O  O     . VAL F 3 27  ? 136.968 -42.555 -21.813 1.00 15.41 ? 323  VAL D O     1 
ATOM   5662  C  CB    . VAL F 3 27  ? 138.280 -45.464 -21.682 1.00 16.25 ? 323  VAL D CB    1 
ATOM   5663  C  CG1   . VAL F 3 27  ? 139.252 -44.433 -22.241 1.00 16.62 ? 323  VAL D CG1   1 
ATOM   5664  C  CG2   . VAL F 3 27  ? 139.010 -46.430 -20.754 1.00 14.53 ? 323  VAL D CG2   1 
ATOM   5665  N  N     . GLU F 3 28  ? 135.441 -44.039 -22.506 1.00 16.47 ? 324  GLU D N     1 
ATOM   5666  C  CA    . GLU F 3 28  ? 134.787 -43.046 -23.354 1.00 17.73 ? 324  GLU D CA    1 
ATOM   5667  C  C     . GLU F 3 28  ? 134.291 -41.898 -22.476 1.00 16.73 ? 324  GLU D C     1 
ATOM   5668  O  O     . GLU F 3 28  ? 133.752 -42.133 -21.396 1.00 15.23 ? 324  GLU D O     1 
ATOM   5669  C  CB    . GLU F 3 28  ? 133.616 -43.674 -24.115 1.00 22.48 ? 324  GLU D CB    1 
ATOM   5670  C  CG    . GLU F 3 28  ? 134.000 -44.927 -24.888 1.00 29.69 ? 324  GLU D CG    1 
ATOM   5671  C  CD    . GLU F 3 28  ? 133.058 -45.218 -26.046 1.00 34.78 ? 324  GLU D CD    1 
ATOM   5672  O  OE1   . GLU F 3 28  ? 131.887 -44.785 -25.987 1.00 36.76 ? 324  GLU D OE1   1 
ATOM   5673  O  OE2   . GLU F 3 28  ? 133.490 -45.886 -27.014 1.00 37.07 ? 324  GLU D OE2   1 
ATOM   5674  N  N     . GLU F 3 29  ? 134.482 -40.662 -22.937 1.00 15.93 ? 325  GLU D N     1 
ATOM   5675  C  CA    . GLU F 3 29  ? 134.057 -39.482 -22.180 1.00 16.62 ? 325  GLU D CA    1 
ATOM   5676  C  C     . GLU F 3 29  ? 132.580 -39.557 -21.808 1.00 13.67 ? 325  GLU D C     1 
ATOM   5677  O  O     . GLU F 3 29  ? 132.212 -39.335 -20.656 1.00 11.88 ? 325  GLU D O     1 
ATOM   5678  C  CB    . GLU F 3 29  ? 134.312 -38.200 -22.982 1.00 18.44 ? 325  GLU D CB    1 
ATOM   5679  C  CG    . GLU F 3 29  ? 135.779 -37.877 -23.204 1.00 27.69 ? 325  GLU D CG    1 
ATOM   5680  C  CD    . GLU F 3 29  ? 136.439 -38.760 -24.253 1.00 32.52 ? 325  GLU D CD    1 
ATOM   5681  O  OE1   . GLU F 3 29  ? 135.738 -39.586 -24.887 1.00 34.73 ? 325  GLU D OE1   1 
ATOM   5682  O  OE2   . GLU F 3 29  ? 137.667 -38.615 -24.448 1.00 35.78 ? 325  GLU D OE2   1 
ATOM   5683  N  N     . ASN F 3 30  ? 131.741 -39.858 -22.793 1.00 10.83 ? 326  ASN D N     1 
ATOM   5684  C  CA    . ASN F 3 30  ? 130.303 -39.990 -22.567 1.00 10.90 ? 326  ASN D CA    1 
ATOM   5685  C  C     . ASN F 3 30  ? 130.130 -41.454 -22.185 1.00 12.20 ? 326  ASN D C     1 
ATOM   5686  O  O     . ASN F 3 30  ? 130.283 -42.336 -23.027 1.00 10.88 ? 326  ASN D O     1 
ATOM   5687  C  CB    . ASN F 3 30  ? 129.534 -39.688 -23.853 1.00 13.62 ? 326  ASN D CB    1 
ATOM   5688  C  CG    . ASN F 3 30  ? 128.027 -39.743 -23.663 1.00 15.97 ? 326  ASN D CG    1 
ATOM   5689  O  OD1   . ASN F 3 30  ? 127.507 -40.630 -22.990 1.00 14.97 ? 326  ASN D OD1   1 
ATOM   5690  N  ND2   . ASN F 3 30  ? 127.317 -38.793 -24.266 1.00 17.28 ? 326  ASN D ND2   1 
ATOM   5691  N  N     . TYR F 3 31  ? 129.815 -41.713 -20.920 1.00 10.25 ? 327  TYR D N     1 
ATOM   5692  C  CA    . TYR F 3 31  ? 129.677 -43.084 -20.445 1.00 9.96  ? 327  TYR D CA    1 
ATOM   5693  C  C     . TYR F 3 31  ? 128.362 -43.805 -20.721 1.00 11.56 ? 327  TYR D C     1 
ATOM   5694  O  O     . TYR F 3 31  ? 128.222 -44.977 -20.371 1.00 11.08 ? 327  TYR D O     1 
ATOM   5695  C  CB    . TYR F 3 31  ? 129.986 -43.142 -18.942 1.00 10.76 ? 327  TYR D CB    1 
ATOM   5696  C  CG    . TYR F 3 31  ? 129.254 -42.117 -18.097 1.00 11.11 ? 327  TYR D CG    1 
ATOM   5697  C  CD1   . TYR F 3 31  ? 127.872 -42.190 -17.911 1.00 10.59 ? 327  TYR D CD1   1 
ATOM   5698  C  CD2   . TYR F 3 31  ? 129.953 -41.089 -17.459 1.00 10.92 ? 327  TYR D CD2   1 
ATOM   5699  C  CE1   . TYR F 3 31  ? 127.202 -41.263 -17.106 1.00 10.31 ? 327  TYR D CE1   1 
ATOM   5700  C  CE2   . TYR F 3 31  ? 129.293 -40.156 -16.652 1.00 10.57 ? 327  TYR D CE2   1 
ATOM   5701  C  CZ    . TYR F 3 31  ? 127.919 -40.253 -16.479 1.00 10.08 ? 327  TYR D CZ    1 
ATOM   5702  O  OH    . TYR F 3 31  ? 127.263 -39.351 -15.670 1.00 11.61 ? 327  TYR D OH    1 
ATOM   5703  N  N     . HIS F 3 32  ? 127.401 -43.130 -21.348 1.00 11.71 ? 328  HIS D N     1 
ATOM   5704  C  CA    . HIS F 3 32  ? 126.119 -43.778 -21.636 1.00 11.85 ? 328  HIS D CA    1 
ATOM   5705  C  C     . HIS F 3 32  ? 126.270 -44.902 -22.655 1.00 12.15 ? 328  HIS D C     1 
ATOM   5706  O  O     . HIS F 3 32  ? 126.733 -44.684 -23.774 1.00 11.16 ? 328  HIS D O     1 
ATOM   5707  C  CB    . HIS F 3 32  ? 125.098 -42.759 -22.144 1.00 12.15 ? 328  HIS D CB    1 
ATOM   5708  C  CG    . HIS F 3 32  ? 124.563 -41.861 -21.074 1.00 11.94 ? 328  HIS D CG    1 
ATOM   5709  N  ND1   . HIS F 3 32  ? 123.819 -42.329 -20.012 1.00 12.54 ? 328  HIS D ND1   1 
ATOM   5710  C  CD2   . HIS F 3 32  ? 124.686 -40.526 -20.889 1.00 11.67 ? 328  HIS D CD2   1 
ATOM   5711  C  CE1   . HIS F 3 32  ? 123.509 -41.321 -19.217 1.00 11.21 ? 328  HIS D CE1   1 
ATOM   5712  N  NE2   . HIS F 3 32  ? 124.023 -40.216 -19.727 1.00 10.59 ? 328  HIS D NE2   1 
ATOM   5713  N  N     . ASP F 3 33  ? 125.874 -46.103 -22.250 1.00 14.51 ? 329  ASP D N     1 
ATOM   5714  C  CA    . ASP F 3 33  ? 125.951 -47.280 -23.103 1.00 17.16 ? 329  ASP D CA    1 
ATOM   5715  C  C     . ASP F 3 33  ? 127.361 -47.384 -23.664 1.00 18.03 ? 329  ASP D C     1 
ATOM   5716  O  O     . ASP F 3 33  ? 127.556 -47.673 -24.845 1.00 19.47 ? 329  ASP D O     1 
ATOM   5717  C  CB    . ASP F 3 33  ? 124.925 -47.175 -24.240 1.00 19.63 ? 329  ASP D CB    1 
ATOM   5718  C  CG    . ASP F 3 33  ? 124.676 -48.507 -24.932 1.00 22.35 ? 329  ASP D CG    1 
ATOM   5719  O  OD1   . ASP F 3 33  ? 124.757 -49.555 -24.258 1.00 23.92 ? 329  ASP D OD1   1 
ATOM   5720  O  OD2   . ASP F 3 33  ? 124.382 -48.502 -26.145 1.00 25.82 ? 329  ASP D OD2   1 
ATOM   5721  N  N     . ALA F 3 34  ? 128.339 -47.134 -22.799 1.00 16.06 ? 330  ALA D N     1 
ATOM   5722  C  CA    . ALA F 3 34  ? 129.744 -47.190 -23.174 1.00 15.87 ? 330  ALA D CA    1 
ATOM   5723  C  C     . ALA F 3 34  ? 130.341 -48.475 -22.631 1.00 14.51 ? 330  ALA D C     1 
ATOM   5724  O  O     . ALA F 3 34  ? 129.872 -49.014 -21.634 1.00 15.02 ? 330  ALA D O     1 
ATOM   5725  C  CB    . ALA F 3 34  ? 130.494 -45.987 -22.609 1.00 15.08 ? 330  ALA D CB    1 
ATOM   5726  N  N     . PRO F 3 35  ? 131.390 -48.989 -23.281 1.00 16.77 ? 331  PRO D N     1 
ATOM   5727  C  CA    . PRO F 3 35  ? 131.968 -50.229 -22.762 1.00 17.21 ? 331  PRO D CA    1 
ATOM   5728  C  C     . PRO F 3 35  ? 132.741 -50.095 -21.452 1.00 16.20 ? 331  PRO D C     1 
ATOM   5729  O  O     . PRO F 3 35  ? 133.333 -49.054 -21.158 1.00 14.53 ? 331  PRO D O     1 
ATOM   5730  C  CB    . PRO F 3 35  ? 132.838 -50.722 -23.919 1.00 18.88 ? 331  PRO D CB    1 
ATOM   5731  C  CG    . PRO F 3 35  ? 133.244 -49.456 -24.606 1.00 21.47 ? 331  PRO D CG    1 
ATOM   5732  C  CD    . PRO F 3 35  ? 131.985 -48.620 -24.579 1.00 17.17 ? 331  PRO D CD    1 
ATOM   5733  N  N     . ILE F 3 36  ? 132.710 -51.161 -20.664 1.00 13.86 ? 332  ILE D N     1 
ATOM   5734  C  CA    . ILE F 3 36  ? 133.447 -51.215 -19.410 1.00 13.68 ? 332  ILE D CA    1 
ATOM   5735  C  C     . ILE F 3 36  ? 134.655 -52.052 -19.816 1.00 14.10 ? 332  ILE D C     1 
ATOM   5736  O  O     . ILE F 3 36  ? 134.513 -53.235 -20.138 1.00 13.96 ? 332  ILE D O     1 
ATOM   5737  C  CB    . ILE F 3 36  ? 132.629 -51.921 -18.313 1.00 13.16 ? 332  ILE D CB    1 
ATOM   5738  C  CG1   . ILE F 3 36  ? 131.411 -51.058 -17.956 1.00 13.69 ? 332  ILE D CG1   1 
ATOM   5739  C  CG2   . ILE F 3 36  ? 133.492 -52.159 -17.081 1.00 13.91 ? 332  ILE D CG2   1 
ATOM   5740  C  CD1   . ILE F 3 36  ? 130.432 -51.730 -17.009 1.00 16.19 ? 332  ILE D CD1   1 
ATOM   5741  N  N     . VAL F 3 37  ? 135.833 -51.435 -19.808 1.00 13.61 ? 333  VAL D N     1 
ATOM   5742  C  CA    . VAL F 3 37  ? 137.061 -52.096 -20.258 1.00 13.95 ? 333  VAL D CA    1 
ATOM   5743  C  C     . VAL F 3 37  ? 137.809 -52.964 -19.256 1.00 13.95 ? 333  VAL D C     1 
ATOM   5744  O  O     . VAL F 3 37  ? 138.656 -53.773 -19.643 1.00 13.59 ? 333  VAL D O     1 
ATOM   5745  C  CB    . VAL F 3 37  ? 138.061 -51.052 -20.827 1.00 14.69 ? 333  VAL D CB    1 
ATOM   5746  C  CG1   . VAL F 3 37  ? 137.372 -50.191 -21.872 1.00 15.09 ? 333  VAL D CG1   1 
ATOM   5747  C  CG2   . VAL F 3 37  ? 138.616 -50.176 -19.700 1.00 13.10 ? 333  VAL D CG2   1 
ATOM   5748  N  N     . GLY F 3 38  ? 137.509 -52.802 -17.976 1.00 13.92 ? 334  GLY D N     1 
ATOM   5749  C  CA    . GLY F 3 38  ? 138.191 -53.589 -16.969 1.00 13.29 ? 334  GLY D CA    1 
ATOM   5750  C  C     . GLY F 3 38  ? 137.697 -53.254 -15.582 1.00 13.89 ? 334  GLY D C     1 
ATOM   5751  O  O     . GLY F 3 38  ? 137.049 -52.228 -15.375 1.00 12.22 ? 334  GLY D O     1 
ATOM   5752  N  N     . ILE F 3 39  ? 138.005 -54.128 -14.634 1.00 12.24 ? 335  ILE D N     1 
ATOM   5753  C  CA    . ILE F 3 39  ? 137.585 -53.951 -13.256 1.00 13.26 ? 335  ILE D CA    1 
ATOM   5754  C  C     . ILE F 3 39  ? 138.735 -54.279 -12.315 1.00 14.22 ? 335  ILE D C     1 
ATOM   5755  O  O     . ILE F 3 39  ? 139.527 -55.184 -12.576 1.00 13.18 ? 335  ILE D O     1 
ATOM   5756  C  CB    . ILE F 3 39  ? 136.390 -54.877 -12.941 1.00 12.98 ? 335  ILE D CB    1 
ATOM   5757  C  CG1   . ILE F 3 39  ? 135.169 -54.419 -13.738 1.00 14.65 ? 335  ILE D CG1   1 
ATOM   5758  C  CG2   . ILE F 3 39  ? 136.104 -54.892 -11.447 1.00 13.71 ? 335  ILE D CG2   1 
ATOM   5759  C  CD1   . ILE F 3 39  ? 134.039 -55.403 -13.719 1.00 20.93 ? 335  ILE D CD1   1 
ATOM   5760  N  N     . ALA F 3 40  ? 138.831 -53.532 -11.224 1.00 13.32 ? 336  ALA D N     1 
ATOM   5761  C  CA    . ALA F 3 40  ? 139.865 -53.783 -10.239 1.00 13.20 ? 336  ALA D CA    1 
ATOM   5762  C  C     . ALA F 3 40  ? 139.231 -53.673 -8.863  1.00 13.12 ? 336  ALA D C     1 
ATOM   5763  O  O     . ALA F 3 40  ? 138.369 -52.821 -8.628  1.00 10.25 ? 336  ALA D O     1 
ATOM   5764  C  CB    . ALA F 3 40  ? 141.007 -52.777 -10.386 1.00 13.99 ? 336  ALA D CB    1 
ATOM   5765  N  N     . VAL F 3 41  ? 139.657 -54.551 -7.965  1.00 13.01 ? 337  VAL D N     1 
ATOM   5766  C  CA    . VAL F 3 41  ? 139.163 -54.576 -6.599  1.00 12.31 ? 337  VAL D CA    1 
ATOM   5767  C  C     . VAL F 3 41  ? 140.356 -54.636 -5.653  1.00 13.88 ? 337  VAL D C     1 
ATOM   5768  O  O     . VAL F 3 41  ? 141.258 -55.455 -5.825  1.00 12.82 ? 337  VAL D O     1 
ATOM   5769  C  CB    . VAL F 3 41  ? 138.278 -55.818 -6.330  1.00 13.26 ? 337  VAL D CB    1 
ATOM   5770  C  CG1   . VAL F 3 41  ? 137.873 -55.866 -4.852  1.00 11.69 ? 337  VAL D CG1   1 
ATOM   5771  C  CG2   . VAL F 3 41  ? 137.049 -55.783 -7.214  1.00 13.16 ? 337  VAL D CG2   1 
ATOM   5772  N  N     . VAL F 3 42  ? 140.370 -53.755 -4.666  1.00 12.77 ? 338  VAL D N     1 
ATOM   5773  C  CA    . VAL F 3 42  ? 141.436 -53.766 -3.681  1.00 13.92 ? 338  VAL D CA    1 
ATOM   5774  C  C     . VAL F 3 42  ? 140.761 -53.818 -2.323  1.00 14.51 ? 338  VAL D C     1 
ATOM   5775  O  O     . VAL F 3 42  ? 139.883 -53.008 -2.022  1.00 14.10 ? 338  VAL D O     1 
ATOM   5776  C  CB    . VAL F 3 42  ? 142.336 -52.508 -3.776  1.00 12.63 ? 338  VAL D CB    1 
ATOM   5777  C  CG1   . VAL F 3 42  ? 143.235 -52.413 -2.548  1.00 13.02 ? 338  VAL D CG1   1 
ATOM   5778  C  CG2   . VAL F 3 42  ? 143.198 -52.584 -5.025  1.00 13.84 ? 338  VAL D CG2   1 
ATOM   5779  N  N     . ASN F 3 43  ? 141.152 -54.790 -1.509  1.00 14.82 ? 339  ASN D N     1 
ATOM   5780  C  CA    . ASN F 3 43  ? 140.580 -54.909 -0.180  1.00 15.27 ? 339  ASN D CA    1 
ATOM   5781  C  C     . ASN F 3 43  ? 141.609 -55.487 0.789   1.00 17.32 ? 339  ASN D C     1 
ATOM   5782  O  O     . ASN F 3 43  ? 142.795 -55.570 0.467   1.00 16.13 ? 339  ASN D O     1 
ATOM   5783  C  CB    . ASN F 3 43  ? 139.292 -55.756 -0.206  1.00 15.65 ? 339  ASN D CB    1 
ATOM   5784  C  CG    . ASN F 3 43  ? 139.510 -57.170 -0.730  1.00 16.64 ? 339  ASN D CG    1 
ATOM   5785  O  OD1   . ASN F 3 43  ? 140.541 -57.782 -0.485  1.00 15.08 ? 339  ASN D OD1   1 
ATOM   5786  N  ND2   . ASN F 3 43  ? 138.514 -57.699 -1.435  1.00 15.14 ? 339  ASN D ND2   1 
ATOM   5787  N  N     . GLU F 3 44  ? 141.161 -55.878 1.974   1.00 19.83 ? 340  GLU D N     1 
ATOM   5788  C  CA    . GLU F 3 44  ? 142.064 -56.425 2.977   1.00 23.47 ? 340  GLU D CA    1 
ATOM   5789  C  C     . GLU F 3 44  ? 142.763 -57.702 2.512   1.00 23.75 ? 340  GLU D C     1 
ATOM   5790  O  O     . GLU F 3 44  ? 143.878 -57.995 2.944   1.00 24.53 ? 340  GLU D O     1 
ATOM   5791  C  CB    . GLU F 3 44  ? 141.290 -56.701 4.271   1.00 25.39 ? 340  GLU D CB    1 
ATOM   5792  C  CG    . GLU F 3 44  ? 140.107 -57.639 4.083   1.00 30.91 ? 340  GLU D CG    1 
ATOM   5793  C  CD    . GLU F 3 44  ? 139.250 -57.764 5.327   1.00 34.62 ? 340  GLU D CD    1 
ATOM   5794  O  OE1   . GLU F 3 44  ? 138.040 -57.449 5.252   1.00 37.07 ? 340  GLU D OE1   1 
ATOM   5795  O  OE2   . GLU F 3 44  ? 139.785 -58.178 6.378   1.00 36.12 ? 340  GLU D OE2   1 
ATOM   5796  N  N     . HIS F 3 45  ? 142.117 -58.447 1.620   1.00 23.09 ? 341  HIS D N     1 
ATOM   5797  C  CA    . HIS F 3 45  ? 142.667 -59.705 1.131   1.00 24.53 ? 341  HIS D CA    1 
ATOM   5798  C  C     . HIS F 3 45  ? 143.677 -59.577 -0.002  1.00 23.67 ? 341  HIS D C     1 
ATOM   5799  O  O     . HIS F 3 45  ? 144.442 -60.504 -0.259  1.00 23.47 ? 341  HIS D O     1 
ATOM   5800  C  CB    . HIS F 3 45  ? 141.531 -60.628 0.692   1.00 26.52 ? 341  HIS D CB    1 
ATOM   5801  C  CG    . HIS F 3 45  ? 140.481 -60.825 1.740   1.00 29.15 ? 341  HIS D CG    1 
ATOM   5802  N  ND1   . HIS F 3 45  ? 140.776 -61.251 3.017   1.00 30.53 ? 341  HIS D ND1   1 
ATOM   5803  C  CD2   . HIS F 3 45  ? 139.139 -60.649 1.702   1.00 29.26 ? 341  HIS D CD2   1 
ATOM   5804  C  CE1   . HIS F 3 45  ? 139.661 -61.329 3.721   1.00 30.46 ? 341  HIS D CE1   1 
ATOM   5805  N  NE2   . HIS F 3 45  ? 138.653 -60.969 2.946   1.00 31.19 ? 341  HIS D NE2   1 
ATOM   5806  N  N     . GLY F 3 46  ? 143.682 -58.438 -0.685  1.00 21.70 ? 342  GLY D N     1 
ATOM   5807  C  CA    . GLY F 3 46  ? 144.625 -58.263 -1.773  1.00 19.40 ? 342  GLY D CA    1 
ATOM   5808  C  C     . GLY F 3 46  ? 144.149 -57.322 -2.861  1.00 18.57 ? 342  GLY D C     1 
ATOM   5809  O  O     . GLY F 3 46  ? 143.200 -56.564 -2.666  1.00 18.02 ? 342  GLY D O     1 
ATOM   5810  N  N     . ARG F 3 47  ? 144.819 -57.377 -4.009  1.00 16.85 ? 343  ARG D N     1 
ATOM   5811  C  CA    . ARG F 3 47  ? 144.484 -56.535 -5.149  1.00 16.08 ? 343  ARG D CA    1 
ATOM   5812  C  C     . ARG F 3 47  ? 144.138 -57.450 -6.315  1.00 17.64 ? 343  ARG D C     1 
ATOM   5813  O  O     . ARG F 3 47  ? 144.880 -58.388 -6.612  1.00 17.29 ? 343  ARG D O     1 
ATOM   5814  C  CB    . ARG F 3 47  ? 145.673 -55.652 -5.515  1.00 15.32 ? 343  ARG D CB    1 
ATOM   5815  C  CG    . ARG F 3 47  ? 146.312 -54.956 -4.322  1.00 14.19 ? 343  ARG D CG    1 
ATOM   5816  C  CD    . ARG F 3 47  ? 147.259 -53.843 -4.766  1.00 16.06 ? 343  ARG D CD    1 
ATOM   5817  N  NE    . ARG F 3 47  ? 147.973 -53.254 -3.635  1.00 16.25 ? 343  ARG D NE    1 
ATOM   5818  C  CZ    . ARG F 3 47  ? 149.141 -53.691 -3.173  1.00 16.96 ? 343  ARG D CZ    1 
ATOM   5819  N  NH1   . ARG F 3 47  ? 149.743 -54.725 -3.746  1.00 16.99 ? 343  ARG D NH1   1 
ATOM   5820  N  NH2   . ARG F 3 47  ? 149.709 -53.094 -2.132  1.00 20.84 ? 343  ARG D NH2   1 
ATOM   5821  N  N     . PHE F 3 48  ? 143.021 -57.180 -6.979  1.00 14.99 ? 344  PHE D N     1 
ATOM   5822  C  CA    . PHE F 3 48  ? 142.595 -58.029 -8.085  1.00 15.89 ? 344  PHE D CA    1 
ATOM   5823  C  C     . PHE F 3 48  ? 142.149 -57.268 -9.327  1.00 16.52 ? 344  PHE D C     1 
ATOM   5824  O  O     . PHE F 3 48  ? 141.606 -56.162 -9.234  1.00 16.14 ? 344  PHE D O     1 
ATOM   5825  C  CB    . PHE F 3 48  ? 141.438 -58.931 -7.629  1.00 15.22 ? 344  PHE D CB    1 
ATOM   5826  C  CG    . PHE F 3 48  ? 141.610 -59.487 -6.243  1.00 16.11 ? 344  PHE D CG    1 
ATOM   5827  C  CD1   . PHE F 3 48  ? 141.280 -58.723 -5.126  1.00 16.75 ? 344  PHE D CD1   1 
ATOM   5828  C  CD2   . PHE F 3 48  ? 142.112 -60.771 -6.052  1.00 16.56 ? 344  PHE D CD2   1 
ATOM   5829  C  CE1   . PHE F 3 48  ? 141.448 -59.231 -3.835  1.00 17.92 ? 344  PHE D CE1   1 
ATOM   5830  C  CE2   . PHE F 3 48  ? 142.285 -61.286 -4.767  1.00 16.29 ? 344  PHE D CE2   1 
ATOM   5831  C  CZ    . PHE F 3 48  ? 141.953 -60.516 -3.659  1.00 17.83 ? 344  PHE D CZ    1 
ATOM   5832  N  N     . PHE F 3 49  ? 142.390 -57.869 -10.489 1.00 15.21 ? 345  PHE D N     1 
ATOM   5833  C  CA    . PHE F 3 49  ? 141.956 -57.299 -11.758 1.00 15.10 ? 345  PHE D CA    1 
ATOM   5834  C  C     . PHE F 3 49  ? 141.037 -58.349 -12.366 1.00 16.45 ? 345  PHE D C     1 
ATOM   5835  O  O     . PHE F 3 49  ? 141.357 -59.543 -12.359 1.00 15.19 ? 345  PHE D O     1 
ATOM   5836  C  CB    . PHE F 3 49  ? 143.124 -57.051 -12.715 1.00 14.20 ? 345  PHE D CB    1 
ATOM   5837  C  CG    . PHE F 3 49  ? 142.685 -56.712 -14.120 1.00 15.10 ? 345  PHE D CG    1 
ATOM   5838  C  CD1   . PHE F 3 49  ? 142.215 -55.441 -14.433 1.00 13.81 ? 345  PHE D CD1   1 
ATOM   5839  C  CD2   . PHE F 3 49  ? 142.724 -57.674 -15.125 1.00 16.54 ? 345  PHE D CD2   1 
ATOM   5840  C  CE1   . PHE F 3 49  ? 141.789 -55.128 -15.726 1.00 15.14 ? 345  PHE D CE1   1 
ATOM   5841  C  CE2   . PHE F 3 49  ? 142.302 -57.376 -16.418 1.00 16.62 ? 345  PHE D CE2   1 
ATOM   5842  C  CZ    . PHE F 3 49  ? 141.832 -56.096 -16.721 1.00 16.87 ? 345  PHE D CZ    1 
ATOM   5843  N  N     . LEU F 3 50  ? 139.901 -57.903 -12.886 1.00 15.21 ? 346  LEU D N     1 
ATOM   5844  C  CA    . LEU F 3 50  ? 138.930 -58.800 -13.493 1.00 15.51 ? 346  LEU D CA    1 
ATOM   5845  C  C     . LEU F 3 50  ? 138.513 -58.287 -14.857 1.00 16.72 ? 346  LEU D C     1 
ATOM   5846  O  O     . LEU F 3 50  ? 138.343 -57.081 -15.045 1.00 15.87 ? 346  LEU D O     1 
ATOM   5847  C  CB    . LEU F 3 50  ? 137.684 -58.910 -12.615 1.00 16.46 ? 346  LEU D CB    1 
ATOM   5848  C  CG    . LEU F 3 50  ? 137.755 -59.709 -11.315 1.00 19.66 ? 346  LEU D CG    1 
ATOM   5849  C  CD1   . LEU F 3 50  ? 136.625 -59.290 -10.385 1.00 18.67 ? 346  LEU D CD1   1 
ATOM   5850  C  CD2   . LEU F 3 50  ? 137.664 -61.199 -11.635 1.00 18.10 ? 346  LEU D CD2   1 
ATOM   5851  N  N     . ARG F 3 51  ? 138.349 -59.200 -15.808 1.00 17.14 ? 347  ARG D N     1 
ATOM   5852  C  CA    . ARG F 3 51  ? 137.903 -58.812 -17.139 1.00 18.68 ? 347  ARG D CA    1 
ATOM   5853  C  C     . ARG F 3 51  ? 136.394 -58.652 -17.001 1.00 19.33 ? 347  ARG D C     1 
ATOM   5854  O  O     . ARG F 3 51  ? 135.757 -59.410 -16.269 1.00 17.79 ? 347  ARG D O     1 
ATOM   5855  C  CB    . ARG F 3 51  ? 138.233 -59.907 -18.158 1.00 19.95 ? 347  ARG D CB    1 
ATOM   5856  C  CG    . ARG F 3 51  ? 139.712 -60.271 -18.199 1.00 25.09 ? 347  ARG D CG    1 
ATOM   5857  C  CD    . ARG F 3 51  ? 140.035 -61.246 -19.325 1.00 29.14 ? 347  ARG D CD    1 
ATOM   5858  N  NE    . ARG F 3 51  ? 141.451 -61.621 -19.327 1.00 34.33 ? 347  ARG D NE    1 
ATOM   5859  C  CZ    . ARG F 3 51  ? 142.006 -62.488 -18.483 1.00 34.93 ? 347  ARG D CZ    1 
ATOM   5860  N  NH1   . ARG F 3 51  ? 141.268 -63.089 -17.559 1.00 34.42 ? 347  ARG D NH1   1 
ATOM   5861  N  NH2   . ARG F 3 51  ? 143.305 -62.753 -18.558 1.00 35.78 ? 347  ARG D NH2   1 
ATOM   5862  N  N     . PRO F 3 52  ? 135.798 -57.676 -17.703 1.00 20.76 ? 348  PRO D N     1 
ATOM   5863  C  CA    . PRO F 3 52  ? 134.353 -57.462 -17.611 1.00 22.96 ? 348  PRO D CA    1 
ATOM   5864  C  C     . PRO F 3 52  ? 133.478 -58.671 -17.940 1.00 23.98 ? 348  PRO D C     1 
ATOM   5865  O  O     . PRO F 3 52  ? 132.526 -58.956 -17.213 1.00 23.29 ? 348  PRO D O     1 
ATOM   5866  C  CB    . PRO F 3 52  ? 134.116 -56.272 -18.543 1.00 24.61 ? 348  PRO D CB    1 
ATOM   5867  C  CG    . PRO F 3 52  ? 135.208 -56.419 -19.558 1.00 23.77 ? 348  PRO D CG    1 
ATOM   5868  C  CD    . PRO F 3 52  ? 136.393 -56.765 -18.692 1.00 22.11 ? 348  PRO D CD    1 
ATOM   5869  N  N     . GLU F 3 53  ? 133.802 -59.387 -19.012 1.00 25.27 ? 349  GLU D N     1 
ATOM   5870  C  CA    . GLU F 3 53  ? 133.015 -60.554 -19.411 1.00 28.49 ? 349  GLU D CA    1 
ATOM   5871  C  C     . GLU F 3 53  ? 133.001 -61.654 -18.350 1.00 28.85 ? 349  GLU D C     1 
ATOM   5872  O  O     . GLU F 3 53  ? 132.105 -62.501 -18.331 1.00 29.72 ? 349  GLU D O     1 
ATOM   5873  C  CB    . GLU F 3 53  ? 133.531 -61.121 -20.746 1.00 31.03 ? 349  GLU D CB    1 
ATOM   5874  C  CG    . GLU F 3 53  ? 135.029 -61.400 -20.795 1.00 35.92 ? 349  GLU D CG    1 
ATOM   5875  C  CD    . GLU F 3 53  ? 135.848 -60.180 -21.191 1.00 38.91 ? 349  GLU D CD    1 
ATOM   5876  O  OE1   . GLU F 3 53  ? 135.274 -59.077 -21.308 1.00 42.04 ? 349  GLU D OE1   1 
ATOM   5877  O  OE2   . GLU F 3 53  ? 137.073 -60.327 -21.386 1.00 42.08 ? 349  GLU D OE2   1 
ATOM   5878  N  N     . THR F 3 54  ? 133.991 -61.631 -17.466 1.00 28.11 ? 350  THR D N     1 
ATOM   5879  C  CA    . THR F 3 54  ? 134.097 -62.610 -16.390 1.00 27.36 ? 350  THR D CA    1 
ATOM   5880  C  C     . THR F 3 54  ? 133.327 -62.150 -15.149 1.00 25.43 ? 350  THR D C     1 
ATOM   5881  O  O     . THR F 3 54  ? 132.463 -62.863 -14.638 1.00 25.85 ? 350  THR D O     1 
ATOM   5882  C  CB    . THR F 3 54  ? 135.573 -62.828 -15.987 1.00 28.15 ? 350  THR D CB    1 
ATOM   5883  O  OG1   . THR F 3 54  ? 136.297 -63.370 -17.098 1.00 31.08 ? 350  THR D OG1   1 
ATOM   5884  C  CG2   . THR F 3 54  ? 135.677 -63.785 -14.805 1.00 28.38 ? 350  THR D CG2   1 
ATOM   5885  N  N     . ALA F 3 55  ? 133.640 -60.950 -14.676 1.00 22.14 ? 351  ALA D N     1 
ATOM   5886  C  CA    . ALA F 3 55  ? 132.999 -60.406 -13.484 1.00 21.19 ? 351  ALA D CA    1 
ATOM   5887  C  C     . ALA F 3 55  ? 131.511 -60.082 -13.619 1.00 18.94 ? 351  ALA D C     1 
ATOM   5888  O  O     . ALA F 3 55  ? 130.704 -60.505 -12.793 1.00 18.10 ? 351  ALA D O     1 
ATOM   5889  C  CB    . ALA F 3 55  ? 133.751 -59.164 -13.024 1.00 20.08 ? 351  ALA D CB    1 
ATOM   5890  N  N     . LEU F 3 56  ? 131.147 -59.339 -14.658 1.00 18.48 ? 352  LEU D N     1 
ATOM   5891  C  CA    . LEU F 3 56  ? 129.758 -58.931 -14.845 1.00 18.36 ? 352  LEU D CA    1 
ATOM   5892  C  C     . LEU F 3 56  ? 128.767 -60.034 -15.209 1.00 18.86 ? 352  LEU D C     1 
ATOM   5893  O  O     . LEU F 3 56  ? 127.556 -59.796 -15.236 1.00 19.35 ? 352  LEU D O     1 
ATOM   5894  C  CB    . LEU F 3 56  ? 129.693 -57.798 -15.873 1.00 18.61 ? 352  LEU D CB    1 
ATOM   5895  C  CG    . LEU F 3 56  ? 130.604 -56.615 -15.512 1.00 18.32 ? 352  LEU D CG    1 
ATOM   5896  C  CD1   . LEU F 3 56  ? 130.383 -55.470 -16.489 1.00 18.45 ? 352  LEU D CD1   1 
ATOM   5897  C  CD2   . LEU F 3 56  ? 130.317 -56.161 -14.087 1.00 18.31 ? 352  LEU D CD2   1 
ATOM   5898  N  N     . ALA F 3 57  ? 129.272 -61.232 -15.489 1.00 17.72 ? 353  ALA D N     1 
ATOM   5899  C  CA    . ALA F 3 57  ? 128.411 -62.363 -15.824 1.00 17.42 ? 353  ALA D CA    1 
ATOM   5900  C  C     . ALA F 3 57  ? 128.407 -63.343 -14.653 1.00 18.65 ? 353  ALA D C     1 
ATOM   5901  O  O     . ALA F 3 57  ? 127.701 -64.353 -14.672 1.00 19.29 ? 353  ALA D O     1 
ATOM   5902  C  CB    . ALA F 3 57  ? 128.908 -63.058 -17.088 1.00 18.46 ? 353  ALA D CB    1 
ATOM   5903  N  N     . ASP F 3 58  ? 129.203 -63.037 -13.634 1.00 18.49 ? 354  ASP D N     1 
ATOM   5904  C  CA    . ASP F 3 58  ? 129.284 -63.884 -12.453 1.00 19.38 ? 354  ASP D CA    1 
ATOM   5905  C  C     . ASP F 3 58  ? 128.169 -63.495 -11.494 1.00 19.66 ? 354  ASP D C     1 
ATOM   5906  O  O     . ASP F 3 58  ? 128.056 -62.330 -11.102 1.00 19.59 ? 354  ASP D O     1 
ATOM   5907  C  CB    . ASP F 3 58  ? 130.643 -63.722 -11.771 1.00 18.99 ? 354  ASP D CB    1 
ATOM   5908  C  CG    . ASP F 3 58  ? 130.779 -64.586 -10.533 1.00 20.78 ? 354  ASP D CG    1 
ATOM   5909  O  OD1   . ASP F 3 58  ? 130.170 -64.252 -9.497  1.00 20.70 ? 354  ASP D OD1   1 
ATOM   5910  O  OD2   . ASP F 3 58  ? 131.487 -65.610 -10.602 1.00 21.20 ? 354  ASP D OD2   1 
ATOM   5911  N  N     . PRO F 3 59  ? 127.332 -64.471 -11.097 1.00 19.47 ? 355  PRO D N     1 
ATOM   5912  C  CA    . PRO F 3 59  ? 126.200 -64.277 -10.181 1.00 19.49 ? 355  PRO D CA    1 
ATOM   5913  C  C     . PRO F 3 59  ? 126.607 -63.647 -8.849  1.00 20.05 ? 355  PRO D C     1 
ATOM   5914  O  O     . PRO F 3 59  ? 125.974 -62.701 -8.371  1.00 19.52 ? 355  PRO D O     1 
ATOM   5915  C  CB    . PRO F 3 59  ? 125.633 -65.689 -10.002 1.00 20.87 ? 355  PRO D CB    1 
ATOM   5916  C  CG    . PRO F 3 59  ? 126.096 -66.421 -11.206 1.00 21.30 ? 355  PRO D CG    1 
ATOM   5917  C  CD    . PRO F 3 59  ? 127.483 -65.895 -11.441 1.00 19.83 ? 355  PRO D CD    1 
ATOM   5918  N  N     . GLN F 3 60  ? 127.665 -64.185 -8.251  1.00 19.60 ? 356  GLN D N     1 
ATOM   5919  C  CA    . GLN F 3 60  ? 128.142 -63.683 -6.971  1.00 18.96 ? 356  GLN D CA    1 
ATOM   5920  C  C     . GLN F 3 60  ? 128.706 -62.268 -7.055  1.00 18.06 ? 356  GLN D C     1 
ATOM   5921  O  O     . GLN F 3 60  ? 128.497 -61.466 -6.143  1.00 17.21 ? 356  GLN D O     1 
ATOM   5922  C  CB    . GLN F 3 60  ? 129.191 -64.631 -6.389  1.00 19.85 ? 356  GLN D CB    1 
ATOM   5923  C  CG    . GLN F 3 60  ? 128.613 -65.947 -5.876  1.00 22.82 ? 356  GLN D CG    1 
ATOM   5924  C  CD    . GLN F 3 60  ? 127.903 -66.734 -6.962  1.00 24.11 ? 356  GLN D CD    1 
ATOM   5925  O  OE1   . GLN F 3 60  ? 128.501 -67.090 -7.976  1.00 27.92 ? 356  GLN D OE1   1 
ATOM   5926  N  NE2   . GLN F 3 60  ? 126.620 -67.008 -6.755  1.00 25.51 ? 356  GLN D NE2   1 
ATOM   5927  N  N     . PHE F 3 61  ? 129.415 -61.953 -8.137  1.00 16.65 ? 357  PHE D N     1 
ATOM   5928  C  CA    . PHE F 3 61  ? 129.969 -60.610 -8.275  1.00 16.17 ? 357  PHE D CA    1 
ATOM   5929  C  C     . PHE F 3 61  ? 128.849 -59.592 -8.485  1.00 15.76 ? 357  PHE D C     1 
ATOM   5930  O  O     . PHE F 3 61  ? 128.889 -58.492 -7.926  1.00 13.54 ? 357  PHE D O     1 
ATOM   5931  C  CB    . PHE F 3 61  ? 130.956 -60.527 -9.439  1.00 17.93 ? 357  PHE D CB    1 
ATOM   5932  C  CG    . PHE F 3 61  ? 131.799 -59.278 -9.416  1.00 19.39 ? 357  PHE D CG    1 
ATOM   5933  C  CD1   . PHE F 3 61  ? 132.876 -59.173 -8.546  1.00 18.80 ? 357  PHE D CD1   1 
ATOM   5934  C  CD2   . PHE F 3 61  ? 131.498 -58.199 -10.243 1.00 18.90 ? 357  PHE D CD2   1 
ATOM   5935  C  CE1   . PHE F 3 61  ? 133.648 -58.005 -8.494  1.00 21.23 ? 357  PHE D CE1   1 
ATOM   5936  C  CE2   . PHE F 3 61  ? 132.264 -57.023 -10.199 1.00 18.65 ? 357  PHE D CE2   1 
ATOM   5937  C  CZ    . PHE F 3 61  ? 133.337 -56.929 -9.325  1.00 18.20 ? 357  PHE D CZ    1 
ATOM   5938  N  N     . VAL F 3 62  ? 127.852 -59.956 -9.291  1.00 14.77 ? 358  VAL D N     1 
ATOM   5939  C  CA    . VAL F 3 62  ? 126.716 -59.068 -9.541  1.00 15.44 ? 358  VAL D CA    1 
ATOM   5940  C  C     . VAL F 3 62  ? 125.966 -58.809 -8.233  1.00 15.29 ? 358  VAL D C     1 
ATOM   5941  O  O     . VAL F 3 62  ? 125.584 -57.673 -7.942  1.00 14.22 ? 358  VAL D O     1 
ATOM   5942  C  CB    . VAL F 3 62  ? 125.731 -59.666 -10.586 1.00 15.80 ? 358  VAL D CB    1 
ATOM   5943  C  CG1   . VAL F 3 62  ? 124.454 -58.828 -10.647 1.00 15.85 ? 358  VAL D CG1   1 
ATOM   5944  C  CG2   . VAL F 3 62  ? 126.394 -59.702 -11.965 1.00 15.92 ? 358  VAL D CG2   1 
ATOM   5945  N  N     . ALA F 3 63  ? 125.761 -59.859 -7.441  1.00 15.01 ? 359  ALA D N     1 
ATOM   5946  C  CA    . ALA F 3 63  ? 125.063 -59.709 -6.168  1.00 15.65 ? 359  ALA D CA    1 
ATOM   5947  C  C     . ALA F 3 63  ? 125.839 -58.763 -5.252  1.00 15.75 ? 359  ALA D C     1 
ATOM   5948  O  O     . ALA F 3 63  ? 125.252 -57.901 -4.594  1.00 16.37 ? 359  ALA D O     1 
ATOM   5949  C  CB    . ALA F 3 63  ? 124.889 -61.074 -5.491  1.00 16.24 ? 359  ALA D CB    1 
ATOM   5950  N  N     . TRP F 3 64  ? 127.158 -58.934 -5.216  1.00 14.46 ? 360  TRP D N     1 
ATOM   5951  C  CA    . TRP F 3 64  ? 128.029 -58.102 -4.390  1.00 13.92 ? 360  TRP D CA    1 
ATOM   5952  C  C     . TRP F 3 64  ? 127.915 -56.627 -4.800  1.00 13.76 ? 360  TRP D C     1 
ATOM   5953  O  O     . TRP F 3 64  ? 127.789 -55.739 -3.955  1.00 12.77 ? 360  TRP D O     1 
ATOM   5954  C  CB    . TRP F 3 64  ? 129.479 -58.582 -4.533  1.00 12.99 ? 360  TRP D CB    1 
ATOM   5955  C  CG    . TRP F 3 64  ? 130.477 -57.761 -3.768  1.00 12.79 ? 360  TRP D CG    1 
ATOM   5956  C  CD1   . TRP F 3 64  ? 130.747 -57.827 -2.431  1.00 12.67 ? 360  TRP D CD1   1 
ATOM   5957  C  CD2   . TRP F 3 64  ? 131.326 -56.740 -4.301  1.00 13.97 ? 360  TRP D CD2   1 
ATOM   5958  N  NE1   . TRP F 3 64  ? 131.716 -56.904 -2.097  1.00 14.92 ? 360  TRP D NE1   1 
ATOM   5959  C  CE2   . TRP F 3 64  ? 132.087 -56.223 -3.227  1.00 13.58 ? 360  TRP D CE2   1 
ATOM   5960  C  CE3   . TRP F 3 64  ? 131.517 -56.208 -5.584  1.00 12.60 ? 360  TRP D CE3   1 
ATOM   5961  C  CZ2   . TRP F 3 64  ? 133.026 -55.200 -3.399  1.00 12.31 ? 360  TRP D CZ2   1 
ATOM   5962  C  CZ3   . TRP F 3 64  ? 132.451 -55.191 -5.755  1.00 12.43 ? 360  TRP D CZ3   1 
ATOM   5963  C  CH2   . TRP F 3 64  ? 133.192 -54.699 -4.668  1.00 14.39 ? 360  TRP D CH2   1 
ATOM   5964  N  N     . LEU F 3 65  ? 127.962 -56.366 -6.103  1.00 14.30 ? 361  LEU D N     1 
ATOM   5965  C  CA    . LEU F 3 65  ? 127.847 -55.000 -6.600  1.00 13.29 ? 361  LEU D CA    1 
ATOM   5966  C  C     . LEU F 3 65  ? 126.554 -54.356 -6.120  1.00 14.60 ? 361  LEU D C     1 
ATOM   5967  O  O     . LEU F 3 65  ? 126.537 -53.186 -5.735  1.00 13.98 ? 361  LEU D O     1 
ATOM   5968  C  CB    . LEU F 3 65  ? 127.859 -54.979 -8.130  1.00 12.99 ? 361  LEU D CB    1 
ATOM   5969  C  CG    . LEU F 3 65  ? 129.177 -55.246 -8.852  1.00 10.77 ? 361  LEU D CG    1 
ATOM   5970  C  CD1   . LEU F 3 65  ? 128.918 -55.309 -10.362 1.00 10.53 ? 361  LEU D CD1   1 
ATOM   5971  C  CD2   . LEU F 3 65  ? 130.177 -54.138 -8.513  1.00 11.56 ? 361  LEU D CD2   1 
ATOM   5972  N  N     . GLY F 3 66  ? 125.471 -55.130 -6.142  1.00 13.81 ? 362  GLY D N     1 
ATOM   5973  C  CA    . GLY F 3 66  ? 124.181 -54.602 -5.738  1.00 14.66 ? 362  GLY D CA    1 
ATOM   5974  C  C     . GLY F 3 66  ? 123.822 -54.680 -4.265  1.00 15.46 ? 362  GLY D C     1 
ATOM   5975  O  O     . GLY F 3 66  ? 122.711 -54.304 -3.886  1.00 14.93 ? 362  GLY D O     1 
ATOM   5976  N  N     . ASP F 3 67  ? 124.743 -55.163 -3.435  1.00 13.36 ? 363  ASP D N     1 
ATOM   5977  C  CA    . ASP F 3 67  ? 124.489 -55.280 -1.999  1.00 16.70 ? 363  ASP D CA    1 
ATOM   5978  C  C     . ASP F 3 67  ? 124.892 -53.977 -1.301  1.00 16.61 ? 363  ASP D C     1 
ATOM   5979  O  O     . ASP F 3 67  ? 126.080 -53.665 -1.198  1.00 14.46 ? 363  ASP D O     1 
ATOM   5980  C  CB    . ASP F 3 67  ? 125.299 -56.441 -1.411  1.00 16.65 ? 363  ASP D CB    1 
ATOM   5981  C  CG    . ASP F 3 67  ? 124.899 -56.771 0.020   1.00 18.56 ? 363  ASP D CG    1 
ATOM   5982  O  OD1   . ASP F 3 67  ? 124.391 -55.876 0.728   1.00 15.63 ? 363  ASP D OD1   1 
ATOM   5983  O  OD2   . ASP F 3 67  ? 125.103 -57.932 0.435   1.00 18.83 ? 363  ASP D OD2   1 
ATOM   5984  N  N     . GLU F 3 68  ? 123.903 -53.228 -0.823  1.00 17.05 ? 364  GLU D N     1 
ATOM   5985  C  CA    . GLU F 3 68  ? 124.162 -51.957 -0.149  1.00 19.94 ? 364  GLU D CA    1 
ATOM   5986  C  C     . GLU F 3 68  ? 125.031 -52.089 1.102   1.00 17.87 ? 364  GLU D C     1 
ATOM   5987  O  O     . GLU F 3 68  ? 125.635 -51.110 1.543   1.00 17.76 ? 364  GLU D O     1 
ATOM   5988  C  CB    . GLU F 3 68  ? 122.839 -51.276 0.225   1.00 24.07 ? 364  GLU D CB    1 
ATOM   5989  C  CG    . GLU F 3 68  ? 121.953 -52.115 1.141   1.00 33.91 ? 364  GLU D CG    1 
ATOM   5990  C  CD    . GLU F 3 68  ? 120.648 -51.420 1.509   1.00 39.16 ? 364  GLU D CD    1 
ATOM   5991  O  OE1   . GLU F 3 68  ? 119.915 -50.991 0.589   1.00 41.83 ? 364  GLU D OE1   1 
ATOM   5992  O  OE2   . GLU F 3 68  ? 120.353 -51.310 2.720   1.00 42.67 ? 364  GLU D OE2   1 
ATOM   5993  N  N     . THR F 3 69  ? 125.100 -53.287 1.675   1.00 17.72 ? 365  THR D N     1 
ATOM   5994  C  CA    . THR F 3 69  ? 125.898 -53.495 2.880   1.00 17.58 ? 365  THR D CA    1 
ATOM   5995  C  C     . THR F 3 69  ? 127.367 -53.779 2.580   1.00 17.40 ? 365  THR D C     1 
ATOM   5996  O  O     . THR F 3 69  ? 128.194 -53.831 3.491   1.00 18.95 ? 365  THR D O     1 
ATOM   5997  C  CB    . THR F 3 69  ? 125.329 -54.637 3.750   1.00 18.53 ? 365  THR D CB    1 
ATOM   5998  O  OG1   . THR F 3 69  ? 125.418 -55.877 3.040   1.00 18.89 ? 365  THR D OG1   1 
ATOM   5999  C  CG2   . THR F 3 69  ? 123.871 -54.354 4.102   1.00 19.29 ? 365  THR D CG2   1 
ATOM   6000  N  N     . LYS F 3 70  ? 127.693 -53.969 1.305   1.00 16.29 ? 366  LYS D N     1 
ATOM   6001  C  CA    . LYS F 3 70  ? 129.078 -54.199 0.898   1.00 15.88 ? 366  LYS D CA    1 
ATOM   6002  C  C     . LYS F 3 70  ? 129.538 -52.824 0.419   1.00 14.70 ? 366  LYS D C     1 
ATOM   6003  O  O     . LYS F 3 70  ? 129.179 -52.390 -0.672  1.00 15.48 ? 366  LYS D O     1 
ATOM   6004  C  CB    . LYS F 3 70  ? 129.151 -55.215 -0.250  1.00 16.20 ? 366  LYS D CB    1 
ATOM   6005  C  CG    . LYS F 3 70  ? 128.479 -56.555 0.052   1.00 18.48 ? 366  LYS D CG    1 
ATOM   6006  C  CD    . LYS F 3 70  ? 129.067 -57.232 1.283   1.00 19.38 ? 366  LYS D CD    1 
ATOM   6007  C  CE    . LYS F 3 70  ? 128.299 -58.507 1.625   1.00 21.00 ? 366  LYS D CE    1 
ATOM   6008  N  NZ    . LYS F 3 70  ? 128.844 -59.172 2.838   1.00 22.74 ? 366  LYS D NZ    1 
ATOM   6009  N  N     . LYS F 3 71  ? 130.327 -52.142 1.243   1.00 14.27 ? 367  LYS D N     1 
ATOM   6010  C  CA    . LYS F 3 71  ? 130.781 -50.792 0.923   1.00 14.64 ? 367  LYS D CA    1 
ATOM   6011  C  C     . LYS F 3 71  ? 131.930 -50.698 -0.071  1.00 14.02 ? 367  LYS D C     1 
ATOM   6012  O  O     . LYS F 3 71  ? 132.919 -51.431 0.020   1.00 14.39 ? 367  LYS D O     1 
ATOM   6013  C  CB    . LYS F 3 71  ? 131.168 -50.056 2.211   1.00 15.74 ? 367  LYS D CB    1 
ATOM   6014  C  CG    . LYS F 3 71  ? 130.100 -50.101 3.296   1.00 16.38 ? 367  LYS D CG    1 
ATOM   6015  C  CD    . LYS F 3 71  ? 128.785 -49.519 2.789   1.00 17.91 ? 367  LYS D CD    1 
ATOM   6016  C  CE    . LYS F 3 71  ? 127.695 -49.592 3.844   1.00 20.41 ? 367  LYS D CE    1 
ATOM   6017  N  NZ    . LYS F 3 71  ? 126.423 -49.012 3.329   1.00 19.80 ? 367  LYS D NZ    1 
ATOM   6018  N  N     . LYS F 3 72  ? 131.791 -49.774 -1.016  1.00 12.30 ? 368  LYS D N     1 
ATOM   6019  C  CA    . LYS F 3 72  ? 132.818 -49.556 -2.021  1.00 12.81 ? 368  LYS D CA    1 
ATOM   6020  C  C     . LYS F 3 72  ? 133.294 -48.104 -2.037  1.00 11.21 ? 368  LYS D C     1 
ATOM   6021  O  O     . LYS F 3 72  ? 132.489 -47.177 -1.942  1.00 11.66 ? 368  LYS D O     1 
ATOM   6022  C  CB    . LYS F 3 72  ? 132.289 -49.896 -3.423  1.00 12.41 ? 368  LYS D CB    1 
ATOM   6023  C  CG    . LYS F 3 72  ? 131.802 -51.320 -3.616  1.00 12.79 ? 368  LYS D CG    1 
ATOM   6024  C  CD    . LYS F 3 72  ? 130.312 -51.448 -3.346  1.00 12.72 ? 368  LYS D CD    1 
ATOM   6025  C  CE    . LYS F 3 72  ? 129.831 -52.871 -3.630  1.00 12.83 ? 368  LYS D CE    1 
ATOM   6026  N  NZ    . LYS F 3 72  ? 128.415 -53.064 -3.209  1.00 10.63 ? 368  LYS D NZ    1 
ATOM   6027  N  N     . SER F 3 73  ? 134.602 -47.913 -2.153  1.00 10.37 ? 369  SER D N     1 
ATOM   6028  C  CA    . SER F 3 73  ? 135.160 -46.572 -2.268  1.00 10.92 ? 369  SER D CA    1 
ATOM   6029  C  C     . SER F 3 73  ? 135.539 -46.498 -3.751  1.00 10.76 ? 369  SER D C     1 
ATOM   6030  O  O     . SER F 3 73  ? 136.108 -47.444 -4.299  1.00 10.66 ? 369  SER D O     1 
ATOM   6031  C  CB    . SER F 3 73  ? 136.379 -46.403 -1.346  1.00 13.13 ? 369  SER D CB    1 
ATOM   6032  O  OG    . SER F 3 73  ? 137.353 -47.407 -1.576  1.00 21.78 ? 369  SER D OG    1 
ATOM   6033  N  N     . MET F 3 74  ? 135.209 -45.387 -4.407  1.00 9.67  ? 370  MET D N     1 
ATOM   6034  C  CA    . MET F 3 74  ? 135.478 -45.246 -5.832  1.00 9.83  ? 370  MET D CA    1 
ATOM   6035  C  C     . MET F 3 74  ? 135.858 -43.824 -6.222  1.00 9.98  ? 370  MET D C     1 
ATOM   6036  O  O     . MET F 3 74  ? 135.948 -42.932 -5.378  1.00 9.72  ? 370  MET D O     1 
ATOM   6037  C  CB    . MET F 3 74  ? 134.229 -45.646 -6.639  1.00 9.67  ? 370  MET D CB    1 
ATOM   6038  C  CG    . MET F 3 74  ? 133.606 -46.993 -6.266  1.00 10.82 ? 370  MET D CG    1 
ATOM   6039  S  SD    . MET F 3 74  ? 132.126 -47.378 -7.261  1.00 11.79 ? 370  MET D SD    1 
ATOM   6040  C  CE    . MET F 3 74  ? 132.924 -47.725 -8.846  1.00 8.33  ? 370  MET D CE    1 
ATOM   6041  N  N     . PHE F 3 75  ? 136.082 -43.635 -7.518  1.00 9.45  ? 371  PHE D N     1 
ATOM   6042  C  CA    . PHE F 3 75  ? 136.377 -42.326 -8.073  1.00 11.43 ? 371  PHE D CA    1 
ATOM   6043  C  C     . PHE F 3 75  ? 135.365 -42.193 -9.213  1.00 12.14 ? 371  PHE D C     1 
ATOM   6044  O  O     . PHE F 3 75  ? 135.392 -42.981 -10.164 1.00 11.77 ? 371  PHE D O     1 
ATOM   6045  C  CB    . PHE F 3 75  ? 137.805 -42.248 -8.620  1.00 10.10 ? 371  PHE D CB    1 
ATOM   6046  C  CG    . PHE F 3 75  ? 138.156 -40.896 -9.196  1.00 8.63  ? 371  PHE D CG    1 
ATOM   6047  C  CD1   . PHE F 3 75  ? 138.768 -39.921 -8.405  1.00 9.15  ? 371  PHE D CD1   1 
ATOM   6048  C  CD2   . PHE F 3 75  ? 137.855 -40.592 -10.522 1.00 8.03  ? 371  PHE D CD2   1 
ATOM   6049  C  CE1   . PHE F 3 75  ? 139.073 -38.662 -8.931  1.00 8.57  ? 371  PHE D CE1   1 
ATOM   6050  C  CE2   . PHE F 3 75  ? 138.153 -39.340 -11.058 1.00 6.76  ? 371  PHE D CE2   1 
ATOM   6051  C  CZ    . PHE F 3 75  ? 138.762 -38.373 -10.263 1.00 7.33  ? 371  PHE D CZ    1 
ATOM   6052  N  N     . ASP F 3 76  ? 134.476 -41.204 -9.104  1.00 12.27 ? 372  ASP D N     1 
ATOM   6053  C  CA    . ASP F 3 76  ? 133.417 -40.962 -10.095 1.00 11.54 ? 372  ASP D CA    1 
ATOM   6054  C  C     . ASP F 3 76  ? 132.490 -42.178 -10.161 1.00 11.64 ? 372  ASP D C     1 
ATOM   6055  O  O     . ASP F 3 76  ? 132.372 -42.838 -11.199 1.00 10.32 ? 372  ASP D O     1 
ATOM   6056  C  CB    . ASP F 3 76  ? 134.009 -40.676 -11.483 1.00 12.39 ? 372  ASP D CB    1 
ATOM   6057  C  CG    . ASP F 3 76  ? 132.963 -40.160 -12.478 1.00 12.02 ? 372  ASP D CG    1 
ATOM   6058  O  OD1   . ASP F 3 76  ? 131.775 -40.028 -12.104 1.00 13.54 ? 372  ASP D OD1   1 
ATOM   6059  O  OD2   . ASP F 3 76  ? 133.327 -39.884 -13.641 1.00 11.04 ? 372  ASP D OD2   1 
ATOM   6060  N  N     . SER F 3 77  ? 131.827 -42.461 -9.041  1.00 10.42 ? 373  SER D N     1 
ATOM   6061  C  CA    . SER F 3 77  ? 130.917 -43.595 -8.951  1.00 10.51 ? 373  SER D CA    1 
ATOM   6062  C  C     . SER F 3 77  ? 129.694 -43.455 -9.858  1.00 10.37 ? 373  SER D C     1 
ATOM   6063  O  O     . SER F 3 77  ? 129.103 -44.457 -10.251 1.00 9.33  ? 373  SER D O     1 
ATOM   6064  C  CB    . SER F 3 77  ? 130.468 -43.803 -7.496  1.00 10.07 ? 373  SER D CB    1 
ATOM   6065  O  OG    . SER F 3 77  ? 129.772 -42.674 -6.996  1.00 12.24 ? 373  SER D OG    1 
ATOM   6066  N  N     . LYS F 3 78  ? 129.307 -42.223 -10.193 1.00 9.53  ? 374  LYS D N     1 
ATOM   6067  C  CA    . LYS F 3 78  ? 128.152 -42.038 -11.072 1.00 9.37  ? 374  LYS D CA    1 
ATOM   6068  C  C     . LYS F 3 78  ? 128.477 -42.620 -12.446 1.00 9.61  ? 374  LYS D C     1 
ATOM   6069  O  O     . LYS F 3 78  ? 127.631 -43.260 -13.071 1.00 7.85  ? 374  LYS D O     1 
ATOM   6070  C  CB    . LYS F 3 78  ? 127.771 -40.550 -11.199 1.00 10.02 ? 374  LYS D CB    1 
ATOM   6071  C  CG    . LYS F 3 78  ? 126.632 -40.297 -12.193 1.00 9.41  ? 374  LYS D CG    1 
ATOM   6072  C  CD    . LYS F 3 78  ? 125.883 -38.985 -11.930 1.00 8.69  ? 374  LYS D CD    1 
ATOM   6073  C  CE    . LYS F 3 78  ? 126.772 -37.742 -12.079 1.00 8.11  ? 374  LYS D CE    1 
ATOM   6074  N  NZ    . LYS F 3 78  ? 127.124 -37.431 -13.498 1.00 7.41  ? 374  LYS D NZ    1 
ATOM   6075  N  N     . ARG F 3 79  ? 129.706 -42.404 -12.908 1.00 8.00  ? 375  ARG D N     1 
ATOM   6076  C  CA    . ARG F 3 79  ? 130.142 -42.933 -14.199 1.00 8.92  ? 375  ARG D CA    1 
ATOM   6077  C  C     . ARG F 3 79  ? 129.981 -44.452 -14.191 1.00 10.18 ? 375  ARG D C     1 
ATOM   6078  O  O     . ARG F 3 79  ? 129.432 -45.036 -15.125 1.00 10.65 ? 375  ARG D O     1 
ATOM   6079  C  CB    . ARG F 3 79  ? 131.612 -42.549 -14.454 1.00 10.05 ? 375  ARG D CB    1 
ATOM   6080  C  CG    . ARG F 3 79  ? 132.309 -43.283 -15.616 1.00 9.71  ? 375  ARG D CG    1 
ATOM   6081  C  CD    . ARG F 3 79  ? 133.713 -42.698 -15.862 1.00 11.12 ? 375  ARG D CD    1 
ATOM   6082  N  NE    . ARG F 3 79  ? 133.623 -41.326 -16.368 1.00 10.87 ? 375  ARG D NE    1 
ATOM   6083  C  CZ    . ARG F 3 79  ? 133.551 -41.003 -17.656 1.00 12.01 ? 375  ARG D CZ    1 
ATOM   6084  N  NH1   . ARG F 3 79  ? 133.580 -41.949 -18.592 1.00 9.33  ? 375  ARG D NH1   1 
ATOM   6085  N  NH2   . ARG F 3 79  ? 133.409 -39.731 -18.010 1.00 7.87  ? 375  ARG D NH2   1 
ATOM   6086  N  N     . ALA F 3 80  ? 130.449 -45.086 -13.119 1.00 10.29 ? 376  ALA D N     1 
ATOM   6087  C  CA    . ALA F 3 80  ? 130.354 -46.539 -12.994 1.00 10.17 ? 376  ALA D CA    1 
ATOM   6088  C  C     . ALA F 3 80  ? 128.904 -47.010 -12.890 1.00 9.87  ? 376  ALA D C     1 
ATOM   6089  O  O     . ALA F 3 80  ? 128.507 -47.963 -13.564 1.00 10.14 ? 376  ALA D O     1 
ATOM   6090  C  CB    . ALA F 3 80  ? 131.142 -47.009 -11.774 1.00 8.56  ? 376  ALA D CB    1 
ATOM   6091  N  N     . ALA F 3 81  ? 128.119 -46.344 -12.047 1.00 8.76  ? 377  ALA D N     1 
ATOM   6092  C  CA    . ALA F 3 81  ? 126.720 -46.709 -11.846 1.00 10.79 ? 377  ALA D CA    1 
ATOM   6093  C  C     . ALA F 3 81  ? 125.905 -46.645 -13.132 1.00 10.50 ? 377  ALA D C     1 
ATOM   6094  O  O     . ALA F 3 81  ? 125.141 -47.562 -13.436 1.00 12.60 ? 377  ALA D O     1 
ATOM   6095  C  CB    . ALA F 3 81  ? 126.082 -45.807 -10.773 1.00 8.36  ? 377  ALA D CB    1 
ATOM   6096  N  N     . VAL F 3 82  ? 126.062 -45.566 -13.890 1.00 11.32 ? 378  VAL D N     1 
ATOM   6097  C  CA    . VAL F 3 82  ? 125.311 -45.419 -15.132 1.00 9.36  ? 378  VAL D CA    1 
ATOM   6098  C  C     . VAL F 3 82  ? 125.757 -46.453 -16.169 1.00 9.90  ? 378  VAL D C     1 
ATOM   6099  O  O     . VAL F 3 82  ? 124.926 -47.095 -16.791 1.00 11.44 ? 378  VAL D O     1 
ATOM   6100  C  CB    . VAL F 3 82  ? 125.458 -43.988 -15.706 1.00 9.79  ? 378  VAL D CB    1 
ATOM   6101  C  CG1   . VAL F 3 82  ? 124.801 -43.899 -17.083 1.00 9.37  ? 378  VAL D CG1   1 
ATOM   6102  C  CG2   . VAL F 3 82  ? 124.796 -42.981 -14.755 1.00 9.14  ? 378  VAL D CG2   1 
ATOM   6103  N  N     . ALA F 3 83  ? 127.063 -46.618 -16.348 1.00 9.91  ? 379  ALA D N     1 
ATOM   6104  C  CA    . ALA F 3 83  ? 127.559 -47.593 -17.314 1.00 10.50 ? 379  ALA D CA    1 
ATOM   6105  C  C     . ALA F 3 83  ? 127.032 -48.980 -16.957 1.00 11.31 ? 379  ALA D C     1 
ATOM   6106  O  O     . ALA F 3 83  ? 126.680 -49.764 -17.839 1.00 11.72 ? 379  ALA D O     1 
ATOM   6107  C  CB    . ALA F 3 83  ? 129.086 -47.600 -17.333 1.00 11.00 ? 379  ALA D CB    1 
ATOM   6108  N  N     . LEU F 3 84  ? 126.980 -49.285 -15.664 1.00 10.73 ? 380  LEU D N     1 
ATOM   6109  C  CA    . LEU F 3 84  ? 126.475 -50.581 -15.231 1.00 11.16 ? 380  LEU D CA    1 
ATOM   6110  C  C     . LEU F 3 84  ? 124.970 -50.678 -15.488 1.00 13.20 ? 380  LEU D C     1 
ATOM   6111  O  O     . LEU F 3 84  ? 124.479 -51.739 -15.892 1.00 12.79 ? 380  LEU D O     1 
ATOM   6112  C  CB    . LEU F 3 84  ? 126.807 -50.817 -13.748 1.00 10.48 ? 380  LEU D CB    1 
ATOM   6113  C  CG    . LEU F 3 84  ? 128.287 -51.138 -13.488 1.00 12.43 ? 380  LEU D CG    1 
ATOM   6114  C  CD1   . LEU F 3 84  ? 128.599 -51.126 -11.987 1.00 11.18 ? 380  LEU D CD1   1 
ATOM   6115  C  CD2   . LEU F 3 84  ? 128.609 -52.504 -14.093 1.00 13.14 ? 380  LEU D CD2   1 
ATOM   6116  N  N     . LYS F 3 85  ? 124.236 -49.583 -15.267 1.00 11.56 ? 381  LYS D N     1 
ATOM   6117  C  CA    . LYS F 3 85  ? 122.791 -49.584 -15.524 1.00 13.04 ? 381  LYS D CA    1 
ATOM   6118  C  C     . LYS F 3 85  ? 122.550 -49.959 -16.989 1.00 13.34 ? 381  LYS D C     1 
ATOM   6119  O  O     . LYS F 3 85  ? 121.626 -50.713 -17.302 1.00 13.16 ? 381  LYS D O     1 
ATOM   6120  C  CB    . LYS F 3 85  ? 122.169 -48.205 -15.269 1.00 14.53 ? 381  LYS D CB    1 
ATOM   6121  C  CG    . LYS F 3 85  ? 121.995 -47.820 -13.806 1.00 16.40 ? 381  LYS D CG    1 
ATOM   6122  C  CD    . LYS F 3 85  ? 121.471 -46.384 -13.696 1.00 15.69 ? 381  LYS D CD    1 
ATOM   6123  C  CE    . LYS F 3 85  ? 121.406 -45.901 -12.248 1.00 18.29 ? 381  LYS D CE    1 
ATOM   6124  N  NZ    . LYS F 3 85  ? 120.371 -46.619 -11.460 1.00 20.60 ? 381  LYS D NZ    1 
ATOM   6125  N  N     . TRP F 3 86  ? 123.380 -49.423 -17.881 1.00 13.40 ? 382  TRP D N     1 
ATOM   6126  C  CA    . TRP F 3 86  ? 123.249 -49.732 -19.306 1.00 13.93 ? 382  TRP D CA    1 
ATOM   6127  C  C     . TRP F 3 86  ? 123.599 -51.199 -19.569 1.00 15.50 ? 382  TRP D C     1 
ATOM   6128  O  O     . TRP F 3 86  ? 123.285 -51.736 -20.630 1.00 15.82 ? 382  TRP D O     1 
ATOM   6129  C  CB    . TRP F 3 86  ? 124.148 -48.828 -20.147 1.00 13.49 ? 382  TRP D CB    1 
ATOM   6130  C  CG    . TRP F 3 86  ? 123.612 -47.433 -20.353 1.00 15.17 ? 382  TRP D CG    1 
ATOM   6131  C  CD1   . TRP F 3 86  ? 123.958 -46.303 -19.660 1.00 15.38 ? 382  TRP D CD1   1 
ATOM   6132  C  CD2   . TRP F 3 86  ? 122.637 -47.027 -21.320 1.00 15.90 ? 382  TRP D CD2   1 
ATOM   6133  N  NE1   . TRP F 3 86  ? 123.256 -45.218 -20.142 1.00 12.57 ? 382  TRP D NE1   1 
ATOM   6134  C  CE2   . TRP F 3 86  ? 122.439 -45.637 -21.160 1.00 14.49 ? 382  TRP D CE2   1 
ATOM   6135  C  CE3   . TRP F 3 86  ? 121.908 -47.706 -22.309 1.00 15.34 ? 382  TRP D CE3   1 
ATOM   6136  C  CZ2   . TRP F 3 86  ? 121.542 -44.912 -21.951 1.00 16.48 ? 382  TRP D CZ2   1 
ATOM   6137  C  CZ3   . TRP F 3 86  ? 121.017 -46.984 -23.095 1.00 18.82 ? 382  TRP D CZ3   1 
ATOM   6138  C  CH2   . TRP F 3 86  ? 120.842 -45.600 -22.911 1.00 18.91 ? 382  TRP D CH2   1 
ATOM   6139  N  N     . LYS F 3 87  ? 124.252 -51.836 -18.601 1.00 16.28 ? 383  LYS D N     1 
ATOM   6140  C  CA    . LYS F 3 87  ? 124.619 -53.247 -18.707 1.00 17.32 ? 383  LYS D CA    1 
ATOM   6141  C  C     . LYS F 3 87  ? 123.626 -54.082 -17.896 1.00 17.14 ? 383  LYS D C     1 
ATOM   6142  O  O     . LYS F 3 87  ? 123.839 -55.277 -17.678 1.00 17.67 ? 383  LYS D O     1 
ATOM   6143  C  CB    . LYS F 3 87  ? 126.034 -53.482 -18.165 1.00 20.49 ? 383  LYS D CB    1 
ATOM   6144  C  CG    . LYS F 3 87  ? 127.141 -52.797 -18.938 1.00 23.37 ? 383  LYS D CG    1 
ATOM   6145  C  CD    . LYS F 3 87  ? 127.262 -53.354 -20.340 1.00 28.11 ? 383  LYS D CD    1 
ATOM   6146  C  CE    . LYS F 3 87  ? 128.421 -52.714 -21.087 1.00 30.87 ? 383  LYS D CE    1 
ATOM   6147  N  NZ    . LYS F 3 87  ? 128.551 -53.263 -22.467 1.00 33.00 ? 383  LYS D NZ    1 
ATOM   6148  N  N     . GLY F 3 88  ? 122.550 -53.442 -17.448 1.00 16.65 ? 384  GLY D N     1 
ATOM   6149  C  CA    . GLY F 3 88  ? 121.525 -54.123 -16.670 1.00 17.39 ? 384  GLY D CA    1 
ATOM   6150  C  C     . GLY F 3 88  ? 121.951 -54.577 -15.284 1.00 17.63 ? 384  GLY D C     1 
ATOM   6151  O  O     . GLY F 3 88  ? 121.398 -55.540 -14.749 1.00 18.07 ? 384  GLY D O     1 
ATOM   6152  N  N     . ILE F 3 89  ? 122.918 -53.877 -14.696 1.00 15.56 ? 385  ILE D N     1 
ATOM   6153  C  CA    . ILE F 3 89  ? 123.440 -54.210 -13.373 1.00 14.22 ? 385  ILE D CA    1 
ATOM   6154  C  C     . ILE F 3 89  ? 123.308 -53.035 -12.405 1.00 14.94 ? 385  ILE D C     1 
ATOM   6155  O  O     . ILE F 3 89  ? 123.623 -51.898 -12.753 1.00 13.70 ? 385  ILE D O     1 
ATOM   6156  C  CB    . ILE F 3 89  ? 124.930 -54.615 -13.467 1.00 15.40 ? 385  ILE D CB    1 
ATOM   6157  C  CG1   . ILE F 3 89  ? 125.074 -55.862 -14.345 1.00 15.56 ? 385  ILE D CG1   1 
ATOM   6158  C  CG2   . ILE F 3 89  ? 125.497 -54.869 -12.082 1.00 14.53 ? 385  ILE D CG2   1 
ATOM   6159  C  CD1   . ILE F 3 89  ? 126.525 -56.231 -14.648 1.00 16.93 ? 385  ILE D CD1   1 
ATOM   6160  N  N     . GLU F 3 90  ? 122.842 -53.320 -11.193 1.00 15.09 ? 386  GLU D N     1 
ATOM   6161  C  CA    . GLU F 3 90  ? 122.662 -52.292 -10.171 1.00 17.12 ? 386  GLU D CA    1 
ATOM   6162  C  C     . GLU F 3 90  ? 123.869 -52.215 -9.234  1.00 16.46 ? 386  GLU D C     1 
ATOM   6163  O  O     . GLU F 3 90  ? 124.332 -53.235 -8.724  1.00 16.70 ? 386  GLU D O     1 
ATOM   6164  C  CB    . GLU F 3 90  ? 121.391 -52.576 -9.359  1.00 19.33 ? 386  GLU D CB    1 
ATOM   6165  C  CG    . GLU F 3 90  ? 121.207 -51.666 -8.149  1.00 25.86 ? 386  GLU D CG    1 
ATOM   6166  C  CD    . GLU F 3 90  ? 119.975 -52.007 -7.321  1.00 28.58 ? 386  GLU D CD    1 
ATOM   6167  O  OE1   . GLU F 3 90  ? 119.826 -53.180 -6.914  1.00 30.50 ? 386  GLU D OE1   1 
ATOM   6168  O  OE2   . GLU F 3 90  ? 119.161 -51.094 -7.069  1.00 30.40 ? 386  GLU D OE2   1 
ATOM   6169  N  N     . LEU F 3 91  ? 124.369 -50.998 -9.023  1.00 15.03 ? 387  LEU D N     1 
ATOM   6170  C  CA    . LEU F 3 91  ? 125.513 -50.747 -8.145  1.00 13.01 ? 387  LEU D CA    1 
ATOM   6171  C  C     . LEU F 3 91  ? 125.024 -50.046 -6.879  1.00 13.82 ? 387  LEU D C     1 
ATOM   6172  O  O     . LEU F 3 91  ? 124.427 -48.970 -6.950  1.00 14.15 ? 387  LEU D O     1 
ATOM   6173  C  CB    . LEU F 3 91  ? 126.544 -49.850 -8.843  1.00 12.59 ? 387  LEU D CB    1 
ATOM   6174  C  CG    . LEU F 3 91  ? 127.713 -49.385 -7.957  1.00 12.37 ? 387  LEU D CG    1 
ATOM   6175  C  CD1   . LEU F 3 91  ? 128.570 -50.589 -7.571  1.00 9.47  ? 387  LEU D CD1   1 
ATOM   6176  C  CD2   . LEU F 3 91  ? 128.556 -48.355 -8.695  1.00 9.82  ? 387  LEU D CD2   1 
ATOM   6177  N  N     . CYS F 3 92  ? 125.276 -50.656 -5.727  1.00 12.38 ? 388  CYS D N     1 
ATOM   6178  C  CA    . CYS F 3 92  ? 124.865 -50.083 -4.452  1.00 12.13 ? 388  CYS D CA    1 
ATOM   6179  C  C     . CYS F 3 92  ? 126.031 -50.096 -3.485  1.00 11.33 ? 388  CYS D C     1 
ATOM   6180  O  O     . CYS F 3 92  ? 127.054 -50.726 -3.743  1.00 11.32 ? 388  CYS D O     1 
ATOM   6181  C  CB    . CYS F 3 92  ? 123.718 -50.898 -3.849  1.00 12.16 ? 388  CYS D CB    1 
ATOM   6182  S  SG    . CYS F 3 92  ? 122.256 -51.020 -4.893  1.00 19.18 ? 388  CYS D SG    1 
ATOM   6183  N  N     . GLY F 3 93  ? 125.875 -49.393 -2.369  1.00 11.11 ? 389  GLY D N     1 
ATOM   6184  C  CA    . GLY F 3 93  ? 126.916 -49.390 -1.358  1.00 11.90 ? 389  GLY D CA    1 
ATOM   6185  C  C     . GLY F 3 93  ? 128.136 -48.510 -1.539  1.00 11.37 ? 389  GLY D C     1 
ATOM   6186  O  O     . GLY F 3 93  ? 129.140 -48.726 -0.856  1.00 11.61 ? 389  GLY D O     1 
ATOM   6187  N  N     . VAL F 3 94  ? 128.079 -47.530 -2.439  1.00 10.59 ? 390  VAL D N     1 
ATOM   6188  C  CA    . VAL F 3 94  ? 129.221 -46.641 -2.615  1.00 11.29 ? 390  VAL D CA    1 
ATOM   6189  C  C     . VAL F 3 94  ? 129.246 -45.717 -1.399  1.00 12.23 ? 390  VAL D C     1 
ATOM   6190  O  O     . VAL F 3 94  ? 128.353 -44.885 -1.226  1.00 13.00 ? 390  VAL D O     1 
ATOM   6191  C  CB    . VAL F 3 94  ? 129.092 -45.795 -3.901  1.00 12.39 ? 390  VAL D CB    1 
ATOM   6192  C  CG1   . VAL F 3 94  ? 130.280 -44.847 -4.025  1.00 13.21 ? 390  VAL D CG1   1 
ATOM   6193  C  CG2   . VAL F 3 94  ? 129.026 -46.708 -5.117  1.00 13.62 ? 390  VAL D CG2   1 
ATOM   6194  N  N     . SER F 3 95  ? 130.261 -45.864 -0.554  1.00 12.13 ? 391  SER D N     1 
ATOM   6195  C  CA    . SER F 3 95  ? 130.357 -45.050 0.657   1.00 12.37 ? 391  SER D CA    1 
ATOM   6196  C  C     . SER F 3 95  ? 131.375 -43.920 0.567   1.00 11.36 ? 391  SER D C     1 
ATOM   6197  O  O     . SER F 3 95  ? 131.453 -43.083 1.467   1.00 12.71 ? 391  SER D O     1 
ATOM   6198  C  CB    . SER F 3 95  ? 130.702 -45.937 1.856   1.00 14.28 ? 391  SER D CB    1 
ATOM   6199  O  OG    . SER F 3 95  ? 131.943 -46.596 1.652   1.00 14.94 ? 391  SER D OG    1 
ATOM   6200  N  N     . PHE F 3 96  ? 132.159 -43.897 -0.507  1.00 11.41 ? 392  PHE D N     1 
ATOM   6201  C  CA    . PHE F 3 96  ? 133.173 -42.857 -0.692  1.00 9.94  ? 392  PHE D CA    1 
ATOM   6202  C  C     . PHE F 3 96  ? 133.501 -42.635 -2.164  1.00 11.24 ? 392  PHE D C     1 
ATOM   6203  O  O     . PHE F 3 96  ? 133.792 -43.586 -2.893  1.00 10.47 ? 392  PHE D O     1 
ATOM   6204  C  CB    . PHE F 3 96  ? 134.468 -43.221 0.051   1.00 11.19 ? 392  PHE D CB    1 
ATOM   6205  C  CG    . PHE F 3 96  ? 135.562 -42.195 -0.105  1.00 11.07 ? 392  PHE D CG    1 
ATOM   6206  C  CD1   . PHE F 3 96  ? 135.475 -40.962 0.535   1.00 12.83 ? 392  PHE D CD1   1 
ATOM   6207  C  CD2   . PHE F 3 96  ? 136.670 -42.452 -0.915  1.00 11.36 ? 392  PHE D CD2   1 
ATOM   6208  C  CE1   . PHE F 3 96  ? 136.471 -39.995 0.372   1.00 11.16 ? 392  PHE D CE1   1 
ATOM   6209  C  CE2   . PHE F 3 96  ? 137.673 -41.491 -1.087  1.00 11.46 ? 392  PHE D CE2   1 
ATOM   6210  C  CZ    . PHE F 3 96  ? 137.572 -40.261 -0.443  1.00 11.58 ? 392  PHE D CZ    1 
ATOM   6211  N  N     . ASP F 3 97  ? 133.454 -41.375 -2.592  1.00 9.86  ? 393  ASP D N     1 
ATOM   6212  C  CA    . ASP F 3 97  ? 133.764 -41.012 -3.973  1.00 9.86  ? 393  ASP D CA    1 
ATOM   6213  C  C     . ASP F 3 97  ? 134.874 -39.962 -3.955  1.00 9.59  ? 393  ASP D C     1 
ATOM   6214  O  O     . ASP F 3 97  ? 134.644 -38.793 -3.618  1.00 9.94  ? 393  ASP D O     1 
ATOM   6215  C  CB    . ASP F 3 97  ? 132.526 -40.452 -4.678  1.00 10.47 ? 393  ASP D CB    1 
ATOM   6216  C  CG    . ASP F 3 97  ? 132.722 -40.328 -6.181  1.00 12.16 ? 393  ASP D CG    1 
ATOM   6217  O  OD1   . ASP F 3 97  ? 133.844 -39.974 -6.610  1.00 9.01  ? 393  ASP D OD1   1 
ATOM   6218  O  OD2   . ASP F 3 97  ? 131.755 -40.578 -6.930  1.00 10.74 ? 393  ASP D OD2   1 
ATOM   6219  N  N     . LEU F 3 98  ? 136.075 -40.395 -4.324  1.00 7.05  ? 394  LEU D N     1 
ATOM   6220  C  CA    . LEU F 3 98  ? 137.262 -39.543 -4.333  1.00 6.94  ? 394  LEU D CA    1 
ATOM   6221  C  C     . LEU F 3 98  ? 137.149 -38.313 -5.229  1.00 6.38  ? 394  LEU D C     1 
ATOM   6222  O  O     . LEU F 3 98  ? 137.722 -37.264 -4.924  1.00 7.51  ? 394  LEU D O     1 
ATOM   6223  C  CB    . LEU F 3 98  ? 138.477 -40.381 -4.744  1.00 8.02  ? 394  LEU D CB    1 
ATOM   6224  C  CG    . LEU F 3 98  ? 139.855 -39.721 -4.697  1.00 7.65  ? 394  LEU D CG    1 
ATOM   6225  C  CD1   . LEU F 3 98  ? 140.134 -39.210 -3.275  1.00 7.68  ? 394  LEU D CD1   1 
ATOM   6226  C  CD2   . LEU F 3 98  ? 140.906 -40.741 -5.124  1.00 9.82  ? 394  LEU D CD2   1 
ATOM   6227  N  N     . LEU F 3 99  ? 136.425 -38.439 -6.337  1.00 7.93  ? 395  LEU D N     1 
ATOM   6228  C  CA    . LEU F 3 99  ? 136.251 -37.305 -7.242  1.00 8.85  ? 395  LEU D CA    1 
ATOM   6229  C  C     . LEU F 3 99  ? 135.488 -36.186 -6.530  1.00 8.27  ? 395  LEU D C     1 
ATOM   6230  O  O     . LEU F 3 99  ? 135.897 -35.023 -6.551  1.00 9.04  ? 395  LEU D O     1 
ATOM   6231  C  CB    . LEU F 3 99  ? 135.482 -37.729 -8.504  1.00 11.13 ? 395  LEU D CB    1 
ATOM   6232  C  CG    . LEU F 3 99  ? 135.047 -36.556 -9.399  1.00 10.95 ? 395  LEU D CG    1 
ATOM   6233  C  CD1   . LEU F 3 99  ? 136.271 -35.755 -9.840  1.00 11.02 ? 395  LEU D CD1   1 
ATOM   6234  C  CD2   . LEU F 3 99  ? 134.286 -37.079 -10.604 1.00 10.72 ? 395  LEU D CD2   1 
ATOM   6235  N  N     . LEU F 3 100 ? 134.377 -36.545 -5.900  1.00 9.28  ? 396  LEU D N     1 
ATOM   6236  C  CA    . LEU F 3 100 ? 133.556 -35.569 -5.189  1.00 9.74  ? 396  LEU D CA    1 
ATOM   6237  C  C     . LEU F 3 100 ? 134.276 -35.031 -3.951  1.00 9.94  ? 396  LEU D C     1 
ATOM   6238  O  O     . LEU F 3 100 ? 134.097 -33.872 -3.573  1.00 9.53  ? 396  LEU D O     1 
ATOM   6239  C  CB    . LEU F 3 100 ? 132.221 -36.206 -4.802  1.00 11.19 ? 396  LEU D CB    1 
ATOM   6240  C  CG    . LEU F 3 100 ? 131.370 -36.671 -5.997  1.00 11.52 ? 396  LEU D CG    1 
ATOM   6241  C  CD1   . LEU F 3 100 ? 130.130 -37.418 -5.499  1.00 14.29 ? 396  LEU D CD1   1 
ATOM   6242  C  CD2   . LEU F 3 100 ? 130.962 -35.454 -6.843  1.00 12.17 ? 396  LEU D CD2   1 
ATOM   6243  N  N     . ALA F 3 101 ? 135.090 -35.874 -3.320  1.00 10.09 ? 397  ALA D N     1 
ATOM   6244  C  CA    . ALA F 3 101 ? 135.842 -35.459 -2.141  1.00 9.52  ? 397  ALA D CA    1 
ATOM   6245  C  C     . ALA F 3 101 ? 136.890 -34.410 -2.527  1.00 9.44  ? 397  ALA D C     1 
ATOM   6246  O  O     . ALA F 3 101 ? 137.030 -33.380 -1.863  1.00 9.85  ? 397  ALA D O     1 
ATOM   6247  C  CB    . ALA F 3 101 ? 136.514 -36.675 -1.491  1.00 9.68  ? 397  ALA D CB    1 
ATOM   6248  N  N     . ALA F 3 102 ? 137.624 -34.666 -3.606  1.00 9.70  ? 398  ALA D N     1 
ATOM   6249  C  CA    . ALA F 3 102 ? 138.640 -33.722 -4.068  1.00 10.28 ? 398  ALA D CA    1 
ATOM   6250  C  C     . ALA F 3 102 ? 137.973 -32.428 -4.527  1.00 10.87 ? 398  ALA D C     1 
ATOM   6251  O  O     . ALA F 3 102 ? 138.483 -31.327 -4.286  1.00 9.11  ? 398  ALA D O     1 
ATOM   6252  C  CB    . ALA F 3 102 ? 139.443 -34.331 -5.218  1.00 10.62 ? 398  ALA D CB    1 
ATOM   6253  N  N     . TYR F 3 103 ? 136.827 -32.567 -5.189  1.00 11.46 ? 399  TYR D N     1 
ATOM   6254  C  CA    . TYR F 3 103 ? 136.080 -31.411 -5.689  1.00 10.19 ? 399  TYR D CA    1 
ATOM   6255  C  C     . TYR F 3 103 ? 135.705 -30.470 -4.547  1.00 10.35 ? 399  TYR D C     1 
ATOM   6256  O  O     . TYR F 3 103 ? 135.888 -29.249 -4.646  1.00 9.90  ? 399  TYR D O     1 
ATOM   6257  C  CB    . TYR F 3 103 ? 134.816 -31.888 -6.413  1.00 10.91 ? 399  TYR D CB    1 
ATOM   6258  C  CG    . TYR F 3 103 ? 133.872 -30.785 -6.848  1.00 10.88 ? 399  TYR D CG    1 
ATOM   6259  C  CD1   . TYR F 3 103 ? 134.263 -29.822 -7.788  1.00 10.16 ? 399  TYR D CD1   1 
ATOM   6260  C  CD2   . TYR F 3 103 ? 132.572 -30.727 -6.346  1.00 10.71 ? 399  TYR D CD2   1 
ATOM   6261  C  CE1   . TYR F 3 103 ? 133.370 -28.833 -8.219  1.00 8.91  ? 399  TYR D CE1   1 
ATOM   6262  C  CE2   . TYR F 3 103 ? 131.676 -29.743 -6.764  1.00 9.50  ? 399  TYR D CE2   1 
ATOM   6263  C  CZ    . TYR F 3 103 ? 132.078 -28.805 -7.699  1.00 9.70  ? 399  TYR D CZ    1 
ATOM   6264  O  OH    . TYR F 3 103 ? 131.180 -27.850 -8.118  1.00 11.01 ? 399  TYR D OH    1 
ATOM   6265  N  N     . LEU F 3 104 ? 135.176 -31.037 -3.464  1.00 9.65  ? 400  LEU D N     1 
ATOM   6266  C  CA    . LEU F 3 104 ? 134.789 -30.238 -2.304  1.00 10.07 ? 400  LEU D CA    1 
ATOM   6267  C  C     . LEU F 3 104 ? 135.988 -29.548 -1.648  1.00 10.04 ? 400  LEU D C     1 
ATOM   6268  O  O     . LEU F 3 104 ? 135.915 -28.372 -1.284  1.00 9.71  ? 400  LEU D O     1 
ATOM   6269  C  CB    . LEU F 3 104 ? 134.071 -31.115 -1.274  1.00 9.16  ? 400  LEU D CB    1 
ATOM   6270  C  CG    . LEU F 3 104 ? 132.711 -31.698 -1.689  1.00 10.18 ? 400  LEU D CG    1 
ATOM   6271  C  CD1   . LEU F 3 104 ? 132.119 -32.500 -0.523  1.00 10.10 ? 400  LEU D CD1   1 
ATOM   6272  C  CD2   . LEU F 3 104 ? 131.773 -30.573 -2.103  1.00 9.58  ? 400  LEU D CD2   1 
ATOM   6273  N  N     . LEU F 3 105 ? 137.093 -30.271 -1.497  1.00 9.23  ? 401  LEU D N     1 
ATOM   6274  C  CA    . LEU F 3 105 ? 138.279 -29.683 -0.878  1.00 11.42 ? 401  LEU D CA    1 
ATOM   6275  C  C     . LEU F 3 105 ? 138.823 -28.474 -1.640  1.00 11.38 ? 401  LEU D C     1 
ATOM   6276  O  O     . LEU F 3 105 ? 139.265 -27.503 -1.031  1.00 10.63 ? 401  LEU D O     1 
ATOM   6277  C  CB    . LEU F 3 105 ? 139.382 -30.729 -0.721  1.00 10.67 ? 401  LEU D CB    1 
ATOM   6278  C  CG    . LEU F 3 105 ? 139.095 -31.832 0.299   1.00 12.67 ? 401  LEU D CG    1 
ATOM   6279  C  CD1   . LEU F 3 105 ? 140.260 -32.821 0.306   1.00 11.78 ? 401  LEU D CD1   1 
ATOM   6280  C  CD2   . LEU F 3 105 ? 138.888 -31.217 1.690   1.00 11.80 ? 401  LEU D CD2   1 
ATOM   6281  N  N     . ASP F 3 106 ? 138.802 -28.532 -2.966  1.00 10.81 ? 402  ASP D N     1 
ATOM   6282  C  CA    . ASP F 3 106 ? 139.286 -27.413 -3.771  1.00 11.20 ? 402  ASP D CA    1 
ATOM   6283  C  C     . ASP F 3 106 ? 138.847 -27.583 -5.213  1.00 10.73 ? 402  ASP D C     1 
ATOM   6284  O  O     . ASP F 3 106 ? 139.503 -28.264 -6.003  1.00 11.71 ? 402  ASP D O     1 
ATOM   6285  C  CB    . ASP F 3 106 ? 140.815 -27.306 -3.707  1.00 12.66 ? 402  ASP D CB    1 
ATOM   6286  C  CG    . ASP F 3 106 ? 141.349 -26.063 -4.411  1.00 14.19 ? 402  ASP D CG    1 
ATOM   6287  O  OD1   . ASP F 3 106 ? 140.545 -25.265 -4.945  1.00 14.30 ? 402  ASP D OD1   1 
ATOM   6288  O  OD2   . ASP F 3 106 ? 142.583 -25.881 -4.428  1.00 15.84 ? 402  ASP D OD2   1 
ATOM   6289  N  N     . PRO F 3 107 ? 137.721 -26.958 -5.576  1.00 11.99 ? 403  PRO D N     1 
ATOM   6290  C  CA    . PRO F 3 107 ? 137.163 -27.023 -6.929  1.00 11.42 ? 403  PRO D CA    1 
ATOM   6291  C  C     . PRO F 3 107 ? 138.119 -26.486 -7.991  1.00 11.94 ? 403  PRO D C     1 
ATOM   6292  O  O     . PRO F 3 107 ? 138.056 -26.888 -9.152  1.00 10.79 ? 403  PRO D O     1 
ATOM   6293  C  CB    . PRO F 3 107 ? 135.880 -26.191 -6.828  1.00 12.27 ? 403  PRO D CB    1 
ATOM   6294  C  CG    . PRO F 3 107 ? 135.521 -26.255 -5.382  1.00 14.48 ? 403  PRO D CG    1 
ATOM   6295  C  CD    . PRO F 3 107 ? 136.855 -26.163 -4.686  1.00 11.08 ? 403  PRO D CD    1 
ATOM   6296  N  N     . ALA F 3 108 ? 138.997 -25.575 -7.582  1.00 12.54 ? 404  ALA D N     1 
ATOM   6297  C  CA    . ALA F 3 108 ? 139.944 -24.943 -8.497  1.00 12.87 ? 404  ALA D CA    1 
ATOM   6298  C  C     . ALA F 3 108 ? 141.056 -25.859 -9.001  1.00 14.34 ? 404  ALA D C     1 
ATOM   6299  O  O     . ALA F 3 108 ? 141.711 -25.551 -9.998  1.00 13.40 ? 404  ALA D O     1 
ATOM   6300  C  CB    . ALA F 3 108 ? 140.543 -23.707 -7.842  1.00 12.61 ? 404  ALA D CB    1 
ATOM   6301  N  N     . GLN F 3 109 ? 141.275 -26.978 -8.319  1.00 16.59 ? 405  GLN D N     1 
ATOM   6302  C  CA    . GLN F 3 109 ? 142.315 -27.915 -8.738  1.00 18.89 ? 405  GLN D CA    1 
ATOM   6303  C  C     . GLN F 3 109 ? 141.942 -28.598 -10.048 1.00 18.96 ? 405  GLN D C     1 
ATOM   6304  O  O     . GLN F 3 109 ? 142.807 -29.129 -10.744 1.00 19.13 ? 405  GLN D O     1 
ATOM   6305  C  CB    . GLN F 3 109 ? 142.557 -28.983 -7.666  1.00 20.92 ? 405  GLN D CB    1 
ATOM   6306  C  CG    . GLN F 3 109 ? 143.537 -28.572 -6.587  1.00 28.85 ? 405  GLN D CG    1 
ATOM   6307  C  CD    . GLN F 3 109 ? 144.894 -28.183 -7.154  1.00 30.60 ? 405  GLN D CD    1 
ATOM   6308  O  OE1   . GLN F 3 109 ? 145.576 -28.994 -7.785  1.00 33.81 ? 405  GLN D OE1   1 
ATOM   6309  N  NE2   . GLN F 3 109 ? 145.288 -26.935 -6.935  1.00 33.39 ? 405  GLN D NE2   1 
ATOM   6310  N  N     . GLY F 3 110 ? 140.653 -28.585 -10.378 1.00 17.05 ? 406  GLY D N     1 
ATOM   6311  C  CA    . GLY F 3 110 ? 140.204 -29.209 -11.611 1.00 16.51 ? 406  GLY D CA    1 
ATOM   6312  C  C     . GLY F 3 110 ? 140.514 -30.693 -11.659 1.00 16.56 ? 406  GLY D C     1 
ATOM   6313  O  O     . GLY F 3 110 ? 140.837 -31.245 -12.718 1.00 15.63 ? 406  GLY D O     1 
ATOM   6314  N  N     . VAL F 3 111 ? 140.416 -31.349 -10.510 1.00 14.30 ? 407  VAL D N     1 
ATOM   6315  C  CA    . VAL F 3 111 ? 140.690 -32.781 -10.437 1.00 15.25 ? 407  VAL D CA    1 
ATOM   6316  C  C     . VAL F 3 111 ? 139.764 -33.549 -11.366 1.00 14.74 ? 407  VAL D C     1 
ATOM   6317  O  O     . VAL F 3 111 ? 138.539 -33.432 -11.273 1.00 13.40 ? 407  VAL D O     1 
ATOM   6318  C  CB    . VAL F 3 111 ? 140.513 -33.306 -9.001  1.00 14.53 ? 407  VAL D CB    1 
ATOM   6319  C  CG1   . VAL F 3 111 ? 140.528 -34.830 -8.991  1.00 15.60 ? 407  VAL D CG1   1 
ATOM   6320  C  CG2   . VAL F 3 111 ? 141.632 -32.757 -8.114  1.00 14.02 ? 407  VAL D CG2   1 
ATOM   6321  N  N     . ASP F 3 112 ? 140.345 -34.341 -12.263 1.00 15.76 ? 408  ASP D N     1 
ATOM   6322  C  CA    . ASP F 3 112 ? 139.525 -35.098 -13.196 1.00 16.29 ? 408  ASP D CA    1 
ATOM   6323  C  C     . ASP F 3 112 ? 139.988 -36.539 -13.405 1.00 14.35 ? 408  ASP D C     1 
ATOM   6324  O  O     . ASP F 3 112 ? 139.522 -37.229 -14.311 1.00 11.28 ? 408  ASP D O     1 
ATOM   6325  C  CB    . ASP F 3 112 ? 139.420 -34.348 -14.530 1.00 20.23 ? 408  ASP D CB    1 
ATOM   6326  C  CG    . ASP F 3 112 ? 140.700 -34.376 -15.321 1.00 23.01 ? 408  ASP D CG    1 
ATOM   6327  O  OD1   . ASP F 3 112 ? 141.785 -34.481 -14.713 1.00 26.92 ? 408  ASP D OD1   1 
ATOM   6328  O  OD2   . ASP F 3 112 ? 140.613 -34.284 -16.561 1.00 29.57 ? 408  ASP D OD2   1 
ATOM   6329  N  N     . ASP F 3 113 ? 140.923 -36.980 -12.569 1.00 13.34 ? 409  ASP D N     1 
ATOM   6330  C  CA    . ASP F 3 113 ? 141.375 -38.365 -12.591 1.00 13.64 ? 409  ASP D CA    1 
ATOM   6331  C  C     . ASP F 3 113 ? 141.972 -38.686 -11.228 1.00 11.67 ? 409  ASP D C     1 
ATOM   6332  O  O     . ASP F 3 113 ? 142.291 -37.781 -10.452 1.00 9.50  ? 409  ASP D O     1 
ATOM   6333  C  CB    . ASP F 3 113 ? 142.353 -38.655 -13.752 1.00 15.96 ? 409  ASP D CB    1 
ATOM   6334  C  CG    . ASP F 3 113 ? 143.720 -38.014 -13.579 1.00 17.48 ? 409  ASP D CG    1 
ATOM   6335  O  OD1   . ASP F 3 113 ? 144.579 -38.266 -14.453 1.00 17.81 ? 409  ASP D OD1   1 
ATOM   6336  O  OD2   . ASP F 3 113 ? 143.948 -37.275 -12.601 1.00 19.06 ? 409  ASP D OD2   1 
ATOM   6337  N  N     . VAL F 3 114 ? 142.099 -39.969 -10.921 1.00 9.59  ? 410  VAL D N     1 
ATOM   6338  C  CA    . VAL F 3 114 ? 142.638 -40.376 -9.625  1.00 11.13 ? 410  VAL D CA    1 
ATOM   6339  C  C     . VAL F 3 114 ? 144.014 -39.776 -9.335  1.00 10.58 ? 410  VAL D C     1 
ATOM   6340  O  O     . VAL F 3 114 ? 144.279 -39.331 -8.217  1.00 10.58 ? 410  VAL D O     1 
ATOM   6341  C  CB    . VAL F 3 114 ? 142.694 -41.926 -9.515  1.00 10.99 ? 410  VAL D CB    1 
ATOM   6342  C  CG1   . VAL F 3 114 ? 143.469 -42.342 -8.266  1.00 11.43 ? 410  VAL D CG1   1 
ATOM   6343  C  CG2   . VAL F 3 114 ? 141.275 -42.490 -9.440  1.00 10.67 ? 410  VAL D CG2   1 
ATOM   6344  N  N     . ALA F 3 115 ? 144.890 -39.745 -10.335 1.00 11.50 ? 411  ALA D N     1 
ATOM   6345  C  CA    . ALA F 3 115 ? 146.228 -39.185 -10.128 1.00 11.21 ? 411  ALA D CA    1 
ATOM   6346  C  C     . ALA F 3 115 ? 146.175 -37.747 -9.614  1.00 11.89 ? 411  ALA D C     1 
ATOM   6347  O  O     . ALA F 3 115 ? 146.887 -37.398 -8.672  1.00 11.23 ? 411  ALA D O     1 
ATOM   6348  C  CB    . ALA F 3 115 ? 147.040 -39.249 -11.420 1.00 11.89 ? 411  ALA D CB    1 
ATOM   6349  N  N     . ALA F 3 116 ? 145.327 -36.916 -10.219 1.00 10.35 ? 412  ALA D N     1 
ATOM   6350  C  CA    . ALA F 3 116 ? 145.213 -35.519 -9.800  1.00 11.62 ? 412  ALA D CA    1 
ATOM   6351  C  C     . ALA F 3 116 ? 144.787 -35.420 -8.335  1.00 11.89 ? 412  ALA D C     1 
ATOM   6352  O  O     . ALA F 3 116 ? 145.332 -34.620 -7.574  1.00 12.61 ? 412  ALA D O     1 
ATOM   6353  C  CB    . ALA F 3 116 ? 144.213 -34.770 -10.702 1.00 11.43 ? 412  ALA D CB    1 
ATOM   6354  N  N     . ALA F 3 117 ? 143.813 -36.230 -7.936  1.00 11.18 ? 413  ALA D N     1 
ATOM   6355  C  CA    . ALA F 3 117 ? 143.363 -36.222 -6.547  1.00 11.15 ? 413  ALA D CA    1 
ATOM   6356  C  C     . ALA F 3 117 ? 144.498 -36.676 -5.618  1.00 11.86 ? 413  ALA D C     1 
ATOM   6357  O  O     . ALA F 3 117 ? 144.782 -36.040 -4.597  1.00 11.11 ? 413  ALA D O     1 
ATOM   6358  C  CB    . ALA F 3 117 ? 142.159 -37.147 -6.378  1.00 12.55 ? 413  ALA D CB    1 
ATOM   6359  N  N     . ALA F 3 118 ? 145.138 -37.784 -5.976  1.00 11.07 ? 414  ALA D N     1 
ATOM   6360  C  CA    . ALA F 3 118 ? 146.224 -38.337 -5.167  1.00 13.00 ? 414  ALA D CA    1 
ATOM   6361  C  C     . ALA F 3 118 ? 147.349 -37.332 -4.939  1.00 13.41 ? 414  ALA D C     1 
ATOM   6362  O  O     . ALA F 3 118 ? 147.915 -37.255 -3.846  1.00 13.98 ? 414  ALA D O     1 
ATOM   6363  C  CB    . ALA F 3 118 ? 146.773 -39.605 -5.826  1.00 12.28 ? 414  ALA D CB    1 
ATOM   6364  N  N     . LYS F 3 119 ? 147.659 -36.543 -5.961  1.00 15.39 ? 415  LYS D N     1 
ATOM   6365  C  CA    . LYS F 3 119 ? 148.730 -35.561 -5.843  1.00 19.43 ? 415  LYS D CA    1 
ATOM   6366  C  C     . LYS F 3 119 ? 148.457 -34.560 -4.720  1.00 19.53 ? 415  LYS D C     1 
ATOM   6367  O  O     . LYS F 3 119 ? 149.391 -34.009 -4.130  1.00 19.14 ? 415  LYS D O     1 
ATOM   6368  C  CB    . LYS F 3 119 ? 148.927 -34.815 -7.169  1.00 22.41 ? 415  LYS D CB    1 
ATOM   6369  C  CG    . LYS F 3 119 ? 150.389 -34.484 -7.443  1.00 28.65 ? 415  LYS D CG    1 
ATOM   6370  C  CD    . LYS F 3 119 ? 150.554 -33.307 -8.396  1.00 33.48 ? 415  LYS D CD    1 
ATOM   6371  C  CE    . LYS F 3 119 ? 150.099 -33.635 -9.804  1.00 36.65 ? 415  LYS D CE    1 
ATOM   6372  N  NZ    . LYS F 3 119 ? 150.247 -32.445 -10.702 1.00 40.04 ? 415  LYS D NZ    1 
ATOM   6373  N  N     . MET F 3 120 ? 147.180 -34.330 -4.424  1.00 19.10 ? 416  MET D N     1 
ATOM   6374  C  CA    . MET F 3 120 ? 146.798 -33.402 -3.362  1.00 19.06 ? 416  MET D CA    1 
ATOM   6375  C  C     . MET F 3 120 ? 147.339 -33.845 -2.002  1.00 19.09 ? 416  MET D C     1 
ATOM   6376  O  O     . MET F 3 120 ? 147.571 -33.013 -1.117  1.00 19.94 ? 416  MET D O     1 
ATOM   6377  C  CB    . MET F 3 120 ? 145.268 -33.277 -3.280  1.00 20.26 ? 416  MET D CB    1 
ATOM   6378  C  CG    . MET F 3 120 ? 144.631 -32.400 -4.361  1.00 21.77 ? 416  MET D CG    1 
ATOM   6379  S  SD    . MET F 3 120 ? 142.812 -32.448 -4.335  1.00 24.32 ? 416  MET D SD    1 
ATOM   6380  C  CE    . MET F 3 120 ? 142.472 -32.130 -2.637  1.00 23.32 ? 416  MET D CE    1 
ATOM   6381  N  N     . LYS F 3 121 ? 147.535 -35.151 -1.843  1.00 16.37 ? 417  LYS D N     1 
ATOM   6382  C  CA    . LYS F 3 121 ? 148.030 -35.717 -0.592  1.00 16.07 ? 417  LYS D CA    1 
ATOM   6383  C  C     . LYS F 3 121 ? 149.406 -36.370 -0.745  1.00 14.96 ? 417  LYS D C     1 
ATOM   6384  O  O     . LYS F 3 121 ? 149.742 -37.317 -0.028  1.00 15.37 ? 417  LYS D O     1 
ATOM   6385  C  CB    . LYS F 3 121 ? 147.035 -36.753 -0.059  1.00 17.62 ? 417  LYS D CB    1 
ATOM   6386  C  CG    . LYS F 3 121 ? 145.666 -36.193 0.310   1.00 18.62 ? 417  LYS D CG    1 
ATOM   6387  C  CD    . LYS F 3 121 ? 145.740 -35.260 1.502   1.00 21.34 ? 417  LYS D CD    1 
ATOM   6388  C  CE    . LYS F 3 121 ? 144.360 -34.739 1.884   1.00 21.96 ? 417  LYS D CE    1 
ATOM   6389  N  NZ    . LYS F 3 121 ? 144.460 -33.703 2.950   1.00 24.45 ? 417  LYS D NZ    1 
ATOM   6390  N  N     . GLN F 3 122 ? 150.190 -35.861 -1.683  1.00 13.80 ? 418  GLN D N     1 
ATOM   6391  C  CA    . GLN F 3 122 ? 151.538 -36.365 -1.927  1.00 14.93 ? 418  GLN D CA    1 
ATOM   6392  C  C     . GLN F 3 122 ? 151.615 -37.859 -2.268  1.00 14.15 ? 418  GLN D C     1 
ATOM   6393  O  O     . GLN F 3 122 ? 152.592 -38.522 -1.930  1.00 12.97 ? 418  GLN D O     1 
ATOM   6394  C  CB    . GLN F 3 122 ? 152.435 -36.065 -0.718  1.00 16.03 ? 418  GLN D CB    1 
ATOM   6395  C  CG    . GLN F 3 122 ? 152.540 -34.586 -0.352  1.00 20.78 ? 418  GLN D CG    1 
ATOM   6396  C  CD    . GLN F 3 122 ? 152.756 -33.694 -1.561  1.00 25.14 ? 418  GLN D CD    1 
ATOM   6397  O  OE1   . GLN F 3 122 ? 151.796 -33.230 -2.180  1.00 29.03 ? 418  GLN D OE1   1 
ATOM   6398  N  NE2   . GLN F 3 122 ? 154.021 -33.456 -1.913  1.00 23.51 ? 418  GLN D NE2   1 
ATOM   6399  N  N     . TYR F 3 123 ? 150.587 -38.377 -2.936  1.00 12.01 ? 419  TYR D N     1 
ATOM   6400  C  CA    . TYR F 3 123 ? 150.547 -39.780 -3.345  1.00 11.82 ? 419  TYR D CA    1 
ATOM   6401  C  C     . TYR F 3 123 ? 150.726 -39.773 -4.865  1.00 13.36 ? 419  TYR D C     1 
ATOM   6402  O  O     . TYR F 3 123 ? 149.929 -39.163 -5.582  1.00 11.82 ? 419  TYR D O     1 
ATOM   6403  C  CB    . TYR F 3 123 ? 149.196 -40.405 -2.966  1.00 11.29 ? 419  TYR D CB    1 
ATOM   6404  C  CG    . TYR F 3 123 ? 149.105 -41.903 -3.187  1.00 10.53 ? 419  TYR D CG    1 
ATOM   6405  C  CD1   . TYR F 3 123 ? 149.127 -42.791 -2.108  1.00 11.70 ? 419  TYR D CD1   1 
ATOM   6406  C  CD2   . TYR F 3 123 ? 148.983 -42.431 -4.471  1.00 9.51  ? 419  TYR D CD2   1 
ATOM   6407  C  CE1   . TYR F 3 123 ? 149.027 -44.180 -2.308  1.00 11.46 ? 419  TYR D CE1   1 
ATOM   6408  C  CE2   . TYR F 3 123 ? 148.885 -43.809 -4.683  1.00 9.67  ? 419  TYR D CE2   1 
ATOM   6409  C  CZ    . TYR F 3 123 ? 148.906 -44.676 -3.600  1.00 11.81 ? 419  TYR D CZ    1 
ATOM   6410  O  OH    . TYR F 3 123 ? 148.806 -46.032 -3.811  1.00 12.52 ? 419  TYR D OH    1 
ATOM   6411  N  N     . GLU F 3 124 ? 151.768 -40.444 -5.355  1.00 11.64 ? 420  GLU D N     1 
ATOM   6412  C  CA    . GLU F 3 124 ? 152.048 -40.453 -6.790  1.00 13.91 ? 420  GLU D CA    1 
ATOM   6413  C  C     . GLU F 3 124 ? 152.333 -41.832 -7.388  1.00 13.44 ? 420  GLU D C     1 
ATOM   6414  O  O     . GLU F 3 124 ? 152.901 -41.935 -8.476  1.00 13.23 ? 420  GLU D O     1 
ATOM   6415  C  CB    . GLU F 3 124 ? 153.226 -39.509 -7.083  1.00 15.59 ? 420  GLU D CB    1 
ATOM   6416  C  CG    . GLU F 3 124 ? 152.904 -38.047 -6.789  1.00 19.02 ? 420  GLU D CG    1 
ATOM   6417  C  CD    . GLU F 3 124 ? 154.065 -37.102 -7.040  1.00 23.31 ? 420  GLU D CD    1 
ATOM   6418  O  OE1   . GLU F 3 124 ? 155.066 -37.525 -7.652  1.00 26.07 ? 420  GLU D OE1   1 
ATOM   6419  O  OE2   . GLU F 3 124 ? 153.970 -35.922 -6.630  1.00 23.82 ? 420  GLU D OE2   1 
ATOM   6420  N  N     . ALA F 3 125 ? 151.933 -42.884 -6.684  1.00 11.79 ? 421  ALA D N     1 
ATOM   6421  C  CA    . ALA F 3 125 ? 152.151 -44.248 -7.155  1.00 11.36 ? 421  ALA D CA    1 
ATOM   6422  C  C     . ALA F 3 125 ? 151.032 -44.665 -8.102  1.00 11.01 ? 421  ALA D C     1 
ATOM   6423  O  O     . ALA F 3 125 ? 150.562 -45.798 -8.061  1.00 10.32 ? 421  ALA D O     1 
ATOM   6424  C  CB    . ALA F 3 125 ? 152.213 -45.208 -5.969  1.00 11.69 ? 421  ALA D CB    1 
ATOM   6425  N  N     . VAL F 3 126 ? 150.614 -43.736 -8.953  1.00 10.76 ? 422  VAL D N     1 
ATOM   6426  C  CA    . VAL F 3 126 ? 149.558 -43.984 -9.920  1.00 11.37 ? 422  VAL D CA    1 
ATOM   6427  C  C     . VAL F 3 126 ? 149.763 -43.010 -11.073 1.00 11.35 ? 422  VAL D C     1 
ATOM   6428  O  O     . VAL F 3 126 ? 150.195 -41.879 -10.865 1.00 12.63 ? 422  VAL D O     1 
ATOM   6429  C  CB    . VAL F 3 126 ? 148.171 -43.759 -9.281  1.00 10.66 ? 422  VAL D CB    1 
ATOM   6430  C  CG1   . VAL F 3 126 ? 148.074 -42.334 -8.741  1.00 14.47 ? 422  VAL D CG1   1 
ATOM   6431  C  CG2   . VAL F 3 126 ? 147.071 -44.030 -10.294 1.00 12.53 ? 422  VAL D CG2   1 
ATOM   6432  N  N     . ARG F 3 127 ? 149.461 -43.447 -12.288 1.00 12.02 ? 423  ARG D N     1 
ATOM   6433  C  CA    . ARG F 3 127 ? 149.633 -42.598 -13.459 1.00 13.18 ? 423  ARG D CA    1 
ATOM   6434  C  C     . ARG F 3 127 ? 148.364 -41.849 -13.840 1.00 13.30 ? 423  ARG D C     1 
ATOM   6435  O  O     . ARG F 3 127 ? 147.258 -42.304 -13.554 1.00 12.14 ? 423  ARG D O     1 
ATOM   6436  C  CB    . ARG F 3 127 ? 150.058 -43.435 -14.670 1.00 17.48 ? 423  ARG D CB    1 
ATOM   6437  C  CG    . ARG F 3 127 ? 151.395 -44.151 -14.548 1.00 22.67 ? 423  ARG D CG    1 
ATOM   6438  C  CD    . ARG F 3 127 ? 151.669 -44.968 -15.811 1.00 28.45 ? 423  ARG D CD    1 
ATOM   6439  N  NE    . ARG F 3 127 ? 151.841 -44.132 -17.002 1.00 36.06 ? 423  ARG D NE    1 
ATOM   6440  C  CZ    . ARG F 3 127 ? 152.919 -43.392 -17.256 1.00 38.33 ? 423  ARG D CZ    1 
ATOM   6441  N  NH1   . ARG F 3 127 ? 153.934 -43.378 -16.404 1.00 42.12 ? 423  ARG D NH1   1 
ATOM   6442  N  NH2   . ARG F 3 127 ? 152.990 -42.668 -18.367 1.00 39.95 ? 423  ARG D NH2   1 
ATOM   6443  N  N     . PRO F 3 128 ? 148.513 -40.684 -14.497 1.00 13.94 ? 424  PRO D N     1 
ATOM   6444  C  CA    . PRO F 3 128 ? 147.360 -39.891 -14.931 1.00 14.66 ? 424  PRO D CA    1 
ATOM   6445  C  C     . PRO F 3 128 ? 146.688 -40.702 -16.045 1.00 15.62 ? 424  PRO D C     1 
ATOM   6446  O  O     . PRO F 3 128 ? 147.374 -41.387 -16.810 1.00 16.26 ? 424  PRO D O     1 
ATOM   6447  C  CB    . PRO F 3 128 ? 147.984 -38.596 -15.445 1.00 15.15 ? 424  PRO D CB    1 
ATOM   6448  C  CG    . PRO F 3 128 ? 149.289 -38.510 -14.708 1.00 17.01 ? 424  PRO D CG    1 
ATOM   6449  C  CD    . PRO F 3 128 ? 149.768 -39.938 -14.700 1.00 15.13 ? 424  PRO D CD    1 
ATOM   6450  N  N     . ASP F 3 129 ? 145.367 -40.635 -16.142 1.00 14.06 ? 425  ASP D N     1 
ATOM   6451  C  CA    . ASP F 3 129 ? 144.661 -41.384 -17.176 1.00 14.61 ? 425  ASP D CA    1 
ATOM   6452  C  C     . ASP F 3 129 ? 145.138 -41.058 -18.589 1.00 15.96 ? 425  ASP D C     1 
ATOM   6453  O  O     . ASP F 3 129 ? 145.245 -41.946 -19.435 1.00 17.06 ? 425  ASP D O     1 
ATOM   6454  C  CB    . ASP F 3 129 ? 143.156 -41.134 -17.089 1.00 14.06 ? 425  ASP D CB    1 
ATOM   6455  C  CG    . ASP F 3 129 ? 142.513 -41.840 -15.910 1.00 15.30 ? 425  ASP D CG    1 
ATOM   6456  O  OD1   . ASP F 3 129 ? 143.112 -42.807 -15.397 1.00 13.85 ? 425  ASP D OD1   1 
ATOM   6457  O  OD2   . ASP F 3 129 ? 141.403 -41.432 -15.505 1.00 15.64 ? 425  ASP D OD2   1 
ATOM   6458  N  N     . GLU F 3 130 ? 145.417 -39.785 -18.843 1.00 16.97 ? 426  GLU D N     1 
ATOM   6459  C  CA    . GLU F 3 130 ? 145.872 -39.353 -20.160 1.00 20.04 ? 426  GLU D CA    1 
ATOM   6460  C  C     . GLU F 3 130 ? 147.197 -40.008 -20.548 1.00 18.88 ? 426  GLU D C     1 
ATOM   6461  O  O     . GLU F 3 130 ? 147.432 -40.309 -21.716 1.00 20.05 ? 426  GLU D O     1 
ATOM   6462  C  CB    . GLU F 3 130 ? 146.019 -37.831 -20.184 1.00 23.64 ? 426  GLU D CB    1 
ATOM   6463  C  CG    . GLU F 3 130 ? 146.418 -37.278 -21.537 1.00 31.51 ? 426  GLU D CG    1 
ATOM   6464  C  CD    . GLU F 3 130 ? 146.534 -35.769 -21.527 1.00 35.68 ? 426  GLU D CD    1 
ATOM   6465  O  OE1   . GLU F 3 130 ? 145.515 -35.099 -21.253 1.00 37.33 ? 426  GLU D OE1   1 
ATOM   6466  O  OE2   . GLU F 3 130 ? 147.645 -35.257 -21.790 1.00 38.82 ? 426  GLU D OE2   1 
ATOM   6467  N  N     . ALA F 3 131 ? 148.056 -40.239 -19.562 1.00 18.76 ? 427  ALA D N     1 
ATOM   6468  C  CA    . ALA F 3 131 ? 149.347 -40.862 -19.818 1.00 20.42 ? 427  ALA D CA    1 
ATOM   6469  C  C     . ALA F 3 131 ? 149.167 -42.315 -20.241 1.00 20.68 ? 427  ALA D C     1 
ATOM   6470  O  O     . ALA F 3 131 ? 149.935 -42.833 -21.046 1.00 22.13 ? 427  ALA D O     1 
ATOM   6471  C  CB    . ALA F 3 131 ? 150.228 -40.784 -18.569 1.00 20.88 ? 427  ALA D CB    1 
ATOM   6472  N  N     . VAL F 3 132 ? 148.138 -42.964 -19.708 1.00 19.66 ? 428  VAL D N     1 
ATOM   6473  C  CA    . VAL F 3 132 ? 147.879 -44.363 -20.026 1.00 18.37 ? 428  VAL D CA    1 
ATOM   6474  C  C     . VAL F 3 132 ? 147.077 -44.572 -21.312 1.00 19.57 ? 428  VAL D C     1 
ATOM   6475  O  O     . VAL F 3 132 ? 147.410 -45.438 -22.123 1.00 18.42 ? 428  VAL D O     1 
ATOM   6476  C  CB    . VAL F 3 132 ? 147.128 -45.060 -18.860 1.00 18.37 ? 428  VAL D CB    1 
ATOM   6477  C  CG1   . VAL F 3 132 ? 146.749 -46.478 -19.249 1.00 17.53 ? 428  VAL D CG1   1 
ATOM   6478  C  CG2   . VAL F 3 132 ? 148.005 -45.074 -17.612 1.00 15.32 ? 428  VAL D CG2   1 
ATOM   6479  N  N     . TYR F 3 133 ? 146.036 -43.768 -21.503 1.00 18.81 ? 429  TYR D N     1 
ATOM   6480  C  CA    . TYR F 3 133 ? 145.167 -43.915 -22.665 1.00 19.41 ? 429  TYR D CA    1 
ATOM   6481  C  C     . TYR F 3 133 ? 145.497 -43.079 -23.902 1.00 20.05 ? 429  TYR D C     1 
ATOM   6482  O  O     . TYR F 3 133 ? 145.041 -43.393 -25.001 1.00 19.45 ? 429  TYR D O     1 
ATOM   6483  C  CB    . TYR F 3 133 ? 143.719 -43.649 -22.244 1.00 15.93 ? 429  TYR D CB    1 
ATOM   6484  C  CG    . TYR F 3 133 ? 143.234 -44.585 -21.160 1.00 16.26 ? 429  TYR D CG    1 
ATOM   6485  C  CD1   . TYR F 3 133 ? 142.929 -44.111 -19.885 1.00 16.86 ? 429  TYR D CD1   1 
ATOM   6486  C  CD2   . TYR F 3 133 ? 143.093 -45.954 -21.406 1.00 15.78 ? 429  TYR D CD2   1 
ATOM   6487  C  CE1   . TYR F 3 133 ? 142.497 -44.973 -18.881 1.00 13.87 ? 429  TYR D CE1   1 
ATOM   6488  C  CE2   . TYR F 3 133 ? 142.665 -46.825 -20.409 1.00 15.37 ? 429  TYR D CE2   1 
ATOM   6489  C  CZ    . TYR F 3 133 ? 142.371 -46.328 -19.152 1.00 15.32 ? 429  TYR D CZ    1 
ATOM   6490  O  OH    . TYR F 3 133 ? 141.978 -47.191 -18.161 1.00 13.35 ? 429  TYR D OH    1 
ATOM   6491  N  N     . GLY F 3 134 ? 146.279 -42.022 -23.733 1.00 21.44 ? 430  GLY D N     1 
ATOM   6492  C  CA    . GLY F 3 134 ? 146.620 -41.190 -24.873 1.00 23.94 ? 430  GLY D CA    1 
ATOM   6493  C  C     . GLY F 3 134 ? 145.529 -40.169 -25.126 1.00 25.79 ? 430  GLY D C     1 
ATOM   6494  O  O     . GLY F 3 134 ? 144.516 -40.162 -24.423 1.00 25.66 ? 430  GLY D O     1 
ATOM   6495  N  N     . LYS F 3 135 ? 145.723 -39.313 -26.126 1.00 26.52 ? 431  LYS D N     1 
ATOM   6496  C  CA    . LYS F 3 135 ? 144.741 -38.279 -26.436 1.00 28.83 ? 431  LYS D CA    1 
ATOM   6497  C  C     . LYS F 3 135 ? 144.352 -38.188 -27.910 1.00 28.26 ? 431  LYS D C     1 
ATOM   6498  O  O     . LYS F 3 135 ? 145.091 -38.621 -28.799 1.00 27.40 ? 431  LYS D O     1 
ATOM   6499  C  CB    . LYS F 3 135 ? 145.259 -36.916 -25.974 1.00 31.49 ? 431  LYS D CB    1 
ATOM   6500  C  CG    . LYS F 3 135 ? 146.599 -36.527 -26.578 1.00 35.18 ? 431  LYS D CG    1 
ATOM   6501  C  CD    . LYS F 3 135 ? 146.983 -35.095 -26.225 1.00 37.95 ? 431  LYS D CD    1 
ATOM   6502  C  CE    . LYS F 3 135 ? 147.105 -34.901 -24.721 1.00 39.41 ? 431  LYS D CE    1 
ATOM   6503  N  NZ    . LYS F 3 135 ? 147.403 -33.483 -24.367 1.00 42.12 ? 431  LYS D NZ    1 
ATOM   6504  N  N     . GLY F 3 136 ? 143.180 -37.611 -28.150 1.00 26.80 ? 432  GLY D N     1 
ATOM   6505  C  CA    . GLY F 3 136 ? 142.687 -37.440 -29.502 1.00 26.31 ? 432  GLY D CA    1 
ATOM   6506  C  C     . GLY F 3 136 ? 142.565 -38.727 -30.288 1.00 25.60 ? 432  GLY D C     1 
ATOM   6507  O  O     . GLY F 3 136 ? 142.092 -39.741 -29.777 1.00 23.67 ? 432  GLY D O     1 
ATOM   6508  N  N     . ALA F 3 137 ? 143.000 -38.682 -31.542 1.00 25.06 ? 433  ALA D N     1 
ATOM   6509  C  CA    . ALA F 3 137 ? 142.932 -39.845 -32.417 1.00 25.87 ? 433  ALA D CA    1 
ATOM   6510  C  C     . ALA F 3 137 ? 143.794 -41.012 -31.938 1.00 25.53 ? 433  ALA D C     1 
ATOM   6511  O  O     . ALA F 3 137 ? 143.618 -42.142 -32.395 1.00 26.41 ? 433  ALA D O     1 
ATOM   6512  C  CB    . ALA F 3 137 ? 143.335 -39.448 -33.839 1.00 26.22 ? 433  ALA D CB    1 
ATOM   6513  N  N     . LYS F 3 138 ? 144.718 -40.743 -31.020 1.00 25.23 ? 434  LYS D N     1 
ATOM   6514  C  CA    . LYS F 3 138 ? 145.599 -41.788 -30.499 1.00 26.32 ? 434  LYS D CA    1 
ATOM   6515  C  C     . LYS F 3 138 ? 145.036 -42.457 -29.248 1.00 25.23 ? 434  LYS D C     1 
ATOM   6516  O  O     . LYS F 3 138 ? 145.582 -43.448 -28.768 1.00 25.03 ? 434  LYS D O     1 
ATOM   6517  C  CB    . LYS F 3 138 ? 146.980 -41.212 -30.173 1.00 28.07 ? 434  LYS D CB    1 
ATOM   6518  C  CG    . LYS F 3 138 ? 147.769 -40.710 -31.374 1.00 31.13 ? 434  LYS D CG    1 
ATOM   6519  C  CD    . LYS F 3 138 ? 149.129 -40.176 -30.936 1.00 34.46 ? 434  LYS D CD    1 
ATOM   6520  C  CE    . LYS F 3 138 ? 149.920 -39.629 -32.114 1.00 37.82 ? 434  LYS D CE    1 
ATOM   6521  N  NZ    . LYS F 3 138 ? 151.230 -39.038 -31.707 1.00 40.97 ? 434  LYS D NZ    1 
ATOM   6522  N  N     . ARG F 3 139 ? 143.943 -41.917 -28.722 1.00 24.94 ? 435  ARG D N     1 
ATOM   6523  C  CA    . ARG F 3 139 ? 143.339 -42.472 -27.518 1.00 25.02 ? 435  ARG D CA    1 
ATOM   6524  C  C     . ARG F 3 139 ? 142.997 -43.940 -27.737 1.00 24.84 ? 435  ARG D C     1 
ATOM   6525  O  O     . ARG F 3 139 ? 142.380 -44.292 -28.739 1.00 24.96 ? 435  ARG D O     1 
ATOM   6526  C  CB    . ARG F 3 139 ? 142.078 -41.685 -27.154 1.00 25.41 ? 435  ARG D CB    1 
ATOM   6527  C  CG    . ARG F 3 139 ? 141.560 -41.952 -25.751 1.00 28.72 ? 435  ARG D CG    1 
ATOM   6528  C  CD    . ARG F 3 139 ? 141.375 -40.641 -24.994 1.00 31.59 ? 435  ARG D CD    1 
ATOM   6529  N  NE    . ARG F 3 139 ? 140.972 -40.851 -23.605 1.00 33.33 ? 435  ARG D NE    1 
ATOM   6530  C  CZ    . ARG F 3 139 ? 139.751 -41.205 -23.223 1.00 33.22 ? 435  ARG D CZ    1 
ATOM   6531  N  NH1   . ARG F 3 139 ? 138.799 -41.388 -24.130 1.00 32.88 ? 435  ARG D NH1   1 
ATOM   6532  N  NH2   . ARG F 3 139 ? 139.484 -41.377 -21.934 1.00 33.25 ? 435  ARG D NH2   1 
ATOM   6533  N  N     . ALA F 3 140 ? 143.400 -44.798 -26.804 1.00 23.49 ? 436  ALA D N     1 
ATOM   6534  C  CA    . ALA F 3 140 ? 143.123 -46.224 -26.933 1.00 23.05 ? 436  ALA D CA    1 
ATOM   6535  C  C     . ALA F 3 140 ? 143.402 -47.002 -25.654 1.00 22.22 ? 436  ALA D C     1 
ATOM   6536  O  O     . ALA F 3 140 ? 144.240 -46.607 -24.840 1.00 21.63 ? 436  ALA D O     1 
ATOM   6537  C  CB    . ALA F 3 140 ? 143.946 -46.806 -28.073 1.00 24.05 ? 436  ALA D CB    1 
ATOM   6538  N  N     . VAL F 3 141 ? 142.689 -48.112 -25.489 1.00 20.79 ? 437  VAL D N     1 
ATOM   6539  C  CA    . VAL F 3 141 ? 142.867 -48.977 -24.331 1.00 20.37 ? 437  VAL D CA    1 
ATOM   6540  C  C     . VAL F 3 141 ? 144.168 -49.739 -24.549 1.00 20.10 ? 437  VAL D C     1 
ATOM   6541  O  O     . VAL F 3 141 ? 144.343 -50.400 -25.571 1.00 19.35 ? 437  VAL D O     1 
ATOM   6542  C  CB    . VAL F 3 141 ? 141.716 -49.999 -24.200 1.00 21.94 ? 437  VAL D CB    1 
ATOM   6543  C  CG1   . VAL F 3 141 ? 142.004 -50.970 -23.064 1.00 23.52 ? 437  VAL D CG1   1 
ATOM   6544  C  CG2   . VAL F 3 141 ? 140.400 -49.271 -23.951 1.00 23.08 ? 437  VAL D CG2   1 
ATOM   6545  N  N     . PRO F 3 142 ? 145.097 -49.663 -23.587 1.00 18.57 ? 438  PRO D N     1 
ATOM   6546  C  CA    . PRO F 3 142 ? 146.376 -50.362 -23.721 1.00 18.74 ? 438  PRO D CA    1 
ATOM   6547  C  C     . PRO F 3 142 ? 146.294 -51.877 -23.529 1.00 20.55 ? 438  PRO D C     1 
ATOM   6548  O  O     . PRO F 3 142 ? 145.239 -52.423 -23.197 1.00 19.52 ? 438  PRO D O     1 
ATOM   6549  C  CB    . PRO F 3 142 ? 147.247 -49.673 -22.678 1.00 18.35 ? 438  PRO D CB    1 
ATOM   6550  C  CG    . PRO F 3 142 ? 146.257 -49.414 -21.571 1.00 17.74 ? 438  PRO D CG    1 
ATOM   6551  C  CD    . PRO F 3 142 ? 145.040 -48.901 -22.324 1.00 18.58 ? 438  PRO D CD    1 
ATOM   6552  N  N     . ASP F 3 143 ? 147.426 -52.542 -23.744 1.00 21.63 ? 439  ASP D N     1 
ATOM   6553  C  CA    . ASP F 3 143 ? 147.536 -53.988 -23.593 1.00 22.39 ? 439  ASP D CA    1 
ATOM   6554  C  C     . ASP F 3 143 ? 147.057 -54.378 -22.190 1.00 21.39 ? 439  ASP D C     1 
ATOM   6555  O  O     . ASP F 3 143 ? 147.276 -53.637 -21.234 1.00 20.31 ? 439  ASP D O     1 
ATOM   6556  C  CB    . ASP F 3 143 ? 148.997 -54.403 -23.801 1.00 25.27 ? 439  ASP D CB    1 
ATOM   6557  C  CG    . ASP F 3 143 ? 149.150 -55.880 -24.072 1.00 27.53 ? 439  ASP D CG    1 
ATOM   6558  O  OD1   . ASP F 3 143 ? 148.375 -56.407 -24.895 1.00 29.33 ? 439  ASP D OD1   1 
ATOM   6559  O  OD2   . ASP F 3 143 ? 150.049 -56.508 -23.476 1.00 31.39 ? 439  ASP D OD2   1 
ATOM   6560  N  N     . GLU F 3 144 ? 146.421 -55.540 -22.064 1.00 19.90 ? 440  GLU D N     1 
ATOM   6561  C  CA    . GLU F 3 144 ? 145.888 -55.979 -20.775 1.00 20.20 ? 440  GLU D CA    1 
ATOM   6562  C  C     . GLU F 3 144 ? 146.802 -55.779 -19.567 1.00 20.42 ? 440  GLU D C     1 
ATOM   6563  O  O     . GLU F 3 144 ? 146.356 -55.296 -18.526 1.00 18.27 ? 440  GLU D O     1 
ATOM   6564  C  CB    . GLU F 3 144 ? 145.440 -57.447 -20.838 1.00 22.29 ? 440  GLU D CB    1 
ATOM   6565  C  CG    . GLU F 3 144 ? 144.685 -57.897 -19.590 1.00 22.70 ? 440  GLU D CG    1 
ATOM   6566  C  CD    . GLU F 3 144 ? 144.104 -59.294 -19.708 1.00 25.45 ? 440  GLU D CD    1 
ATOM   6567  O  OE1   . GLU F 3 144 ? 144.884 -60.269 -19.700 1.00 26.84 ? 440  GLU D OE1   1 
ATOM   6568  O  OE2   . GLU F 3 144 ? 142.863 -59.415 -19.811 1.00 23.07 ? 440  GLU D OE2   1 
ATOM   6569  N  N     . PRO F 3 145 ? 148.089 -56.150 -19.679 1.00 20.78 ? 441  PRO D N     1 
ATOM   6570  C  CA    . PRO F 3 145 ? 148.993 -55.973 -18.539 1.00 20.37 ? 441  PRO D CA    1 
ATOM   6571  C  C     . PRO F 3 145 ? 149.100 -54.518 -18.090 1.00 19.02 ? 441  PRO D C     1 
ATOM   6572  O  O     . PRO F 3 145 ? 149.122 -54.227 -16.893 1.00 18.15 ? 441  PRO D O     1 
ATOM   6573  C  CB    . PRO F 3 145 ? 150.318 -56.529 -19.051 1.00 23.09 ? 441  PRO D CB    1 
ATOM   6574  C  CG    . PRO F 3 145 ? 149.880 -57.563 -20.052 1.00 22.76 ? 441  PRO D CG    1 
ATOM   6575  C  CD    . PRO F 3 145 ? 148.772 -56.857 -20.777 1.00 21.12 ? 441  PRO D CD    1 
ATOM   6576  N  N     . VAL F 3 146 ? 149.169 -53.611 -19.057 1.00 16.93 ? 442  VAL D N     1 
ATOM   6577  C  CA    . VAL F 3 146 ? 149.284 -52.193 -18.758 1.00 17.78 ? 442  VAL D CA    1 
ATOM   6578  C  C     . VAL F 3 146 ? 147.971 -51.659 -18.193 1.00 16.96 ? 442  VAL D C     1 
ATOM   6579  O  O     . VAL F 3 146 ? 147.969 -50.851 -17.265 1.00 16.90 ? 442  VAL D O     1 
ATOM   6580  C  CB    . VAL F 3 146 ? 149.665 -51.390 -20.018 1.00 18.67 ? 442  VAL D CB    1 
ATOM   6581  C  CG1   . VAL F 3 146 ? 149.784 -49.913 -19.676 1.00 18.72 ? 442  VAL D CG1   1 
ATOM   6582  C  CG2   . VAL F 3 146 ? 150.994 -51.909 -20.582 1.00 20.69 ? 442  VAL D CG2   1 
ATOM   6583  N  N     . LEU F 3 147 ? 146.859 -52.114 -18.758 1.00 14.94 ? 443  LEU D N     1 
ATOM   6584  C  CA    . LEU F 3 147 ? 145.545 -51.685 -18.291 1.00 14.06 ? 443  LEU D CA    1 
ATOM   6585  C  C     . LEU F 3 147 ? 145.321 -52.158 -16.855 1.00 14.34 ? 443  LEU D C     1 
ATOM   6586  O  O     . LEU F 3 147 ? 144.928 -51.380 -15.987 1.00 13.61 ? 443  LEU D O     1 
ATOM   6587  C  CB    . LEU F 3 147 ? 144.455 -52.260 -19.193 1.00 14.68 ? 443  LEU D CB    1 
ATOM   6588  C  CG    . LEU F 3 147 ? 143.013 -52.093 -18.700 1.00 14.72 ? 443  LEU D CG    1 
ATOM   6589  C  CD1   . LEU F 3 147 ? 142.661 -50.613 -18.589 1.00 12.38 ? 443  LEU D CD1   1 
ATOM   6590  C  CD2   . LEU F 3 147 ? 142.074 -52.804 -19.654 1.00 12.56 ? 443  LEU D CD2   1 
ATOM   6591  N  N     . ALA F 3 148 ? 145.587 -53.440 -16.615 1.00 12.56 ? 444  ALA D N     1 
ATOM   6592  C  CA    . ALA F 3 148 ? 145.406 -54.040 -15.300 1.00 13.80 ? 444  ALA D CA    1 
ATOM   6593  C  C     . ALA F 3 148 ? 146.197 -53.335 -14.202 1.00 14.78 ? 444  ALA D C     1 
ATOM   6594  O  O     . ALA F 3 148 ? 145.654 -53.049 -13.135 1.00 16.58 ? 444  ALA D O     1 
ATOM   6595  C  CB    . ALA F 3 148 ? 145.779 -55.525 -15.344 1.00 12.52 ? 444  ALA D CB    1 
ATOM   6596  N  N     . GLU F 3 149 ? 147.475 -53.054 -14.448 1.00 15.10 ? 445  GLU D N     1 
ATOM   6597  C  CA    . GLU F 3 149 ? 148.270 -52.381 -13.428 1.00 14.50 ? 445  GLU D CA    1 
ATOM   6598  C  C     . GLU F 3 149 ? 147.699 -50.994 -13.146 1.00 12.93 ? 445  GLU D C     1 
ATOM   6599  O  O     . GLU F 3 149 ? 147.651 -50.559 -12.002 1.00 12.02 ? 445  GLU D O     1 
ATOM   6600  C  CB    . GLU F 3 149 ? 149.741 -52.246 -13.851 1.00 17.23 ? 445  GLU D CB    1 
ATOM   6601  C  CG    . GLU F 3 149 ? 150.580 -51.597 -12.758 1.00 20.78 ? 445  GLU D CG    1 
ATOM   6602  C  CD    . GLU F 3 149 ? 152.048 -51.437 -13.109 1.00 24.63 ? 445  GLU D CD    1 
ATOM   6603  O  OE1   . GLU F 3 149 ? 152.791 -50.904 -12.261 1.00 26.68 ? 445  GLU D OE1   1 
ATOM   6604  O  OE2   . GLU F 3 149 ? 152.463 -51.835 -14.217 1.00 23.98 ? 445  GLU D OE2   1 
ATOM   6605  N  N     . HIS F 3 150 ? 147.269 -50.303 -14.195 1.00 11.25 ? 446  HIS D N     1 
ATOM   6606  C  CA    . HIS F 3 150 ? 146.706 -48.967 -14.032 1.00 11.85 ? 446  HIS D CA    1 
ATOM   6607  C  C     . HIS F 3 150 ? 145.446 -48.995 -13.168 1.00 11.09 ? 446  HIS D C     1 
ATOM   6608  O  O     . HIS F 3 150 ? 145.330 -48.229 -12.215 1.00 10.50 ? 446  HIS D O     1 
ATOM   6609  C  CB    . HIS F 3 150 ? 146.387 -48.351 -15.393 1.00 10.53 ? 446  HIS D CB    1 
ATOM   6610  C  CG    . HIS F 3 150 ? 145.802 -46.973 -15.314 1.00 13.86 ? 446  HIS D CG    1 
ATOM   6611  N  ND1   . HIS F 3 150 ? 146.374 -45.959 -14.573 1.00 15.12 ? 446  HIS D ND1   1 
ATOM   6612  C  CD2   . HIS F 3 150 ? 144.723 -46.427 -15.926 1.00 14.27 ? 446  HIS D CD2   1 
ATOM   6613  C  CE1   . HIS F 3 150 ? 145.676 -44.850 -14.734 1.00 13.55 ? 446  HIS D CE1   1 
ATOM   6614  N  NE2   . HIS F 3 150 ? 144.669 -45.105 -15.551 1.00 14.63 ? 446  HIS D NE2   1 
ATOM   6615  N  N     . LEU F 3 151 ? 144.505 -49.877 -13.491 1.00 11.11 ? 447  LEU D N     1 
ATOM   6616  C  CA    . LEU F 3 151 ? 143.278 -49.951 -12.704 1.00 11.13 ? 447  LEU D CA    1 
ATOM   6617  C  C     . LEU F 3 151 ? 143.575 -50.345 -11.258 1.00 11.53 ? 447  LEU D C     1 
ATOM   6618  O  O     . LEU F 3 151 ? 142.984 -49.800 -10.323 1.00 10.12 ? 447  LEU D O     1 
ATOM   6619  C  CB    . LEU F 3 151 ? 142.291 -50.939 -13.330 1.00 9.82  ? 447  LEU D CB    1 
ATOM   6620  C  CG    . LEU F 3 151 ? 141.924 -50.659 -14.792 1.00 10.84 ? 447  LEU D CG    1 
ATOM   6621  C  CD1   . LEU F 3 151 ? 140.659 -51.429 -15.144 1.00 10.52 ? 447  LEU D CD1   1 
ATOM   6622  C  CD2   . LEU F 3 151 ? 141.717 -49.153 -15.014 1.00 9.86  ? 447  LEU D CD2   1 
ATOM   6623  N  N     . VAL F 3 152 ? 144.492 -51.287 -11.066 1.00 9.47  ? 448  VAL D N     1 
ATOM   6624  C  CA    . VAL F 3 152 ? 144.842 -51.707 -9.715  1.00 10.45 ? 448  VAL D CA    1 
ATOM   6625  C  C     . VAL F 3 152 ? 145.485 -50.554 -8.942  1.00 9.91  ? 448  VAL D C     1 
ATOM   6626  O  O     . VAL F 3 152 ? 145.202 -50.360 -7.758  1.00 10.46 ? 448  VAL D O     1 
ATOM   6627  C  CB    . VAL F 3 152 ? 145.796 -52.922 -9.740  1.00 11.96 ? 448  VAL D CB    1 
ATOM   6628  C  CG1   . VAL F 3 152 ? 146.417 -53.137 -8.364  1.00 12.97 ? 448  VAL D CG1   1 
ATOM   6629  C  CG2   . VAL F 3 152 ? 145.012 -54.175 -10.157 1.00 12.78 ? 448  VAL D CG2   1 
ATOM   6630  N  N     . ARG F 3 153 ? 146.349 -49.789 -9.604  1.00 10.10 ? 449  ARG D N     1 
ATOM   6631  C  CA    . ARG F 3 153 ? 146.994 -48.665 -8.941  1.00 10.92 ? 449  ARG D CA    1 
ATOM   6632  C  C     . ARG F 3 153 ? 145.971 -47.590 -8.598  1.00 10.50 ? 449  ARG D C     1 
ATOM   6633  O  O     . ARG F 3 153 ? 146.114 -46.877 -7.608  1.00 11.18 ? 449  ARG D O     1 
ATOM   6634  C  CB    . ARG F 3 153 ? 148.107 -48.082 -9.813  1.00 11.51 ? 449  ARG D CB    1 
ATOM   6635  C  CG    . ARG F 3 153 ? 149.415 -48.852 -9.698  1.00 11.16 ? 449  ARG D CG    1 
ATOM   6636  C  CD    . ARG F 3 153 ? 150.534 -48.188 -10.474 1.00 11.67 ? 449  ARG D CD    1 
ATOM   6637  N  NE    . ARG F 3 153 ? 151.793 -48.921 -10.332 1.00 14.80 ? 449  ARG D NE    1 
ATOM   6638  C  CZ    . ARG F 3 153 ? 152.561 -48.902 -9.246  1.00 15.74 ? 449  ARG D CZ    1 
ATOM   6639  N  NH1   . ARG F 3 153 ? 152.216 -48.177 -8.185  1.00 12.09 ? 449  ARG D NH1   1 
ATOM   6640  N  NH2   . ARG F 3 153 ? 153.674 -49.626 -9.217  1.00 15.51 ? 449  ARG D NH2   1 
ATOM   6641  N  N     . LYS F 3 154 ? 144.932 -47.462 -9.413  1.00 12.30 ? 450  LYS D N     1 
ATOM   6642  C  CA    . LYS F 3 154 ? 143.912 -46.469 -9.099  1.00 10.72 ? 450  LYS D CA    1 
ATOM   6643  C  C     . LYS F 3 154 ? 143.105 -46.956 -7.893  1.00 10.83 ? 450  LYS D C     1 
ATOM   6644  O  O     . LYS F 3 154 ? 142.810 -46.180 -6.980  1.00 11.72 ? 450  LYS D O     1 
ATOM   6645  C  CB    . LYS F 3 154 ? 143.013 -46.214 -10.311 1.00 10.88 ? 450  LYS D CB    1 
ATOM   6646  C  CG    . LYS F 3 154 ? 143.764 -45.516 -11.442 1.00 12.80 ? 450  LYS D CG    1 
ATOM   6647  C  CD    . LYS F 3 154 ? 142.852 -44.709 -12.349 1.00 13.27 ? 450  LYS D CD    1 
ATOM   6648  C  CE    . LYS F 3 154 ? 141.929 -45.579 -13.171 1.00 13.51 ? 450  LYS D CE    1 
ATOM   6649  N  NZ    . LYS F 3 154 ? 141.118 -44.740 -14.106 1.00 13.61 ? 450  LYS D NZ    1 
ATOM   6650  N  N     . ALA F 3 155 ? 142.779 -48.245 -7.870  1.00 9.01  ? 451  ALA D N     1 
ATOM   6651  C  CA    . ALA F 3 155 ? 142.024 -48.816 -6.757  1.00 8.69  ? 451  ALA D CA    1 
ATOM   6652  C  C     . ALA F 3 155 ? 142.843 -48.714 -5.470  1.00 9.07  ? 451  ALA D C     1 
ATOM   6653  O  O     . ALA F 3 155 ? 142.304 -48.405 -4.403  1.00 10.53 ? 451  ALA D O     1 
ATOM   6654  C  CB    . ALA F 3 155 ? 141.675 -50.282 -7.047  1.00 10.06 ? 451  ALA D CB    1 
ATOM   6655  N  N     . ALA F 3 156 ? 144.144 -48.972 -5.579  1.00 8.08  ? 452  ALA D N     1 
ATOM   6656  C  CA    . ALA F 3 156 ? 145.053 -48.909 -4.437  1.00 10.06 ? 452  ALA D CA    1 
ATOM   6657  C  C     . ALA F 3 156 ? 145.118 -47.490 -3.880  1.00 9.56  ? 452  ALA D C     1 
ATOM   6658  O  O     . ALA F 3 156 ? 145.128 -47.288 -2.665  1.00 10.08 ? 452  ALA D O     1 
ATOM   6659  C  CB    . ALA F 3 156 ? 146.458 -49.364 -4.855  1.00 7.57  ? 452  ALA D CB    1 
ATOM   6660  N  N     . ALA F 3 157 ? 145.172 -46.513 -4.778  1.00 9.64  ? 453  ALA D N     1 
ATOM   6661  C  CA    . ALA F 3 157 ? 145.229 -45.113 -4.376  1.00 10.55 ? 453  ALA D CA    1 
ATOM   6662  C  C     . ALA F 3 157 ? 143.957 -44.740 -3.620  1.00 11.18 ? 453  ALA D C     1 
ATOM   6663  O  O     . ALA F 3 157 ? 144.011 -44.117 -2.556  1.00 9.83  ? 453  ALA D O     1 
ATOM   6664  C  CB    . ALA F 3 157 ? 145.403 -44.221 -5.607  1.00 12.53 ? 453  ALA D CB    1 
ATOM   6665  N  N     . ILE F 3 158 ? 142.811 -45.125 -4.174  1.00 10.54 ? 454  ILE D N     1 
ATOM   6666  C  CA    . ILE F 3 158 ? 141.521 -44.846 -3.538  1.00 10.89 ? 454  ILE D CA    1 
ATOM   6667  C  C     . ILE F 3 158 ? 141.512 -45.464 -2.133  1.00 11.45 ? 454  ILE D C     1 
ATOM   6668  O  O     . ILE F 3 158 ? 141.137 -44.820 -1.149  1.00 10.87 ? 454  ILE D O     1 
ATOM   6669  C  CB    . ILE F 3 158 ? 140.366 -45.445 -4.383  1.00 10.38 ? 454  ILE D CB    1 
ATOM   6670  C  CG1   . ILE F 3 158 ? 140.341 -44.772 -5.760  1.00 11.52 ? 454  ILE D CG1   1 
ATOM   6671  C  CG2   . ILE F 3 158 ? 139.033 -45.269 -3.665  1.00 11.46 ? 454  ILE D CG2   1 
ATOM   6672  C  CD1   . ILE F 3 158 ? 139.456 -45.479 -6.782  1.00 12.60 ? 454  ILE D CD1   1 
ATOM   6673  N  N     . TRP F 3 159 ? 141.949 -46.715 -2.051  1.00 11.18 ? 455  TRP D N     1 
ATOM   6674  C  CA    . TRP F 3 159 ? 142.004 -47.449 -0.790  1.00 13.03 ? 455  TRP D CA    1 
ATOM   6675  C  C     . TRP F 3 159 ? 142.811 -46.713 0.286   1.00 13.85 ? 455  TRP D C     1 
ATOM   6676  O  O     . TRP F 3 159 ? 142.405 -46.653 1.451   1.00 13.94 ? 455  TRP D O     1 
ATOM   6677  C  CB    . TRP F 3 159 ? 142.601 -48.834 -1.053  1.00 11.29 ? 455  TRP D CB    1 
ATOM   6678  C  CG    . TRP F 3 159 ? 142.630 -49.762 0.120   1.00 13.58 ? 455  TRP D CG    1 
ATOM   6679  C  CD1   . TRP F 3 159 ? 143.732 -50.154 0.829   1.00 17.46 ? 455  TRP D CD1   1 
ATOM   6680  C  CD2   . TRP F 3 159 ? 141.515 -50.446 0.704   1.00 14.36 ? 455  TRP D CD2   1 
ATOM   6681  N  NE1   . TRP F 3 159 ? 143.370 -51.044 1.815   1.00 17.70 ? 455  TRP D NE1   1 
ATOM   6682  C  CE2   . TRP F 3 159 ? 142.015 -51.241 1.759   1.00 15.88 ? 455  TRP D CE2   1 
ATOM   6683  C  CE3   . TRP F 3 159 ? 140.139 -50.467 0.435   1.00 15.08 ? 455  TRP D CE3   1 
ATOM   6684  C  CZ2   . TRP F 3 159 ? 141.187 -52.051 2.547   1.00 16.78 ? 455  TRP D CZ2   1 
ATOM   6685  C  CZ3   . TRP F 3 159 ? 139.316 -51.273 1.221   1.00 17.37 ? 455  TRP D CZ3   1 
ATOM   6686  C  CH2   . TRP F 3 159 ? 139.846 -52.052 2.263   1.00 15.54 ? 455  TRP D CH2   1 
ATOM   6687  N  N     . GLU F 3 160 ? 143.938 -46.134 -0.109  1.00 14.49 ? 456  GLU D N     1 
ATOM   6688  C  CA    . GLU F 3 160 ? 144.807 -45.421 0.823   1.00 16.57 ? 456  GLU D CA    1 
ATOM   6689  C  C     . GLU F 3 160 ? 144.430 -43.961 1.076   1.00 15.52 ? 456  GLU D C     1 
ATOM   6690  O  O     . GLU F 3 160 ? 144.758 -43.411 2.121   1.00 13.64 ? 456  GLU D O     1 
ATOM   6691  C  CB    . GLU F 3 160 ? 146.257 -45.466 0.322   1.00 20.11 ? 456  GLU D CB    1 
ATOM   6692  C  CG    . GLU F 3 160 ? 146.822 -46.870 0.180   1.00 25.61 ? 456  GLU D CG    1 
ATOM   6693  C  CD    . GLU F 3 160 ? 147.024 -47.562 1.517   1.00 27.45 ? 456  GLU D CD    1 
ATOM   6694  O  OE1   . GLU F 3 160 ? 147.097 -48.806 1.532   1.00 29.87 ? 456  GLU D OE1   1 
ATOM   6695  O  OE2   . GLU F 3 160 ? 147.125 -46.862 2.548   1.00 30.47 ? 456  GLU D OE2   1 
ATOM   6696  N  N     . LEU F 3 161 ? 143.732 -43.339 0.133   1.00 13.35 ? 457  LEU D N     1 
ATOM   6697  C  CA    . LEU F 3 161 ? 143.388 -41.927 0.271   1.00 12.18 ? 457  LEU D CA    1 
ATOM   6698  C  C     . LEU F 3 161 ? 142.073 -41.587 0.963   1.00 12.40 ? 457  LEU D C     1 
ATOM   6699  O  O     . LEU F 3 161 ? 141.878 -40.445 1.387   1.00 10.36 ? 457  LEU D O     1 
ATOM   6700  C  CB    . LEU F 3 161 ? 143.431 -41.267 -1.113  1.00 12.74 ? 457  LEU D CB    1 
ATOM   6701  C  CG    . LEU F 3 161 ? 144.830 -41.215 -1.744  1.00 13.19 ? 457  LEU D CG    1 
ATOM   6702  C  CD1   . LEU F 3 161 ? 144.736 -40.928 -3.225  1.00 13.04 ? 457  LEU D CD1   1 
ATOM   6703  C  CD2   . LEU F 3 161 ? 145.659 -40.156 -1.041  1.00 16.57 ? 457  LEU D CD2   1 
ATOM   6704  N  N     . GLU F 3 162 ? 141.171 -42.556 1.088   1.00 11.84 ? 458  GLU D N     1 
ATOM   6705  C  CA    . GLU F 3 162 ? 139.886 -42.279 1.729   1.00 12.69 ? 458  GLU D CA    1 
ATOM   6706  C  C     . GLU F 3 162 ? 140.048 -41.647 3.112   1.00 14.24 ? 458  GLU D C     1 
ATOM   6707  O  O     . GLU F 3 162 ? 139.416 -40.634 3.412   1.00 11.77 ? 458  GLU D O     1 
ATOM   6708  C  CB    . GLU F 3 162 ? 139.046 -43.555 1.864   1.00 13.71 ? 458  GLU D CB    1 
ATOM   6709  C  CG    . GLU F 3 162 ? 137.692 -43.304 2.526   1.00 16.82 ? 458  GLU D CG    1 
ATOM   6710  C  CD    . GLU F 3 162 ? 136.830 -44.556 2.636   1.00 19.39 ? 458  GLU D CD    1 
ATOM   6711  O  OE1   . GLU F 3 162 ? 135.702 -44.443 3.155   1.00 20.87 ? 458  GLU D OE1   1 
ATOM   6712  O  OE2   . GLU F 3 162 ? 137.272 -45.644 2.204   1.00 19.91 ? 458  GLU D OE2   1 
ATOM   6713  N  N     . ARG F 3 163 ? 140.894 -42.239 3.953   1.00 15.03 ? 459  ARG D N     1 
ATOM   6714  C  CA    . ARG F 3 163 ? 141.089 -41.707 5.301   1.00 16.44 ? 459  ARG D CA    1 
ATOM   6715  C  C     . ARG F 3 163 ? 141.625 -40.277 5.307   1.00 15.20 ? 459  ARG D C     1 
ATOM   6716  O  O     . ARG F 3 163 ? 141.045 -39.404 5.947   1.00 14.74 ? 459  ARG D O     1 
ATOM   6717  C  CB    . ARG F 3 163 ? 142.009 -42.625 6.118   1.00 19.82 ? 459  ARG D CB    1 
ATOM   6718  C  CG    . ARG F 3 163 ? 142.328 -42.106 7.520   1.00 25.83 ? 459  ARG D CG    1 
ATOM   6719  C  CD    . ARG F 3 163 ? 141.079 -41.566 8.201   1.00 29.29 ? 459  ARG D CD    1 
ATOM   6720  N  NE    . ARG F 3 163 ? 139.978 -42.524 8.159   1.00 34.68 ? 459  ARG D NE    1 
ATOM   6721  C  CZ    . ARG F 3 163 ? 138.703 -42.206 8.359   1.00 36.41 ? 459  ARG D CZ    1 
ATOM   6722  N  NH1   . ARG F 3 163 ? 138.359 -40.948 8.614   1.00 37.92 ? 459  ARG D NH1   1 
ATOM   6723  N  NH2   . ARG F 3 163 ? 137.770 -43.148 8.305   1.00 38.65 ? 459  ARG D NH2   1 
ATOM   6724  N  N     . PRO F 3 164 ? 142.739 -40.020 4.597   1.00 15.86 ? 460  PRO D N     1 
ATOM   6725  C  CA    . PRO F 3 164 ? 143.326 -38.676 4.540   1.00 14.84 ? 460  PRO D CA    1 
ATOM   6726  C  C     . PRO F 3 164 ? 142.316 -37.630 4.052   1.00 15.15 ? 460  PRO D C     1 
ATOM   6727  O  O     . PRO F 3 164 ? 142.246 -36.517 4.573   1.00 13.25 ? 460  PRO D O     1 
ATOM   6728  C  CB    . PRO F 3 164 ? 144.504 -38.845 3.582   1.00 15.98 ? 460  PRO D CB    1 
ATOM   6729  C  CG    . PRO F 3 164 ? 144.892 -40.277 3.763   1.00 17.59 ? 460  PRO D CG    1 
ATOM   6730  C  CD    . PRO F 3 164 ? 143.561 -40.981 3.838   1.00 16.55 ? 460  PRO D CD    1 
ATOM   6731  N  N     . PHE F 3 165 ? 141.536 -37.994 3.041   1.00 13.04 ? 461  PHE D N     1 
ATOM   6732  C  CA    . PHE F 3 165 ? 140.546 -37.071 2.504   1.00 11.85 ? 461  PHE D CA    1 
ATOM   6733  C  C     . PHE F 3 165 ? 139.390 -36.822 3.469   1.00 11.92 ? 461  PHE D C     1 
ATOM   6734  O  O     . PHE F 3 165 ? 138.978 -35.678 3.656   1.00 9.48  ? 461  PHE D O     1 
ATOM   6735  C  CB    . PHE F 3 165 ? 140.026 -37.573 1.154   1.00 11.27 ? 461  PHE D CB    1 
ATOM   6736  C  CG    . PHE F 3 165 ? 140.863 -37.135 -0.010  1.00 10.72 ? 461  PHE D CG    1 
ATOM   6737  C  CD1   . PHE F 3 165 ? 142.125 -37.683 -0.228  1.00 10.46 ? 461  PHE D CD1   1 
ATOM   6738  C  CD2   . PHE F 3 165 ? 140.399 -36.155 -0.881  1.00 11.22 ? 461  PHE D CD2   1 
ATOM   6739  C  CE1   . PHE F 3 165 ? 142.909 -37.259 -1.297  1.00 11.57 ? 461  PHE D CE1   1 
ATOM   6740  C  CE2   . PHE F 3 165 ? 141.178 -35.721 -1.956  1.00 13.19 ? 461  PHE D CE2   1 
ATOM   6741  C  CZ    . PHE F 3 165 ? 142.436 -36.274 -2.165  1.00 13.36 ? 461  PHE D CZ    1 
ATOM   6742  N  N     . LEU F 3 166 ? 138.871 -37.880 4.088   1.00 10.86 ? 462  LEU D N     1 
ATOM   6743  C  CA    . LEU F 3 166 ? 137.774 -37.719 5.040   1.00 12.90 ? 462  LEU D CA    1 
ATOM   6744  C  C     . LEU F 3 166 ? 138.244 -36.869 6.222   1.00 13.57 ? 462  LEU D C     1 
ATOM   6745  O  O     . LEU F 3 166 ? 137.494 -36.042 6.746   1.00 11.25 ? 462  LEU D O     1 
ATOM   6746  C  CB    . LEU F 3 166 ? 137.284 -39.083 5.538   1.00 13.09 ? 462  LEU D CB    1 
ATOM   6747  C  CG    . LEU F 3 166 ? 136.463 -39.890 4.529   1.00 14.33 ? 462  LEU D CG    1 
ATOM   6748  C  CD1   . LEU F 3 166 ? 136.092 -41.247 5.133   1.00 12.98 ? 462  LEU D CD1   1 
ATOM   6749  C  CD2   . LEU F 3 166 ? 135.206 -39.094 4.145   1.00 13.05 ? 462  LEU D CD2   1 
ATOM   6750  N  N     . ASP F 3 167 ? 139.492 -37.068 6.634   1.00 13.53 ? 463  ASP D N     1 
ATOM   6751  C  CA    . ASP F 3 167 ? 140.043 -36.300 7.744   1.00 14.47 ? 463  ASP D CA    1 
ATOM   6752  C  C     . ASP F 3 167 ? 140.090 -34.810 7.433   1.00 12.53 ? 463  ASP D C     1 
ATOM   6753  O  O     . ASP F 3 167 ? 139.778 -33.986 8.289   1.00 14.16 ? 463  ASP D O     1 
ATOM   6754  C  CB    . ASP F 3 167 ? 141.446 -36.797 8.102   1.00 18.64 ? 463  ASP D CB    1 
ATOM   6755  C  CG    . ASP F 3 167 ? 141.421 -38.072 8.920   1.00 20.48 ? 463  ASP D CG    1 
ATOM   6756  O  OD1   . ASP F 3 167 ? 142.506 -38.636 9.165   1.00 25.42 ? 463  ASP D OD1   1 
ATOM   6757  O  OD2   . ASP F 3 167 ? 140.322 -38.509 9.326   1.00 25.43 ? 463  ASP D OD2   1 
ATOM   6758  N  N     . GLU F 3 168 ? 140.474 -34.450 6.213   1.00 13.10 ? 464  GLU D N     1 
ATOM   6759  C  CA    . GLU F 3 168 ? 140.527 -33.038 5.875   1.00 12.93 ? 464  GLU D CA    1 
ATOM   6760  C  C     . GLU F 3 168 ? 139.115 -32.497 5.684   1.00 12.57 ? 464  GLU D C     1 
ATOM   6761  O  O     . GLU F 3 168 ? 138.824 -31.353 6.044   1.00 12.76 ? 464  GLU D O     1 
ATOM   6762  C  CB    . GLU F 3 168 ? 141.356 -32.781 4.609   1.00 12.66 ? 464  GLU D CB    1 
ATOM   6763  C  CG    . GLU F 3 168 ? 141.542 -31.286 4.374   1.00 14.92 ? 464  GLU D CG    1 
ATOM   6764  C  CD    . GLU F 3 168 ? 142.327 -30.942 3.129   1.00 15.87 ? 464  GLU D CD    1 
ATOM   6765  O  OE1   . GLU F 3 168 ? 142.472 -29.732 2.857   1.00 19.32 ? 464  GLU D OE1   1 
ATOM   6766  O  OE2   . GLU F 3 168 ? 142.797 -31.861 2.426   1.00 15.77 ? 464  GLU D OE2   1 
ATOM   6767  N  N     . LEU F 3 169 ? 138.232 -33.312 5.112   1.00 11.11 ? 465  LEU D N     1 
ATOM   6768  C  CA    . LEU F 3 169 ? 136.862 -32.861 4.917   1.00 11.38 ? 465  LEU D CA    1 
ATOM   6769  C  C     . LEU F 3 169 ? 136.262 -32.515 6.279   1.00 10.36 ? 465  LEU D C     1 
ATOM   6770  O  O     . LEU F 3 169 ? 135.624 -31.476 6.436   1.00 9.44  ? 465  LEU D O     1 
ATOM   6771  C  CB    . LEU F 3 169 ? 136.038 -33.943 4.216   1.00 8.81  ? 465  LEU D CB    1 
ATOM   6772  C  CG    . LEU F 3 169 ? 136.361 -34.094 2.724   1.00 9.70  ? 465  LEU D CG    1 
ATOM   6773  C  CD1   . LEU F 3 169 ? 135.784 -35.417 2.224   1.00 9.51  ? 465  LEU D CD1   1 
ATOM   6774  C  CD2   . LEU F 3 169 ? 135.785 -32.907 1.933   1.00 9.59  ? 465  LEU D CD2   1 
ATOM   6775  N  N     . ARG F 3 170 ? 136.500 -33.380 7.260   1.00 11.47 ? 466  ARG D N     1 
ATOM   6776  C  CA    . ARG F 3 170 ? 135.999 -33.177 8.614   1.00 14.50 ? 466  ARG D CA    1 
ATOM   6777  C  C     . ARG F 3 170 ? 136.528 -31.864 9.197   1.00 15.01 ? 466  ARG D C     1 
ATOM   6778  O  O     . ARG F 3 170 ? 135.787 -31.114 9.838   1.00 12.49 ? 466  ARG D O     1 
ATOM   6779  C  CB    . ARG F 3 170 ? 136.410 -34.356 9.500   1.00 16.40 ? 466  ARG D CB    1 
ATOM   6780  C  CG    . ARG F 3 170 ? 135.971 -34.230 10.954  1.00 25.98 ? 466  ARG D CG    1 
ATOM   6781  C  CD    . ARG F 3 170 ? 136.384 -35.453 11.754  1.00 30.89 ? 466  ARG D CD    1 
ATOM   6782  N  NE    . ARG F 3 170 ? 137.807 -35.744 11.590  1.00 38.00 ? 466  ARG D NE    1 
ATOM   6783  C  CZ    . ARG F 3 170 ? 138.790 -34.916 11.937  1.00 40.31 ? 466  ARG D CZ    1 
ATOM   6784  N  NH1   . ARG F 3 170 ? 138.516 -33.734 12.478  1.00 42.15 ? 466  ARG D NH1   1 
ATOM   6785  N  NH2   . ARG F 3 170 ? 140.053 -35.270 11.738  1.00 42.00 ? 466  ARG D NH2   1 
ATOM   6786  N  N     . ARG F 3 171 ? 137.810 -31.583 8.973   1.00 14.55 ? 467  ARG D N     1 
ATOM   6787  C  CA    . ARG F 3 171 ? 138.396 -30.345 9.472   1.00 15.02 ? 467  ARG D CA    1 
ATOM   6788  C  C     . ARG F 3 171 ? 137.725 -29.136 8.822   1.00 14.02 ? 467  ARG D C     1 
ATOM   6789  O  O     . ARG F 3 171 ? 137.518 -28.115 9.471   1.00 13.29 ? 467  ARG D O     1 
ATOM   6790  C  CB    . ARG F 3 171 ? 139.908 -30.309 9.201   1.00 16.19 ? 467  ARG D CB    1 
ATOM   6791  C  CG    . ARG F 3 171 ? 140.722 -31.281 10.068  1.00 17.25 ? 467  ARG D CG    1 
ATOM   6792  C  CD    . ARG F 3 171 ? 142.226 -30.995 9.981   1.00 21.06 ? 467  ARG D CD    1 
ATOM   6793  N  NE    . ARG F 3 171 ? 142.815 -31.350 8.689   1.00 23.43 ? 467  ARG D NE    1 
ATOM   6794  C  CZ    . ARG F 3 171 ? 143.246 -32.568 8.363   1.00 23.90 ? 467  ARG D CZ    1 
ATOM   6795  N  NH1   . ARG F 3 171 ? 143.158 -33.563 9.233   1.00 23.29 ? 467  ARG D NH1   1 
ATOM   6796  N  NH2   . ARG F 3 171 ? 143.773 -32.790 7.165   1.00 20.65 ? 467  ARG D NH2   1 
ATOM   6797  N  N     . ASN F 3 172 ? 137.386 -29.264 7.541   1.00 12.75 ? 468  ASN D N     1 
ATOM   6798  C  CA    . ASN F 3 172 ? 136.733 -28.194 6.782   1.00 13.52 ? 468  ASN D CA    1 
ATOM   6799  C  C     . ASN F 3 172 ? 135.232 -28.110 7.042   1.00 13.15 ? 468  ASN D C     1 
ATOM   6800  O  O     . ASN F 3 172 ? 134.559 -27.228 6.507   1.00 12.79 ? 468  ASN D O     1 
ATOM   6801  C  CB    . ASN F 3 172 ? 136.924 -28.401 5.277   1.00 11.60 ? 468  ASN D CB    1 
ATOM   6802  C  CG    . ASN F 3 172 ? 138.334 -28.098 4.806   1.00 14.18 ? 468  ASN D CG    1 
ATOM   6803  O  OD1   . ASN F 3 172 ? 139.238 -27.839 5.607   1.00 14.38 ? 468  ASN D OD1   1 
ATOM   6804  N  ND2   . ASN F 3 172 ? 138.529 -28.140 3.490   1.00 11.97 ? 468  ASN D ND2   1 
ATOM   6805  N  N     . GLU F 3 173 ? 134.714 -29.028 7.852   1.00 12.02 ? 469  GLU D N     1 
ATOM   6806  C  CA    . GLU F 3 173 ? 133.284 -29.078 8.147   1.00 13.30 ? 469  GLU D CA    1 
ATOM   6807  C  C     . GLU F 3 173 ? 132.546 -29.462 6.862   1.00 12.60 ? 469  GLU D C     1 
ATOM   6808  O  O     . GLU F 3 173 ? 131.421 -29.020 6.608   1.00 12.29 ? 469  GLU D O     1 
ATOM   6809  C  CB    . GLU F 3 173 ? 132.779 -27.722 8.651   1.00 14.21 ? 469  GLU D CB    1 
ATOM   6810  C  CG    . GLU F 3 173 ? 131.427 -27.812 9.314   1.00 18.96 ? 469  GLU D CG    1 
ATOM   6811  C  CD    . GLU F 3 173 ? 131.448 -28.708 10.543  1.00 21.57 ? 469  GLU D CD    1 
ATOM   6812  O  OE1   . GLU F 3 173 ? 130.371 -29.201 10.934  1.00 23.50 ? 469  GLU D OE1   1 
ATOM   6813  O  OE2   . GLU F 3 173 ? 132.536 -28.915 11.119  1.00 22.31 ? 469  GLU D OE2   1 
ATOM   6814  N  N     . GLN F 3 174 ? 133.194 -30.309 6.065   1.00 13.52 ? 470  GLN D N     1 
ATOM   6815  C  CA    . GLN F 3 174 ? 132.649 -30.766 4.792   1.00 12.81 ? 470  GLN D CA    1 
ATOM   6816  C  C     . GLN F 3 174 ? 132.398 -32.268 4.706   1.00 14.61 ? 470  GLN D C     1 
ATOM   6817  O  O     . GLN F 3 174 ? 132.066 -32.767 3.635   1.00 11.57 ? 470  GLN D O     1 
ATOM   6818  C  CB    . GLN F 3 174 ? 133.597 -30.389 3.654   1.00 13.57 ? 470  GLN D CB    1 
ATOM   6819  C  CG    . GLN F 3 174 ? 133.830 -28.906 3.472   1.00 12.20 ? 470  GLN D CG    1 
ATOM   6820  C  CD    . GLN F 3 174 ? 134.785 -28.636 2.333   1.00 13.35 ? 470  GLN D CD    1 
ATOM   6821  O  OE1   . GLN F 3 174 ? 135.888 -29.179 2.302   1.00 12.25 ? 470  GLN D OE1   1 
ATOM   6822  N  NE2   . GLN F 3 174 ? 134.370 -27.799 1.390   1.00 9.71  ? 470  GLN D NE2   1 
ATOM   6823  N  N     . ASP F 3 175 ? 132.550 -33.002 5.803   1.00 14.25 ? 471  ASP D N     1 
ATOM   6824  C  CA    . ASP F 3 175 ? 132.333 -34.439 5.705   1.00 15.79 ? 471  ASP D CA    1 
ATOM   6825  C  C     . ASP F 3 175 ? 130.867 -34.801 5.482   1.00 15.36 ? 471  ASP D C     1 
ATOM   6826  O  O     . ASP F 3 175 ? 130.570 -35.705 4.704   1.00 12.47 ? 471  ASP D O     1 
ATOM   6827  C  CB    . ASP F 3 175 ? 132.922 -35.170 6.919   1.00 20.11 ? 471  ASP D CB    1 
ATOM   6828  C  CG    . ASP F 3 175 ? 132.487 -34.575 8.237   1.00 23.28 ? 471  ASP D CG    1 
ATOM   6829  O  OD1   . ASP F 3 175 ? 132.243 -33.353 8.300   1.00 25.48 ? 471  ASP D OD1   1 
ATOM   6830  O  OD2   . ASP F 3 175 ? 132.400 -35.339 9.219   1.00 29.03 ? 471  ASP D OD2   1 
ATOM   6831  N  N     . ARG F 3 176 ? 129.947 -34.102 6.141   1.00 13.86 ? 472  ARG D N     1 
ATOM   6832  C  CA    . ARG F 3 176 ? 128.533 -34.386 5.917   1.00 14.50 ? 472  ARG D CA    1 
ATOM   6833  C  C     . ARG F 3 176 ? 128.164 -33.871 4.527   1.00 13.17 ? 472  ARG D C     1 
ATOM   6834  O  O     . ARG F 3 176 ? 127.308 -34.440 3.851   1.00 11.24 ? 472  ARG D O     1 
ATOM   6835  C  CB    . ARG F 3 176 ? 127.657 -33.713 6.976   1.00 18.09 ? 472  ARG D CB    1 
ATOM   6836  C  CG    . ARG F 3 176 ? 127.680 -34.409 8.338   1.00 23.57 ? 472  ARG D CG    1 
ATOM   6837  C  CD    . ARG F 3 176 ? 126.664 -33.781 9.288   1.00 26.25 ? 472  ARG D CD    1 
ATOM   6838  N  NE    . ARG F 3 176 ? 127.011 -32.402 9.610   1.00 32.16 ? 472  ARG D NE    1 
ATOM   6839  C  CZ    . ARG F 3 176 ? 126.200 -31.544 10.223  1.00 34.90 ? 472  ARG D CZ    1 
ATOM   6840  N  NH1   . ARG F 3 176 ? 124.980 -31.919 10.585  1.00 35.75 ? 472  ARG D NH1   1 
ATOM   6841  N  NH2   . ARG F 3 176 ? 126.610 -30.307 10.474  1.00 36.82 ? 472  ARG D NH2   1 
ATOM   6842  N  N     . LEU F 3 177 ? 128.818 -32.791 4.101   1.00 11.36 ? 473  LEU D N     1 
ATOM   6843  C  CA    . LEU F 3 177 ? 128.552 -32.235 2.778   1.00 11.06 ? 473  LEU D CA    1 
ATOM   6844  C  C     . LEU F 3 177 ? 128.794 -33.322 1.734   1.00 11.73 ? 473  LEU D C     1 
ATOM   6845  O  O     . LEU F 3 177 ? 128.032 -33.463 0.780   1.00 12.71 ? 473  LEU D O     1 
ATOM   6846  C  CB    . LEU F 3 177 ? 129.460 -31.035 2.512   1.00 10.55 ? 473  LEU D CB    1 
ATOM   6847  C  CG    . LEU F 3 177 ? 129.322 -30.345 1.148   1.00 13.06 ? 473  LEU D CG    1 
ATOM   6848  C  CD1   . LEU F 3 177 ? 127.883 -29.883 0.920   1.00 11.54 ? 473  LEU D CD1   1 
ATOM   6849  C  CD2   . LEU F 3 177 ? 130.284 -29.166 1.092   1.00 11.18 ? 473  LEU D CD2   1 
ATOM   6850  N  N     . LEU F 3 178 ? 129.850 -34.104 1.930   1.00 10.87 ? 474  LEU D N     1 
ATOM   6851  C  CA    . LEU F 3 178 ? 130.167 -35.184 1.002   1.00 10.37 ? 474  LEU D CA    1 
ATOM   6852  C  C     . LEU F 3 178 ? 129.236 -36.389 1.134   1.00 10.04 ? 474  LEU D C     1 
ATOM   6853  O  O     . LEU F 3 178 ? 128.600 -36.808 0.171   1.00 9.18  ? 474  LEU D O     1 
ATOM   6854  C  CB    . LEU F 3 178 ? 131.599 -35.680 1.218   1.00 10.79 ? 474  LEU D CB    1 
ATOM   6855  C  CG    . LEU F 3 178 ? 131.954 -36.917 0.377   1.00 12.82 ? 474  LEU D CG    1 
ATOM   6856  C  CD1   . LEU F 3 178 ? 132.027 -36.512 -1.087  1.00 10.53 ? 474  LEU D CD1   1 
ATOM   6857  C  CD2   . LEU F 3 178 ? 133.287 -37.516 0.832   1.00 12.14 ? 474  LEU D CD2   1 
ATOM   6858  N  N     . VAL F 3 179 ? 129.169 -36.936 2.342   1.00 10.58 ? 475  VAL D N     1 
ATOM   6859  C  CA    . VAL F 3 179 ? 128.397 -38.141 2.616   1.00 12.29 ? 475  VAL D CA    1 
ATOM   6860  C  C     . VAL F 3 179 ? 126.877 -38.042 2.655   1.00 11.51 ? 475  VAL D C     1 
ATOM   6861  O  O     . VAL F 3 179 ? 126.192 -39.004 2.303   1.00 10.71 ? 475  VAL D O     1 
ATOM   6862  C  CB    . VAL F 3 179 ? 128.882 -38.784 3.940   1.00 13.65 ? 475  VAL D CB    1 
ATOM   6863  C  CG1   . VAL F 3 179 ? 128.035 -39.986 4.281   1.00 18.96 ? 475  VAL D CG1   1 
ATOM   6864  C  CG2   . VAL F 3 179 ? 130.342 -39.189 3.803   1.00 15.74 ? 475  VAL D CG2   1 
ATOM   6865  N  N     . GLU F 3 180 ? 126.351 -36.898 3.077   1.00 10.50 ? 476  GLU D N     1 
ATOM   6866  C  CA    . GLU F 3 180 ? 124.904 -36.727 3.166   1.00 10.95 ? 476  GLU D CA    1 
ATOM   6867  C  C     . GLU F 3 180 ? 124.311 -35.884 2.046   1.00 11.20 ? 476  GLU D C     1 
ATOM   6868  O  O     . GLU F 3 180 ? 123.088 -35.868 1.865   1.00 10.66 ? 476  GLU D O     1 
ATOM   6869  C  CB    . GLU F 3 180 ? 124.523 -36.121 4.521   1.00 13.37 ? 476  GLU D CB    1 
ATOM   6870  C  CG    . GLU F 3 180 ? 124.954 -36.976 5.707   1.00 19.97 ? 476  GLU D CG    1 
ATOM   6871  C  CD    . GLU F 3 180 ? 124.515 -36.402 7.046   1.00 23.80 ? 476  GLU D CD    1 
ATOM   6872  O  OE1   . GLU F 3 180 ? 124.974 -36.911 8.088   1.00 28.00 ? 476  GLU D OE1   1 
ATOM   6873  O  OE2   . GLU F 3 180 ? 123.710 -35.446 7.061   1.00 27.73 ? 476  GLU D OE2   1 
ATOM   6874  N  N     . LEU F 3 181 ? 125.158 -35.187 1.291   1.00 10.28 ? 477  LEU D N     1 
ATOM   6875  C  CA    . LEU F 3 181 ? 124.650 -34.377 0.186   1.00 10.45 ? 477  LEU D CA    1 
ATOM   6876  C  C     . LEU F 3 181 ? 125.150 -34.804 -1.198  1.00 8.78  ? 477  LEU D C     1 
ATOM   6877  O  O     . LEU F 3 181 ? 124.374 -35.326 -1.994  1.00 8.75  ? 477  LEU D O     1 
ATOM   6878  C  CB    . LEU F 3 181 ? 124.965 -32.892 0.391   1.00 11.03 ? 477  LEU D CB    1 
ATOM   6879  C  CG    . LEU F 3 181 ? 124.256 -32.001 -0.643  1.00 14.96 ? 477  LEU D CG    1 
ATOM   6880  C  CD1   . LEU F 3 181 ? 122.795 -31.875 -0.250  1.00 17.25 ? 477  LEU D CD1   1 
ATOM   6881  C  CD2   . LEU F 3 181 ? 124.888 -30.609 -0.715  1.00 16.40 ? 477  LEU D CD2   1 
ATOM   6882  N  N     . GLU F 3 182 ? 126.436 -34.610 -1.488  1.00 7.30  ? 478  GLU D N     1 
ATOM   6883  C  CA    . GLU F 3 182 ? 126.942 -34.953 -2.823  1.00 8.29  ? 478  GLU D CA    1 
ATOM   6884  C  C     . GLU F 3 182 ? 126.865 -36.427 -3.224  1.00 8.89  ? 478  GLU D C     1 
ATOM   6885  O  O     . GLU F 3 182 ? 126.497 -36.739 -4.354  1.00 8.21  ? 478  GLU D O     1 
ATOM   6886  C  CB    . GLU F 3 182 ? 128.387 -34.469 -3.005  1.00 7.43  ? 478  GLU D CB    1 
ATOM   6887  C  CG    . GLU F 3 182 ? 128.603 -32.957 -2.796  1.00 10.49 ? 478  GLU D CG    1 
ATOM   6888  C  CD    . GLU F 3 182 ? 127.945 -32.067 -3.854  1.00 13.10 ? 478  GLU D CD    1 
ATOM   6889  O  OE1   . GLU F 3 182 ? 127.379 -32.585 -4.845  1.00 13.52 ? 478  GLU D OE1   1 
ATOM   6890  O  OE2   . GLU F 3 182 ? 128.004 -30.827 -3.689  1.00 12.91 ? 478  GLU D OE2   1 
ATOM   6891  N  N     . GLN F 3 183 ? 127.213 -37.336 -2.320  1.00 9.21  ? 479  GLN D N     1 
ATOM   6892  C  CA    . GLN F 3 183 ? 127.167 -38.746 -2.674  1.00 9.97  ? 479  GLN D CA    1 
ATOM   6893  C  C     . GLN F 3 183 ? 125.736 -39.213 -2.906  1.00 9.41  ? 479  GLN D C     1 
ATOM   6894  O  O     . GLN F 3 183 ? 125.472 -39.909 -3.879  1.00 11.00 ? 479  GLN D O     1 
ATOM   6895  C  CB    . GLN F 3 183 ? 127.919 -39.585 -1.628  1.00 9.47  ? 479  GLN D CB    1 
ATOM   6896  C  CG    . GLN F 3 183 ? 129.426 -39.346 -1.781  1.00 11.39 ? 479  GLN D CG    1 
ATOM   6897  C  CD    . GLN F 3 183 ? 130.309 -40.145 -0.842  1.00 11.99 ? 479  GLN D CD    1 
ATOM   6898  O  OE1   . GLN F 3 183 ? 131.538 -40.070 -0.937  1.00 10.95 ? 479  GLN D OE1   1 
ATOM   6899  N  NE2   . GLN F 3 183 ? 129.701 -40.907 0.066   1.00 11.04 ? 479  GLN D NE2   1 
ATOM   6900  N  N     . PRO F 3 184 ? 124.793 -38.836 -2.023  1.00 10.24 ? 480  PRO D N     1 
ATOM   6901  C  CA    . PRO F 3 184 ? 123.411 -39.270 -2.260  1.00 10.31 ? 480  PRO D CA    1 
ATOM   6902  C  C     . PRO F 3 184 ? 122.891 -38.641 -3.561  1.00 10.66 ? 480  PRO D C     1 
ATOM   6903  O  O     . PRO F 3 184 ? 122.149 -39.270 -4.317  1.00 9.12  ? 480  PRO D O     1 
ATOM   6904  C  CB    . PRO F 3 184 ? 122.671 -38.776 -1.021  1.00 11.34 ? 480  PRO D CB    1 
ATOM   6905  C  CG    . PRO F 3 184 ? 123.724 -38.854 0.043   1.00 11.84 ? 480  PRO D CG    1 
ATOM   6906  C  CD    . PRO F 3 184 ? 124.939 -38.291 -0.660  1.00 11.03 ? 480  PRO D CD    1 
ATOM   6907  N  N     . LEU F 3 185 ? 123.292 -37.397 -3.821  1.00 10.22 ? 481  LEU D N     1 
ATOM   6908  C  CA    . LEU F 3 185 ? 122.866 -36.713 -5.042  1.00 8.91  ? 481  LEU D CA    1 
ATOM   6909  C  C     . LEU F 3 185 ? 123.395 -37.454 -6.265  1.00 9.57  ? 481  LEU D C     1 
ATOM   6910  O  O     . LEU F 3 185 ? 122.708 -37.570 -7.281  1.00 8.03  ? 481  LEU D O     1 
ATOM   6911  C  CB    . LEU F 3 185 ? 123.382 -35.270 -5.075  1.00 10.24 ? 481  LEU D CB    1 
ATOM   6912  C  CG    . LEU F 3 185 ? 123.024 -34.483 -6.342  1.00 11.14 ? 481  LEU D CG    1 
ATOM   6913  C  CD1   . LEU F 3 185 ? 121.507 -34.298 -6.419  1.00 11.47 ? 481  LEU D CD1   1 
ATOM   6914  C  CD2   . LEU F 3 185 ? 123.720 -33.129 -6.327  1.00 11.65 ? 481  LEU D CD2   1 
ATOM   6915  N  N     . SER F 3 186 ? 124.622 -37.956 -6.165  1.00 8.20  ? 482  SER D N     1 
ATOM   6916  C  CA    . SER F 3 186 ? 125.228 -38.679 -7.273  1.00 11.26 ? 482  SER D CA    1 
ATOM   6917  C  C     . SER F 3 186 ? 124.355 -39.835 -7.766  1.00 10.46 ? 482  SER D C     1 
ATOM   6918  O  O     . SER F 3 186 ? 124.226 -40.046 -8.973  1.00 8.80  ? 482  SER D O     1 
ATOM   6919  C  CB    . SER F 3 186 ? 126.607 -39.209 -6.867  1.00 12.87 ? 482  SER D CB    1 
ATOM   6920  O  OG    . SER F 3 186 ? 127.218 -39.867 -7.955  1.00 17.03 ? 482  SER D OG    1 
ATOM   6921  N  N     . SER F 3 187 ? 123.765 -40.581 -6.834  1.00 10.11 ? 483  SER D N     1 
ATOM   6922  C  CA    . SER F 3 187 ? 122.899 -41.708 -7.182  1.00 12.05 ? 483  SER D CA    1 
ATOM   6923  C  C     . SER F 3 187 ? 121.622 -41.212 -7.863  1.00 10.86 ? 483  SER D C     1 
ATOM   6924  O  O     . SER F 3 187 ? 121.098 -41.850 -8.774  1.00 9.33  ? 483  SER D O     1 
ATOM   6925  C  CB    . SER F 3 187 ? 122.529 -42.508 -5.927  1.00 13.01 ? 483  SER D CB    1 
ATOM   6926  O  OG    . SER F 3 187 ? 123.681 -43.075 -5.327  1.00 18.19 ? 483  SER D OG    1 
ATOM   6927  N  N     . ILE F 3 188 ? 121.125 -40.068 -7.407  1.00 10.54 ? 484  ILE D N     1 
ATOM   6928  C  CA    . ILE F 3 188 ? 119.921 -39.477 -7.979  1.00 9.23  ? 484  ILE D CA    1 
ATOM   6929  C  C     . ILE F 3 188 ? 120.189 -38.993 -9.405  1.00 9.47  ? 484  ILE D C     1 
ATOM   6930  O  O     . ILE F 3 188 ? 119.369 -39.202 -10.307 1.00 6.17  ? 484  ILE D O     1 
ATOM   6931  C  CB    . ILE F 3 188 ? 119.439 -38.312 -7.107  1.00 9.69  ? 484  ILE D CB    1 
ATOM   6932  C  CG1   . ILE F 3 188 ? 119.027 -38.853 -5.730  1.00 12.65 ? 484  ILE D CG1   1 
ATOM   6933  C  CG2   . ILE F 3 188 ? 118.275 -37.591 -7.781  1.00 10.54 ? 484  ILE D CG2   1 
ATOM   6934  C  CD1   . ILE F 3 188 ? 118.609 -37.779 -4.742  1.00 9.62  ? 484  ILE D CD1   1 
ATOM   6935  N  N     . LEU F 3 189 ? 121.341 -38.354 -9.607  1.00 7.53  ? 485  LEU D N     1 
ATOM   6936  C  CA    . LEU F 3 189 ? 121.715 -37.864 -10.931 1.00 7.45  ? 485  LEU D CA    1 
ATOM   6937  C  C     . LEU F 3 189 ? 121.896 -39.051 -11.875 1.00 7.76  ? 485  LEU D C     1 
ATOM   6938  O  O     . LEU F 3 189 ? 121.566 -38.973 -13.056 1.00 6.56  ? 485  LEU D O     1 
ATOM   6939  C  CB    . LEU F 3 189 ? 123.019 -37.049 -10.856 1.00 7.79  ? 485  LEU D CB    1 
ATOM   6940  C  CG    . LEU F 3 189 ? 122.923 -35.693 -10.142 1.00 8.23  ? 485  LEU D CG    1 
ATOM   6941  C  CD1   . LEU F 3 189 ? 124.304 -35.043 -10.038 1.00 8.74  ? 485  LEU D CD1   1 
ATOM   6942  C  CD2   . LEU F 3 189 ? 121.959 -34.786 -10.912 1.00 9.57  ? 485  LEU D CD2   1 
ATOM   6943  N  N     . ALA F 3 190 ? 122.422 -40.156 -11.353 1.00 7.01  ? 486  ALA D N     1 
ATOM   6944  C  CA    . ALA F 3 190 ? 122.619 -41.341 -12.178 1.00 8.26  ? 486  ALA D CA    1 
ATOM   6945  C  C     . ALA F 3 190 ? 121.275 -41.841 -12.724 1.00 10.36 ? 486  ALA D C     1 
ATOM   6946  O  O     . ALA F 3 190 ? 121.169 -42.189 -13.900 1.00 10.58 ? 486  ALA D O     1 
ATOM   6947  C  CB    . ALA F 3 190 ? 123.303 -42.442 -11.365 1.00 9.60  ? 486  ALA D CB    1 
ATOM   6948  N  N     . GLU F 3 191 ? 120.255 -41.873 -11.870 1.00 10.63 ? 487  GLU D N     1 
ATOM   6949  C  CA    . GLU F 3 191 ? 118.927 -42.329 -12.285 1.00 11.92 ? 487  GLU D CA    1 
ATOM   6950  C  C     . GLU F 3 191 ? 118.342 -41.395 -13.340 1.00 10.14 ? 487  GLU D C     1 
ATOM   6951  O  O     . GLU F 3 191 ? 117.760 -41.840 -14.329 1.00 9.37  ? 487  GLU D O     1 
ATOM   6952  C  CB    . GLU F 3 191 ? 117.971 -42.389 -11.086 1.00 14.22 ? 487  GLU D CB    1 
ATOM   6953  C  CG    . GLU F 3 191 ? 118.473 -43.234 -9.934  1.00 20.66 ? 487  GLU D CG    1 
ATOM   6954  C  CD    . GLU F 3 191 ? 117.406 -43.490 -8.880  1.00 27.15 ? 487  GLU D CD    1 
ATOM   6955  O  OE1   . GLU F 3 191 ? 116.668 -42.542 -8.522  1.00 28.27 ? 487  GLU D OE1   1 
ATOM   6956  O  OE2   . GLU F 3 191 ? 117.309 -44.645 -8.404  1.00 30.77 ? 487  GLU D OE2   1 
ATOM   6957  N  N     . MET F 3 192 ? 118.498 -40.095 -13.117 1.00 9.42  ? 488  MET D N     1 
ATOM   6958  C  CA    . MET F 3 192 ? 117.989 -39.090 -14.040 1.00 8.97  ? 488  MET D CA    1 
ATOM   6959  C  C     . MET F 3 192 ? 118.633 -39.232 -15.414 1.00 9.78  ? 488  MET D C     1 
ATOM   6960  O  O     . MET F 3 192 ? 117.945 -39.263 -16.440 1.00 8.23  ? 488  MET D O     1 
ATOM   6961  C  CB    . MET F 3 192 ? 118.264 -37.687 -13.478 1.00 8.23  ? 488  MET D CB    1 
ATOM   6962  C  CG    . MET F 3 192 ? 117.483 -37.365 -12.206 1.00 8.67  ? 488  MET D CG    1 
ATOM   6963  S  SD    . MET F 3 192 ? 118.105 -35.905 -11.311 1.00 9.42  ? 488  MET D SD    1 
ATOM   6964  C  CE    . MET F 3 192 ? 117.893 -34.618 -12.556 1.00 6.22  ? 488  MET D CE    1 
ATOM   6965  N  N     . GLU F 3 193 ? 119.957 -39.318 -15.432 1.00 8.21  ? 489  GLU D N     1 
ATOM   6966  C  CA    . GLU F 3 193 ? 120.681 -39.440 -16.692 1.00 8.27  ? 489  GLU D CA    1 
ATOM   6967  C  C     . GLU F 3 193 ? 120.285 -40.708 -17.434 1.00 8.93  ? 489  GLU D C     1 
ATOM   6968  O  O     . GLU F 3 193 ? 120.083 -40.683 -18.649 1.00 8.06  ? 489  GLU D O     1 
ATOM   6969  C  CB    . GLU F 3 193 ? 122.192 -39.452 -16.436 1.00 7.86  ? 489  GLU D CB    1 
ATOM   6970  C  CG    . GLU F 3 193 ? 122.736 -38.185 -15.782 1.00 9.26  ? 489  GLU D CG    1 
ATOM   6971  C  CD    . GLU F 3 193 ? 124.200 -38.328 -15.367 1.00 11.72 ? 489  GLU D CD    1 
ATOM   6972  O  OE1   . GLU F 3 193 ? 124.766 -37.354 -14.827 1.00 10.58 ? 489  GLU D OE1   1 
ATOM   6973  O  OE2   . GLU F 3 193 ? 124.782 -39.416 -15.579 1.00 11.83 ? 489  GLU D OE2   1 
ATOM   6974  N  N     . PHE F 3 194 ? 120.175 -41.816 -16.704 1.00 9.59  ? 490  PHE D N     1 
ATOM   6975  C  CA    . PHE F 3 194 ? 119.814 -43.090 -17.320 1.00 9.70  ? 490  PHE D CA    1 
ATOM   6976  C  C     . PHE F 3 194 ? 118.383 -43.068 -17.849 1.00 11.17 ? 490  PHE D C     1 
ATOM   6977  O  O     . PHE F 3 194 ? 118.103 -43.609 -18.919 1.00 10.45 ? 490  PHE D O     1 
ATOM   6978  C  CB    . PHE F 3 194 ? 119.973 -44.242 -16.324 1.00 11.68 ? 490  PHE D CB    1 
ATOM   6979  C  CG    . PHE F 3 194 ? 119.741 -45.598 -16.934 1.00 10.97 ? 490  PHE D CG    1 
ATOM   6980  C  CD1   . PHE F 3 194 ? 120.606 -46.095 -17.910 1.00 12.41 ? 490  PHE D CD1   1 
ATOM   6981  C  CD2   . PHE F 3 194 ? 118.652 -46.368 -16.551 1.00 12.71 ? 490  PHE D CD2   1 
ATOM   6982  C  CE1   . PHE F 3 194 ? 120.384 -47.347 -18.500 1.00 12.46 ? 490  PHE D CE1   1 
ATOM   6983  C  CE2   . PHE F 3 194 ? 118.417 -47.625 -17.134 1.00 14.14 ? 490  PHE D CE2   1 
ATOM   6984  C  CZ    . PHE F 3 194 ? 119.284 -48.111 -18.107 1.00 12.31 ? 490  PHE D CZ    1 
ATOM   6985  N  N     . ALA F 3 195 ? 117.477 -42.443 -17.103 1.00 10.40 ? 491  ALA D N     1 
ATOM   6986  C  CA    . ALA F 3 195 ? 116.083 -42.358 -17.537 1.00 11.17 ? 491  ALA D CA    1 
ATOM   6987  C  C     . ALA F 3 195 ? 116.008 -41.581 -18.853 1.00 12.66 ? 491  ALA D C     1 
ATOM   6988  O  O     . ALA F 3 195 ? 115.313 -41.983 -19.785 1.00 9.96  ? 491  ALA D O     1 
ATOM   6989  C  CB    . ALA F 3 195 ? 115.242 -41.658 -16.476 1.00 13.37 ? 491  ALA D CB    1 
ATOM   6990  N  N     . GLY F 3 196 ? 116.732 -40.466 -18.915 1.00 11.87 ? 492  GLY D N     1 
ATOM   6991  C  CA    . GLY F 3 196 ? 116.733 -39.648 -20.116 1.00 11.43 ? 492  GLY D CA    1 
ATOM   6992  C  C     . GLY F 3 196 ? 115.428 -38.901 -20.319 1.00 10.90 ? 492  GLY D C     1 
ATOM   6993  O  O     . GLY F 3 196 ? 114.481 -39.069 -19.549 1.00 11.75 ? 492  GLY D O     1 
ATOM   6994  N  N     . VAL F 3 197 ? 115.385 -38.070 -21.359 1.00 10.39 ? 493  VAL D N     1 
ATOM   6995  C  CA    . VAL F 3 197 ? 114.196 -37.297 -21.694 1.00 9.97  ? 493  VAL D CA    1 
ATOM   6996  C  C     . VAL F 3 197 ? 113.794 -37.644 -23.126 1.00 9.25  ? 493  VAL D C     1 
ATOM   6997  O  O     . VAL F 3 197 ? 114.618 -37.613 -24.032 1.00 10.74 ? 493  VAL D O     1 
ATOM   6998  C  CB    . VAL F 3 197 ? 114.471 -35.787 -21.600 1.00 11.38 ? 493  VAL D CB    1 
ATOM   6999  C  CG1   . VAL F 3 197 ? 113.178 -34.997 -21.870 1.00 10.52 ? 493  VAL D CG1   1 
ATOM   7000  C  CG2   . VAL F 3 197 ? 115.029 -35.457 -20.224 1.00 10.34 ? 493  VAL D CG2   1 
ATOM   7001  N  N     . LYS F 3 198 ? 112.523 -37.970 -23.322 1.00 10.70 ? 494  LYS D N     1 
ATOM   7002  C  CA    . LYS F 3 198 ? 112.035 -38.346 -24.642 1.00 11.25 ? 494  LYS D CA    1 
ATOM   7003  C  C     . LYS F 3 198 ? 111.851 -37.140 -25.564 1.00 11.35 ? 494  LYS D C     1 
ATOM   7004  O  O     . LYS F 3 198 ? 111.383 -36.079 -25.143 1.00 11.17 ? 494  LYS D O     1 
ATOM   7005  C  CB    . LYS F 3 198 ? 110.716 -39.118 -24.506 1.00 13.90 ? 494  LYS D CB    1 
ATOM   7006  C  CG    . LYS F 3 198 ? 110.291 -39.844 -25.772 1.00 17.49 ? 494  LYS D CG    1 
ATOM   7007  C  CD    . LYS F 3 198 ? 109.131 -40.783 -25.501 1.00 22.32 ? 494  LYS D CD    1 
ATOM   7008  C  CE    . LYS F 3 198 ? 108.688 -41.501 -26.768 1.00 24.94 ? 494  LYS D CE    1 
ATOM   7009  N  NZ    . LYS F 3 198 ? 109.802 -42.302 -27.334 1.00 30.18 ? 494  LYS D NZ    1 
ATOM   7010  N  N     . VAL F 3 199 ? 112.226 -37.319 -26.826 1.00 10.74 ? 495  VAL D N     1 
ATOM   7011  C  CA    . VAL F 3 199 ? 112.123 -36.268 -27.828 1.00 12.35 ? 495  VAL D CA    1 
ATOM   7012  C  C     . VAL F 3 199 ? 111.176 -36.644 -28.972 1.00 13.37 ? 495  VAL D C     1 
ATOM   7013  O  O     . VAL F 3 199 ? 111.199 -37.767 -29.477 1.00 13.51 ? 495  VAL D O     1 
ATOM   7014  C  CB    . VAL F 3 199 ? 113.514 -35.949 -28.427 1.00 13.45 ? 495  VAL D CB    1 
ATOM   7015  C  CG1   . VAL F 3 199 ? 113.379 -34.943 -29.569 1.00 15.58 ? 495  VAL D CG1   1 
ATOM   7016  C  CG2   . VAL F 3 199 ? 114.433 -35.401 -27.340 1.00 14.10 ? 495  VAL D CG2   1 
ATOM   7017  N  N     . ASP F 3 200 ? 110.347 -35.687 -29.370 1.00 13.77 ? 496  ASP D N     1 
ATOM   7018  C  CA    . ASP F 3 200 ? 109.403 -35.871 -30.467 1.00 14.53 ? 496  ASP D CA    1 
ATOM   7019  C  C     . ASP F 3 200 ? 110.203 -35.522 -31.717 1.00 13.75 ? 496  ASP D C     1 
ATOM   7020  O  O     . ASP F 3 200 ? 110.208 -34.374 -32.156 1.00 14.28 ? 496  ASP D O     1 
ATOM   7021  C  CB    . ASP F 3 200 ? 108.230 -34.906 -30.301 1.00 13.63 ? 496  ASP D CB    1 
ATOM   7022  C  CG    . ASP F 3 200 ? 107.143 -35.107 -31.341 1.00 18.48 ? 496  ASP D CG    1 
ATOM   7023  O  OD1   . ASP F 3 200 ? 107.414 -35.722 -32.399 1.00 14.70 ? 496  ASP D OD1   1 
ATOM   7024  O  OD2   . ASP F 3 200 ? 106.014 -34.637 -31.088 1.00 15.47 ? 496  ASP D OD2   1 
ATOM   7025  N  N     . THR F 3 201 ? 110.881 -36.512 -32.286 1.00 14.44 ? 497  THR D N     1 
ATOM   7026  C  CA    . THR F 3 201 ? 111.710 -36.277 -33.461 1.00 15.59 ? 497  THR D CA    1 
ATOM   7027  C  C     . THR F 3 201 ? 110.935 -35.803 -34.687 1.00 17.08 ? 497  THR D C     1 
ATOM   7028  O  O     . THR F 3 201 ? 111.449 -35.008 -35.465 1.00 17.52 ? 497  THR D O     1 
ATOM   7029  C  CB    . THR F 3 201 ? 112.538 -37.534 -33.823 1.00 15.61 ? 497  THR D CB    1 
ATOM   7030  O  OG1   . THR F 3 201 ? 111.663 -38.643 -34.065 1.00 16.30 ? 497  THR D OG1   1 
ATOM   7031  C  CG2   . THR F 3 201 ? 113.493 -37.877 -32.680 1.00 14.60 ? 497  THR D CG2   1 
ATOM   7032  N  N     . LYS F 3 202 ? 109.705 -36.275 -34.862 1.00 17.33 ? 498  LYS D N     1 
ATOM   7033  C  CA    . LYS F 3 202 ? 108.910 -35.847 -36.009 1.00 19.32 ? 498  LYS D CA    1 
ATOM   7034  C  C     . LYS F 3 202 ? 108.658 -34.343 -35.951 1.00 19.49 ? 498  LYS D C     1 
ATOM   7035  O  O     . LYS F 3 202 ? 108.807 -33.641 -36.948 1.00 19.45 ? 498  LYS D O     1 
ATOM   7036  C  CB    . LYS F 3 202 ? 107.570 -36.589 -36.053 1.00 20.45 ? 498  LYS D CB    1 
ATOM   7037  C  CG    . LYS F 3 202 ? 107.694 -38.063 -36.421 1.00 26.23 ? 498  LYS D CG    1 
ATOM   7038  C  CD    . LYS F 3 202 ? 106.322 -38.718 -36.542 1.00 28.96 ? 498  LYS D CD    1 
ATOM   7039  C  CE    . LYS F 3 202 ? 106.438 -40.187 -36.921 1.00 31.96 ? 498  LYS D CE    1 
ATOM   7040  N  NZ    . LYS F 3 202 ? 105.099 -40.806 -37.145 1.00 35.76 ? 498  LYS D NZ    1 
ATOM   7041  N  N     . ARG F 3 203 ? 108.280 -33.851 -34.776 1.00 18.81 ? 499  ARG D N     1 
ATOM   7042  C  CA    . ARG F 3 203 ? 108.014 -32.431 -34.608 1.00 18.77 ? 499  ARG D CA    1 
ATOM   7043  C  C     . ARG F 3 203 ? 109.299 -31.618 -34.759 1.00 18.98 ? 499  ARG D C     1 
ATOM   7044  O  O     . ARG F 3 203 ? 109.322 -30.594 -35.446 1.00 19.57 ? 499  ARG D O     1 
ATOM   7045  C  CB    . ARG F 3 203 ? 107.394 -32.180 -33.235 1.00 21.11 ? 499  ARG D CB    1 
ATOM   7046  C  CG    . ARG F 3 203 ? 106.785 -30.803 -33.070 1.00 27.61 ? 499  ARG D CG    1 
ATOM   7047  C  CD    . ARG F 3 203 ? 105.830 -30.782 -31.887 1.00 32.03 ? 499  ARG D CD    1 
ATOM   7048  N  NE    . ARG F 3 203 ? 104.916 -29.645 -31.943 1.00 37.37 ? 499  ARG D NE    1 
ATOM   7049  C  CZ    . ARG F 3 203 ? 103.948 -29.419 -31.061 1.00 40.44 ? 499  ARG D CZ    1 
ATOM   7050  N  NH1   . ARG F 3 203 ? 103.763 -30.253 -30.043 1.00 41.60 ? 499  ARG D NH1   1 
ATOM   7051  N  NH2   . ARG F 3 203 ? 103.162 -28.358 -31.197 1.00 40.85 ? 499  ARG D NH2   1 
ATOM   7052  N  N     . LEU F 3 204 ? 110.369 -32.086 -34.125 1.00 18.13 ? 500  LEU D N     1 
ATOM   7053  C  CA    . LEU F 3 204 ? 111.649 -31.396 -34.182 1.00 18.08 ? 500  LEU D CA    1 
ATOM   7054  C  C     . LEU F 3 204 ? 112.142 -31.288 -35.624 1.00 19.04 ? 500  LEU D C     1 
ATOM   7055  O  O     . LEU F 3 204 ? 112.560 -30.218 -36.076 1.00 18.16 ? 500  LEU D O     1 
ATOM   7056  C  CB    . LEU F 3 204 ? 112.683 -32.141 -33.331 1.00 17.57 ? 500  LEU D CB    1 
ATOM   7057  C  CG    . LEU F 3 204 ? 113.998 -31.410 -33.045 1.00 18.93 ? 500  LEU D CG    1 
ATOM   7058  C  CD1   . LEU F 3 204 ? 113.713 -30.161 -32.227 1.00 17.98 ? 500  LEU D CD1   1 
ATOM   7059  C  CD2   . LEU F 3 204 ? 114.945 -32.326 -32.291 1.00 19.71 ? 500  LEU D CD2   1 
ATOM   7060  N  N     . GLU F 3 205 ? 112.089 -32.399 -36.348 1.00 16.79 ? 501  GLU D N     1 
ATOM   7061  C  CA    . GLU F 3 205 ? 112.540 -32.407 -37.730 1.00 18.72 ? 501  GLU D CA    1 
ATOM   7062  C  C     . GLU F 3 205 ? 111.698 -31.476 -38.597 1.00 17.87 ? 501  GLU D C     1 
ATOM   7063  O  O     . GLU F 3 205 ? 112.220 -30.833 -39.507 1.00 19.02 ? 501  GLU D O     1 
ATOM   7064  C  CB    . GLU F 3 205 ? 112.524 -33.840 -38.272 1.00 19.34 ? 501  GLU D CB    1 
ATOM   7065  C  CG    . GLU F 3 205 ? 113.705 -34.677 -37.773 1.00 18.55 ? 501  GLU D CG    1 
ATOM   7066  C  CD    . GLU F 3 205 ? 113.505 -36.172 -37.957 1.00 22.37 ? 501  GLU D CD    1 
ATOM   7067  O  OE1   . GLU F 3 205 ? 112.766 -36.567 -38.884 1.00 20.20 ? 501  GLU D OE1   1 
ATOM   7068  O  OE2   . GLU F 3 205 ? 114.100 -36.953 -37.177 1.00 20.22 ? 501  GLU D OE2   1 
ATOM   7069  N  N     . GLN F 3 206 ? 110.402 -31.395 -38.308 1.00 18.73 ? 502  GLN D N     1 
ATOM   7070  C  CA    . GLN F 3 206 ? 109.516 -30.515 -39.060 1.00 21.69 ? 502  GLN D CA    1 
ATOM   7071  C  C     . GLN F 3 206 ? 109.918 -29.067 -38.769 1.00 22.44 ? 502  GLN D C     1 
ATOM   7072  O  O     . GLN F 3 206 ? 110.064 -28.257 -39.692 1.00 22.61 ? 502  GLN D O     1 
ATOM   7073  C  CB    . GLN F 3 206 ? 108.052 -30.766 -38.667 1.00 22.22 ? 502  GLN D CB    1 
ATOM   7074  C  CG    . GLN F 3 206 ? 107.021 -29.913 -39.420 1.00 26.12 ? 502  GLN D CG    1 
ATOM   7075  C  CD    . GLN F 3 206 ? 107.264 -29.865 -40.921 1.00 27.44 ? 502  GLN D CD    1 
ATOM   7076  O  OE1   . GLN F 3 206 ? 107.554 -30.885 -41.551 1.00 30.43 ? 502  GLN D OE1   1 
ATOM   7077  N  NE2   . GLN F 3 206 ? 107.138 -28.675 -41.505 1.00 28.69 ? 502  GLN D NE2   1 
ATOM   7078  N  N     . MET F 3 207 ? 110.109 -28.745 -37.490 1.00 22.10 ? 503  MET D N     1 
ATOM   7079  C  CA    . MET F 3 207 ? 110.527 -27.395 -37.107 1.00 22.19 ? 503  MET D CA    1 
ATOM   7080  C  C     . MET F 3 207 ? 111.829 -27.054 -37.826 1.00 21.15 ? 503  MET D C     1 
ATOM   7081  O  O     . MET F 3 207 ? 112.038 -25.919 -38.254 1.00 20.80 ? 503  MET D O     1 
ATOM   7082  C  CB    . MET F 3 207 ? 110.759 -27.296 -35.595 1.00 24.08 ? 503  MET D CB    1 
ATOM   7083  C  CG    . MET F 3 207 ? 109.499 -27.362 -34.754 1.00 25.39 ? 503  MET D CG    1 
ATOM   7084  S  SD    . MET F 3 207 ? 109.836 -27.048 -33.000 1.00 28.86 ? 503  MET D SD    1 
ATOM   7085  C  CE    . MET F 3 207 ? 110.359 -28.659 -32.463 1.00 27.72 ? 503  MET D CE    1 
ATOM   7086  N  N     . GLY F 3 208 ? 112.695 -28.053 -37.961 1.00 20.30 ? 504  GLY D N     1 
ATOM   7087  C  CA    . GLY F 3 208 ? 113.968 -27.851 -38.624 1.00 21.51 ? 504  GLY D CA    1 
ATOM   7088  C  C     . GLY F 3 208 ? 113.834 -27.499 -40.093 1.00 24.00 ? 504  GLY D C     1 
ATOM   7089  O  O     . GLY F 3 208 ? 114.580 -26.662 -40.605 1.00 22.31 ? 504  GLY D O     1 
ATOM   7090  N  N     . LYS F 3 209 ? 112.885 -28.129 -40.778 1.00 25.37 ? 505  LYS D N     1 
ATOM   7091  C  CA    . LYS F 3 209 ? 112.689 -27.849 -42.197 1.00 29.21 ? 505  LYS D CA    1 
ATOM   7092  C  C     . LYS F 3 209 ? 112.140 -26.439 -42.402 1.00 29.19 ? 505  LYS D C     1 
ATOM   7093  O  O     . LYS F 3 209 ? 112.598 -25.708 -43.277 1.00 31.03 ? 505  LYS D O     1 
ATOM   7094  C  CB    . LYS F 3 209 ? 111.731 -28.862 -42.831 1.00 31.42 ? 505  LYS D CB    1 
ATOM   7095  C  CG    . LYS F 3 209 ? 111.747 -28.810 -44.356 1.00 36.08 ? 505  LYS D CG    1 
ATOM   7096  C  CD    . LYS F 3 209 ? 110.638 -29.639 -44.972 1.00 40.57 ? 505  LYS D CD    1 
ATOM   7097  C  CE    . LYS F 3 209 ? 110.831 -29.785 -46.482 1.00 43.01 ? 505  LYS D CE    1 
ATOM   7098  N  NZ    . LYS F 3 209 ? 112.053 -30.577 -46.815 1.00 45.89 ? 505  LYS D NZ    1 
ATOM   7099  N  N     . GLU F 3 210 ? 111.161 -26.061 -41.590 1.00 29.78 ? 506  GLU D N     1 
ATOM   7100  C  CA    . GLU F 3 210 ? 110.557 -24.739 -41.690 1.00 30.48 ? 506  GLU D CA    1 
ATOM   7101  C  C     . GLU F 3 210 ? 111.560 -23.665 -41.278 1.00 30.83 ? 506  GLU D C     1 
ATOM   7102  O  O     . GLU F 3 210 ? 111.571 -22.563 -41.831 1.00 29.70 ? 506  GLU D O     1 
ATOM   7103  C  CB    . GLU F 3 210 ? 109.322 -24.665 -40.795 1.00 32.77 ? 506  GLU D CB    1 
ATOM   7104  C  CG    . GLU F 3 210 ? 108.436 -25.892 -40.896 1.00 37.18 ? 506  GLU D CG    1 
ATOM   7105  C  CD    . GLU F 3 210 ? 107.160 -25.762 -40.098 1.00 40.83 ? 506  GLU D CD    1 
ATOM   7106  O  OE1   . GLU F 3 210 ? 107.203 -25.175 -38.994 1.00 43.92 ? 506  GLU D OE1   1 
ATOM   7107  O  OE2   . GLU F 3 210 ? 106.114 -26.253 -40.572 1.00 41.59 ? 506  GLU D OE2   1 
ATOM   7108  N  N     . LEU F 3 211 ? 112.403 -23.993 -40.304 1.00 30.10 ? 507  LEU D N     1 
ATOM   7109  C  CA    . LEU F 3 211 ? 113.416 -23.061 -39.825 1.00 29.56 ? 507  LEU D CA    1 
ATOM   7110  C  C     . LEU F 3 211 ? 114.410 -22.760 -40.946 1.00 29.78 ? 507  LEU D C     1 
ATOM   7111  O  O     . LEU F 3 211 ? 114.849 -21.621 -41.114 1.00 27.79 ? 507  LEU D O     1 
ATOM   7112  C  CB    . LEU F 3 211 ? 114.149 -23.657 -38.622 1.00 29.17 ? 507  LEU D CB    1 
ATOM   7113  C  CG    . LEU F 3 211 ? 115.244 -22.807 -37.974 1.00 30.55 ? 507  LEU D CG    1 
ATOM   7114  C  CD1   . LEU F 3 211 ? 114.654 -21.498 -37.473 1.00 31.92 ? 507  LEU D CD1   1 
ATOM   7115  C  CD2   . LEU F 3 211 ? 115.875 -23.583 -36.829 1.00 30.35 ? 507  LEU D CD2   1 
ATOM   7116  N  N     . ALA F 3 212 ? 114.762 -23.790 -41.709 1.00 30.37 ? 508  ALA D N     1 
ATOM   7117  C  CA    . ALA F 3 212 ? 115.693 -23.630 -42.816 1.00 32.04 ? 508  ALA D CA    1 
ATOM   7118  C  C     . ALA F 3 212 ? 115.084 -22.660 -43.819 1.00 33.62 ? 508  ALA D C     1 
ATOM   7119  O  O     . ALA F 3 212 ? 115.789 -21.858 -44.432 1.00 34.55 ? 508  ALA D O     1 
ATOM   7120  C  CB    . ALA F 3 212 ? 115.964 -24.976 -43.476 1.00 31.24 ? 508  ALA D CB    1 
ATOM   7121  N  N     . GLU F 3 213 ? 113.766 -22.740 -43.976 1.00 34.95 ? 509  GLU D N     1 
ATOM   7122  C  CA    . GLU F 3 213 ? 113.043 -21.863 -44.890 1.00 36.88 ? 509  GLU D CA    1 
ATOM   7123  C  C     . GLU F 3 213 ? 113.198 -20.418 -44.437 1.00 35.71 ? 509  GLU D C     1 
ATOM   7124  O  O     . GLU F 3 213 ? 113.625 -19.558 -45.206 1.00 35.06 ? 509  GLU D O     1 
ATOM   7125  C  CB    . GLU F 3 213 ? 111.556 -22.227 -44.912 1.00 39.56 ? 509  GLU D CB    1 
ATOM   7126  C  CG    . GLU F 3 213 ? 111.258 -23.625 -45.427 1.00 45.19 ? 509  GLU D CG    1 
ATOM   7127  C  CD    . GLU F 3 213 ? 111.613 -23.794 -46.889 1.00 48.53 ? 509  GLU D CD    1 
ATOM   7128  O  OE1   . GLU F 3 213 ? 111.036 -23.069 -47.729 1.00 50.56 ? 509  GLU D OE1   1 
ATOM   7129  O  OE2   . GLU F 3 213 ? 112.468 -24.652 -47.200 1.00 51.22 ? 509  GLU D OE2   1 
ATOM   7130  N  N     . GLN F 3 214 ? 112.844 -20.156 -43.183 1.00 35.13 ? 510  GLN D N     1 
ATOM   7131  C  CA    . GLN F 3 214 ? 112.950 -18.813 -42.629 1.00 34.53 ? 510  GLN D CA    1 
ATOM   7132  C  C     . GLN F 3 214 ? 114.373 -18.281 -42.701 1.00 33.24 ? 510  GLN D C     1 
ATOM   7133  O  O     . GLN F 3 214 ? 114.587 -17.114 -43.037 1.00 32.37 ? 510  GLN D O     1 
ATOM   7134  C  CB    . GLN F 3 214 ? 112.479 -18.792 -41.177 1.00 36.74 ? 510  GLN D CB    1 
ATOM   7135  C  CG    . GLN F 3 214 ? 110.977 -18.730 -41.009 1.00 40.35 ? 510  GLN D CG    1 
ATOM   7136  C  CD    . GLN F 3 214 ? 110.574 -18.552 -39.560 1.00 42.41 ? 510  GLN D CD    1 
ATOM   7137  O  OE1   . GLN F 3 214 ? 111.081 -17.667 -38.868 1.00 44.47 ? 510  GLN D OE1   1 
ATOM   7138  N  NE2   . GLN F 3 214 ? 109.654 -19.390 -39.093 1.00 43.83 ? 510  GLN D NE2   1 
ATOM   7139  N  N     . LEU F 3 215 ? 115.343 -19.134 -42.382 1.00 30.78 ? 511  LEU D N     1 
ATOM   7140  C  CA    . LEU F 3 215 ? 116.744 -18.736 -42.418 1.00 29.83 ? 511  LEU D CA    1 
ATOM   7141  C  C     . LEU F 3 215 ? 117.126 -18.216 -43.795 1.00 29.99 ? 511  LEU D C     1 
ATOM   7142  O  O     . LEU F 3 215 ? 117.790 -17.186 -43.916 1.00 28.14 ? 511  LEU D O     1 
ATOM   7143  C  CB    . LEU F 3 215 ? 117.650 -19.911 -42.055 1.00 28.90 ? 511  LEU D CB    1 
ATOM   7144  C  CG    . LEU F 3 215 ? 118.059 -20.041 -40.587 1.00 29.78 ? 511  LEU D CG    1 
ATOM   7145  C  CD1   . LEU F 3 215 ? 118.876 -21.313 -40.397 1.00 30.51 ? 511  LEU D CD1   1 
ATOM   7146  C  CD2   . LEU F 3 215 ? 118.867 -18.815 -40.169 1.00 27.51 ? 511  LEU D CD2   1 
ATOM   7147  N  N     . GLY F 3 216 ? 116.704 -18.936 -44.829 1.00 29.12 ? 512  GLY D N     1 
ATOM   7148  C  CA    . GLY F 3 216 ? 117.011 -18.529 -46.188 1.00 30.30 ? 512  GLY D CA    1 
ATOM   7149  C  C     . GLY F 3 216 ? 116.435 -17.169 -46.536 1.00 29.83 ? 512  GLY D C     1 
ATOM   7150  O  O     . GLY F 3 216 ? 117.096 -16.352 -47.182 1.00 29.84 ? 512  GLY D O     1 
ATOM   7151  N  N     . THR F 3 217 ? 115.200 -16.920 -46.110 1.00 29.75 ? 513  THR D N     1 
ATOM   7152  C  CA    . THR F 3 217 ? 114.547 -15.644 -46.382 1.00 29.62 ? 513  THR D CA    1 
ATOM   7153  C  C     . THR F 3 217 ? 115.294 -14.509 -45.686 1.00 28.95 ? 513  THR D C     1 
ATOM   7154  O  O     . THR F 3 217 ? 115.580 -13.475 -46.290 1.00 27.66 ? 513  THR D O     1 
ATOM   7155  C  CB    . THR F 3 217 ? 113.078 -15.655 -45.899 1.00 31.10 ? 513  THR D CB    1 
ATOM   7156  O  OG1   . THR F 3 217 ? 112.355 -16.678 -46.595 1.00 32.75 ? 513  THR D OG1   1 
ATOM   7157  C  CG2   . THR F 3 217 ? 112.414 -14.309 -46.163 1.00 31.33 ? 513  THR D CG2   1 
ATOM   7158  N  N     . VAL F 3 218 ? 115.614 -14.706 -44.411 1.00 26.73 ? 514  VAL D N     1 
ATOM   7159  C  CA    . VAL F 3 218 ? 116.325 -13.692 -43.646 1.00 25.75 ? 514  VAL D CA    1 
ATOM   7160  C  C     . VAL F 3 218 ? 117.716 -13.474 -44.234 1.00 24.78 ? 514  VAL D C     1 
ATOM   7161  O  O     . VAL F 3 218 ? 118.191 -12.343 -44.334 1.00 24.60 ? 514  VAL D O     1 
ATOM   7162  C  CB    . VAL F 3 218 ? 116.466 -14.109 -42.160 1.00 26.33 ? 514  VAL D CB    1 
ATOM   7163  C  CG1   . VAL F 3 218 ? 117.231 -13.044 -41.386 1.00 26.18 ? 514  VAL D CG1   1 
ATOM   7164  C  CG2   . VAL F 3 218 ? 115.085 -14.317 -41.549 1.00 26.08 ? 514  VAL D CG2   1 
ATOM   7165  N  N     . GLU F 3 219 ? 118.354 -14.570 -44.630 1.00 23.71 ? 515  GLU D N     1 
ATOM   7166  C  CA    . GLU F 3 219 ? 119.692 -14.530 -45.204 1.00 25.14 ? 515  GLU D CA    1 
ATOM   7167  C  C     . GLU F 3 219 ? 119.746 -13.658 -46.455 1.00 26.02 ? 515  GLU D C     1 
ATOM   7168  O  O     . GLU F 3 219 ? 120.629 -12.807 -46.597 1.00 24.99 ? 515  GLU D O     1 
ATOM   7169  C  CB    . GLU F 3 219 ? 120.152 -15.947 -45.552 1.00 25.91 ? 515  GLU D CB    1 
ATOM   7170  C  CG    . GLU F 3 219 ? 121.558 -16.012 -46.112 1.00 26.36 ? 515  GLU D CG    1 
ATOM   7171  C  CD    . GLU F 3 219 ? 121.945 -17.402 -46.582 1.00 26.00 ? 515  GLU D CD    1 
ATOM   7172  O  OE1   . GLU F 3 219 ? 123.116 -17.589 -46.968 1.00 27.23 ? 515  GLU D OE1   1 
ATOM   7173  O  OE2   . GLU F 3 219 ? 121.083 -18.304 -46.567 1.00 26.74 ? 515  GLU D OE2   1 
ATOM   7174  N  N     . GLN F 3 220 ? 118.800 -13.879 -47.362 1.00 25.26 ? 516  GLN D N     1 
ATOM   7175  C  CA    . GLN F 3 220 ? 118.746 -13.114 -48.601 1.00 26.51 ? 516  GLN D CA    1 
ATOM   7176  C  C     . GLN F 3 220 ? 118.493 -11.639 -48.330 1.00 25.52 ? 516  GLN D C     1 
ATOM   7177  O  O     . GLN F 3 220 ? 119.108 -10.775 -48.953 1.00 24.95 ? 516  GLN D O     1 
ATOM   7178  C  CB    . GLN F 3 220 ? 117.655 -13.663 -49.523 1.00 28.08 ? 516  GLN D CB    1 
ATOM   7179  C  CG    . GLN F 3 220 ? 117.997 -14.995 -50.161 1.00 32.08 ? 516  GLN D CG    1 
ATOM   7180  C  CD    . GLN F 3 220 ? 119.342 -14.975 -50.867 1.00 34.02 ? 516  GLN D CD    1 
ATOM   7181  O  OE1   . GLN F 3 220 ? 119.648 -14.052 -51.623 1.00 34.71 ? 516  GLN D OE1   1 
ATOM   7182  N  NE2   . GLN F 3 220 ? 120.150 -15.999 -50.625 1.00 34.53 ? 516  GLN D NE2   1 
ATOM   7183  N  N     . ARG F 3 221 ? 117.586 -11.357 -47.399 1.00 24.71 ? 517  ARG D N     1 
ATOM   7184  C  CA    . ARG F 3 221 ? 117.268 -9.981  -47.049 1.00 25.67 ? 517  ARG D CA    1 
ATOM   7185  C  C     . ARG F 3 221 ? 118.526 -9.261  -46.571 1.00 25.13 ? 517  ARG D C     1 
ATOM   7186  O  O     . ARG F 3 221 ? 118.762 -8.105  -46.921 1.00 24.87 ? 517  ARG D O     1 
ATOM   7187  C  CB    . ARG F 3 221 ? 116.190 -9.943  -45.963 1.00 26.38 ? 517  ARG D CB    1 
ATOM   7188  C  CG    . ARG F 3 221 ? 115.790 -8.541  -45.541 1.00 29.77 ? 517  ARG D CG    1 
ATOM   7189  C  CD    . ARG F 3 221 ? 115.405 -7.702  -46.754 1.00 33.18 ? 517  ARG D CD    1 
ATOM   7190  N  NE    . ARG F 3 221 ? 115.020 -6.343  -46.391 1.00 35.76 ? 517  ARG D NE    1 
ATOM   7191  C  CZ    . ARG F 3 221 ? 114.885 -5.352  -47.265 1.00 37.85 ? 517  ARG D CZ    1 
ATOM   7192  N  NH1   . ARG F 3 221 ? 115.105 -5.569  -48.555 1.00 38.89 ? 517  ARG D NH1   1 
ATOM   7193  N  NH2   . ARG F 3 221 ? 114.530 -4.143  -46.850 1.00 38.84 ? 517  ARG D NH2   1 
ATOM   7194  N  N     . ILE F 3 222 ? 119.336 -9.952  -45.774 1.00 23.85 ? 518  ILE D N     1 
ATOM   7195  C  CA    . ILE F 3 222 ? 120.570 -9.370  -45.268 1.00 23.31 ? 518  ILE D CA    1 
ATOM   7196  C  C     . ILE F 3 222 ? 121.534 -9.036  -46.405 1.00 24.89 ? 518  ILE D C     1 
ATOM   7197  O  O     . ILE F 3 222 ? 122.175 -7.981  -46.387 1.00 24.93 ? 518  ILE D O     1 
ATOM   7198  C  CB    . ILE F 3 222 ? 121.259 -10.324 -44.262 1.00 21.18 ? 518  ILE D CB    1 
ATOM   7199  C  CG1   . ILE F 3 222 ? 120.430 -10.388 -42.974 1.00 17.44 ? 518  ILE D CG1   1 
ATOM   7200  C  CG2   . ILE F 3 222 ? 122.685 -9.860  -43.971 1.00 19.93 ? 518  ILE D CG2   1 
ATOM   7201  C  CD1   . ILE F 3 222 ? 120.957 -11.371 -41.950 1.00 13.81 ? 518  ILE D CD1   1 
ATOM   7202  N  N     . TYR F 3 223 ? 121.639 -9.924  -47.393 1.00 24.42 ? 519  TYR D N     1 
ATOM   7203  C  CA    . TYR F 3 223 ? 122.538 -9.680  -48.519 1.00 25.60 ? 519  TYR D CA    1 
ATOM   7204  C  C     . TYR F 3 223 ? 122.066 -8.479  -49.337 1.00 27.53 ? 519  TYR D C     1 
ATOM   7205  O  O     . TYR F 3 223 ? 122.877 -7.681  -49.807 1.00 27.38 ? 519  TYR D O     1 
ATOM   7206  C  CB    . TYR F 3 223 ? 122.630 -10.908 -49.435 1.00 26.01 ? 519  TYR D CB    1 
ATOM   7207  C  CG    . TYR F 3 223 ? 123.185 -12.153 -48.774 1.00 26.65 ? 519  TYR D CG    1 
ATOM   7208  C  CD1   . TYR F 3 223 ? 124.114 -12.061 -47.736 1.00 25.63 ? 519  TYR D CD1   1 
ATOM   7209  C  CD2   . TYR F 3 223 ? 122.793 -13.425 -49.197 1.00 26.38 ? 519  TYR D CD2   1 
ATOM   7210  C  CE1   . TYR F 3 223 ? 124.638 -13.201 -47.135 1.00 26.69 ? 519  TYR D CE1   1 
ATOM   7211  C  CE2   . TYR F 3 223 ? 123.315 -14.575 -48.602 1.00 26.77 ? 519  TYR D CE2   1 
ATOM   7212  C  CZ    . TYR F 3 223 ? 124.236 -14.455 -47.571 1.00 26.71 ? 519  TYR D CZ    1 
ATOM   7213  O  OH    . TYR F 3 223 ? 124.755 -15.581 -46.974 1.00 26.58 ? 519  TYR D OH    1 
ATOM   7214  N  N     . GLU F 3 224 ? 120.754 -8.354  -49.506 1.00 28.59 ? 520  GLU D N     1 
ATOM   7215  C  CA    . GLU F 3 224 ? 120.194 -7.245  -50.267 1.00 30.55 ? 520  GLU D CA    1 
ATOM   7216  C  C     . GLU F 3 224 ? 120.460 -5.932  -49.538 1.00 30.35 ? 520  GLU D C     1 
ATOM   7217  O  O     . GLU F 3 224 ? 120.821 -4.934  -50.157 1.00 30.38 ? 520  GLU D O     1 
ATOM   7218  C  CB    . GLU F 3 224 ? 118.689 -7.439  -50.466 1.00 33.32 ? 520  GLU D CB    1 
ATOM   7219  C  CG    . GLU F 3 224 ? 118.316 -8.790  -51.052 1.00 38.36 ? 520  GLU D CG    1 
ATOM   7220  C  CD    . GLU F 3 224 ? 116.837 -8.904  -51.360 1.00 41.68 ? 520  GLU D CD    1 
ATOM   7221  O  OE1   . GLU F 3 224 ? 116.037 -8.204  -50.701 1.00 44.19 ? 520  GLU D OE1   1 
ATOM   7222  O  OE2   . GLU F 3 224 ? 116.475 -9.698  -52.257 1.00 43.67 ? 520  GLU D OE2   1 
ATOM   7223  N  N     . LEU F 3 225 ? 120.289 -5.940  -48.220 1.00 28.71 ? 521  LEU D N     1 
ATOM   7224  C  CA    . LEU F 3 225 ? 120.524 -4.748  -47.412 1.00 28.86 ? 521  LEU D CA    1 
ATOM   7225  C  C     . LEU F 3 225 ? 121.999 -4.374  -47.398 1.00 28.89 ? 521  LEU D C     1 
ATOM   7226  O  O     . LEU F 3 225 ? 122.352 -3.196  -47.338 1.00 30.00 ? 521  LEU D O     1 
ATOM   7227  C  CB    . LEU F 3 225 ? 120.043 -4.972  -45.978 1.00 28.11 ? 521  LEU D CB    1 
ATOM   7228  C  CG    . LEU F 3 225 ? 118.545 -4.800  -45.734 1.00 28.12 ? 521  LEU D CG    1 
ATOM   7229  C  CD1   . LEU F 3 225 ? 118.188 -5.265  -44.330 1.00 27.90 ? 521  LEU D CD1   1 
ATOM   7230  C  CD2   . LEU F 3 225 ? 118.180 -3.335  -45.927 1.00 27.79 ? 521  LEU D CD2   1 
ATOM   7231  N  N     . ALA F 3 226 ? 122.857 -5.385  -47.449 1.00 28.63 ? 522  ALA D N     1 
ATOM   7232  C  CA    . ALA F 3 226 ? 124.292 -5.161  -47.445 1.00 28.91 ? 522  ALA D CA    1 
ATOM   7233  C  C     . ALA F 3 226 ? 124.769 -4.839  -48.853 1.00 29.00 ? 522  ALA D C     1 
ATOM   7234  O  O     . ALA F 3 226 ? 125.858 -4.296  -49.038 1.00 28.06 ? 522  ALA D O     1 
ATOM   7235  C  CB    . ALA F 3 226 ? 125.010 -6.398  -46.927 1.00 28.95 ? 522  ALA D CB    1 
ATOM   7236  N  N     . GLY F 3 227 ? 123.943 -5.174  -49.840 1.00 29.74 ? 523  GLY D N     1 
ATOM   7237  C  CA    . GLY F 3 227 ? 124.303 -4.936  -51.224 1.00 30.41 ? 523  GLY D CA    1 
ATOM   7238  C  C     . GLY F 3 227 ? 125.434 -5.869  -51.599 1.00 31.00 ? 523  GLY D C     1 
ATOM   7239  O  O     . GLY F 3 227 ? 126.190 -5.609  -52.533 1.00 30.75 ? 523  GLY D O     1 
ATOM   7240  N  N     . GLN F 3 228 ? 125.537 -6.974  -50.867 1.00 31.47 ? 524  GLN D N     1 
ATOM   7241  C  CA    . GLN F 3 228 ? 126.592 -7.952  -51.095 1.00 31.57 ? 524  GLN D CA    1 
ATOM   7242  C  C     . GLN F 3 228 ? 126.324 -9.231  -50.305 1.00 31.64 ? 524  GLN D C     1 
ATOM   7243  O  O     . GLN F 3 228 ? 125.655 -9.200  -49.272 1.00 32.13 ? 524  GLN D O     1 
ATOM   7244  C  CB    . GLN F 3 228 ? 127.932 -7.363  -50.651 1.00 33.14 ? 524  GLN D CB    1 
ATOM   7245  C  CG    . GLN F 3 228 ? 129.130 -8.280  -50.821 1.00 33.69 ? 524  GLN D CG    1 
ATOM   7246  C  CD    . GLN F 3 228 ? 130.346 -7.791  -50.050 1.00 34.96 ? 524  GLN D CD    1 
ATOM   7247  O  OE1   . GLN F 3 228 ? 130.676 -6.604  -50.071 1.00 34.18 ? 524  GLN D OE1   1 
ATOM   7248  N  NE2   . GLN F 3 228 ? 131.021 -8.710  -49.367 1.00 36.18 ? 524  GLN D NE2   1 
ATOM   7249  N  N     . GLU F 3 229 ? 126.842 -10.354 -50.793 1.00 31.10 ? 525  GLU D N     1 
ATOM   7250  C  CA    . GLU F 3 229 ? 126.687 -11.615 -50.083 1.00 30.04 ? 525  GLU D CA    1 
ATOM   7251  C  C     . GLU F 3 229 ? 127.997 -11.840 -49.335 1.00 28.19 ? 525  GLU D C     1 
ATOM   7252  O  O     . GLU F 3 229 ? 129.075 -11.515 -49.840 1.00 27.39 ? 525  GLU D O     1 
ATOM   7253  C  CB    . GLU F 3 229 ? 126.429 -12.778 -51.048 1.00 32.99 ? 525  GLU D CB    1 
ATOM   7254  C  CG    . GLU F 3 229 ? 125.194 -12.609 -51.922 1.00 36.83 ? 525  GLU D CG    1 
ATOM   7255  C  CD    . GLU F 3 229 ? 124.712 -13.924 -52.522 1.00 40.10 ? 525  GLU D CD    1 
ATOM   7256  O  OE1   . GLU F 3 229 ? 125.555 -14.812 -52.780 1.00 39.76 ? 525  GLU D OE1   1 
ATOM   7257  O  OE2   . GLU F 3 229 ? 123.488 -14.066 -52.741 1.00 41.50 ? 525  GLU D OE2   1 
ATOM   7258  N  N     . PHE F 3 230 ? 127.896 -12.386 -48.128 1.00 24.65 ? 526  PHE D N     1 
ATOM   7259  C  CA    . PHE F 3 230 ? 129.058 -12.656 -47.290 1.00 22.15 ? 526  PHE D CA    1 
ATOM   7260  C  C     . PHE F 3 230 ? 128.648 -13.685 -46.238 1.00 20.30 ? 526  PHE D C     1 
ATOM   7261  O  O     . PHE F 3 230 ? 127.465 -13.994 -46.107 1.00 19.18 ? 526  PHE D O     1 
ATOM   7262  C  CB    . PHE F 3 230 ? 129.515 -11.372 -46.591 1.00 22.34 ? 526  PHE D CB    1 
ATOM   7263  C  CG    . PHE F 3 230 ? 128.482 -10.786 -45.667 1.00 22.21 ? 526  PHE D CG    1 
ATOM   7264  C  CD1   . PHE F 3 230 ? 127.353 -10.150 -46.172 1.00 22.83 ? 526  PHE D CD1   1 
ATOM   7265  C  CD2   . PHE F 3 230 ? 128.628 -10.891 -44.287 1.00 22.86 ? 526  PHE D CD2   1 
ATOM   7266  C  CE1   . PHE F 3 230 ? 126.382 -9.625  -45.316 1.00 23.31 ? 526  PHE D CE1   1 
ATOM   7267  C  CE2   . PHE F 3 230 ? 127.665 -10.371 -43.422 1.00 22.31 ? 526  PHE D CE2   1 
ATOM   7268  C  CZ    . PHE F 3 230 ? 126.540 -9.737  -43.937 1.00 23.37 ? 526  PHE D CZ    1 
ATOM   7269  N  N     . ASN F 3 231 ? 129.616 -14.206 -45.487 1.00 19.22 ? 527  ASN D N     1 
ATOM   7270  C  CA    . ASN F 3 231 ? 129.307 -15.188 -44.450 1.00 20.14 ? 527  ASN D CA    1 
ATOM   7271  C  C     . ASN F 3 231 ? 128.843 -14.470 -43.181 1.00 20.02 ? 527  ASN D C     1 
ATOM   7272  O  O     . ASN F 3 231 ? 129.653 -13.930 -42.432 1.00 19.19 ? 527  ASN D O     1 
ATOM   7273  C  CB    . ASN F 3 231 ? 130.529 -16.053 -44.132 1.00 20.30 ? 527  ASN D CB    1 
ATOM   7274  C  CG    . ASN F 3 231 ? 130.182 -17.236 -43.236 1.00 22.14 ? 527  ASN D CG    1 
ATOM   7275  O  OD1   . ASN F 3 231 ? 129.399 -17.099 -42.302 1.00 22.83 ? 527  ASN D OD1   1 
ATOM   7276  N  ND2   . ASN F 3 231 ? 130.766 -18.396 -43.517 1.00 20.45 ? 527  ASN D ND2   1 
ATOM   7277  N  N     . ILE F 3 232 ? 127.533 -14.472 -42.951 1.00 19.74 ? 528  ILE D N     1 
ATOM   7278  C  CA    . ILE F 3 232 ? 126.942 -13.809 -41.789 1.00 18.84 ? 528  ILE D CA    1 
ATOM   7279  C  C     . ILE F 3 232 ? 127.431 -14.392 -40.465 1.00 19.87 ? 528  ILE D C     1 
ATOM   7280  O  O     . ILE F 3 232 ? 127.483 -13.688 -39.457 1.00 19.56 ? 528  ILE D O     1 
ATOM   7281  C  CB    . ILE F 3 232 ? 125.400 -13.889 -41.831 1.00 18.18 ? 528  ILE D CB    1 
ATOM   7282  C  CG1   . ILE F 3 232 ? 124.887 -13.363 -43.176 1.00 17.94 ? 528  ILE D CG1   1 
ATOM   7283  C  CG2   . ILE F 3 232 ? 124.802 -13.048 -40.707 1.00 18.38 ? 528  ILE D CG2   1 
ATOM   7284  C  CD1   . ILE F 3 232 ? 123.420 -13.613 -43.421 1.00 17.91 ? 528  ILE D CD1   1 
ATOM   7285  N  N     . ASN F 3 233 ? 127.788 -15.674 -40.466 1.00 19.95 ? 529  ASN D N     1 
ATOM   7286  C  CA    . ASN F 3 233 ? 128.276 -16.323 -39.255 1.00 21.33 ? 529  ASN D CA    1 
ATOM   7287  C  C     . ASN F 3 233 ? 129.762 -16.094 -39.039 1.00 21.25 ? 529  ASN D C     1 
ATOM   7288  O  O     . ASN F 3 233 ? 130.394 -16.768 -38.226 1.00 20.93 ? 529  ASN D O     1 
ATOM   7289  C  CB    . ASN F 3 233 ? 127.986 -17.823 -39.294 1.00 23.20 ? 529  ASN D CB    1 
ATOM   7290  C  CG    . ASN F 3 233 ? 126.517 -18.122 -39.149 1.00 23.55 ? 529  ASN D CG    1 
ATOM   7291  O  OD1   . ASN F 3 233 ? 125.857 -17.606 -38.245 1.00 26.23 ? 529  ASN D OD1   1 
ATOM   7292  N  ND2   . ASN F 3 233 ? 125.992 -18.957 -40.034 1.00 23.28 ? 529  ASN D ND2   1 
ATOM   7293  N  N     . SER F 3 234 ? 130.316 -15.139 -39.774 1.00 19.95 ? 530  SER D N     1 
ATOM   7294  C  CA    . SER F 3 234 ? 131.725 -14.807 -39.645 1.00 20.68 ? 530  SER D CA    1 
ATOM   7295  C  C     . SER F 3 234 ? 131.835 -13.393 -39.088 1.00 20.87 ? 530  SER D C     1 
ATOM   7296  O  O     . SER F 3 234 ? 131.633 -12.419 -39.811 1.00 19.62 ? 530  SER D O     1 
ATOM   7297  C  CB    . SER F 3 234 ? 132.420 -14.871 -41.010 1.00 21.23 ? 530  SER D CB    1 
ATOM   7298  O  OG    . SER F 3 234 ? 133.782 -14.486 -40.909 1.00 20.73 ? 530  SER D OG    1 
ATOM   7299  N  N     . PRO F 3 235 ? 132.147 -13.261 -37.789 1.00 21.99 ? 531  PRO D N     1 
ATOM   7300  C  CA    . PRO F 3 235 ? 132.268 -11.919 -37.209 1.00 22.69 ? 531  PRO D CA    1 
ATOM   7301  C  C     . PRO F 3 235 ? 133.298 -11.093 -37.979 1.00 23.50 ? 531  PRO D C     1 
ATOM   7302  O  O     . PRO F 3 235 ? 133.184 -9.871  -38.086 1.00 23.11 ? 531  PRO D O     1 
ATOM   7303  C  CB    . PRO F 3 235 ? 132.668 -12.201 -35.766 1.00 23.34 ? 531  PRO D CB    1 
ATOM   7304  C  CG    . PRO F 3 235 ? 131.957 -13.499 -35.481 1.00 24.24 ? 531  PRO D CG    1 
ATOM   7305  C  CD    . PRO F 3 235 ? 132.240 -14.295 -36.742 1.00 23.04 ? 531  PRO D CD    1 
ATOM   7306  N  N     . LYS F 3 236 ? 134.299 -11.782 -38.520 1.00 23.67 ? 532  LYS D N     1 
ATOM   7307  C  CA    . LYS F 3 236 ? 135.355 -11.147 -39.302 1.00 25.76 ? 532  LYS D CA    1 
ATOM   7308  C  C     . LYS F 3 236 ? 134.770 -10.488 -40.551 1.00 24.91 ? 532  LYS D C     1 
ATOM   7309  O  O     . LYS F 3 236 ? 134.938 -9.284  -40.766 1.00 24.67 ? 532  LYS D O     1 
ATOM   7310  C  CB    . LYS F 3 236 ? 136.393 -12.192 -39.714 1.00 28.84 ? 532  LYS D CB    1 
ATOM   7311  C  CG    . LYS F 3 236 ? 137.503 -11.672 -40.610 1.00 33.76 ? 532  LYS D CG    1 
ATOM   7312  C  CD    . LYS F 3 236 ? 138.468 -10.778 -39.856 1.00 37.22 ? 532  LYS D CD    1 
ATOM   7313  C  CE    . LYS F 3 236 ? 139.642 -10.381 -40.744 1.00 39.93 ? 532  LYS D CE    1 
ATOM   7314  N  NZ    . LYS F 3 236 ? 140.380 -11.574 -41.253 1.00 37.33 ? 532  LYS D NZ    1 
ATOM   7315  N  N     . GLN F 3 237 ? 134.083 -11.282 -41.370 1.00 23.43 ? 533  GLN D N     1 
ATOM   7316  C  CA    . GLN F 3 237 ? 133.471 -10.779 -42.597 1.00 20.76 ? 533  GLN D CA    1 
ATOM   7317  C  C     . GLN F 3 237 ? 132.377 -9.766  -42.281 1.00 20.89 ? 533  GLN D C     1 
ATOM   7318  O  O     . GLN F 3 237 ? 132.244 -8.748  -42.965 1.00 20.46 ? 533  GLN D O     1 
ATOM   7319  C  CB    . GLN F 3 237 ? 132.900 -11.939 -43.423 1.00 21.74 ? 533  GLN D CB    1 
ATOM   7320  C  CG    . GLN F 3 237 ? 133.974 -12.867 -43.995 1.00 21.22 ? 533  GLN D CG    1 
ATOM   7321  C  CD    . GLN F 3 237 ? 133.405 -13.952 -44.891 1.00 20.28 ? 533  GLN D CD    1 
ATOM   7322  O  OE1   . GLN F 3 237 ? 132.543 -13.689 -45.727 1.00 20.01 ? 533  GLN D OE1   1 
ATOM   7323  N  NE2   . GLN F 3 237 ? 133.899 -15.178 -44.728 1.00 20.33 ? 533  GLN D NE2   1 
ATOM   7324  N  N     . LEU F 3 238 ? 131.604 -10.042 -41.237 1.00 17.82 ? 534  LEU D N     1 
ATOM   7325  C  CA    . LEU F 3 238 ? 130.526 -9.148  -40.823 1.00 18.86 ? 534  LEU D CA    1 
ATOM   7326  C  C     . LEU F 3 238 ? 131.091 -7.791  -40.415 1.00 17.96 ? 534  LEU D C     1 
ATOM   7327  O  O     . LEU F 3 238 ? 130.499 -6.755  -40.706 1.00 20.18 ? 534  LEU D O     1 
ATOM   7328  C  CB    . LEU F 3 238 ? 129.752 -9.754  -39.645 1.00 16.41 ? 534  LEU D CB    1 
ATOM   7329  C  CG    . LEU F 3 238 ? 128.671 -8.877  -39.000 1.00 16.29 ? 534  LEU D CG    1 
ATOM   7330  C  CD1   . LEU F 3 238 ? 127.572 -8.585  -40.013 1.00 16.29 ? 534  LEU D CD1   1 
ATOM   7331  C  CD2   . LEU F 3 238 ? 128.094 -9.588  -37.778 1.00 15.82 ? 534  LEU D CD2   1 
ATOM   7332  N  N     . GLY F 3 239 ? 132.234 -7.811  -39.737 1.00 19.06 ? 535  GLY D N     1 
ATOM   7333  C  CA    . GLY F 3 239 ? 132.868 -6.578  -39.297 1.00 19.66 ? 535  GLY D CA    1 
ATOM   7334  C  C     . GLY F 3 239 ? 133.257 -5.683  -40.460 1.00 19.93 ? 535  GLY D C     1 
ATOM   7335  O  O     . GLY F 3 239 ? 133.184 -4.459  -40.364 1.00 20.40 ? 535  GLY D O     1 
ATOM   7336  N  N     . VAL F 3 240 ? 133.679 -6.298  -41.559 1.00 20.73 ? 536  VAL D N     1 
ATOM   7337  C  CA    . VAL F 3 240 ? 134.062 -5.556  -42.752 1.00 20.72 ? 536  VAL D CA    1 
ATOM   7338  C  C     . VAL F 3 240 ? 132.823 -4.909  -43.364 1.00 20.93 ? 536  VAL D C     1 
ATOM   7339  O  O     . VAL F 3 240 ? 132.845 -3.741  -43.748 1.00 21.77 ? 536  VAL D O     1 
ATOM   7340  C  CB    . VAL F 3 240 ? 134.723 -6.489  -43.800 1.00 20.78 ? 536  VAL D CB    1 
ATOM   7341  C  CG1   . VAL F 3 240 ? 134.906 -5.755  -45.127 1.00 21.34 ? 536  VAL D CG1   1 
ATOM   7342  C  CG2   . VAL F 3 240 ? 136.063 -6.968  -43.283 1.00 21.32 ? 536  VAL D CG2   1 
ATOM   7343  N  N     . ILE F 3 241 ? 131.737 -5.671  -43.443 1.00 20.69 ? 537  ILE D N     1 
ATOM   7344  C  CA    . ILE F 3 241 ? 130.494 -5.164  -44.012 1.00 20.04 ? 537  ILE D CA    1 
ATOM   7345  C  C     . ILE F 3 241 ? 129.936 -3.979  -43.220 1.00 21.30 ? 537  ILE D C     1 
ATOM   7346  O  O     . ILE F 3 241 ? 129.597 -2.942  -43.790 1.00 21.36 ? 537  ILE D O     1 
ATOM   7347  C  CB    . ILE F 3 241 ? 129.403 -6.271  -44.064 1.00 20.69 ? 537  ILE D CB    1 
ATOM   7348  C  CG1   . ILE F 3 241 ? 129.836 -7.407  -44.998 1.00 20.36 ? 537  ILE D CG1   1 
ATOM   7349  C  CG2   . ILE F 3 241 ? 128.075 -5.676  -44.521 1.00 20.19 ? 537  ILE D CG2   1 
ATOM   7350  C  CD1   . ILE F 3 241 ? 129.917 -7.016  -46.467 1.00 22.36 ? 537  ILE D CD1   1 
ATOM   7351  N  N     . LEU F 3 242 ? 129.851 -4.138  -41.904 1.00 18.46 ? 538  LEU D N     1 
ATOM   7352  C  CA    . LEU F 3 242 ? 129.300 -3.100  -41.038 1.00 18.90 ? 538  LEU D CA    1 
ATOM   7353  C  C     . LEU F 3 242 ? 130.165 -1.866  -40.817 1.00 18.09 ? 538  LEU D C     1 
ATOM   7354  O  O     . LEU F 3 242 ? 129.695 -0.740  -40.947 1.00 19.34 ? 538  LEU D O     1 
ATOM   7355  C  CB    . LEU F 3 242 ? 128.970 -3.683  -39.658 1.00 18.08 ? 538  LEU D CB    1 
ATOM   7356  C  CG    . LEU F 3 242 ? 127.991 -4.855  -39.541 1.00 18.13 ? 538  LEU D CG    1 
ATOM   7357  C  CD1   . LEU F 3 242 ? 127.865 -5.235  -38.069 1.00 18.93 ? 538  LEU D CD1   1 
ATOM   7358  C  CD2   . LEU F 3 242 ? 126.636 -4.473  -40.111 1.00 17.36 ? 538  LEU D CD2   1 
ATOM   7359  N  N     . PHE F 3 243 ? 131.432 -2.078  -40.482 1.00 18.82 ? 539  PHE D N     1 
ATOM   7360  C  CA    . PHE F 3 243 ? 132.308 -0.964  -40.161 1.00 19.74 ? 539  PHE D CA    1 
ATOM   7361  C  C     . PHE F 3 243 ? 133.208 -0.434  -41.263 1.00 21.56 ? 539  PHE D C     1 
ATOM   7362  O  O     . PHE F 3 243 ? 133.865 0.591   -41.089 1.00 22.80 ? 539  PHE D O     1 
ATOM   7363  C  CB    . PHE F 3 243 ? 133.112 -1.340  -38.922 1.00 18.60 ? 539  PHE D CB    1 
ATOM   7364  C  CG    . PHE F 3 243 ? 132.258 -1.917  -37.830 1.00 18.86 ? 539  PHE D CG    1 
ATOM   7365  C  CD1   . PHE F 3 243 ? 131.252 -1.151  -37.245 1.00 18.67 ? 539  PHE D CD1   1 
ATOM   7366  C  CD2   . PHE F 3 243 ? 132.405 -3.245  -37.438 1.00 19.98 ? 539  PHE D CD2   1 
ATOM   7367  C  CE1   . PHE F 3 243 ? 130.403 -1.700  -36.286 1.00 19.35 ? 539  PHE D CE1   1 
ATOM   7368  C  CE2   . PHE F 3 243 ? 131.561 -3.805  -36.480 1.00 16.11 ? 539  PHE D CE2   1 
ATOM   7369  C  CZ    . PHE F 3 243 ? 130.558 -3.033  -35.904 1.00 17.89 ? 539  PHE D CZ    1 
ATOM   7370  N  N     . GLU F 3 244 ? 133.246 -1.118  -42.396 1.00 22.13 ? 540  GLU D N     1 
ATOM   7371  C  CA    . GLU F 3 244 ? 134.056 -0.633  -43.499 1.00 24.49 ? 540  GLU D CA    1 
ATOM   7372  C  C     . GLU F 3 244 ? 133.138 -0.309  -44.668 1.00 24.66 ? 540  GLU D C     1 
ATOM   7373  O  O     . GLU F 3 244 ? 133.079 0.834   -45.116 1.00 24.55 ? 540  GLU D O     1 
ATOM   7374  C  CB    . GLU F 3 244 ? 135.122 -1.662  -43.878 1.00 25.61 ? 540  GLU D CB    1 
ATOM   7375  C  CG    . GLU F 3 244 ? 136.150 -1.837  -42.769 1.00 27.52 ? 540  GLU D CG    1 
ATOM   7376  C  CD    . GLU F 3 244 ? 137.302 -2.744  -43.142 1.00 29.62 ? 540  GLU D CD    1 
ATOM   7377  O  OE1   . GLU F 3 244 ? 138.175 -2.968  -42.275 1.00 30.55 ? 540  GLU D OE1   1 
ATOM   7378  O  OE2   . GLU F 3 244 ? 137.340 -3.231  -44.290 1.00 29.86 ? 540  GLU D OE2   1 
ATOM   7379  N  N     . LYS F 3 245 ? 132.387 -1.300  -45.134 1.00 25.08 ? 541  LYS D N     1 
ATOM   7380  C  CA    . LYS F 3 245 ? 131.477 -1.067  -46.245 1.00 24.72 ? 541  LYS D CA    1 
ATOM   7381  C  C     . LYS F 3 245 ? 130.358 -0.097  -45.880 1.00 23.67 ? 541  LYS D C     1 
ATOM   7382  O  O     . LYS F 3 245 ? 130.168 0.915   -46.552 1.00 23.74 ? 541  LYS D O     1 
ATOM   7383  C  CB    . LYS F 3 245 ? 130.860 -2.380  -46.735 1.00 24.89 ? 541  LYS D CB    1 
ATOM   7384  C  CG    . LYS F 3 245 ? 130.051 -2.204  -48.018 1.00 27.67 ? 541  LYS D CG    1 
ATOM   7385  C  CD    . LYS F 3 245 ? 129.514 -3.524  -48.553 1.00 29.42 ? 541  LYS D CD    1 
ATOM   7386  C  CE    . LYS F 3 245 ? 128.906 -3.336  -49.937 1.00 30.32 ? 541  LYS D CE    1 
ATOM   7387  N  NZ    . LYS F 3 245 ? 127.880 -2.256  -49.952 1.00 31.05 ? 541  LYS D NZ    1 
ATOM   7388  N  N     . LEU F 3 246 ? 129.617 -0.401  -44.815 1.00 21.75 ? 542  LEU D N     1 
ATOM   7389  C  CA    . LEU F 3 246 ? 128.508 0.453   -44.403 1.00 21.33 ? 542  LEU D CA    1 
ATOM   7390  C  C     . LEU F 3 246 ? 128.944 1.637   -43.546 1.00 21.15 ? 542  LEU D C     1 
ATOM   7391  O  O     . LEU F 3 246 ? 128.147 2.532   -43.263 1.00 21.10 ? 542  LEU D O     1 
ATOM   7392  C  CB    . LEU F 3 246 ? 127.448 -0.375  -43.666 1.00 20.74 ? 542  LEU D CB    1 
ATOM   7393  C  CG    . LEU F 3 246 ? 126.799 -1.481  -44.511 1.00 23.84 ? 542  LEU D CG    1 
ATOM   7394  C  CD1   . LEU F 3 246 ? 125.808 -2.250  -43.657 1.00 21.02 ? 542  LEU D CD1   1 
ATOM   7395  C  CD2   . LEU F 3 246 ? 126.104 -0.872  -45.733 1.00 21.13 ? 542  LEU D CD2   1 
ATOM   7396  N  N     . GLN F 3 247 ? 130.207 1.632   -43.135 1.00 21.26 ? 543  GLN D N     1 
ATOM   7397  C  CA    . GLN F 3 247 ? 130.776 2.713   -42.338 1.00 23.78 ? 543  GLN D CA    1 
ATOM   7398  C  C     . GLN F 3 247 ? 130.036 3.034   -41.047 1.00 23.81 ? 543  GLN D C     1 
ATOM   7399  O  O     . GLN F 3 247 ? 129.943 4.200   -40.656 1.00 24.78 ? 543  GLN D O     1 
ATOM   7400  C  CB    . GLN F 3 247 ? 130.877 3.983   -43.186 1.00 27.80 ? 543  GLN D CB    1 
ATOM   7401  C  CG    . GLN F 3 247 ? 131.710 3.816   -44.446 1.00 31.95 ? 543  GLN D CG    1 
ATOM   7402  C  CD    . GLN F 3 247 ? 131.711 5.059   -45.314 1.00 35.53 ? 543  GLN D CD    1 
ATOM   7403  O  OE1   . GLN F 3 247 ? 132.129 6.133   -44.882 1.00 37.99 ? 543  GLN D OE1   1 
ATOM   7404  N  NE2   . GLN F 3 247 ? 131.243 4.919   -46.549 1.00 38.18 ? 543  GLN D NE2   1 
ATOM   7405  N  N     . LEU F 3 248 ? 129.507 2.012   -40.383 1.00 21.79 ? 544  LEU D N     1 
ATOM   7406  C  CA    . LEU F 3 248 ? 128.808 2.234   -39.122 1.00 19.79 ? 544  LEU D CA    1 
ATOM   7407  C  C     . LEU F 3 248 ? 129.842 2.524   -38.038 1.00 18.98 ? 544  LEU D C     1 
ATOM   7408  O  O     . LEU F 3 248 ? 130.992 2.105   -38.139 1.00 19.60 ? 544  LEU D O     1 
ATOM   7409  C  CB    . LEU F 3 248 ? 127.983 1.001   -38.742 1.00 20.58 ? 544  LEU D CB    1 
ATOM   7410  C  CG    . LEU F 3 248 ? 126.851 0.622   -39.704 1.00 20.89 ? 544  LEU D CG    1 
ATOM   7411  C  CD1   . LEU F 3 248 ? 126.048 -0.532  -39.107 1.00 20.98 ? 544  LEU D CD1   1 
ATOM   7412  C  CD2   . LEU F 3 248 ? 125.944 1.814   -39.938 1.00 21.53 ? 544  LEU D CD2   1 
ATOM   7413  N  N     . PRO F 3 249 ? 129.448 3.249   -36.983 1.00 19.41 ? 545  PRO D N     1 
ATOM   7414  C  CA    . PRO F 3 249 ? 130.381 3.572   -35.899 1.00 20.52 ? 545  PRO D CA    1 
ATOM   7415  C  C     . PRO F 3 249 ? 130.965 2.335   -35.216 1.00 20.49 ? 545  PRO D C     1 
ATOM   7416  O  O     . PRO F 3 249 ? 130.261 1.352   -34.998 1.00 19.72 ? 545  PRO D O     1 
ATOM   7417  C  CB    . PRO F 3 249 ? 129.538 4.416   -34.943 1.00 20.97 ? 545  PRO D CB    1 
ATOM   7418  C  CG    . PRO F 3 249 ? 128.478 5.007   -35.838 1.00 21.06 ? 545  PRO D CG    1 
ATOM   7419  C  CD    . PRO F 3 249 ? 128.128 3.851   -36.736 1.00 19.28 ? 545  PRO D CD    1 
ATOM   7420  N  N     . VAL F 3 250 ? 132.250 2.386   -34.885 1.00 20.23 ? 546  VAL D N     1 
ATOM   7421  C  CA    . VAL F 3 250 ? 132.895 1.275   -34.194 1.00 21.28 ? 546  VAL D CA    1 
ATOM   7422  C  C     . VAL F 3 250 ? 132.764 1.563   -32.698 1.00 22.62 ? 546  VAL D C     1 
ATOM   7423  O  O     . VAL F 3 250 ? 133.435 2.442   -32.162 1.00 22.41 ? 546  VAL D O     1 
ATOM   7424  C  CB    . VAL F 3 250 ? 134.387 1.163   -34.573 1.00 21.85 ? 546  VAL D CB    1 
ATOM   7425  C  CG1   . VAL F 3 250 ? 135.065 0.094   -33.721 1.00 22.17 ? 546  VAL D CG1   1 
ATOM   7426  C  CG2   . VAL F 3 250 ? 134.520 0.820   -36.057 1.00 20.05 ? 546  VAL D CG2   1 
ATOM   7427  N  N     . LEU F 3 251 ? 131.890 0.819   -32.031 1.00 21.93 ? 547  LEU D N     1 
ATOM   7428  C  CA    . LEU F 3 251 ? 131.649 1.019   -30.610 1.00 22.64 ? 547  LEU D CA    1 
ATOM   7429  C  C     . LEU F 3 251 ? 132.576 0.219   -29.711 1.00 23.62 ? 547  LEU D C     1 
ATOM   7430  O  O     . LEU F 3 251 ? 132.759 0.563   -28.545 1.00 24.27 ? 547  LEU D O     1 
ATOM   7431  C  CB    . LEU F 3 251 ? 130.197 0.675   -30.284 1.00 21.19 ? 547  LEU D CB    1 
ATOM   7432  C  CG    . LEU F 3 251 ? 129.170 1.436   -31.123 1.00 21.19 ? 547  LEU D CG    1 
ATOM   7433  C  CD1   . LEU F 3 251 ? 127.767 0.972   -30.761 1.00 21.35 ? 547  LEU D CD1   1 
ATOM   7434  C  CD2   . LEU F 3 251 ? 129.330 2.936   -30.893 1.00 21.15 ? 547  LEU D CD2   1 
ATOM   7435  N  N     . LYS F 3 252 ? 133.160 -0.846  -30.247 1.00 23.82 ? 548  LYS D N     1 
ATOM   7436  C  CA    . LYS F 3 252 ? 134.057 -1.676  -29.456 1.00 25.76 ? 548  LYS D CA    1 
ATOM   7437  C  C     . LYS F 3 252 ? 134.908 -2.605  -30.306 1.00 25.46 ? 548  LYS D C     1 
ATOM   7438  O  O     . LYS F 3 252 ? 134.514 -3.004  -31.403 1.00 23.46 ? 548  LYS D O     1 
ATOM   7439  C  CB    . LYS F 3 252 ? 133.256 -2.502  -28.443 1.00 26.83 ? 548  LYS D CB    1 
ATOM   7440  C  CG    . LYS F 3 252 ? 134.114 -3.448  -27.605 1.00 31.45 ? 548  LYS D CG    1 
ATOM   7441  C  CD    . LYS F 3 252 ? 133.347 -4.009  -26.419 1.00 34.69 ? 548  LYS D CD    1 
ATOM   7442  C  CE    . LYS F 3 252 ? 132.171 -4.856  -26.861 1.00 37.36 ? 548  LYS D CE    1 
ATOM   7443  N  NZ    . LYS F 3 252 ? 132.611 -6.068  -27.606 1.00 40.54 ? 548  LYS D NZ    1 
ATOM   7444  N  N     . LYS F 3 253 ? 136.080 -2.943  -29.784 1.00 25.78 ? 549  LYS D N     1 
ATOM   7445  C  CA    . LYS F 3 253 ? 136.997 -3.839  -30.470 1.00 27.63 ? 549  LYS D CA    1 
ATOM   7446  C  C     . LYS F 3 253 ? 137.477 -4.928  -29.521 1.00 27.94 ? 549  LYS D C     1 
ATOM   7447  O  O     . LYS F 3 253 ? 137.525 -4.733  -28.307 1.00 27.42 ? 549  LYS D O     1 
ATOM   7448  C  CB    . LYS F 3 253 ? 138.218 -3.072  -30.989 1.00 29.56 ? 549  LYS D CB    1 
ATOM   7449  C  CG    . LYS F 3 253 ? 137.940 -2.070  -32.097 1.00 31.09 ? 549  LYS D CG    1 
ATOM   7450  C  CD    . LYS F 3 253 ? 139.250 -1.498  -32.631 1.00 34.27 ? 549  LYS D CD    1 
ATOM   7451  C  CE    . LYS F 3 253 ? 139.020 -0.589  -33.829 1.00 36.71 ? 549  LYS D CE    1 
ATOM   7452  N  NZ    . LYS F 3 253 ? 140.308 -0.085  -34.399 1.00 37.57 ? 549  LYS D NZ    1 
ATOM   7453  N  N     . THR F 3 254 ? 137.827 -6.077  -30.086 1.00 27.02 ? 550  THR D N     1 
ATOM   7454  C  CA    . THR F 3 254 ? 138.355 -7.187  -29.305 1.00 27.99 ? 550  THR D CA    1 
ATOM   7455  C  C     . THR F 3 254 ? 139.784 -7.333  -29.805 1.00 28.79 ? 550  THR D C     1 
ATOM   7456  O  O     . THR F 3 254 ? 140.196 -6.607  -30.709 1.00 28.08 ? 550  THR D O     1 
ATOM   7457  C  CB    . THR F 3 254 ? 137.578 -8.497  -29.563 1.00 27.94 ? 550  THR D CB    1 
ATOM   7458  O  OG1   . THR F 3 254 ? 137.603 -8.803  -30.961 1.00 28.28 ? 550  THR D OG1   1 
ATOM   7459  C  CG2   . THR F 3 254 ? 136.133 -8.357  -29.105 1.00 27.59 ? 550  THR D CG2   1 
ATOM   7460  N  N     . LYS F 3 255 ? 140.543 -8.262  -29.235 1.00 29.72 ? 551  LYS D N     1 
ATOM   7461  C  CA    . LYS F 3 255 ? 141.921 -8.439  -29.666 1.00 30.10 ? 551  LYS D CA    1 
ATOM   7462  C  C     . LYS F 3 255 ? 142.031 -8.943  -31.107 1.00 29.53 ? 551  LYS D C     1 
ATOM   7463  O  O     . LYS F 3 255 ? 143.099 -8.855  -31.710 1.00 29.25 ? 551  LYS D O     1 
ATOM   7464  C  CB    . LYS F 3 255 ? 142.657 -9.393  -28.721 1.00 32.76 ? 551  LYS D CB    1 
ATOM   7465  C  CG    . LYS F 3 255 ? 142.188 -10.832 -28.779 1.00 33.72 ? 551  LYS D CG    1 
ATOM   7466  C  CD    . LYS F 3 255 ? 143.007 -11.686 -27.829 1.00 36.35 ? 551  LYS D CD    1 
ATOM   7467  C  CE    . LYS F 3 255 ? 142.688 -13.166 -27.982 1.00 36.41 ? 551  LYS D CE    1 
ATOM   7468  N  NZ    . LYS F 3 255 ? 143.538 -13.973 -27.065 1.00 37.38 ? 551  LYS D NZ    1 
ATOM   7469  N  N     . THR F 3 256 ? 140.938 -9.465  -31.663 1.00 27.80 ? 552  THR D N     1 
ATOM   7470  C  CA    . THR F 3 256 ? 140.973 -9.958  -33.040 1.00 27.29 ? 552  THR D CA    1 
ATOM   7471  C  C     . THR F 3 256 ? 140.407 -8.964  -34.049 1.00 25.94 ? 552  THR D C     1 
ATOM   7472  O  O     . THR F 3 256 ? 140.639 -9.105  -35.247 1.00 27.10 ? 552  THR D O     1 
ATOM   7473  C  CB    . THR F 3 256 ? 140.207 -11.299 -33.208 1.00 28.37 ? 552  THR D CB    1 
ATOM   7474  O  OG1   . THR F 3 256 ? 138.823 -11.111 -32.894 1.00 27.46 ? 552  THR D OG1   1 
ATOM   7475  C  CG2   . THR F 3 256 ? 140.798 -12.369 -32.301 1.00 28.80 ? 552  THR D CG2   1 
ATOM   7476  N  N     . GLY F 3 257 ? 139.667 -7.965  -33.576 1.00 24.29 ? 553  GLY D N     1 
ATOM   7477  C  CA    . GLY F 3 257 ? 139.108 -6.979  -34.488 1.00 24.20 ? 553  GLY D CA    1 
ATOM   7478  C  C     . GLY F 3 257 ? 137.870 -6.256  -33.985 1.00 24.04 ? 553  GLY D C     1 
ATOM   7479  O  O     . GLY F 3 257 ? 137.697 -6.075  -32.780 1.00 23.39 ? 553  GLY D O     1 
ATOM   7480  N  N     . TYR F 3 258 ? 137.010 -5.838  -34.914 1.00 22.95 ? 554  TYR D N     1 
ATOM   7481  C  CA    . TYR F 3 258 ? 135.776 -5.137  -34.563 1.00 23.13 ? 554  TYR D CA    1 
ATOM   7482  C  C     . TYR F 3 258 ? 134.815 -6.090  -33.864 1.00 22.23 ? 554  TYR D C     1 
ATOM   7483  O  O     . TYR F 3 258 ? 134.676 -7.243  -34.264 1.00 22.52 ? 554  TYR D O     1 
ATOM   7484  C  CB    . TYR F 3 258 ? 135.050 -4.610  -35.803 1.00 23.52 ? 554  TYR D CB    1 
ATOM   7485  C  CG    . TYR F 3 258 ? 135.885 -3.857  -36.806 1.00 26.81 ? 554  TYR D CG    1 
ATOM   7486  C  CD1   . TYR F 3 258 ? 136.090 -4.371  -38.085 1.00 26.54 ? 554  TYR D CD1   1 
ATOM   7487  C  CD2   . TYR F 3 258 ? 136.422 -2.605  -36.503 1.00 26.90 ? 554  TYR D CD2   1 
ATOM   7488  C  CE1   . TYR F 3 258 ? 136.804 -3.660  -39.041 1.00 28.46 ? 554  TYR D CE1   1 
ATOM   7489  C  CE2   . TYR F 3 258 ? 137.141 -1.885  -37.454 1.00 28.15 ? 554  TYR D CE2   1 
ATOM   7490  C  CZ    . TYR F 3 258 ? 137.327 -2.418  -38.719 1.00 28.44 ? 554  TYR D CZ    1 
ATOM   7491  O  OH    . TYR F 3 258 ? 138.032 -1.714  -39.667 1.00 30.80 ? 554  TYR D OH    1 
ATOM   7492  N  N     . SER F 3 259 ? 134.134 -5.606  -32.835 1.00 21.18 ? 555  SER D N     1 
ATOM   7493  C  CA    . SER F 3 259 ? 133.172 -6.442  -32.137 1.00 20.36 ? 555  SER D CA    1 
ATOM   7494  C  C     . SER F 3 259 ? 131.828 -6.374  -32.860 1.00 20.09 ? 555  SER D C     1 
ATOM   7495  O  O     . SER F 3 259 ? 131.401 -5.299  -33.295 1.00 17.95 ? 555  SER D O     1 
ATOM   7496  C  CB    . SER F 3 259 ? 132.997 -5.967  -30.693 1.00 21.50 ? 555  SER D CB    1 
ATOM   7497  O  OG    . SER F 3 259 ? 131.976 -6.708  -30.036 1.00 22.14 ? 555  SER D OG    1 
ATOM   7498  N  N     . THR F 3 260 ? 131.171 -7.523  -33.002 1.00 18.88 ? 556  THR D N     1 
ATOM   7499  C  CA    . THR F 3 260 ? 129.854 -7.574  -33.630 1.00 18.62 ? 556  THR D CA    1 
ATOM   7500  C  C     . THR F 3 260 ? 128.923 -8.273  -32.646 1.00 18.87 ? 556  THR D C     1 
ATOM   7501  O  O     . THR F 3 260 ? 127.965 -8.939  -33.039 1.00 17.94 ? 556  THR D O     1 
ATOM   7502  C  CB    . THR F 3 260 ? 129.854 -8.358  -34.978 1.00 20.21 ? 556  THR D CB    1 
ATOM   7503  O  OG1   . THR F 3 260 ? 130.155 -9.741  -34.743 1.00 18.07 ? 556  THR D OG1   1 
ATOM   7504  C  CG2   . THR F 3 260 ? 130.882 -7.769  -35.938 1.00 19.69 ? 556  THR D CG2   1 
ATOM   7505  N  N     . SER F 3 261 ? 129.218 -8.108  -31.359 1.00 19.29 ? 557  SER D N     1 
ATOM   7506  C  CA    . SER F 3 261 ? 128.420 -8.717  -30.299 1.00 20.28 ? 557  SER D CA    1 
ATOM   7507  C  C     . SER F 3 261 ? 126.988 -8.186  -30.311 1.00 20.17 ? 557  SER D C     1 
ATOM   7508  O  O     . SER F 3 261 ? 126.730 -7.089  -30.805 1.00 18.80 ? 557  SER D O     1 
ATOM   7509  C  CB    . SER F 3 261 ? 129.053 -8.434  -28.936 1.00 20.16 ? 557  SER D CB    1 
ATOM   7510  O  OG    . SER F 3 261 ? 129.014 -7.046  -28.636 1.00 23.17 ? 557  SER D OG    1 
ATOM   7511  N  N     . ALA F 3 262 ? 126.063 -8.965  -29.753 1.00 19.02 ? 558  ALA D N     1 
ATOM   7512  C  CA    . ALA F 3 262 ? 124.661 -8.566  -29.703 1.00 20.66 ? 558  ALA D CA    1 
ATOM   7513  C  C     . ALA F 3 262 ? 124.489 -7.192  -29.053 1.00 21.48 ? 558  ALA D C     1 
ATOM   7514  O  O     . ALA F 3 262 ? 123.720 -6.367  -29.542 1.00 20.81 ? 558  ALA D O     1 
ATOM   7515  C  CB    . ALA F 3 262 ? 123.843 -9.612  -28.945 1.00 18.99 ? 558  ALA D CB    1 
ATOM   7516  N  N     . ASP F 3 263 ? 125.200 -6.944  -27.954 1.00 23.13 ? 559  ASP D N     1 
ATOM   7517  C  CA    . ASP F 3 263 ? 125.096 -5.655  -27.274 1.00 24.74 ? 559  ASP D CA    1 
ATOM   7518  C  C     . ASP F 3 263 ? 125.478 -4.514  -28.210 1.00 24.69 ? 559  ASP D C     1 
ATOM   7519  O  O     . ASP F 3 263 ? 124.807 -3.480  -28.246 1.00 24.70 ? 559  ASP D O     1 
ATOM   7520  C  CB    . ASP F 3 263 ? 125.987 -5.614  -26.028 1.00 29.53 ? 559  ASP D CB    1 
ATOM   7521  C  CG    . ASP F 3 263 ? 125.469 -6.501  -24.905 1.00 33.77 ? 559  ASP D CG    1 
ATOM   7522  O  OD1   . ASP F 3 263 ? 124.237 -6.714  -24.828 1.00 37.06 ? 559  ASP D OD1   1 
ATOM   7523  O  OD2   . ASP F 3 263 ? 126.293 -6.978  -24.093 1.00 37.34 ? 559  ASP D OD2   1 
ATOM   7524  N  N     . VAL F 3 264 ? 126.553 -4.706  -28.970 1.00 22.97 ? 560  VAL D N     1 
ATOM   7525  C  CA    . VAL F 3 264 ? 127.008 -3.691  -29.914 1.00 22.61 ? 560  VAL D CA    1 
ATOM   7526  C  C     . VAL F 3 264 ? 126.007 -3.495  -31.049 1.00 22.15 ? 560  VAL D C     1 
ATOM   7527  O  O     . VAL F 3 264 ? 125.632 -2.365  -31.371 1.00 22.04 ? 560  VAL D O     1 
ATOM   7528  C  CB    . VAL F 3 264 ? 128.384 -4.065  -30.522 1.00 22.29 ? 560  VAL D CB    1 
ATOM   7529  C  CG1   . VAL F 3 264 ? 128.694 -3.175  -31.731 1.00 21.38 ? 560  VAL D CG1   1 
ATOM   7530  C  CG2   . VAL F 3 264 ? 129.467 -3.908  -29.472 1.00 23.70 ? 560  VAL D CG2   1 
ATOM   7531  N  N     . LEU F 3 265 ? 125.571 -4.591  -31.660 1.00 21.11 ? 561  LEU D N     1 
ATOM   7532  C  CA    . LEU F 3 265 ? 124.628 -4.479  -32.763 1.00 21.10 ? 561  LEU D CA    1 
ATOM   7533  C  C     . LEU F 3 265 ? 123.328 -3.799  -32.365 1.00 21.19 ? 561  LEU D C     1 
ATOM   7534  O  O     . LEU F 3 265 ? 122.756 -3.043  -33.149 1.00 20.29 ? 561  LEU D O     1 
ATOM   7535  C  CB    . LEU F 3 265 ? 124.332 -5.855  -33.371 1.00 23.22 ? 561  LEU D CB    1 
ATOM   7536  C  CG    . LEU F 3 265 ? 125.500 -6.547  -34.083 1.00 24.82 ? 561  LEU D CG    1 
ATOM   7537  C  CD1   . LEU F 3 265 ? 124.950 -7.619  -35.020 1.00 25.09 ? 561  LEU D CD1   1 
ATOM   7538  C  CD2   . LEU F 3 265 ? 126.311 -5.537  -34.876 1.00 23.85 ? 561  LEU D CD2   1 
ATOM   7539  N  N     . GLU F 3 266 ? 122.862 -4.052  -31.147 1.00 21.06 ? 562  GLU D N     1 
ATOM   7540  C  CA    . GLU F 3 266 ? 121.622 -3.433  -30.695 1.00 22.17 ? 562  GLU D CA    1 
ATOM   7541  C  C     . GLU F 3 266 ? 121.780 -1.913  -30.609 1.00 20.70 ? 562  GLU D C     1 
ATOM   7542  O  O     . GLU F 3 266 ? 120.827 -1.173  -30.834 1.00 20.72 ? 562  GLU D O     1 
ATOM   7543  C  CB    . GLU F 3 266 ? 121.211 -3.999  -29.334 1.00 24.49 ? 562  GLU D CB    1 
ATOM   7544  C  CG    . GLU F 3 266 ? 121.030 -5.508  -29.333 1.00 29.15 ? 562  GLU D CG    1 
ATOM   7545  C  CD    . GLU F 3 266 ? 120.671 -6.055  -27.965 1.00 32.89 ? 562  GLU D CD    1 
ATOM   7546  O  OE1   . GLU F 3 266 ? 120.987 -5.389  -26.954 1.00 33.83 ? 562  GLU D OE1   1 
ATOM   7547  O  OE2   . GLU F 3 266 ? 120.080 -7.155  -27.903 1.00 35.31 ? 562  GLU D OE2   1 
ATOM   7548  N  N     . LYS F 3 267 ? 122.986 -1.452  -30.295 1.00 20.32 ? 563  LYS D N     1 
ATOM   7549  C  CA    . LYS F 3 267 ? 123.237 -0.015  -30.191 1.00 21.94 ? 563  LYS D CA    1 
ATOM   7550  C  C     . LYS F 3 267 ? 123.331 0.641   -31.570 1.00 22.22 ? 563  LYS D C     1 
ATOM   7551  O  O     . LYS F 3 267 ? 123.148 1.848   -31.702 1.00 21.63 ? 563  LYS D O     1 
ATOM   7552  C  CB    . LYS F 3 267 ? 124.530 0.252   -29.411 1.00 22.29 ? 563  LYS D CB    1 
ATOM   7553  C  CG    . LYS F 3 267 ? 124.502 -0.222  -27.958 1.00 23.86 ? 563  LYS D CG    1 
ATOM   7554  C  CD    . LYS F 3 267 ? 125.837 0.031   -27.274 1.00 26.69 ? 563  LYS D CD    1 
ATOM   7555  C  CE    . LYS F 3 267 ? 125.862 -0.534  -25.860 1.00 28.38 ? 563  LYS D CE    1 
ATOM   7556  N  NZ    . LYS F 3 267 ? 124.781 0.043   -25.019 1.00 30.19 ? 563  LYS D NZ    1 
ATOM   7557  N  N     . LEU F 3 268 ? 123.610 -0.159  -32.593 1.00 21.22 ? 564  LEU D N     1 
ATOM   7558  C  CA    . LEU F 3 268 ? 123.730 0.360   -33.949 1.00 22.08 ? 564  LEU D CA    1 
ATOM   7559  C  C     . LEU F 3 268 ? 122.406 0.340   -34.698 1.00 21.71 ? 564  LEU D C     1 
ATOM   7560  O  O     . LEU F 3 268 ? 122.334 0.772   -35.852 1.00 21.96 ? 564  LEU D O     1 
ATOM   7561  C  CB    . LEU F 3 268 ? 124.761 -0.458  -34.731 1.00 21.89 ? 564  LEU D CB    1 
ATOM   7562  C  CG    . LEU F 3 268 ? 126.185 -0.461  -34.182 1.00 21.23 ? 564  LEU D CG    1 
ATOM   7563  C  CD1   . LEU F 3 268 ? 127.031 -1.396  -35.023 1.00 19.32 ? 564  LEU D CD1   1 
ATOM   7564  C  CD2   . LEU F 3 268 ? 126.758 0.954   -34.199 1.00 22.41 ? 564  LEU D CD2   1 
ATOM   7565  N  N     . ALA F 3 269 ? 121.359 -0.156  -34.045 1.00 21.15 ? 565  ALA D N     1 
ATOM   7566  C  CA    . ALA F 3 269 ? 120.040 -0.245  -34.671 1.00 22.08 ? 565  ALA D CA    1 
ATOM   7567  C  C     . ALA F 3 269 ? 119.524 1.072   -35.258 1.00 23.14 ? 565  ALA D C     1 
ATOM   7568  O  O     . ALA F 3 269 ? 118.815 1.074   -36.270 1.00 24.20 ? 565  ALA D O     1 
ATOM   7569  C  CB    . ALA F 3 269 ? 119.026 -0.803  -33.673 1.00 22.30 ? 565  ALA D CB    1 
ATOM   7570  N  N     . PRO F 3 270 ? 119.861 2.210   -34.633 1.00 22.84 ? 566  PRO D N     1 
ATOM   7571  C  CA    . PRO F 3 270 ? 119.376 3.481   -35.183 1.00 23.64 ? 566  PRO D CA    1 
ATOM   7572  C  C     . PRO F 3 270 ? 120.092 3.896   -36.471 1.00 24.43 ? 566  PRO D C     1 
ATOM   7573  O  O     . PRO F 3 270 ? 119.635 4.790   -37.180 1.00 26.78 ? 566  PRO D O     1 
ATOM   7574  C  CB    . PRO F 3 270 ? 119.603 4.471   -34.041 1.00 24.57 ? 566  PRO D CB    1 
ATOM   7575  C  CG    . PRO F 3 270 ? 119.586 3.596   -32.805 1.00 23.50 ? 566  PRO D CG    1 
ATOM   7576  C  CD    . PRO F 3 270 ? 120.375 2.401   -33.266 1.00 23.11 ? 566  PRO D CD    1 
ATOM   7577  N  N     . TYR F 3 271 ? 121.209 3.242   -36.771 1.00 24.81 ? 567  TYR D N     1 
ATOM   7578  C  CA    . TYR F 3 271 ? 121.986 3.578   -37.958 1.00 24.57 ? 567  TYR D CA    1 
ATOM   7579  C  C     . TYR F 3 271 ? 121.623 2.806   -39.217 1.00 24.80 ? 567  TYR D C     1 
ATOM   7580  O  O     . TYR F 3 271 ? 121.561 3.378   -40.305 1.00 22.84 ? 567  TYR D O     1 
ATOM   7581  C  CB    . TYR F 3 271 ? 123.481 3.391   -37.683 1.00 24.50 ? 567  TYR D CB    1 
ATOM   7582  C  CG    . TYR F 3 271 ? 124.031 4.290   -36.603 1.00 27.30 ? 567  TYR D CG    1 
ATOM   7583  C  CD1   . TYR F 3 271 ? 123.870 3.975   -35.255 1.00 27.55 ? 567  TYR D CD1   1 
ATOM   7584  C  CD2   . TYR F 3 271 ? 124.711 5.465   -36.929 1.00 27.73 ? 567  TYR D CD2   1 
ATOM   7585  C  CE1   . TYR F 3 271 ? 124.376 4.807   -34.257 1.00 27.67 ? 567  TYR D CE1   1 
ATOM   7586  C  CE2   . TYR F 3 271 ? 125.218 6.303   -35.942 1.00 26.64 ? 567  TYR D CE2   1 
ATOM   7587  C  CZ    . TYR F 3 271 ? 125.048 5.968   -34.609 1.00 27.89 ? 567  TYR D CZ    1 
ATOM   7588  O  OH    . TYR F 3 271 ? 125.553 6.792   -33.630 1.00 28.06 ? 567  TYR D OH    1 
ATOM   7589  N  N     . HIS F 3 272 ? 121.383 1.509   -39.073 1.00 25.28 ? 568  HIS D N     1 
ATOM   7590  C  CA    . HIS F 3 272 ? 121.066 0.683   -40.225 1.00 26.15 ? 568  HIS D CA    1 
ATOM   7591  C  C     . HIS F 3 272 ? 120.125 -0.459  -39.861 1.00 27.55 ? 568  HIS D C     1 
ATOM   7592  O  O     . HIS F 3 272 ? 120.260 -1.088  -38.814 1.00 27.13 ? 568  HIS D O     1 
ATOM   7593  C  CB    . HIS F 3 272 ? 122.363 0.129   -40.818 1.00 24.85 ? 568  HIS D CB    1 
ATOM   7594  C  CG    . HIS F 3 272 ? 122.283 -0.166  -42.282 1.00 24.63 ? 568  HIS D CG    1 
ATOM   7595  N  ND1   . HIS F 3 272 ? 121.442 -1.124  -42.804 1.00 22.76 ? 568  HIS D ND1   1 
ATOM   7596  C  CD2   . HIS F 3 272 ? 122.927 0.386   -43.338 1.00 24.23 ? 568  HIS D CD2   1 
ATOM   7597  C  CE1   . HIS F 3 272 ? 121.569 -1.149  -44.119 1.00 24.56 ? 568  HIS D CE1   1 
ATOM   7598  N  NE2   . HIS F 3 272 ? 122.464 -0.241  -44.470 1.00 23.60 ? 568  HIS D NE2   1 
ATOM   7599  N  N     . GLU F 3 273 ? 119.170 -0.711  -40.746 1.00 29.02 ? 569  GLU D N     1 
ATOM   7600  C  CA    . GLU F 3 273 ? 118.175 -1.759  -40.574 1.00 30.22 ? 569  GLU D CA    1 
ATOM   7601  C  C     . GLU F 3 273 ? 118.772 -3.167  -40.661 1.00 29.45 ? 569  GLU D C     1 
ATOM   7602  O  O     . GLU F 3 273 ? 118.169 -4.139  -40.204 1.00 30.58 ? 569  GLU D O     1 
ATOM   7603  C  CB    . GLU F 3 273 ? 117.094 -1.575  -41.642 1.00 32.24 ? 569  GLU D CB    1 
ATOM   7604  C  CG    . GLU F 3 273 ? 116.217 -2.772  -41.890 1.00 37.00 ? 569  GLU D CG    1 
ATOM   7605  C  CD    . GLU F 3 273 ? 115.157 -2.485  -42.925 1.00 38.44 ? 569  GLU D CD    1 
ATOM   7606  O  OE1   . GLU F 3 273 ? 115.515 -2.034  -44.035 1.00 41.64 ? 569  GLU D OE1   1 
ATOM   7607  O  OE2   . GLU F 3 273 ? 113.967 -2.710  -42.630 1.00 40.18 ? 569  GLU D OE2   1 
ATOM   7608  N  N     . ILE F 3 274 ? 119.963 -3.273  -41.235 1.00 26.62 ? 570  ILE D N     1 
ATOM   7609  C  CA    . ILE F 3 274 ? 120.609 -4.567  -41.393 1.00 24.27 ? 570  ILE D CA    1 
ATOM   7610  C  C     . ILE F 3 274 ? 121.020 -5.236  -40.074 1.00 23.66 ? 570  ILE D C     1 
ATOM   7611  O  O     . ILE F 3 274 ? 121.078 -6.464  -39.998 1.00 23.70 ? 570  ILE D O     1 
ATOM   7612  C  CB    . ILE F 3 274 ? 121.851 -4.449  -42.308 1.00 22.86 ? 570  ILE D CB    1 
ATOM   7613  C  CG1   . ILE F 3 274 ? 122.299 -5.841  -42.759 1.00 22.83 ? 570  ILE D CG1   1 
ATOM   7614  C  CG2   . ILE F 3 274 ? 122.981 -3.736  -41.571 1.00 22.95 ? 570  ILE D CG2   1 
ATOM   7615  C  CD1   . ILE F 3 274 ? 123.492 -5.833  -43.689 1.00 22.42 ? 570  ILE D CD1   1 
ATOM   7616  N  N     . VAL F 3 275 ? 121.293 -4.442  -39.040 1.00 21.52 ? 571  VAL D N     1 
ATOM   7617  C  CA    . VAL F 3 275 ? 121.713 -5.001  -37.758 1.00 21.57 ? 571  VAL D CA    1 
ATOM   7618  C  C     . VAL F 3 275 ? 120.655 -5.861  -37.067 1.00 21.45 ? 571  VAL D C     1 
ATOM   7619  O  O     . VAL F 3 275 ? 120.984 -6.886  -36.475 1.00 22.35 ? 571  VAL D O     1 
ATOM   7620  C  CB    . VAL F 3 275 ? 122.176 -3.899  -36.773 1.00 21.97 ? 571  VAL D CB    1 
ATOM   7621  C  CG1   . VAL F 3 275 ? 123.383 -3.168  -37.345 1.00 22.39 ? 571  VAL D CG1   1 
ATOM   7622  C  CG2   . VAL F 3 275 ? 121.043 -2.932  -36.494 1.00 23.87 ? 571  VAL D CG2   1 
ATOM   7623  N  N     . GLU F 3 276 ? 119.391 -5.455  -37.132 1.00 21.02 ? 572  GLU D N     1 
ATOM   7624  C  CA    . GLU F 3 276 ? 118.339 -6.245  -36.502 1.00 21.74 ? 572  GLU D CA    1 
ATOM   7625  C  C     . GLU F 3 276 ? 118.132 -7.553  -37.262 1.00 21.19 ? 572  GLU D C     1 
ATOM   7626  O  O     . GLU F 3 276 ? 117.820 -8.587  -36.667 1.00 19.43 ? 572  GLU D O     1 
ATOM   7627  C  CB    . GLU F 3 276 ? 117.034 -5.442  -36.436 1.00 24.98 ? 572  GLU D CB    1 
ATOM   7628  C  CG    . GLU F 3 276 ? 117.073 -4.326  -35.396 1.00 31.07 ? 572  GLU D CG    1 
ATOM   7629  C  CD    . GLU F 3 276 ? 115.831 -3.451  -35.408 1.00 34.41 ? 572  GLU D CD    1 
ATOM   7630  O  OE1   . GLU F 3 276 ? 114.717 -3.979  -35.200 1.00 36.83 ? 572  GLU D OE1   1 
ATOM   7631  O  OE2   . GLU F 3 276 ? 115.972 -2.229  -35.624 1.00 34.94 ? 572  GLU D OE2   1 
ATOM   7632  N  N     . ASN F 3 277 ? 118.311 -7.508  -38.579 1.00 18.35 ? 573  ASN D N     1 
ATOM   7633  C  CA    . ASN F 3 277 ? 118.165 -8.706  -39.399 1.00 19.22 ? 573  ASN D CA    1 
ATOM   7634  C  C     . ASN F 3 277 ? 119.291 -9.681  -39.063 1.00 18.01 ? 573  ASN D C     1 
ATOM   7635  O  O     . ASN F 3 277 ? 119.074 -10.891 -38.975 1.00 15.83 ? 573  ASN D O     1 
ATOM   7636  C  CB    . ASN F 3 277 ? 118.208 -8.340  -40.884 1.00 20.87 ? 573  ASN D CB    1 
ATOM   7637  C  CG    . ASN F 3 277 ? 116.934 -7.661  -41.352 1.00 23.28 ? 573  ASN D CG    1 
ATOM   7638  O  OD1   . ASN F 3 277 ? 115.946 -8.322  -41.667 1.00 25.78 ? 573  ASN D OD1   1 
ATOM   7639  N  ND2   . ASN F 3 277 ? 116.945 -6.334  -41.380 1.00 23.42 ? 573  ASN D ND2   1 
ATOM   7640  N  N     . ILE F 3 278 ? 120.494 -9.150  -38.870 1.00 16.33 ? 574  ILE D N     1 
ATOM   7641  C  CA    . ILE F 3 278 ? 121.642 -9.982  -38.527 1.00 17.22 ? 574  ILE D CA    1 
ATOM   7642  C  C     . ILE F 3 278 ? 121.421 -10.676 -37.179 1.00 17.09 ? 574  ILE D C     1 
ATOM   7643  O  O     . ILE F 3 278 ? 121.697 -11.870 -37.031 1.00 15.38 ? 574  ILE D O     1 
ATOM   7644  C  CB    . ILE F 3 278 ? 122.932 -9.143  -38.471 1.00 17.97 ? 574  ILE D CB    1 
ATOM   7645  C  CG1   . ILE F 3 278 ? 123.301 -8.681  -39.887 1.00 20.01 ? 574  ILE D CG1   1 
ATOM   7646  C  CG2   . ILE F 3 278 ? 124.068 -9.964  -37.871 1.00 16.79 ? 574  ILE D CG2   1 
ATOM   7647  C  CD1   . ILE F 3 278 ? 124.351 -7.591  -39.923 1.00 21.98 ? 574  ILE D CD1   1 
ATOM   7648  N  N     . LEU F 3 279 ? 120.924 -9.926  -36.201 1.00 16.59 ? 575  LEU D N     1 
ATOM   7649  C  CA    . LEU F 3 279 ? 120.656 -10.492 -34.882 1.00 17.33 ? 575  LEU D CA    1 
ATOM   7650  C  C     . LEU F 3 279 ? 119.628 -11.615 -35.014 1.00 16.87 ? 575  LEU D C     1 
ATOM   7651  O  O     . LEU F 3 279 ? 119.784 -12.693 -34.432 1.00 15.56 ? 575  LEU D O     1 
ATOM   7652  C  CB    . LEU F 3 279 ? 120.130 -9.406  -33.933 1.00 18.00 ? 575  LEU D CB    1 
ATOM   7653  C  CG    . LEU F 3 279 ? 121.154 -8.376  -33.447 1.00 18.70 ? 575  LEU D CG    1 
ATOM   7654  C  CD1   . LEU F 3 279 ? 120.460 -7.302  -32.623 1.00 21.58 ? 575  LEU D CD1   1 
ATOM   7655  C  CD2   . LEU F 3 279 ? 122.226 -9.075  -32.617 1.00 20.58 ? 575  LEU D CD2   1 
ATOM   7656  N  N     . HIS F 3 280 ? 118.576 -11.361 -35.785 1.00 17.48 ? 576  HIS D N     1 
ATOM   7657  C  CA    . HIS F 3 280 ? 117.541 -12.366 -35.994 1.00 18.22 ? 576  HIS D CA    1 
ATOM   7658  C  C     . HIS F 3 280 ? 118.153 -13.608 -36.644 1.00 18.27 ? 576  HIS D C     1 
ATOM   7659  O  O     . HIS F 3 280 ? 117.912 -14.732 -36.206 1.00 17.63 ? 576  HIS D O     1 
ATOM   7660  C  CB    . HIS F 3 280 ? 116.427 -11.822 -36.888 1.00 19.01 ? 576  HIS D CB    1 
ATOM   7661  C  CG    . HIS F 3 280 ? 115.220 -12.707 -36.946 1.00 21.82 ? 576  HIS D CG    1 
ATOM   7662  N  ND1   . HIS F 3 280 ? 114.259 -12.596 -37.928 1.00 22.09 ? 576  HIS D ND1   1 
ATOM   7663  C  CD2   . HIS F 3 280 ? 114.814 -13.715 -36.136 1.00 22.25 ? 576  HIS D CD2   1 
ATOM   7664  C  CE1   . HIS F 3 280 ? 113.314 -13.496 -37.722 1.00 23.66 ? 576  HIS D CE1   1 
ATOM   7665  N  NE2   . HIS F 3 280 ? 113.626 -14.188 -36.640 1.00 23.15 ? 576  HIS D NE2   1 
ATOM   7666  N  N     . TYR F 3 281 ? 118.955 -13.398 -37.683 1.00 16.58 ? 577  TYR D N     1 
ATOM   7667  C  CA    . TYR F 3 281 ? 119.599 -14.504 -38.378 1.00 17.85 ? 577  TYR D CA    1 
ATOM   7668  C  C     . TYR F 3 281 ? 120.483 -15.371 -37.470 1.00 18.43 ? 577  TYR D C     1 
ATOM   7669  O  O     . TYR F 3 281 ? 120.369 -16.599 -37.481 1.00 17.47 ? 577  TYR D O     1 
ATOM   7670  C  CB    . TYR F 3 281 ? 120.449 -13.980 -39.541 1.00 18.81 ? 577  TYR D CB    1 
ATOM   7671  C  CG    . TYR F 3 281 ? 121.224 -15.069 -40.249 1.00 20.96 ? 577  TYR D CG    1 
ATOM   7672  C  CD1   . TYR F 3 281 ? 120.669 -15.770 -41.323 1.00 21.29 ? 577  TYR D CD1   1 
ATOM   7673  C  CD2   . TYR F 3 281 ? 122.506 -15.418 -39.826 1.00 21.38 ? 577  TYR D CD2   1 
ATOM   7674  C  CE1   . TYR F 3 281 ? 121.379 -16.796 -41.955 1.00 22.42 ? 577  TYR D CE1   1 
ATOM   7675  C  CE2   . TYR F 3 281 ? 123.218 -16.435 -40.443 1.00 22.43 ? 577  TYR D CE2   1 
ATOM   7676  C  CZ    . TYR F 3 281 ? 122.654 -17.121 -41.502 1.00 25.22 ? 577  TYR D CZ    1 
ATOM   7677  O  OH    . TYR F 3 281 ? 123.373 -18.139 -42.087 1.00 28.88 ? 577  TYR D OH    1 
ATOM   7678  N  N     . ARG F 3 282 ? 121.365 -14.747 -36.689 1.00 16.02 ? 578  ARG D N     1 
ATOM   7679  C  CA    . ARG F 3 282 ? 122.255 -15.522 -35.824 1.00 18.41 ? 578  ARG D CA    1 
ATOM   7680  C  C     . ARG F 3 282 ? 121.488 -16.258 -34.726 1.00 18.46 ? 578  ARG D C     1 
ATOM   7681  O  O     . ARG F 3 282 ? 121.957 -17.267 -34.192 1.00 18.84 ? 578  ARG D O     1 
ATOM   7682  C  CB    . ARG F 3 282 ? 123.354 -14.621 -35.242 1.00 17.49 ? 578  ARG D CB    1 
ATOM   7683  C  CG    . ARG F 3 282 ? 124.223 -13.992 -36.343 1.00 17.44 ? 578  ARG D CG    1 
ATOM   7684  C  CD    . ARG F 3 282 ? 125.522 -13.364 -35.841 1.00 19.39 ? 578  ARG D CD    1 
ATOM   7685  N  NE    . ARG F 3 282 ? 125.310 -12.358 -34.808 1.00 18.72 ? 578  ARG D NE    1 
ATOM   7686  C  CZ    . ARG F 3 282 ? 126.222 -11.462 -34.438 1.00 18.16 ? 578  ARG D CZ    1 
ATOM   7687  N  NH1   . ARG F 3 282 ? 127.417 -11.435 -35.022 1.00 17.52 ? 578  ARG D NH1   1 
ATOM   7688  N  NH2   . ARG F 3 282 ? 125.938 -10.596 -33.477 1.00 15.35 ? 578  ARG D NH2   1 
ATOM   7689  N  N     . GLN F 3 283 ? 120.300 -15.754 -34.415 1.00 18.06 ? 579  GLN D N     1 
ATOM   7690  C  CA    . GLN F 3 283 ? 119.424 -16.367 -33.426 1.00 21.72 ? 579  GLN D CA    1 
ATOM   7691  C  C     . GLN F 3 283 ? 118.907 -17.679 -34.032 1.00 20.68 ? 579  GLN D C     1 
ATOM   7692  O  O     . GLN F 3 283 ? 119.092 -18.757 -33.469 1.00 19.67 ? 579  GLN D O     1 
ATOM   7693  C  CB    . GLN F 3 283 ? 118.245 -15.436 -33.130 1.00 24.13 ? 579  GLN D CB    1 
ATOM   7694  C  CG    . GLN F 3 283 ? 117.330 -15.892 -31.999 1.00 31.01 ? 579  GLN D CG    1 
ATOM   7695  C  CD    . GLN F 3 283 ? 115.894 -15.425 -32.185 1.00 32.32 ? 579  GLN D CD    1 
ATOM   7696  O  OE1   . GLN F 3 283 ? 115.639 -14.385 -32.796 1.00 35.34 ? 579  GLN D OE1   1 
ATOM   7697  N  NE2   . GLN F 3 283 ? 114.949 -16.192 -31.651 1.00 33.10 ? 579  GLN D NE2   1 
ATOM   7698  N  N     . LEU F 3 284 ? 118.269 -17.578 -35.196 1.00 18.54 ? 580  LEU D N     1 
ATOM   7699  C  CA    . LEU F 3 284 ? 117.729 -18.750 -35.881 1.00 18.45 ? 580  LEU D CA    1 
ATOM   7700  C  C     . LEU F 3 284 ? 118.845 -19.724 -36.261 1.00 17.57 ? 580  LEU D C     1 
ATOM   7701  O  O     . LEU F 3 284 ? 118.657 -20.941 -36.239 1.00 17.81 ? 580  LEU D O     1 
ATOM   7702  C  CB    . LEU F 3 284 ? 116.961 -18.318 -37.138 1.00 19.77 ? 580  LEU D CB    1 
ATOM   7703  C  CG    . LEU F 3 284 ? 115.797 -17.344 -36.933 1.00 21.56 ? 580  LEU D CG    1 
ATOM   7704  C  CD1   . LEU F 3 284 ? 115.231 -16.937 -38.290 1.00 23.60 ? 580  LEU D CD1   1 
ATOM   7705  C  CD2   . LEU F 3 284 ? 114.718 -17.985 -36.074 1.00 22.85 ? 580  LEU D CD2   1 
ATOM   7706  N  N     . GLY F 3 285 ? 120.008 -19.187 -36.609 1.00 15.51 ? 581  GLY D N     1 
ATOM   7707  C  CA    . GLY F 3 285 ? 121.127 -20.037 -36.976 1.00 15.43 ? 581  GLY D CA    1 
ATOM   7708  C  C     . GLY F 3 285 ? 121.564 -20.924 -35.824 1.00 15.55 ? 581  GLY D C     1 
ATOM   7709  O  O     . GLY F 3 285 ? 121.913 -22.087 -36.023 1.00 15.89 ? 581  GLY D O     1 
ATOM   7710  N  N     . LYS F 3 286 ? 121.547 -20.371 -34.615 1.00 14.10 ? 582  LYS D N     1 
ATOM   7711  C  CA    . LYS F 3 286 ? 121.934 -21.114 -33.419 1.00 15.26 ? 582  LYS D CA    1 
ATOM   7712  C  C     . LYS F 3 286 ? 120.878 -22.176 -33.124 1.00 15.23 ? 582  LYS D C     1 
ATOM   7713  O  O     . LYS F 3 286 ? 121.197 -23.299 -32.728 1.00 16.07 ? 582  LYS D O     1 
ATOM   7714  C  CB    . LYS F 3 286 ? 122.064 -20.160 -32.228 1.00 16.86 ? 582  LYS D CB    1 
ATOM   7715  C  CG    . LYS F 3 286 ? 122.472 -20.832 -30.927 1.00 18.36 ? 582  LYS D CG    1 
ATOM   7716  C  CD    . LYS F 3 286 ? 123.849 -21.457 -31.024 1.00 20.41 ? 582  LYS D CD    1 
ATOM   7717  C  CE    . LYS F 3 286 ? 124.220 -22.126 -29.703 1.00 23.89 ? 582  LYS D CE    1 
ATOM   7718  N  NZ    . LYS F 3 286 ? 125.451 -22.935 -29.810 1.00 20.09 ? 582  LYS D NZ    1 
ATOM   7719  N  N     . LEU F 3 287 ? 119.615 -21.816 -33.317 1.00 14.07 ? 583  LEU D N     1 
ATOM   7720  C  CA    . LEU F 3 287 ? 118.531 -22.757 -33.093 1.00 14.67 ? 583  LEU D CA    1 
ATOM   7721  C  C     . LEU F 3 287 ? 118.690 -23.954 -34.033 1.00 15.15 ? 583  LEU D C     1 
ATOM   7722  O  O     . LEU F 3 287 ? 118.574 -25.105 -33.615 1.00 14.95 ? 583  LEU D O     1 
ATOM   7723  C  CB    . LEU F 3 287 ? 117.181 -22.072 -33.324 1.00 15.70 ? 583  LEU D CB    1 
ATOM   7724  C  CG    . LEU F 3 287 ? 116.818 -21.010 -32.282 1.00 15.43 ? 583  LEU D CG    1 
ATOM   7725  C  CD1   . LEU F 3 287 ? 115.465 -20.390 -32.609 1.00 15.86 ? 583  LEU D CD1   1 
ATOM   7726  C  CD2   . LEU F 3 287 ? 116.787 -21.658 -30.896 1.00 14.33 ? 583  LEU D CD2   1 
ATOM   7727  N  N     . GLN F 3 288 ? 118.984 -23.678 -35.299 1.00 14.79 ? 584  GLN D N     1 
ATOM   7728  C  CA    . GLN F 3 288 ? 119.156 -24.741 -36.287 1.00 15.05 ? 584  GLN D CA    1 
ATOM   7729  C  C     . GLN F 3 288 ? 120.365 -25.640 -36.035 1.00 13.86 ? 584  GLN D C     1 
ATOM   7730  O  O     . GLN F 3 288 ? 120.246 -26.866 -36.026 1.00 15.53 ? 584  GLN D O     1 
ATOM   7731  C  CB    . GLN F 3 288 ? 119.272 -24.145 -37.696 1.00 17.29 ? 584  GLN D CB    1 
ATOM   7732  C  CG    . GLN F 3 288 ? 119.722 -25.160 -38.753 1.00 23.15 ? 584  GLN D CG    1 
ATOM   7733  C  CD    . GLN F 3 288 ? 119.854 -24.559 -40.143 1.00 26.30 ? 584  GLN D CD    1 
ATOM   7734  O  OE1   . GLN F 3 288 ? 118.858 -24.340 -40.834 1.00 30.35 ? 584  GLN D OE1   1 
ATOM   7735  N  NE2   . GLN F 3 288 ? 121.088 -24.285 -40.557 1.00 26.98 ? 584  GLN D NE2   1 
ATOM   7736  N  N     . SER F 3 289 ? 121.529 -25.038 -35.827 1.00 13.65 ? 585  SER D N     1 
ATOM   7737  C  CA    . SER F 3 289 ? 122.747 -25.817 -35.630 1.00 14.59 ? 585  SER D CA    1 
ATOM   7738  C  C     . SER F 3 289 ? 122.811 -26.582 -34.318 1.00 13.80 ? 585  SER D C     1 
ATOM   7739  O  O     . SER F 3 289 ? 123.320 -27.703 -34.260 1.00 14.19 ? 585  SER D O     1 
ATOM   7740  C  CB    . SER F 3 289 ? 123.972 -24.905 -35.701 1.00 15.35 ? 585  SER D CB    1 
ATOM   7741  O  OG    . SER F 3 289 ? 124.092 -24.137 -34.509 1.00 17.59 ? 585  SER D OG    1 
ATOM   7742  N  N     . THR F 3 290 ? 122.285 -25.978 -33.266 1.00 13.97 ? 586  THR D N     1 
ATOM   7743  C  CA    . THR F 3 290 ? 122.372 -26.575 -31.944 1.00 13.65 ? 586  THR D CA    1 
ATOM   7744  C  C     . THR F 3 290 ? 121.144 -27.273 -31.379 1.00 13.55 ? 586  THR D C     1 
ATOM   7745  O  O     . THR F 3 290 ? 121.244 -28.382 -30.839 1.00 14.15 ? 586  THR D O     1 
ATOM   7746  C  CB    . THR F 3 290 ? 122.825 -25.498 -30.935 1.00 13.53 ? 586  THR D CB    1 
ATOM   7747  O  OG1   . THR F 3 290 ? 124.044 -24.902 -31.403 1.00 14.68 ? 586  THR D OG1   1 
ATOM   7748  C  CG2   . THR F 3 290 ? 123.051 -26.101 -29.558 1.00 13.75 ? 586  THR D CG2   1 
ATOM   7749  N  N     . TYR F 3 291 ? 119.986 -26.642 -31.496 1.00 12.00 ? 587  TYR D N     1 
ATOM   7750  C  CA    . TYR F 3 291 ? 118.790 -27.227 -30.915 1.00 13.13 ? 587  TYR D CA    1 
ATOM   7751  C  C     . TYR F 3 291 ? 117.930 -28.086 -31.830 1.00 14.01 ? 587  TYR D C     1 
ATOM   7752  O  O     . TYR F 3 291 ? 116.937 -28.675 -31.391 1.00 14.68 ? 587  TYR D O     1 
ATOM   7753  C  CB    . TYR F 3 291 ? 117.978 -26.123 -30.247 1.00 11.38 ? 587  TYR D CB    1 
ATOM   7754  C  CG    . TYR F 3 291 ? 118.811 -25.402 -29.208 1.00 13.56 ? 587  TYR D CG    1 
ATOM   7755  C  CD1   . TYR F 3 291 ? 119.341 -24.135 -29.457 1.00 11.15 ? 587  TYR D CD1   1 
ATOM   7756  C  CD2   . TYR F 3 291 ? 119.095 -26.005 -27.982 1.00 11.73 ? 587  TYR D CD2   1 
ATOM   7757  C  CE1   . TYR F 3 291 ? 120.139 -23.485 -28.506 1.00 12.25 ? 587  TYR D CE1   1 
ATOM   7758  C  CE2   . TYR F 3 291 ? 119.888 -25.367 -27.030 1.00 12.07 ? 587  TYR D CE2   1 
ATOM   7759  C  CZ    . TYR F 3 291 ? 120.406 -24.111 -27.295 1.00 11.20 ? 587  TYR D CZ    1 
ATOM   7760  O  OH    . TYR F 3 291 ? 121.188 -23.489 -26.343 1.00 10.82 ? 587  TYR D OH    1 
ATOM   7761  N  N     . ILE F 3 292 ? 118.316 -28.160 -33.096 1.00 13.60 ? 588  ILE D N     1 
ATOM   7762  C  CA    . ILE F 3 292 ? 117.610 -29.001 -34.054 1.00 15.27 ? 588  ILE D CA    1 
ATOM   7763  C  C     . ILE F 3 292 ? 118.615 -30.058 -34.497 1.00 15.66 ? 588  ILE D C     1 
ATOM   7764  O  O     . ILE F 3 292 ? 118.521 -31.222 -34.099 1.00 16.54 ? 588  ILE D O     1 
ATOM   7765  C  CB    . ILE F 3 292 ? 117.140 -28.224 -35.308 1.00 17.01 ? 588  ILE D CB    1 
ATOM   7766  C  CG1   . ILE F 3 292 ? 116.173 -27.104 -34.916 1.00 17.19 ? 588  ILE D CG1   1 
ATOM   7767  C  CG2   . ILE F 3 292 ? 116.467 -29.196 -36.291 1.00 16.47 ? 588  ILE D CG2   1 
ATOM   7768  C  CD1   . ILE F 3 292 ? 114.918 -27.576 -34.233 1.00 19.01 ? 588  ILE D CD1   1 
ATOM   7769  N  N     . GLU F 3 293 ? 119.590 -29.642 -35.300 1.00 16.46 ? 589  GLU D N     1 
ATOM   7770  C  CA    . GLU F 3 293 ? 120.610 -30.557 -35.804 1.00 18.55 ? 589  GLU D CA    1 
ATOM   7771  C  C     . GLU F 3 293 ? 121.448 -31.182 -34.695 1.00 18.74 ? 589  GLU D C     1 
ATOM   7772  O  O     . GLU F 3 293 ? 121.559 -32.406 -34.606 1.00 17.17 ? 589  GLU D O     1 
ATOM   7773  C  CB    . GLU F 3 293 ? 121.529 -29.834 -36.793 1.00 20.31 ? 589  GLU D CB    1 
ATOM   7774  C  CG    . GLU F 3 293 ? 120.894 -29.574 -38.148 1.00 25.20 ? 589  GLU D CG    1 
ATOM   7775  C  CD    . GLU F 3 293 ? 121.754 -28.695 -39.042 1.00 27.48 ? 589  GLU D CD    1 
ATOM   7776  O  OE1   . GLU F 3 293 ? 122.992 -28.690 -38.869 1.00 31.05 ? 589  GLU D OE1   1 
ATOM   7777  O  OE2   . GLU F 3 293 ? 121.193 -28.018 -39.925 1.00 29.43 ? 589  GLU D OE2   1 
ATOM   7778  N  N     . GLY F 3 294 ? 122.037 -30.338 -33.852 1.00 17.91 ? 590  GLY D N     1 
ATOM   7779  C  CA    . GLY F 3 294 ? 122.867 -30.832 -32.768 1.00 17.61 ? 590  GLY D CA    1 
ATOM   7780  C  C     . GLY F 3 294 ? 122.133 -31.769 -31.828 1.00 15.92 ? 590  GLY D C     1 
ATOM   7781  O  O     . GLY F 3 294 ? 122.694 -32.763 -31.367 1.00 17.05 ? 590  GLY D O     1 
ATOM   7782  N  N     . LEU F 3 295 ? 120.873 -31.454 -31.549 1.00 15.54 ? 591  LEU D N     1 
ATOM   7783  C  CA    . LEU F 3 295 ? 120.056 -32.267 -30.655 1.00 14.07 ? 591  LEU D CA    1 
ATOM   7784  C  C     . LEU F 3 295 ? 119.716 -33.615 -31.296 1.00 14.57 ? 591  LEU D C     1 
ATOM   7785  O  O     . LEU F 3 295 ? 119.818 -34.663 -30.654 1.00 14.81 ? 591  LEU D O     1 
ATOM   7786  C  CB    . LEU F 3 295 ? 118.774 -31.506 -30.303 1.00 16.64 ? 591  LEU D CB    1 
ATOM   7787  C  CG    . LEU F 3 295 ? 117.828 -32.111 -29.265 1.00 16.67 ? 591  LEU D CG    1 
ATOM   7788  C  CD1   . LEU F 3 295 ? 118.550 -32.265 -27.931 1.00 17.53 ? 591  LEU D CD1   1 
ATOM   7789  C  CD2   . LEU F 3 295 ? 116.615 -31.205 -29.108 1.00 16.82 ? 591  LEU D CD2   1 
ATOM   7790  N  N     . LEU F 3 296 ? 119.316 -33.595 -32.565 1.00 13.29 ? 592  LEU D N     1 
ATOM   7791  C  CA    . LEU F 3 296 ? 118.976 -34.838 -33.257 1.00 15.03 ? 592  LEU D CA    1 
ATOM   7792  C  C     . LEU F 3 296 ? 120.147 -35.809 -33.245 1.00 15.83 ? 592  LEU D C     1 
ATOM   7793  O  O     . LEU F 3 296 ? 119.967 -37.022 -33.126 1.00 18.05 ? 592  LEU D O     1 
ATOM   7794  C  CB    . LEU F 3 296 ? 118.570 -34.552 -34.706 1.00 15.19 ? 592  LEU D CB    1 
ATOM   7795  C  CG    . LEU F 3 296 ? 117.178 -33.957 -34.904 1.00 16.86 ? 592  LEU D CG    1 
ATOM   7796  C  CD1   . LEU F 3 296 ? 117.002 -33.501 -36.354 1.00 18.04 ? 592  LEU D CD1   1 
ATOM   7797  C  CD2   . LEU F 3 296 ? 116.127 -34.996 -34.528 1.00 17.34 ? 592  LEU D CD2   1 
ATOM   7798  N  N     . LYS F 3 297 ? 121.351 -35.264 -33.365 1.00 16.93 ? 593  LYS D N     1 
ATOM   7799  C  CA    . LYS F 3 297 ? 122.562 -36.065 -33.391 1.00 18.63 ? 593  LYS D CA    1 
ATOM   7800  C  C     . LYS F 3 297 ? 122.799 -36.890 -32.133 1.00 18.15 ? 593  LYS D C     1 
ATOM   7801  O  O     . LYS F 3 297 ? 123.447 -37.933 -32.196 1.00 17.52 ? 593  LYS D O     1 
ATOM   7802  C  CB    . LYS F 3 297 ? 123.769 -35.163 -33.645 1.00 21.59 ? 593  LYS D CB    1 
ATOM   7803  C  CG    . LYS F 3 297 ? 123.718 -34.455 -34.990 1.00 25.83 ? 593  LYS D CG    1 
ATOM   7804  C  CD    . LYS F 3 297 ? 124.846 -33.435 -35.152 1.00 31.01 ? 593  LYS D CD    1 
ATOM   7805  C  CE    . LYS F 3 297 ? 126.223 -34.087 -35.101 1.00 32.65 ? 593  LYS D CE    1 
ATOM   7806  N  NZ    . LYS F 3 297 ? 126.555 -34.617 -33.748 1.00 36.34 ? 593  LYS D NZ    1 
ATOM   7807  N  N     . VAL F 3 298 ? 122.281 -36.435 -30.994 1.00 16.34 ? 594  VAL D N     1 
ATOM   7808  C  CA    . VAL F 3 298 ? 122.483 -37.170 -29.752 1.00 15.70 ? 594  VAL D CA    1 
ATOM   7809  C  C     . VAL F 3 298 ? 121.268 -37.953 -29.279 1.00 14.82 ? 594  VAL D C     1 
ATOM   7810  O  O     . VAL F 3 298 ? 121.289 -38.551 -28.203 1.00 14.94 ? 594  VAL D O     1 
ATOM   7811  C  CB    . VAL F 3 298 ? 122.947 -36.241 -28.607 1.00 16.39 ? 594  VAL D CB    1 
ATOM   7812  C  CG1   . VAL F 3 298 ? 124.350 -35.728 -28.898 1.00 17.52 ? 594  VAL D CG1   1 
ATOM   7813  C  CG2   . VAL F 3 298 ? 121.975 -35.085 -28.446 1.00 15.52 ? 594  VAL D CG2   1 
ATOM   7814  N  N     . VAL F 3 299 ? 120.207 -37.950 -30.074 1.00 13.20 ? 595  VAL D N     1 
ATOM   7815  C  CA    . VAL F 3 299 ? 119.010 -38.698 -29.713 1.00 14.96 ? 595  VAL D CA    1 
ATOM   7816  C  C     . VAL F 3 299 ? 119.273 -40.174 -29.985 1.00 16.03 ? 595  VAL D C     1 
ATOM   7817  O  O     . VAL F 3 299 ? 119.730 -40.526 -31.074 1.00 16.37 ? 595  VAL D O     1 
ATOM   7818  C  CB    . VAL F 3 299 ? 117.785 -38.277 -30.561 1.00 16.08 ? 595  VAL D CB    1 
ATOM   7819  C  CG1   . VAL F 3 299 ? 116.618 -39.214 -30.273 1.00 19.20 ? 595  VAL D CG1   1 
ATOM   7820  C  CG2   . VAL F 3 299 ? 117.387 -36.829 -30.256 1.00 16.43 ? 595  VAL D CG2   1 
ATOM   7821  N  N     . ARG F 3 300 ? 119.001 -41.036 -29.010 1.00 15.80 ? 596  ARG D N     1 
ATOM   7822  C  CA    . ARG F 3 300 ? 119.182 -42.472 -29.227 1.00 16.93 ? 596  ARG D CA    1 
ATOM   7823  C  C     . ARG F 3 300 ? 117.961 -42.887 -30.052 1.00 16.71 ? 596  ARG D C     1 
ATOM   7824  O  O     . ARG F 3 300 ? 116.832 -42.840 -29.575 1.00 15.35 ? 596  ARG D O     1 
ATOM   7825  C  CB    . ARG F 3 300 ? 119.243 -43.215 -27.891 1.00 20.01 ? 596  ARG D CB    1 
ATOM   7826  C  CG    . ARG F 3 300 ? 120.419 -42.761 -27.033 1.00 25.14 ? 596  ARG D CG    1 
ATOM   7827  C  CD    . ARG F 3 300 ? 120.680 -43.690 -25.856 1.00 29.28 ? 596  ARG D CD    1 
ATOM   7828  N  NE    . ARG F 3 300 ? 121.205 -44.991 -26.272 1.00 32.95 ? 596  ARG D NE    1 
ATOM   7829  C  CZ    . ARG F 3 300 ? 120.479 -46.099 -26.399 1.00 33.55 ? 596  ARG D CZ    1 
ATOM   7830  N  NH1   . ARG F 3 300 ? 119.175 -46.088 -26.143 1.00 31.56 ? 596  ARG D NH1   1 
ATOM   7831  N  NH2   . ARG F 3 300 ? 121.065 -47.227 -26.780 1.00 34.80 ? 596  ARG D NH2   1 
ATOM   7832  N  N     . PRO F 3 301 ? 118.182 -43.296 -31.313 1.00 17.61 ? 597  PRO D N     1 
ATOM   7833  C  CA    . PRO F 3 301 ? 117.145 -43.712 -32.264 1.00 18.70 ? 597  PRO D CA    1 
ATOM   7834  C  C     . PRO F 3 301 ? 116.050 -44.674 -31.809 1.00 18.18 ? 597  PRO D C     1 
ATOM   7835  O  O     . PRO F 3 301 ? 114.867 -44.425 -32.041 1.00 18.44 ? 597  PRO D O     1 
ATOM   7836  C  CB    . PRO F 3 301 ? 117.955 -44.270 -33.433 1.00 19.30 ? 597  PRO D CB    1 
ATOM   7837  C  CG    . PRO F 3 301 ? 119.205 -43.464 -33.384 1.00 20.77 ? 597  PRO D CG    1 
ATOM   7838  C  CD    . PRO F 3 301 ? 119.519 -43.465 -31.908 1.00 18.55 ? 597  PRO D CD    1 
ATOM   7839  N  N     . ALA F 3 302 ? 116.441 -45.768 -31.168 1.00 18.64 ? 598  ALA D N     1 
ATOM   7840  C  CA    . ALA F 3 302 ? 115.484 -46.777 -30.725 1.00 17.90 ? 598  ALA D CA    1 
ATOM   7841  C  C     . ALA F 3 302 ? 114.448 -46.295 -29.713 1.00 19.23 ? 598  ALA D C     1 
ATOM   7842  O  O     . ALA F 3 302 ? 113.296 -46.736 -29.739 1.00 18.87 ? 598  ALA D O     1 
ATOM   7843  C  CB    . ALA F 3 302 ? 116.239 -47.984 -30.157 1.00 20.64 ? 598  ALA D CB    1 
ATOM   7844  N  N     . THR F 3 303 ? 114.857 -45.388 -28.829 1.00 15.72 ? 599  THR D N     1 
ATOM   7845  C  CA    . THR F 3 303 ? 113.981 -44.878 -27.780 1.00 14.86 ? 599  THR D CA    1 
ATOM   7846  C  C     . THR F 3 303 ? 113.566 -43.418 -27.945 1.00 13.70 ? 599  THR D C     1 
ATOM   7847  O  O     . THR F 3 303 ? 112.616 -42.959 -27.301 1.00 15.47 ? 599  THR D O     1 
ATOM   7848  C  CB    . THR F 3 303 ? 114.670 -45.009 -26.423 1.00 13.40 ? 599  THR D CB    1 
ATOM   7849  O  OG1   . THR F 3 303 ? 115.873 -44.223 -26.432 1.00 13.23 ? 599  THR D OG1   1 
ATOM   7850  C  CG2   . THR F 3 303 ? 115.031 -46.456 -26.150 1.00 13.46 ? 599  THR D CG2   1 
ATOM   7851  N  N     . LYS F 3 304 ? 114.276 -42.699 -28.807 1.00 13.76 ? 600  LYS D N     1 
ATOM   7852  C  CA    . LYS F 3 304 ? 114.024 -41.278 -29.038 1.00 14.65 ? 600  LYS D CA    1 
ATOM   7853  C  C     . LYS F 3 304 ? 114.289 -40.484 -27.767 1.00 15.04 ? 600  LYS D C     1 
ATOM   7854  O  O     . LYS F 3 304 ? 113.646 -39.467 -27.504 1.00 15.83 ? 600  LYS D O     1 
ATOM   7855  C  CB    . LYS F 3 304 ? 112.587 -41.036 -29.518 1.00 15.98 ? 600  LYS D CB    1 
ATOM   7856  C  CG    . LYS F 3 304 ? 112.321 -41.572 -30.923 1.00 15.54 ? 600  LYS D CG    1 
ATOM   7857  C  CD    . LYS F 3 304 ? 111.042 -41.001 -31.508 1.00 21.16 ? 600  LYS D CD    1 
ATOM   7858  C  CE    . LYS F 3 304 ? 110.773 -41.554 -32.902 1.00 21.92 ? 600  LYS D CE    1 
ATOM   7859  N  NZ    . LYS F 3 304 ? 110.468 -43.020 -32.864 1.00 23.51 ? 600  LYS D NZ    1 
ATOM   7860  N  N     . LYS F 3 305 ? 115.251 -40.957 -26.980 1.00 13.01 ? 601  LYS D N     1 
ATOM   7861  C  CA    . LYS F 3 305 ? 115.617 -40.287 -25.740 1.00 13.20 ? 601  LYS D CA    1 
ATOM   7862  C  C     . LYS F 3 305 ? 117.015 -39.690 -25.809 1.00 12.05 ? 601  LYS D C     1 
ATOM   7863  O  O     . LYS F 3 305 ? 117.882 -40.199 -26.519 1.00 12.32 ? 601  LYS D O     1 
ATOM   7864  C  CB    . LYS F 3 305 ? 115.579 -41.266 -24.570 1.00 14.89 ? 601  LYS D CB    1 
ATOM   7865  C  CG    . LYS F 3 305 ? 114.192 -41.627 -24.075 1.00 16.82 ? 601  LYS D CG    1 
ATOM   7866  C  CD    . LYS F 3 305 ? 114.315 -42.481 -22.835 1.00 19.48 ? 601  LYS D CD    1 
ATOM   7867  C  CE    . LYS F 3 305 ? 112.992 -42.657 -22.129 1.00 18.57 ? 601  LYS D CE    1 
ATOM   7868  N  NZ    . LYS F 3 305 ? 113.188 -43.535 -20.944 1.00 20.46 ? 601  LYS D NZ    1 
ATOM   7869  N  N     . VAL F 3 306 ? 117.222 -38.600 -25.073 1.00 11.17 ? 602  VAL D N     1 
ATOM   7870  C  CA    . VAL F 3 306 ? 118.538 -37.975 -24.991 1.00 10.92 ? 602  VAL D CA    1 
ATOM   7871  C  C     . VAL F 3 306 ? 118.969 -38.158 -23.543 1.00 10.20 ? 602  VAL D C     1 
ATOM   7872  O  O     . VAL F 3 306 ? 118.165 -37.997 -22.623 1.00 10.67 ? 602  VAL D O     1 
ATOM   7873  C  CB    . VAL F 3 306 ? 118.513 -36.475 -25.360 1.00 12.08 ? 602  VAL D CB    1 
ATOM   7874  C  CG1   . VAL F 3 306 ? 118.366 -36.327 -26.868 1.00 11.96 ? 602  VAL D CG1   1 
ATOM   7875  C  CG2   . VAL F 3 306 ? 117.378 -35.766 -24.636 1.00 11.07 ? 602  VAL D CG2   1 
ATOM   7876  N  N     . HIS F 3 307 ? 120.238 -38.501 -23.349 1.00 8.73  ? 603  HIS D N     1 
ATOM   7877  C  CA    . HIS F 3 307 ? 120.774 -38.761 -22.023 1.00 8.85  ? 603  HIS D CA    1 
ATOM   7878  C  C     . HIS F 3 307 ? 121.939 -37.831 -21.709 1.00 9.22  ? 603  HIS D C     1 
ATOM   7879  O  O     . HIS F 3 307 ? 123.080 -38.108 -22.065 1.00 8.19  ? 603  HIS D O     1 
ATOM   7880  C  CB    . HIS F 3 307 ? 121.234 -40.218 -21.954 1.00 9.30  ? 603  HIS D CB    1 
ATOM   7881  C  CG    . HIS F 3 307 ? 120.137 -41.206 -22.199 1.00 10.26 ? 603  HIS D CG    1 
ATOM   7882  N  ND1   . HIS F 3 307 ? 119.340 -41.702 -21.189 1.00 10.28 ? 603  HIS D ND1   1 
ATOM   7883  C  CD2   . HIS F 3 307 ? 119.702 -41.790 -23.341 1.00 11.56 ? 603  HIS D CD2   1 
ATOM   7884  C  CE1   . HIS F 3 307 ? 118.464 -42.550 -21.698 1.00 9.60  ? 603  HIS D CE1   1 
ATOM   7885  N  NE2   . HIS F 3 307 ? 118.662 -42.621 -23.002 1.00 9.78  ? 603  HIS D NE2   1 
ATOM   7886  N  N     . THR F 3 308 ? 121.647 -36.726 -21.039 1.00 9.34  ? 604  THR D N     1 
ATOM   7887  C  CA    . THR F 3 308 ? 122.690 -35.773 -20.701 1.00 10.41 ? 604  THR D CA    1 
ATOM   7888  C  C     . THR F 3 308 ? 123.572 -36.340 -19.598 1.00 11.12 ? 604  THR D C     1 
ATOM   7889  O  O     . THR F 3 308 ? 123.287 -37.398 -19.026 1.00 10.67 ? 604  THR D O     1 
ATOM   7890  C  CB    . THR F 3 308 ? 122.078 -34.428 -20.210 1.00 11.49 ? 604  THR D CB    1 
ATOM   7891  O  OG1   . THR F 3 308 ? 123.114 -33.448 -20.070 1.00 9.80  ? 604  THR D OG1   1 
ATOM   7892  C  CG2   . THR F 3 308 ? 121.379 -34.613 -18.850 1.00 10.01 ? 604  THR D CG2   1 
ATOM   7893  N  N     . ILE F 3 309 ? 124.658 -35.635 -19.317 1.00 10.93 ? 605  ILE D N     1 
ATOM   7894  C  CA    . ILE F 3 309 ? 125.551 -36.012 -18.238 1.00 9.51  ? 605  ILE D CA    1 
ATOM   7895  C  C     . ILE F 3 309 ? 125.713 -34.748 -17.419 1.00 10.04 ? 605  ILE D C     1 
ATOM   7896  O  O     . ILE F 3 309 ? 126.136 -33.710 -17.939 1.00 9.44  ? 605  ILE D O     1 
ATOM   7897  C  CB    . ILE F 3 309 ? 126.940 -36.489 -18.743 1.00 11.40 ? 605  ILE D CB    1 
ATOM   7898  C  CG1   . ILE F 3 309 ? 126.819 -37.898 -19.326 1.00 10.56 ? 605  ILE D CG1   1 
ATOM   7899  C  CG2   . ILE F 3 309 ? 127.953 -36.491 -17.594 1.00 10.43 ? 605  ILE D CG2   1 
ATOM   7900  C  CD1   . ILE F 3 309 ? 128.128 -38.455 -19.872 1.00 8.46  ? 605  ILE D CD1   1 
ATOM   7901  N  N     . PHE F 3 310 ? 125.348 -34.836 -16.145 1.00 8.49  ? 606  PHE D N     1 
ATOM   7902  C  CA    . PHE F 3 310 ? 125.474 -33.705 -15.240 1.00 9.69  ? 606  PHE D CA    1 
ATOM   7903  C  C     . PHE F 3 310 ? 126.856 -33.780 -14.619 1.00 10.78 ? 606  PHE D C     1 
ATOM   7904  O  O     . PHE F 3 310 ? 127.154 -34.726 -13.890 1.00 11.68 ? 606  PHE D O     1 
ATOM   7905  C  CB    . PHE F 3 310 ? 124.417 -33.780 -14.138 1.00 9.57  ? 606  PHE D CB    1 
ATOM   7906  C  CG    . PHE F 3 310 ? 123.022 -33.486 -14.617 1.00 11.26 ? 606  PHE D CG    1 
ATOM   7907  C  CD1   . PHE F 3 310 ? 122.626 -32.174 -14.887 1.00 10.32 ? 606  PHE D CD1   1 
ATOM   7908  C  CD2   . PHE F 3 310 ? 122.106 -34.515 -14.807 1.00 9.30  ? 606  PHE D CD2   1 
ATOM   7909  C  CE1   . PHE F 3 310 ? 121.338 -31.894 -15.338 1.00 10.22 ? 606  PHE D CE1   1 
ATOM   7910  C  CE2   . PHE F 3 310 ? 120.810 -34.244 -15.261 1.00 8.86  ? 606  PHE D CE2   1 
ATOM   7911  C  CZ    . PHE F 3 310 ? 120.428 -32.934 -15.525 1.00 9.98  ? 606  PHE D CZ    1 
ATOM   7912  N  N     . ASN F 3 311 ? 127.707 -32.805 -14.916 1.00 8.34  ? 607  ASN D N     1 
ATOM   7913  C  CA    . ASN F 3 311 ? 129.032 -32.821 -14.322 1.00 9.67  ? 607  ASN D CA    1 
ATOM   7914  C  C     . ASN F 3 311 ? 128.856 -32.253 -12.920 1.00 7.81  ? 607  ASN D C     1 
ATOM   7915  O  O     . ASN F 3 311 ? 128.524 -31.080 -12.747 1.00 8.14  ? 607  ASN D O     1 
ATOM   7916  C  CB    . ASN F 3 311 ? 130.025 -31.972 -15.116 1.00 9.31  ? 607  ASN D CB    1 
ATOM   7917  C  CG    . ASN F 3 311 ? 131.458 -32.277 -14.736 1.00 12.51 ? 607  ASN D CG    1 
ATOM   7918  O  OD1   . ASN F 3 311 ? 131.763 -32.473 -13.556 1.00 9.59  ? 607  ASN D OD1   1 
ATOM   7919  N  ND2   . ASN F 3 311 ? 132.347 -32.322 -15.728 1.00 11.68 ? 607  ASN D ND2   1 
ATOM   7920  N  N     . GLN F 3 312 ? 129.079 -33.102 -11.925 1.00 7.15  ? 608  GLN D N     1 
ATOM   7921  C  CA    . GLN F 3 312 ? 128.915 -32.736 -10.523 1.00 6.89  ? 608  GLN D CA    1 
ATOM   7922  C  C     . GLN F 3 312 ? 130.205 -32.238 -9.864  1.00 8.22  ? 608  GLN D C     1 
ATOM   7923  O  O     . GLN F 3 312 ? 130.192 -31.815 -8.707  1.00 9.07  ? 608  GLN D O     1 
ATOM   7924  C  CB    . GLN F 3 312 ? 128.393 -33.960 -9.763  1.00 8.65  ? 608  GLN D CB    1 
ATOM   7925  C  CG    . GLN F 3 312 ? 127.939 -33.704 -8.343  1.00 6.91  ? 608  GLN D CG    1 
ATOM   7926  C  CD    . GLN F 3 312 ? 127.475 -34.975 -7.649  1.00 8.21  ? 608  GLN D CD    1 
ATOM   7927  O  OE1   . GLN F 3 312 ? 127.401 -36.047 -8.260  1.00 9.05  ? 608  GLN D OE1   1 
ATOM   7928  N  NE2   . GLN F 3 312 ? 127.158 -34.863 -6.365  1.00 6.91  ? 608  GLN D NE2   1 
ATOM   7929  N  N     . ALA F 3 313 ? 131.315 -32.289 -10.589 1.00 8.55  ? 609  ALA D N     1 
ATOM   7930  C  CA    . ALA F 3 313 ? 132.594 -31.867 -10.015 1.00 9.31  ? 609  ALA D CA    1 
ATOM   7931  C  C     . ALA F 3 313 ? 133.346 -30.913 -10.930 1.00 9.53  ? 609  ALA D C     1 
ATOM   7932  O  O     . ALA F 3 313 ? 134.529 -31.118 -11.236 1.00 9.37  ? 609  ALA D O     1 
ATOM   7933  C  CB    . ALA F 3 313 ? 133.451 -33.102 -9.721  1.00 9.61  ? 609  ALA D CB    1 
ATOM   7934  N  N     . LEU F 3 314 ? 132.671 -29.848 -11.347 1.00 9.30  ? 610  LEU D N     1 
ATOM   7935  C  CA    . LEU F 3 314 ? 133.302 -28.907 -12.249 1.00 11.07 ? 610  LEU D CA    1 
ATOM   7936  C  C     . LEU F 3 314 ? 133.208 -27.438 -11.867 1.00 11.47 ? 610  LEU D C     1 
ATOM   7937  O  O     . LEU F 3 314 ? 134.231 -26.762 -11.761 1.00 10.95 ? 610  LEU D O     1 
ATOM   7938  C  CB    . LEU F 3 314 ? 132.743 -29.112 -13.662 1.00 12.27 ? 610  LEU D CB    1 
ATOM   7939  C  CG    . LEU F 3 314 ? 133.308 -28.294 -14.831 1.00 16.96 ? 610  LEU D CG    1 
ATOM   7940  C  CD1   . LEU F 3 314 ? 133.084 -29.061 -16.125 1.00 19.19 ? 610  LEU D CD1   1 
ATOM   7941  C  CD2   . LEU F 3 314 ? 132.642 -26.929 -14.911 1.00 15.80 ? 610  LEU D CD2   1 
ATOM   7942  N  N     . THR F 3 315 ? 131.994 -26.938 -11.653 1.00 9.21  ? 611  THR D N     1 
ATOM   7943  C  CA    . THR F 3 315 ? 131.835 -25.523 -11.352 1.00 9.03  ? 611  THR D CA    1 
ATOM   7944  C  C     . THR F 3 315 ? 132.479 -25.085 -10.049 1.00 9.07  ? 611  THR D C     1 
ATOM   7945  O  O     . THR F 3 315 ? 132.496 -25.817 -9.056  1.00 8.91  ? 611  THR D O     1 
ATOM   7946  C  CB    . THR F 3 315 ? 130.352 -25.092 -11.332 1.00 7.52  ? 611  THR D CB    1 
ATOM   7947  O  OG1   . THR F 3 315 ? 129.766 -25.441 -10.078 1.00 8.05  ? 611  THR D OG1   1 
ATOM   7948  C  CG2   . THR F 3 315 ? 129.588 -25.749 -12.475 1.00 7.71  ? 611  THR D CG2   1 
ATOM   7949  N  N     . GLN F 3 316 ? 132.992 -23.861 -10.064 1.00 9.34  ? 612  GLN D N     1 
ATOM   7950  C  CA    . GLN F 3 316 ? 133.665 -23.293 -8.908  1.00 9.86  ? 612  GLN D CA    1 
ATOM   7951  C  C     . GLN F 3 316 ? 132.747 -22.898 -7.755  1.00 9.70  ? 612  GLN D C     1 
ATOM   7952  O  O     . GLN F 3 316 ? 133.224 -22.614 -6.658  1.00 10.77 ? 612  GLN D O     1 
ATOM   7953  C  CB    . GLN F 3 316 ? 134.485 -22.081 -9.356  1.00 9.48  ? 612  GLN D CB    1 
ATOM   7954  C  CG    . GLN F 3 316 ? 135.543 -22.434 -10.390 1.00 11.66 ? 612  GLN D CG    1 
ATOM   7955  C  CD    . GLN F 3 316 ? 136.418 -23.574 -9.917  1.00 14.44 ? 612  GLN D CD    1 
ATOM   7956  O  OE1   . GLN F 3 316 ? 137.153 -23.438 -8.939  1.00 15.17 ? 612  GLN D OE1   1 
ATOM   7957  N  NE2   . GLN F 3 316 ? 136.331 -24.714 -10.597 1.00 12.60 ? 612  GLN D NE2   1 
ATOM   7958  N  N     . THR F 3 317 ? 131.438 -22.905 -7.996  1.00 8.59  ? 613  THR D N     1 
ATOM   7959  C  CA    . THR F 3 317 ? 130.465 -22.503 -6.982  1.00 8.82  ? 613  THR D CA    1 
ATOM   7960  C  C     . THR F 3 317 ? 129.620 -23.634 -6.402  1.00 9.90  ? 613  THR D C     1 
ATOM   7961  O  O     . THR F 3 317 ? 128.866 -23.415 -5.454  1.00 9.62  ? 613  THR D O     1 
ATOM   7962  C  CB    . THR F 3 317 ? 129.484 -21.463 -7.549  1.00 8.99  ? 613  THR D CB    1 
ATOM   7963  O  OG1   . THR F 3 317 ? 128.855 -22.007 -8.720  1.00 6.89  ? 613  THR D OG1   1 
ATOM   7964  C  CG2   . THR F 3 317 ? 130.209 -20.162 -7.905  1.00 6.45  ? 613  THR D CG2   1 
ATOM   7965  N  N     . GLY F 3 318 ? 129.731 -24.834 -6.964  1.00 8.02  ? 614  GLY D N     1 
ATOM   7966  C  CA    . GLY F 3 318 ? 128.932 -25.931 -6.446  1.00 8.39  ? 614  GLY D CA    1 
ATOM   7967  C  C     . GLY F 3 318 ? 127.739 -26.253 -7.328  1.00 8.07  ? 614  GLY D C     1 
ATOM   7968  O  O     . GLY F 3 318 ? 126.984 -27.188 -7.053  1.00 7.81  ? 614  GLY D O     1 
ATOM   7969  N  N     . ARG F 3 319 ? 127.557 -25.475 -8.389  1.00 7.88  ? 615  ARG D N     1 
ATOM   7970  C  CA    . ARG F 3 319 ? 126.471 -25.734 -9.327  1.00 9.16  ? 615  ARG D CA    1 
ATOM   7971  C  C     . ARG F 3 319 ? 126.838 -26.957 -10.157 1.00 8.98  ? 615  ARG D C     1 
ATOM   7972  O  O     . ARG F 3 319 ? 127.992 -27.386 -10.179 1.00 8.75  ? 615  ARG D O     1 
ATOM   7973  C  CB    . ARG F 3 319 ? 126.278 -24.567 -10.300 1.00 8.32  ? 615  ARG D CB    1 
ATOM   7974  C  CG    . ARG F 3 319 ? 125.471 -23.391 -9.781  1.00 7.18  ? 615  ARG D CG    1 
ATOM   7975  C  CD    . ARG F 3 319 ? 125.023 -22.511 -10.943 1.00 6.22  ? 615  ARG D CD    1 
ATOM   7976  N  NE    . ARG F 3 319 ? 124.085 -21.467 -10.529 1.00 7.02  ? 615  ARG D NE    1 
ATOM   7977  C  CZ    . ARG F 3 319 ? 123.523 -20.599 -11.365 1.00 8.44  ? 615  ARG D CZ    1 
ATOM   7978  N  NH1   . ARG F 3 319 ? 123.803 -20.651 -12.663 1.00 6.53  ? 615  ARG D NH1   1 
ATOM   7979  N  NH2   . ARG F 3 319 ? 122.682 -19.674 -10.905 1.00 7.38  ? 615  ARG D NH2   1 
ATOM   7980  N  N     . LEU F 3 320 ? 125.846 -27.513 -10.838 1.00 8.52  ? 616  LEU D N     1 
ATOM   7981  C  CA    . LEU F 3 320 ? 126.065 -28.633 -11.745 1.00 8.30  ? 616  LEU D CA    1 
ATOM   7982  C  C     . LEU F 3 320 ? 126.231 -27.991 -13.120 1.00 8.74  ? 616  LEU D C     1 
ATOM   7983  O  O     . LEU F 3 320 ? 125.946 -26.804 -13.283 1.00 7.27  ? 616  LEU D O     1 
ATOM   7984  C  CB    . LEU F 3 320 ? 124.835 -29.539 -11.815 1.00 7.13  ? 616  LEU D CB    1 
ATOM   7985  C  CG    . LEU F 3 320 ? 124.322 -30.237 -10.554 1.00 6.95  ? 616  LEU D CG    1 
ATOM   7986  C  CD1   . LEU F 3 320 ? 122.989 -30.908 -10.867 1.00 8.08  ? 616  LEU D CD1   1 
ATOM   7987  C  CD2   . LEU F 3 320 ? 125.357 -31.259 -10.065 1.00 6.56  ? 616  LEU D CD2   1 
ATOM   7988  N  N     . SER F 3 321 ? 126.706 -28.767 -14.091 1.00 8.99  ? 617  SER D N     1 
ATOM   7989  C  CA    . SER F 3 321 ? 126.768 -28.309 -15.480 1.00 8.77  ? 617  SER D CA    1 
ATOM   7990  C  C     . SER F 3 321 ? 126.190 -29.517 -16.222 1.00 10.00 ? 617  SER D C     1 
ATOM   7991  O  O     . SER F 3 321 ? 126.106 -30.610 -15.651 1.00 10.20 ? 617  SER D O     1 
ATOM   7992  C  CB    . SER F 3 321 ? 128.196 -27.984 -15.948 1.00 10.25 ? 617  SER D CB    1 
ATOM   7993  O  OG    . SER F 3 321 ? 128.994 -29.140 -16.075 1.00 11.16 ? 617  SER D OG    1 
ATOM   7994  N  N     . SER F 3 322 ? 125.783 -29.326 -17.472 1.00 10.50 ? 618  SER D N     1 
ATOM   7995  C  CA    . SER F 3 322 ? 125.173 -30.394 -18.257 1.00 10.68 ? 618  SER D CA    1 
ATOM   7996  C  C     . SER F 3 322 ? 125.791 -30.457 -19.647 1.00 11.26 ? 618  SER D C     1 
ATOM   7997  O  O     . SER F 3 322 ? 125.988 -29.423 -20.295 1.00 10.70 ? 618  SER D O     1 
ATOM   7998  C  CB    . SER F 3 322 ? 123.658 -30.136 -18.351 1.00 10.84 ? 618  SER D CB    1 
ATOM   7999  O  OG    . SER F 3 322 ? 123.019 -30.995 -19.275 1.00 10.25 ? 618  SER D OG    1 
ATOM   8000  N  N     . THR F 3 323 ? 126.095 -31.666 -20.115 1.00 11.58 ? 619  THR D N     1 
ATOM   8001  C  CA    . THR F 3 323 ? 126.712 -31.801 -21.426 1.00 12.32 ? 619  THR D CA    1 
ATOM   8002  C  C     . THR F 3 323 ? 126.222 -32.940 -22.314 1.00 13.09 ? 619  THR D C     1 
ATOM   8003  O  O     . THR F 3 323 ? 125.697 -33.953 -21.842 1.00 11.30 ? 619  THR D O     1 
ATOM   8004  C  CB    . THR F 3 323 ? 128.249 -31.978 -21.305 1.00 14.14 ? 619  THR D CB    1 
ATOM   8005  O  OG1   . THR F 3 323 ? 128.532 -33.199 -20.608 1.00 13.03 ? 619  THR D OG1   1 
ATOM   8006  C  CG2   . THR F 3 323 ? 128.867 -30.816 -20.550 1.00 13.16 ? 619  THR D CG2   1 
ATOM   8007  N  N     . GLU F 3 324 ? 126.425 -32.731 -23.613 1.00 13.27 ? 620  GLU D N     1 
ATOM   8008  C  CA    . GLU F 3 324 ? 126.117 -33.684 -24.676 1.00 14.21 ? 620  GLU D CA    1 
ATOM   8009  C  C     . GLU F 3 324 ? 124.859 -34.528 -24.509 1.00 12.63 ? 620  GLU D C     1 
ATOM   8010  O  O     . GLU F 3 324 ? 124.934 -35.740 -24.319 1.00 11.88 ? 620  GLU D O     1 
ATOM   8011  C  CB    . GLU F 3 324 ? 127.331 -34.599 -24.875 1.00 16.90 ? 620  GLU D CB    1 
ATOM   8012  C  CG    . GLU F 3 324 ? 127.300 -35.445 -26.141 1.00 20.56 ? 620  GLU D CG    1 
ATOM   8013  C  CD    . GLU F 3 324 ? 128.524 -36.345 -26.262 1.00 25.18 ? 620  GLU D CD    1 
ATOM   8014  O  OE1   . GLU F 3 324 ? 129.461 -36.198 -25.453 1.00 27.13 ? 620  GLU D OE1   1 
ATOM   8015  O  OE2   . GLU F 3 324 ? 128.550 -37.198 -27.167 1.00 31.10 ? 620  GLU D OE2   1 
ATOM   8016  N  N     . PRO F 3 325 ? 123.681 -33.900 -24.603 1.00 11.94 ? 621  PRO D N     1 
ATOM   8017  C  CA    . PRO F 3 325 ? 123.508 -32.468 -24.850 1.00 10.58 ? 621  PRO D CA    1 
ATOM   8018  C  C     . PRO F 3 325 ? 123.388 -31.701 -23.542 1.00 10.76 ? 621  PRO D C     1 
ATOM   8019  O  O     . PRO F 3 325 ? 123.134 -32.296 -22.493 1.00 8.73  ? 621  PRO D O     1 
ATOM   8020  C  CB    . PRO F 3 325 ? 122.227 -32.417 -25.656 1.00 12.82 ? 621  PRO D CB    1 
ATOM   8021  C  CG    . PRO F 3 325 ? 121.397 -33.456 -24.953 1.00 11.29 ? 621  PRO D CG    1 
ATOM   8022  C  CD    . PRO F 3 325 ? 122.387 -34.603 -24.705 1.00 12.45 ? 621  PRO D CD    1 
ATOM   8023  N  N     . ASN F 3 326 ? 123.577 -30.386 -23.611 1.00 9.35  ? 622  ASN D N     1 
ATOM   8024  C  CA    . ASN F 3 326 ? 123.404 -29.536 -22.442 1.00 8.72  ? 622  ASN D CA    1 
ATOM   8025  C  C     . ASN F 3 326 ? 121.893 -29.298 -22.401 1.00 9.03  ? 622  ASN D C     1 
ATOM   8026  O  O     . ASN F 3 326 ? 121.346 -28.674 -23.309 1.00 9.69  ? 622  ASN D O     1 
ATOM   8027  C  CB    . ASN F 3 326 ? 124.125 -28.195 -22.625 1.00 8.80  ? 622  ASN D CB    1 
ATOM   8028  C  CG    . ASN F 3 326 ? 123.902 -27.248 -21.456 1.00 9.29  ? 622  ASN D CG    1 
ATOM   8029  O  OD1   . ASN F 3 326 ? 123.079 -27.509 -20.579 1.00 9.45  ? 622  ASN D OD1   1 
ATOM   8030  N  ND2   . ASN F 3 326 ? 124.632 -26.138 -21.442 1.00 11.13 ? 622  ASN D ND2   1 
ATOM   8031  N  N     . LEU F 3 327 ? 121.218 -29.799 -21.370 1.00 7.74  ? 623  LEU D N     1 
ATOM   8032  C  CA    . LEU F 3 327 ? 119.777 -29.608 -21.261 1.00 7.76  ? 623  LEU D CA    1 
ATOM   8033  C  C     . LEU F 3 327 ? 119.449 -28.517 -20.249 1.00 8.48  ? 623  LEU D C     1 
ATOM   8034  O  O     . LEU F 3 327 ? 118.312 -28.382 -19.799 1.00 10.35 ? 623  LEU D O     1 
ATOM   8035  C  CB    . LEU F 3 327 ? 119.092 -30.932 -20.893 1.00 9.76  ? 623  LEU D CB    1 
ATOM   8036  C  CG    . LEU F 3 327 ? 119.268 -32.018 -21.969 1.00 9.66  ? 623  LEU D CG    1 
ATOM   8037  C  CD1   . LEU F 3 327 ? 118.568 -33.310 -21.547 1.00 10.38 ? 623  LEU D CD1   1 
ATOM   8038  C  CD2   . LEU F 3 327 ? 118.710 -31.505 -23.303 1.00 9.43  ? 623  LEU D CD2   1 
ATOM   8039  N  N     . GLN F 3 328 ? 120.465 -27.734 -19.901 1.00 7.29  ? 624  GLN D N     1 
ATOM   8040  C  CA    . GLN F 3 328 ? 120.298 -26.626 -18.974 1.00 8.75  ? 624  GLN D CA    1 
ATOM   8041  C  C     . GLN F 3 328 ? 120.286 -25.285 -19.714 1.00 8.70  ? 624  GLN D C     1 
ATOM   8042  O  O     . GLN F 3 328 ? 120.197 -24.230 -19.083 1.00 8.24  ? 624  GLN D O     1 
ATOM   8043  C  CB    . GLN F 3 328 ? 121.404 -26.637 -17.915 1.00 8.87  ? 624  GLN D CB    1 
ATOM   8044  C  CG    . GLN F 3 328 ? 121.361 -27.859 -16.994 1.00 7.58  ? 624  GLN D CG    1 
ATOM   8045  C  CD    . GLN F 3 328 ? 122.384 -27.791 -15.876 1.00 9.55  ? 624  GLN D CD    1 
ATOM   8046  O  OE1   . GLN F 3 328 ? 123.525 -27.386 -16.092 1.00 7.84  ? 624  GLN D OE1   1 
ATOM   8047  N  NE2   . GLN F 3 328 ? 121.981 -28.200 -14.669 1.00 10.21 ? 624  GLN D NE2   1 
ATOM   8048  N  N     . ASN F 3 329 ? 120.380 -25.321 -21.045 1.00 8.76  ? 625  ASN D N     1 
ATOM   8049  C  CA    . ASN F 3 329 ? 120.335 -24.087 -21.828 1.00 9.51  ? 625  ASN D CA    1 
ATOM   8050  C  C     . ASN F 3 329 ? 119.422 -24.185 -23.054 1.00 9.72  ? 625  ASN D C     1 
ATOM   8051  O  O     . ASN F 3 329 ? 119.705 -23.626 -24.113 1.00 9.42  ? 625  ASN D O     1 
ATOM   8052  C  CB    . ASN F 3 329 ? 121.754 -23.621 -22.219 1.00 9.18  ? 625  ASN D CB    1 
ATOM   8053  C  CG    . ASN F 3 329 ? 122.396 -24.468 -23.310 1.00 10.36 ? 625  ASN D CG    1 
ATOM   8054  O  OD1   . ASN F 3 329 ? 121.946 -25.564 -23.622 1.00 10.40 ? 625  ASN D OD1   1 
ATOM   8055  N  ND2   . ASN F 3 329 ? 123.475 -23.948 -23.892 1.00 13.10 ? 625  ASN D ND2   1 
ATOM   8056  N  N     . ILE F 3 330 ? 118.321 -24.912 -22.901 1.00 10.99 ? 626  ILE D N     1 
ATOM   8057  C  CA    . ILE F 3 330 ? 117.350 -25.036 -23.984 1.00 10.75 ? 626  ILE D CA    1 
ATOM   8058  C  C     . ILE F 3 330 ? 116.628 -23.686 -24.006 1.00 10.30 ? 626  ILE D C     1 
ATOM   8059  O  O     . ILE F 3 330 ? 116.231 -23.171 -22.960 1.00 10.57 ? 626  ILE D O     1 
ATOM   8060  C  CB    . ILE F 3 330 ? 116.341 -26.185 -23.708 1.00 12.69 ? 626  ILE D CB    1 
ATOM   8061  C  CG1   . ILE F 3 330 ? 117.095 -27.513 -23.568 1.00 9.74  ? 626  ILE D CG1   1 
ATOM   8062  C  CG2   . ILE F 3 330 ? 115.315 -26.272 -24.840 1.00 13.73 ? 626  ILE D CG2   1 
ATOM   8063  C  CD1   . ILE F 3 330 ? 117.957 -27.877 -24.778 1.00 11.19 ? 626  ILE D CD1   1 
ATOM   8064  N  N     . PRO F 3 331 ? 116.466 -23.087 -25.194 1.00 11.25 ? 627  PRO D N     1 
ATOM   8065  C  CA    . PRO F 3 331 ? 115.803 -21.792 -25.379 1.00 10.00 ? 627  PRO D CA    1 
ATOM   8066  C  C     . PRO F 3 331 ? 114.468 -21.611 -24.652 1.00 11.33 ? 627  PRO D C     1 
ATOM   8067  O  O     . PRO F 3 331 ? 113.704 -22.565 -24.477 1.00 10.52 ? 627  PRO D O     1 
ATOM   8068  C  CB    . PRO F 3 331 ? 115.654 -21.690 -26.896 1.00 12.47 ? 627  PRO D CB    1 
ATOM   8069  C  CG    . PRO F 3 331 ? 116.833 -22.468 -27.398 1.00 12.03 ? 627  PRO D CG    1 
ATOM   8070  C  CD    . PRO F 3 331 ? 116.830 -23.674 -26.495 1.00 10.50 ? 627  PRO D CD    1 
ATOM   8071  N  N     . ILE F 3 332 ? 114.186 -20.376 -24.239 1.00 11.05 ? 628  ILE D N     1 
ATOM   8072  C  CA    . ILE F 3 332 ? 112.932 -20.073 -23.553 1.00 11.86 ? 628  ILE D CA    1 
ATOM   8073  C  C     . ILE F 3 332 ? 112.650 -18.572 -23.508 1.00 13.80 ? 628  ILE D C     1 
ATOM   8074  O  O     . ILE F 3 332 ? 111.495 -18.156 -23.412 1.00 13.90 ? 628  ILE D O     1 
ATOM   8075  C  CB    . ILE F 3 332 ? 112.935 -20.610 -22.095 1.00 11.68 ? 628  ILE D CB    1 
ATOM   8076  C  CG1   . ILE F 3 332 ? 111.522 -20.537 -21.507 1.00 12.60 ? 628  ILE D CG1   1 
ATOM   8077  C  CG2   . ILE F 3 332 ? 113.881 -19.783 -21.230 1.00 9.99  ? 628  ILE D CG2   1 
ATOM   8078  C  CD1   . ILE F 3 332 ? 111.399 -21.117 -20.110 1.00 13.15 ? 628  ILE D CD1   1 
ATOM   8079  N  N     . ARG F 3 333 ? 113.701 -17.762 -23.587 1.00 13.74 ? 629  ARG D N     1 
ATOM   8080  C  CA    . ARG F 3 333 ? 113.551 -16.310 -23.504 1.00 16.22 ? 629  ARG D CA    1 
ATOM   8081  C  C     . ARG F 3 333 ? 112.812 -15.656 -24.662 1.00 17.83 ? 629  ARG D C     1 
ATOM   8082  O  O     . ARG F 3 333 ? 112.081 -14.692 -24.457 1.00 21.09 ? 629  ARG D O     1 
ATOM   8083  C  CB    . ARG F 3 333 ? 114.921 -15.655 -23.320 1.00 14.56 ? 629  ARG D CB    1 
ATOM   8084  C  CG    . ARG F 3 333 ? 115.598 -16.093 -22.034 1.00 14.49 ? 629  ARG D CG    1 
ATOM   8085  C  CD    . ARG F 3 333 ? 116.952 -15.417 -21.833 1.00 16.10 ? 629  ARG D CD    1 
ATOM   8086  N  NE    . ARG F 3 333 ? 117.612 -15.949 -20.644 1.00 13.17 ? 629  ARG D NE    1 
ATOM   8087  C  CZ    . ARG F 3 333 ? 118.830 -15.602 -20.239 1.00 13.96 ? 629  ARG D CZ    1 
ATOM   8088  N  NH1   . ARG F 3 333 ? 119.543 -14.710 -20.920 1.00 12.76 ? 629  ARG D NH1   1 
ATOM   8089  N  NH2   . ARG F 3 333 ? 119.334 -16.160 -19.149 1.00 15.26 ? 629  ARG D NH2   1 
ATOM   8090  N  N     . LEU F 3 334 ? 113.001 -16.170 -25.871 1.00 17.96 ? 630  LEU D N     1 
ATOM   8091  C  CA    . LEU F 3 334 ? 112.318 -15.626 -27.043 1.00 19.99 ? 630  LEU D CA    1 
ATOM   8092  C  C     . LEU F 3 334 ? 111.369 -16.721 -27.518 1.00 19.80 ? 630  LEU D C     1 
ATOM   8093  O  O     . LEU F 3 334 ? 111.726 -17.899 -27.513 1.00 19.77 ? 630  LEU D O     1 
ATOM   8094  C  CB    . LEU F 3 334 ? 113.328 -15.261 -28.139 1.00 19.14 ? 630  LEU D CB    1 
ATOM   8095  C  CG    . LEU F 3 334 ? 114.354 -14.166 -27.805 1.00 21.67 ? 630  LEU D CG    1 
ATOM   8096  C  CD1   . LEU F 3 334 ? 115.378 -14.053 -28.933 1.00 19.48 ? 630  LEU D CD1   1 
ATOM   8097  C  CD2   . LEU F 3 334 ? 113.647 -12.830 -27.587 1.00 20.41 ? 630  LEU D CD2   1 
ATOM   8098  N  N     . GLU F 3 335 ? 110.163 -16.337 -27.925 1.00 20.71 ? 631  GLU D N     1 
ATOM   8099  C  CA    . GLU F 3 335 ? 109.163 -17.309 -28.357 1.00 20.89 ? 631  GLU D CA    1 
ATOM   8100  C  C     . GLU F 3 335 ? 109.611 -18.252 -29.472 1.00 20.52 ? 631  GLU D C     1 
ATOM   8101  O  O     . GLU F 3 335 ? 109.285 -19.438 -29.436 1.00 19.68 ? 631  GLU D O     1 
ATOM   8102  C  CB    . GLU F 3 335 ? 107.868 -16.585 -28.750 1.00 22.61 ? 631  GLU D CB    1 
ATOM   8103  C  CG    . GLU F 3 335 ? 106.702 -17.496 -29.163 1.00 25.20 ? 631  GLU D CG    1 
ATOM   8104  C  CD    . GLU F 3 335 ? 106.359 -18.566 -28.132 1.00 27.18 ? 631  GLU D CD    1 
ATOM   8105  O  OE1   . GLU F 3 335 ? 106.422 -18.289 -26.915 1.00 27.71 ? 631  GLU D OE1   1 
ATOM   8106  O  OE2   . GLU F 3 335 ? 106.005 -19.689 -28.546 1.00 28.65 ? 631  GLU D OE2   1 
ATOM   8107  N  N     . GLU F 3 336 ? 110.359 -17.747 -30.452 1.00 21.22 ? 632  GLU D N     1 
ATOM   8108  C  CA    . GLU F 3 336 ? 110.825 -18.596 -31.556 1.00 23.05 ? 632  GLU D CA    1 
ATOM   8109  C  C     . GLU F 3 336 ? 111.690 -19.763 -31.071 1.00 22.69 ? 632  GLU D C     1 
ATOM   8110  O  O     . GLU F 3 336 ? 111.550 -20.893 -31.545 1.00 22.99 ? 632  GLU D O     1 
ATOM   8111  C  CB    . GLU F 3 336 ? 111.620 -17.772 -32.575 1.00 25.85 ? 632  GLU D CB    1 
ATOM   8112  C  CG    . GLU F 3 336 ? 110.765 -16.855 -33.434 1.00 30.34 ? 632  GLU D CG    1 
ATOM   8113  C  CD    . GLU F 3 336 ? 111.600 -15.983 -34.351 1.00 33.53 ? 632  GLU D CD    1 
ATOM   8114  O  OE1   . GLU F 3 336 ? 112.404 -15.180 -33.829 1.00 35.72 ? 632  GLU D OE1   1 
ATOM   8115  O  OE2   . GLU F 3 336 ? 111.454 -16.102 -35.588 1.00 34.28 ? 632  GLU D OE2   1 
ATOM   8116  N  N     . GLY F 3 337 ? 112.585 -19.485 -30.132 1.00 20.14 ? 633  GLY D N     1 
ATOM   8117  C  CA    . GLY F 3 337 ? 113.437 -20.534 -29.608 1.00 18.42 ? 633  GLY D CA    1 
ATOM   8118  C  C     . GLY F 3 337 ? 112.678 -21.375 -28.599 1.00 16.93 ? 633  GLY D C     1 
ATOM   8119  O  O     . GLY F 3 337 ? 112.869 -22.580 -28.521 1.00 17.65 ? 633  GLY D O     1 
ATOM   8120  N  N     . ARG F 3 338 ? 111.801 -20.736 -27.836 1.00 15.87 ? 634  ARG D N     1 
ATOM   8121  C  CA    . ARG F 3 338 ? 111.017 -21.427 -26.819 1.00 17.01 ? 634  ARG D CA    1 
ATOM   8122  C  C     . ARG F 3 338 ? 110.244 -22.628 -27.376 1.00 16.61 ? 634  ARG D C     1 
ATOM   8123  O  O     . ARG F 3 338 ? 110.020 -23.619 -26.670 1.00 13.94 ? 634  ARG D O     1 
ATOM   8124  C  CB    . ARG F 3 338 ? 110.044 -20.443 -26.165 1.00 18.39 ? 634  ARG D CB    1 
ATOM   8125  C  CG    . ARG F 3 338 ? 109.248 -21.032 -25.025 1.00 22.10 ? 634  ARG D CG    1 
ATOM   8126  C  CD    . ARG F 3 338 ? 108.458 -19.964 -24.297 1.00 26.00 ? 634  ARG D CD    1 
ATOM   8127  N  NE    . ARG F 3 338 ? 108.052 -20.440 -22.980 1.00 31.42 ? 634  ARG D NE    1 
ATOM   8128  C  CZ    . ARG F 3 338 ? 107.625 -19.655 -21.997 1.00 33.51 ? 634  ARG D CZ    1 
ATOM   8129  N  NH1   . ARG F 3 338 ? 107.538 -18.342 -22.180 1.00 35.45 ? 634  ARG D NH1   1 
ATOM   8130  N  NH2   . ARG F 3 338 ? 107.295 -20.184 -20.826 1.00 32.65 ? 634  ARG D NH2   1 
ATOM   8131  N  N     . LYS F 3 339 ? 109.849 -22.540 -28.644 1.00 14.56 ? 635  LYS D N     1 
ATOM   8132  C  CA    . LYS F 3 339 ? 109.097 -23.613 -29.287 1.00 14.84 ? 635  LYS D CA    1 
ATOM   8133  C  C     . LYS F 3 339 ? 109.867 -24.927 -29.336 1.00 14.22 ? 635  LYS D C     1 
ATOM   8134  O  O     . LYS F 3 339 ? 109.271 -25.994 -29.434 1.00 15.46 ? 635  LYS D O     1 
ATOM   8135  C  CB    . LYS F 3 339 ? 108.684 -23.202 -30.705 1.00 16.06 ? 635  LYS D CB    1 
ATOM   8136  C  CG    . LYS F 3 339 ? 107.696 -22.048 -30.735 1.00 19.56 ? 635  LYS D CG    1 
ATOM   8137  C  CD    . LYS F 3 339 ? 107.094 -21.867 -32.120 1.00 23.35 ? 635  LYS D CD    1 
ATOM   8138  C  CE    . LYS F 3 339 ? 106.078 -20.726 -32.130 1.00 26.89 ? 635  LYS D CE    1 
ATOM   8139  N  NZ    . LYS F 3 339 ? 104.995 -20.924 -31.125 1.00 26.54 ? 635  LYS D NZ    1 
ATOM   8140  N  N     . ILE F 3 340 ? 111.194 -24.851 -29.273 1.00 13.64 ? 636  ILE D N     1 
ATOM   8141  C  CA    . ILE F 3 340 ? 112.009 -26.061 -29.285 1.00 12.91 ? 636  ILE D CA    1 
ATOM   8142  C  C     . ILE F 3 340 ? 111.541 -26.984 -28.164 1.00 11.73 ? 636  ILE D C     1 
ATOM   8143  O  O     . ILE F 3 340 ? 111.563 -28.210 -28.303 1.00 11.29 ? 636  ILE D O     1 
ATOM   8144  C  CB    . ILE F 3 340 ? 113.504 -25.740 -29.048 1.00 14.00 ? 636  ILE D CB    1 
ATOM   8145  C  CG1   . ILE F 3 340 ? 114.072 -24.958 -30.234 1.00 15.10 ? 636  ILE D CG1   1 
ATOM   8146  C  CG2   . ILE F 3 340 ? 114.288 -27.034 -28.814 1.00 13.24 ? 636  ILE D CG2   1 
ATOM   8147  C  CD1   . ILE F 3 340 ? 114.184 -25.764 -31.519 1.00 16.55 ? 636  ILE D CD1   1 
ATOM   8148  N  N     . ARG F 3 341 ? 111.116 -26.389 -27.052 1.00 10.45 ? 637  ARG D N     1 
ATOM   8149  C  CA    . ARG F 3 341 ? 110.665 -27.166 -25.902 1.00 10.70 ? 637  ARG D CA    1 
ATOM   8150  C  C     . ARG F 3 341 ? 109.431 -28.027 -26.168 1.00 11.78 ? 637  ARG D C     1 
ATOM   8151  O  O     . ARG F 3 341 ? 109.119 -28.926 -25.390 1.00 11.12 ? 637  ARG D O     1 
ATOM   8152  C  CB    . ARG F 3 341 ? 110.429 -26.245 -24.702 1.00 12.07 ? 637  ARG D CB    1 
ATOM   8153  C  CG    . ARG F 3 341 ? 111.708 -25.589 -24.219 1.00 13.33 ? 637  ARG D CG    1 
ATOM   8154  C  CD    . ARG F 3 341 ? 111.558 -24.952 -22.846 1.00 16.07 ? 637  ARG D CD    1 
ATOM   8155  N  NE    . ARG F 3 341 ? 112.825 -24.373 -22.405 1.00 15.86 ? 637  ARG D NE    1 
ATOM   8156  C  CZ    . ARG F 3 341 ? 113.187 -24.240 -21.133 1.00 14.48 ? 637  ARG D CZ    1 
ATOM   8157  N  NH1   . ARG F 3 341 ? 112.378 -24.645 -20.166 1.00 13.39 ? 637  ARG D NH1   1 
ATOM   8158  N  NH2   . ARG F 3 341 ? 114.367 -23.716 -20.832 1.00 12.83 ? 637  ARG D NH2   1 
ATOM   8159  N  N     . GLN F 3 342 ? 108.732 -27.763 -27.268 1.00 13.22 ? 638  GLN D N     1 
ATOM   8160  C  CA    . GLN F 3 342 ? 107.562 -28.572 -27.612 1.00 14.26 ? 638  GLN D CA    1 
ATOM   8161  C  C     . GLN F 3 342 ? 108.016 -29.975 -28.028 1.00 13.55 ? 638  GLN D C     1 
ATOM   8162  O  O     . GLN F 3 342 ? 107.223 -30.920 -28.021 1.00 12.81 ? 638  GLN D O     1 
ATOM   8163  C  CB    . GLN F 3 342 ? 106.772 -27.917 -28.753 1.00 17.17 ? 638  GLN D CB    1 
ATOM   8164  C  CG    . GLN F 3 342 ? 106.062 -26.633 -28.345 1.00 16.89 ? 638  GLN D CG    1 
ATOM   8165  C  CD    . GLN F 3 342 ? 105.519 -25.847 -29.528 1.00 20.19 ? 638  GLN D CD    1 
ATOM   8166  O  OE1   . GLN F 3 342 ? 105.648 -26.262 -30.679 1.00 20.63 ? 638  GLN D OE1   1 
ATOM   8167  N  NE2   . GLN F 3 342 ? 104.910 -24.700 -29.243 1.00 20.66 ? 638  GLN D NE2   1 
ATOM   8168  N  N     . ALA F 3 343 ? 109.299 -30.107 -28.363 1.00 12.48 ? 639  ALA D N     1 
ATOM   8169  C  CA    . ALA F 3 343 ? 109.859 -31.391 -28.791 1.00 13.68 ? 639  ALA D CA    1 
ATOM   8170  C  C     . ALA F 3 343 ? 110.271 -32.285 -27.629 1.00 13.11 ? 639  ALA D C     1 
ATOM   8171  O  O     . ALA F 3 343 ? 110.612 -33.452 -27.832 1.00 15.52 ? 639  ALA D O     1 
ATOM   8172  C  CB    . ALA F 3 343 ? 111.055 -31.165 -29.716 1.00 12.87 ? 639  ALA D CB    1 
ATOM   8173  N  N     . PHE F 3 344 ? 110.252 -31.743 -26.416 1.00 11.76 ? 640  PHE D N     1 
ATOM   8174  C  CA    . PHE F 3 344 ? 110.604 -32.523 -25.228 1.00 12.02 ? 640  PHE D CA    1 
ATOM   8175  C  C     . PHE F 3 344 ? 109.294 -32.991 -24.607 1.00 12.38 ? 640  PHE D C     1 
ATOM   8176  O  O     . PHE F 3 344 ? 108.512 -32.189 -24.105 1.00 13.41 ? 640  PHE D O     1 
ATOM   8177  C  CB    . PHE F 3 344 ? 111.396 -31.658 -24.253 1.00 13.65 ? 640  PHE D CB    1 
ATOM   8178  C  CG    . PHE F 3 344 ? 112.811 -31.407 -24.696 1.00 15.26 ? 640  PHE D CG    1 
ATOM   8179  C  CD1   . PHE F 3 344 ? 113.815 -32.322 -24.405 1.00 14.04 ? 640  PHE D CD1   1 
ATOM   8180  C  CD2   . PHE F 3 344 ? 113.130 -30.278 -25.442 1.00 15.54 ? 640  PHE D CD2   1 
ATOM   8181  C  CE1   . PHE F 3 344 ? 115.129 -32.117 -24.851 1.00 16.50 ? 640  PHE D CE1   1 
ATOM   8182  C  CE2   . PHE F 3 344 ? 114.438 -30.062 -25.895 1.00 17.23 ? 640  PHE D CE2   1 
ATOM   8183  C  CZ    . PHE F 3 344 ? 115.440 -30.987 -25.596 1.00 14.68 ? 640  PHE D CZ    1 
ATOM   8184  N  N     . VAL F 3 345 ? 109.068 -34.299 -24.637 1.00 13.78 ? 641  VAL D N     1 
ATOM   8185  C  CA    . VAL F 3 345 ? 107.817 -34.869 -24.151 1.00 12.28 ? 641  VAL D CA    1 
ATOM   8186  C  C     . VAL F 3 345 ? 107.965 -35.958 -23.099 1.00 11.34 ? 641  VAL D C     1 
ATOM   8187  O  O     . VAL F 3 345 ? 109.062 -36.445 -22.847 1.00 10.44 ? 641  VAL D O     1 
ATOM   8188  C  CB    . VAL F 3 345 ? 107.030 -35.464 -25.327 1.00 13.73 ? 641  VAL D CB    1 
ATOM   8189  C  CG1   . VAL F 3 345 ? 106.780 -34.393 -26.387 1.00 13.97 ? 641  VAL D CG1   1 
ATOM   8190  C  CG2   . VAL F 3 345 ? 107.814 -36.629 -25.927 1.00 13.70 ? 641  VAL D CG2   1 
ATOM   8191  N  N     . PRO F 3 346 ? 106.847 -36.348 -22.465 1.00 11.49 ? 642  PRO D N     1 
ATOM   8192  C  CA    . PRO F 3 346 ? 106.855 -37.396 -21.443 1.00 13.19 ? 642  PRO D CA    1 
ATOM   8193  C  C     . PRO F 3 346 ? 107.283 -38.703 -22.100 1.00 14.59 ? 642  PRO D C     1 
ATOM   8194  O  O     . PRO F 3 346 ? 107.045 -38.905 -23.296 1.00 14.68 ? 642  PRO D O     1 
ATOM   8195  C  CB    . PRO F 3 346 ? 105.412 -37.418 -20.945 1.00 12.93 ? 642  PRO D CB    1 
ATOM   8196  C  CG    . PRO F 3 346 ? 104.969 -36.000 -21.132 1.00 12.99 ? 642  PRO D CG    1 
ATOM   8197  C  CD    . PRO F 3 346 ? 105.540 -35.663 -22.493 1.00 14.93 ? 642  PRO D CD    1 
ATOM   8198  N  N     . SER F 3 347 ? 107.898 -39.588 -21.322 1.00 13.99 ? 643  SER D N     1 
ATOM   8199  C  CA    . SER F 3 347 ? 108.382 -40.857 -21.850 1.00 15.85 ? 643  SER D CA    1 
ATOM   8200  C  C     . SER F 3 347 ? 107.304 -41.926 -21.988 1.00 18.08 ? 643  SER D C     1 
ATOM   8201  O  O     . SER F 3 347 ? 107.559 -42.997 -22.530 1.00 19.30 ? 643  SER D O     1 
ATOM   8202  C  CB    . SER F 3 347 ? 109.504 -41.392 -20.963 1.00 16.06 ? 643  SER D CB    1 
ATOM   8203  O  OG    . SER F 3 347 ? 109.010 -41.675 -19.666 1.00 19.02 ? 643  SER D OG    1 
ATOM   8204  N  N     . GLU F 3 348 ? 106.107 -41.644 -21.492 1.00 19.98 ? 644  GLU D N     1 
ATOM   8205  C  CA    . GLU F 3 348 ? 105.009 -42.601 -21.585 1.00 23.92 ? 644  GLU D CA    1 
ATOM   8206  C  C     . GLU F 3 348 ? 103.714 -41.879 -21.909 1.00 24.25 ? 644  GLU D C     1 
ATOM   8207  O  O     . GLU F 3 348 ? 103.557 -40.701 -21.597 1.00 22.09 ? 644  GLU D O     1 
ATOM   8208  C  CB    . GLU F 3 348 ? 104.850 -43.375 -20.269 1.00 27.34 ? 644  GLU D CB    1 
ATOM   8209  C  CG    . GLU F 3 348 ? 105.918 -44.434 -20.028 1.00 34.75 ? 644  GLU D CG    1 
ATOM   8210  C  CD    . GLU F 3 348 ? 105.753 -45.144 -18.694 1.00 38.91 ? 644  GLU D CD    1 
ATOM   8211  O  OE1   . GLU F 3 348 ? 104.640 -45.643 -18.415 1.00 40.99 ? 644  GLU D OE1   1 
ATOM   8212  O  OE2   . GLU F 3 348 ? 106.739 -45.208 -17.927 1.00 40.84 ? 644  GLU D OE2   1 
ATOM   8213  N  N     . SER F 3 349 ? 102.786 -42.589 -22.541 1.00 25.78 ? 645  SER D N     1 
ATOM   8214  C  CA    . SER F 3 349 ? 101.506 -41.996 -22.884 1.00 26.93 ? 645  SER D CA    1 
ATOM   8215  C  C     . SER F 3 349 ? 100.732 -41.706 -21.605 1.00 25.52 ? 645  SER D C     1 
ATOM   8216  O  O     . SER F 3 349 ? 100.808 -42.460 -20.631 1.00 25.29 ? 645  SER D O     1 
ATOM   8217  C  CB    . SER F 3 349 ? 100.703 -42.941 -23.783 1.00 29.85 ? 645  SER D CB    1 
ATOM   8218  O  OG    . SER F 3 349 ? 101.285 -43.021 -25.074 1.00 34.84 ? 645  SER D OG    1 
ATOM   8219  N  N     . ASP F 3 350 ? 99.993  -40.605 -21.613 1.00 25.29 ? 646  ASP D N     1 
ATOM   8220  C  CA    . ASP F 3 350 ? 99.200  -40.203 -20.459 1.00 25.36 ? 646  ASP D CA    1 
ATOM   8221  C  C     . ASP F 3 350 ? 100.042 -39.773 -19.260 1.00 24.27 ? 646  ASP D C     1 
ATOM   8222  O  O     . ASP F 3 350 ? 99.596  -39.841 -18.111 1.00 23.34 ? 646  ASP D O     1 
ATOM   8223  C  CB    . ASP F 3 350 ? 98.237  -41.321 -20.063 1.00 29.27 ? 646  ASP D CB    1 
ATOM   8224  C  CG    . ASP F 3 350 ? 97.200  -41.589 -21.135 1.00 32.30 ? 646  ASP D CG    1 
ATOM   8225  O  OD1   . ASP F 3 350 ? 96.568  -40.615 -21.598 1.00 33.74 ? 646  ASP D OD1   1 
ATOM   8226  O  OD2   . ASP F 3 350 ? 97.015  -42.767 -21.511 1.00 35.39 ? 646  ASP D OD2   1 
ATOM   8227  N  N     . TRP F 3 351 ? 101.266 -39.340 -19.543 1.00 21.74 ? 647  TRP D N     1 
ATOM   8228  C  CA    . TRP F 3 351 ? 102.163 -38.823 -18.518 1.00 18.68 ? 647  TRP D CA    1 
ATOM   8229  C  C     . TRP F 3 351 ? 102.314 -37.352 -18.871 1.00 16.08 ? 647  TRP D C     1 
ATOM   8230  O  O     . TRP F 3 351 ? 102.026 -36.954 -20.003 1.00 15.48 ? 647  TRP D O     1 
ATOM   8231  C  CB    . TRP F 3 351 ? 103.523 -39.523 -18.565 1.00 17.61 ? 647  TRP D CB    1 
ATOM   8232  C  CG    . TRP F 3 351 ? 103.566 -40.815 -17.804 1.00 16.45 ? 647  TRP D CG    1 
ATOM   8233  C  CD1   . TRP F 3 351 ? 102.638 -41.822 -17.836 1.00 16.23 ? 647  TRP D CD1   1 
ATOM   8234  C  CD2   . TRP F 3 351 ? 104.599 -41.252 -16.918 1.00 16.60 ? 647  TRP D CD2   1 
ATOM   8235  N  NE1   . TRP F 3 351 ? 103.032 -42.853 -17.024 1.00 14.78 ? 647  TRP D NE1   1 
ATOM   8236  C  CE2   . TRP F 3 351 ? 104.233 -42.533 -16.448 1.00 16.52 ? 647  TRP D CE2   1 
ATOM   8237  C  CE3   . TRP F 3 351 ? 105.804 -40.685 -16.474 1.00 16.61 ? 647  TRP D CE3   1 
ATOM   8238  C  CZ2   . TRP F 3 351 ? 105.028 -43.260 -15.555 1.00 16.83 ? 647  TRP D CZ2   1 
ATOM   8239  C  CZ3   . TRP F 3 351 ? 106.596 -41.409 -15.586 1.00 17.01 ? 647  TRP D CZ3   1 
ATOM   8240  C  CH2   . TRP F 3 351 ? 106.202 -42.685 -15.137 1.00 17.76 ? 647  TRP D CH2   1 
ATOM   8241  N  N     . LEU F 3 352 ? 102.761 -36.543 -17.915 1.00 13.28 ? 648  LEU D N     1 
ATOM   8242  C  CA    . LEU F 3 352 ? 102.927 -35.113 -18.151 1.00 12.70 ? 648  LEU D CA    1 
ATOM   8243  C  C     . LEU F 3 352 ? 104.259 -34.621 -17.601 1.00 12.32 ? 648  LEU D C     1 
ATOM   8244  O  O     . LEU F 3 352 ? 104.883 -35.296 -16.788 1.00 12.58 ? 648  LEU D O     1 
ATOM   8245  C  CB    . LEU F 3 352 ? 101.796 -34.333 -17.474 1.00 13.99 ? 648  LEU D CB    1 
ATOM   8246  C  CG    . LEU F 3 352 ? 100.368 -34.646 -17.931 1.00 15.35 ? 648  LEU D CG    1 
ATOM   8247  C  CD1   . LEU F 3 352 ? 99.352  -34.068 -16.944 1.00 15.26 ? 648  LEU D CD1   1 
ATOM   8248  C  CD2   . LEU F 3 352 ? 100.167 -34.082 -19.336 1.00 14.33 ? 648  LEU D CD2   1 
ATOM   8249  N  N     . ILE F 3 353 ? 104.680 -33.443 -18.054 1.00 11.76 ? 649  ILE D N     1 
ATOM   8250  C  CA    . ILE F 3 353 ? 105.915 -32.827 -17.583 1.00 13.60 ? 649  ILE D CA    1 
ATOM   8251  C  C     . ILE F 3 353 ? 105.511 -31.864 -16.466 1.00 14.24 ? 649  ILE D C     1 
ATOM   8252  O  O     . ILE F 3 353 ? 104.503 -31.162 -16.581 1.00 13.54 ? 649  ILE D O     1 
ATOM   8253  C  CB    . ILE F 3 353 ? 106.622 -32.019 -18.701 1.00 13.11 ? 649  ILE D CB    1 
ATOM   8254  C  CG1   . ILE F 3 353 ? 106.936 -32.928 -19.887 1.00 14.65 ? 649  ILE D CG1   1 
ATOM   8255  C  CG2   . ILE F 3 353 ? 107.918 -31.405 -18.165 1.00 12.79 ? 649  ILE D CG2   1 
ATOM   8256  C  CD1   . ILE F 3 353 ? 107.810 -34.116 -19.526 1.00 16.59 ? 649  ILE D CD1   1 
ATOM   8257  N  N     . PHE F 3 354 ? 106.292 -31.842 -15.390 1.00 14.31 ? 650  PHE D N     1 
ATOM   8258  C  CA    . PHE F 3 354 ? 106.028 -30.972 -14.242 1.00 13.29 ? 650  PHE D CA    1 
ATOM   8259  C  C     . PHE F 3 354 ? 107.317 -30.201 -13.965 1.00 13.62 ? 650  PHE D C     1 
ATOM   8260  O  O     . PHE F 3 354 ? 108.381 -30.806 -13.852 1.00 12.78 ? 650  PHE D O     1 
ATOM   8261  C  CB    . PHE F 3 354 ? 105.661 -31.817 -13.016 1.00 13.10 ? 650  PHE D CB    1 
ATOM   8262  C  CG    . PHE F 3 354 ? 105.284 -31.012 -11.798 1.00 13.83 ? 650  PHE D CG    1 
ATOM   8263  C  CD1   . PHE F 3 354 ? 103.951 -30.746 -11.509 1.00 15.26 ? 650  PHE D CD1   1 
ATOM   8264  C  CD2   . PHE F 3 354 ? 106.261 -30.540 -10.925 1.00 15.67 ? 650  PHE D CD2   1 
ATOM   8265  C  CE1   . PHE F 3 354 ? 103.594 -30.022 -10.364 1.00 16.19 ? 650  PHE D CE1   1 
ATOM   8266  C  CE2   . PHE F 3 354 ? 105.918 -29.818 -9.784  1.00 14.56 ? 650  PHE D CE2   1 
ATOM   8267  C  CZ    . PHE F 3 354 ? 104.581 -29.560 -9.503  1.00 15.28 ? 650  PHE D CZ    1 
ATOM   8268  N  N     . ALA F 3 355 ? 107.228 -28.879 -13.858 1.00 11.58 ? 651  ALA D N     1 
ATOM   8269  C  CA    . ALA F 3 355 ? 108.415 -28.066 -13.593 1.00 12.90 ? 651  ALA D CA    1 
ATOM   8270  C  C     . ALA F 3 355 ? 108.193 -27.112 -12.416 1.00 13.77 ? 651  ALA D C     1 
ATOM   8271  O  O     . ALA F 3 355 ? 107.174 -26.414 -12.361 1.00 12.14 ? 651  ALA D O     1 
ATOM   8272  C  CB    . ALA F 3 355 ? 108.793 -27.273 -14.844 1.00 14.32 ? 651  ALA D CB    1 
ATOM   8273  N  N     . ALA F 3 356 ? 109.146 -27.093 -11.484 1.00 11.94 ? 652  ALA D N     1 
ATOM   8274  C  CA    . ALA F 3 356 ? 109.088 -26.232 -10.298 1.00 12.31 ? 652  ALA D CA    1 
ATOM   8275  C  C     . ALA F 3 356 ? 110.345 -25.352 -10.269 1.00 13.81 ? 652  ALA D C     1 
ATOM   8276  O  O     . ALA F 3 356 ? 111.463 -25.854 -10.417 1.00 13.93 ? 652  ALA D O     1 
ATOM   8277  C  CB    . ALA F 3 356 ? 109.006 -27.081 -9.035  1.00 12.06 ? 652  ALA D CB    1 
ATOM   8278  N  N     . ASP F 3 357 ? 110.146 -24.053 -10.053 1.00 11.47 ? 653  ASP D N     1 
ATOM   8279  C  CA    . ASP F 3 357 ? 111.219 -23.050 -10.069 1.00 10.73 ? 653  ASP D CA    1 
ATOM   8280  C  C     . ASP F 3 357 ? 111.231 -22.216 -8.780  1.00 11.00 ? 653  ASP D C     1 
ATOM   8281  O  O     . ASP F 3 357 ? 110.189 -21.723 -8.356  1.00 8.55  ? 653  ASP D O     1 
ATOM   8282  C  CB    . ASP F 3 357 ? 110.976 -22.143 -11.286 1.00 14.18 ? 653  ASP D CB    1 
ATOM   8283  C  CG    . ASP F 3 357 ? 112.101 -21.149 -11.550 1.00 14.95 ? 653  ASP D CG    1 
ATOM   8284  O  OD1   . ASP F 3 357 ? 112.828 -20.748 -10.616 1.00 14.01 ? 653  ASP D OD1   1 
ATOM   8285  O  OD2   . ASP F 3 357 ? 112.241 -20.754 -12.730 1.00 17.25 ? 653  ASP D OD2   1 
ATOM   8286  N  N     . TYR F 3 358 ? 112.397 -22.065 -8.153  1.00 9.62  ? 654  TYR D N     1 
ATOM   8287  C  CA    . TYR F 3 358 ? 112.489 -21.244 -6.944  1.00 10.12 ? 654  TYR D CA    1 
ATOM   8288  C  C     . TYR F 3 358 ? 112.357 -19.772 -7.334  1.00 10.02 ? 654  TYR D C     1 
ATOM   8289  O  O     . TYR F 3 358 ? 113.084 -19.287 -8.202  1.00 11.37 ? 654  TYR D O     1 
ATOM   8290  C  CB    . TYR F 3 358 ? 113.837 -21.422 -6.240  1.00 8.42  ? 654  TYR D CB    1 
ATOM   8291  C  CG    . TYR F 3 358 ? 113.947 -22.648 -5.365  1.00 9.93  ? 654  TYR D CG    1 
ATOM   8292  C  CD1   . TYR F 3 358 ? 114.756 -23.722 -5.732  1.00 10.03 ? 654  TYR D CD1   1 
ATOM   8293  C  CD2   . TYR F 3 358 ? 113.276 -22.712 -4.144  1.00 9.53  ? 654  TYR D CD2   1 
ATOM   8294  C  CE1   . TYR F 3 358 ? 114.899 -24.834 -4.896  1.00 11.10 ? 654  TYR D CE1   1 
ATOM   8295  C  CE2   . TYR F 3 358 ? 113.408 -23.815 -3.305  1.00 10.03 ? 654  TYR D CE2   1 
ATOM   8296  C  CZ    . TYR F 3 358 ? 114.221 -24.869 -3.683  1.00 10.14 ? 654  TYR D CZ    1 
ATOM   8297  O  OH    . TYR F 3 358 ? 114.360 -25.950 -2.848  1.00 9.69  ? 654  TYR D OH    1 
ATOM   8298  N  N     . SER F 3 359 ? 111.440 -19.072 -6.675  1.00 11.16 ? 655  SER D N     1 
ATOM   8299  C  CA    . SER F 3 359 ? 111.201 -17.649 -6.916  1.00 11.27 ? 655  SER D CA    1 
ATOM   8300  C  C     . SER F 3 359 ? 112.343 -16.788 -6.357  1.00 10.95 ? 655  SER D C     1 
ATOM   8301  O  O     . SER F 3 359 ? 112.737 -16.947 -5.198  1.00 10.38 ? 655  SER D O     1 
ATOM   8302  C  CB    . SER F 3 359 ? 109.872 -17.248 -6.256  1.00 13.83 ? 655  SER D CB    1 
ATOM   8303  O  OG    . SER F 3 359 ? 109.749 -15.842 -6.120  1.00 15.02 ? 655  SER D OG    1 
ATOM   8304  N  N     . GLN F 3 360 ? 112.874 -15.889 -7.189  1.00 9.19  ? 656  GLN D N     1 
ATOM   8305  C  CA    . GLN F 3 360 ? 113.947 -14.972 -6.781  1.00 10.89 ? 656  GLN D CA    1 
ATOM   8306  C  C     . GLN F 3 360 ? 114.905 -15.647 -5.803  1.00 10.62 ? 656  GLN D C     1 
ATOM   8307  O  O     . GLN F 3 360 ? 115.265 -15.086 -4.765  1.00 8.60  ? 656  GLN D O     1 
ATOM   8308  C  CB    . GLN F 3 360 ? 113.324 -13.735 -6.122  1.00 12.29 ? 656  GLN D CB    1 
ATOM   8309  C  CG    . GLN F 3 360 ? 112.143 -13.174 -6.915  1.00 13.52 ? 656  GLN D CG    1 
ATOM   8310  C  CD    . GLN F 3 360 ? 111.356 -12.133 -6.149  1.00 15.99 ? 656  GLN D CD    1 
ATOM   8311  O  OE1   . GLN F 3 360 ? 111.807 -11.000 -5.967  1.00 18.41 ? 656  GLN D OE1   1 
ATOM   8312  N  NE2   . GLN F 3 360 ? 110.167 -12.515 -5.689  1.00 16.87 ? 656  GLN D NE2   1 
ATOM   8313  N  N     . ILE F 3 361 ? 115.341 -16.846 -6.157  1.00 10.13 ? 657  ILE D N     1 
ATOM   8314  C  CA    . ILE F 3 361 ? 116.192 -17.626 -5.274  1.00 9.40  ? 657  ILE D CA    1 
ATOM   8315  C  C     . ILE F 3 361 ? 117.431 -16.967 -4.674  1.00 7.67  ? 657  ILE D C     1 
ATOM   8316  O  O     . ILE F 3 361 ? 117.588 -16.968 -3.455  1.00 7.11  ? 657  ILE D O     1 
ATOM   8317  C  CB    . ILE F 3 361 ? 116.612 -18.965 -5.952  1.00 10.04 ? 657  ILE D CB    1 
ATOM   8318  C  CG1   . ILE F 3 361 ? 117.343 -19.856 -4.941  1.00 10.45 ? 657  ILE D CG1   1 
ATOM   8319  C  CG2   . ILE F 3 361 ? 117.510 -18.693 -7.157  1.00 8.56  ? 657  ILE D CG2   1 
ATOM   8320  C  CD1   . ILE F 3 361 ? 116.511 -20.260 -3.746  1.00 11.47 ? 657  ILE D CD1   1 
ATOM   8321  N  N     . GLU F 3 362 ? 118.313 -16.397 -5.492  1.00 7.68  ? 658  GLU D N     1 
ATOM   8322  C  CA    . GLU F 3 362 ? 119.522 -15.821 -4.915  1.00 7.27  ? 658  GLU D CA    1 
ATOM   8323  C  C     . GLU F 3 362 ? 119.311 -14.523 -4.148  1.00 8.31  ? 658  GLU D C     1 
ATOM   8324  O  O     . GLU F 3 362 ? 120.102 -14.193 -3.272  1.00 9.34  ? 658  GLU D O     1 
ATOM   8325  C  CB    . GLU F 3 362 ? 120.627 -15.720 -5.985  1.00 7.71  ? 658  GLU D CB    1 
ATOM   8326  C  CG    . GLU F 3 362 ? 121.188 -17.129 -6.286  1.00 8.69  ? 658  GLU D CG    1 
ATOM   8327  C  CD    . GLU F 3 362 ? 122.218 -17.190 -7.392  1.00 11.49 ? 658  GLU D CD    1 
ATOM   8328  O  OE1   . GLU F 3 362 ? 122.238 -18.222 -8.101  1.00 12.39 ? 658  GLU D OE1   1 
ATOM   8329  O  OE2   . GLU F 3 362 ? 123.004 -16.229 -7.550  1.00 12.74 ? 658  GLU D OE2   1 
ATOM   8330  N  N     . LEU F 3 363 ? 118.239 -13.796 -4.451  1.00 9.59  ? 659  LEU D N     1 
ATOM   8331  C  CA    . LEU F 3 363 ? 117.949 -12.586 -3.696  1.00 7.88  ? 659  LEU D CA    1 
ATOM   8332  C  C     . LEU F 3 363 ? 117.444 -13.023 -2.314  1.00 9.94  ? 659  LEU D C     1 
ATOM   8333  O  O     . LEU F 3 363 ? 117.753 -12.389 -1.310  1.00 8.04  ? 659  LEU D O     1 
ATOM   8334  C  CB    . LEU F 3 363 ? 116.894 -11.735 -4.401  1.00 8.96  ? 659  LEU D CB    1 
ATOM   8335  C  CG    . LEU F 3 363 ? 117.352 -11.079 -5.709  1.00 10.10 ? 659  LEU D CG    1 
ATOM   8336  C  CD1   . LEU F 3 363 ? 116.261 -10.160 -6.224  1.00 11.98 ? 659  LEU D CD1   1 
ATOM   8337  C  CD2   . LEU F 3 363 ? 118.632 -10.292 -5.467  1.00 9.97  ? 659  LEU D CD2   1 
ATOM   8338  N  N     . ARG F 3 364 ? 116.671 -14.109 -2.261  1.00 9.26  ? 660  ARG D N     1 
ATOM   8339  C  CA    . ARG F 3 364 ? 116.170 -14.611 -0.977  1.00 9.11  ? 660  ARG D CA    1 
ATOM   8340  C  C     . ARG F 3 364 ? 117.341 -15.137 -0.141  1.00 8.71  ? 660  ARG D C     1 
ATOM   8341  O  O     . ARG F 3 364 ? 117.404 -14.913 1.070   1.00 9.19  ? 660  ARG D O     1 
ATOM   8342  C  CB    . ARG F 3 364 ? 115.135 -15.729 -1.187  1.00 9.37  ? 660  ARG D CB    1 
ATOM   8343  C  CG    . ARG F 3 364 ? 113.815 -15.257 -1.792  1.00 8.39  ? 660  ARG D CG    1 
ATOM   8344  C  CD    . ARG F 3 364 ? 112.831 -16.413 -2.025  1.00 10.13 ? 660  ARG D CD    1 
ATOM   8345  N  NE    . ARG F 3 364 ? 111.648 -15.963 -2.763  1.00 11.21 ? 660  ARG D NE    1 
ATOM   8346  C  CZ    . ARG F 3 364 ? 110.494 -15.594 -2.208  1.00 12.56 ? 660  ARG D CZ    1 
ATOM   8347  N  NH1   . ARG F 3 364 ? 110.328 -15.623 -0.888  1.00 9.03  ? 660  ARG D NH1   1 
ATOM   8348  N  NH2   . ARG F 3 364 ? 109.501 -15.170 -2.983  1.00 12.07 ? 660  ARG D NH2   1 
ATOM   8349  N  N     . VAL F 3 365 ? 118.267 -15.839 -0.787  1.00 7.99  ? 661  VAL D N     1 
ATOM   8350  C  CA    . VAL F 3 365 ? 119.438 -16.363 -0.081  1.00 7.97  ? 661  VAL D CA    1 
ATOM   8351  C  C     . VAL F 3 365 ? 120.273 -15.192 0.432   1.00 9.11  ? 661  VAL D C     1 
ATOM   8352  O  O     . VAL F 3 365 ? 120.743 -15.200 1.570   1.00 7.68  ? 661  VAL D O     1 
ATOM   8353  C  CB    . VAL F 3 365 ? 120.297 -17.254 -1.013  1.00 9.37  ? 661  VAL D CB    1 
ATOM   8354  C  CG1   . VAL F 3 365 ? 121.635 -17.587 -0.355  1.00 6.50  ? 661  VAL D CG1   1 
ATOM   8355  C  CG2   . VAL F 3 365 ? 119.535 -18.546 -1.324  1.00 6.65  ? 661  VAL D CG2   1 
ATOM   8356  N  N     . LEU F 3 366 ? 120.433 -14.175 -0.410  1.00 9.66  ? 662  LEU D N     1 
ATOM   8357  C  CA    . LEU F 3 366 ? 121.199 -12.991 -0.043  1.00 9.91  ? 662  LEU D CA    1 
ATOM   8358  C  C     . LEU F 3 366 ? 120.551 -12.276 1.140   1.00 9.25  ? 662  LEU D C     1 
ATOM   8359  O  O     . LEU F 3 366 ? 121.246 -11.816 2.042   1.00 8.77  ? 662  LEU D O     1 
ATOM   8360  C  CB    . LEU F 3 366 ? 121.299 -12.034 -1.235  1.00 8.64  ? 662  LEU D CB    1 
ATOM   8361  C  CG    . LEU F 3 366 ? 121.990 -10.687 -0.989  1.00 9.52  ? 662  LEU D CG    1 
ATOM   8362  C  CD1   . LEU F 3 366 ? 123.428 -10.913 -0.510  1.00 10.51 ? 662  LEU D CD1   1 
ATOM   8363  C  CD2   . LEU F 3 366 ? 121.962 -9.864  -2.281  1.00 9.22  ? 662  LEU D CD2   1 
ATOM   8364  N  N     . ALA F 3 367 ? 119.222 -12.185 1.140   1.00 7.94  ? 663  ALA D N     1 
ATOM   8365  C  CA    . ALA F 3 367 ? 118.514 -11.516 2.241   1.00 8.29  ? 663  ALA D CA    1 
ATOM   8366  C  C     . ALA F 3 367 ? 118.837 -12.223 3.556   1.00 7.94  ? 663  ALA D C     1 
ATOM   8367  O  O     . ALA F 3 367 ? 119.109 -11.588 4.577   1.00 8.04  ? 663  ALA D O     1 
ATOM   8368  C  CB    . ALA F 3 367 ? 116.991 -11.535 1.988   1.00 6.81  ? 663  ALA D CB    1 
ATOM   8369  N  N     . HIS F 3 368 ? 118.818 -13.550 3.515   1.00 8.25  ? 664  HIS D N     1 
ATOM   8370  C  CA    . HIS F 3 368 ? 119.109 -14.363 4.687   1.00 7.94  ? 664  HIS D CA    1 
ATOM   8371  C  C     . HIS F 3 368 ? 120.555 -14.192 5.170   1.00 8.48  ? 664  HIS D C     1 
ATOM   8372  O  O     . HIS F 3 368 ? 120.807 -13.933 6.351   1.00 9.27  ? 664  HIS D O     1 
ATOM   8373  C  CB    . HIS F 3 368 ? 118.866 -15.845 4.365   1.00 7.45  ? 664  HIS D CB    1 
ATOM   8374  C  CG    . HIS F 3 368 ? 119.361 -16.776 5.427   1.00 10.73 ? 664  HIS D CG    1 
ATOM   8375  N  ND1   . HIS F 3 368 ? 118.586 -17.162 6.501   1.00 8.75  ? 664  HIS D ND1   1 
ATOM   8376  C  CD2   . HIS F 3 368 ? 120.562 -17.379 5.593   1.00 10.41 ? 664  HIS D CD2   1 
ATOM   8377  C  CE1   . HIS F 3 368 ? 119.289 -17.962 7.282   1.00 11.29 ? 664  HIS D CE1   1 
ATOM   8378  N  NE2   . HIS F 3 368 ? 120.492 -18.110 6.754   1.00 12.25 ? 664  HIS D NE2   1 
ATOM   8379  N  N     . ILE F 3 369 ? 121.501 -14.346 4.250   1.00 7.96  ? 665  ILE D N     1 
ATOM   8380  C  CA    . ILE F 3 369 ? 122.917 -14.244 4.584   1.00 9.65  ? 665  ILE D CA    1 
ATOM   8381  C  C     . ILE F 3 369 ? 123.358 -12.840 5.008   1.00 12.16 ? 665  ILE D C     1 
ATOM   8382  O  O     . ILE F 3 369 ? 124.075 -12.683 6.001   1.00 10.24 ? 665  ILE D O     1 
ATOM   8383  C  CB    . ILE F 3 369 ? 123.786 -14.759 3.402   1.00 10.29 ? 665  ILE D CB    1 
ATOM   8384  C  CG1   . ILE F 3 369 ? 123.560 -16.268 3.229   1.00 10.11 ? 665  ILE D CG1   1 
ATOM   8385  C  CG2   . ILE F 3 369 ? 125.279 -14.490 3.667   1.00 10.22 ? 665  ILE D CG2   1 
ATOM   8386  C  CD1   . ILE F 3 369 ? 124.282 -16.890 2.041   1.00 11.05 ? 665  ILE D CD1   1 
ATOM   8387  N  N     . ALA F 3 370 ? 122.923 -11.820 4.278   1.00 11.82 ? 666  ALA D N     1 
ATOM   8388  C  CA    . ALA F 3 370 ? 123.297 -10.445 4.618   1.00 12.32 ? 666  ALA D CA    1 
ATOM   8389  C  C     . ALA F 3 370 ? 122.475 -9.905  5.783   1.00 12.82 ? 666  ALA D C     1 
ATOM   8390  O  O     . ALA F 3 370 ? 122.865 -8.933  6.434   1.00 12.13 ? 666  ALA D O     1 
ATOM   8391  C  CB    . ALA F 3 370 ? 123.114 -9.538  3.400   1.00 10.97 ? 666  ALA D CB    1 
ATOM   8392  N  N     . GLU F 3 371 ? 121.346 -10.550 6.053   1.00 12.99 ? 667  GLU D N     1 
ATOM   8393  C  CA    . GLU F 3 371 ? 120.444 -10.118 7.110   1.00 13.49 ? 667  GLU D CA    1 
ATOM   8394  C  C     . GLU F 3 371 ? 120.086 -8.647  6.920   1.00 13.74 ? 667  GLU D C     1 
ATOM   8395  O  O     . GLU F 3 371 ? 120.138 -7.851  7.852   1.00 13.68 ? 667  GLU D O     1 
ATOM   8396  C  CB    . GLU F 3 371 ? 121.070 -10.347 8.490   1.00 17.04 ? 667  GLU D CB    1 
ATOM   8397  C  CG    . GLU F 3 371 ? 121.113 -11.814 8.886   1.00 20.07 ? 667  GLU D CG    1 
ATOM   8398  C  CD    . GLU F 3 371 ? 121.659 -12.041 10.282  1.00 23.02 ? 667  GLU D CD    1 
ATOM   8399  O  OE1   . GLU F 3 371 ? 121.097 -11.477 11.244  1.00 24.86 ? 667  GLU D OE1   1 
ATOM   8400  O  OE2   . GLU F 3 371 ? 122.647 -12.791 10.415  1.00 22.88 ? 667  GLU D OE2   1 
ATOM   8401  N  N     . ASP F 3 372 ? 119.729 -8.295  5.692   1.00 12.87 ? 668  ASP D N     1 
ATOM   8402  C  CA    . ASP F 3 372 ? 119.343 -6.931  5.363   1.00 13.12 ? 668  ASP D CA    1 
ATOM   8403  C  C     . ASP F 3 372 ? 117.865 -6.789  5.729   1.00 13.27 ? 668  ASP D C     1 
ATOM   8404  O  O     . ASP F 3 372 ? 117.018 -7.477  5.169   1.00 11.98 ? 668  ASP D O     1 
ATOM   8405  C  CB    . ASP F 3 372 ? 119.552 -6.682  3.867   1.00 13.42 ? 668  ASP D CB    1 
ATOM   8406  C  CG    . ASP F 3 372 ? 119.142 -5.292  3.448   1.00 16.13 ? 668  ASP D CG    1 
ATOM   8407  O  OD1   . ASP F 3 372 ? 117.925 -5.016  3.394   1.00 14.88 ? 668  ASP D OD1   1 
ATOM   8408  O  OD2   . ASP F 3 372 ? 120.045 -4.469  3.181   1.00 18.28 ? 668  ASP D OD2   1 
ATOM   8409  N  N     . ASP F 3 373 ? 117.565 -5.897  6.667   1.00 13.33 ? 669  ASP D N     1 
ATOM   8410  C  CA    . ASP F 3 373 ? 116.192 -5.699  7.123   1.00 15.33 ? 669  ASP D CA    1 
ATOM   8411  C  C     . ASP F 3 373 ? 115.148 -5.438  6.037   1.00 12.76 ? 669  ASP D C     1 
ATOM   8412  O  O     . ASP F 3 373 ? 114.078 -6.050  6.046   1.00 13.63 ? 669  ASP D O     1 
ATOM   8413  C  CB    . ASP F 3 373 ? 116.131 -4.566  8.151   1.00 18.86 ? 669  ASP D CB    1 
ATOM   8414  C  CG    . ASP F 3 373 ? 116.984 -4.842  9.375   1.00 23.94 ? 669  ASP D CG    1 
ATOM   8415  O  OD1   . ASP F 3 373 ? 116.948 -5.981  9.890   1.00 25.22 ? 669  ASP D OD1   1 
ATOM   8416  O  OD2   . ASP F 3 373 ? 117.690 -3.914  9.826   1.00 29.08 ? 669  ASP D OD2   1 
ATOM   8417  N  N     . ASN F 3 374 ? 115.438 -4.535  5.107   1.00 10.19 ? 670  ASN D N     1 
ATOM   8418  C  CA    . ASN F 3 374 ? 114.467 -4.234  4.071   1.00 12.65 ? 670  ASN D CA    1 
ATOM   8419  C  C     . ASN F 3 374 ? 114.261 -5.366  3.086   1.00 11.70 ? 670  ASN D C     1 
ATOM   8420  O  O     . ASN F 3 374 ? 113.133 -5.617  2.661   1.00 10.05 ? 670  ASN D O     1 
ATOM   8421  C  CB    . ASN F 3 374 ? 114.840 -2.951  3.315   1.00 13.94 ? 670  ASN D CB    1 
ATOM   8422  C  CG    . ASN F 3 374 ? 114.541 -1.698  4.121   1.00 20.05 ? 670  ASN D CG    1 
ATOM   8423  O  OD1   . ASN F 3 374 ? 113.658 -1.703  4.978   1.00 21.72 ? 670  ASN D OD1   1 
ATOM   8424  N  ND2   . ASN F 3 374 ? 115.269 -0.619  3.846   1.00 18.49 ? 670  ASN D ND2   1 
ATOM   8425  N  N     . LEU F 3 375 ? 115.343 -6.045  2.715   1.00 10.19 ? 671  LEU D N     1 
ATOM   8426  C  CA    . LEU F 3 375 ? 115.229 -7.152  1.772   1.00 9.78  ? 671  LEU D CA    1 
ATOM   8427  C  C     . LEU F 3 375 ? 114.512 -8.333  2.425   1.00 10.16 ? 671  LEU D C     1 
ATOM   8428  O  O     . LEU F 3 375 ? 113.743 -9.028  1.763   1.00 10.14 ? 671  LEU D O     1 
ATOM   8429  C  CB    . LEU F 3 375 ? 116.614 -7.585  1.260   1.00 10.67 ? 671  LEU D CB    1 
ATOM   8430  C  CG    . LEU F 3 375 ? 116.597 -8.471  0.005   1.00 10.71 ? 671  LEU D CG    1 
ATOM   8431  C  CD1   . LEU F 3 375 ? 115.882 -7.745  -1.141  1.00 10.69 ? 671  LEU D CD1   1 
ATOM   8432  C  CD2   . LEU F 3 375 ? 118.027 -8.809  -0.393  1.00 10.84 ? 671  LEU D CD2   1 
ATOM   8433  N  N     . MET F 3 376 ? 114.754 -8.575  3.712   1.00 9.42  ? 672  MET D N     1 
ATOM   8434  C  CA    . MET F 3 376 ? 114.055 -9.677  4.372   1.00 10.62 ? 672  MET D CA    1 
ATOM   8435  C  C     . MET F 3 376 ? 112.562 -9.347  4.469   1.00 10.29 ? 672  MET D C     1 
ATOM   8436  O  O     . MET F 3 376 ? 111.716 -10.211 4.265   1.00 10.02 ? 672  MET D O     1 
ATOM   8437  C  CB    . MET F 3 376 ? 114.619 -9.941  5.773   1.00 10.44 ? 672  MET D CB    1 
ATOM   8438  C  CG    . MET F 3 376 ? 116.029 -10.524 5.768   1.00 11.08 ? 672  MET D CG    1 
ATOM   8439  S  SD    . MET F 3 376 ? 116.574 -11.069 7.401   1.00 14.13 ? 672  MET D SD    1 
ATOM   8440  C  CE    . MET F 3 376 ? 116.944 -9.516  8.162   1.00 14.73 ? 672  MET D CE    1 
ATOM   8441  N  N     . GLU F 3 377 ? 112.246 -8.096  4.782   1.00 9.58  ? 673  GLU D N     1 
ATOM   8442  C  CA    . GLU F 3 377 ? 110.851 -7.662  4.883   1.00 9.47  ? 673  GLU D CA    1 
ATOM   8443  C  C     . GLU F 3 377 ? 110.182 -7.850  3.517   1.00 10.95 ? 673  GLU D C     1 
ATOM   8444  O  O     . GLU F 3 377 ? 109.060 -8.353  3.424   1.00 12.52 ? 673  GLU D O     1 
ATOM   8445  C  CB    . GLU F 3 377 ? 110.797 -6.187  5.313   1.00 10.68 ? 673  GLU D CB    1 
ATOM   8446  C  CG    . GLU F 3 377 ? 109.406 -5.520  5.290   1.00 11.39 ? 673  GLU D CG    1 
ATOM   8447  C  CD    . GLU F 3 377 ? 108.445 -6.078  6.326   1.00 11.04 ? 673  GLU D CD    1 
ATOM   8448  O  OE1   . GLU F 3 377 ? 108.908 -6.646  7.331   1.00 14.46 ? 673  GLU D OE1   1 
ATOM   8449  O  OE2   . GLU F 3 377 ? 107.217 -5.933  6.140   1.00 12.47 ? 673  GLU D OE2   1 
ATOM   8450  N  N     . ALA F 3 378 ? 110.879 -7.462  2.454   1.00 9.57  ? 674  ALA D N     1 
ATOM   8451  C  CA    . ALA F 3 378 ? 110.330 -7.603  1.112   1.00 10.56 ? 674  ALA D CA    1 
ATOM   8452  C  C     . ALA F 3 378 ? 109.919 -9.043  0.823   1.00 9.98  ? 674  ALA D C     1 
ATOM   8453  O  O     . ALA F 3 378 ? 108.828 -9.291  0.324   1.00 9.35  ? 674  ALA D O     1 
ATOM   8454  C  CB    . ALA F 3 378 ? 111.340 -7.131  0.068   1.00 9.73  ? 674  ALA D CB    1 
ATOM   8455  N  N     . PHE F 3 379 ? 110.781 -10.002 1.139   1.00 11.63 ? 675  PHE D N     1 
ATOM   8456  C  CA    . PHE F 3 379 ? 110.427 -11.386 0.862   1.00 11.19 ? 675  PHE D CA    1 
ATOM   8457  C  C     . PHE F 3 379 ? 109.412 -11.969 1.832   1.00 12.46 ? 675  PHE D C     1 
ATOM   8458  O  O     . PHE F 3 379 ? 108.703 -12.917 1.498   1.00 13.59 ? 675  PHE D O     1 
ATOM   8459  C  CB    . PHE F 3 379 ? 111.695 -12.236 0.769   1.00 10.83 ? 675  PHE D CB    1 
ATOM   8460  C  CG    . PHE F 3 379 ? 112.493 -11.931 -0.454  1.00 10.91 ? 675  PHE D CG    1 
ATOM   8461  C  CD1   . PHE F 3 379 ? 113.826 -11.545 -0.367  1.00 11.75 ? 675  PHE D CD1   1 
ATOM   8462  C  CD2   . PHE F 3 379 ? 111.886 -11.982 -1.709  1.00 10.98 ? 675  PHE D CD2   1 
ATOM   8463  C  CE1   . PHE F 3 379 ? 114.539 -11.209 -1.511  1.00 12.12 ? 675  PHE D CE1   1 
ATOM   8464  C  CE2   . PHE F 3 379 ? 112.594 -11.647 -2.857  1.00 13.33 ? 675  PHE D CE2   1 
ATOM   8465  C  CZ    . PHE F 3 379 ? 113.922 -11.259 -2.757  1.00 13.37 ? 675  PHE D CZ    1 
ATOM   8466  N  N     . ARG F 3 380 ? 109.323 -11.399 3.029   1.00 12.29 ? 676  ARG D N     1 
ATOM   8467  C  CA    . ARG F 3 380 ? 108.335 -11.872 3.984   1.00 12.53 ? 676  ARG D CA    1 
ATOM   8468  C  C     . ARG F 3 380 ? 106.966 -11.451 3.451   1.00 13.24 ? 676  ARG D C     1 
ATOM   8469  O  O     . ARG F 3 380 ? 105.954 -12.099 3.720   1.00 12.47 ? 676  ARG D O     1 
ATOM   8470  C  CB    . ARG F 3 380 ? 108.617 -11.288 5.377   1.00 13.58 ? 676  ARG D CB    1 
ATOM   8471  C  CG    . ARG F 3 380 ? 109.728 -12.049 6.086   1.00 16.93 ? 676  ARG D CG    1 
ATOM   8472  C  CD    . ARG F 3 380 ? 110.288 -11.338 7.304   1.00 18.40 ? 676  ARG D CD    1 
ATOM   8473  N  NE    . ARG F 3 380 ? 111.388 -12.120 7.867   1.00 19.31 ? 676  ARG D NE    1 
ATOM   8474  C  CZ    . ARG F 3 380 ? 112.254 -11.668 8.767   1.00 19.12 ? 676  ARG D CZ    1 
ATOM   8475  N  NH1   . ARG F 3 380 ? 112.162 -10.423 9.217   1.00 17.26 ? 676  ARG D NH1   1 
ATOM   8476  N  NH2   . ARG F 3 380 ? 113.203 -12.471 9.230   1.00 17.11 ? 676  ARG D NH2   1 
ATOM   8477  N  N     . ARG F 3 381 ? 106.946 -10.371 2.672   1.00 13.05 ? 677  ARG D N     1 
ATOM   8478  C  CA    . ARG F 3 381 ? 105.711 -9.885  2.060   1.00 13.29 ? 677  ARG D CA    1 
ATOM   8479  C  C     . ARG F 3 381 ? 105.534 -10.577 0.699   1.00 15.05 ? 677  ARG D C     1 
ATOM   8480  O  O     . ARG F 3 381 ? 104.568 -10.316 -0.020  1.00 12.53 ? 677  ARG D O     1 
ATOM   8481  C  CB    . ARG F 3 381 ? 105.773 -8.371  1.811   1.00 13.85 ? 677  ARG D CB    1 
ATOM   8482  C  CG    . ARG F 3 381 ? 105.915 -7.486  3.037   1.00 13.76 ? 677  ARG D CG    1 
ATOM   8483  C  CD    . ARG F 3 381 ? 105.876 -6.022  2.608   1.00 15.21 ? 677  ARG D CD    1 
ATOM   8484  N  NE    . ARG F 3 381 ? 106.232 -5.102  3.681   1.00 14.68 ? 677  ARG D NE    1 
ATOM   8485  C  CZ    . ARG F 3 381 ? 106.249 -3.779  3.551   1.00 14.67 ? 677  ARG D CZ    1 
ATOM   8486  N  NH1   . ARG F 3 381 ? 105.925 -3.220  2.392   1.00 14.12 ? 677  ARG D NH1   1 
ATOM   8487  N  NH2   . ARG F 3 381 ? 106.598 -3.016  4.579   1.00 14.40 ? 677  ARG D NH2   1 
ATOM   8488  N  N     . ASP F 3 382 ? 106.475 -11.455 0.362   1.00 13.67 ? 678  ASP D N     1 
ATOM   8489  C  CA    . ASP F 3 382 ? 106.490 -12.154 -0.922  1.00 15.30 ? 678  ASP D CA    1 
ATOM   8490  C  C     . ASP F 3 382 ? 106.411 -11.163 -2.089  1.00 15.23 ? 678  ASP D C     1 
ATOM   8491  O  O     . ASP F 3 382 ? 105.674 -11.372 -3.052  1.00 15.42 ? 678  ASP D O     1 
ATOM   8492  C  CB    . ASP F 3 382 ? 105.353 -13.184 -1.023  1.00 17.30 ? 678  ASP D CB    1 
ATOM   8493  C  CG    . ASP F 3 382 ? 105.468 -14.062 -2.270  1.00 19.49 ? 678  ASP D CG    1 
ATOM   8494  O  OD1   . ASP F 3 382 ? 106.601 -14.453 -2.630  1.00 21.48 ? 678  ASP D OD1   1 
ATOM   8495  O  OD2   . ASP F 3 382 ? 104.431 -14.372 -2.889  1.00 22.11 ? 678  ASP D OD2   1 
ATOM   8496  N  N     . LEU F 3 383 ? 107.177 -10.080 -1.996  1.00 15.60 ? 679  LEU D N     1 
ATOM   8497  C  CA    . LEU F 3 383 ? 107.205 -9.080  -3.057  1.00 16.04 ? 679  LEU D CA    1 
ATOM   8498  C  C     . LEU F 3 383 ? 108.092 -9.566  -4.195  1.00 15.49 ? 679  LEU D C     1 
ATOM   8499  O  O     . LEU F 3 383 ? 109.109 -10.216 -3.962  1.00 16.07 ? 679  LEU D O     1 
ATOM   8500  C  CB    . LEU F 3 383 ? 107.762 -7.753  -2.543  1.00 17.72 ? 679  LEU D CB    1 
ATOM   8501  C  CG    . LEU F 3 383 ? 107.065 -7.088  -1.359  1.00 19.15 ? 679  LEU D CG    1 
ATOM   8502  C  CD1   . LEU F 3 383 ? 107.756 -5.765  -1.063  1.00 20.80 ? 679  LEU D CD1   1 
ATOM   8503  C  CD2   . LEU F 3 383 ? 105.591 -6.873  -1.670  1.00 21.58 ? 679  LEU D CD2   1 
ATOM   8504  N  N     . ASP F 3 384 ? 107.705 -9.247  -5.423  1.00 15.72 ? 680  ASP D N     1 
ATOM   8505  C  CA    . ASP F 3 384 ? 108.486 -9.634  -6.589  1.00 16.71 ? 680  ASP D CA    1 
ATOM   8506  C  C     . ASP F 3 384 ? 109.429 -8.468  -6.868  1.00 16.70 ? 680  ASP D C     1 
ATOM   8507  O  O     . ASP F 3 384 ? 109.061 -7.507  -7.548  1.00 16.84 ? 680  ASP D O     1 
ATOM   8508  C  CB    . ASP F 3 384 ? 107.572 -9.867  -7.791  1.00 19.31 ? 680  ASP D CB    1 
ATOM   8509  C  CG    . ASP F 3 384 ? 108.323 -10.375 -9.009  1.00 22.32 ? 680  ASP D CG    1 
ATOM   8510  O  OD1   . ASP F 3 384 ? 109.572 -10.279 -9.042  1.00 22.16 ? 680  ASP D OD1   1 
ATOM   8511  O  OD2   . ASP F 3 384 ? 107.659 -10.865 -9.943  1.00 26.09 ? 680  ASP D OD2   1 
ATOM   8512  N  N     . ILE F 3 385 ? 110.642 -8.554  -6.329  1.00 15.53 ? 681  ILE D N     1 
ATOM   8513  C  CA    . ILE F 3 385 ? 111.638 -7.499  -6.500  1.00 14.83 ? 681  ILE D CA    1 
ATOM   8514  C  C     . ILE F 3 385 ? 112.055 -7.307  -7.958  1.00 14.24 ? 681  ILE D C     1 
ATOM   8515  O  O     . ILE F 3 385 ? 112.484 -6.216  -8.343  1.00 14.41 ? 681  ILE D O     1 
ATOM   8516  C  CB    . ILE F 3 385 ? 112.894 -7.776  -5.630  1.00 15.73 ? 681  ILE D CB    1 
ATOM   8517  C  CG1   . ILE F 3 385 ? 112.512 -7.774  -4.145  1.00 16.34 ? 681  ILE D CG1   1 
ATOM   8518  C  CG2   . ILE F 3 385 ? 113.956 -6.714  -5.886  1.00 14.51 ? 681  ILE D CG2   1 
ATOM   8519  C  CD1   . ILE F 3 385 ? 111.966 -6.434  -3.650  1.00 17.30 ? 681  ILE D CD1   1 
ATOM   8520  N  N     . HIS F 3 386 ? 111.941 -8.349  -8.777  1.00 13.49 ? 682  HIS D N     1 
ATOM   8521  C  CA    . HIS F 3 386 ? 112.310 -8.199  -10.183 1.00 13.64 ? 682  HIS D CA    1 
ATOM   8522  C  C     . HIS F 3 386 ? 111.305 -7.277  -10.867 1.00 14.96 ? 682  HIS D C     1 
ATOM   8523  O  O     . HIS F 3 386 ? 111.681 -6.367  -11.614 1.00 14.55 ? 682  HIS D O     1 
ATOM   8524  C  CB    . HIS F 3 386 ? 112.347 -9.556  -10.897 1.00 12.62 ? 682  HIS D CB    1 
ATOM   8525  C  CG    . HIS F 3 386 ? 113.417 -10.474 -10.391 1.00 12.34 ? 682  HIS D CG    1 
ATOM   8526  N  ND1   . HIS F 3 386 ? 114.653 -10.019 -9.982  1.00 9.98  ? 682  HIS D ND1   1 
ATOM   8527  C  CD2   . HIS F 3 386 ? 113.441 -11.821 -10.239 1.00 10.94 ? 682  HIS D CD2   1 
ATOM   8528  C  CE1   . HIS F 3 386 ? 115.391 -11.047 -9.598  1.00 12.35 ? 682  HIS D CE1   1 
ATOM   8529  N  NE2   . HIS F 3 386 ? 114.680 -12.151 -9.744  1.00 10.70 ? 682  HIS D NE2   1 
ATOM   8530  N  N     . THR F 3 387 ? 110.026 -7.504  -10.598 1.00 14.53 ? 683  THR D N     1 
ATOM   8531  C  CA    . THR F 3 387 ? 108.983 -6.680  -11.184 1.00 16.68 ? 683  THR D CA    1 
ATOM   8532  C  C     . THR F 3 387 ? 109.066 -5.263  -10.627 1.00 17.44 ? 683  THR D C     1 
ATOM   8533  O  O     . THR F 3 387 ? 108.919 -4.290  -11.368 1.00 17.80 ? 683  THR D O     1 
ATOM   8534  C  CB    . THR F 3 387 ? 107.593 -7.271  -10.905 1.00 16.36 ? 683  THR D CB    1 
ATOM   8535  O  OG1   . THR F 3 387 ? 107.445 -8.481  -11.653 1.00 14.89 ? 683  THR D OG1   1 
ATOM   8536  C  CG2   . THR F 3 387 ? 106.494 -6.285  -11.310 1.00 16.81 ? 683  THR D CG2   1 
ATOM   8537  N  N     . LYS F 3 388 ? 109.321 -5.147  -9.327  1.00 18.12 ? 684  LYS D N     1 
ATOM   8538  C  CA    . LYS F 3 388 ? 109.428 -3.833  -8.706  1.00 19.42 ? 684  LYS D CA    1 
ATOM   8539  C  C     . LYS F 3 388 ? 110.563 -3.035  -9.347  1.00 19.42 ? 684  LYS D C     1 
ATOM   8540  O  O     . LYS F 3 388 ? 110.432 -1.836  -9.578  1.00 18.68 ? 684  LYS D O     1 
ATOM   8541  C  CB    . LYS F 3 388 ? 109.663 -3.959  -7.203  1.00 21.78 ? 684  LYS D CB    1 
ATOM   8542  C  CG    . LYS F 3 388 ? 109.673 -2.614  -6.484  1.00 27.39 ? 684  LYS D CG    1 
ATOM   8543  C  CD    . LYS F 3 388 ? 109.856 -2.773  -4.982  1.00 31.75 ? 684  LYS D CD    1 
ATOM   8544  C  CE    . LYS F 3 388 ? 108.712 -3.566  -4.371  1.00 35.35 ? 684  LYS D CE    1 
ATOM   8545  N  NZ    . LYS F 3 388 ? 108.928 -3.829  -2.921  1.00 39.12 ? 684  LYS D NZ    1 
ATOM   8546  N  N     . THR F 3 389 ? 111.678 -3.700  -9.633  1.00 16.92 ? 685  THR D N     1 
ATOM   8547  C  CA    . THR F 3 389 ? 112.807 -3.033  -10.269 1.00 17.46 ? 685  THR D CA    1 
ATOM   8548  C  C     . THR F 3 389 ? 112.431 -2.662  -11.702 1.00 18.29 ? 685  THR D C     1 
ATOM   8549  O  O     . THR F 3 389 ? 112.800 -1.594  -12.193 1.00 18.21 ? 685  THR D O     1 
ATOM   8550  C  CB    . THR F 3 389 ? 114.061 -3.940  -10.265 1.00 17.14 ? 685  THR D CB    1 
ATOM   8551  O  OG1   . THR F 3 389 ? 114.557 -4.034  -8.924  1.00 17.07 ? 685  THR D OG1   1 
ATOM   8552  C  CG2   . THR F 3 389 ? 115.160 -3.375  -11.176 1.00 15.87 ? 685  THR D CG2   1 
ATOM   8553  N  N     . ALA F 3 390 ? 111.688 -3.542  -12.367 1.00 19.03 ? 686  ALA D N     1 
ATOM   8554  C  CA    . ALA F 3 390 ? 111.254 -3.282  -13.735 1.00 20.27 ? 686  ALA D CA    1 
ATOM   8555  C  C     . ALA F 3 390 ? 110.386 -2.020  -13.771 1.00 22.62 ? 686  ALA D C     1 
ATOM   8556  O  O     . ALA F 3 390 ? 110.510 -1.194  -14.677 1.00 21.14 ? 686  ALA D O     1 
ATOM   8557  C  CB    . ALA F 3 390 ? 110.471 -4.475  -14.270 1.00 19.64 ? 686  ALA D CB    1 
ATOM   8558  N  N     . MET F 3 391 ? 109.510 -1.874  -12.779 1.00 24.09 ? 687  MET D N     1 
ATOM   8559  C  CA    . MET F 3 391 ? 108.637 -0.706  -12.704 1.00 26.66 ? 687  MET D CA    1 
ATOM   8560  C  C     . MET F 3 391 ? 109.463 0.571   -12.614 1.00 28.62 ? 687  MET D C     1 
ATOM   8561  O  O     . MET F 3 391 ? 109.167 1.566   -13.277 1.00 28.46 ? 687  MET D O     1 
ATOM   8562  C  CB    . MET F 3 391 ? 107.723 -0.802  -11.483 1.00 26.60 ? 687  MET D CB    1 
ATOM   8563  C  CG    . MET F 3 391 ? 106.624 -1.838  -11.602 1.00 27.62 ? 687  MET D CG    1 
ATOM   8564  S  SD    . MET F 3 391 ? 105.851 -2.191  -10.014 1.00 28.38 ? 687  MET D SD    1 
ATOM   8565  C  CE    . MET F 3 391 ? 104.878 -0.685  -9.744  1.00 30.12 ? 687  MET D CE    1 
ATOM   8566  N  N     . ASP F 3 392 ? 110.509 0.529   -11.796 1.00 30.21 ? 688  ASP D N     1 
ATOM   8567  C  CA    . ASP F 3 392 ? 111.378 1.680   -11.593 1.00 32.37 ? 688  ASP D CA    1 
ATOM   8568  C  C     . ASP F 3 392 ? 112.240 2.019   -12.807 1.00 33.09 ? 688  ASP D C     1 
ATOM   8569  O  O     . ASP F 3 392 ? 112.311 3.180   -13.213 1.00 33.31 ? 688  ASP D O     1 
ATOM   8570  C  CB    . ASP F 3 392 ? 112.277 1.443   -10.377 1.00 34.62 ? 688  ASP D CB    1 
ATOM   8571  C  CG    . ASP F 3 392 ? 112.970 2.707   -9.907  1.00 37.18 ? 688  ASP D CG    1 
ATOM   8572  O  OD1   . ASP F 3 392 ? 112.278 3.624   -9.423  1.00 40.53 ? 688  ASP D OD1   1 
ATOM   8573  O  OD2   . ASP F 3 392 ? 114.207 2.789   -10.022 1.00 40.27 ? 688  ASP D OD2   1 
ATOM   8574  N  N     . ILE F 3 393 ? 112.893 1.018   -13.391 1.00 33.12 ? 689  ILE D N     1 
ATOM   8575  C  CA    . ILE F 3 393 ? 113.760 1.266   -14.544 1.00 34.06 ? 689  ILE D CA    1 
ATOM   8576  C  C     . ILE F 3 393 ? 113.010 1.613   -15.830 1.00 34.92 ? 689  ILE D C     1 
ATOM   8577  O  O     . ILE F 3 393 ? 113.492 2.410   -16.634 1.00 35.30 ? 689  ILE D O     1 
ATOM   8578  C  CB    . ILE F 3 393 ? 114.699 0.065   -14.830 1.00 34.11 ? 689  ILE D CB    1 
ATOM   8579  C  CG1   . ILE F 3 393 ? 113.887 -1.160  -15.242 1.00 34.19 ? 689  ILE D CG1   1 
ATOM   8580  C  CG2   . ILE F 3 393 ? 115.535 -0.246  -13.598 1.00 33.76 ? 689  ILE D CG2   1 
ATOM   8581  C  CD1   . ILE F 3 393 ? 114.743 -2.372  -15.562 1.00 35.66 ? 689  ILE D CD1   1 
ATOM   8582  N  N     . PHE F 3 394 ? 111.837 1.019   -16.025 1.00 34.01 ? 690  PHE D N     1 
ATOM   8583  C  CA    . PHE F 3 394 ? 111.042 1.286   -17.218 1.00 35.35 ? 690  PHE D CA    1 
ATOM   8584  C  C     . PHE F 3 394 ? 109.988 2.350   -16.930 1.00 36.78 ? 690  PHE D C     1 
ATOM   8585  O  O     . PHE F 3 394 ? 109.251 2.772   -17.822 1.00 36.72 ? 690  PHE D O     1 
ATOM   8586  C  CB    . PHE F 3 394 ? 110.370 0.001   -17.699 1.00 34.93 ? 690  PHE D CB    1 
ATOM   8587  C  CG    . PHE F 3 394 ? 111.332 -1.013  -18.253 1.00 34.90 ? 690  PHE D CG    1 
ATOM   8588  C  CD1   . PHE F 3 394 ? 111.974 -0.789  -19.467 1.00 35.07 ? 690  PHE D CD1   1 
ATOM   8589  C  CD2   . PHE F 3 394 ? 111.602 -2.188  -17.560 1.00 33.58 ? 690  PHE D CD2   1 
ATOM   8590  C  CE1   . PHE F 3 394 ? 112.873 -1.719  -19.984 1.00 35.70 ? 690  PHE D CE1   1 
ATOM   8591  C  CE2   . PHE F 3 394 ? 112.499 -3.125  -18.067 1.00 34.26 ? 690  PHE D CE2   1 
ATOM   8592  C  CZ    . PHE F 3 394 ? 113.135 -2.892  -19.281 1.00 35.63 ? 690  PHE D CZ    1 
ATOM   8593  N  N     . GLN F 3 395 ? 109.929 2.777   -15.674 1.00 37.48 ? 691  GLN D N     1 
ATOM   8594  C  CA    . GLN F 3 395 ? 108.980 3.792   -15.245 1.00 38.89 ? 691  GLN D CA    1 
ATOM   8595  C  C     . GLN F 3 395 ? 107.560 3.465   -15.709 1.00 38.02 ? 691  GLN D C     1 
ATOM   8596  O  O     . GLN F 3 395 ? 106.910 4.273   -16.379 1.00 37.72 ? 691  GLN D O     1 
ATOM   8597  C  CB    . GLN F 3 395 ? 109.407 5.163   -15.783 1.00 41.28 ? 691  GLN D CB    1 
ATOM   8598  C  CG    . GLN F 3 395 ? 108.586 6.311   -15.231 1.00 46.47 ? 691  GLN D CG    1 
ATOM   8599  C  CD    . GLN F 3 395 ? 108.754 6.475   -13.734 1.00 49.02 ? 691  GLN D CD    1 
ATOM   8600  O  OE1   . GLN F 3 395 ? 109.735 7.058   -13.268 1.00 51.10 ? 691  GLN D OE1   1 
ATOM   8601  N  NE2   . GLN F 3 395 ? 107.799 5.954   -12.969 1.00 50.22 ? 691  GLN D NE2   1 
ATOM   8602  N  N     . VAL F 3 396 ? 107.081 2.277   -15.353 1.00 35.88 ? 692  VAL D N     1 
ATOM   8603  C  CA    . VAL F 3 396 ? 105.737 1.858   -15.733 1.00 36.15 ? 692  VAL D CA    1 
ATOM   8604  C  C     . VAL F 3 396 ? 104.965 1.293   -14.547 1.00 36.16 ? 692  VAL D C     1 
ATOM   8605  O  O     . VAL F 3 396 ? 105.492 1.179   -13.439 1.00 34.32 ? 692  VAL D O     1 
ATOM   8606  C  CB    . VAL F 3 396 ? 105.765 0.781   -16.844 1.00 35.84 ? 692  VAL D CB    1 
ATOM   8607  C  CG1   . VAL F 3 396 ? 106.499 1.306   -18.063 1.00 36.61 ? 692  VAL D CG1   1 
ATOM   8608  C  CG2   . VAL F 3 396 ? 106.419 -0.489  -16.323 1.00 36.00 ? 692  VAL D CG2   1 
ATOM   8609  N  N     . SER F 3 397 ? 103.709 0.941   -14.800 1.00 36.40 ? 693  SER D N     1 
ATOM   8610  C  CA    . SER F 3 397 ? 102.833 0.379   -13.781 1.00 37.20 ? 693  SER D CA    1 
ATOM   8611  C  C     . SER F 3 397 ? 103.142 -1.104  -13.603 1.00 36.31 ? 693  SER D C     1 
ATOM   8612  O  O     . SER F 3 397 ? 103.761 -1.721  -14.468 1.00 35.67 ? 693  SER D O     1 
ATOM   8613  C  CB    . SER F 3 397 ? 101.373 0.558   -14.204 1.00 37.50 ? 693  SER D CB    1 
ATOM   8614  O  OG    . SER F 3 397 ? 100.491 -0.009  -13.255 1.00 39.89 ? 693  SER D OG    1 
ATOM   8615  N  N     . GLU F 3 398 ? 102.713 -1.675  -12.483 1.00 36.42 ? 694  GLU D N     1 
ATOM   8616  C  CA    . GLU F 3 398 ? 102.952 -3.089  -12.224 1.00 36.22 ? 694  GLU D CA    1 
ATOM   8617  C  C     . GLU F 3 398 ? 102.282 -3.958  -13.281 1.00 36.37 ? 694  GLU D C     1 
ATOM   8618  O  O     . GLU F 3 398 ? 102.833 -4.977  -13.696 1.00 34.08 ? 694  GLU D O     1 
ATOM   8619  C  CB    . GLU F 3 398 ? 102.430 -3.477  -10.841 1.00 36.75 ? 694  GLU D CB    1 
ATOM   8620  C  CG    . GLU F 3 398 ? 102.573 -4.956  -10.527 1.00 38.34 ? 694  GLU D CG    1 
ATOM   8621  C  CD    . GLU F 3 398 ? 102.185 -5.290  -9.100  1.00 40.17 ? 694  GLU D CD    1 
ATOM   8622  O  OE1   . GLU F 3 398 ? 101.809 -4.362  -8.352  1.00 41.05 ? 694  GLU D OE1   1 
ATOM   8623  O  OE2   . GLU F 3 398 ? 102.257 -6.480  -8.728  1.00 40.68 ? 694  GLU D OE2   1 
ATOM   8624  N  N     . ASP F 3 399 ? 101.094 -3.547  -13.715 1.00 36.93 ? 695  ASP D N     1 
ATOM   8625  C  CA    . ASP F 3 399 ? 100.353 -4.294  -14.725 1.00 38.04 ? 695  ASP D CA    1 
ATOM   8626  C  C     . ASP F 3 399 ? 101.006 -4.152  -16.094 1.00 37.22 ? 695  ASP D C     1 
ATOM   8627  O  O     . ASP F 3 399 ? 100.818 -4.996  -16.971 1.00 37.78 ? 695  ASP D O     1 
ATOM   8628  C  CB    . ASP F 3 399 ? 98.909  -3.794  -14.805 1.00 41.71 ? 695  ASP D CB    1 
ATOM   8629  C  CG    . ASP F 3 399 ? 98.234  -3.743  -13.452 1.00 45.67 ? 695  ASP D CG    1 
ATOM   8630  O  OD1   . ASP F 3 399 ? 98.263  -4.765  -12.732 1.00 48.89 ? 695  ASP D OD1   1 
ATOM   8631  O  OD2   . ASP F 3 399 ? 97.671  -2.680  -13.109 1.00 48.62 ? 695  ASP D OD2   1 
ATOM   8632  N  N     . GLU F 3 400 ? 101.771 -3.079  -16.270 1.00 35.72 ? 696  GLU D N     1 
ATOM   8633  C  CA    . GLU F 3 400 ? 102.449 -2.811  -17.534 1.00 34.47 ? 696  GLU D CA    1 
ATOM   8634  C  C     . GLU F 3 400 ? 103.775 -3.561  -17.682 1.00 33.02 ? 696  GLU D C     1 
ATOM   8635  O  O     . GLU F 3 400 ? 104.390 -3.537  -18.747 1.00 30.96 ? 696  GLU D O     1 
ATOM   8636  C  CB    . GLU F 3 400 ? 102.694 -1.305  -17.686 1.00 37.17 ? 696  GLU D CB    1 
ATOM   8637  C  CG    . GLU F 3 400 ? 101.425 -0.466  -17.795 1.00 40.26 ? 696  GLU D CG    1 
ATOM   8638  C  CD    . GLU F 3 400 ? 101.715 1.020   -17.936 1.00 42.40 ? 696  GLU D CD    1 
ATOM   8639  O  OE1   . GLU F 3 400 ? 102.278 1.615   -16.992 1.00 42.31 ? 696  GLU D OE1   1 
ATOM   8640  O  OE2   . GLU F 3 400 ? 101.384 1.594   -18.996 1.00 44.25 ? 696  GLU D OE2   1 
ATOM   8641  N  N     . VAL F 3 401 ? 104.221 -4.226  -16.621 1.00 30.39 ? 697  VAL D N     1 
ATOM   8642  C  CA    . VAL F 3 401 ? 105.474 -4.967  -16.699 1.00 28.65 ? 697  VAL D CA    1 
ATOM   8643  C  C     . VAL F 3 401 ? 105.289 -6.255  -17.497 1.00 27.99 ? 697  VAL D C     1 
ATOM   8644  O  O     . VAL F 3 401 ? 104.503 -7.125  -17.116 1.00 27.91 ? 697  VAL D O     1 
ATOM   8645  C  CB    . VAL F 3 401 ? 106.012 -5.327  -15.298 1.00 26.86 ? 697  VAL D CB    1 
ATOM   8646  C  CG1   . VAL F 3 401 ? 107.309 -6.124  -15.432 1.00 26.40 ? 697  VAL D CG1   1 
ATOM   8647  C  CG2   . VAL F 3 401 ? 106.255 -4.065  -14.495 1.00 25.58 ? 697  VAL D CG2   1 
ATOM   8648  N  N     . THR F 3 402 ? 106.013 -6.369  -18.606 1.00 28.19 ? 698  THR D N     1 
ATOM   8649  C  CA    . THR F 3 402 ? 105.939 -7.554  -19.457 1.00 28.40 ? 698  THR D CA    1 
ATOM   8650  C  C     . THR F 3 402 ? 106.991 -8.570  -19.031 1.00 28.37 ? 698  THR D C     1 
ATOM   8651  O  O     . THR F 3 402 ? 107.939 -8.233  -18.321 1.00 27.58 ? 698  THR D O     1 
ATOM   8652  C  CB    . THR F 3 402 ? 106.202 -7.216  -20.933 1.00 28.94 ? 698  THR D CB    1 
ATOM   8653  O  OG1   . THR F 3 402 ? 107.522 -6.672  -21.067 1.00 30.45 ? 698  THR D OG1   1 
ATOM   8654  C  CG2   . THR F 3 402 ? 105.177 -6.212  -21.448 1.00 29.92 ? 698  THR D CG2   1 
ATOM   8655  N  N     . PRO F 3 403 ? 106.835 -9.833  -19.460 1.00 28.71 ? 699  PRO D N     1 
ATOM   8656  C  CA    . PRO F 3 403 ? 107.807 -10.866 -19.099 1.00 28.73 ? 699  PRO D CA    1 
ATOM   8657  C  C     . PRO F 3 403 ? 109.218 -10.453 -19.507 1.00 29.09 ? 699  PRO D C     1 
ATOM   8658  O  O     . PRO F 3 403 ? 110.182 -10.711 -18.791 1.00 29.18 ? 699  PRO D O     1 
ATOM   8659  C  CB    . PRO F 3 403 ? 107.302 -12.095 -19.847 1.00 28.54 ? 699  PRO D CB    1 
ATOM   8660  C  CG    . PRO F 3 403 ? 105.814 -11.893 -19.833 1.00 28.61 ? 699  PRO D CG    1 
ATOM   8661  C  CD    . PRO F 3 403 ? 105.686 -10.422 -20.175 1.00 28.41 ? 699  PRO D CD    1 
ATOM   8662  N  N     . ASN F 3 404 ? 109.324 -9.802  -20.661 1.00 28.66 ? 700  ASN D N     1 
ATOM   8663  C  CA    . ASN F 3 404 ? 110.609 -9.348  -21.173 1.00 29.08 ? 700  ASN D CA    1 
ATOM   8664  C  C     . ASN F 3 404 ? 111.211 -8.308  -20.233 1.00 26.34 ? 700  ASN D C     1 
ATOM   8665  O  O     . ASN F 3 404 ? 112.416 -8.311  -19.977 1.00 25.11 ? 700  ASN D O     1 
ATOM   8666  C  CB    . ASN F 3 404 ? 110.430 -8.734  -22.563 1.00 34.06 ? 700  ASN D CB    1 
ATOM   8667  C  CG    . ASN F 3 404 ? 111.745 -8.504  -23.278 1.00 37.39 ? 700  ASN D CG    1 
ATOM   8668  O  OD1   . ASN F 3 404 ? 112.717 -8.029  -22.688 1.00 40.68 ? 700  ASN D OD1   1 
ATOM   8669  N  ND2   . ASN F 3 404 ? 111.781 -8.837  -24.563 1.00 41.08 ? 700  ASN D ND2   1 
ATOM   8670  N  N     . MET F 3 405 ? 110.368 -7.416  -19.722 1.00 23.97 ? 701  MET D N     1 
ATOM   8671  C  CA    . MET F 3 405 ? 110.835 -6.375  -18.811 1.00 22.67 ? 701  MET D CA    1 
ATOM   8672  C  C     . MET F 3 405 ? 111.289 -6.969  -17.481 1.00 20.28 ? 701  MET D C     1 
ATOM   8673  O  O     . MET F 3 405 ? 112.300 -6.551  -16.921 1.00 18.73 ? 701  MET D O     1 
ATOM   8674  C  CB    . MET F 3 405 ? 109.727 -5.348  -18.565 1.00 23.78 ? 701  MET D CB    1 
ATOM   8675  C  CG    . MET F 3 405 ? 109.403 -4.484  -19.775 1.00 26.88 ? 701  MET D CG    1 
ATOM   8676  S  SD    . MET F 3 405 ? 107.843 -3.598  -19.570 1.00 31.90 ? 701  MET D SD    1 
ATOM   8677  C  CE    . MET F 3 405 ? 108.301 -2.400  -18.388 1.00 27.38 ? 701  MET D CE    1 
ATOM   8678  N  N     . ARG F 3 406 ? 110.538 -7.943  -16.975 1.00 19.36 ? 702  ARG D N     1 
ATOM   8679  C  CA    . ARG F 3 406 ? 110.903 -8.577  -15.710 1.00 18.65 ? 702  ARG D CA    1 
ATOM   8680  C  C     . ARG F 3 406 ? 112.263 -9.252  -15.845 1.00 17.87 ? 702  ARG D C     1 
ATOM   8681  O  O     . ARG F 3 406 ? 113.098 -9.150  -14.950 1.00 16.34 ? 702  ARG D O     1 
ATOM   8682  C  CB    . ARG F 3 406 ? 109.847 -9.609  -15.287 1.00 19.00 ? 702  ARG D CB    1 
ATOM   8683  C  CG    . ARG F 3 406 ? 110.126 -10.251 -13.926 1.00 17.80 ? 702  ARG D CG    1 
ATOM   8684  C  CD    . ARG F 3 406 ? 108.945 -11.075 -13.415 1.00 16.75 ? 702  ARG D CD    1 
ATOM   8685  N  NE    . ARG F 3 406 ? 109.200 -11.635 -12.083 1.00 15.66 ? 702  ARG D NE    1 
ATOM   8686  C  CZ    . ARG F 3 406 ? 110.002 -12.672 -11.837 1.00 14.98 ? 702  ARG D CZ    1 
ATOM   8687  N  NH1   . ARG F 3 406 ? 110.635 -13.279 -12.831 1.00 13.56 ? 702  ARG D NH1   1 
ATOM   8688  N  NH2   . ARG F 3 406 ? 110.174 -13.104 -10.592 1.00 11.91 ? 702  ARG D NH2   1 
ATOM   8689  N  N     . ARG F 3 407 ? 112.488 -9.932  -16.967 1.00 18.05 ? 703  ARG D N     1 
ATOM   8690  C  CA    . ARG F 3 407 ? 113.759 -10.613 -17.189 1.00 19.64 ? 703  ARG D CA    1 
ATOM   8691  C  C     . ARG F 3 407 ? 114.906 -9.613  -17.224 1.00 19.66 ? 703  ARG D C     1 
ATOM   8692  O  O     . ARG F 3 407 ? 115.976 -9.857  -16.664 1.00 18.71 ? 703  ARG D O     1 
ATOM   8693  C  CB    . ARG F 3 407 ? 113.731 -11.418 -18.493 1.00 22.44 ? 703  ARG D CB    1 
ATOM   8694  C  CG    . ARG F 3 407 ? 112.994 -12.742 -18.403 1.00 26.46 ? 703  ARG D CG    1 
ATOM   8695  C  CD    . ARG F 3 407 ? 113.312 -13.628 -19.611 1.00 30.69 ? 703  ARG D CD    1 
ATOM   8696  N  NE    . ARG F 3 407 ? 112.720 -13.117 -20.845 1.00 32.37 ? 703  ARG D NE    1 
ATOM   8697  C  CZ    . ARG F 3 407 ? 111.436 -13.246 -21.169 1.00 34.36 ? 703  ARG D CZ    1 
ATOM   8698  N  NH1   . ARG F 3 407 ? 110.600 -13.879 -20.354 1.00 35.28 ? 703  ARG D NH1   1 
ATOM   8699  N  NH2   . ARG F 3 407 ? 110.984 -12.729 -22.304 1.00 35.45 ? 703  ARG D NH2   1 
ATOM   8700  N  N     . GLN F 3 408 ? 114.682 -8.483  -17.884 1.00 18.67 ? 704  GLN D N     1 
ATOM   8701  C  CA    . GLN F 3 408 ? 115.703 -7.451  -17.965 1.00 19.49 ? 704  GLN D CA    1 
ATOM   8702  C  C     . GLN F 3 408 ? 115.973 -6.893  -16.566 1.00 17.11 ? 704  GLN D C     1 
ATOM   8703  O  O     . GLN F 3 408 ? 117.118 -6.663  -16.190 1.00 16.82 ? 704  GLN D O     1 
ATOM   8704  C  CB    . GLN F 3 408 ? 115.241 -6.333  -18.904 1.00 23.17 ? 704  GLN D CB    1 
ATOM   8705  C  CG    . GLN F 3 408 ? 115.244 -6.725  -20.379 1.00 28.54 ? 704  GLN D CG    1 
ATOM   8706  C  CD    . GLN F 3 408 ? 114.560 -5.689  -21.257 1.00 31.99 ? 704  GLN D CD    1 
ATOM   8707  O  OE1   . GLN F 3 408 ? 113.352 -5.756  -21.498 1.00 32.58 ? 704  GLN D OE1   1 
ATOM   8708  N  NE2   . GLN F 3 408 ? 115.330 -4.713  -21.724 1.00 33.37 ? 704  GLN D NE2   1 
ATOM   8709  N  N     . ALA F 3 409 ? 114.909 -6.686  -15.800 1.00 16.20 ? 705  ALA D N     1 
ATOM   8710  C  CA    . ALA F 3 409 ? 115.042 -6.168  -14.445 1.00 15.55 ? 705  ALA D CA    1 
ATOM   8711  C  C     . ALA F 3 409 ? 115.757 -7.191  -13.562 1.00 14.87 ? 705  ALA D C     1 
ATOM   8712  O  O     . ALA F 3 409 ? 116.529 -6.826  -12.672 1.00 12.65 ? 705  ALA D O     1 
ATOM   8713  C  CB    . ALA F 3 409 ? 113.672 -5.846  -13.876 1.00 15.59 ? 705  ALA D CB    1 
ATOM   8714  N  N     . LYS F 3 410 ? 115.493 -8.470  -13.816 1.00 15.04 ? 706  LYS D N     1 
ATOM   8715  C  CA    . LYS F 3 410 ? 116.126 -9.545  -13.057 1.00 15.80 ? 706  LYS D CA    1 
ATOM   8716  C  C     . LYS F 3 410 ? 117.640 -9.474  -13.249 1.00 14.72 ? 706  LYS D C     1 
ATOM   8717  O  O     . LYS F 3 410 ? 118.400 -9.554  -12.287 1.00 15.30 ? 706  LYS D O     1 
ATOM   8718  C  CB    . LYS F 3 410 ? 115.623 -10.910 -13.535 1.00 16.07 ? 706  LYS D CB    1 
ATOM   8719  C  CG    . LYS F 3 410 ? 116.222 -12.081 -12.765 1.00 15.31 ? 706  LYS D CG    1 
ATOM   8720  C  CD    . LYS F 3 410 ? 115.975 -13.419 -13.449 1.00 20.47 ? 706  LYS D CD    1 
ATOM   8721  C  CE    . LYS F 3 410 ? 114.528 -13.613 -13.857 1.00 19.21 ? 706  LYS D CE    1 
ATOM   8722  N  NZ    . LYS F 3 410 ? 114.279 -14.983 -14.393 1.00 19.92 ? 706  LYS D NZ    1 
ATOM   8723  N  N     . ALA F 3 411 ? 118.078 -9.327  -14.496 1.00 15.59 ? 707  ALA D N     1 
ATOM   8724  C  CA    . ALA F 3 411 ? 119.511 -9.240  -14.780 1.00 16.20 ? 707  ALA D CA    1 
ATOM   8725  C  C     . ALA F 3 411 ? 120.094 -8.023  -14.075 1.00 15.33 ? 707  ALA D C     1 
ATOM   8726  O  O     . ALA F 3 411 ? 121.211 -8.073  -13.561 1.00 15.25 ? 707  ALA D O     1 
ATOM   8727  C  CB    . ALA F 3 411 ? 119.758 -9.147  -16.288 1.00 15.39 ? 707  ALA D CB    1 
ATOM   8728  N  N     . VAL F 3 412 ? 119.327 -6.933  -14.043 1.00 14.08 ? 708  VAL D N     1 
ATOM   8729  C  CA    . VAL F 3 412 ? 119.765 -5.705  -13.385 1.00 12.66 ? 708  VAL D CA    1 
ATOM   8730  C  C     . VAL F 3 412 ? 119.916 -5.917  -11.876 1.00 12.75 ? 708  VAL D C     1 
ATOM   8731  O  O     . VAL F 3 412 ? 120.921 -5.517  -11.290 1.00 11.88 ? 708  VAL D O     1 
ATOM   8732  C  CB    . VAL F 3 412 ? 118.773 -4.537  -13.629 1.00 12.71 ? 708  VAL D CB    1 
ATOM   8733  C  CG1   . VAL F 3 412 ? 119.137 -3.340  -12.743 1.00 12.71 ? 708  VAL D CG1   1 
ATOM   8734  C  CG2   . VAL F 3 412 ? 118.804 -4.134  -15.104 1.00 11.54 ? 708  VAL D CG2   1 
ATOM   8735  N  N     . ASN F 3 413 ? 118.922 -6.540  -11.248 1.00 10.61 ? 709  ASN D N     1 
ATOM   8736  C  CA    . ASN F 3 413 ? 118.998 -6.794  -9.809  1.00 11.71 ? 709  ASN D CA    1 
ATOM   8737  C  C     . ASN F 3 413 ? 120.249 -7.603  -9.448  1.00 11.18 ? 709  ASN D C     1 
ATOM   8738  O  O     . ASN F 3 413 ? 121.011 -7.220  -8.562  1.00 10.51 ? 709  ASN D O     1 
ATOM   8739  C  CB    . ASN F 3 413 ? 117.750 -7.539  -9.310  1.00 10.57 ? 709  ASN D CB    1 
ATOM   8740  C  CG    . ASN F 3 413 ? 116.562 -6.618  -9.102  1.00 12.12 ? 709  ASN D CG    1 
ATOM   8741  O  OD1   . ASN F 3 413 ? 116.725 -5.468  -8.696  1.00 13.65 ? 709  ASN D OD1   1 
ATOM   8742  N  ND2   . ASN F 3 413 ? 115.357 -7.122  -9.366  1.00 9.52  ? 709  ASN D ND2   1 
ATOM   8743  N  N     . TYR F 3 414 ? 120.470 -8.722  -10.134 1.00 12.13 ? 710  TYR D N     1 
ATOM   8744  C  CA    . TYR F 3 414 ? 121.639 -9.534  -9.831  1.00 10.37 ? 710  TYR D CA    1 
ATOM   8745  C  C     . TYR F 3 414 ? 122.948 -8.840  -10.186 1.00 12.25 ? 710  TYR D C     1 
ATOM   8746  O  O     . TYR F 3 414 ? 123.942 -8.971  -9.467  1.00 11.98 ? 710  TYR D O     1 
ATOM   8747  C  CB    . TYR F 3 414 ? 121.529 -10.901 -10.512 1.00 9.89  ? 710  TYR D CB    1 
ATOM   8748  C  CG    . TYR F 3 414 ? 120.526 -11.794 -9.812  1.00 9.65  ? 710  TYR D CG    1 
ATOM   8749  C  CD1   . TYR F 3 414 ? 120.687 -12.116 -8.461  1.00 10.01 ? 710  TYR D CD1   1 
ATOM   8750  C  CD2   . TYR F 3 414 ? 119.395 -12.278 -10.475 1.00 10.01 ? 710  TYR D CD2   1 
ATOM   8751  C  CE1   . TYR F 3 414 ? 119.750 -12.892 -7.783  1.00 9.49  ? 710  TYR D CE1   1 
ATOM   8752  C  CE2   . TYR F 3 414 ? 118.445 -13.065 -9.803  1.00 9.33  ? 710  TYR D CE2   1 
ATOM   8753  C  CZ    . TYR F 3 414 ? 118.635 -13.363 -8.455  1.00 8.53  ? 710  TYR D CZ    1 
ATOM   8754  O  OH    . TYR F 3 414 ? 117.718 -14.125 -7.773  1.00 8.37  ? 710  TYR D OH    1 
ATOM   8755  N  N     . GLY F 3 415 ? 122.949 -8.089  -11.283 1.00 12.35 ? 711  GLY D N     1 
ATOM   8756  C  CA    . GLY F 3 415 ? 124.156 -7.377  -11.665 1.00 12.01 ? 711  GLY D CA    1 
ATOM   8757  C  C     . GLY F 3 415 ? 124.564 -6.407  -10.570 1.00 12.47 ? 711  GLY D C     1 
ATOM   8758  O  O     . GLY F 3 415 ? 125.734 -6.327  -10.190 1.00 12.12 ? 711  GLY D O     1 
ATOM   8759  N  N     . ILE F 3 416 ? 123.594 -5.670  -10.041 1.00 12.86 ? 712  ILE D N     1 
ATOM   8760  C  CA    . ILE F 3 416 ? 123.897 -4.706  -8.997  1.00 11.73 ? 712  ILE D CA    1 
ATOM   8761  C  C     . ILE F 3 416 ? 124.392 -5.353  -7.705  1.00 11.74 ? 712  ILE D C     1 
ATOM   8762  O  O     . ILE F 3 416 ? 125.453 -4.982  -7.207  1.00 10.93 ? 712  ILE D O     1 
ATOM   8763  C  CB    . ILE F 3 416 ? 122.677 -3.796  -8.704  1.00 12.90 ? 712  ILE D CB    1 
ATOM   8764  C  CG1   . ILE F 3 416 ? 122.403 -2.913  -9.926  1.00 13.81 ? 712  ILE D CG1   1 
ATOM   8765  C  CG2   . ILE F 3 416 ? 122.946 -2.916  -7.479  1.00 14.01 ? 712  ILE D CG2   1 
ATOM   8766  C  CD1   . ILE F 3 416 ? 121.160 -2.046  -9.803  1.00 14.41 ? 712  ILE D CD1   1 
ATOM   8767  N  N     . VAL F 3 417 ? 123.660 -6.329  -7.172  1.00 12.26 ? 713  VAL D N     1 
ATOM   8768  C  CA    . VAL F 3 417 ? 124.095 -6.951  -5.923  1.00 11.53 ? 713  VAL D CA    1 
ATOM   8769  C  C     . VAL F 3 417 ? 125.429 -7.680  -6.067  1.00 12.39 ? 713  VAL D C     1 
ATOM   8770  O  O     . VAL F 3 417 ? 126.137 -7.879  -5.077  1.00 12.71 ? 713  VAL D O     1 
ATOM   8771  C  CB    . VAL F 3 417 ? 123.033 -7.940  -5.346  1.00 11.89 ? 713  VAL D CB    1 
ATOM   8772  C  CG1   . VAL F 3 417 ? 121.705 -7.219  -5.148  1.00 11.52 ? 713  VAL D CG1   1 
ATOM   8773  C  CG2   . VAL F 3 417 ? 122.868 -9.143  -6.254  1.00 12.11 ? 713  VAL D CG2   1 
ATOM   8774  N  N     . TYR F 3 418 ? 125.784 -8.059  -7.292  1.00 12.74 ? 714  TYR D N     1 
ATOM   8775  C  CA    . TYR F 3 418 ? 127.045 -8.759  -7.506  1.00 11.75 ? 714  TYR D CA    1 
ATOM   8776  C  C     . TYR F 3 418 ? 128.190 -7.873  -8.016  1.00 13.40 ? 714  TYR D C     1 
ATOM   8777  O  O     . TYR F 3 418 ? 129.170 -8.363  -8.590  1.00 13.30 ? 714  TYR D O     1 
ATOM   8778  C  CB    . TYR F 3 418 ? 126.835 -9.975  -8.422  1.00 10.86 ? 714  TYR D CB    1 
ATOM   8779  C  CG    . TYR F 3 418 ? 125.999 -11.085 -7.786  1.00 9.03  ? 714  TYR D CG    1 
ATOM   8780  C  CD1   . TYR F 3 418 ? 126.243 -11.508 -6.477  1.00 9.66  ? 714  TYR D CD1   1 
ATOM   8781  C  CD2   . TYR F 3 418 ? 124.980 -11.720 -8.502  1.00 8.89  ? 714  TYR D CD2   1 
ATOM   8782  C  CE1   . TYR F 3 418 ? 125.496 -12.540 -5.895  1.00 10.30 ? 714  TYR D CE1   1 
ATOM   8783  C  CE2   . TYR F 3 418 ? 124.226 -12.752 -7.932  1.00 8.28  ? 714  TYR D CE2   1 
ATOM   8784  C  CZ    . TYR F 3 418 ? 124.490 -13.156 -6.630  1.00 10.89 ? 714  TYR D CZ    1 
ATOM   8785  O  OH    . TYR F 3 418 ? 123.756 -14.179 -6.069  1.00 11.61 ? 714  TYR D OH    1 
ATOM   8786  N  N     . GLY F 3 419 ? 128.057 -6.564  -7.811  1.00 12.73 ? 715  GLY D N     1 
ATOM   8787  C  CA    . GLY F 3 419 ? 129.134 -5.646  -8.161  1.00 13.71 ? 715  GLY D CA    1 
ATOM   8788  C  C     . GLY F 3 419 ? 129.264 -4.935  -9.495  1.00 13.77 ? 715  GLY D C     1 
ATOM   8789  O  O     . GLY F 3 419 ? 130.345 -4.429  -9.798  1.00 13.93 ? 715  GLY D O     1 
ATOM   8790  N  N     . ILE F 3 420 ? 128.203 -4.863  -10.286 1.00 12.31 ? 716  ILE D N     1 
ATOM   8791  C  CA    . ILE F 3 420 ? 128.298 -4.181  -11.576 1.00 13.05 ? 716  ILE D CA    1 
ATOM   8792  C  C     . ILE F 3 420 ? 128.641 -2.703  -11.336 1.00 14.43 ? 716  ILE D C     1 
ATOM   8793  O  O     . ILE F 3 420 ? 128.201 -2.114  -10.349 1.00 13.86 ? 716  ILE D O     1 
ATOM   8794  C  CB    . ILE F 3 420 ? 126.965 -4.304  -12.370 1.00 12.97 ? 716  ILE D CB    1 
ATOM   8795  C  CG1   . ILE F 3 420 ? 127.210 -4.009  -13.850 1.00 13.05 ? 716  ILE D CG1   1 
ATOM   8796  C  CG2   . ILE F 3 420 ? 125.910 -3.338  -11.814 1.00 13.61 ? 716  ILE D CG2   1 
ATOM   8797  C  CD1   . ILE F 3 420 ? 125.984 -4.245  -14.726 1.00 13.18 ? 716  ILE D CD1   1 
ATOM   8798  N  N     . SER F 3 421 ? 129.431 -2.108  -12.228 1.00 15.30 ? 717  SER D N     1 
ATOM   8799  C  CA    . SER F 3 421 ? 129.806 -0.699  -12.082 1.00 15.30 ? 717  SER D CA    1 
ATOM   8800  C  C     . SER F 3 421 ? 128.798 0.192   -12.789 1.00 15.42 ? 717  SER D C     1 
ATOM   8801  O  O     . SER F 3 421 ? 127.943 -0.292  -13.531 1.00 15.20 ? 717  SER D O     1 
ATOM   8802  C  CB    . SER F 3 421 ? 131.203 -0.440  -12.669 1.00 14.12 ? 717  SER D CB    1 
ATOM   8803  O  OG    . SER F 3 421 ? 131.220 -0.636  -14.075 1.00 14.75 ? 717  SER D OG    1 
ATOM   8804  N  N     . ASP F 3 422 ? 128.895 1.497   -12.563 1.00 15.03 ? 718  ASP D N     1 
ATOM   8805  C  CA    . ASP F 3 422 ? 127.979 2.424   -13.215 1.00 17.23 ? 718  ASP D CA    1 
ATOM   8806  C  C     . ASP F 3 422 ? 128.153 2.297   -14.728 1.00 16.35 ? 718  ASP D C     1 
ATOM   8807  O  O     . ASP F 3 422 ? 127.189 2.406   -15.480 1.00 17.10 ? 718  ASP D O     1 
ATOM   8808  C  CB    . ASP F 3 422 ? 128.243 3.861   -12.741 1.00 20.60 ? 718  ASP D CB    1 
ATOM   8809  C  CG    . ASP F 3 422 ? 129.615 4.374   -13.133 1.00 24.42 ? 718  ASP D CG    1 
ATOM   8810  O  OD1   . ASP F 3 422 ? 130.603 3.622   -13.021 1.00 27.50 ? 718  ASP D OD1   1 
ATOM   8811  O  OD2   . ASP F 3 422 ? 129.707 5.547   -13.550 1.00 29.31 ? 718  ASP D OD2   1 
ATOM   8812  N  N     . TYR F 3 423 ? 129.383 2.037   -15.166 1.00 17.56 ? 719  TYR D N     1 
ATOM   8813  C  CA    . TYR F 3 423 ? 129.667 1.878   -16.592 1.00 17.96 ? 719  TYR D CA    1 
ATOM   8814  C  C     . TYR F 3 423 ? 128.943 0.652   -17.150 1.00 17.61 ? 719  TYR D C     1 
ATOM   8815  O  O     . TYR F 3 423 ? 128.276 0.721   -18.182 1.00 18.13 ? 719  TYR D O     1 
ATOM   8816  C  CB    . TYR F 3 423 ? 131.173 1.720   -16.828 1.00 20.38 ? 719  TYR D CB    1 
ATOM   8817  C  CG    . TYR F 3 423 ? 131.532 1.566   -18.293 1.00 23.76 ? 719  TYR D CG    1 
ATOM   8818  C  CD1   . TYR F 3 423 ? 131.497 2.661   -19.157 1.00 23.87 ? 719  TYR D CD1   1 
ATOM   8819  C  CD2   . TYR F 3 423 ? 131.877 0.321   -18.821 1.00 23.89 ? 719  TYR D CD2   1 
ATOM   8820  C  CE1   . TYR F 3 423 ? 131.793 2.522   -20.511 1.00 26.02 ? 719  TYR D CE1   1 
ATOM   8821  C  CE2   . TYR F 3 423 ? 132.173 0.169   -20.176 1.00 26.99 ? 719  TYR D CE2   1 
ATOM   8822  C  CZ    . TYR F 3 423 ? 132.129 1.275   -21.015 1.00 26.34 ? 719  TYR D CZ    1 
ATOM   8823  O  OH    . TYR F 3 423 ? 132.413 1.136   -22.355 1.00 27.35 ? 719  TYR D OH    1 
ATOM   8824  N  N     . GLY F 3 424 ? 129.078 -0.473  -16.456 1.00 17.69 ? 720  GLY D N     1 
ATOM   8825  C  CA    . GLY F 3 424 ? 128.435 -1.694  -16.901 1.00 17.42 ? 720  GLY D CA    1 
ATOM   8826  C  C     . GLY F 3 424 ? 126.925 -1.572  -16.963 1.00 17.49 ? 720  GLY D C     1 
ATOM   8827  O  O     . GLY F 3 424 ? 126.301 -2.050  -17.912 1.00 18.50 ? 720  GLY D O     1 
ATOM   8828  N  N     . LEU F 3 425 ? 126.334 -0.933  -15.957 1.00 15.78 ? 721  LEU D N     1 
ATOM   8829  C  CA    . LEU F 3 425 ? 124.888 -0.770  -15.915 1.00 16.86 ? 721  LEU D CA    1 
ATOM   8830  C  C     . LEU F 3 425 ? 124.410 0.204   -16.992 1.00 18.24 ? 721  LEU D C     1 
ATOM   8831  O  O     . LEU F 3 425 ? 123.389 -0.029  -17.641 1.00 17.55 ? 721  LEU D O     1 
ATOM   8832  C  CB    . LEU F 3 425 ? 124.446 -0.275  -14.536 1.00 15.77 ? 721  LEU D CB    1 
ATOM   8833  C  CG    . LEU F 3 425 ? 122.938 -0.065  -14.368 1.00 16.64 ? 721  LEU D CG    1 
ATOM   8834  C  CD1   . LEU F 3 425 ? 122.203 -1.357  -14.677 1.00 15.77 ? 721  LEU D CD1   1 
ATOM   8835  C  CD2   . LEU F 3 425 ? 122.634 0.409   -12.951 1.00 15.43 ? 721  LEU D CD2   1 
ATOM   8836  N  N     . ALA F 3 426 ? 125.150 1.293   -17.174 1.00 18.91 ? 722  ALA D N     1 
ATOM   8837  C  CA    . ALA F 3 426 ? 124.798 2.292   -18.179 1.00 20.91 ? 722  ALA D CA    1 
ATOM   8838  C  C     . ALA F 3 426 ? 124.831 1.661   -19.568 1.00 22.71 ? 722  ALA D C     1 
ATOM   8839  O  O     . ALA F 3 426 ? 123.972 1.939   -20.403 1.00 24.32 ? 722  ALA D O     1 
ATOM   8840  C  CB    . ALA F 3 426 ? 125.764 3.474   -18.110 1.00 19.19 ? 722  ALA D CB    1 
ATOM   8841  N  N     . GLN F 3 427 ? 125.821 0.804   -19.803 1.00 24.59 ? 723  GLN D N     1 
ATOM   8842  C  CA    . GLN F 3 427 ? 125.965 0.118   -21.087 1.00 27.48 ? 723  GLN D CA    1 
ATOM   8843  C  C     . GLN F 3 427 ? 124.845 -0.893  -21.339 1.00 29.24 ? 723  GLN D C     1 
ATOM   8844  O  O     . GLN F 3 427 ? 124.344 -1.003  -22.459 1.00 28.01 ? 723  GLN D O     1 
ATOM   8845  C  CB    . GLN F 3 427 ? 127.308 -0.611  -21.157 1.00 28.47 ? 723  GLN D CB    1 
ATOM   8846  C  CG    . GLN F 3 427 ? 128.528 0.281   -21.300 1.00 30.48 ? 723  GLN D CG    1 
ATOM   8847  C  CD    . GLN F 3 427 ? 128.558 1.020   -22.624 1.00 32.93 ? 723  GLN D CD    1 
ATOM   8848  O  OE1   . GLN F 3 427 ? 128.122 2.166   -22.721 1.00 33.44 ? 723  GLN D OE1   1 
ATOM   8849  N  NE2   . GLN F 3 427 ? 129.071 0.360   -23.656 1.00 32.97 ? 723  GLN D NE2   1 
ATOM   8850  N  N     . ASN F 3 428 ? 124.458 -1.633  -20.302 1.00 29.87 ? 724  ASN D N     1 
ATOM   8851  C  CA    . ASN F 3 428 ? 123.400 -2.629  -20.443 1.00 31.38 ? 724  ASN D CA    1 
ATOM   8852  C  C     . ASN F 3 428 ? 122.027 -2.015  -20.689 1.00 31.02 ? 724  ASN D C     1 
ATOM   8853  O  O     . ASN F 3 428 ? 121.279 -2.483  -21.544 1.00 32.29 ? 724  ASN D O     1 
ATOM   8854  C  CB    . ASN F 3 428 ? 123.329 -3.536  -19.208 1.00 33.03 ? 724  ASN D CB    1 
ATOM   8855  C  CG    . ASN F 3 428 ? 124.499 -4.501  -19.119 1.00 36.75 ? 724  ASN D CG    1 
ATOM   8856  O  OD1   . ASN F 3 428 ? 125.084 -4.884  -20.134 1.00 38.26 ? 724  ASN D OD1   1 
ATOM   8857  N  ND2   . ASN F 3 428 ? 124.840 -4.908  -17.899 1.00 37.77 ? 724  ASN D ND2   1 
ATOM   8858  N  N     . LEU F 3 429 ? 121.695 -0.970  -19.939 1.00 30.51 ? 725  LEU D N     1 
ATOM   8859  C  CA    . LEU F 3 429 ? 120.405 -0.305  -20.088 1.00 31.65 ? 725  LEU D CA    1 
ATOM   8860  C  C     . LEU F 3 429 ? 120.490 0.852   -21.073 1.00 33.09 ? 725  LEU D C     1 
ATOM   8861  O  O     . LEU F 3 429 ? 119.519 1.586   -21.263 1.00 33.39 ? 725  LEU D O     1 
ATOM   8862  C  CB    . LEU F 3 429 ? 119.921 0.228   -18.738 1.00 30.23 ? 725  LEU D CB    1 
ATOM   8863  C  CG    . LEU F 3 429 ? 119.575 -0.807  -17.667 1.00 30.20 ? 725  LEU D CG    1 
ATOM   8864  C  CD1   . LEU F 3 429 ? 119.139 -0.104  -16.398 1.00 28.92 ? 725  LEU D CD1   1 
ATOM   8865  C  CD2   . LEU F 3 429 ? 118.472 -1.718  -18.180 1.00 30.58 ? 725  LEU D CD2   1 
ATOM   8866  N  N     . ASN F 3 430 ? 121.656 1.004   -21.690 1.00 33.39 ? 726  ASN D N     1 
ATOM   8867  C  CA    . ASN F 3 430 ? 121.899 2.078   -22.644 1.00 34.51 ? 726  ASN D CA    1 
ATOM   8868  C  C     . ASN F 3 430 ? 121.298 3.369   -22.105 1.00 33.34 ? 726  ASN D C     1 
ATOM   8869  O  O     . ASN F 3 430 ? 120.484 4.019   -22.763 1.00 34.14 ? 726  ASN D O     1 
ATOM   8870  C  CB    . ASN F 3 430 ? 121.299 1.736   -24.012 1.00 36.57 ? 726  ASN D CB    1 
ATOM   8871  C  CG    . ASN F 3 430 ? 121.880 2.589   -25.132 1.00 39.56 ? 726  ASN D CG    1 
ATOM   8872  O  OD1   . ASN F 3 430 ? 123.098 2.639   -25.324 1.00 40.26 ? 726  ASN D OD1   1 
ATOM   8873  N  ND2   . ASN F 3 430 ? 121.009 3.261   -25.878 1.00 40.56 ? 726  ASN D ND2   1 
ATOM   8874  N  N     . ILE F 3 431 ? 121.705 3.722   -20.889 1.00 30.90 ? 727  ILE D N     1 
ATOM   8875  C  CA    . ILE F 3 431 ? 121.240 4.932   -20.225 1.00 28.42 ? 727  ILE D CA    1 
ATOM   8876  C  C     . ILE F 3 431 ? 122.445 5.758   -19.791 1.00 26.78 ? 727  ILE D C     1 
ATOM   8877  O  O     . ILE F 3 431 ? 123.588 5.331   -19.938 1.00 25.36 ? 727  ILE D O     1 
ATOM   8878  C  CB    . ILE F 3 431 ? 120.407 4.613   -18.960 1.00 29.60 ? 727  ILE D CB    1 
ATOM   8879  C  CG1   . ILE F 3 431 ? 121.279 3.881   -17.934 1.00 28.23 ? 727  ILE D CG1   1 
ATOM   8880  C  CG2   . ILE F 3 431 ? 119.188 3.780   -19.332 1.00 28.50 ? 727  ILE D CG2   1 
ATOM   8881  C  CD1   . ILE F 3 431 ? 120.611 3.688   -16.587 1.00 29.00 ? 727  ILE D CD1   1 
ATOM   8882  N  N     . SER F 3 432 ? 122.177 6.940   -19.253 1.00 25.90 ? 728  SER D N     1 
ATOM   8883  C  CA    . SER F 3 432 ? 123.227 7.832   -18.781 1.00 25.75 ? 728  SER D CA    1 
ATOM   8884  C  C     . SER F 3 432 ? 124.058 7.152   -17.703 1.00 26.09 ? 728  SER D C     1 
ATOM   8885  O  O     . SER F 3 432 ? 123.515 6.477   -16.828 1.00 25.70 ? 728  SER D O     1 
ATOM   8886  C  CB    . SER F 3 432 ? 122.606 9.106   -18.208 1.00 25.41 ? 728  SER D CB    1 
ATOM   8887  O  OG    . SER F 3 432 ? 123.526 9.808   -17.394 1.00 25.66 ? 728  SER D OG    1 
ATOM   8888  N  N     . ARG F 3 433 ? 125.372 7.340   -17.758 1.00 24.60 ? 729  ARG D N     1 
ATOM   8889  C  CA    . ARG F 3 433 ? 126.250 6.743   -16.764 1.00 25.38 ? 729  ARG D CA    1 
ATOM   8890  C  C     . ARG F 3 433 ? 126.004 7.401   -15.405 1.00 25.19 ? 729  ARG D C     1 
ATOM   8891  O  O     . ARG F 3 433 ? 126.056 6.745   -14.368 1.00 22.94 ? 729  ARG D O     1 
ATOM   8892  C  CB    . ARG F 3 433 ? 127.711 6.901   -17.188 1.00 25.32 ? 729  ARG D CB    1 
ATOM   8893  C  CG    . ARG F 3 433 ? 128.691 6.215   -16.266 1.00 24.75 ? 729  ARG D CG    1 
ATOM   8894  C  CD    . ARG F 3 433 ? 130.053 6.048   -16.919 1.00 23.66 ? 729  ARG D CD    1 
ATOM   8895  N  NE    . ARG F 3 433 ? 131.025 5.537   -15.960 1.00 23.23 ? 729  ARG D NE    1 
ATOM   8896  C  CZ    . ARG F 3 433 ? 132.311 5.339   -16.221 1.00 22.56 ? 729  ARG D CZ    1 
ATOM   8897  N  NH1   . ARG F 3 433 ? 132.799 5.607   -17.428 1.00 19.71 ? 729  ARG D NH1   1 
ATOM   8898  N  NH2   . ARG F 3 433 ? 133.108 4.873   -15.270 1.00 22.68 ? 729  ARG D NH2   1 
ATOM   8899  N  N     . LYS F 3 434 ? 125.733 8.703   -15.419 1.00 24.92 ? 730  LYS D N     1 
ATOM   8900  C  CA    . LYS F 3 434 ? 125.444 9.437   -14.191 1.00 25.16 ? 730  LYS D CA    1 
ATOM   8901  C  C     . LYS F 3 434 ? 124.171 8.860   -13.568 1.00 24.03 ? 730  LYS D C     1 
ATOM   8902  O  O     . LYS F 3 434 ? 124.089 8.669   -12.355 1.00 23.12 ? 730  LYS D O     1 
ATOM   8903  C  CB    . LYS F 3 434 ? 125.250 10.923  -14.508 1.00 28.48 ? 730  LYS D CB    1 
ATOM   8904  C  CG    . LYS F 3 434 ? 124.653 11.748  -13.382 1.00 31.97 ? 730  LYS D CG    1 
ATOM   8905  C  CD    . LYS F 3 434 ? 124.571 13.220  -13.781 1.00 35.30 ? 730  LYS D CD    1 
ATOM   8906  C  CE    . LYS F 3 434 ? 123.757 14.028  -12.779 1.00 37.40 ? 730  LYS D CE    1 
ATOM   8907  N  NZ    . LYS F 3 434 ? 122.339 13.568  -12.734 1.00 39.31 ? 730  LYS D NZ    1 
ATOM   8908  N  N     . GLU F 3 435 ? 123.184 8.579   -14.411 1.00 23.78 ? 731  GLU D N     1 
ATOM   8909  C  CA    . GLU F 3 435 ? 121.921 8.008   -13.956 1.00 25.05 ? 731  GLU D CA    1 
ATOM   8910  C  C     . GLU F 3 435 ? 122.116 6.585   -13.434 1.00 22.85 ? 731  GLU D C     1 
ATOM   8911  O  O     . GLU F 3 435 ? 121.461 6.171   -12.477 1.00 21.70 ? 731  GLU D O     1 
ATOM   8912  C  CB    . GLU F 3 435 ? 120.905 7.998   -15.099 1.00 28.19 ? 731  GLU D CB    1 
ATOM   8913  C  CG    . GLU F 3 435 ? 120.370 9.372   -15.461 1.00 34.58 ? 731  GLU D CG    1 
ATOM   8914  C  CD    . GLU F 3 435 ? 119.645 9.383   -16.794 1.00 38.82 ? 731  GLU D CD    1 
ATOM   8915  O  OE1   . GLU F 3 435 ? 118.766 8.520   -17.009 1.00 40.40 ? 731  GLU D OE1   1 
ATOM   8916  O  OE2   . GLU F 3 435 ? 119.953 10.262  -17.628 1.00 43.59 ? 731  GLU D OE2   1 
ATOM   8917  N  N     . ALA F 3 436 ? 123.014 5.835   -14.065 1.00 21.72 ? 732  ALA D N     1 
ATOM   8918  C  CA    . ALA F 3 436 ? 123.275 4.468   -13.632 1.00 20.70 ? 732  ALA D CA    1 
ATOM   8919  C  C     . ALA F 3 436 ? 123.897 4.520   -12.241 1.00 19.97 ? 732  ALA D C     1 
ATOM   8920  O  O     . ALA F 3 436 ? 123.504 3.771   -11.345 1.00 20.13 ? 732  ALA D O     1 
ATOM   8921  C  CB    . ALA F 3 436 ? 124.213 3.768   -14.613 1.00 19.00 ? 732  ALA D CB    1 
ATOM   8922  N  N     . ALA F 3 437 ? 124.859 5.422   -12.064 1.00 20.12 ? 733  ALA D N     1 
ATOM   8923  C  CA    . ALA F 3 437 ? 125.535 5.586   -10.782 1.00 20.56 ? 733  ALA D CA    1 
ATOM   8924  C  C     . ALA F 3 437 ? 124.546 5.956   -9.682  1.00 22.07 ? 733  ALA D C     1 
ATOM   8925  O  O     . ALA F 3 437 ? 124.625 5.448   -8.563  1.00 21.42 ? 733  ALA D O     1 
ATOM   8926  C  CB    . ALA F 3 437 ? 126.611 6.655   -10.891 1.00 22.51 ? 733  ALA D CB    1 
ATOM   8927  N  N     . GLU F 3 438 ? 123.614 6.846   -10.003 1.00 22.13 ? 734  GLU D N     1 
ATOM   8928  C  CA    . GLU F 3 438 ? 122.614 7.278   -9.039  1.00 23.87 ? 734  GLU D CA    1 
ATOM   8929  C  C     . GLU F 3 438 ? 121.637 6.159   -8.697  1.00 22.68 ? 734  GLU D C     1 
ATOM   8930  O  O     . GLU F 3 438 ? 121.158 6.070   -7.564  1.00 22.03 ? 734  GLU D O     1 
ATOM   8931  C  CB    . GLU F 3 438 ? 121.861 8.498   -9.577  1.00 26.74 ? 734  GLU D CB    1 
ATOM   8932  C  CG    . GLU F 3 438 ? 122.651 9.793   -9.449  1.00 32.01 ? 734  GLU D CG    1 
ATOM   8933  C  CD    . GLU F 3 438 ? 122.047 10.936  -10.243 1.00 35.60 ? 734  GLU D CD    1 
ATOM   8934  O  OE1   . GLU F 3 438 ? 120.813 11.129  -10.176 1.00 37.78 ? 734  GLU D OE1   1 
ATOM   8935  O  OE2   . GLU F 3 438 ? 122.812 11.648  -10.928 1.00 37.93 ? 734  GLU D OE2   1 
ATOM   8936  N  N     . PHE F 3 439 ? 121.341 5.305   -9.674  1.00 20.72 ? 735  PHE D N     1 
ATOM   8937  C  CA    . PHE F 3 439 ? 120.428 4.192   -9.437  1.00 20.06 ? 735  PHE D CA    1 
ATOM   8938  C  C     . PHE F 3 439 ? 121.097 3.198   -8.490  1.00 18.18 ? 735  PHE D C     1 
ATOM   8939  O  O     . PHE F 3 439 ? 120.476 2.687   -7.557  1.00 17.82 ? 735  PHE D O     1 
ATOM   8940  C  CB    . PHE F 3 439 ? 120.084 3.485   -10.746 1.00 20.54 ? 735  PHE D CB    1 
ATOM   8941  C  CG    . PHE F 3 439 ? 119.058 2.404   -10.588 1.00 23.90 ? 735  PHE D CG    1 
ATOM   8942  C  CD1   . PHE F 3 439 ? 117.724 2.724   -10.359 1.00 25.39 ? 735  PHE D CD1   1 
ATOM   8943  C  CD2   . PHE F 3 439 ? 119.424 1.064   -10.644 1.00 22.69 ? 735  PHE D CD2   1 
ATOM   8944  C  CE1   . PHE F 3 439 ? 116.771 1.723   -10.187 1.00 27.25 ? 735  PHE D CE1   1 
ATOM   8945  C  CE2   . PHE F 3 439 ? 118.479 0.060   -10.473 1.00 24.24 ? 735  PHE D CE2   1 
ATOM   8946  C  CZ    . PHE F 3 439 ? 117.150 0.389   -10.244 1.00 25.56 ? 735  PHE D CZ    1 
ATOM   8947  N  N     . ILE F 3 440 ? 122.371 2.924   -8.739  1.00 16.43 ? 736  ILE D N     1 
ATOM   8948  C  CA    . ILE F 3 440 ? 123.120 1.999   -7.900  1.00 16.79 ? 736  ILE D CA    1 
ATOM   8949  C  C     . ILE F 3 440 ? 123.165 2.522   -6.463  1.00 17.66 ? 736  ILE D C     1 
ATOM   8950  O  O     . ILE F 3 440 ? 122.936 1.773   -5.504  1.00 14.81 ? 736  ILE D O     1 
ATOM   8951  C  CB    . ILE F 3 440 ? 124.555 1.814   -8.436  1.00 17.50 ? 736  ILE D CB    1 
ATOM   8952  C  CG1   . ILE F 3 440 ? 124.502 1.113   -9.799  1.00 17.09 ? 736  ILE D CG1   1 
ATOM   8953  C  CG2   . ILE F 3 440 ? 125.391 1.015   -7.439  1.00 16.44 ? 736  ILE D CG2   1 
ATOM   8954  C  CD1   . ILE F 3 440 ? 125.837 1.052   -10.524 1.00 19.21 ? 736  ILE D CD1   1 
ATOM   8955  N  N     . GLU F 3 441 ? 123.453 3.812   -6.315  1.00 18.46 ? 737  GLU D N     1 
ATOM   8956  C  CA    . GLU F 3 441 ? 123.512 4.422   -4.993  1.00 20.30 ? 737  GLU D CA    1 
ATOM   8957  C  C     . GLU F 3 441 ? 122.165 4.307   -4.275  1.00 19.62 ? 737  GLU D C     1 
ATOM   8958  O  O     . GLU F 3 441 ? 122.117 3.999   -3.081  1.00 19.62 ? 737  GLU D O     1 
ATOM   8959  C  CB    . GLU F 3 441 ? 123.923 5.892   -5.106  1.00 23.64 ? 737  GLU D CB    1 
ATOM   8960  C  CG    . GLU F 3 441 ? 123.782 6.668   -3.810  1.00 28.35 ? 737  GLU D CG    1 
ATOM   8961  C  CD    . GLU F 3 441 ? 124.128 8.136   -3.977  1.00 32.49 ? 737  GLU D CD    1 
ATOM   8962  O  OE1   . GLU F 3 441 ? 125.318 8.448   -4.196  1.00 33.92 ? 737  GLU D OE1   1 
ATOM   8963  O  OE2   . GLU F 3 441 ? 123.206 8.975   -3.898  1.00 35.65 ? 737  GLU D OE2   1 
ATOM   8964  N  N     . ARG F 3 442 ? 121.072 4.556   -4.993  1.00 19.41 ? 738  ARG D N     1 
ATOM   8965  C  CA    . ARG F 3 442 ? 119.738 4.451   -4.399  1.00 21.56 ? 738  ARG D CA    1 
ATOM   8966  C  C     . ARG F 3 442 ? 119.440 3.007   -3.999  1.00 20.19 ? 738  ARG D C     1 
ATOM   8967  O  O     . ARG F 3 442 ? 118.823 2.748   -2.968  1.00 21.30 ? 738  ARG D O     1 
ATOM   8968  C  CB    . ARG F 3 442 ? 118.658 4.924   -5.381  1.00 23.83 ? 738  ARG D CB    1 
ATOM   8969  C  CG    . ARG F 3 442 ? 118.589 6.431   -5.583  1.00 29.79 ? 738  ARG D CG    1 
ATOM   8970  C  CD    . ARG F 3 442 ? 117.247 6.843   -6.200  1.00 32.73 ? 738  ARG D CD    1 
ATOM   8971  N  NE    . ARG F 3 442 ? 117.103 6.403   -7.585  1.00 36.27 ? 738  ARG D NE    1 
ATOM   8972  C  CZ    . ARG F 3 442 ? 117.741 6.953   -8.614  1.00 37.26 ? 738  ARG D CZ    1 
ATOM   8973  N  NH1   . ARG F 3 442 ? 118.569 7.972   -8.416  1.00 38.81 ? 738  ARG D NH1   1 
ATOM   8974  N  NH2   . ARG F 3 442 ? 117.556 6.483   -9.839  1.00 36.72 ? 738  ARG D NH2   1 
ATOM   8975  N  N     . TYR F 3 443 ? 119.883 2.071   -4.828  1.00 19.51 ? 739  TYR D N     1 
ATOM   8976  C  CA    . TYR F 3 443 ? 119.665 0.652   -4.576  1.00 17.42 ? 739  TYR D CA    1 
ATOM   8977  C  C     . TYR F 3 443 ? 120.255 0.269   -3.219  1.00 17.03 ? 739  TYR D C     1 
ATOM   8978  O  O     . TYR F 3 443 ? 119.600 -0.368  -2.391  1.00 15.25 ? 739  TYR D O     1 
ATOM   8979  C  CB    . TYR F 3 443 ? 120.331 -0.176  -5.678  1.00 17.05 ? 739  TYR D CB    1 
ATOM   8980  C  CG    . TYR F 3 443 ? 119.774 -1.574  -5.846  1.00 15.92 ? 739  TYR D CG    1 
ATOM   8981  C  CD1   . TYR F 3 443 ? 118.766 -1.835  -6.776  1.00 15.52 ? 739  TYR D CD1   1 
ATOM   8982  C  CD2   . TYR F 3 443 ? 120.263 -2.636  -5.089  1.00 14.59 ? 739  TYR D CD2   1 
ATOM   8983  C  CE1   . TYR F 3 443 ? 118.259 -3.124  -6.950  1.00 16.95 ? 739  TYR D CE1   1 
ATOM   8984  C  CE2   . TYR F 3 443 ? 119.764 -3.925  -5.253  1.00 16.23 ? 739  TYR D CE2   1 
ATOM   8985  C  CZ    . TYR F 3 443 ? 118.765 -4.164  -6.185  1.00 15.43 ? 739  TYR D CZ    1 
ATOM   8986  O  OH    . TYR F 3 443 ? 118.277 -5.437  -6.357  1.00 16.07 ? 739  TYR D OH    1 
ATOM   8987  N  N     . PHE F 3 444 ? 121.498 0.664   -2.984  1.00 16.72 ? 740  PHE D N     1 
ATOM   8988  C  CA    . PHE F 3 444 ? 122.138 0.327   -1.724  1.00 17.87 ? 740  PHE D CA    1 
ATOM   8989  C  C     . PHE F 3 444 ? 121.661 1.151   -0.540  1.00 18.27 ? 740  PHE D C     1 
ATOM   8990  O  O     . PHE F 3 444 ? 121.932 0.808   0.610   1.00 16.74 ? 740  PHE D O     1 
ATOM   8991  C  CB    . PHE F 3 444 ? 123.658 0.380   -1.880  1.00 18.79 ? 740  PHE D CB    1 
ATOM   8992  C  CG    . PHE F 3 444 ? 124.203 -0.763  -2.690  1.00 18.77 ? 740  PHE D CG    1 
ATOM   8993  C  CD1   . PHE F 3 444 ? 123.965 -2.080  -2.296  1.00 19.85 ? 740  PHE D CD1   1 
ATOM   8994  C  CD2   . PHE F 3 444 ? 124.905 -0.533  -3.866  1.00 18.41 ? 740  PHE D CD2   1 
ATOM   8995  C  CE1   . PHE F 3 444 ? 124.417 -3.149  -3.066  1.00 17.93 ? 740  PHE D CE1   1 
ATOM   8996  C  CE2   . PHE F 3 444 ? 125.360 -1.590  -4.642  1.00 16.86 ? 740  PHE D CE2   1 
ATOM   8997  C  CZ    . PHE F 3 444 ? 125.116 -2.903  -4.243  1.00 20.48 ? 740  PHE D CZ    1 
ATOM   8998  N  N     . GLU F 3 445 ? 120.941 2.233   -0.812  1.00 18.85 ? 741  GLU D N     1 
ATOM   8999  C  CA    . GLU F 3 445 ? 120.389 3.031   0.273   1.00 20.15 ? 741  GLU D CA    1 
ATOM   9000  C  C     . GLU F 3 445 ? 119.142 2.279   0.741   1.00 19.15 ? 741  GLU D C     1 
ATOM   9001  O  O     . GLU F 3 445 ? 118.735 2.383   1.897   1.00 19.58 ? 741  GLU D O     1 
ATOM   9002  C  CB    . GLU F 3 445 ? 120.031 4.439   -0.211  1.00 23.76 ? 741  GLU D CB    1 
ATOM   9003  C  CG    . GLU F 3 445 ? 121.246 5.345   -0.388  1.00 28.47 ? 741  GLU D CG    1 
ATOM   9004  C  CD    . GLU F 3 445 ? 120.909 6.681   -1.031  1.00 32.34 ? 741  GLU D CD    1 
ATOM   9005  O  OE1   . GLU F 3 445 ? 121.828 7.519   -1.173  1.00 35.56 ? 741  GLU D OE1   1 
ATOM   9006  O  OE2   . GLU F 3 445 ? 119.732 6.893   -1.398  1.00 34.61 ? 741  GLU D OE2   1 
ATOM   9007  N  N     . SER F 3 446 ? 118.549 1.507   -0.166  1.00 17.57 ? 742  SER D N     1 
ATOM   9008  C  CA    . SER F 3 446 ? 117.365 0.712   0.165   1.00 17.94 ? 742  SER D CA    1 
ATOM   9009  C  C     . SER F 3 446 ? 117.778 -0.575  0.872   1.00 16.83 ? 742  SER D C     1 
ATOM   9010  O  O     . SER F 3 446 ? 117.060 -1.084  1.736   1.00 14.77 ? 742  SER D O     1 
ATOM   9011  C  CB    . SER F 3 446 ? 116.583 0.349   -1.100  1.00 18.67 ? 742  SER D CB    1 
ATOM   9012  O  OG    . SER F 3 446 ? 115.943 1.481   -1.659  1.00 23.09 ? 742  SER D OG    1 
ATOM   9013  N  N     . PHE F 3 447 ? 118.949 -1.088  0.505   1.00 15.91 ? 743  PHE D N     1 
ATOM   9014  C  CA    . PHE F 3 447 ? 119.458 -2.328  1.079   1.00 15.96 ? 743  PHE D CA    1 
ATOM   9015  C  C     . PHE F 3 447 ? 120.875 -2.143  1.617   1.00 16.85 ? 743  PHE D C     1 
ATOM   9016  O  O     . PHE F 3 447 ? 121.834 -2.733  1.109   1.00 15.18 ? 743  PHE D O     1 
ATOM   9017  C  CB    . PHE F 3 447 ? 119.441 -3.424  0.013   1.00 16.34 ? 743  PHE D CB    1 
ATOM   9018  C  CG    . PHE F 3 447 ? 118.121 -3.569  -0.679  1.00 16.09 ? 743  PHE D CG    1 
ATOM   9019  C  CD1   . PHE F 3 447 ? 116.974 -3.876  0.043   1.00 16.70 ? 743  PHE D CD1   1 
ATOM   9020  C  CD2   . PHE F 3 447 ? 118.019 -3.389  -2.059  1.00 17.60 ? 743  PHE D CD2   1 
ATOM   9021  C  CE1   . PHE F 3 447 ? 115.739 -4.002  -0.594  1.00 16.14 ? 743  PHE D CE1   1 
ATOM   9022  C  CE2   . PHE F 3 447 ? 116.789 -3.513  -2.711  1.00 16.44 ? 743  PHE D CE2   1 
ATOM   9023  C  CZ    . PHE F 3 447 ? 115.647 -3.819  -1.978  1.00 16.70 ? 743  PHE D CZ    1 
ATOM   9024  N  N     . PRO F 3 448 ? 121.023 -1.319  2.662   1.00 16.46 ? 744  PRO D N     1 
ATOM   9025  C  CA    . PRO F 3 448 ? 122.328 -1.056  3.269   1.00 16.90 ? 744  PRO D CA    1 
ATOM   9026  C  C     . PRO F 3 448 ? 122.966 -2.308  3.854   1.00 16.15 ? 744  PRO D C     1 
ATOM   9027  O  O     . PRO F 3 448 ? 124.187 -2.408  3.949   1.00 13.80 ? 744  PRO D O     1 
ATOM   9028  C  CB    . PRO F 3 448 ? 122.013 0.004   4.320   1.00 18.43 ? 744  PRO D CB    1 
ATOM   9029  C  CG    . PRO F 3 448 ? 120.615 -0.349  4.732   1.00 18.39 ? 744  PRO D CG    1 
ATOM   9030  C  CD    . PRO F 3 448 ? 119.958 -0.607  3.391   1.00 17.31 ? 744  PRO D CD    1 
ATOM   9031  N  N     . GLY F 3 449 ? 122.129 -3.262  4.244   1.00 15.88 ? 745  GLY D N     1 
ATOM   9032  C  CA    . GLY F 3 449 ? 122.639 -4.495  4.816   1.00 13.82 ? 745  GLY D CA    1 
ATOM   9033  C  C     . GLY F 3 449 ? 123.410 -5.276  3.774   1.00 13.99 ? 745  GLY D C     1 
ATOM   9034  O  O     . GLY F 3 449 ? 124.438 -5.886  4.075   1.00 14.33 ? 745  GLY D O     1 
ATOM   9035  N  N     . VAL F 3 450 ? 122.913 -5.267  2.542   1.00 13.07 ? 746  VAL D N     1 
ATOM   9036  C  CA    . VAL F 3 450 ? 123.591 -5.971  1.464   1.00 13.97 ? 746  VAL D CA    1 
ATOM   9037  C  C     . VAL F 3 450 ? 124.954 -5.317  1.207   1.00 14.40 ? 746  VAL D C     1 
ATOM   9038  O  O     . VAL F 3 450 ? 125.965 -6.005  1.058   1.00 13.75 ? 746  VAL D O     1 
ATOM   9039  C  CB    . VAL F 3 450 ? 122.744 -5.965  0.173   1.00 13.57 ? 746  VAL D CB    1 
ATOM   9040  C  CG1   . VAL F 3 450 ? 123.518 -6.607  -0.977  1.00 12.92 ? 746  VAL D CG1   1 
ATOM   9041  C  CG2   . VAL F 3 450 ? 121.450 -6.735  0.410   1.00 12.46 ? 746  VAL D CG2   1 
ATOM   9042  N  N     . LYS F 3 451 ? 124.983 -3.988  1.172   1.00 14.41 ? 747  LYS D N     1 
ATOM   9043  C  CA    . LYS F 3 451 ? 126.236 -3.273  0.941   1.00 16.56 ? 747  LYS D CA    1 
ATOM   9044  C  C     . LYS F 3 451 ? 127.243 -3.625  2.026   1.00 16.34 ? 747  LYS D C     1 
ATOM   9045  O  O     . LYS F 3 451 ? 128.409 -3.910  1.737   1.00 15.93 ? 747  LYS D O     1 
ATOM   9046  C  CB    . LYS F 3 451 ? 126.008 -1.760  0.938   1.00 19.08 ? 747  LYS D CB    1 
ATOM   9047  C  CG    . LYS F 3 451 ? 127.295 -0.962  0.765   1.00 23.07 ? 747  LYS D CG    1 
ATOM   9048  C  CD    . LYS F 3 451 ? 127.044 0.537   0.815   1.00 26.79 ? 747  LYS D CD    1 
ATOM   9049  C  CE    . LYS F 3 451 ? 128.350 1.319   0.712   1.00 28.99 ? 747  LYS D CE    1 
ATOM   9050  N  NZ    . LYS F 3 451 ? 128.113 2.793   0.690   1.00 30.56 ? 747  LYS D NZ    1 
ATOM   9051  N  N     . ARG F 3 452 ? 126.788 -3.596  3.277   1.00 17.13 ? 748  ARG D N     1 
ATOM   9052  C  CA    . ARG F 3 452 ? 127.641 -3.925  4.412   1.00 19.15 ? 748  ARG D CA    1 
ATOM   9053  C  C     . ARG F 3 452 ? 128.151 -5.353  4.261   1.00 18.56 ? 748  ARG D C     1 
ATOM   9054  O  O     . ARG F 3 452 ? 129.330 -5.640  4.484   1.00 17.56 ? 748  ARG D O     1 
ATOM   9055  C  CB    . ARG F 3 452 ? 126.858 -3.779  5.723   1.00 22.98 ? 748  ARG D CB    1 
ATOM   9056  C  CG    . ARG F 3 452 ? 127.451 -4.553  6.892   1.00 31.02 ? 748  ARG D CG    1 
ATOM   9057  C  CD    . ARG F 3 452 ? 126.724 -4.298  8.219   1.00 37.71 ? 748  ARG D CD    1 
ATOM   9058  N  NE    . ARG F 3 452 ? 125.279 -4.541  8.170   1.00 41.84 ? 748  ARG D NE    1 
ATOM   9059  C  CZ    . ARG F 3 452 ? 124.368 -3.597  7.938   1.00 43.31 ? 748  ARG D CZ    1 
ATOM   9060  N  NH1   . ARG F 3 452 ? 124.749 -2.343  7.730   1.00 44.89 ? 748  ARG D NH1   1 
ATOM   9061  N  NH2   . ARG F 3 452 ? 123.076 -3.902  7.921   1.00 44.11 ? 748  ARG D NH2   1 
ATOM   9062  N  N     . TYR F 3 453 ? 127.252 -6.248  3.873   1.00 16.35 ? 749  TYR D N     1 
ATOM   9063  C  CA    . TYR F 3 453 ? 127.617 -7.642  3.683   1.00 17.02 ? 749  TYR D CA    1 
ATOM   9064  C  C     . TYR F 3 453 ? 128.711 -7.810  2.626   1.00 16.47 ? 749  TYR D C     1 
ATOM   9065  O  O     . TYR F 3 453 ? 129.696 -8.509  2.845   1.00 16.88 ? 749  TYR D O     1 
ATOM   9066  C  CB    . TYR F 3 453 ? 126.398 -8.467  3.266   1.00 16.72 ? 749  TYR D CB    1 
ATOM   9067  C  CG    . TYR F 3 453 ? 126.807 -9.840  2.825   1.00 17.40 ? 749  TYR D CG    1 
ATOM   9068  C  CD1   . TYR F 3 453 ? 127.233 -10.785 3.753   1.00 19.14 ? 749  TYR D CD1   1 
ATOM   9069  C  CD2   . TYR F 3 453 ? 126.837 -10.176 1.478   1.00 17.77 ? 749  TYR D CD2   1 
ATOM   9070  C  CE1   . TYR F 3 453 ? 127.686 -12.032 3.345   1.00 21.32 ? 749  TYR D CE1   1 
ATOM   9071  C  CE2   . TYR F 3 453 ? 127.293 -11.419 1.062   1.00 19.59 ? 749  TYR D CE2   1 
ATOM   9072  C  CZ    . TYR F 3 453 ? 127.716 -12.337 2.001   1.00 18.42 ? 749  TYR D CZ    1 
ATOM   9073  O  OH    . TYR F 3 453 ? 128.188 -13.565 1.603   1.00 22.33 ? 749  TYR D OH    1 
ATOM   9074  N  N     . MET F 3 454 ? 128.535 -7.172  1.475   1.00 15.82 ? 750  MET D N     1 
ATOM   9075  C  CA    . MET F 3 454 ? 129.515 -7.288  0.409   1.00 15.83 ? 750  MET D CA    1 
ATOM   9076  C  C     . MET F 3 454 ? 130.887 -6.755  0.829   1.00 16.65 ? 750  MET D C     1 
ATOM   9077  O  O     . MET F 3 454 ? 131.919 -7.234  0.353   1.00 14.90 ? 750  MET D O     1 
ATOM   9078  C  CB    . MET F 3 454 ? 129.006 -6.585  -0.853  1.00 16.65 ? 750  MET D CB    1 
ATOM   9079  C  CG    . MET F 3 454 ? 127.794 -7.282  -1.482  1.00 17.71 ? 750  MET D CG    1 
ATOM   9080  S  SD    . MET F 3 454 ? 128.054 -9.090  -1.703  1.00 22.31 ? 750  MET D SD    1 
ATOM   9081  C  CE    . MET F 3 454 ? 126.484 -9.584  -2.467  1.00 20.91 ? 750  MET D CE    1 
ATOM   9082  N  N     . GLU F 3 455 ? 130.900 -5.775  1.727   1.00 16.09 ? 751  GLU D N     1 
ATOM   9083  C  CA    . GLU F 3 455 ? 132.159 -5.224  2.209   1.00 17.90 ? 751  GLU D CA    1 
ATOM   9084  C  C     . GLU F 3 455 ? 132.797 -6.219  3.175   1.00 17.33 ? 751  GLU D C     1 
ATOM   9085  O  O     . GLU F 3 455 ? 133.990 -6.515  3.079   1.00 19.08 ? 751  GLU D O     1 
ATOM   9086  C  CB    . GLU F 3 455 ? 131.915 -3.884  2.917   1.00 17.86 ? 751  GLU D CB    1 
ATOM   9087  C  CG    . GLU F 3 455 ? 131.423 -2.797  1.972   1.00 22.06 ? 751  GLU D CG    1 
ATOM   9088  C  CD    . GLU F 3 455 ? 130.916 -1.557  2.689   1.00 25.38 ? 751  GLU D CD    1 
ATOM   9089  O  OE1   . GLU F 3 455 ? 130.579 -0.574  1.994   1.00 25.70 ? 751  GLU D OE1   1 
ATOM   9090  O  OE2   . GLU F 3 455 ? 130.846 -1.565  3.938   1.00 26.62 ? 751  GLU D OE2   1 
ATOM   9091  N  N     . ASN F 3 456 ? 131.989 -6.749  4.089   1.00 16.42 ? 752  ASN D N     1 
ATOM   9092  C  CA    . ASN F 3 456 ? 132.466 -7.703  5.085   1.00 16.20 ? 752  ASN D CA    1 
ATOM   9093  C  C     . ASN F 3 456 ? 132.910 -9.058  4.540   1.00 15.53 ? 752  ASN D C     1 
ATOM   9094  O  O     . ASN F 3 456 ? 133.860 -9.646  5.056   1.00 15.78 ? 752  ASN D O     1 
ATOM   9095  C  CB    . ASN F 3 456 ? 131.404 -7.931  6.166   1.00 18.54 ? 752  ASN D CB    1 
ATOM   9096  C  CG    . ASN F 3 456 ? 131.101 -6.675  6.961   1.00 20.87 ? 752  ASN D CG    1 
ATOM   9097  O  OD1   . ASN F 3 456 ? 131.956 -5.808  7.112   1.00 23.39 ? 752  ASN D OD1   1 
ATOM   9098  N  ND2   . ASN F 3 456 ? 129.885 -6.578  7.478   1.00 20.39 ? 752  ASN D ND2   1 
ATOM   9099  N  N     . ILE F 3 457 ? 132.237 -9.560  3.508   1.00 14.26 ? 753  ILE D N     1 
ATOM   9100  C  CA    . ILE F 3 457 ? 132.615 -10.861 2.958   1.00 13.34 ? 753  ILE D CA    1 
ATOM   9101  C  C     . ILE F 3 457 ? 133.986 -10.780 2.278   1.00 14.25 ? 753  ILE D C     1 
ATOM   9102  O  O     . ILE F 3 457 ? 134.766 -11.733 2.312   1.00 13.36 ? 753  ILE D O     1 
ATOM   9103  C  CB    . ILE F 3 457 ? 131.543 -11.396 1.962   1.00 12.99 ? 753  ILE D CB    1 
ATOM   9104  C  CG1   . ILE F 3 457 ? 131.754 -12.894 1.733   1.00 13.45 ? 753  ILE D CG1   1 
ATOM   9105  C  CG2   . ILE F 3 457 ? 131.619 -10.662 0.630   1.00 12.44 ? 753  ILE D CG2   1 
ATOM   9106  C  CD1   . ILE F 3 457 ? 131.598 -13.731 2.994   1.00 14.98 ? 753  ILE D CD1   1 
ATOM   9107  N  N     . VAL F 3 458 ? 134.280 -9.636  1.671   1.00 14.18 ? 754  VAL D N     1 
ATOM   9108  C  CA    . VAL F 3 458 ? 135.563 -9.445  1.011   1.00 15.68 ? 754  VAL D CA    1 
ATOM   9109  C  C     . VAL F 3 458 ? 136.666 -9.440  2.062   1.00 16.31 ? 754  VAL D C     1 
ATOM   9110  O  O     . VAL F 3 458 ? 137.728 -10.020 1.856   1.00 16.19 ? 754  VAL D O     1 
ATOM   9111  C  CB    . VAL F 3 458 ? 135.592 -8.124  0.217   1.00 16.67 ? 754  VAL D CB    1 
ATOM   9112  C  CG1   . VAL F 3 458 ? 137.030 -7.736  -0.127  1.00 15.26 ? 754  VAL D CG1   1 
ATOM   9113  C  CG2   . VAL F 3 458 ? 134.781 -8.287  -1.061  1.00 14.92 ? 754  VAL D CG2   1 
ATOM   9114  N  N     . GLN F 3 459 ? 136.412 -8.782  3.189   1.00 16.40 ? 755  GLN D N     1 
ATOM   9115  C  CA    . GLN F 3 459 ? 137.401 -8.741  4.254   1.00 17.91 ? 755  GLN D CA    1 
ATOM   9116  C  C     . GLN F 3 459 ? 137.581 -10.125 4.873   1.00 16.39 ? 755  GLN D C     1 
ATOM   9117  O  O     . GLN F 3 459 ? 138.684 -10.497 5.252   1.00 16.85 ? 755  GLN D O     1 
ATOM   9118  C  CB    . GLN F 3 459 ? 136.999 -7.726  5.331   1.00 19.75 ? 755  GLN D CB    1 
ATOM   9119  C  CG    . GLN F 3 459 ? 137.072 -6.274  4.864   1.00 24.63 ? 755  GLN D CG    1 
ATOM   9120  C  CD    . GLN F 3 459 ? 138.425 -5.916  4.251   1.00 27.53 ? 755  GLN D CD    1 
ATOM   9121  O  OE1   . GLN F 3 459 ? 139.469 -6.056  4.893   1.00 29.17 ? 755  GLN D OE1   1 
ATOM   9122  N  NE2   . GLN F 3 459 ? 138.408 -5.452  3.004   1.00 27.26 ? 755  GLN D NE2   1 
ATOM   9123  N  N     . GLU F 3 460 ? 136.506 -10.899 4.963   1.00 15.92 ? 756  GLU D N     1 
ATOM   9124  C  CA    . GLU F 3 460 ? 136.614 -12.234 5.540   1.00 18.91 ? 756  GLU D CA    1 
ATOM   9125  C  C     . GLU F 3 460 ? 137.420 -13.150 4.617   1.00 16.20 ? 756  GLU D C     1 
ATOM   9126  O  O     . GLU F 3 460 ? 138.170 -14.007 5.081   1.00 15.83 ? 756  GLU D O     1 
ATOM   9127  C  CB    . GLU F 3 460 ? 135.231 -12.841 5.779   1.00 22.79 ? 756  GLU D CB    1 
ATOM   9128  C  CG    . GLU F 3 460 ? 135.217 -13.849 6.920   1.00 30.95 ? 756  GLU D CG    1 
ATOM   9129  C  CD    . GLU F 3 460 ? 133.981 -14.717 6.923   1.00 35.00 ? 756  GLU D CD    1 
ATOM   9130  O  OE1   . GLU F 3 460 ? 132.871 -14.184 6.706   1.00 36.98 ? 756  GLU D OE1   1 
ATOM   9131  O  OE2   . GLU F 3 460 ? 134.120 -15.938 7.147   1.00 38.94 ? 756  GLU D OE2   1 
ATOM   9132  N  N     . ALA F 3 461 ? 137.264 -12.957 3.312   1.00 14.59 ? 757  ALA D N     1 
ATOM   9133  C  CA    . ALA F 3 461 ? 137.978 -13.759 2.323   1.00 13.14 ? 757  ALA D CA    1 
ATOM   9134  C  C     . ALA F 3 461 ? 139.478 -13.465 2.391   1.00 13.92 ? 757  ALA D C     1 
ATOM   9135  O  O     . ALA F 3 461 ? 140.311 -14.370 2.272   1.00 12.56 ? 757  ALA D O     1 
ATOM   9136  C  CB    . ALA F 3 461 ? 137.443 -13.461 0.922   1.00 13.00 ? 757  ALA D CB    1 
ATOM   9137  N  N     . LYS F 3 462 ? 139.818 -12.194 2.582   1.00 14.64 ? 758  LYS D N     1 
ATOM   9138  C  CA    . LYS F 3 462 ? 141.215 -11.801 2.677   1.00 16.38 ? 758  LYS D CA    1 
ATOM   9139  C  C     . LYS F 3 462 ? 141.837 -12.427 3.923   1.00 16.27 ? 758  LYS D C     1 
ATOM   9140  O  O     . LYS F 3 462 ? 142.979 -12.880 3.891   1.00 16.15 ? 758  LYS D O     1 
ATOM   9141  C  CB    . LYS F 3 462 ? 141.341 -10.270 2.732   1.00 19.27 ? 758  LYS D CB    1 
ATOM   9142  C  CG    . LYS F 3 462 ? 140.909 -9.556  1.444   1.00 23.24 ? 758  LYS D CG    1 
ATOM   9143  C  CD    . LYS F 3 462 ? 140.993 -8.032  1.582   1.00 27.78 ? 758  LYS D CD    1 
ATOM   9144  C  CE    . LYS F 3 462 ? 140.291 -7.298  0.431   1.00 29.61 ? 758  LYS D CE    1 
ATOM   9145  N  NZ    . LYS F 3 462 ? 140.861 -7.550  -0.929  1.00 32.34 ? 758  LYS D NZ    1 
ATOM   9146  N  N     . GLN F 3 463 ? 141.078 -12.469 5.015   1.00 14.84 ? 759  GLN D N     1 
ATOM   9147  C  CA    . GLN F 3 463 ? 141.572 -13.037 6.264   1.00 15.05 ? 759  GLN D CA    1 
ATOM   9148  C  C     . GLN F 3 463 ? 141.726 -14.560 6.255   1.00 14.99 ? 759  GLN D C     1 
ATOM   9149  O  O     . GLN F 3 463 ? 142.769 -15.083 6.654   1.00 14.50 ? 759  GLN D O     1 
ATOM   9150  C  CB    . GLN F 3 463 ? 140.661 -12.617 7.423   1.00 16.41 ? 759  GLN D CB    1 
ATOM   9151  C  CG    . GLN F 3 463 ? 141.095 -13.126 8.799   1.00 17.25 ? 759  GLN D CG    1 
ATOM   9152  C  CD    . GLN F 3 463 ? 140.378 -14.400 9.215   1.00 19.66 ? 759  GLN D CD    1 
ATOM   9153  O  OE1   . GLN F 3 463 ? 139.147 -14.457 9.215   1.00 21.45 ? 759  GLN D OE1   1 
ATOM   9154  N  NE2   . GLN F 3 463 ? 141.145 -15.429 9.576   1.00 16.41 ? 759  GLN D NE2   1 
ATOM   9155  N  N     . LYS F 3 464 ? 140.694 -15.269 5.802   1.00 13.87 ? 760  LYS D N     1 
ATOM   9156  C  CA    . LYS F 3 464 ? 140.725 -16.733 5.771   1.00 14.51 ? 760  LYS D CA    1 
ATOM   9157  C  C     . LYS F 3 464 ? 141.351 -17.339 4.525   1.00 12.94 ? 760  LYS D C     1 
ATOM   9158  O  O     . LYS F 3 464 ? 141.859 -18.460 4.571   1.00 12.94 ? 760  LYS D O     1 
ATOM   9159  C  CB    . LYS F 3 464 ? 139.309 -17.295 5.919   1.00 16.17 ? 760  LYS D CB    1 
ATOM   9160  C  CG    . LYS F 3 464 ? 138.630 -16.921 7.219   1.00 22.04 ? 760  LYS D CG    1 
ATOM   9161  C  CD    . LYS F 3 464 ? 137.282 -17.615 7.354   1.00 25.31 ? 760  LYS D CD    1 
ATOM   9162  C  CE    . LYS F 3 464 ? 136.534 -17.099 8.569   1.00 27.16 ? 760  LYS D CE    1 
ATOM   9163  N  NZ    . LYS F 3 464 ? 137.379 -17.165 9.790   1.00 31.65 ? 760  LYS D NZ    1 
ATOM   9164  N  N     . GLY F 3 465 ? 141.306 -16.606 3.416   1.00 11.48 ? 761  GLY D N     1 
ATOM   9165  C  CA    . GLY F 3 465 ? 141.859 -17.112 2.170   1.00 11.81 ? 761  GLY D CA    1 
ATOM   9166  C  C     . GLY F 3 465 ? 140.806 -17.779 1.292   1.00 11.49 ? 761  GLY D C     1 
ATOM   9167  O  O     . GLY F 3 465 ? 141.104 -18.210 0.172   1.00 12.61 ? 761  GLY D O     1 
ATOM   9168  N  N     . TYR F 3 466 ? 139.573 -17.854 1.792   1.00 10.44 ? 762  TYR D N     1 
ATOM   9169  C  CA    . TYR F 3 466 ? 138.474 -18.482 1.058   1.00 10.80 ? 762  TYR D CA    1 
ATOM   9170  C  C     . TYR F 3 466 ? 137.116 -17.990 1.562   1.00 11.32 ? 762  TYR D C     1 
ATOM   9171  O  O     . TYR F 3 466 ? 137.038 -17.268 2.559   1.00 9.88  ? 762  TYR D O     1 
ATOM   9172  C  CB    . TYR F 3 466 ? 138.544 -20.002 1.235   1.00 10.58 ? 762  TYR D CB    1 
ATOM   9173  C  CG    . TYR F 3 466 ? 138.339 -20.445 2.675   1.00 12.27 ? 762  TYR D CG    1 
ATOM   9174  C  CD1   . TYR F 3 466 ? 137.059 -20.689 3.179   1.00 11.52 ? 762  TYR D CD1   1 
ATOM   9175  C  CD2   . TYR F 3 466 ? 139.426 -20.591 3.543   1.00 12.40 ? 762  TYR D CD2   1 
ATOM   9176  C  CE1   . TYR F 3 466 ? 136.865 -21.066 4.515   1.00 12.59 ? 762  TYR D CE1   1 
ATOM   9177  C  CE2   . TYR F 3 466 ? 139.243 -20.965 4.876   1.00 12.80 ? 762  TYR D CE2   1 
ATOM   9178  C  CZ    . TYR F 3 466 ? 137.960 -21.199 5.357   1.00 13.87 ? 762  TYR D CZ    1 
ATOM   9179  O  OH    . TYR F 3 466 ? 137.767 -21.531 6.687   1.00 14.49 ? 762  TYR D OH    1 
ATOM   9180  N  N     . VAL F 3 467 ? 136.054 -18.389 0.861   1.00 10.15 ? 763  VAL D N     1 
ATOM   9181  C  CA    . VAL F 3 467 ? 134.683 -18.060 1.244   1.00 10.26 ? 763  VAL D CA    1 
ATOM   9182  C  C     . VAL F 3 467 ? 133.925 -19.391 1.270   1.00 11.52 ? 763  VAL D C     1 
ATOM   9183  O  O     . VAL F 3 467 ? 134.351 -20.360 0.642   1.00 10.06 ? 763  VAL D O     1 
ATOM   9184  C  CB    . VAL F 3 467 ? 134.007 -17.088 0.241   1.00 8.58  ? 763  VAL D CB    1 
ATOM   9185  C  CG1   . VAL F 3 467 ? 134.766 -15.760 0.213   1.00 9.59  ? 763  VAL D CG1   1 
ATOM   9186  C  CG2   . VAL F 3 467 ? 133.955 -17.703 -1.149  1.00 8.70  ? 763  VAL D CG2   1 
ATOM   9187  N  N     . THR F 3 468 ? 132.814 -19.450 1.998   1.00 11.93 ? 764  THR D N     1 
ATOM   9188  C  CA    . THR F 3 468 ? 132.050 -20.695 2.089   1.00 12.65 ? 764  THR D CA    1 
ATOM   9189  C  C     . THR F 3 468 ? 130.566 -20.457 1.857   1.00 11.67 ? 764  THR D C     1 
ATOM   9190  O  O     . THR F 3 468 ? 130.123 -19.319 1.776   1.00 12.66 ? 764  THR D O     1 
ATOM   9191  C  CB    . THR F 3 468 ? 132.213 -21.359 3.470   1.00 11.93 ? 764  THR D CB    1 
ATOM   9192  O  OG1   . THR F 3 468 ? 131.806 -20.439 4.491   1.00 17.14 ? 764  THR D OG1   1 
ATOM   9193  C  CG2   . THR F 3 468 ? 133.658 -21.761 3.707   1.00 17.13 ? 764  THR D CG2   1 
ATOM   9194  N  N     . THR F 3 469 ? 129.809 -21.544 1.750   1.00 10.37 ? 765  THR D N     1 
ATOM   9195  C  CA    . THR F 3 469 ? 128.367 -21.466 1.537   1.00 8.76  ? 765  THR D CA    1 
ATOM   9196  C  C     . THR F 3 469 ? 127.670 -21.957 2.795   1.00 9.86  ? 765  THR D C     1 
ATOM   9197  O  O     . THR F 3 469 ? 128.327 -22.368 3.758   1.00 10.75 ? 765  THR D O     1 
ATOM   9198  C  CB    . THR F 3 469 ? 127.919 -22.355 0.363   1.00 8.84  ? 765  THR D CB    1 
ATOM   9199  O  OG1   . THR F 3 469 ? 128.163 -23.729 0.693   1.00 7.50  ? 765  THR D OG1   1 
ATOM   9200  C  CG2   . THR F 3 469 ? 128.690 -21.999 -0.907  1.00 8.58  ? 765  THR D CG2   1 
ATOM   9201  N  N     . LEU F 3 470 ? 126.340 -21.937 2.782   1.00 9.07  ? 766  LEU D N     1 
ATOM   9202  C  CA    . LEU F 3 470 ? 125.572 -22.374 3.940   1.00 10.34 ? 766  LEU D CA    1 
ATOM   9203  C  C     . LEU F 3 470 ? 125.870 -23.817 4.346   1.00 11.07 ? 766  LEU D C     1 
ATOM   9204  O  O     . LEU F 3 470 ? 125.879 -24.132 5.540   1.00 9.68  ? 766  LEU D O     1 
ATOM   9205  C  CB    . LEU F 3 470 ? 124.068 -22.197 3.683   1.00 12.52 ? 766  LEU D CB    1 
ATOM   9206  C  CG    . LEU F 3 470 ? 123.548 -20.750 3.705   1.00 16.33 ? 766  LEU D CG    1 
ATOM   9207  C  CD1   . LEU F 3 470 ? 122.072 -20.723 3.323   1.00 18.27 ? 766  LEU D CD1   1 
ATOM   9208  C  CD2   . LEU F 3 470 ? 123.745 -20.147 5.094   1.00 18.63 ? 766  LEU D CD2   1 
ATOM   9209  N  N     . LEU F 3 471 ? 126.117 -24.697 3.374   1.00 9.49  ? 767  LEU D N     1 
ATOM   9210  C  CA    . LEU F 3 471 ? 126.419 -26.086 3.710   1.00 10.28 ? 767  LEU D CA    1 
ATOM   9211  C  C     . LEU F 3 471 ? 127.922 -26.385 3.699   1.00 10.37 ? 767  LEU D C     1 
ATOM   9212  O  O     . LEU F 3 471 ? 128.340 -27.538 3.585   1.00 10.29 ? 767  LEU D O     1 
ATOM   9213  C  CB    . LEU F 3 471 ? 125.657 -27.060 2.796   1.00 11.68 ? 767  LEU D CB    1 
ATOM   9214  C  CG    . LEU F 3 471 ? 124.123 -27.015 2.897   1.00 16.40 ? 767  LEU D CG    1 
ATOM   9215  C  CD1   . LEU F 3 471 ? 123.508 -28.203 2.142   1.00 13.88 ? 767  LEU D CD1   1 
ATOM   9216  C  CD2   . LEU F 3 471 ? 123.700 -27.052 4.357   1.00 17.50 ? 767  LEU D CD2   1 
ATOM   9217  N  N     . HIS F 3 472 ? 128.719 -25.325 3.814   1.00 10.80 ? 768  HIS D N     1 
ATOM   9218  C  CA    . HIS F 3 472 ? 130.176 -25.409 3.911   1.00 10.43 ? 768  HIS D CA    1 
ATOM   9219  C  C     . HIS F 3 472 ? 131.017 -25.722 2.685   1.00 12.53 ? 768  HIS D C     1 
ATOM   9220  O  O     . HIS F 3 472 ? 132.153 -26.186 2.807   1.00 10.91 ? 768  HIS D O     1 
ATOM   9221  C  CB    . HIS F 3 472 ? 130.541 -26.369 5.045   1.00 13.35 ? 768  HIS D CB    1 
ATOM   9222  C  CG    . HIS F 3 472 ? 129.843 -26.050 6.326   1.00 15.31 ? 768  HIS D CG    1 
ATOM   9223  N  ND1   . HIS F 3 472 ? 130.049 -24.869 7.006   1.00 17.91 ? 768  HIS D ND1   1 
ATOM   9224  C  CD2   . HIS F 3 472 ? 128.878 -26.712 7.004   1.00 17.09 ? 768  HIS D CD2   1 
ATOM   9225  C  CE1   . HIS F 3 472 ? 129.237 -24.817 8.047   1.00 18.67 ? 768  HIS D CE1   1 
ATOM   9226  N  NE2   . HIS F 3 472 ? 128.515 -25.922 8.068   1.00 18.09 ? 768  HIS D NE2   1 
ATOM   9227  N  N     . ARG F 3 473 ? 130.464 -25.471 1.508   1.00 9.79  ? 769  ARG D N     1 
ATOM   9228  C  CA    . ARG F 3 473 ? 131.201 -25.665 0.275   1.00 12.24 ? 769  ARG D CA    1 
ATOM   9229  C  C     . ARG F 3 473 ? 132.206 -24.518 0.348   1.00 14.04 ? 769  ARG D C     1 
ATOM   9230  O  O     . ARG F 3 473 ? 131.902 -23.486 0.954   1.00 13.82 ? 769  ARG D O     1 
ATOM   9231  C  CB    . ARG F 3 473 ? 130.258 -25.479 -0.914  1.00 11.91 ? 769  ARG D CB    1 
ATOM   9232  C  CG    . ARG F 3 473 ? 130.824 -25.821 -2.272  1.00 12.25 ? 769  ARG D CG    1 
ATOM   9233  C  CD    . ARG F 3 473 ? 129.750 -25.583 -3.325  1.00 10.37 ? 769  ARG D CD    1 
ATOM   9234  N  NE    . ARG F 3 473 ? 128.525 -26.328 -3.036  1.00 10.22 ? 769  ARG D NE    1 
ATOM   9235  C  CZ    . ARG F 3 473 ? 128.370 -27.637 -3.231  1.00 10.60 ? 769  ARG D CZ    1 
ATOM   9236  N  NH1   . ARG F 3 473 ? 129.363 -28.362 -3.727  1.00 9.15  ? 769  ARG D NH1   1 
ATOM   9237  N  NH2   . ARG F 3 473 ? 127.219 -28.226 -2.914  1.00 8.58  ? 769  ARG D NH2   1 
ATOM   9238  N  N     . ARG F 3 474 ? 133.395 -24.672 -0.230  1.00 12.53 ? 770  ARG D N     1 
ATOM   9239  C  CA    . ARG F 3 474 ? 134.342 -23.560 -0.180  1.00 13.15 ? 770  ARG D CA    1 
ATOM   9240  C  C     . ARG F 3 474 ? 135.042 -23.277 -1.496  1.00 12.80 ? 770  ARG D C     1 
ATOM   9241  O  O     . ARG F 3 474 ? 135.086 -24.117 -2.398  1.00 12.93 ? 770  ARG D O     1 
ATOM   9242  C  CB    . ARG F 3 474 ? 135.384 -23.737 0.952   1.00 17.23 ? 770  ARG D CB    1 
ATOM   9243  C  CG    . ARG F 3 474 ? 136.500 -24.739 0.728   1.00 18.06 ? 770  ARG D CG    1 
ATOM   9244  C  CD    . ARG F 3 474 ? 137.634 -24.581 1.788   1.00 17.31 ? 770  ARG D CD    1 
ATOM   9245  N  NE    . ARG F 3 474 ? 137.159 -24.725 3.169   1.00 14.88 ? 770  ARG D NE    1 
ATOM   9246  C  CZ    . ARG F 3 474 ? 137.928 -24.652 4.254   1.00 15.42 ? 770  ARG D CZ    1 
ATOM   9247  N  NH1   . ARG F 3 474 ? 139.236 -24.438 4.149   1.00 12.07 ? 770  ARG D NH1   1 
ATOM   9248  N  NH2   . ARG F 3 474 ? 137.384 -24.785 5.458   1.00 13.35 ? 770  ARG D NH2   1 
ATOM   9249  N  N     . ARG F 3 475 ? 135.580 -22.070 -1.599  1.00 10.05 ? 771  ARG D N     1 
ATOM   9250  C  CA    . ARG F 3 475 ? 136.295 -21.652 -2.787  1.00 10.61 ? 771  ARG D CA    1 
ATOM   9251  C  C     . ARG F 3 475 ? 137.434 -20.747 -2.350  1.00 9.33  ? 771  ARG D C     1 
ATOM   9252  O  O     . ARG F 3 475 ? 137.199 -19.686 -1.758  1.00 9.08  ? 771  ARG D O     1 
ATOM   9253  C  CB    . ARG F 3 475 ? 135.369 -20.885 -3.735  1.00 10.55 ? 771  ARG D CB    1 
ATOM   9254  C  CG    . ARG F 3 475 ? 136.049 -20.493 -5.031  1.00 10.38 ? 771  ARG D CG    1 
ATOM   9255  C  CD    . ARG F 3 475 ? 135.141 -19.670 -5.912  1.00 8.99  ? 771  ARG D CD    1 
ATOM   9256  N  NE    . ARG F 3 475 ? 135.701 -19.514 -7.252  1.00 9.50  ? 771  ARG D NE    1 
ATOM   9257  C  CZ    . ARG F 3 475 ? 135.067 -18.922 -8.256  1.00 11.19 ? 771  ARG D CZ    1 
ATOM   9258  N  NH1   . ARG F 3 475 ? 133.849 -18.426 -8.068  1.00 10.07 ? 771  ARG D NH1   1 
ATOM   9259  N  NH2   . ARG F 3 475 ? 135.641 -18.838 -9.448  1.00 11.31 ? 771  ARG D NH2   1 
ATOM   9260  N  N     . TYR F 3 476 ? 138.666 -21.163 -2.625  1.00 8.72  ? 772  TYR D N     1 
ATOM   9261  C  CA    . TYR F 3 476 ? 139.816 -20.346 -2.254  1.00 9.79  ? 772  TYR D CA    1 
ATOM   9262  C  C     . TYR F 3 476 ? 139.938 -19.174 -3.204  1.00 9.16  ? 772  TYR D C     1 
ATOM   9263  O  O     . TYR F 3 476 ? 139.654 -19.295 -4.392  1.00 9.75  ? 772  TYR D O     1 
ATOM   9264  C  CB    . TYR F 3 476 ? 141.112 -21.173 -2.268  1.00 11.27 ? 772  TYR D CB    1 
ATOM   9265  C  CG    . TYR F 3 476 ? 141.139 -22.206 -1.171  1.00 11.20 ? 772  TYR D CG    1 
ATOM   9266  C  CD1   . TYR F 3 476 ? 140.661 -23.499 -1.389  1.00 13.14 ? 772  TYR D CD1   1 
ATOM   9267  C  CD2   . TYR F 3 476 ? 141.592 -21.874 0.107   1.00 10.15 ? 772  TYR D CD2   1 
ATOM   9268  C  CE1   . TYR F 3 476 ? 140.626 -24.441 -0.353  1.00 11.75 ? 772  TYR D CE1   1 
ATOM   9269  C  CE2   . TYR F 3 476 ? 141.557 -22.797 1.145   1.00 11.13 ? 772  TYR D CE2   1 
ATOM   9270  C  CZ    . TYR F 3 476 ? 141.070 -24.079 0.913   1.00 13.68 ? 772  TYR D CZ    1 
ATOM   9271  O  OH    . TYR F 3 476 ? 140.994 -24.977 1.956   1.00 10.78 ? 772  TYR D OH    1 
ATOM   9272  N  N     . LEU F 3 477 ? 140.361 -18.033 -2.674  1.00 10.07 ? 773  LEU D N     1 
ATOM   9273  C  CA    . LEU F 3 477 ? 140.511 -16.835 -3.486  1.00 10.62 ? 773  LEU D CA    1 
ATOM   9274  C  C     . LEU F 3 477 ? 141.865 -16.178 -3.221  1.00 13.51 ? 773  LEU D C     1 
ATOM   9275  O  O     . LEU F 3 477 ? 141.941 -15.087 -2.654  1.00 14.21 ? 773  LEU D O     1 
ATOM   9276  C  CB    . LEU F 3 477 ? 139.367 -15.864 -3.184  1.00 9.65  ? 773  LEU D CB    1 
ATOM   9277  C  CG    . LEU F 3 477 ? 137.969 -16.404 -3.534  1.00 11.99 ? 773  LEU D CG    1 
ATOM   9278  C  CD1   . LEU F 3 477 ? 136.874 -15.447 -3.045  1.00 10.20 ? 773  LEU D CD1   1 
ATOM   9279  C  CD2   . LEU F 3 477 ? 137.878 -16.597 -5.042  1.00 10.76 ? 773  LEU D CD2   1 
ATOM   9280  N  N     . PRO F 3 478 ? 142.958 -16.843 -3.630  1.00 16.17 ? 774  PRO D N     1 
ATOM   9281  C  CA    . PRO F 3 478 ? 144.297 -16.284 -3.416  1.00 18.43 ? 774  PRO D CA    1 
ATOM   9282  C  C     . PRO F 3 478 ? 144.514 -14.909 -4.051  1.00 19.70 ? 774  PRO D C     1 
ATOM   9283  O  O     . PRO F 3 478 ? 145.297 -14.106 -3.543  1.00 22.15 ? 774  PRO D O     1 
ATOM   9284  C  CB    . PRO F 3 478 ? 145.222 -17.364 -3.976  1.00 19.22 ? 774  PRO D CB    1 
ATOM   9285  C  CG    . PRO F 3 478 ? 144.365 -18.067 -5.003  1.00 19.03 ? 774  PRO D CG    1 
ATOM   9286  C  CD    . PRO F 3 478 ? 143.038 -18.157 -4.289  1.00 16.38 ? 774  PRO D CD    1 
ATOM   9287  N  N     . ASP F 3 479 ? 143.818 -14.638 -5.151  1.00 18.87 ? 775  ASP D N     1 
ATOM   9288  C  CA    . ASP F 3 479 ? 143.942 -13.358 -5.843  1.00 19.75 ? 775  ASP D CA    1 
ATOM   9289  C  C     . ASP F 3 479 ? 143.336 -12.173 -5.097  1.00 20.22 ? 775  ASP D C     1 
ATOM   9290  O  O     . ASP F 3 479 ? 143.551 -11.020 -5.482  1.00 20.02 ? 775  ASP D O     1 
ATOM   9291  C  CB    . ASP F 3 479 ? 143.293 -13.437 -7.228  1.00 21.16 ? 775  ASP D CB    1 
ATOM   9292  C  CG    . ASP F 3 479 ? 144.099 -14.268 -8.203  1.00 24.60 ? 775  ASP D CG    1 
ATOM   9293  O  OD1   . ASP F 3 479 ? 143.633 -14.467 -9.347  1.00 24.01 ? 775  ASP D OD1   1 
ATOM   9294  O  OD2   . ASP F 3 479 ? 145.202 -14.715 -7.825  1.00 23.92 ? 775  ASP D OD2   1 
ATOM   9295  N  N     . ILE F 3 480 ? 142.582 -12.438 -4.037  1.00 19.55 ? 776  ILE D N     1 
ATOM   9296  C  CA    . ILE F 3 480 ? 141.953 -11.345 -3.311  1.00 21.54 ? 776  ILE D CA    1 
ATOM   9297  C  C     . ILE F 3 480 ? 142.970 -10.448 -2.606  1.00 24.22 ? 776  ILE D C     1 
ATOM   9298  O  O     . ILE F 3 480 ? 142.662 -9.308  -2.269  1.00 23.70 ? 776  ILE D O     1 
ATOM   9299  C  CB    . ILE F 3 480 ? 140.911 -11.870 -2.296  1.00 21.23 ? 776  ILE D CB    1 
ATOM   9300  C  CG1   . ILE F 3 480 ? 139.866 -10.784 -2.035  1.00 20.71 ? 776  ILE D CG1   1 
ATOM   9301  C  CG2   . ILE F 3 480 ? 141.590 -12.281 -0.994  1.00 20.81 ? 776  ILE D CG2   1 
ATOM   9302  C  CD1   . ILE F 3 480 ? 138.565 -11.315 -1.508  1.00 19.37 ? 776  ILE D CD1   1 
ATOM   9303  N  N     . THR F 3 481 ? 144.178 -10.960 -2.391  1.00 26.54 ? 777  THR D N     1 
ATOM   9304  C  CA    . THR F 3 481 ? 145.226 -10.173 -1.741  1.00 30.84 ? 777  THR D CA    1 
ATOM   9305  C  C     . THR F 3 481 ? 146.273 -9.726  -2.754  1.00 33.05 ? 777  THR D C     1 
ATOM   9306  O  O     . THR F 3 481 ? 147.380 -9.332  -2.383  1.00 34.06 ? 777  THR D O     1 
ATOM   9307  C  CB    . THR F 3 481 ? 145.948 -10.967 -0.634  1.00 30.88 ? 777  THR D CB    1 
ATOM   9308  O  OG1   . THR F 3 481 ? 146.497 -12.168 -1.188  1.00 32.44 ? 777  THR D OG1   1 
ATOM   9309  C  CG2   . THR F 3 481 ? 144.989 -11.307 0.497   1.00 32.36 ? 777  THR D CG2   1 
ATOM   9310  N  N     . SER F 3 482 ? 145.920 -9.791  -4.033  1.00 33.18 ? 778  SER D N     1 
ATOM   9311  C  CA    . SER F 3 482 ? 146.833 -9.388  -5.094  1.00 35.20 ? 778  SER D CA    1 
ATOM   9312  C  C     . SER F 3 482 ? 147.019 -7.878  -5.111  1.00 37.17 ? 778  SER D C     1 
ATOM   9313  O  O     . SER F 3 482 ? 146.096 -7.125  -4.785  1.00 36.30 ? 778  SER D O     1 
ATOM   9314  C  CB    . SER F 3 482 ? 146.297 -9.839  -6.451  1.00 35.52 ? 778  SER D CB    1 
ATOM   9315  O  OG    . SER F 3 482 ? 147.035 -9.247  -7.506  1.00 35.53 ? 778  SER D OG    1 
ATOM   9316  N  N     . ARG F 3 483 ? 148.215 -7.436  -5.490  1.00 38.69 ? 779  ARG D N     1 
ATOM   9317  C  CA    . ARG F 3 483 ? 148.499 -6.009  -5.561  1.00 39.65 ? 779  ARG D CA    1 
ATOM   9318  C  C     . ARG F 3 483 ? 147.985 -5.430  -6.873  1.00 38.37 ? 779  ARG D C     1 
ATOM   9319  O  O     . ARG F 3 483 ? 147.926 -4.213  -7.040  1.00 38.53 ? 779  ARG D O     1 
ATOM   9320  C  CB    . ARG F 3 483 ? 150.001 -5.743  -5.428  1.00 42.23 ? 779  ARG D CB    1 
ATOM   9321  C  CG    . ARG F 3 483 ? 150.554 -5.968  -4.030  1.00 46.22 ? 779  ARG D CG    1 
ATOM   9322  C  CD    . ARG F 3 483 ? 151.976 -5.436  -3.920  1.00 50.15 ? 779  ARG D CD    1 
ATOM   9323  N  NE    . ARG F 3 483 ? 152.564 -5.682  -2.605  1.00 52.82 ? 779  ARG D NE    1 
ATOM   9324  C  CZ    . ARG F 3 483 ? 152.836 -6.891  -2.121  1.00 54.25 ? 779  ARG D CZ    1 
ATOM   9325  N  NH1   . ARG F 3 483 ? 152.572 -7.972  -2.842  1.00 54.74 ? 779  ARG D NH1   1 
ATOM   9326  N  NH2   . ARG F 3 483 ? 153.377 -7.019  -0.917  1.00 54.91 ? 779  ARG D NH2   1 
ATOM   9327  N  N     . ASN F 3 484 ? 147.615 -6.308  -7.802  1.00 37.63 ? 780  ASN D N     1 
ATOM   9328  C  CA    . ASN F 3 484 ? 147.085 -5.878  -9.094  1.00 36.68 ? 780  ASN D CA    1 
ATOM   9329  C  C     . ASN F 3 484 ? 145.586 -5.611  -8.965  1.00 36.10 ? 780  ASN D C     1 
ATOM   9330  O  O     . ASN F 3 484 ? 144.791 -6.534  -8.775  1.00 34.81 ? 780  ASN D O     1 
ATOM   9331  C  CB    . ASN F 3 484 ? 147.340 -6.948  -10.160 1.00 37.53 ? 780  ASN D CB    1 
ATOM   9332  C  CG    . ASN F 3 484 ? 146.737 -6.588  -11.510 1.00 38.98 ? 780  ASN D CG    1 
ATOM   9333  O  OD1   . ASN F 3 484 ? 145.519 -6.634  -11.696 1.00 40.20 ? 780  ASN D OD1   1 
ATOM   9334  N  ND2   . ASN F 3 484 ? 147.591 -6.221  -12.459 1.00 39.76 ? 780  ASN D ND2   1 
ATOM   9335  N  N     . PHE F 3 485 ? 145.213 -4.340  -9.071  1.00 34.80 ? 781  PHE D N     1 
ATOM   9336  C  CA    . PHE F 3 485 ? 143.822 -3.915  -8.949  1.00 34.28 ? 781  PHE D CA    1 
ATOM   9337  C  C     . PHE F 3 485 ? 142.829 -4.773  -9.731  1.00 33.36 ? 781  PHE D C     1 
ATOM   9338  O  O     . PHE F 3 485 ? 141.805 -5.197  -9.194  1.00 32.58 ? 781  PHE D O     1 
ATOM   9339  C  CB    . PHE F 3 485 ? 143.681 -2.460  -9.402  1.00 34.74 ? 781  PHE D CB    1 
ATOM   9340  C  CG    . PHE F 3 485 ? 142.278 -1.929  -9.307  1.00 35.74 ? 781  PHE D CG    1 
ATOM   9341  C  CD1   . PHE F 3 485 ? 141.748 -1.542  -8.080  1.00 36.14 ? 781  PHE D CD1   1 
ATOM   9342  C  CD2   . PHE F 3 485 ? 141.484 -1.821  -10.445 1.00 36.81 ? 781  PHE D CD2   1 
ATOM   9343  C  CE1   . PHE F 3 485 ? 140.445 -1.055  -7.986  1.00 36.84 ? 781  PHE D CE1   1 
ATOM   9344  C  CE2   . PHE F 3 485 ? 140.179 -1.335  -10.363 1.00 36.94 ? 781  PHE D CE2   1 
ATOM   9345  C  CZ    . PHE F 3 485 ? 139.659 -0.951  -9.130  1.00 36.53 ? 781  PHE D CZ    1 
ATOM   9346  N  N     . ASN F 3 486 ? 143.132 -5.023  -10.999 1.00 32.15 ? 782  ASN D N     1 
ATOM   9347  C  CA    . ASN F 3 486 ? 142.247 -5.805  -11.850 1.00 32.47 ? 782  ASN D CA    1 
ATOM   9348  C  C     . ASN F 3 486 ? 142.080 -7.253  -11.384 1.00 30.74 ? 782  ASN D C     1 
ATOM   9349  O  O     . ASN F 3 486 ? 140.965 -7.771  -11.351 1.00 29.54 ? 782  ASN D O     1 
ATOM   9350  C  CB    . ASN F 3 486 ? 142.751 -5.778  -13.293 1.00 35.65 ? 782  ASN D CB    1 
ATOM   9351  C  CG    . ASN F 3 486 ? 141.633 -5.964  -14.299 1.00 38.73 ? 782  ASN D CG    1 
ATOM   9352  O  OD1   . ASN F 3 486 ? 140.675 -5.188  -14.329 1.00 41.13 ? 782  ASN D OD1   1 
ATOM   9353  N  ND2   . ASN F 3 486 ? 141.746 -6.995  -15.128 1.00 40.39 ? 782  ASN D ND2   1 
ATOM   9354  N  N     . VAL F 3 487 ? 143.182 -7.904  -11.027 1.00 28.48 ? 783  VAL D N     1 
ATOM   9355  C  CA    . VAL F 3 487 ? 143.131 -9.285  -10.560 1.00 26.25 ? 783  VAL D CA    1 
ATOM   9356  C  C     . VAL F 3 487 ? 142.426 -9.381  -9.202  1.00 24.72 ? 783  VAL D C     1 
ATOM   9357  O  O     . VAL F 3 487 ? 141.671 -10.324 -8.947  1.00 23.73 ? 783  VAL D O     1 
ATOM   9358  C  CB    . VAL F 3 487 ? 144.552 -9.884  -10.425 1.00 26.90 ? 783  VAL D CB    1 
ATOM   9359  C  CG1   . VAL F 3 487 ? 144.486 -11.242 -9.749  1.00 27.93 ? 783  VAL D CG1   1 
ATOM   9360  C  CG2   . VAL F 3 487 ? 145.195 -10.013 -11.798 1.00 27.77 ? 783  VAL D CG2   1 
ATOM   9361  N  N     . ARG F 3 488 ? 142.679 -8.404  -8.337  1.00 21.43 ? 784  ARG D N     1 
ATOM   9362  C  CA    . ARG F 3 488 ? 142.070 -8.383  -7.011  1.00 21.65 ? 784  ARG D CA    1 
ATOM   9363  C  C     . ARG F 3 488 ? 140.573 -8.119  -7.124  1.00 19.95 ? 784  ARG D C     1 
ATOM   9364  O  O     . ARG F 3 488 ? 139.772 -8.753  -6.441  1.00 18.82 ? 784  ARG D O     1 
ATOM   9365  C  CB    . ARG F 3 488 ? 142.720 -7.301  -6.136  1.00 23.82 ? 784  ARG D CB    1 
ATOM   9366  C  CG    . ARG F 3 488 ? 142.198 -7.271  -4.707  1.00 26.62 ? 784  ARG D CG    1 
ATOM   9367  C  CD    . ARG F 3 488 ? 142.927 -6.256  -3.820  1.00 30.39 ? 784  ARG D CD    1 
ATOM   9368  N  NE    . ARG F 3 488 ? 142.765 -4.882  -4.287  1.00 32.69 ? 784  ARG D NE    1 
ATOM   9369  C  CZ    . ARG F 3 488 ? 143.606 -4.262  -5.109  1.00 33.99 ? 784  ARG D CZ    1 
ATOM   9370  N  NH1   . ARG F 3 488 ? 144.685 -4.887  -5.561  1.00 34.98 ? 784  ARG D NH1   1 
ATOM   9371  N  NH2   . ARG F 3 488 ? 143.364 -3.015  -5.489  1.00 34.03 ? 784  ARG D NH2   1 
ATOM   9372  N  N     . SER F 3 489 ? 140.203 -7.183  -7.991  1.00 18.60 ? 785  SER D N     1 
ATOM   9373  C  CA    . SER F 3 489 ? 138.801 -6.841  -8.187  1.00 20.27 ? 785  SER D CA    1 
ATOM   9374  C  C     . SER F 3 489 ? 137.997 -8.064  -8.603  1.00 18.48 ? 785  SER D C     1 
ATOM   9375  O  O     . SER F 3 489 ? 136.893 -8.283  -8.109  1.00 18.62 ? 785  SER D O     1 
ATOM   9376  C  CB    . SER F 3 489 ? 138.664 -5.737  -9.239  1.00 21.43 ? 785  SER D CB    1 
ATOM   9377  O  OG    . SER F 3 489 ? 139.166 -4.509  -8.733  1.00 27.94 ? 785  SER D OG    1 
ATOM   9378  N  N     . PHE F 3 490 ? 138.548 -8.861  -9.511  1.00 17.09 ? 786  PHE D N     1 
ATOM   9379  C  CA    . PHE F 3 490 ? 137.852 -10.065 -9.951  1.00 17.70 ? 786  PHE D CA    1 
ATOM   9380  C  C     . PHE F 3 490 ? 137.633 -11.018 -8.776  1.00 15.25 ? 786  PHE D C     1 
ATOM   9381  O  O     . PHE F 3 490 ? 136.562 -11.615 -8.643  1.00 15.02 ? 786  PHE D O     1 
ATOM   9382  C  CB    . PHE F 3 490 ? 138.641 -10.756 -11.068 1.00 18.91 ? 786  PHE D CB    1 
ATOM   9383  C  CG    . PHE F 3 490 ? 138.294 -10.260 -12.445 1.00 20.46 ? 786  PHE D CG    1 
ATOM   9384  C  CD1   . PHE F 3 490 ? 137.142 -10.702 -13.084 1.00 21.04 ? 786  PHE D CD1   1 
ATOM   9385  C  CD2   . PHE F 3 490 ? 139.102 -9.329  -13.093 1.00 24.05 ? 786  PHE D CD2   1 
ATOM   9386  C  CE1   . PHE F 3 490 ? 136.794 -10.226 -14.350 1.00 23.67 ? 786  PHE D CE1   1 
ATOM   9387  C  CE2   . PHE F 3 490 ? 138.764 -8.843  -14.361 1.00 23.43 ? 786  PHE D CE2   1 
ATOM   9388  C  CZ    . PHE F 3 490 ? 137.606 -9.295  -14.990 1.00 23.82 ? 786  PHE D CZ    1 
ATOM   9389  N  N     . ALA F 3 491 ? 138.640 -11.145 -7.917  1.00 13.22 ? 787  ALA D N     1 
ATOM   9390  C  CA    . ALA F 3 491 ? 138.540 -12.021 -6.755  1.00 13.09 ? 787  ALA D CA    1 
ATOM   9391  C  C     . ALA F 3 491 ? 137.523 -11.490 -5.748  1.00 14.08 ? 787  ALA D C     1 
ATOM   9392  O  O     . ALA F 3 491 ? 136.825 -12.266 -5.087  1.00 12.15 ? 787  ALA D O     1 
ATOM   9393  C  CB    . ALA F 3 491 ? 139.903 -12.172 -6.089  1.00 13.47 ? 787  ALA D CB    1 
ATOM   9394  N  N     . GLU F 3 492 ? 137.432 -10.169 -5.625  1.00 14.09 ? 788  GLU D N     1 
ATOM   9395  C  CA    . GLU F 3 492 ? 136.481 -9.584  -4.685  1.00 13.54 ? 788  GLU D CA    1 
ATOM   9396  C  C     . GLU F 3 492 ? 135.050 -9.864  -5.127  1.00 12.39 ? 788  GLU D C     1 
ATOM   9397  O  O     . GLU F 3 492 ? 134.195 -10.152 -4.296  1.00 12.28 ? 788  GLU D O     1 
ATOM   9398  C  CB    . GLU F 3 492 ? 136.701 -8.075  -4.558  1.00 15.17 ? 788  GLU D CB    1 
ATOM   9399  C  CG    . GLU F 3 492 ? 138.096 -7.719  -4.064  1.00 18.12 ? 788  GLU D CG    1 
ATOM   9400  C  CD    . GLU F 3 492 ? 138.290 -6.230  -3.865  1.00 22.56 ? 788  GLU D CD    1 
ATOM   9401  O  OE1   . GLU F 3 492 ? 137.694 -5.445  -4.631  1.00 21.70 ? 788  GLU D OE1   1 
ATOM   9402  O  OE2   . GLU F 3 492 ? 139.047 -5.849  -2.946  1.00 24.53 ? 788  GLU D OE2   1 
ATOM   9403  N  N     . ARG F 3 493 ? 134.784 -9.779  -6.429  1.00 12.00 ? 789  ARG D N     1 
ATOM   9404  C  CA    . ARG F 3 493 ? 133.429 -10.034 -6.914  1.00 11.58 ? 789  ARG D CA    1 
ATOM   9405  C  C     . ARG F 3 493 ? 133.080 -11.512 -6.757  1.00 11.50 ? 789  ARG D C     1 
ATOM   9406  O  O     . ARG F 3 493 ? 131.915 -11.864 -6.567  1.00 11.25 ? 789  ARG D O     1 
ATOM   9407  C  CB    . ARG F 3 493 ? 133.270 -9.563  -8.370  1.00 11.75 ? 789  ARG D CB    1 
ATOM   9408  C  CG    . ARG F 3 493 ? 133.269 -8.028  -8.494  1.00 14.15 ? 789  ARG D CG    1 
ATOM   9409  C  CD    . ARG F 3 493 ? 132.892 -7.530  -9.898  1.00 14.91 ? 789  ARG D CD    1 
ATOM   9410  N  NE    . ARG F 3 493 ? 133.868 -7.896  -10.925 1.00 16.06 ? 789  ARG D NE    1 
ATOM   9411  C  CZ    . ARG F 3 493 ? 134.951 -7.186  -11.236 1.00 18.43 ? 789  ARG D CZ    1 
ATOM   9412  N  NH1   . ARG F 3 493 ? 135.225 -6.049  -10.606 1.00 17.44 ? 789  ARG D NH1   1 
ATOM   9413  N  NH2   . ARG F 3 493 ? 135.765 -7.618  -12.189 1.00 19.62 ? 789  ARG D NH2   1 
ATOM   9414  N  N     . MET F 3 494 ? 134.086 -12.379 -6.830  1.00 10.01 ? 790  MET D N     1 
ATOM   9415  C  CA    . MET F 3 494 ? 133.843 -13.805 -6.632  1.00 11.20 ? 790  MET D CA    1 
ATOM   9416  C  C     . MET F 3 494 ? 133.467 -13.989 -5.166  1.00 11.21 ? 790  MET D C     1 
ATOM   9417  O  O     . MET F 3 494 ? 132.584 -14.776 -4.829  1.00 13.41 ? 790  MET D O     1 
ATOM   9418  C  CB    . MET F 3 494 ? 135.099 -14.630 -6.946  1.00 9.83  ? 790  MET D CB    1 
ATOM   9419  C  CG    . MET F 3 494 ? 135.386 -14.776 -8.421  1.00 9.88  ? 790  MET D CG    1 
ATOM   9420  S  SD    . MET F 3 494 ? 136.897 -15.721 -8.700  1.00 12.64 ? 790  MET D SD    1 
ATOM   9421  C  CE    . MET F 3 494 ? 136.963 -15.637 -10.521 1.00 8.56  ? 790  MET D CE    1 
ATOM   9422  N  N     . ALA F 3 495 ? 134.149 -13.253 -4.295  1.00 10.98 ? 791  ALA D N     1 
ATOM   9423  C  CA    . ALA F 3 495 ? 133.879 -13.320 -2.866  1.00 11.55 ? 791  ALA D CA    1 
ATOM   9424  C  C     . ALA F 3 495 ? 132.423 -12.914 -2.610  1.00 11.31 ? 791  ALA D C     1 
ATOM   9425  O  O     . ALA F 3 495 ? 131.762 -13.469 -1.735  1.00 9.51  ? 791  ALA D O     1 
ATOM   9426  C  CB    . ALA F 3 495 ? 134.835 -12.387 -2.106  1.00 12.46 ? 791  ALA D CB    1 
ATOM   9427  N  N     . MET F 3 496 ? 131.931 -11.949 -3.385  1.00 9.78  ? 792  MET D N     1 
ATOM   9428  C  CA    . MET F 3 496 ? 130.549 -11.479 -3.251  1.00 11.67 ? 792  MET D CA    1 
ATOM   9429  C  C     . MET F 3 496 ? 129.492 -12.455 -3.789  1.00 11.94 ? 792  MET D C     1 
ATOM   9430  O  O     . MET F 3 496 ? 128.435 -12.638 -3.181  1.00 12.46 ? 792  MET D O     1 
ATOM   9431  C  CB    . MET F 3 496 ? 130.370 -10.148 -3.986  1.00 10.64 ? 792  MET D CB    1 
ATOM   9432  C  CG    . MET F 3 496 ? 131.245 -9.009  -3.484  1.00 16.52 ? 792  MET D CG    1 
ATOM   9433  S  SD    . MET F 3 496 ? 131.015 -7.533  -4.507  1.00 20.99 ? 792  MET D SD    1 
ATOM   9434  C  CE    . MET F 3 496 ? 132.092 -6.419  -3.680  1.00 24.88 ? 792  MET D CE    1 
ATOM   9435  N  N     . ASN F 3 497 ? 129.779 -13.076 -4.927  1.00 9.93  ? 793  ASN D N     1 
ATOM   9436  C  CA    . ASN F 3 497 ? 128.825 -13.983 -5.574  1.00 9.41  ? 793  ASN D CA    1 
ATOM   9437  C  C     . ASN F 3 497 ? 128.848 -15.456 -5.164  1.00 9.91  ? 793  ASN D C     1 
ATOM   9438  O  O     . ASN F 3 497 ? 127.793 -16.072 -4.988  1.00 10.83 ? 793  ASN D O     1 
ATOM   9439  C  CB    . ASN F 3 497 ? 128.995 -13.857 -7.099  1.00 9.73  ? 793  ASN D CB    1 
ATOM   9440  C  CG    . ASN F 3 497 ? 128.223 -14.914 -7.878  1.00 9.24  ? 793  ASN D CG    1 
ATOM   9441  O  OD1   . ASN F 3 497 ? 128.724 -16.016 -8.128  1.00 9.44  ? 793  ASN D OD1   1 
ATOM   9442  N  ND2   . ASN F 3 497 ? 127.000 -14.582 -8.263  1.00 5.08  ? 793  ASN D ND2   1 
ATOM   9443  N  N     . THR F 3 498 ? 130.033 -16.024 -4.987  1.00 8.10  ? 794  THR D N     1 
ATOM   9444  C  CA    . THR F 3 498 ? 130.121 -17.443 -4.646  1.00 9.38  ? 794  THR D CA    1 
ATOM   9445  C  C     . THR F 3 498 ? 129.299 -17.931 -3.451  1.00 7.38  ? 794  THR D C     1 
ATOM   9446  O  O     . THR F 3 498 ? 128.603 -18.932 -3.562  1.00 7.30  ? 794  THR D O     1 
ATOM   9447  C  CB    . THR F 3 498 ? 131.589 -17.879 -4.495  1.00 7.93  ? 794  THR D CB    1 
ATOM   9448  O  OG1   . THR F 3 498 ? 132.229 -17.774 -5.771  1.00 9.25  ? 794  THR D OG1   1 
ATOM   9449  C  CG2   . THR F 3 498 ? 131.686 -19.326 -4.021  1.00 7.92  ? 794  THR D CG2   1 
ATOM   9450  N  N     . PRO F 3 499 ? 129.360 -17.236 -2.301  1.00 8.54  ? 795  PRO D N     1 
ATOM   9451  C  CA    . PRO F 3 499 ? 128.569 -17.695 -1.153  1.00 8.47  ? 795  PRO D CA    1 
ATOM   9452  C  C     . PRO F 3 499 ? 127.062 -17.712 -1.438  1.00 9.42  ? 795  PRO D C     1 
ATOM   9453  O  O     . PRO F 3 499 ? 126.329 -18.529 -0.887  1.00 10.12 ? 795  PRO D O     1 
ATOM   9454  C  CB    . PRO F 3 499 ? 128.934 -16.709 -0.044  1.00 8.41  ? 795  PRO D CB    1 
ATOM   9455  C  CG    . PRO F 3 499 ? 130.301 -16.222 -0.446  1.00 8.73  ? 795  PRO D CG    1 
ATOM   9456  C  CD    . PRO F 3 499 ? 130.174 -16.062 -1.938  1.00 8.12  ? 795  PRO D CD    1 
ATOM   9457  N  N     . ILE F 3 500 ? 126.604 -16.810 -2.298  1.00 8.86  ? 796  ILE D N     1 
ATOM   9458  C  CA    . ILE F 3 500 ? 125.177 -16.737 -2.614  1.00 7.71  ? 796  ILE D CA    1 
ATOM   9459  C  C     . ILE F 3 500 ? 124.796 -17.775 -3.665  1.00 8.56  ? 796  ILE D C     1 
ATOM   9460  O  O     . ILE F 3 500 ? 123.918 -18.605 -3.432  1.00 7.25  ? 796  ILE D O     1 
ATOM   9461  C  CB    . ILE F 3 500 ? 124.774 -15.330 -3.124  1.00 5.37  ? 796  ILE D CB    1 
ATOM   9462  C  CG1   . ILE F 3 500 ? 125.349 -14.250 -2.203  1.00 7.74  ? 796  ILE D CG1   1 
ATOM   9463  C  CG2   . ILE F 3 500 ? 123.247 -15.213 -3.186  1.00 8.15  ? 796  ILE D CG2   1 
ATOM   9464  C  CD1   . ILE F 3 500 ? 125.069 -14.465 -0.730  1.00 7.22  ? 796  ILE D CD1   1 
ATOM   9465  N  N     . GLN F 3 501 ? 125.452 -17.735 -4.822  1.00 8.98  ? 797  GLN D N     1 
ATOM   9466  C  CA    . GLN F 3 501 ? 125.143 -18.704 -5.866  1.00 8.63  ? 797  GLN D CA    1 
ATOM   9467  C  C     . GLN F 3 501 ? 125.373 -20.118 -5.329  1.00 8.23  ? 797  GLN D C     1 
ATOM   9468  O  O     . GLN F 3 501 ? 124.597 -21.039 -5.612  1.00 8.02  ? 797  GLN D O     1 
ATOM   9469  C  CB    . GLN F 3 501 ? 126.021 -18.464 -7.105  1.00 7.97  ? 797  GLN D CB    1 
ATOM   9470  C  CG    . GLN F 3 501 ? 125.613 -19.317 -8.312  1.00 8.69  ? 797  GLN D CG    1 
ATOM   9471  C  CD    . GLN F 3 501 ? 126.566 -19.182 -9.496  1.00 9.45  ? 797  GLN D CD    1 
ATOM   9472  O  OE1   . GLN F 3 501 ? 127.330 -20.097 -9.799  1.00 9.18  ? 797  GLN D OE1   1 
ATOM   9473  N  NE2   . GLN F 3 501 ? 126.524 -18.036 -10.164 1.00 8.10  ? 797  GLN D NE2   1 
ATOM   9474  N  N     . GLY F 3 502 ? 126.437 -20.278 -4.545  1.00 9.08  ? 798  GLY D N     1 
ATOM   9475  C  CA    . GLY F 3 502 ? 126.770 -21.578 -3.981  1.00 8.90  ? 798  GLY D CA    1 
ATOM   9476  C  C     . GLY F 3 502 ? 125.778 -22.091 -2.952  1.00 8.99  ? 798  GLY D C     1 
ATOM   9477  O  O     . GLY F 3 502 ? 125.480 -23.288 -2.917  1.00 9.93  ? 798  GLY D O     1 
ATOM   9478  N  N     . SER F 3 503 ? 125.270 -21.203 -2.103  1.00 7.98  ? 799  SER D N     1 
ATOM   9479  C  CA    . SER F 3 503 ? 124.297 -21.616 -1.098  1.00 8.69  ? 799  SER D CA    1 
ATOM   9480  C  C     . SER F 3 503 ? 123.003 -21.991 -1.820  1.00 8.72  ? 799  SER D C     1 
ATOM   9481  O  O     . SER F 3 503 ? 122.283 -22.893 -1.392  1.00 8.05  ? 799  SER D O     1 
ATOM   9482  C  CB    . SER F 3 503 ? 124.037 -20.494 -0.078  1.00 8.35  ? 799  SER D CB    1 
ATOM   9483  O  OG    . SER F 3 503 ? 125.180 -20.247 0.736   1.00 7.74  ? 799  SER D OG    1 
ATOM   9484  N  N     . ALA F 3 504 ? 122.706 -21.298 -2.918  1.00 8.10  ? 800  ALA D N     1 
ATOM   9485  C  CA    . ALA F 3 504 ? 121.508 -21.616 -3.693  1.00 7.27  ? 800  ALA D CA    1 
ATOM   9486  C  C     . ALA F 3 504 ? 121.682 -23.008 -4.315  1.00 7.61  ? 800  ALA D C     1 
ATOM   9487  O  O     . ALA F 3 504 ? 120.713 -23.751 -4.472  1.00 5.71  ? 800  ALA D O     1 
ATOM   9488  C  CB    . ALA F 3 504 ? 121.282 -20.565 -4.795  1.00 7.66  ? 800  ALA D CB    1 
ATOM   9489  N  N     . ALA F 3 505 ? 122.918 -23.363 -4.664  1.00 6.63  ? 801  ALA D N     1 
ATOM   9490  C  CA    . ALA F 3 505 ? 123.188 -24.680 -5.252  1.00 6.07  ? 801  ALA D CA    1 
ATOM   9491  C  C     . ALA F 3 505 ? 123.027 -25.742 -4.162  1.00 6.49  ? 801  ALA D C     1 
ATOM   9492  O  O     . ALA F 3 505 ? 122.497 -26.827 -4.408  1.00 7.09  ? 801  ALA D O     1 
ATOM   9493  C  CB    . ALA F 3 505 ? 124.603 -24.726 -5.836  1.00 3.89  ? 801  ALA D CB    1 
ATOM   9494  N  N     . ASP F 3 506 ? 123.493 -25.421 -2.954  1.00 6.71  ? 802  ASP D N     1 
ATOM   9495  C  CA    . ASP F 3 506 ? 123.376 -26.333 -1.812  1.00 7.08  ? 802  ASP D CA    1 
ATOM   9496  C  C     . ASP F 3 506 ? 121.906 -26.675 -1.554  1.00 9.68  ? 802  ASP D C     1 
ATOM   9497  O  O     . ASP F 3 506 ? 121.540 -27.834 -1.331  1.00 9.84  ? 802  ASP D O     1 
ATOM   9498  C  CB    . ASP F 3 506 ? 123.929 -25.682 -0.545  1.00 8.88  ? 802  ASP D CB    1 
ATOM   9499  C  CG    . ASP F 3 506 ? 125.438 -25.531 -0.558  1.00 9.66  ? 802  ASP D CG    1 
ATOM   9500  O  OD1   . ASP F 3 506 ? 125.935 -24.709 0.241   1.00 12.34 ? 802  ASP D OD1   1 
ATOM   9501  O  OD2   . ASP F 3 506 ? 126.124 -26.227 -1.339  1.00 11.08 ? 802  ASP D OD2   1 
ATOM   9502  N  N     . ILE F 3 507 ? 121.074 -25.642 -1.580  1.00 8.60  ? 803  ILE D N     1 
ATOM   9503  C  CA    . ILE F 3 507 ? 119.651 -25.783 -1.315  1.00 8.79  ? 803  ILE D CA    1 
ATOM   9504  C  C     . ILE F 3 507 ? 118.912 -26.662 -2.309  1.00 8.48  ? 803  ILE D C     1 
ATOM   9505  O  O     . ILE F 3 507 ? 118.190 -27.569 -1.901  1.00 9.57  ? 803  ILE D O     1 
ATOM   9506  C  CB    . ILE F 3 507 ? 118.977 -24.399 -1.233  1.00 8.51  ? 803  ILE D CB    1 
ATOM   9507  C  CG1   . ILE F 3 507 ? 119.518 -23.647 -0.010  1.00 8.55  ? 803  ILE D CG1   1 
ATOM   9508  C  CG2   . ILE F 3 507 ? 117.453 -24.554 -1.129  1.00 8.80  ? 803  ILE D CG2   1 
ATOM   9509  C  CD1   . ILE F 3 507 ? 119.143 -22.174 0.026   1.00 8.37  ? 803  ILE D CD1   1 
ATOM   9510  N  N     . ILE F 3 508 ? 119.080 -26.415 -3.604  1.00 8.21  ? 804  ILE D N     1 
ATOM   9511  C  CA    . ILE F 3 508 ? 118.375 -27.248 -4.567  1.00 9.17  ? 804  ILE D CA    1 
ATOM   9512  C  C     . ILE F 3 508 ? 118.886 -28.686 -4.537  1.00 8.68  ? 804  ILE D C     1 
ATOM   9513  O  O     . ILE F 3 508 ? 118.133 -29.621 -4.825  1.00 7.41  ? 804  ILE D O     1 
ATOM   9514  C  CB    . ILE F 3 508 ? 118.448 -26.685 -6.011  1.00 10.44 ? 804  ILE D CB    1 
ATOM   9515  C  CG1   . ILE F 3 508 ? 117.528 -27.524 -6.907  1.00 10.69 ? 804  ILE D CG1   1 
ATOM   9516  C  CG2   . ILE F 3 508 ? 119.893 -26.690 -6.525  1.00 9.98  ? 804  ILE D CG2   1 
ATOM   9517  C  CD1   . ILE F 3 508 ? 117.128 -26.862 -8.207  1.00 13.96 ? 804  ILE D CD1   1 
ATOM   9518  N  N     . LYS F 3 509 ? 120.158 -28.870 -4.186  1.00 7.62  ? 805  LYS D N     1 
ATOM   9519  C  CA    . LYS F 3 509 ? 120.708 -30.223 -4.093  1.00 8.03  ? 805  LYS D CA    1 
ATOM   9520  C  C     . LYS F 3 509 ? 120.033 -30.967 -2.943  1.00 7.49  ? 805  LYS D C     1 
ATOM   9521  O  O     . LYS F 3 509 ? 119.662 -32.130 -3.082  1.00 9.38  ? 805  LYS D O     1 
ATOM   9522  C  CB    . LYS F 3 509 ? 122.227 -30.181 -3.871  1.00 5.94  ? 805  LYS D CB    1 
ATOM   9523  C  CG    . LYS F 3 509 ? 123.011 -29.872 -5.141  1.00 8.83  ? 805  LYS D CG    1 
ATOM   9524  C  CD    . LYS F 3 509 ? 124.512 -29.863 -4.877  1.00 7.22  ? 805  LYS D CD    1 
ATOM   9525  C  CE    . LYS F 3 509 ? 125.286 -29.853 -6.185  1.00 8.40  ? 805  LYS D CE    1 
ATOM   9526  N  NZ    . LYS F 3 509 ? 126.757 -29.771 -5.947  1.00 6.34  ? 805  LYS D NZ    1 
ATOM   9527  N  N     . LYS F 3 510 ? 119.869 -30.303 -1.802  1.00 7.48  ? 806  LYS D N     1 
ATOM   9528  C  CA    . LYS F 3 510 ? 119.211 -30.961 -0.678  1.00 7.65  ? 806  LYS D CA    1 
ATOM   9529  C  C     . LYS F 3 510 ? 117.746 -31.239 -1.019  1.00 8.36  ? 806  LYS D C     1 
ATOM   9530  O  O     . LYS F 3 510 ? 117.194 -32.275 -0.634  1.00 8.68  ? 806  LYS D O     1 
ATOM   9531  C  CB    . LYS F 3 510 ? 119.283 -30.116 0.593   1.00 9.95  ? 806  LYS D CB    1 
ATOM   9532  C  CG    . LYS F 3 510 ? 118.605 -30.811 1.770   1.00 13.07 ? 806  LYS D CG    1 
ATOM   9533  C  CD    . LYS F 3 510 ? 118.891 -30.143 3.099   1.00 15.98 ? 806  LYS D CD    1 
ATOM   9534  C  CE    . LYS F 3 510 ? 118.223 -30.901 4.251   1.00 15.07 ? 806  LYS D CE    1 
ATOM   9535  N  NZ    . LYS F 3 510 ? 116.725 -30.900 4.152   1.00 13.91 ? 806  LYS D NZ    1 
ATOM   9536  N  N     . ALA F 3 511 ? 117.122 -30.320 -1.748  1.00 7.22  ? 807  ALA D N     1 
ATOM   9537  C  CA    . ALA F 3 511 ? 115.724 -30.493 -2.145  1.00 8.85  ? 807  ALA D CA    1 
ATOM   9538  C  C     . ALA F 3 511 ? 115.527 -31.736 -3.014  1.00 10.06 ? 807  ALA D C     1 
ATOM   9539  O  O     . ALA F 3 511 ? 114.513 -32.432 -2.894  1.00 10.39 ? 807  ALA D O     1 
ATOM   9540  C  CB    . ALA F 3 511 ? 115.243 -29.271 -2.895  1.00 8.33  ? 807  ALA D CB    1 
ATOM   9541  N  N     . MET F 3 512 ? 116.492 -32.007 -3.888  1.00 9.52  ? 808  MET D N     1 
ATOM   9542  C  CA    . MET F 3 512 ? 116.419 -33.166 -4.778  1.00 10.61 ? 808  MET D CA    1 
ATOM   9543  C  C     . MET F 3 512 ? 116.471 -34.460 -3.973  1.00 10.27 ? 808  MET D C     1 
ATOM   9544  O  O     . MET F 3 512 ? 115.770 -35.430 -4.283  1.00 9.61  ? 808  MET D O     1 
ATOM   9545  C  CB    . MET F 3 512 ? 117.574 -33.131 -5.784  1.00 9.59  ? 808  MET D CB    1 
ATOM   9546  C  CG    . MET F 3 512 ? 117.447 -32.006 -6.807  1.00 8.42  ? 808  MET D CG    1 
ATOM   9547  S  SD    . MET F 3 512 ? 118.883 -31.856 -7.888  1.00 10.31 ? 808  MET D SD    1 
ATOM   9548  C  CE    . MET F 3 512 ? 118.732 -33.391 -8.882  1.00 7.06  ? 808  MET D CE    1 
ATOM   9549  N  N     . ILE F 3 513 ? 117.309 -34.465 -2.941  1.00 9.20  ? 809  ILE D N     1 
ATOM   9550  C  CA    . ILE F 3 513 ? 117.450 -35.633 -2.074  1.00 10.97 ? 809  ILE D CA    1 
ATOM   9551  C  C     . ILE F 3 513 ? 116.145 -35.825 -1.296  1.00 10.96 ? 809  ILE D C     1 
ATOM   9552  O  O     . ILE F 3 513 ? 115.585 -36.926 -1.262  1.00 10.73 ? 809  ILE D O     1 
ATOM   9553  C  CB    . ILE F 3 513 ? 118.638 -35.441 -1.101  1.00 10.29 ? 809  ILE D CB    1 
ATOM   9554  C  CG1   . ILE F 3 513 ? 119.951 -35.439 -1.895  1.00 11.08 ? 809  ILE D CG1   1 
ATOM   9555  C  CG2   . ILE F 3 513 ? 118.638 -36.543 -0.035  1.00 11.66 ? 809  ILE D CG2   1 
ATOM   9556  C  CD1   . ILE F 3 513 ? 121.174 -35.040 -1.076  1.00 12.93 ? 809  ILE D CD1   1 
ATOM   9557  N  N     . ASP F 3 514 ? 115.655 -34.746 -0.689  1.00 10.37 ? 810  ASP D N     1 
ATOM   9558  C  CA    . ASP F 3 514 ? 114.405 -34.801 0.067   1.00 11.71 ? 810  ASP D CA    1 
ATOM   9559  C  C     . ASP F 3 514 ? 113.247 -35.222 -0.839  1.00 10.38 ? 810  ASP D C     1 
ATOM   9560  O  O     . ASP F 3 514 ? 112.386 -36.003 -0.434  1.00 10.74 ? 810  ASP D O     1 
ATOM   9561  C  CB    . ASP F 3 514 ? 114.060 -33.433 0.679   1.00 11.11 ? 810  ASP D CB    1 
ATOM   9562  C  CG    . ASP F 3 514 ? 115.044 -32.992 1.753   1.00 13.83 ? 810  ASP D CG    1 
ATOM   9563  O  OD1   . ASP F 3 514 ? 115.861 -33.816 2.209   1.00 12.54 ? 810  ASP D OD1   1 
ATOM   9564  O  OD2   . ASP F 3 514 ? 114.986 -31.803 2.141   1.00 15.16 ? 810  ASP D OD2   1 
ATOM   9565  N  N     . LEU F 3 515 ? 113.227 -34.702 -2.064  1.00 9.18  ? 811  LEU D N     1 
ATOM   9566  C  CA    . LEU F 3 515 ? 112.162 -35.020 -3.014  1.00 11.43 ? 811  LEU D CA    1 
ATOM   9567  C  C     . LEU F 3 515 ? 112.164 -36.496 -3.399  1.00 12.59 ? 811  LEU D C     1 
ATOM   9568  O  O     . LEU F 3 515 ? 111.119 -37.144 -3.422  1.00 11.89 ? 811  LEU D O     1 
ATOM   9569  C  CB    . LEU F 3 515 ? 112.294 -34.158 -4.275  1.00 10.79 ? 811  LEU D CB    1 
ATOM   9570  C  CG    . LEU F 3 515 ? 111.310 -34.480 -5.408  1.00 14.59 ? 811  LEU D CG    1 
ATOM   9571  C  CD1   . LEU F 3 515 ? 109.869 -34.266 -4.931  1.00 13.12 ? 811  LEU D CD1   1 
ATOM   9572  C  CD2   . LEU F 3 515 ? 111.615 -33.590 -6.614  1.00 13.81 ? 811  LEU D CD2   1 
ATOM   9573  N  N     . ASN F 3 516 ? 113.345 -37.016 -3.703  1.00 11.94 ? 812  ASN D N     1 
ATOM   9574  C  CA    . ASN F 3 516 ? 113.504 -38.416 -4.078  1.00 14.54 ? 812  ASN D CA    1 
ATOM   9575  C  C     . ASN F 3 516 ? 112.975 -39.317 -2.956  1.00 13.82 ? 812  ASN D C     1 
ATOM   9576  O  O     . ASN F 3 516 ? 112.272 -40.301 -3.209  1.00 13.80 ? 812  ASN D O     1 
ATOM   9577  C  CB    . ASN F 3 516 ? 114.986 -38.704 -4.330  1.00 16.89 ? 812  ASN D CB    1 
ATOM   9578  C  CG    . ASN F 3 516 ? 115.207 -39.867 -5.263  1.00 21.66 ? 812  ASN D CG    1 
ATOM   9579  O  OD1   . ASN F 3 516 ? 114.975 -39.767 -6.467  1.00 25.90 ? 812  ASN D OD1   1 
ATOM   9580  N  ND2   . ASN F 3 516 ? 115.668 -40.981 -4.715  1.00 25.72 ? 812  ASN D ND2   1 
ATOM   9581  N  N     . ALA F 3 517 ? 113.306 -38.970 -1.716  1.00 12.76 ? 813  ALA D N     1 
ATOM   9582  C  CA    . ALA F 3 517 ? 112.871 -39.746 -0.560  1.00 13.61 ? 813  ALA D CA    1 
ATOM   9583  C  C     . ALA F 3 517 ? 111.348 -39.728 -0.411  1.00 15.30 ? 813  ALA D C     1 
ATOM   9584  O  O     . ALA F 3 517 ? 110.730 -40.754 -0.104  1.00 14.13 ? 813  ALA D O     1 
ATOM   9585  C  CB    . ALA F 3 517 ? 113.534 -39.210 0.710   1.00 15.41 ? 813  ALA D CB    1 
ATOM   9586  N  N     . ARG F 3 518 ? 110.751 -38.561 -0.630  1.00 14.21 ? 814  ARG D N     1 
ATOM   9587  C  CA    . ARG F 3 518 ? 109.304 -38.402 -0.535  1.00 15.12 ? 814  ARG D CA    1 
ATOM   9588  C  C     . ARG F 3 518 ? 108.566 -39.156 -1.644  1.00 13.82 ? 814  ARG D C     1 
ATOM   9589  O  O     . ARG F 3 518 ? 107.535 -39.785 -1.393  1.00 12.48 ? 814  ARG D O     1 
ATOM   9590  C  CB    . ARG F 3 518 ? 108.923 -36.916 -0.591  1.00 16.17 ? 814  ARG D CB    1 
ATOM   9591  C  CG    . ARG F 3 518 ? 109.026 -36.193 0.743   1.00 25.79 ? 814  ARG D CG    1 
ATOM   9592  C  CD    . ARG F 3 518 ? 108.038 -36.770 1.757   1.00 30.41 ? 814  ARG D CD    1 
ATOM   9593  N  NE    . ARG F 3 518 ? 106.644 -36.534 1.384   1.00 34.04 ? 814  ARG D NE    1 
ATOM   9594  C  CZ    . ARG F 3 518 ? 106.023 -35.363 1.504   1.00 37.25 ? 814  ARG D CZ    1 
ATOM   9595  N  NH1   . ARG F 3 518 ? 106.670 -34.312 1.992   1.00 38.38 ? 814  ARG D NH1   1 
ATOM   9596  N  NH2   . ARG F 3 518 ? 104.753 -35.240 1.136   1.00 38.52 ? 814  ARG D NH2   1 
ATOM   9597  N  N     . LEU F 3 519 ? 109.088 -39.085 -2.865  1.00 12.89 ? 815  LEU D N     1 
ATOM   9598  C  CA    . LEU F 3 519 ? 108.466 -39.770 -3.992  1.00 14.75 ? 815  LEU D CA    1 
ATOM   9599  C  C     . LEU F 3 519 ? 108.467 -41.275 -3.754  1.00 17.37 ? 815  LEU D C     1 
ATOM   9600  O  O     . LEU F 3 519 ? 107.502 -41.968 -4.083  1.00 16.34 ? 815  LEU D O     1 
ATOM   9601  C  CB    . LEU F 3 519 ? 109.203 -39.444 -5.295  1.00 13.56 ? 815  LEU D CB    1 
ATOM   9602  C  CG    . LEU F 3 519 ? 109.106 -38.003 -5.813  1.00 13.07 ? 815  LEU D CG    1 
ATOM   9603  C  CD1   . LEU F 3 519 ? 109.966 -37.858 -7.063  1.00 13.27 ? 815  LEU D CD1   1 
ATOM   9604  C  CD2   . LEU F 3 519 ? 107.655 -37.650 -6.126  1.00 12.23 ? 815  LEU D CD2   1 
ATOM   9605  N  N     . LYS F 3 520 ? 109.557 -41.774 -3.179  1.00 18.86 ? 816  LYS D N     1 
ATOM   9606  C  CA    . LYS F 3 520 ? 109.677 -43.197 -2.877  1.00 22.81 ? 816  LYS D CA    1 
ATOM   9607  C  C     . LYS F 3 520 ? 108.697 -43.620 -1.783  1.00 23.50 ? 816  LYS D C     1 
ATOM   9608  O  O     . LYS F 3 520 ? 107.983 -44.613 -1.928  1.00 22.47 ? 816  LYS D O     1 
ATOM   9609  C  CB    . LYS F 3 520 ? 111.107 -43.531 -2.437  1.00 24.74 ? 816  LYS D CB    1 
ATOM   9610  C  CG    . LYS F 3 520 ? 111.265 -44.964 -1.929  1.00 31.70 ? 816  LYS D CG    1 
ATOM   9611  C  CD    . LYS F 3 520 ? 112.702 -45.282 -1.532  1.00 36.20 ? 816  LYS D CD    1 
ATOM   9612  C  CE    . LYS F 3 520 ? 113.629 -45.269 -2.744  1.00 39.96 ? 816  LYS D CE    1 
ATOM   9613  N  NZ    . LYS F 3 520 ? 115.022 -45.665 -2.389  1.00 41.60 ? 816  LYS D NZ    1 
ATOM   9614  N  N     . GLU F 3 521 ? 108.662 -42.865 -0.689  1.00 24.02 ? 817  GLU D N     1 
ATOM   9615  C  CA    . GLU F 3 521 ? 107.768 -43.178 0.424   1.00 25.03 ? 817  GLU D CA    1 
ATOM   9616  C  C     . GLU F 3 521 ? 106.293 -43.154 0.011   1.00 24.50 ? 817  GLU D C     1 
ATOM   9617  O  O     . GLU F 3 521 ? 105.484 -43.937 0.515   1.00 21.86 ? 817  GLU D O     1 
ATOM   9618  C  CB    . GLU F 3 521 ? 108.000 -42.194 1.574   1.00 30.05 ? 817  GLU D CB    1 
ATOM   9619  C  CG    . GLU F 3 521 ? 107.181 -42.498 2.822   1.00 37.53 ? 817  GLU D CG    1 
ATOM   9620  C  CD    . GLU F 3 521 ? 107.482 -41.546 3.966   1.00 42.61 ? 817  GLU D CD    1 
ATOM   9621  O  OE1   . GLU F 3 521 ? 108.635 -41.541 4.450   1.00 45.40 ? 817  GLU D OE1   1 
ATOM   9622  O  OE2   . GLU F 3 521 ? 106.567 -40.801 4.380   1.00 45.08 ? 817  GLU D OE2   1 
ATOM   9623  N  N     . GLU F 3 522 ? 105.948 -42.254 -0.905  1.00 22.48 ? 818  GLU D N     1 
ATOM   9624  C  CA    . GLU F 3 522 ? 104.573 -42.131 -1.386  1.00 22.21 ? 818  GLU D CA    1 
ATOM   9625  C  C     . GLU F 3 522 ? 104.293 -43.168 -2.471  1.00 21.06 ? 818  GLU D C     1 
ATOM   9626  O  O     . GLU F 3 522 ? 103.171 -43.271 -2.969  1.00 19.33 ? 818  GLU D O     1 
ATOM   9627  C  CB    . GLU F 3 522 ? 104.339 -40.735 -1.967  1.00 23.40 ? 818  GLU D CB    1 
ATOM   9628  C  CG    . GLU F 3 522 ? 104.497 -39.598 -0.977  1.00 28.34 ? 818  GLU D CG    1 
ATOM   9629  C  CD    . GLU F 3 522 ? 103.174 -39.133 -0.411  1.00 30.86 ? 818  GLU D CD    1 
ATOM   9630  O  OE1   . GLU F 3 522 ? 103.160 -38.085 0.267   1.00 34.09 ? 818  GLU D OE1   1 
ATOM   9631  O  OE2   . GLU F 3 522 ? 102.150 -39.810 -0.642  1.00 32.95 ? 818  GLU D OE2   1 
ATOM   9632  N  N     . ARG F 3 523 ? 105.323 -43.926 -2.833  1.00 19.58 ? 819  ARG D N     1 
ATOM   9633  C  CA    . ARG F 3 523 ? 105.213 -44.953 -3.860  1.00 21.08 ? 819  ARG D CA    1 
ATOM   9634  C  C     . ARG F 3 523 ? 104.683 -44.395 -5.182  1.00 20.00 ? 819  ARG D C     1 
ATOM   9635  O  O     . ARG F 3 523 ? 103.887 -45.036 -5.869  1.00 19.49 ? 819  ARG D O     1 
ATOM   9636  C  CB    . ARG F 3 523 ? 104.314 -46.090 -3.365  1.00 23.20 ? 819  ARG D CB    1 
ATOM   9637  C  CG    . ARG F 3 523 ? 104.855 -46.774 -2.120  1.00 27.81 ? 819  ARG D CG    1 
ATOM   9638  C  CD    . ARG F 3 523 ? 104.005 -47.966 -1.709  1.00 32.03 ? 819  ARG D CD    1 
ATOM   9639  N  NE    . ARG F 3 523 ? 102.681 -47.582 -1.226  1.00 38.59 ? 819  ARG D NE    1 
ATOM   9640  C  CZ    . ARG F 3 523 ? 102.458 -46.873 -0.121  1.00 41.11 ? 819  ARG D CZ    1 
ATOM   9641  N  NH1   . ARG F 3 523 ? 103.473 -46.460 0.626   1.00 43.27 ? 819  ARG D NH1   1 
ATOM   9642  N  NH2   . ARG F 3 523 ? 101.215 -46.584 0.241   1.00 42.64 ? 819  ARG D NH2   1 
ATOM   9643  N  N     . LEU F 3 524 ? 105.137 -43.198 -5.541  1.00 17.34 ? 820  LEU D N     1 
ATOM   9644  C  CA    . LEU F 3 524 ? 104.713 -42.563 -6.786  1.00 15.75 ? 820  LEU D CA    1 
ATOM   9645  C  C     . LEU F 3 524 ? 105.613 -42.982 -7.939  1.00 16.29 ? 820  LEU D C     1 
ATOM   9646  O  O     . LEU F 3 524 ? 106.777 -43.328 -7.732  1.00 15.14 ? 820  LEU D O     1 
ATOM   9647  C  CB    . LEU F 3 524 ? 104.757 -41.041 -6.639  1.00 15.65 ? 820  LEU D CB    1 
ATOM   9648  C  CG    . LEU F 3 524 ? 103.835 -40.460 -5.568  1.00 16.05 ? 820  LEU D CG    1 
ATOM   9649  C  CD1   . LEU F 3 524 ? 104.175 -38.993 -5.325  1.00 17.46 ? 820  LEU D CD1   1 
ATOM   9650  C  CD2   . LEU F 3 524 ? 102.387 -40.616 -6.015  1.00 16.14 ? 820  LEU D CD2   1 
ATOM   9651  N  N     . GLN F 3 525 ? 105.073 -42.951 -9.154  1.00 14.53 ? 821  GLN D N     1 
ATOM   9652  C  CA    . GLN F 3 525 ? 105.848 -43.313 -10.338 1.00 15.36 ? 821  GLN D CA    1 
ATOM   9653  C  C     . GLN F 3 525 ? 106.628 -42.102 -10.829 1.00 15.21 ? 821  GLN D C     1 
ATOM   9654  O  O     . GLN F 3 525 ? 107.597 -42.236 -11.577 1.00 14.18 ? 821  GLN D O     1 
ATOM   9655  C  CB    . GLN F 3 525 ? 104.933 -43.792 -11.460 1.00 15.74 ? 821  GLN D CB    1 
ATOM   9656  C  CG    . GLN F 3 525 ? 104.323 -45.165 -11.241 1.00 20.09 ? 821  GLN D CG    1 
ATOM   9657  C  CD    . GLN F 3 525 ? 103.416 -45.560 -12.386 1.00 23.00 ? 821  GLN D CD    1 
ATOM   9658  O  OE1   . GLN F 3 525 ? 102.193 -45.418 -12.308 1.00 27.67 ? 821  GLN D OE1   1 
ATOM   9659  N  NE2   . GLN F 3 525 ? 104.013 -46.037 -13.467 1.00 23.66 ? 821  GLN D NE2   1 
ATOM   9660  N  N     . ALA F 3 526 ? 106.190 -40.920 -10.407 1.00 12.50 ? 822  ALA D N     1 
ATOM   9661  C  CA    . ALA F 3 526 ? 106.842 -39.678 -10.790 1.00 11.69 ? 822  ALA D CA    1 
ATOM   9662  C  C     . ALA F 3 526 ? 108.333 -39.746 -10.483 1.00 12.15 ? 822  ALA D C     1 
ATOM   9663  O  O     . ALA F 3 526 ? 108.739 -40.295 -9.458  1.00 11.40 ? 822  ALA D O     1 
ATOM   9664  C  CB    . ALA F 3 526 ? 106.219 -38.512 -10.034 1.00 12.75 ? 822  ALA D CB    1 
ATOM   9665  N  N     . HIS F 3 527 ? 109.149 -39.183 -11.367 1.00 11.33 ? 823  HIS D N     1 
ATOM   9666  C  CA    . HIS F 3 527 ? 110.583 -39.175 -11.139 1.00 11.38 ? 823  HIS D CA    1 
ATOM   9667  C  C     . HIS F 3 527 ? 111.230 -37.946 -11.755 1.00 10.22 ? 823  HIS D C     1 
ATOM   9668  O  O     . HIS F 3 527 ? 110.688 -37.335 -12.673 1.00 9.35  ? 823  HIS D O     1 
ATOM   9669  C  CB    . HIS F 3 527 ? 111.233 -40.447 -11.689 1.00 13.16 ? 823  HIS D CB    1 
ATOM   9670  C  CG    . HIS F 3 527 ? 110.943 -40.706 -13.135 1.00 16.70 ? 823  HIS D CG    1 
ATOM   9671  N  ND1   . HIS F 3 527 ? 110.289 -41.839 -13.568 1.00 21.72 ? 823  HIS D ND1   1 
ATOM   9672  C  CD2   . HIS F 3 527 ? 111.224 -39.987 -14.245 1.00 19.02 ? 823  HIS D CD2   1 
ATOM   9673  C  CE1   . HIS F 3 527 ? 110.181 -41.807 -14.885 1.00 22.52 ? 823  HIS D CE1   1 
ATOM   9674  N  NE2   . HIS F 3 527 ? 110.740 -40.694 -15.321 1.00 19.80 ? 823  HIS D NE2   1 
ATOM   9675  N  N     . LEU F 3 528 ? 112.391 -37.587 -11.229 1.00 10.36 ? 824  LEU D N     1 
ATOM   9676  C  CA    . LEU F 3 528 ? 113.139 -36.438 -11.720 1.00 8.76  ? 824  LEU D CA    1 
ATOM   9677  C  C     . LEU F 3 528 ? 113.742 -36.719 -13.093 1.00 9.44  ? 824  LEU D C     1 
ATOM   9678  O  O     . LEU F 3 528 ? 114.177 -37.835 -13.379 1.00 9.21  ? 824  LEU D O     1 
ATOM   9679  C  CB    . LEU F 3 528 ? 114.260 -36.101 -10.746 1.00 9.37  ? 824  LEU D CB    1 
ATOM   9680  C  CG    . LEU F 3 528 ? 113.861 -35.312 -9.502  1.00 8.21  ? 824  LEU D CG    1 
ATOM   9681  C  CD1   . LEU F 3 528 ? 114.932 -35.490 -8.430  1.00 10.68 ? 824  LEU D CD1   1 
ATOM   9682  C  CD2   . LEU F 3 528 ? 113.687 -33.834 -9.870  1.00 7.45  ? 824  LEU D CD2   1 
ATOM   9683  N  N     . LEU F 3 529 ? 113.770 -35.693 -13.933 1.00 8.55  ? 825  LEU D N     1 
ATOM   9684  C  CA    . LEU F 3 529 ? 114.351 -35.803 -15.263 1.00 9.11  ? 825  LEU D CA    1 
ATOM   9685  C  C     . LEU F 3 529 ? 115.537 -34.862 -15.365 1.00 9.41  ? 825  LEU D C     1 
ATOM   9686  O  O     . LEU F 3 529 ? 116.620 -35.251 -15.803 1.00 8.05  ? 825  LEU D O     1 
ATOM   9687  C  CB    . LEU F 3 529 ? 113.328 -35.420 -16.341 1.00 8.80  ? 825  LEU D CB    1 
ATOM   9688  C  CG    . LEU F 3 529 ? 112.138 -36.357 -16.548 1.00 9.84  ? 825  LEU D CG    1 
ATOM   9689  C  CD1   . LEU F 3 529 ? 111.191 -35.778 -17.601 1.00 12.82 ? 825  LEU D CD1   1 
ATOM   9690  C  CD2   . LEU F 3 529 ? 112.652 -37.721 -16.978 1.00 10.10 ? 825  LEU D CD2   1 
ATOM   9691  N  N     . LEU F 3 530 ? 115.326 -33.621 -14.937 1.00 8.26  ? 826  LEU D N     1 
ATOM   9692  C  CA    . LEU F 3 530 ? 116.356 -32.600 -15.034 1.00 8.53  ? 826  LEU D CA    1 
ATOM   9693  C  C     . LEU F 3 530 ? 116.403 -31.620 -13.866 1.00 9.09  ? 826  LEU D C     1 
ATOM   9694  O  O     . LEU F 3 530 ? 115.414 -31.413 -13.162 1.00 8.61  ? 826  LEU D O     1 
ATOM   9695  C  CB    . LEU F 3 530 ? 116.149 -31.777 -16.312 1.00 8.93  ? 826  LEU D CB    1 
ATOM   9696  C  CG    . LEU F 3 530 ? 116.112 -32.428 -17.699 1.00 9.79  ? 826  LEU D CG    1 
ATOM   9697  C  CD1   . LEU F 3 530 ? 115.602 -31.406 -18.728 1.00 8.85  ? 826  LEU D CD1   1 
ATOM   9698  C  CD2   . LEU F 3 530 ? 117.507 -32.936 -18.073 1.00 9.33  ? 826  LEU D CD2   1 
ATOM   9699  N  N     . GLN F 3 531 ? 117.578 -31.032 -13.673 1.00 8.60  ? 827  GLN D N     1 
ATOM   9700  C  CA    . GLN F 3 531 ? 117.772 -29.981 -12.684 1.00 9.53  ? 827  GLN D CA    1 
ATOM   9701  C  C     . GLN F 3 531 ? 118.332 -28.840 -13.530 1.00 8.79  ? 827  GLN D C     1 
ATOM   9702  O  O     . GLN F 3 531 ? 119.226 -29.059 -14.344 1.00 8.14  ? 827  GLN D O     1 
ATOM   9703  C  CB    . GLN F 3 531 ? 118.799 -30.366 -11.614 1.00 10.16 ? 827  GLN D CB    1 
ATOM   9704  C  CG    . GLN F 3 531 ? 119.029 -29.256 -10.583 1.00 9.13  ? 827  GLN D CG    1 
ATOM   9705  C  CD    . GLN F 3 531 ? 120.313 -28.455 -10.815 1.00 11.01 ? 827  GLN D CD    1 
ATOM   9706  O  OE1   . GLN F 3 531 ? 120.680 -28.154 -11.948 1.00 10.97 ? 827  GLN D OE1   1 
ATOM   9707  N  NE2   . GLN F 3 531 ? 120.989 -28.097 -9.727  1.00 10.05 ? 827  GLN D NE2   1 
ATOM   9708  N  N     . VAL F 3 532 ? 117.803 -27.634 -13.367 1.00 8.49  ? 828  VAL D N     1 
ATOM   9709  C  CA    . VAL F 3 532 ? 118.320 -26.508 -14.135 1.00 9.99  ? 828  VAL D CA    1 
ATOM   9710  C  C     . VAL F 3 532 ? 118.675 -25.360 -13.193 1.00 9.83  ? 828  VAL D C     1 
ATOM   9711  O  O     . VAL F 3 532 ? 118.074 -24.286 -13.238 1.00 10.75 ? 828  VAL D O     1 
ATOM   9712  C  CB    . VAL F 3 532 ? 117.312 -26.035 -15.222 1.00 9.64  ? 828  VAL D CB    1 
ATOM   9713  C  CG1   . VAL F 3 532 ? 117.979 -25.011 -16.148 1.00 11.24 ? 828  VAL D CG1   1 
ATOM   9714  C  CG2   . VAL F 3 532 ? 116.843 -27.231 -16.050 1.00 9.18  ? 828  VAL D CG2   1 
ATOM   9715  N  N     . HIS F 3 533 ? 119.656 -25.629 -12.329 1.00 8.68  ? 829  HIS D N     1 
ATOM   9716  C  CA    . HIS F 3 533 ? 120.188 -24.671 -11.359 1.00 8.13  ? 829  HIS D CA    1 
ATOM   9717  C  C     . HIS F 3 533 ? 119.272 -24.299 -10.182 1.00 9.34  ? 829  HIS D C     1 
ATOM   9718  O  O     . HIS F 3 533 ? 119.699 -24.350 -9.027  1.00 9.06  ? 829  HIS D O     1 
ATOM   9719  C  CB    . HIS F 3 533 ? 120.683 -23.430 -12.109 1.00 6.34  ? 829  HIS D CB    1 
ATOM   9720  C  CG    . HIS F 3 533 ? 121.618 -23.756 -13.234 1.00 9.01  ? 829  HIS D CG    1 
ATOM   9721  N  ND1   . HIS F 3 533 ? 122.735 -24.546 -13.062 1.00 7.60  ? 829  HIS D ND1   1 
ATOM   9722  C  CD2   . HIS F 3 533 ? 121.573 -23.450 -14.553 1.00 7.13  ? 829  HIS D CD2   1 
ATOM   9723  C  CE1   . HIS F 3 533 ? 123.336 -24.715 -14.226 1.00 7.69  ? 829  HIS D CE1   1 
ATOM   9724  N  NE2   . HIS F 3 533 ? 122.652 -24.061 -15.148 1.00 5.86  ? 829  HIS D NE2   1 
ATOM   9725  N  N     . ASP F 3 534 ? 118.029 -23.918 -10.454 1.00 8.90  ? 830  ASP D N     1 
ATOM   9726  C  CA    . ASP F 3 534 ? 117.101 -23.618 -9.367  1.00 9.70  ? 830  ASP D CA    1 
ATOM   9727  C  C     . ASP F 3 534 ? 115.713 -24.126 -9.746  1.00 10.01 ? 830  ASP D C     1 
ATOM   9728  O  O     . ASP F 3 534 ? 114.708 -23.710 -9.172  1.00 9.71  ? 830  ASP D O     1 
ATOM   9729  C  CB    . ASP F 3 534 ? 117.072 -22.112 -9.047  1.00 9.35  ? 830  ASP D CB    1 
ATOM   9730  C  CG    . ASP F 3 534 ? 116.247 -21.311 -10.032 1.00 11.56 ? 830  ASP D CG    1 
ATOM   9731  O  OD1   . ASP F 3 534 ? 116.296 -21.606 -11.244 1.00 9.49  ? 830  ASP D OD1   1 
ATOM   9732  O  OD2   . ASP F 3 534 ? 115.556 -20.371 -9.585  1.00 10.49 ? 830  ASP D OD2   1 
ATOM   9733  N  N     . GLU F 3 535 ? 115.684 -25.041 -10.716 1.00 10.02 ? 831  GLU D N     1 
ATOM   9734  C  CA    . GLU F 3 535 ? 114.447 -25.650 -11.213 1.00 11.30 ? 831  GLU D CA    1 
ATOM   9735  C  C     . GLU F 3 535 ? 114.594 -27.159 -11.225 1.00 9.78  ? 831  GLU D C     1 
ATOM   9736  O  O     . GLU F 3 535 ? 115.674 -27.681 -11.486 1.00 8.85  ? 831  GLU D O     1 
ATOM   9737  C  CB    . GLU F 3 535 ? 114.147 -25.282 -12.666 1.00 15.41 ? 831  GLU D CB    1 
ATOM   9738  C  CG    . GLU F 3 535 ? 114.079 -23.838 -13.051 1.00 23.78 ? 831  GLU D CG    1 
ATOM   9739  C  CD    . GLU F 3 535 ? 114.029 -23.701 -14.571 1.00 26.35 ? 831  GLU D CD    1 
ATOM   9740  O  OE1   . GLU F 3 535 ? 113.281 -24.474 -15.209 1.00 26.88 ? 831  GLU D OE1   1 
ATOM   9741  O  OE2   . GLU F 3 535 ? 114.733 -22.829 -15.124 1.00 28.53 ? 831  GLU D OE2   1 
ATOM   9742  N  N     . LEU F 3 536 ? 113.493 -27.853 -10.977 1.00 7.94  ? 832  LEU D N     1 
ATOM   9743  C  CA    . LEU F 3 536 ? 113.483 -29.306 -11.032 1.00 9.15  ? 832  LEU D CA    1 
ATOM   9744  C  C     . LEU F 3 536 ? 112.388 -29.659 -12.028 1.00 9.80  ? 832  LEU D C     1 
ATOM   9745  O  O     . LEU F 3 536 ? 111.282 -29.124 -11.960 1.00 10.13 ? 832  LEU D O     1 
ATOM   9746  C  CB    . LEU F 3 536 ? 113.194 -29.911 -9.654  1.00 9.02  ? 832  LEU D CB    1 
ATOM   9747  C  CG    . LEU F 3 536 ? 114.290 -29.666 -8.608  1.00 9.30  ? 832  LEU D CG    1 
ATOM   9748  C  CD1   . LEU F 3 536 ? 113.959 -30.400 -7.300  1.00 8.50  ? 832  LEU D CD1   1 
ATOM   9749  C  CD2   . LEU F 3 536 ? 115.635 -30.145 -9.164  1.00 7.60  ? 832  LEU D CD2   1 
ATOM   9750  N  N     . ILE F 3 537 ? 112.712 -30.545 -12.964 1.00 9.87  ? 833  ILE D N     1 
ATOM   9751  C  CA    . ILE F 3 537 ? 111.768 -30.971 -13.989 1.00 10.59 ? 833  ILE D CA    1 
ATOM   9752  C  C     . ILE F 3 537 ? 111.510 -32.455 -13.803 1.00 10.23 ? 833  ILE D C     1 
ATOM   9753  O  O     . ILE F 3 537 ? 112.448 -33.248 -13.732 1.00 12.04 ? 833  ILE D O     1 
ATOM   9754  C  CB    . ILE F 3 537 ? 112.336 -30.762 -15.410 1.00 11.45 ? 833  ILE D CB    1 
ATOM   9755  C  CG1   . ILE F 3 537 ? 112.890 -29.337 -15.557 1.00 13.80 ? 833  ILE D CG1   1 
ATOM   9756  C  CG2   . ILE F 3 537 ? 111.245 -31.041 -16.454 1.00 9.59  ? 833  ILE D CG2   1 
ATOM   9757  C  CD1   . ILE F 3 537 ? 111.851 -28.246 -15.426 1.00 17.35 ? 833  ILE D CD1   1 
ATOM   9758  N  N     . LEU F 3 538 ? 110.242 -32.830 -13.717 1.00 10.57 ? 834  LEU D N     1 
ATOM   9759  C  CA    . LEU F 3 538 ? 109.875 -34.232 -13.547 1.00 11.82 ? 834  LEU D CA    1 
ATOM   9760  C  C     . LEU F 3 538 ? 108.833 -34.625 -14.585 1.00 12.00 ? 834  LEU D C     1 
ATOM   9761  O  O     . LEU F 3 538 ? 108.325 -33.777 -15.325 1.00 10.82 ? 834  LEU D O     1 
ATOM   9762  C  CB    . LEU F 3 538 ? 109.263 -34.478 -12.161 1.00 12.68 ? 834  LEU D CB    1 
ATOM   9763  C  CG    . LEU F 3 538 ? 110.011 -34.110 -10.876 1.00 15.88 ? 834  LEU D CG    1 
ATOM   9764  C  CD1   . LEU F 3 538 ? 109.900 -32.610 -10.607 1.00 12.99 ? 834  LEU D CD1   1 
ATOM   9765  C  CD2   . LEU F 3 538 ? 109.397 -34.885 -9.715  1.00 17.18 ? 834  LEU D CD2   1 
ATOM   9766  N  N     . GLU F 3 539 ? 108.529 -35.919 -14.635 1.00 11.97 ? 835  GLU D N     1 
ATOM   9767  C  CA    . GLU F 3 539 ? 107.475 -36.421 -15.506 1.00 10.12 ? 835  GLU D CA    1 
ATOM   9768  C  C     . GLU F 3 539 ? 106.708 -37.382 -14.615 1.00 10.99 ? 835  GLU D C     1 
ATOM   9769  O  O     . GLU F 3 539 ? 107.279 -37.979 -13.706 1.00 10.52 ? 835  GLU D O     1 
ATOM   9770  C  CB    . GLU F 3 539 ? 108.024 -37.133 -16.747 1.00 10.60 ? 835  GLU D CB    1 
ATOM   9771  C  CG    . GLU F 3 539 ? 108.744 -38.444 -16.521 1.00 12.47 ? 835  GLU D CG    1 
ATOM   9772  C  CD    . GLU F 3 539 ? 109.190 -39.080 -17.835 1.00 13.32 ? 835  GLU D CD    1 
ATOM   9773  O  OE1   . GLU F 3 539 ? 108.854 -38.533 -18.911 1.00 11.18 ? 835  GLU D OE1   1 
ATOM   9774  O  OE2   . GLU F 3 539 ? 109.874 -40.124 -17.791 1.00 13.90 ? 835  GLU D OE2   1 
ATOM   9775  N  N     . ALA F 3 540 ? 105.412 -37.528 -14.860 1.00 11.12 ? 836  ALA D N     1 
ATOM   9776  C  CA    . ALA F 3 540 ? 104.619 -38.406 -14.028 1.00 13.82 ? 836  ALA D CA    1 
ATOM   9777  C  C     . ALA F 3 540 ? 103.286 -38.725 -14.669 1.00 11.66 ? 836  ALA D C     1 
ATOM   9778  O  O     . ALA F 3 540 ? 102.820 -38.004 -15.549 1.00 11.88 ? 836  ALA D O     1 
ATOM   9779  C  CB    . ALA F 3 540 ? 104.381 -37.746 -12.663 1.00 13.47 ? 836  ALA D CB    1 
ATOM   9780  N  N     . PRO F 3 541 ? 102.655 -39.820 -14.229 1.00 14.58 ? 837  PRO D N     1 
ATOM   9781  C  CA    . PRO F 3 541 ? 101.352 -40.205 -14.777 1.00 13.54 ? 837  PRO D CA    1 
ATOM   9782  C  C     . PRO F 3 541 ? 100.376 -39.073 -14.475 1.00 15.03 ? 837  PRO D C     1 
ATOM   9783  O  O     . PRO F 3 541 ? 100.492 -38.416 -13.436 1.00 14.45 ? 837  PRO D O     1 
ATOM   9784  C  CB    . PRO F 3 541 ? 101.012 -41.483 -14.020 1.00 14.60 ? 837  PRO D CB    1 
ATOM   9785  C  CG    . PRO F 3 541 ? 102.353 -42.050 -13.668 1.00 14.71 ? 837  PRO D CG    1 
ATOM   9786  C  CD    . PRO F 3 541 ? 103.144 -40.827 -13.271 1.00 11.50 ? 837  PRO D CD    1 
ATOM   9787  N  N     . LYS F 3 542 ? 99.421  -38.845 -15.367 1.00 16.20 ? 838  LYS D N     1 
ATOM   9788  C  CA    . LYS F 3 542 ? 98.431  -37.798 -15.155 1.00 17.95 ? 838  LYS D CA    1 
ATOM   9789  C  C     . LYS F 3 542 ? 97.723  -37.968 -13.816 1.00 17.13 ? 838  LYS D C     1 
ATOM   9790  O  O     . LYS F 3 542 ? 97.409  -36.983 -13.148 1.00 14.52 ? 838  LYS D O     1 
ATOM   9791  C  CB    . LYS F 3 542 ? 97.403  -37.800 -16.290 1.00 19.87 ? 838  LYS D CB    1 
ATOM   9792  C  CG    . LYS F 3 542 ? 97.956  -37.254 -17.595 1.00 26.72 ? 838  LYS D CG    1 
ATOM   9793  C  CD    . LYS F 3 542 ? 96.913  -37.248 -18.702 1.00 30.04 ? 838  LYS D CD    1 
ATOM   9794  C  CE    . LYS F 3 542 ? 97.507  -36.717 -19.998 1.00 31.08 ? 838  LYS D CE    1 
ATOM   9795  N  NZ    . LYS F 3 542 ? 96.508  -36.701 -21.095 1.00 36.48 ? 838  LYS D NZ    1 
ATOM   9796  N  N     . GLU F 3 543 ? 97.490  -39.219 -13.423 1.00 16.63 ? 839  GLU D N     1 
ATOM   9797  C  CA    . GLU F 3 543 ? 96.807  -39.528 -12.165 1.00 18.59 ? 839  GLU D CA    1 
ATOM   9798  C  C     . GLU F 3 543 ? 97.567  -39.122 -10.901 1.00 17.14 ? 839  GLU D C     1 
ATOM   9799  O  O     . GLU F 3 543 ? 97.005  -39.153 -9.804  1.00 17.19 ? 839  GLU D O     1 
ATOM   9800  C  CB    . GLU F 3 543 ? 96.495  -41.026 -12.077 1.00 19.58 ? 839  GLU D CB    1 
ATOM   9801  C  CG    . GLU F 3 543 ? 95.526  -41.555 -13.128 1.00 26.30 ? 839  GLU D CG    1 
ATOM   9802  C  CD    . GLU F 3 543 ? 96.137  -41.635 -14.521 1.00 30.45 ? 839  GLU D CD    1 
ATOM   9803  O  OE1   . GLU F 3 543 ? 97.387  -41.619 -14.635 1.00 27.65 ? 839  GLU D OE1   1 
ATOM   9804  O  OE2   . GLU F 3 543 ? 95.361  -41.729 -15.501 1.00 31.52 ? 839  GLU D OE2   1 
ATOM   9805  N  N     . GLU F 3 544 ? 98.837  -38.754 -11.042 1.00 15.48 ? 840  GLU D N     1 
ATOM   9806  C  CA    . GLU F 3 544 ? 99.636  -38.349 -9.885  1.00 14.72 ? 840  GLU D CA    1 
ATOM   9807  C  C     . GLU F 3 544 ? 99.838  -36.837 -9.829  1.00 13.86 ? 840  GLU D C     1 
ATOM   9808  O  O     . GLU F 3 544 ? 100.395 -36.315 -8.867  1.00 13.78 ? 840  GLU D O     1 
ATOM   9809  C  CB    . GLU F 3 544 ? 101.015 -39.022 -9.918  1.00 14.31 ? 840  GLU D CB    1 
ATOM   9810  C  CG    . GLU F 3 544 ? 101.002 -40.540 -9.764  1.00 14.16 ? 840  GLU D CG    1 
ATOM   9811  C  CD    . GLU F 3 544 ? 102.402 -41.124 -9.689  1.00 14.06 ? 840  GLU D CD    1 
ATOM   9812  O  OE1   . GLU F 3 544 ? 102.526 -42.354 -9.530  1.00 14.18 ? 840  GLU D OE1   1 
ATOM   9813  O  OE2   . GLU F 3 544 ? 103.383 -40.354 -9.789  1.00 13.57 ? 840  GLU D OE2   1 
ATOM   9814  N  N     . MET F 3 545 ? 99.379  -36.128 -10.851 1.00 14.15 ? 841  MET D N     1 
ATOM   9815  C  CA    . MET F 3 545 ? 99.591  -34.687 -10.891 1.00 16.37 ? 841  MET D CA    1 
ATOM   9816  C  C     . MET F 3 545 ? 99.054  -33.876 -9.715  1.00 15.34 ? 841  MET D C     1 
ATOM   9817  O  O     . MET F 3 545 ? 99.745  -32.993 -9.208  1.00 14.15 ? 841  MET D O     1 
ATOM   9818  C  CB    . MET F 3 545 ? 99.040  -34.107 -12.191 1.00 18.53 ? 841  MET D CB    1 
ATOM   9819  C  CG    . MET F 3 545 ? 99.605  -32.739 -12.494 1.00 22.97 ? 841  MET D CG    1 
ATOM   9820  S  SD    . MET F 3 545 ? 101.422 -32.800 -12.456 1.00 29.60 ? 841  MET D SD    1 
ATOM   9821  C  CE    . MET F 3 545 ? 101.717 -33.816 -13.805 1.00 17.74 ? 841  MET D CE    1 
ATOM   9822  N  N     . GLU F 3 546 ? 97.834  -34.154 -9.272  1.00 14.60 ? 842  GLU D N     1 
ATOM   9823  C  CA    . GLU F 3 546 ? 97.289  -33.381 -8.159  1.00 14.44 ? 842  GLU D CA    1 
ATOM   9824  C  C     . GLU F 3 546 ? 98.116  -33.571 -6.888  1.00 14.38 ? 842  GLU D C     1 
ATOM   9825  O  O     . GLU F 3 546 ? 98.368  -32.617 -6.150  1.00 11.93 ? 842  GLU D O     1 
ATOM   9826  C  CB    . GLU F 3 546 ? 95.816  -33.738 -7.926  1.00 15.64 ? 842  GLU D CB    1 
ATOM   9827  C  CG    . GLU F 3 546 ? 94.924  -33.358 -9.105  1.00 17.41 ? 842  GLU D CG    1 
ATOM   9828  C  CD    . GLU F 3 546 ? 93.446  -33.327 -8.752  1.00 19.60 ? 842  GLU D CD    1 
ATOM   9829  O  OE1   . GLU F 3 546 ? 93.038  -32.460 -7.950  1.00 18.62 ? 842  GLU D OE1   1 
ATOM   9830  O  OE2   . GLU F 3 546 ? 92.696  -34.173 -9.276  1.00 20.96 ? 842  GLU D OE2   1 
ATOM   9831  N  N     . ARG F 3 547 ? 98.556  -34.796 -6.627  1.00 13.33 ? 843  ARG D N     1 
ATOM   9832  C  CA    . ARG F 3 547 ? 99.371  -35.021 -5.445  1.00 13.27 ? 843  ARG D CA    1 
ATOM   9833  C  C     . ARG F 3 547 ? 100.725 -34.352 -5.612  1.00 13.52 ? 843  ARG D C     1 
ATOM   9834  O  O     . ARG F 3 547 ? 101.297 -33.824 -4.656  1.00 12.93 ? 843  ARG D O     1 
ATOM   9835  C  CB    . ARG F 3 547 ? 99.567  -36.514 -5.197  1.00 15.21 ? 843  ARG D CB    1 
ATOM   9836  C  CG    . ARG F 3 547 ? 98.357  -37.165 -4.580  1.00 19.58 ? 843  ARG D CG    1 
ATOM   9837  C  CD    . ARG F 3 547 ? 98.769  -38.360 -3.764  1.00 25.70 ? 843  ARG D CD    1 
ATOM   9838  N  NE    . ARG F 3 547 ? 98.906  -39.560 -4.566  1.00 28.22 ? 843  ARG D NE    1 
ATOM   9839  C  CZ    . ARG F 3 547 ? 99.598  -40.627 -4.185  1.00 29.75 ? 843  ARG D CZ    1 
ATOM   9840  N  NH1   . ARG F 3 547 ? 100.227 -40.628 -3.014  1.00 30.66 ? 843  ARG D NH1   1 
ATOM   9841  N  NH2   . ARG F 3 547 ? 99.635  -41.703 -4.958  1.00 28.05 ? 843  ARG D NH2   1 
ATOM   9842  N  N     . LEU F 3 548 ? 101.228 -34.376 -6.840  1.00 12.77 ? 844  LEU D N     1 
ATOM   9843  C  CA    . LEU F 3 548 ? 102.520 -33.786 -7.159  1.00 14.91 ? 844  LEU D CA    1 
ATOM   9844  C  C     . LEU F 3 548 ? 102.499 -32.267 -6.968  1.00 14.36 ? 844  LEU D C     1 
ATOM   9845  O  O     . LEU F 3 548 ? 103.471 -31.680 -6.494  1.00 14.05 ? 844  LEU D O     1 
ATOM   9846  C  CB    . LEU F 3 548 ? 102.885 -34.141 -8.603  1.00 15.95 ? 844  LEU D CB    1 
ATOM   9847  C  CG    . LEU F 3 548 ? 104.350 -34.374 -8.961  1.00 20.08 ? 844  LEU D CG    1 
ATOM   9848  C  CD1   . LEU F 3 548 ? 104.909 -35.540 -8.147  1.00 18.32 ? 844  LEU D CD1   1 
ATOM   9849  C  CD2   . LEU F 3 548 ? 104.450 -34.654 -10.459 1.00 20.35 ? 844  LEU D CD2   1 
ATOM   9850  N  N     . CYS F 3 549 ? 101.386 -31.628 -7.323  1.00 14.52 ? 845  CYS D N     1 
ATOM   9851  C  CA    . CYS F 3 549 ? 101.269 -30.176 -7.179  1.00 15.25 ? 845  CYS D CA    1 
ATOM   9852  C  C     . CYS F 3 549 ? 101.401 -29.732 -5.736  1.00 15.82 ? 845  CYS D C     1 
ATOM   9853  O  O     . CYS F 3 549 ? 101.801 -28.600 -5.458  1.00 14.39 ? 845  CYS D O     1 
ATOM   9854  C  CB    . CYS F 3 549 ? 99.924  -29.681 -7.719  1.00 16.89 ? 845  CYS D CB    1 
ATOM   9855  S  SG    . CYS F 3 549 ? 99.821  -29.674 -9.503  1.00 22.05 ? 845  CYS D SG    1 
ATOM   9856  N  N     . ARG F 3 550 ? 101.064 -30.626 -4.815  1.00 14.46 ? 846  ARG D N     1 
ATOM   9857  C  CA    . ARG F 3 550 ? 101.129 -30.308 -3.396  1.00 16.93 ? 846  ARG D CA    1 
ATOM   9858  C  C     . ARG F 3 550 ? 102.464 -30.744 -2.786  1.00 15.79 ? 846  ARG D C     1 
ATOM   9859  O  O     . ARG F 3 550 ? 103.022 -30.065 -1.921  1.00 16.29 ? 846  ARG D O     1 
ATOM   9860  C  CB    . ARG F 3 550 ? 99.966  -31.003 -2.680  1.00 19.64 ? 846  ARG D CB    1 
ATOM   9861  C  CG    . ARG F 3 550 ? 99.606  -30.434 -1.321  1.00 25.71 ? 846  ARG D CG    1 
ATOM   9862  C  CD    . ARG F 3 550 ? 98.305  -31.057 -0.801  1.00 27.55 ? 846  ARG D CD    1 
ATOM   9863  N  NE    . ARG F 3 550 ? 97.865  -30.432 0.443   1.00 33.77 ? 846  ARG D NE    1 
ATOM   9864  C  CZ    . ARG F 3 550 ? 97.459  -29.169 0.535   1.00 33.14 ? 846  ARG D CZ    1 
ATOM   9865  N  NH1   . ARG F 3 550 ? 97.434  -28.399 -0.545  1.00 34.54 ? 846  ARG D NH1   1 
ATOM   9866  N  NH2   . ARG F 3 550 ? 97.083  -28.675 1.706   1.00 36.66 ? 846  ARG D NH2   1 
ATOM   9867  N  N     . LEU F 3 551 ? 102.974 -31.872 -3.263  1.00 12.94 ? 847  LEU D N     1 
ATOM   9868  C  CA    . LEU F 3 551 ? 104.219 -32.442 -2.761  1.00 15.13 ? 847  LEU D CA    1 
ATOM   9869  C  C     . LEU F 3 551 ? 105.517 -31.741 -3.163  1.00 12.89 ? 847  LEU D C     1 
ATOM   9870  O  O     . LEU F 3 551 ? 106.333 -31.402 -2.305  1.00 11.50 ? 847  LEU D O     1 
ATOM   9871  C  CB    . LEU F 3 551 ? 104.295 -33.921 -3.171  1.00 16.02 ? 847  LEU D CB    1 
ATOM   9872  C  CG    . LEU F 3 551 ? 105.490 -34.764 -2.708  1.00 20.08 ? 847  LEU D CG    1 
ATOM   9873  C  CD1   . LEU F 3 551 ? 105.146 -36.240 -2.819  1.00 21.96 ? 847  LEU D CD1   1 
ATOM   9874  C  CD2   . LEU F 3 551 ? 106.713 -34.447 -3.547  1.00 20.87 ? 847  LEU D CD2   1 
ATOM   9875  N  N     . VAL F 3 552 ? 105.714 -31.531 -4.461  1.00 11.55 ? 848  VAL D N     1 
ATOM   9876  C  CA    . VAL F 3 552 ? 106.953 -30.920 -4.932  1.00 13.33 ? 848  VAL D CA    1 
ATOM   9877  C  C     . VAL F 3 552 ? 107.253 -29.533 -4.360  1.00 13.15 ? 848  VAL D C     1 
ATOM   9878  O  O     . VAL F 3 552 ? 108.350 -29.294 -3.855  1.00 12.06 ? 848  VAL D O     1 
ATOM   9879  C  CB    . VAL F 3 552 ? 106.992 -30.872 -6.479  1.00 12.33 ? 848  VAL D CB    1 
ATOM   9880  C  CG1   . VAL F 3 552 ? 108.332 -30.308 -6.952  1.00 13.01 ? 848  VAL D CG1   1 
ATOM   9881  C  CG2   . VAL F 3 552 ? 106.792 -32.277 -7.039  1.00 14.54 ? 848  VAL D CG2   1 
ATOM   9882  N  N     . PRO F 3 553 ? 106.290 -28.598 -4.430  1.00 14.46 ? 849  PRO D N     1 
ATOM   9883  C  CA    . PRO F 3 553 ? 106.560 -27.261 -3.882  1.00 14.74 ? 849  PRO D CA    1 
ATOM   9884  C  C     . PRO F 3 553 ? 106.894 -27.298 -2.393  1.00 13.45 ? 849  PRO D C     1 
ATOM   9885  O  O     . PRO F 3 553 ? 107.794 -26.597 -1.931  1.00 13.29 ? 849  PRO D O     1 
ATOM   9886  C  CB    . PRO F 3 553 ? 105.273 -26.490 -4.180  1.00 16.57 ? 849  PRO D CB    1 
ATOM   9887  C  CG    . PRO F 3 553 ? 104.778 -27.143 -5.439  1.00 16.34 ? 849  PRO D CG    1 
ATOM   9888  C  CD    . PRO F 3 553 ? 105.007 -28.618 -5.155  1.00 14.55 ? 849  PRO D CD    1 
ATOM   9889  N  N     . GLU F 3 554 ? 106.167 -28.122 -1.644  1.00 14.78 ? 850  GLU D N     1 
ATOM   9890  C  CA    . GLU F 3 554 ? 106.388 -28.232 -0.206  1.00 15.17 ? 850  GLU D CA    1 
ATOM   9891  C  C     . GLU F 3 554 ? 107.798 -28.719 0.131   1.00 13.84 ? 850  GLU D C     1 
ATOM   9892  O  O     . GLU F 3 554 ? 108.484 -28.128 0.969   1.00 13.46 ? 850  GLU D O     1 
ATOM   9893  C  CB    . GLU F 3 554 ? 105.358 -29.176 0.418   1.00 18.07 ? 850  GLU D CB    1 
ATOM   9894  C  CG    . GLU F 3 554 ? 105.527 -29.360 1.922   1.00 23.30 ? 850  GLU D CG    1 
ATOM   9895  C  CD    . GLU F 3 554 ? 105.279 -28.083 2.709   1.00 29.40 ? 850  GLU D CD    1 
ATOM   9896  O  OE1   . GLU F 3 554 ? 105.453 -28.104 3.948   1.00 33.83 ? 850  GLU D OE1   1 
ATOM   9897  O  OE2   . GLU F 3 554 ? 104.908 -27.056 2.099   1.00 32.17 ? 850  GLU D OE2   1 
ATOM   9898  N  N     . VAL F 3 555 ? 108.223 -29.798 -0.518  1.00 12.69 ? 851  VAL D N     1 
ATOM   9899  C  CA    . VAL F 3 555 ? 109.554 -30.357 -0.287  1.00 11.78 ? 851  VAL D CA    1 
ATOM   9900  C  C     . VAL F 3 555 ? 110.650 -29.342 -0.620  1.00 10.48 ? 851  VAL D C     1 
ATOM   9901  O  O     . VAL F 3 555 ? 111.602 -29.172 0.149   1.00 12.00 ? 851  VAL D O     1 
ATOM   9902  C  CB    . VAL F 3 555 ? 109.766 -31.642 -1.133  1.00 12.85 ? 851  VAL D CB    1 
ATOM   9903  C  CG1   . VAL F 3 555 ? 111.196 -32.146 -0.986  1.00 14.12 ? 851  VAL D CG1   1 
ATOM   9904  C  CG2   . VAL F 3 555 ? 108.793 -32.717 -0.685  1.00 13.08 ? 851  VAL D CG2   1 
ATOM   9905  N  N     . MET F 3 556 ? 110.513 -28.663 -1.757  1.00 10.03 ? 852  MET D N     1 
ATOM   9906  C  CA    . MET F 3 556 ? 111.503 -27.668 -2.170  1.00 11.50 ? 852  MET D CA    1 
ATOM   9907  C  C     . MET F 3 556 ? 111.539 -26.465 -1.228  1.00 10.97 ? 852  MET D C     1 
ATOM   9908  O  O     . MET F 3 556 ? 112.613 -25.975 -0.871  1.00 11.99 ? 852  MET D O     1 
ATOM   9909  C  CB    . MET F 3 556 ? 111.222 -27.193 -3.601  1.00 11.02 ? 852  MET D CB    1 
ATOM   9910  C  CG    . MET F 3 556 ? 111.426 -28.280 -4.658  1.00 11.54 ? 852  MET D CG    1 
ATOM   9911  S  SD    . MET F 3 556 ? 111.037 -27.742 -6.333  1.00 11.23 ? 852  MET D SD    1 
ATOM   9912  C  CE    . MET F 3 556 ? 112.421 -26.598 -6.647  1.00 12.18 ? 852  MET D CE    1 
ATOM   9913  N  N     . GLU F 3 557 ? 110.368 -25.995 -0.818  1.00 10.68 ? 853  GLU D N     1 
ATOM   9914  C  CA    . GLU F 3 557 ? 110.286 -24.842 0.077   1.00 11.41 ? 853  GLU D CA    1 
ATOM   9915  C  C     . GLU F 3 557 ? 110.786 -25.145 1.491   1.00 12.47 ? 853  GLU D C     1 
ATOM   9916  O  O     . GLU F 3 557 ? 111.262 -24.249 2.191   1.00 13.72 ? 853  GLU D O     1 
ATOM   9917  C  CB    . GLU F 3 557 ? 108.843 -24.330 0.126   1.00 12.85 ? 853  GLU D CB    1 
ATOM   9918  C  CG    . GLU F 3 557 ? 108.392 -23.683 -1.187  1.00 14.38 ? 853  GLU D CG    1 
ATOM   9919  C  CD    . GLU F 3 557 ? 106.903 -23.373 -1.222  1.00 18.75 ? 853  GLU D CD    1 
ATOM   9920  O  OE1   . GLU F 3 557 ? 106.465 -22.688 -2.175  1.00 18.55 ? 853  GLU D OE1   1 
ATOM   9921  O  OE2   . GLU F 3 557 ? 106.174 -23.816 -0.307  1.00 18.70 ? 853  GLU D OE2   1 
ATOM   9922  N  N     . GLN F 3 558 ? 110.694 -26.408 1.903   1.00 9.98  ? 854  GLN D N     1 
ATOM   9923  C  CA    . GLN F 3 558 ? 111.118 -26.807 3.240   1.00 12.66 ? 854  GLN D CA    1 
ATOM   9924  C  C     . GLN F 3 558 ? 112.513 -27.432 3.303   1.00 12.59 ? 854  GLN D C     1 
ATOM   9925  O  O     . GLN F 3 558 ? 112.943 -27.864 4.370   1.00 10.44 ? 854  GLN D O     1 
ATOM   9926  C  CB    . GLN F 3 558 ? 110.101 -27.787 3.839   1.00 15.25 ? 854  GLN D CB    1 
ATOM   9927  C  CG    . GLN F 3 558 ? 108.687 -27.221 3.991   1.00 19.43 ? 854  GLN D CG    1 
ATOM   9928  C  CD    . GLN F 3 558 ? 108.662 -25.945 4.817   1.00 24.13 ? 854  GLN D CD    1 
ATOM   9929  O  OE1   . GLN F 3 558 ? 109.280 -25.871 5.878   1.00 25.74 ? 854  GLN D OE1   1 
ATOM   9930  N  NE2   . GLN F 3 558 ? 107.943 -24.936 4.333   1.00 25.76 ? 854  GLN D NE2   1 
ATOM   9931  N  N     . ALA F 3 559 ? 113.211 -27.476 2.169   1.00 12.11 ? 855  ALA D N     1 
ATOM   9932  C  CA    . ALA F 3 559 ? 114.559 -28.057 2.105   1.00 13.91 ? 855  ALA D CA    1 
ATOM   9933  C  C     . ALA F 3 559 ? 115.480 -27.495 3.188   1.00 14.00 ? 855  ALA D C     1 
ATOM   9934  O  O     . ALA F 3 559 ? 116.262 -28.222 3.807   1.00 13.68 ? 855  ALA D O     1 
ATOM   9935  C  CB    . ALA F 3 559 ? 115.163 -27.809 0.729   1.00 12.94 ? 855  ALA D CB    1 
ATOM   9936  N  N     . VAL F 3 560 ? 115.389 -26.190 3.406   1.00 15.21 ? 856  VAL D N     1 
ATOM   9937  C  CA    . VAL F 3 560 ? 116.182 -25.521 4.430   1.00 14.74 ? 856  VAL D CA    1 
ATOM   9938  C  C     . VAL F 3 560 ? 115.271 -24.485 5.074   1.00 16.86 ? 856  VAL D C     1 
ATOM   9939  O  O     . VAL F 3 560 ? 114.235 -24.126 4.509   1.00 18.23 ? 856  VAL D O     1 
ATOM   9940  C  CB    . VAL F 3 560 ? 117.411 -24.784 3.833   1.00 16.17 ? 856  VAL D CB    1 
ATOM   9941  C  CG1   . VAL F 3 560 ? 118.309 -25.764 3.098   1.00 15.27 ? 856  VAL D CG1   1 
ATOM   9942  C  CG2   . VAL F 3 560 ? 116.949 -23.669 2.888   1.00 16.55 ? 856  VAL D CG2   1 
ATOM   9943  N  N     . THR F 3 561 ? 115.642 -24.012 6.256   1.00 14.98 ? 857  THR D N     1 
ATOM   9944  C  CA    . THR F 3 561 ? 114.851 -22.990 6.920   1.00 17.96 ? 857  THR D CA    1 
ATOM   9945  C  C     . THR F 3 561 ? 115.701 -21.731 6.985   1.00 16.75 ? 857  THR D C     1 
ATOM   9946  O  O     . THR F 3 561 ? 116.727 -21.708 7.662   1.00 18.54 ? 857  THR D O     1 
ATOM   9947  C  CB    . THR F 3 561 ? 114.458 -23.403 8.353   1.00 20.61 ? 857  THR D CB    1 
ATOM   9948  O  OG1   . THR F 3 561 ? 113.667 -24.596 8.307   1.00 21.36 ? 857  THR D OG1   1 
ATOM   9949  C  CG2   . THR F 3 561 ? 113.645 -22.300 9.014   1.00 21.34 ? 857  THR D CG2   1 
ATOM   9950  N  N     . LEU F 3 562 ? 115.277 -20.692 6.270   1.00 14.76 ? 858  LEU D N     1 
ATOM   9951  C  CA    . LEU F 3 562 ? 116.009 -19.431 6.248   1.00 12.32 ? 858  LEU D CA    1 
ATOM   9952  C  C     . LEU F 3 562 ? 115.239 -18.356 7.010   1.00 13.47 ? 858  LEU D C     1 
ATOM   9953  O  O     . LEU F 3 562 ? 114.156 -18.611 7.544   1.00 12.25 ? 858  LEU D O     1 
ATOM   9954  C  CB    . LEU F 3 562 ? 116.231 -18.973 4.798   1.00 11.76 ? 858  LEU D CB    1 
ATOM   9955  C  CG    . LEU F 3 562 ? 116.935 -19.943 3.835   1.00 10.01 ? 858  LEU D CG    1 
ATOM   9956  C  CD1   . LEU F 3 562 ? 117.118 -19.270 2.471   1.00 8.20  ? 858  LEU D CD1   1 
ATOM   9957  C  CD2   . LEU F 3 562 ? 118.279 -20.346 4.405   1.00 11.36 ? 858  LEU D CD2   1 
ATOM   9958  N  N     . ARG F 3 563 ? 115.801 -17.151 7.047   1.00 13.59 ? 859  ARG D N     1 
ATOM   9959  C  CA    . ARG F 3 563 ? 115.173 -16.027 7.735   1.00 14.01 ? 859  ARG D CA    1 
ATOM   9960  C  C     . ARG F 3 563 ? 114.024 -15.433 6.923   1.00 14.08 ? 859  ARG D C     1 
ATOM   9961  O  O     . ARG F 3 563 ? 113.299 -14.554 7.393   1.00 13.19 ? 859  ARG D O     1 
ATOM   9962  C  CB    . ARG F 3 563 ? 116.228 -14.962 8.049   1.00 14.64 ? 859  ARG D CB    1 
ATOM   9963  C  CG    . ARG F 3 563 ? 117.221 -15.421 9.116   1.00 18.84 ? 859  ARG D CG    1 
ATOM   9964  C  CD    . ARG F 3 563 ? 118.324 -14.400 9.380   1.00 22.84 ? 859  ARG D CD    1 
ATOM   9965  N  NE    . ARG F 3 563 ? 119.253 -14.891 10.398  1.00 23.21 ? 859  ARG D NE    1 
ATOM   9966  C  CZ    . ARG F 3 563 ? 120.482 -15.340 10.152  1.00 25.43 ? 859  ARG D CZ    1 
ATOM   9967  N  NH1   . ARG F 3 563 ? 120.961 -15.365 8.911   1.00 19.32 ? 859  ARG D NH1   1 
ATOM   9968  N  NH2   . ARG F 3 563 ? 121.235 -15.771 11.158  1.00 25.88 ? 859  ARG D NH2   1 
ATOM   9969  N  N     . VAL F 3 564 ? 113.868 -15.921 5.697   1.00 11.17 ? 860  VAL D N     1 
ATOM   9970  C  CA    . VAL F 3 564 ? 112.785 -15.486 4.823   1.00 10.94 ? 860  VAL D CA    1 
ATOM   9971  C  C     . VAL F 3 564 ? 112.209 -16.760 4.224   1.00 10.15 ? 860  VAL D C     1 
ATOM   9972  O  O     . VAL F 3 564 ? 112.898 -17.773 4.141   1.00 9.16  ? 860  VAL D O     1 
ATOM   9973  C  CB    . VAL F 3 564 ? 113.279 -14.574 3.665   1.00 11.24 ? 860  VAL D CB    1 
ATOM   9974  C  CG1   . VAL F 3 564 ? 113.880 -13.294 4.227   1.00 12.00 ? 860  VAL D CG1   1 
ATOM   9975  C  CG2   . VAL F 3 564 ? 114.300 -15.316 2.798   1.00 12.60 ? 860  VAL D CG2   1 
ATOM   9976  N  N     . PRO F 3 565 ? 110.939 -16.731 3.802   1.00 11.26 ? 861  PRO D N     1 
ATOM   9977  C  CA    . PRO F 3 565 ? 110.371 -17.949 3.222   1.00 12.17 ? 861  PRO D CA    1 
ATOM   9978  C  C     . PRO F 3 565 ? 110.948 -18.221 1.836   1.00 11.82 ? 861  PRO D C     1 
ATOM   9979  O  O     . PRO F 3 565 ? 111.413 -17.307 1.158   1.00 12.53 ? 861  PRO D O     1 
ATOM   9980  C  CB    . PRO F 3 565 ? 108.868 -17.662 3.165   1.00 12.59 ? 861  PRO D CB    1 
ATOM   9981  C  CG    . PRO F 3 565 ? 108.671 -16.438 4.048   1.00 14.36 ? 861  PRO D CG    1 
ATOM   9982  C  CD    . PRO F 3 565 ? 109.935 -15.657 3.865   1.00 12.31 ? 861  PRO D CD    1 
ATOM   9983  N  N     . LEU F 3 566 ? 110.935 -19.481 1.426   1.00 11.65 ? 862  LEU D N     1 
ATOM   9984  C  CA    . LEU F 3 566 ? 111.363 -19.822 0.081   1.00 12.12 ? 862  LEU D CA    1 
ATOM   9985  C  C     . LEU F 3 566 ? 110.021 -20.039 -0.610  1.00 13.04 ? 862  LEU D C     1 
ATOM   9986  O  O     . LEU F 3 566 ? 109.058 -20.475 0.027   1.00 12.24 ? 862  LEU D O     1 
ATOM   9987  C  CB    . LEU F 3 566 ? 112.188 -21.112 0.053   1.00 12.62 ? 862  LEU D CB    1 
ATOM   9988  C  CG    . LEU F 3 566 ? 113.642 -20.977 0.513   1.00 15.57 ? 862  LEU D CG    1 
ATOM   9989  C  CD1   . LEU F 3 566 ? 114.338 -22.322 0.411   1.00 17.73 ? 862  LEU D CD1   1 
ATOM   9990  C  CD2   . LEU F 3 566 ? 114.352 -19.937 -0.345  1.00 15.95 ? 862  LEU D CD2   1 
ATOM   9991  N  N     . LYS F 3 567 ? 109.951 -19.726 -1.896  1.00 12.00 ? 863  LYS D N     1 
ATOM   9992  C  CA    . LYS F 3 567 ? 108.717 -19.883 -2.641  1.00 14.03 ? 863  LYS D CA    1 
ATOM   9993  C  C     . LYS F 3 567 ? 109.006 -20.588 -3.957  1.00 12.62 ? 863  LYS D C     1 
ATOM   9994  O  O     . LYS F 3 567 ? 110.029 -20.352 -4.597  1.00 11.39 ? 863  LYS D O     1 
ATOM   9995  C  CB    . LYS F 3 567 ? 108.081 -18.513 -2.908  1.00 16.18 ? 863  LYS D CB    1 
ATOM   9996  C  CG    . LYS F 3 567 ? 106.701 -18.592 -3.537  1.00 18.99 ? 863  LYS D CG    1 
ATOM   9997  C  CD    . LYS F 3 567 ? 106.167 -17.215 -3.852  1.00 24.23 ? 863  LYS D CD    1 
ATOM   9998  C  CE    . LYS F 3 567 ? 104.770 -17.279 -4.449  1.00 25.17 ? 863  LYS D CE    1 
ATOM   9999  N  NZ    . LYS F 3 567 ? 104.368 -15.939 -4.960  1.00 27.74 ? 863  LYS D NZ    1 
ATOM   10000 N  N     . VAL F 3 568 ? 108.099 -21.463 -4.361  1.00 12.49 ? 864  VAL D N     1 
ATOM   10001 C  CA    . VAL F 3 568 ? 108.287 -22.194 -5.599  1.00 12.95 ? 864  VAL D CA    1 
ATOM   10002 C  C     . VAL F 3 568 ? 107.123 -21.980 -6.550  1.00 14.82 ? 864  VAL D C     1 
ATOM   10003 O  O     . VAL F 3 568 ? 105.962 -22.058 -6.155  1.00 14.50 ? 864  VAL D O     1 
ATOM   10004 C  CB    . VAL F 3 568 ? 108.456 -23.706 -5.313  1.00 16.70 ? 864  VAL D CB    1 
ATOM   10005 C  CG1   . VAL F 3 568 ? 108.354 -24.511 -6.607  1.00 16.26 ? 864  VAL D CG1   1 
ATOM   10006 C  CG2   . VAL F 3 568 ? 109.809 -23.949 -4.648  1.00 16.85 ? 864  VAL D CG2   1 
ATOM   10007 N  N     . ASP F 3 569 ? 107.450 -21.696 -7.806  1.00 14.85 ? 865  ASP D N     1 
ATOM   10008 C  CA    . ASP F 3 569 ? 106.449 -21.502 -8.841  1.00 16.05 ? 865  ASP D CA    1 
ATOM   10009 C  C     . ASP F 3 569 ? 106.474 -22.817 -9.618  1.00 16.29 ? 865  ASP D C     1 
ATOM   10010 O  O     . ASP F 3 569 ? 107.545 -23.355 -9.884  1.00 15.46 ? 865  ASP D O     1 
ATOM   10011 C  CB    . ASP F 3 569 ? 106.842 -20.333 -9.751  1.00 18.73 ? 865  ASP D CB    1 
ATOM   10012 C  CG    . ASP F 3 569 ? 107.071 -19.042 -8.977  1.00 22.85 ? 865  ASP D CG    1 
ATOM   10013 O  OD1   . ASP F 3 569 ? 106.190 -18.665 -8.175  1.00 24.54 ? 865  ASP D OD1   1 
ATOM   10014 O  OD2   . ASP F 3 569 ? 108.128 -18.402 -9.169  1.00 26.54 ? 865  ASP D OD2   1 
ATOM   10015 N  N     . TYR F 3 570 ? 105.311 -23.346 -9.974  1.00 15.10 ? 866  TYR D N     1 
ATOM   10016 C  CA    . TYR F 3 570 ? 105.285 -24.610 -10.699 1.00 15.45 ? 866  TYR D CA    1 
ATOM   10017 C  C     . TYR F 3 570 ? 104.215 -24.647 -11.774 1.00 16.12 ? 866  TYR D C     1 
ATOM   10018 O  O     . TYR F 3 570 ? 103.206 -23.945 -11.688 1.00 14.11 ? 866  TYR D O     1 
ATOM   10019 C  CB    . TYR F 3 570 ? 105.087 -25.766 -9.718  1.00 15.92 ? 866  TYR D CB    1 
ATOM   10020 C  CG    . TYR F 3 570 ? 103.824 -25.653 -8.901  1.00 19.52 ? 866  TYR D CG    1 
ATOM   10021 C  CD1   . TYR F 3 570 ? 102.652 -26.300 -9.290  1.00 20.15 ? 866  TYR D CD1   1 
ATOM   10022 C  CD2   . TYR F 3 570 ? 103.797 -24.885 -7.740  1.00 21.80 ? 866  TYR D CD2   1 
ATOM   10023 C  CE1   . TYR F 3 570 ? 101.483 -26.181 -8.537  1.00 24.29 ? 866  TYR D CE1   1 
ATOM   10024 C  CE2   . TYR F 3 570 ? 102.636 -24.759 -6.982  1.00 24.11 ? 866  TYR D CE2   1 
ATOM   10025 C  CZ    . TYR F 3 570 ? 101.487 -25.407 -7.384  1.00 24.12 ? 866  TYR D CZ    1 
ATOM   10026 O  OH    . TYR F 3 570 ? 100.347 -25.275 -6.628  1.00 28.05 ? 866  TYR D OH    1 
ATOM   10027 N  N     . HIS F 3 571 ? 104.452 -25.474 -12.788 1.00 14.58 ? 867  HIS D N     1 
ATOM   10028 C  CA    . HIS F 3 571 ? 103.537 -25.622 -13.912 1.00 16.60 ? 867  HIS D CA    1 
ATOM   10029 C  C     . HIS F 3 571 ? 103.698 -27.026 -14.475 1.00 17.32 ? 867  HIS D C     1 
ATOM   10030 O  O     . HIS F 3 571 ? 104.720 -27.677 -14.249 1.00 16.01 ? 867  HIS D O     1 
ATOM   10031 C  CB    . HIS F 3 571 ? 103.877 -24.609 -15.010 1.00 17.28 ? 867  HIS D CB    1 
ATOM   10032 C  CG    . HIS F 3 571 ? 103.955 -23.194 -14.530 1.00 18.79 ? 867  HIS D CG    1 
ATOM   10033 N  ND1   . HIS F 3 571 ? 102.844 -22.389 -14.399 1.00 21.07 ? 867  HIS D ND1   1 
ATOM   10034 C  CD2   . HIS F 3 571 ? 105.012 -22.444 -14.136 1.00 20.24 ? 867  HIS D CD2   1 
ATOM   10035 C  CE1   . HIS F 3 571 ? 103.213 -21.203 -13.946 1.00 20.83 ? 867  HIS D CE1   1 
ATOM   10036 N  NE2   . HIS F 3 571 ? 104.523 -21.211 -13.778 1.00 21.21 ? 867  HIS D NE2   1 
ATOM   10037 N  N     . TYR F 3 572 ? 102.697 -27.493 -15.214 1.00 18.48 ? 868  TYR D N     1 
ATOM   10038 C  CA    . TYR F 3 572 ? 102.771 -28.817 -15.825 1.00 17.83 ? 868  TYR D CA    1 
ATOM   10039 C  C     . TYR F 3 572 ? 102.005 -28.823 -17.139 1.00 17.88 ? 868  TYR D C     1 
ATOM   10040 O  O     . TYR F 3 572 ? 101.150 -27.963 -17.368 1.00 17.89 ? 868  TYR D O     1 
ATOM   10041 C  CB    . TYR F 3 572 ? 102.224 -29.887 -14.870 1.00 19.56 ? 868  TYR D CB    1 
ATOM   10042 C  CG    . TYR F 3 572 ? 100.747 -29.777 -14.573 1.00 24.11 ? 868  TYR D CG    1 
ATOM   10043 C  CD1   . TYR F 3 572 ? 99.795  -30.222 -15.490 1.00 26.25 ? 868  TYR D CD1   1 
ATOM   10044 C  CD2   . TYR F 3 572 ? 100.300 -29.228 -13.372 1.00 26.79 ? 868  TYR D CD2   1 
ATOM   10045 C  CE1   . TYR F 3 572 ? 98.430  -30.123 -15.218 1.00 28.60 ? 868  TYR D CE1   1 
ATOM   10046 C  CE2   . TYR F 3 572 ? 98.938  -29.123 -13.090 1.00 28.09 ? 868  TYR D CE2   1 
ATOM   10047 C  CZ    . TYR F 3 572 ? 98.011  -29.572 -14.017 1.00 29.54 ? 868  TYR D CZ    1 
ATOM   10048 O  OH    . TYR F 3 572 ? 96.664  -29.474 -13.745 1.00 32.98 ? 868  TYR D OH    1 
ATOM   10049 N  N     . GLY F 3 573 ? 102.315 -29.789 -17.999 1.00 16.86 ? 869  GLY D N     1 
ATOM   10050 C  CA    . GLY F 3 573 ? 101.649 -29.869 -19.288 1.00 17.10 ? 869  GLY D CA    1 
ATOM   10051 C  C     . GLY F 3 573 ? 102.117 -31.044 -20.126 1.00 16.98 ? 869  GLY D C     1 
ATOM   10052 O  O     . GLY F 3 573 ? 102.931 -31.851 -19.672 1.00 15.84 ? 869  GLY D O     1 
ATOM   10053 N  N     . SER F 3 574 ? 101.611 -31.116 -21.359 1.00 16.54 ? 870  SER D N     1 
ATOM   10054 C  CA    . SER F 3 574 ? 101.912 -32.195 -22.305 1.00 16.22 ? 870  SER D CA    1 
ATOM   10055 C  C     . SER F 3 574 ? 103.338 -32.217 -22.839 1.00 15.61 ? 870  SER D C     1 
ATOM   10056 O  O     . SER F 3 574 ? 103.820 -33.258 -23.297 1.00 15.79 ? 870  SER D O     1 
ATOM   10057 C  CB    . SER F 3 574 ? 100.950 -32.117 -23.495 1.00 16.10 ? 870  SER D CB    1 
ATOM   10058 O  OG    . SER F 3 574 ? 99.609  -32.106 -23.053 1.00 24.34 ? 870  SER D OG    1 
ATOM   10059 N  N     . THR F 3 575 ? 104.003 -31.069 -22.805 1.00 13.68 ? 871  THR D N     1 
ATOM   10060 C  CA    . THR F 3 575 ? 105.381 -30.985 -23.271 1.00 13.47 ? 871  THR D CA    1 
ATOM   10061 C  C     . THR F 3 575 ? 106.087 -30.017 -22.341 1.00 13.45 ? 871  THR D C     1 
ATOM   10062 O  O     . THR F 3 575 ? 105.442 -29.298 -21.579 1.00 14.28 ? 871  THR D O     1 
ATOM   10063 C  CB    . THR F 3 575 ? 105.489 -30.430 -24.715 1.00 14.54 ? 871  THR D CB    1 
ATOM   10064 O  OG1   . THR F 3 575 ? 105.127 -29.046 -24.718 1.00 13.97 ? 871  THR D OG1   1 
ATOM   10065 C  CG2   . THR F 3 575 ? 104.571 -31.194 -25.668 1.00 14.80 ? 871  THR D CG2   1 
ATOM   10066 N  N     . TRP F 3 576 ? 107.409 -29.996 -22.406 1.00 12.26 ? 872  TRP D N     1 
ATOM   10067 C  CA    . TRP F 3 576 ? 108.179 -29.103 -21.557 1.00 13.04 ? 872  TRP D CA    1 
ATOM   10068 C  C     . TRP F 3 576 ? 107.736 -27.663 -21.821 1.00 11.31 ? 872  TRP D C     1 
ATOM   10069 O  O     . TRP F 3 576 ? 107.689 -26.838 -20.913 1.00 12.26 ? 872  TRP D O     1 
ATOM   10070 C  CB    . TRP F 3 576 ? 109.666 -29.277 -21.866 1.00 11.34 ? 872  TRP D CB    1 
ATOM   10071 C  CG    . TRP F 3 576 ? 110.598 -28.630 -20.888 1.00 12.48 ? 872  TRP D CG    1 
ATOM   10072 C  CD1   . TRP F 3 576 ? 110.268 -27.939 -19.754 1.00 12.62 ? 872  TRP D CD1   1 
ATOM   10073 C  CD2   . TRP F 3 576 ? 112.028 -28.649 -20.945 1.00 12.62 ? 872  TRP D CD2   1 
ATOM   10074 N  NE1   . TRP F 3 576 ? 111.410 -27.532 -19.102 1.00 12.53 ? 872  TRP D NE1   1 
ATOM   10075 C  CE2   . TRP F 3 576 ? 112.503 -27.955 -19.812 1.00 11.38 ? 872  TRP D CE2   1 
ATOM   10076 C  CE3   . TRP F 3 576 ? 112.955 -29.189 -21.848 1.00 13.32 ? 872  TRP D CE3   1 
ATOM   10077 C  CZ2   . TRP F 3 576 ? 113.872 -27.787 -19.553 1.00 13.36 ? 872  TRP D CZ2   1 
ATOM   10078 C  CZ3   . TRP F 3 576 ? 114.317 -29.022 -21.591 1.00 14.01 ? 872  TRP D CZ3   1 
ATOM   10079 C  CH2   . TRP F 3 576 ? 114.757 -28.327 -20.453 1.00 12.46 ? 872  TRP D CH2   1 
ATOM   10080 N  N     . TYR F 3 577 ? 107.413 -27.372 -23.078 1.00 12.37 ? 873  TYR D N     1 
ATOM   10081 C  CA    . TYR F 3 577 ? 106.960 -26.041 -23.477 1.00 14.20 ? 873  TYR D CA    1 
ATOM   10082 C  C     . TYR F 3 577 ? 105.751 -25.614 -22.650 1.00 16.74 ? 873  TYR D C     1 
ATOM   10083 O  O     . TYR F 3 577 ? 105.653 -24.464 -22.208 1.00 16.63 ? 873  TYR D O     1 
ATOM   10084 C  CB    . TYR F 3 577 ? 106.574 -26.053 -24.956 1.00 13.67 ? 873  TYR D CB    1 
ATOM   10085 C  CG    . TYR F 3 577 ? 106.009 -24.750 -25.476 1.00 15.09 ? 873  TYR D CG    1 
ATOM   10086 C  CD1   . TYR F 3 577 ? 106.845 -23.771 -26.010 1.00 16.06 ? 873  TYR D CD1   1 
ATOM   10087 C  CD2   . TYR F 3 577 ? 104.634 -24.504 -25.456 1.00 18.17 ? 873  TYR D CD2   1 
ATOM   10088 C  CE1   . TYR F 3 577 ? 106.328 -22.573 -26.521 1.00 16.85 ? 873  TYR D CE1   1 
ATOM   10089 C  CE2   . TYR F 3 577 ? 104.104 -23.306 -25.960 1.00 18.45 ? 873  TYR D CE2   1 
ATOM   10090 C  CZ    . TYR F 3 577 ? 104.961 -22.349 -26.493 1.00 18.91 ? 873  TYR D CZ    1 
ATOM   10091 O  OH    . TYR F 3 577 ? 104.457 -21.175 -27.003 1.00 21.05 ? 873  TYR D OH    1 
ATOM   10092 N  N     . ASP F 3 578 ? 104.834 -26.554 -22.449 1.00 18.37 ? 874  ASP D N     1 
ATOM   10093 C  CA    . ASP F 3 578 ? 103.602 -26.304 -21.705 1.00 23.20 ? 874  ASP D CA    1 
ATOM   10094 C  C     . ASP F 3 578 ? 103.778 -26.154 -20.207 1.00 26.97 ? 874  ASP D C     1 
ATOM   10095 O  O     . ASP F 3 578 ? 102.850 -25.752 -19.510 1.00 28.40 ? 874  ASP D O     1 
ATOM   10096 C  CB    . ASP F 3 578 ? 102.603 -27.422 -21.986 1.00 23.15 ? 874  ASP D CB    1 
ATOM   10097 C  CG    . ASP F 3 578 ? 102.271 -27.533 -23.450 1.00 25.29 ? 874  ASP D CG    1 
ATOM   10098 O  OD1   . ASP F 3 578 ? 102.456 -28.630 -24.019 1.00 27.92 ? 874  ASP D OD1   1 
ATOM   10099 O  OD2   . ASP F 3 578 ? 101.828 -26.519 -24.032 1.00 22.87 ? 874  ASP D OD2   1 
ATOM   10100 N  N     . ALA F 3 579 ? 104.960 -26.482 -19.705 1.00 30.60 ? 875  ALA D N     1 
ATOM   10101 C  CA    . ALA F 3 579 ? 105.223 -26.350 -18.280 1.00 35.40 ? 875  ALA D CA    1 
ATOM   10102 C  C     . ALA F 3 579 ? 105.686 -24.923 -18.007 1.00 37.84 ? 875  ALA D C     1 
ATOM   10103 O  O     . ALA F 3 579 ? 106.608 -24.709 -17.229 1.00 37.50 ? 875  ALA D O     1 
ATOM   10104 C  CB    . ALA F 3 579 ? 106.289 -27.349 -17.849 1.00 35.43 ? 875  ALA D CB    1 
ATOM   10105 N  N     . LYS F 3 580 ? 105.018 -23.974 -18.669 1.00 42.72 ? 876  LYS D N     1 
ATOM   10106 C  CA    . LYS F 3 580 ? 105.257 -22.523 -18.603 1.00 46.43 ? 876  LYS D CA    1 
ATOM   10107 C  C     . LYS F 3 580 ? 106.541 -22.011 -17.932 1.00 48.13 ? 876  LYS D C     1 
ATOM   10108 O  O     . LYS F 3 580 ? 107.040 -22.635 -16.977 1.00 49.60 ? 876  LYS D O     1 
ATOM   10109 C  CB    . LYS F 3 580 ? 104.038 -21.844 -17.959 1.00 47.86 ? 876  LYS D CB    1 
ATOM   10110 C  CG    . LYS F 3 580 ? 104.031 -20.318 -18.041 1.00 50.65 ? 876  LYS D CG    1 
ATOM   10111 C  CD    . LYS F 3 580 ? 102.708 -19.744 -17.539 1.00 51.52 ? 876  LYS D CD    1 
ATOM   10112 C  CE    . LYS F 3 580 ? 102.669 -18.222 -17.647 1.00 52.61 ? 876  LYS D CE    1 
ATOM   10113 N  NZ    . LYS F 3 580 ? 103.685 -17.558 -16.781 1.00 53.31 ? 876  LYS D NZ    1 
ATOM   10114 O  OXT   . LYS F 3 580 ? 107.031 -20.945 -18.366 1.00 50.38 ? 876  LYS D OXT   1 
HETATM 10115 C  C1    . GLC G 4 .   ? 112.876 -45.749 30.949  1.00 28.61 ? 1    GLC G C1    1 
HETATM 10116 C  C2    . GLC G 4 .   ? 111.484 -45.071 31.120  1.00 28.18 ? 1    GLC G C2    1 
HETATM 10117 C  C3    . GLC G 4 .   ? 111.760 -43.669 31.966  1.00 28.59 ? 1    GLC G C3    1 
HETATM 10118 C  C4    . GLC G 4 .   ? 112.371 -44.021 33.359  1.00 28.15 ? 1    GLC G C4    1 
HETATM 10119 C  C5    . GLC G 4 .   ? 113.673 -44.900 33.197  1.00 28.55 ? 1    GLC G C5    1 
HETATM 10120 C  C6    . GLC G 4 .   ? 114.207 -45.487 34.521  1.00 28.74 ? 1    GLC G C6    1 
HETATM 10121 O  O2    . GLC G 4 .   ? 110.928 -44.724 29.849  1.00 28.80 ? 1    GLC G O2    1 
HETATM 10122 O  O3    . GLC G 4 .   ? 110.486 -43.062 32.133  1.00 28.77 ? 1    GLC G O3    1 
HETATM 10123 O  O4    . GLC G 4 .   ? 112.633 -42.796 34.043  1.00 28.74 ? 1    GLC G O4    1 
HETATM 10124 O  O5    . GLC G 4 .   ? 113.416 -46.046 32.293  1.00 28.08 ? 1    GLC G O5    1 
HETATM 10125 O  O6    . GLC G 4 .   ? 113.189 -46.203 35.214  1.00 28.04 ? 1    GLC G O6    1 
HETATM 10126 C  C1    . FRU G 4 .   ? 113.784 -45.825 27.918  1.00 28.56 ? 2    FRU G C1    1 
HETATM 10127 C  C2    . FRU G 4 .   ? 114.644 -45.352 29.130  1.00 28.70 ? 2    FRU G C2    1 
HETATM 10128 C  C3    . FRU G 4 .   ? 115.783 -44.384 28.769  1.00 28.22 ? 2    FRU G C3    1 
HETATM 10129 C  C4    . FRU G 4 .   ? 116.830 -44.704 29.840  1.00 28.01 ? 2    FRU G C4    1 
HETATM 10130 C  C5    . FRU G 4 .   ? 116.657 -46.228 30.064  1.00 28.00 ? 2    FRU G C5    1 
HETATM 10131 C  C6    . FRU G 4 .   ? 116.834 -46.731 31.514  1.00 27.30 ? 2    FRU G C6    1 
HETATM 10132 O  O1    . FRU G 4 .   ? 114.559 -46.483 26.914  1.00 30.32 ? 2    FRU G O1    1 
HETATM 10133 O  O2    . FRU G 4 .   ? 113.788 -44.869 30.217  1.00 27.63 ? 2    FRU G O2    1 
HETATM 10134 O  O3    . FRU G 4 .   ? 115.401 -43.006 28.813  1.00 27.84 ? 2    FRU G O3    1 
HETATM 10135 O  O4    . FRU G 4 .   ? 118.133 -44.313 29.429  1.00 25.90 ? 2    FRU G O4    1 
HETATM 10136 O  O5    . FRU G 4 .   ? 115.307 -46.539 29.629  1.00 28.46 ? 2    FRU G O5    1 
HETATM 10137 O  O6    . FRU G 4 .   ? 116.687 -48.146 31.548  1.00 26.51 ? 2    FRU G O6    1 
HETATM 10138 C  C1    . GLC H 4 .   ? 134.748 -36.339 -18.256 1.00 18.06 ? 1    GLC H C1    1 
HETATM 10139 C  C2    . GLC H 4 .   ? 135.465 -35.670 -19.464 1.00 19.75 ? 1    GLC H C2    1 
HETATM 10140 C  C3    . GLC H 4 .   ? 134.630 -34.276 -19.788 1.00 19.17 ? 1    GLC H C3    1 
HETATM 10141 C  C4    . GLC H 4 .   ? 133.157 -34.635 -20.156 1.00 18.62 ? 1    GLC H C4    1 
HETATM 10142 C  C5    . GLC H 4 .   ? 132.491 -35.490 -19.011 1.00 17.67 ? 1    GLC H C5    1 
HETATM 10143 C  C6    . GLC H 4 .   ? 131.118 -36.077 -19.387 1.00 17.01 ? 1    GLC H C6    1 
HETATM 10144 O  O2    . GLC H 4 .   ? 136.807 -35.319 -19.125 1.00 19.85 ? 1    GLC H O2    1 
HETATM 10145 O  O3    . GLC H 4 .   ? 135.287 -33.689 -20.906 1.00 20.46 ? 1    GLC H O3    1 
HETATM 10146 O  O4    . GLC H 4 .   ? 132.456 -33.417 -20.386 1.00 19.07 ? 1    GLC H O4    1 
HETATM 10147 O  O5    . GLC H 4 .   ? 133.363 -36.640 -18.644 1.00 17.69 ? 1    GLC H O5    1 
HETATM 10148 O  O6    . GLC H 4 .   ? 131.181 -36.739 -20.640 1.00 14.36 ? 1    GLC H O6    1 
HETATM 10149 C  C1    . FRU H 4 .   ? 136.623 -36.468 -15.766 1.00 19.13 ? 2    FRU H C1    1 
HETATM 10150 C  C2    . FRU H 4 .   ? 135.146 -35.954 -15.762 1.00 19.03 ? 2    FRU H C2    1 
HETATM 10151 C  C3    . FRU H 4 .   ? 134.795 -34.981 -14.627 1.00 18.22 ? 2    FRU H C3    1 
HETATM 10152 C  C4    . FRU H 4 .   ? 133.303 -35.252 -14.437 1.00 17.32 ? 2    FRU H C4    1 
HETATM 10153 C  C5    . FRU H 4 .   ? 133.169 -36.770 -14.721 1.00 18.15 ? 2    FRU H C5    1 
HETATM 10154 C  C6    . FRU H 4 .   ? 131.905 -37.215 -15.482 1.00 17.88 ? 2    FRU H C6    1 
HETATM 10155 O  O1    . FRU H 4 .   ? 137.020 -37.045 -14.519 1.00 20.54 ? 2    FRU H O1    1 
HETATM 10156 O  O2    . FRU H 4 .   ? 134.759 -35.461 -17.089 1.00 17.31 ? 2    FRU H O2    1 
HETATM 10157 O  O3    . FRU H 4 .   ? 135.023 -33.605 -14.955 1.00 18.96 ? 2    FRU H O3    1 
HETATM 10158 O  O4    . FRU H 4 .   ? 132.863 -34.847 -13.148 1.00 17.05 ? 2    FRU H O4    1 
HETATM 10159 O  O5    . FRU H 4 .   ? 134.328 -37.125 -15.519 1.00 18.61 ? 2    FRU H O5    1 
HETATM 10160 O  O6    . FRU H 4 .   ? 131.929 -38.627 -15.654 1.00 17.22 ? 2    FRU H O6    1 
HETATM 10161 MN MN    . MN  I 5 .   ? 131.808 -28.529 42.864  1.00 21.22 ? 878  MN  A MN    1 
HETATM 10162 S  S     . SO4 J 6 .   ? 123.119 -78.779 20.874  1.00 95.36 ? 879  SO4 A S     1 
HETATM 10163 O  O1    . SO4 J 6 .   ? 123.235 -78.461 19.438  1.00 94.86 ? 879  SO4 A O1    1 
HETATM 10164 O  O2    . SO4 J 6 .   ? 121.727 -79.158 21.185  1.00 95.07 ? 879  SO4 A O2    1 
HETATM 10165 O  O3    . SO4 J 6 .   ? 123.496 -77.599 21.673  1.00 95.29 ? 879  SO4 A O3    1 
HETATM 10166 O  O4    . SO4 J 6 .   ? 124.023 -79.895 21.209  1.00 95.20 ? 879  SO4 A O4    1 
HETATM 10167 S  S     . SO4 K 6 .   ? 117.135 -65.908 6.534   1.00 98.12 ? 880  SO4 A S     1 
HETATM 10168 O  O1    . SO4 K 6 .   ? 117.699 -66.850 5.549   1.00 98.13 ? 880  SO4 A O1    1 
HETATM 10169 O  O2    . SO4 K 6 .   ? 117.575 -64.537 6.210   1.00 97.77 ? 880  SO4 A O2    1 
HETATM 10170 O  O3    . SO4 K 6 .   ? 117.606 -66.271 7.885   1.00 97.64 ? 880  SO4 A O3    1 
HETATM 10171 O  O4    . SO4 K 6 .   ? 115.661 -65.974 6.492   1.00 97.79 ? 880  SO4 A O4    1 
HETATM 10172 P  PA    . D3T L 7 .   ? 128.876 -26.829 42.254  1.00 20.99 ? 881  D3T A PA    1 
HETATM 10173 O  O1A   . D3T L 7 .   ? 129.722 -27.884 42.855  1.00 17.53 ? 881  D3T A O1A   1 
HETATM 10174 O  O2A   . D3T L 7 .   ? 127.819 -26.221 43.304  1.00 21.59 ? 881  D3T A O2A   1 
HETATM 10175 O  "O5'" . D3T L 7 .   ? 128.014 -27.337 40.992  1.00 19.54 ? 881  D3T A "O5'" 1 
HETATM 10176 C  "C5'" . D3T L 7 .   ? 128.670 -27.973 39.892  1.00 19.53 ? 881  D3T A "C5'" 1 
HETATM 10177 C  "C4'" . D3T L 7 .   ? 128.308 -27.284 38.575  1.00 18.54 ? 881  D3T A "C4'" 1 
HETATM 10178 O  "O4'" . D3T L 7 .   ? 126.889 -27.270 38.341  1.00 17.64 ? 881  D3T A "O4'" 1 
HETATM 10179 C  "C1'" . D3T L 7 .   ? 126.579 -26.065 37.618  1.00 17.64 ? 881  D3T A "C1'" 1 
HETATM 10180 N  N1    . D3T L 7 .   ? 125.817 -25.144 38.491  1.00 18.87 ? 881  D3T A N1    1 
HETATM 10181 C  C6    . D3T L 7 .   ? 125.852 -25.274 39.885  1.00 19.08 ? 881  D3T A C6    1 
HETATM 10182 C  C2    . D3T L 7 .   ? 125.099 -24.095 37.905  1.00 17.00 ? 881  D3T A C2    1 
HETATM 10183 O  O2    . D3T L 7 .   ? 125.047 -23.997 36.680  1.00 19.11 ? 881  D3T A O2    1 
HETATM 10184 N  N3    . D3T L 7 .   ? 124.431 -23.170 38.714  1.00 19.74 ? 881  D3T A N3    1 
HETATM 10185 C  C4    . D3T L 7 .   ? 124.486 -23.300 40.108  1.00 21.74 ? 881  D3T A C4    1 
HETATM 10186 O  O4    . D3T L 7 .   ? 123.932 -22.462 40.817  1.00 22.29 ? 881  D3T A O4    1 
HETATM 10187 C  C5    . D3T L 7 .   ? 125.188 -24.351 40.686  1.00 20.69 ? 881  D3T A C5    1 
HETATM 10188 C  C5M   . D3T L 7 .   ? 125.222 -24.502 42.209  1.00 21.76 ? 881  D3T A C5M   1 
HETATM 10189 C  "C2'" . D3T L 7 .   ? 127.933 -25.423 37.302  1.00 18.72 ? 881  D3T A "C2'" 1 
HETATM 10190 C  "C3'" . D3T L 7 .   ? 128.706 -25.810 38.561  1.00 17.79 ? 881  D3T A "C3'" 1 
HETATM 10191 O  O3A   . D3T L 7 .   ? 129.729 -25.569 41.723  1.00 21.43 ? 881  D3T A O3A   1 
HETATM 10192 P  PB    . D3T L 7 .   ? 131.322 -25.436 41.934  1.00 21.84 ? 881  D3T A PB    1 
HETATM 10193 O  O1B   . D3T L 7 .   ? 131.456 -24.215 40.892  1.00 19.15 ? 881  D3T A O1B   1 
HETATM 10194 O  O2B   . D3T L 7 .   ? 131.772 -26.807 41.610  1.00 20.52 ? 881  D3T A O2B   1 
HETATM 10195 O  O3B   . D3T L 7 .   ? 131.202 -24.907 43.450  1.00 23.86 ? 881  D3T A O3B   1 
HETATM 10196 P  PG    . D3T L 7 .   ? 132.076 -25.571 44.628  1.00 24.36 ? 881  D3T A PG    1 
HETATM 10197 O  O1G   . D3T L 7 .   ? 132.228 -27.133 44.269  1.00 23.72 ? 881  D3T A O1G   1 
HETATM 10198 O  O2G   . D3T L 7 .   ? 133.547 -24.931 44.491  1.00 25.92 ? 881  D3T A O2G   1 
HETATM 10199 O  O3G   . D3T L 7 .   ? 131.473 -25.349 45.961  1.00 25.24 ? 881  D3T A O3G   1 
HETATM 10200 MN MN    . MN  M 5 .   ? 114.071 -19.017 -10.123 1.00 10.08 ? 878  MN  D MN    1 
HETATM 10201 S  S     . SO4 N 6 .   ? 153.474 -54.827 -2.982  1.00 76.28 ? 879  SO4 D S     1 
HETATM 10202 O  O1    . SO4 N 6 .   ? 154.347 -53.683 -3.294  1.00 78.81 ? 879  SO4 D O1    1 
HETATM 10203 O  O2    . SO4 N 6 .   ? 152.388 -54.894 -3.971  1.00 78.75 ? 879  SO4 D O2    1 
HETATM 10204 O  O3    . SO4 N 6 .   ? 152.905 -54.657 -1.632  1.00 77.81 ? 879  SO4 D O3    1 
HETATM 10205 O  O4    . SO4 N 6 .   ? 154.260 -56.071 -3.040  1.00 78.60 ? 879  SO4 D O4    1 
HETATM 10206 P  PA    . D3T O 7 .   ? 116.325 -17.443 -12.184 1.00 11.52 ? 880  D3T D PA    1 
HETATM 10207 O  O1A   . D3T O 7 .   ? 116.148 -16.927 -13.697 1.00 11.50 ? 880  D3T D O1A   1 
HETATM 10208 O  O2A   . D3T O 7 .   ? 115.316 -18.457 -11.803 1.00 11.96 ? 880  D3T D O2A   1 
HETATM 10209 O  "O5'" . D3T O 7 .   ? 117.842 -17.969 -12.062 1.00 10.60 ? 880  D3T D "O5'" 1 
HETATM 10210 C  "C5'" . D3T O 7 .   ? 118.298 -18.545 -10.835 1.00 10.05 ? 880  D3T D "C5'" 1 
HETATM 10211 C  "C4'" . D3T O 7 .   ? 119.560 -17.832 -10.343 1.00 11.06 ? 880  D3T D "C4'" 1 
HETATM 10212 O  "O4'" . D3T O 7 .   ? 120.572 -17.774 -11.362 1.00 9.14  ? 880  D3T D "O4'" 1 
HETATM 10213 C  "C1'" . D3T O 7 .   ? 121.348 -16.582 -11.139 1.00 10.48 ? 880  D3T D "C1'" 1 
HETATM 10214 N  N1    . D3T O 7 .   ? 121.154 -15.655 -12.276 1.00 10.77 ? 880  D3T D N1    1 
HETATM 10215 C  C6    . D3T O 7 .   ? 120.053 -15.781 -13.132 1.00 11.88 ? 880  D3T D C6    1 
HETATM 10216 C  C2    . D3T O 7 .   ? 122.058 -14.601 -12.450 1.00 10.77 ? 880  D3T D C2    1 
HETATM 10217 O  O2    . D3T O 7 .   ? 123.050 -14.520 -11.726 1.00 10.31 ? 880  D3T D O2    1 
HETATM 10218 N  N3    . D3T O 7 .   ? 121.845 -13.665 -13.467 1.00 11.28 ? 880  D3T D N3    1 
HETATM 10219 C  C4    . D3T O 7 .   ? 120.735 -13.792 -14.312 1.00 13.61 ? 880  D3T D C4    1 
HETATM 10220 O  O4    . D3T O 7 .   ? 120.535 -12.952 -15.185 1.00 13.96 ? 880  D3T D O4    1 
HETATM 10221 C  C5    . D3T O 7 .   ? 119.849 -14.852 -14.146 1.00 13.08 ? 880  D3T D C5    1 
HETATM 10222 C  C5M   . D3T O 7 .   ? 118.663 -15.009 -15.100 1.00 12.16 ? 880  D3T D C5M   1 
HETATM 10223 C  "C2'" . D3T O 7 .   ? 120.764 -15.945 -9.874  1.00 10.40 ? 880  D3T D "C2'" 1 
HETATM 10224 C  "C3'" . D3T O 7 .   ? 119.302 -16.365 -10.004 1.00 10.61 ? 880  D3T D "C3'" 1 
HETATM 10225 O  O3A   . D3T O 7 .   ? 116.268 -16.123 -11.263 1.00 12.10 ? 880  D3T D O3A   1 
HETATM 10226 P  PB    . D3T O 7 .   ? 115.190 -15.880 -10.088 1.00 11.78 ? 880  D3T D PB    1 
HETATM 10227 O  O1B   . D3T O 7 .   ? 114.875 -17.285 -9.371  1.00 11.61 ? 880  D3T D O1B   1 
HETATM 10228 O  O2B   . D3T O 7 .   ? 115.681 -14.867 -9.127  1.00 12.06 ? 880  D3T D O2B   1 
HETATM 10229 O  O3B   . D3T O 7 .   ? 113.858 -15.352 -10.827 1.00 14.11 ? 880  D3T D O3B   1 
HETATM 10230 P  PG    . D3T O 7 .   ? 112.435 -16.106 -10.911 1.00 14.21 ? 880  D3T D PG    1 
HETATM 10231 O  O1G   . D3T O 7 .   ? 111.780 -15.858 -12.214 1.00 15.05 ? 880  D3T D O1G   1 
HETATM 10232 O  O2G   . D3T O 7 .   ? 112.668 -17.672 -10.621 1.00 13.27 ? 880  D3T D O2G   1 
HETATM 10233 O  O3G   . D3T O 7 .   ? 111.568 -15.534 -9.682  1.00 12.61 ? 880  D3T D O3G   1 
HETATM 10234 O  O     . HOH P 8 .   ? 122.419 -23.189 -17.888 1.00 9.69  ? 17   HOH E O     1 
HETATM 10235 O  O     . HOH P 8 .   ? 129.219 -14.422 -24.986 1.00 22.64 ? 60   HOH E O     1 
HETATM 10236 O  O     . HOH P 8 .   ? 115.635 -17.745 -26.741 1.00 18.49 ? 70   HOH E O     1 
HETATM 10237 O  O     . HOH P 8 .   ? 126.816 -18.831 -32.421 1.00 19.05 ? 78   HOH E O     1 
HETATM 10238 O  O     . HOH P 8 .   ? 132.193 -16.496 -33.862 1.00 25.82 ? 130  HOH E O     1 
HETATM 10239 O  O     . HOH P 8 .   ? 127.174 -11.478 -28.151 1.00 33.04 ? 139  HOH E O     1 
HETATM 10240 O  O     . HOH P 8 .   ? 121.799 -14.406 -18.749 1.00 15.56 ? 159  HOH E O     1 
HETATM 10241 O  O     . HOH P 8 .   ? 117.453 -15.712 -26.387 1.00 18.60 ? 167  HOH E O     1 
HETATM 10242 O  O     . HOH P 8 .   ? 120.707 -15.604 -24.351 1.00 16.44 ? 170  HOH E O     1 
HETATM 10243 O  O     . HOH P 8 .   ? 132.298 -17.225 -24.649 1.00 27.35 ? 244  HOH E O     1 
HETATM 10244 O  O     . HOH P 8 .   ? 131.674 -15.026 -26.219 1.00 34.14 ? 255  HOH E O     1 
HETATM 10245 O  O     . HOH P 8 .   ? 115.706 -15.498 -17.606 1.00 22.91 ? 257  HOH E O     1 
HETATM 10246 O  O     . HOH P 8 .   ? 130.419 -12.077 -28.128 1.00 24.56 ? 265  HOH E O     1 
HETATM 10247 O  O     . HOH P 8 .   ? 114.388 -22.363 -18.251 1.00 24.60 ? 274  HOH E O     1 
HETATM 10248 O  O     . HOH P 8 .   ? 126.255 -14.331 -22.890 1.00 25.12 ? 289  HOH E O     1 
HETATM 10249 O  O     . HOH P 8 .   ? 117.965 -18.226 -30.529 1.00 28.14 ? 295  HOH E O     1 
HETATM 10250 O  O     . HOH P 8 .   ? 134.782 -16.109 -34.220 1.00 24.68 ? 316  HOH E O     1 
HETATM 10251 O  O     . HOH P 8 .   ? 124.234 -13.159 -27.532 1.00 27.51 ? 319  HOH E O     1 
HETATM 10252 O  O     . HOH P 8 .   ? 134.455 -10.069 -33.665 1.00 28.14 ? 364  HOH E O     1 
HETATM 10253 O  O     . HOH P 8 .   ? 134.100 -21.112 -25.825 1.00 36.20 ? 391  HOH E O     1 
HETATM 10254 O  O     . HOH P 8 .   ? 128.816 -15.407 -35.252 1.00 22.29 ? 434  HOH E O     1 
HETATM 10255 O  O     . HOH P 8 .   ? 134.987 -18.697 -25.848 1.00 28.00 ? 439  HOH E O     1 
HETATM 10256 O  O     . HOH P 8 .   ? 135.910 -24.413 -29.007 1.00 28.62 ? 464  HOH E O     1 
HETATM 10257 O  O     . HOH P 8 .   ? 112.919 -18.214 -17.949 1.00 29.49 ? 496  HOH E O     1 
HETATM 10258 O  O     . HOH P 8 .   ? 123.964 -12.692 -19.385 1.00 39.72 ? 511  HOH E O     1 
HETATM 10259 O  O     . HOH P 8 .   ? 135.357 -23.477 -25.432 1.00 39.60 ? 582  HOH E O     1 
HETATM 10260 O  O     . HOH P 8 .   ? 140.477 -17.964 -33.518 1.00 37.57 ? 617  HOH E O     1 
HETATM 10261 O  O     . HOH P 8 .   ? 135.746 -14.223 -27.037 1.00 40.27 ? 752  HOH E O     1 
HETATM 10262 O  O     . HOH Q 8 .   ? 125.647 -22.290 -14.275 1.00 9.85  ? 13   HOH F O     1 
HETATM 10263 O  O     . HOH Q 8 .   ? 124.824 -24.030 -19.265 1.00 9.71  ? 14   HOH F O     1 
HETATM 10264 O  O     . HOH Q 8 .   ? 124.653 -24.588 -26.942 1.00 18.31 ? 15   HOH F O     1 
HETATM 10265 O  O     . HOH Q 8 .   ? 131.353 -27.888 -26.262 1.00 19.91 ? 16   HOH F O     1 
HETATM 10266 O  O     . HOH Q 8 .   ? 135.109 -24.211 -13.473 1.00 15.06 ? 17   HOH F O     1 
HETATM 10267 O  O     . HOH Q 8 .   ? 131.526 -19.206 -16.193 1.00 12.86 ? 18   HOH F O     1 
HETATM 10268 O  O     . HOH Q 8 .   ? 130.205 -16.926 -19.229 1.00 24.75 ? 19   HOH F O     1 
HETATM 10269 O  O     . HOH Q 8 .   ? 134.973 -12.258 -10.860 1.00 16.09 ? 20   HOH F O     1 
HETATM 10270 O  O     . HOH Q 8 .   ? 132.333 -25.126 -21.675 1.00 16.53 ? 21   HOH F O     1 
HETATM 10271 O  O     . HOH Q 8 .   ? 132.013 -29.494 -19.580 1.00 17.66 ? 22   HOH F O     1 
HETATM 10272 O  O     . HOH Q 8 .   ? 135.050 -13.944 -13.036 1.00 13.26 ? 23   HOH F O     1 
HETATM 10273 O  O     . HOH Q 8 .   ? 132.217 -16.675 -15.164 1.00 18.75 ? 24   HOH F O     1 
HETATM 10274 O  O     . HOH Q 8 .   ? 132.143 -29.166 -22.250 1.00 21.13 ? 25   HOH F O     1 
HETATM 10275 O  O     . HOH Q 8 .   ? 129.389 -14.945 -17.358 1.00 23.30 ? 26   HOH F O     1 
HETATM 10276 O  O     . HOH Q 8 .   ? 132.413 -19.982 -18.489 1.00 24.77 ? 27   HOH F O     1 
HETATM 10277 O  O     . HOH Q 8 .   ? 130.709 -18.090 -22.393 1.00 22.07 ? 28   HOH F O     1 
HETATM 10278 O  O     . HOH Q 8 .   ? 125.298 -7.769  -17.704 1.00 33.57 ? 29   HOH F O     1 
HETATM 10279 O  O     . HOH Q 8 .   ? 126.883 -20.301 -42.410 1.00 22.85 ? 30   HOH F O     1 
HETATM 10280 O  O     . HOH Q 8 .   ? 131.010 -31.805 -24.720 1.00 26.87 ? 31   HOH F O     1 
HETATM 10281 O  O     . HOH Q 8 .   ? 131.233 -20.316 -21.007 1.00 26.09 ? 32   HOH F O     1 
HETATM 10282 O  O     . HOH Q 8 .   ? 134.715 -29.357 -19.081 1.00 28.41 ? 33   HOH F O     1 
HETATM 10283 O  O     . HOH Q 8 .   ? 134.815 -17.502 -36.659 1.00 30.59 ? 34   HOH F O     1 
HETATM 10284 O  O     . HOH Q 8 .   ? 133.549 -26.970 -22.862 1.00 29.90 ? 35   HOH F O     1 
HETATM 10285 O  O     . HOH Q 8 .   ? 127.398 -14.540 -19.369 1.00 26.36 ? 36   HOH F O     1 
HETATM 10286 O  O     . HOH Q 8 .   ? 126.430 -30.433 -33.938 1.00 30.92 ? 37   HOH F O     1 
HETATM 10287 O  O     . HOH Q 8 .   ? 128.343 -6.178  -16.884 1.00 27.17 ? 38   HOH F O     1 
HETATM 10288 O  O     . HOH Q 8 .   ? 137.117 -6.628  -17.928 1.00 42.66 ? 39   HOH F O     1 
HETATM 10289 O  O     . HOH Q 8 .   ? 130.088 -10.833 -15.920 1.00 34.55 ? 40   HOH F O     1 
HETATM 10290 O  O     . HOH Q 8 .   ? 126.855 -11.513 -18.364 1.00 28.97 ? 41   HOH F O     1 
HETATM 10291 O  O     . HOH Q 8 .   ? 134.419 -26.113 -18.627 1.00 28.21 ? 42   HOH F O     1 
HETATM 10292 O  O     . HOH Q 8 .   ? 129.226 -29.472 -35.197 1.00 44.41 ? 43   HOH F O     1 
HETATM 10293 O  O     . HOH Q 8 .   ? 125.710 -22.506 -40.901 1.00 35.54 ? 44   HOH F O     1 
HETATM 10294 O  O     . HOH Q 8 .   ? 133.710 -25.700 -27.913 1.00 40.37 ? 45   HOH F O     1 
HETATM 10295 O  O     . HOH Q 8 .   ? 133.175 -23.205 -18.518 1.00 35.42 ? 46   HOH F O     1 
HETATM 10296 O  O     . HOH Q 8 .   ? 135.271 -20.181 -14.373 1.00 32.79 ? 47   HOH F O     1 
HETATM 10297 O  O     . HOH Q 8 .   ? 130.613 -28.380 -31.048 1.00 41.43 ? 48   HOH F O     1 
HETATM 10298 O  O     . HOH Q 8 .   ? 133.488 -8.318  -15.697 1.00 37.29 ? 49   HOH F O     1 
HETATM 10299 O  O     . HOH Q 8 .   ? 133.928 -26.232 -31.912 1.00 30.08 ? 50   HOH F O     1 
HETATM 10300 O  O     . HOH Q 8 .   ? 133.647 -18.693 -45.069 1.00 45.49 ? 51   HOH F O     1 
HETATM 10301 O  O     . HOH R 8 .   ? 120.665 -32.597 40.704  1.00 11.97 ? 11   HOH B O     1 
HETATM 10302 O  O     . HOH R 8 .   ? 113.162 -27.673 51.695  1.00 23.79 ? 113  HOH B O     1 
HETATM 10303 O  O     . HOH R 8 .   ? 109.935 -22.018 50.103  1.00 31.72 ? 125  HOH B O     1 
HETATM 10304 O  O     . HOH R 8 .   ? 117.716 -27.073 51.782  1.00 23.43 ? 166  HOH B O     1 
HETATM 10305 O  O     . HOH R 8 .   ? 120.202 -23.762 41.905  1.00 19.23 ? 176  HOH B O     1 
HETATM 10306 O  O     . HOH R 8 .   ? 103.773 -33.728 36.281  1.00 21.82 ? 206  HOH B O     1 
HETATM 10307 O  O     . HOH R 8 .   ? 125.324 -31.880 47.078  1.00 32.19 ? 225  HOH B O     1 
HETATM 10308 O  O     . HOH R 8 .   ? 127.394 -28.269 45.294  1.00 23.61 ? 239  HOH B O     1 
HETATM 10309 O  O     . HOH R 8 .   ? 109.020 -26.781 36.875  1.00 27.58 ? 247  HOH B O     1 
HETATM 10310 O  O     . HOH R 8 .   ? 116.700 -25.236 49.858  1.00 27.44 ? 249  HOH B O     1 
HETATM 10311 O  O     . HOH R 8 .   ? 110.846 -23.991 39.521  1.00 26.90 ? 269  HOH B O     1 
HETATM 10312 O  O     . HOH R 8 .   ? 107.120 -30.437 36.026  1.00 30.50 ? 310  HOH B O     1 
HETATM 10313 O  O     . HOH R 8 .   ? 102.018 -25.949 42.866  1.00 30.03 ? 318  HOH B O     1 
HETATM 10314 O  O     . HOH R 8 .   ? 116.307 -25.233 46.042  1.00 33.95 ? 333  HOH B O     1 
HETATM 10315 O  O     . HOH R 8 .   ? 114.111 -23.821 40.725  1.00 31.21 ? 334  HOH B O     1 
HETATM 10316 O  O     . HOH R 8 .   ? 106.459 -28.403 46.040  1.00 23.64 ? 357  HOH B O     1 
HETATM 10317 O  O     . HOH R 8 .   ? 99.931  -25.598 40.419  1.00 28.90 ? 410  HOH B O     1 
HETATM 10318 O  O     . HOH R 8 .   ? 105.124 -23.490 35.782  1.00 35.24 ? 412  HOH B O     1 
HETATM 10319 O  O     . HOH R 8 .   ? 108.462 -24.640 38.118  1.00 30.61 ? 421  HOH B O     1 
HETATM 10320 O  O     . HOH R 8 .   ? 106.578 -28.073 35.579  1.00 32.34 ? 433  HOH B O     1 
HETATM 10321 O  O     . HOH R 8 .   ? 102.879 -24.768 46.168  1.00 24.89 ? 444  HOH B O     1 
HETATM 10322 O  O     . HOH R 8 .   ? 124.733 -24.989 45.860  1.00 24.74 ? 502  HOH B O     1 
HETATM 10323 O  O     . HOH R 8 .   ? 97.140  -27.383 36.044  1.00 31.46 ? 512  HOH B O     1 
HETATM 10324 O  O     . HOH R 8 .   ? 107.706 -21.428 40.572  1.00 24.32 ? 535  HOH B O     1 
HETATM 10325 O  O     . HOH R 8 .   ? 106.885 -32.793 34.801  1.00 29.84 ? 573  HOH B O     1 
HETATM 10326 O  O     . HOH R 8 .   ? 113.097 -22.244 46.958  1.00 34.36 ? 575  HOH B O     1 
HETATM 10327 O  O     . HOH R 8 .   ? 104.947 -18.453 39.018  1.00 29.81 ? 586  HOH B O     1 
HETATM 10328 O  O     . HOH R 8 .   ? 102.290 -36.270 37.718  1.00 48.25 ? 637  HOH B O     1 
HETATM 10329 O  O     . HOH R 8 .   ? 118.016 -22.780 49.530  1.00 46.71 ? 647  HOH B O     1 
HETATM 10330 O  O     . HOH R 8 .   ? 111.572 -22.341 44.812  1.00 29.63 ? 660  HOH B O     1 
HETATM 10331 O  O     . HOH S 8 .   ? 121.477 -31.748 35.975  1.00 18.02 ? 35   HOH C O     1 
HETATM 10332 O  O     . HOH S 8 .   ? 116.539 -28.634 32.454  1.00 17.37 ? 42   HOH C O     1 
HETATM 10333 O  O     . HOH S 8 .   ? 118.096 -33.521 39.610  1.00 17.23 ? 82   HOH C O     1 
HETATM 10334 O  O     . HOH S 8 .   ? 112.088 -34.013 44.375  1.00 20.57 ? 89   HOH C O     1 
HETATM 10335 O  O     . HOH S 8 .   ? 113.612 -32.656 32.502  1.00 27.54 ? 149  HOH C O     1 
HETATM 10336 O  O     . HOH S 8 .   ? 116.452 -33.547 27.985  1.00 20.19 ? 181  HOH C O     1 
HETATM 10337 O  O     . HOH S 8 .   ? 98.140  -29.712 51.837  1.00 26.92 ? 196  HOH C O     1 
HETATM 10338 O  O     . HOH S 8 .   ? 118.520 -21.716 26.605  1.00 21.97 ? 205  HOH C O     1 
HETATM 10339 O  O     . HOH S 8 .   ? 116.914 -26.060 31.479  1.00 23.83 ? 215  HOH C O     1 
HETATM 10340 O  O     . HOH S 8 .   ? 109.824 -41.314 41.376  1.00 23.80 ? 246  HOH C O     1 
HETATM 10341 O  O     . HOH S 8 .   ? 100.142 -27.546 44.045  1.00 18.52 ? 262  HOH C O     1 
HETATM 10342 O  O     . HOH S 8 .   ? 111.476 -34.531 35.068  1.00 22.46 ? 277  HOH C O     1 
HETATM 10343 O  O     . HOH S 8 .   ? 108.562 -37.428 38.404  1.00 23.18 ? 306  HOH C O     1 
HETATM 10344 O  O     . HOH S 8 .   ? 113.471 -38.920 33.790  1.00 23.85 ? 358  HOH C O     1 
HETATM 10345 O  O     . HOH S 8 .   ? 98.146  -26.866 41.845  1.00 27.24 ? 380  HOH C O     1 
HETATM 10346 O  O     . HOH S 8 .   ? 116.699 -23.328 27.777  1.00 25.48 ? 384  HOH C O     1 
HETATM 10347 O  O     . HOH S 8 .   ? 116.335 -24.266 37.556  1.00 35.87 ? 404  HOH C O     1 
HETATM 10348 O  O     . HOH S 8 .   ? 115.347 -22.105 30.332  1.00 29.25 ? 414  HOH C O     1 
HETATM 10349 O  O     . HOH S 8 .   ? 105.211 -39.875 46.941  1.00 28.46 ? 441  HOH C O     1 
HETATM 10350 O  O     . HOH S 8 .   ? 116.849 -24.185 34.768  1.00 30.34 ? 454  HOH C O     1 
HETATM 10351 O  O     . HOH S 8 .   ? 95.928  -29.127 53.967  1.00 41.94 ? 494  HOH C O     1 
HETATM 10352 O  O     . HOH S 8 .   ? 105.048 -38.073 41.995  1.00 35.39 ? 495  HOH C O     1 
HETATM 10353 O  O     . HOH S 8 .   ? 91.472  -23.573 43.927  1.00 31.68 ? 501  HOH C O     1 
HETATM 10354 O  O     . HOH S 8 .   ? 115.429 -16.951 33.739  1.00 38.69 ? 543  HOH C O     1 
HETATM 10355 O  O     . HOH S 8 .   ? 117.839 -20.806 37.702  1.00 38.00 ? 553  HOH C O     1 
HETATM 10356 O  O     . HOH S 8 .   ? 114.786 -26.155 35.518  1.00 33.04 ? 565  HOH C O     1 
HETATM 10357 O  O     . HOH S 8 .   ? 110.511 -32.124 34.238  1.00 39.07 ? 595  HOH C O     1 
HETATM 10358 O  O     . HOH S 8 .   ? 114.168 -29.570 33.173  1.00 35.22 ? 596  HOH C O     1 
HETATM 10359 O  O     . HOH S 8 .   ? 115.434 -18.119 31.189  1.00 39.83 ? 609  HOH C O     1 
HETATM 10360 O  O     . HOH S 8 .   ? 91.416  -29.964 44.073  1.00 45.31 ? 640  HOH C O     1 
HETATM 10361 O  O     . HOH S 8 .   ? 117.209 -20.421 33.662  1.00 39.15 ? 656  HOH C O     1 
HETATM 10362 O  O     . HOH S 8 .   ? 111.327 -38.824 35.681  1.00 28.66 ? 668  HOH C O     1 
HETATM 10363 O  O     . HOH S 8 .   ? 93.658  -27.930 53.914  1.00 46.25 ? 683  HOH C O     1 
HETATM 10364 O  O     . HOH S 8 .   ? 109.658 -30.171 35.795  1.00 49.08 ? 685  HOH C O     1 
HETATM 10365 O  O     . HOH S 8 .   ? 95.452  -33.270 46.046  1.00 37.11 ? 693  HOH C O     1 
HETATM 10366 O  O     . HOH S 8 .   ? 111.726 -27.522 36.873  1.00 29.40 ? 694  HOH C O     1 
HETATM 10367 O  O     . HOH S 8 .   ? 106.709 -39.540 40.123  1.00 42.33 ? 713  HOH C O     1 
HETATM 10368 O  O     . HOH S 8 .   ? 109.987 -40.988 37.565  1.00 36.44 ? 716  HOH C O     1 
HETATM 10369 O  O     . HOH S 8 .   ? 117.556 -15.676 35.857  1.00 28.94 ? 719  HOH C O     1 
HETATM 10370 O  O     . HOH S 8 .   ? 92.354  -28.477 51.805  1.00 36.22 ? 737  HOH C O     1 
HETATM 10371 O  O     . HOH S 8 .   ? 115.184 -24.120 32.053  1.00 40.54 ? 749  HOH C O     1 
HETATM 10372 O  O     . HOH S 8 .   ? 100.271 -32.055 51.649  1.00 30.05 ? 758  HOH C O     1 
HETATM 10373 O  O     . HOH T 8 .   ? 121.985 -35.314 46.204  1.00 19.35 ? 882  HOH A O     1 
HETATM 10374 O  O     . HOH T 8 .   ? 122.908 -25.420 27.626  1.00 15.47 ? 883  HOH A O     1 
HETATM 10375 O  O     . HOH T 8 .   ? 125.018 -47.115 51.906  1.00 19.48 ? 884  HOH A O     1 
HETATM 10376 O  O     . HOH T 8 .   ? 142.444 -13.237 27.367  1.00 38.33 ? 885  HOH A O     1 
HETATM 10377 O  O     . HOH T 8 .   ? 128.005 -34.082 35.104  1.00 17.25 ? 886  HOH A O     1 
HETATM 10378 O  O     . HOH T 8 .   ? 121.330 -38.486 30.939  1.00 13.68 ? 887  HOH A O     1 
HETATM 10379 O  O     . HOH T 8 .   ? 118.867 -22.317 46.537  1.00 28.95 ? 888  HOH A O     1 
HETATM 10380 O  O     . HOH T 8 .   ? 115.245 -58.659 38.038  1.00 21.94 ? 889  HOH A O     1 
HETATM 10381 O  O     . HOH T 8 .   ? 125.831 -35.613 35.572  1.00 13.85 ? 890  HOH A O     1 
HETATM 10382 O  O     . HOH T 8 .   ? 114.195 -56.232 12.749  1.00 30.14 ? 891  HOH A O     1 
HETATM 10383 O  O     . HOH T 8 .   ? 128.176 -31.331 34.208  1.00 15.93 ? 892  HOH A O     1 
HETATM 10384 O  O     . HOH T 8 .   ? 120.381 -34.302 35.827  1.00 11.32 ? 893  HOH A O     1 
HETATM 10385 O  O     . HOH T 8 .   ? 125.816 -25.349 33.976  1.00 16.93 ? 894  HOH A O     1 
HETATM 10386 O  O     . HOH T 8 .   ? 119.148 -35.476 37.967  1.00 14.09 ? 895  HOH A O     1 
HETATM 10387 O  O     . HOH T 8 .   ? 134.936 -9.612  40.253  1.00 44.05 ? 896  HOH A O     1 
HETATM 10388 O  O     . HOH T 8 .   ? 112.084 -19.465 10.877  1.00 52.82 ? 897  HOH A O     1 
HETATM 10389 O  O     . HOH T 8 .   ? 120.828 -45.996 44.887  1.00 17.14 ? 898  HOH A O     1 
HETATM 10390 O  O     . HOH T 8 .   ? 118.439 -39.667 21.386  1.00 23.48 ? 899  HOH A O     1 
HETATM 10391 O  O     . HOH T 8 .   ? 119.153 -55.438 23.801  1.00 18.60 ? 900  HOH A O     1 
HETATM 10392 O  O     . HOH T 8 .   ? 118.279 -54.069 48.355  1.00 16.92 ? 901  HOH A O     1 
HETATM 10393 O  O     . HOH T 8 .   ? 115.330 -54.807 28.738  1.00 22.36 ? 902  HOH A O     1 
HETATM 10394 O  O     . HOH T 8 .   ? 115.719 -48.846 27.382  1.00 21.96 ? 903  HOH A O     1 
HETATM 10395 O  O     . HOH T 8 .   ? 122.875 -46.602 30.218  1.00 19.29 ? 904  HOH A O     1 
HETATM 10396 O  O     . HOH T 8 .   ? 124.396 -58.929 35.376  1.00 22.15 ? 905  HOH A O     1 
HETATM 10397 O  O     . HOH T 8 .   ? 126.292 -52.234 30.399  1.00 29.48 ? 906  HOH A O     1 
HETATM 10398 O  O     . HOH T 8 .   ? 111.324 -50.918 19.690  1.00 20.47 ? 907  HOH A O     1 
HETATM 10399 O  O     . HOH T 8 .   ? 129.351 -30.088 36.283  1.00 20.37 ? 908  HOH A O     1 
HETATM 10400 O  O     . HOH T 8 .   ? 113.472 -50.933 22.907  1.00 22.44 ? 909  HOH A O     1 
HETATM 10401 O  O     . HOH T 8 .   ? 117.665 -25.411 18.696  1.00 23.66 ? 910  HOH A O     1 
HETATM 10402 O  O     . HOH T 8 .   ? 116.966 -47.943 60.814  1.00 20.34 ? 911  HOH A O     1 
HETATM 10403 O  O     . HOH T 8 .   ? 112.050 -48.836 60.861  1.00 19.04 ? 912  HOH A O     1 
HETATM 10404 O  O     . HOH T 8 .   ? 124.787 -39.213 30.227  1.00 15.33 ? 913  HOH A O     1 
HETATM 10405 O  O     . HOH T 8 .   ? 123.496 -46.350 44.495  1.00 18.87 ? 914  HOH A O     1 
HETATM 10406 O  O     . HOH T 8 .   ? 126.776 -65.433 34.174  1.00 22.60 ? 915  HOH A O     1 
HETATM 10407 O  O     . HOH T 8 .   ? 119.781 -47.884 31.875  1.00 19.54 ? 916  HOH A O     1 
HETATM 10408 O  O     . HOH T 8 .   ? 99.784  -4.691  42.186  1.00 23.15 ? 917  HOH A O     1 
HETATM 10409 O  O     . HOH T 8 .   ? 108.379 -49.429 37.022  1.00 19.91 ? 918  HOH A O     1 
HETATM 10410 O  O     . HOH T 8 .   ? 117.860 -56.110 26.151  1.00 23.16 ? 919  HOH A O     1 
HETATM 10411 O  O     . HOH T 8 .   ? 124.459 -67.425 38.493  1.00 23.30 ? 920  HOH A O     1 
HETATM 10412 O  O     . HOH T 8 .   ? 121.800 -42.293 61.058  1.00 21.93 ? 921  HOH A O     1 
HETATM 10413 O  O     . HOH T 8 .   ? 120.695 -69.346 37.151  1.00 23.88 ? 922  HOH A O     1 
HETATM 10414 O  O     . HOH T 8 .   ? 126.584 -36.133 21.849  1.00 25.12 ? 923  HOH A O     1 
HETATM 10415 O  O     . HOH T 8 .   ? 96.770  -26.089 53.795  1.00 26.82 ? 924  HOH A O     1 
HETATM 10416 O  O     . HOH T 8 .   ? 100.754 -4.889  39.828  1.00 19.27 ? 925  HOH A O     1 
HETATM 10417 O  O     . HOH T 8 .   ? 114.733 -41.374 33.533  1.00 21.57 ? 926  HOH A O     1 
HETATM 10418 O  O     . HOH T 8 .   ? 125.418 -36.969 24.317  1.00 22.05 ? 927  HOH A O     1 
HETATM 10419 O  O     . HOH T 8 .   ? 116.865 -19.340 9.508   1.00 24.45 ? 928  HOH A O     1 
HETATM 10420 O  O     . HOH T 8 .   ? 104.985 -31.330 48.519  1.00 28.51 ? 929  HOH A O     1 
HETATM 10421 O  O     . HOH T 8 .   ? 120.567 -45.192 30.970  1.00 15.16 ? 930  HOH A O     1 
HETATM 10422 O  O     . HOH T 8 .   ? 123.782 -20.226 28.978  1.00 20.03 ? 931  HOH A O     1 
HETATM 10423 O  O     . HOH T 8 .   ? 115.494 -22.418 21.059  1.00 22.11 ? 932  HOH A O     1 
HETATM 10424 O  O     . HOH T 8 .   ? 133.618 -28.531 46.524  1.00 25.31 ? 933  HOH A O     1 
HETATM 10425 O  O     . HOH T 8 .   ? 112.757 -52.804 64.131  1.00 20.49 ? 934  HOH A O     1 
HETATM 10426 O  O     . HOH T 8 .   ? 130.022 -56.000 29.517  1.00 23.06 ? 935  HOH A O     1 
HETATM 10427 O  O     . HOH T 8 .   ? 129.931 -27.727 46.528  1.00 25.65 ? 936  HOH A O     1 
HETATM 10428 O  O     . HOH T 8 .   ? 108.627 -42.014 46.030  1.00 26.65 ? 937  HOH A O     1 
HETATM 10429 O  O     . HOH T 8 .   ? 101.545 -22.706 47.011  1.00 21.05 ? 938  HOH A O     1 
HETATM 10430 O  O     . HOH T 8 .   ? 137.968 -28.645 40.028  1.00 23.49 ? 939  HOH A O     1 
HETATM 10431 O  O     . HOH T 8 .   ? 113.802 -35.997 45.057  1.00 19.69 ? 940  HOH A O     1 
HETATM 10432 O  O     . HOH T 8 .   ? 113.053 -38.643 44.674  1.00 25.09 ? 941  HOH A O     1 
HETATM 10433 O  O     . HOH T 8 .   ? 125.155 -36.742 14.757  1.00 23.28 ? 942  HOH A O     1 
HETATM 10434 O  O     . HOH T 8 .   ? 128.731 -32.942 51.545  1.00 30.93 ? 943  HOH A O     1 
HETATM 10435 O  O     . HOH T 8 .   ? 131.218 -34.757 17.758  1.00 27.34 ? 944  HOH A O     1 
HETATM 10436 O  O     . HOH T 8 .   ? 126.299 -22.404 7.708   1.00 19.30 ? 945  HOH A O     1 
HETATM 10437 O  O     . HOH T 8 .   ? 116.473 -42.132 26.409  1.00 21.94 ? 946  HOH A O     1 
HETATM 10438 O  O     . HOH T 8 .   ? 126.102 -32.509 54.793  1.00 29.48 ? 947  HOH A O     1 
HETATM 10439 O  O     . HOH T 8 .   ? 102.318 -12.138 41.883  1.00 30.84 ? 948  HOH A O     1 
HETATM 10440 O  O     . HOH T 8 .   ? 123.701 -9.490  29.846  1.00 30.66 ? 949  HOH A O     1 
HETATM 10441 O  O     . HOH T 8 .   ? 115.172 -31.398 59.861  1.00 25.15 ? 950  HOH A O     1 
HETATM 10442 O  O     . HOH T 8 .   ? 117.890 -54.197 28.071  1.00 33.95 ? 951  HOH A O     1 
H