data_2HJ8
# 
_entry.id   2HJ8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2HJ8         pdb_00002hj8 10.2210/pdb2hj8/pdb 
RCSB  RCSB038404   ?            ?                   
WWPDB D_1000038404 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
TargetDB HR2873B .                                                                                     unspecified 
PDB      1Z2M    'Crystal Structure of ISG15, the Interferon-Induced Ubiquitin Cross Reactive Protein' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HJ8 
_pdbx_database_status.recvd_initial_deposition_date   2006-06-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Aramini, J.M.'                                   1  
'Ho, C.K.'                                        2  
'Yin, C.'                                         3  
'Cunningham, K.'                                  4  
'Janjua, H.'                                      5  
'Ma, L.-C.'                                       6  
'Xiao, R.'                                        7  
'Acton, T.B.'                                     8  
'Montelione, G.T.'                                9  
'Northeast Structural Genomics Consortium (NESG)' 10 
# 
_citation.id                        primary 
_citation.title                     
;Solution NMR structure of the C-terminal domain of the interferon alpha-inducible ISG15 protein from Homo sapiens.  Northeast Structural Genomics target HR2873B.
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Aramini, J.M.'    1 ? 
primary 'Ho, C.K.'         2 ? 
primary 'Yin, C.'          3 ? 
primary 'Cunningham, K.'   4 ? 
primary 'Janjua, H.'       5 ? 
primary 'Li, M.-C.'        6 ? 
primary 'Xiao, R.'         7 ? 
primary 'Acton, T.B.'      8 ? 
primary 'Montelione, G.T.' 9 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Interferon-induced 17 kDa protein' 
_entity.formula_weight             10113.471 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'ISG15 C-terminal domain (8.9 kDa), Ubiquitin-like 2' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'hUCRP, Interferon-induced 15 kDa protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG
LEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG
LEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         HR2873B 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ASP n 
1 3  GLU n 
1 4  PRO n 
1 5  LEU n 
1 6  SER n 
1 7  ILE n 
1 8  LEU n 
1 9  VAL n 
1 10 ARG n 
1 11 ASN n 
1 12 ASN n 
1 13 LYS n 
1 14 GLY n 
1 15 ARG n 
1 16 SER n 
1 17 SER n 
1 18 THR n 
1 19 TYR n 
1 20 GLU n 
1 21 VAL n 
1 22 ARG n 
1 23 LEU n 
1 24 THR n 
1 25 GLN n 
1 26 THR n 
1 27 VAL n 
1 28 ALA n 
1 29 HIS n 
1 30 LEU n 
1 31 LYS n 
1 32 GLN n 
1 33 GLN n 
1 34 VAL n 
1 35 SER n 
1 36 GLY n 
1 37 LEU n 
1 38 GLU n 
1 39 GLY n 
1 40 VAL n 
1 41 GLN n 
1 42 ASP n 
1 43 ASP n 
1 44 LEU n 
1 45 PHE n 
1 46 TRP n 
1 47 LEU n 
1 48 THR n 
1 49 PHE n 
1 50 GLU n 
1 51 GLY n 
1 52 LYS n 
1 53 PRO n 
1 54 LEU n 
1 55 GLU n 
1 56 ASP n 
1 57 GLN n 
1 58 LEU n 
1 59 PRO n 
1 60 LEU n 
1 61 GLY n 
1 62 GLU n 
1 63 TYR n 
1 64 GLY n 
1 65 LEU n 
1 66 LYS n 
1 67 PRO n 
1 68 LEU n 
1 69 SER n 
1 70 THR n 
1 71 VAL n 
1 72 PHE n 
1 73 MET n 
1 74 ASN n 
1 75 LEU n 
1 76 ARG n 
1 77 LEU n 
1 78 ARG n 
1 79 GLY n 
1 80 GLY n 
1 81 LEU n 
1 82 GLU n 
1 83 HIS n 
1 84 HIS n 
1 85 HIS n 
1 86 HIS n 
1 87 HIS n 
1 88 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'ISG15, G1P2, UCRP' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)MGK' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PET21 
_entity_src_gen.pdbx_host_org_vector               plasmid 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       HR2873B-21.1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    UCRP_HUMAN 
_struct_ref.pdbx_db_accession          P05161 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           78 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2HJ8 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 80 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P05161 
_struct_ref_seq.db_align_beg                  78 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  156 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       86 
_struct_ref_seq.pdbx_auth_seq_align_end       164 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2HJ8 MET A 1  ? UNP P05161 ? ? 'cloning artifact' 85  1 
1 2HJ8 LEU A 81 ? UNP P05161 ? ? 'cloning artifact' 165 2 
1 2HJ8 GLU A 82 ? UNP P05161 ? ? 'cloning artifact' 166 3 
1 2HJ8 HIS A 83 ? UNP P05161 ? ? 'expression tag'   167 4 
1 2HJ8 HIS A 84 ? UNP P05161 ? ? 'expression tag'   168 5 
1 2HJ8 HIS A 85 ? UNP P05161 ? ? 'expression tag'   169 6 
1 2HJ8 HIS A 86 ? UNP P05161 ? ? 'expression tag'   170 7 
1 2HJ8 HIS A 87 ? UNP P05161 ? ? 'expression tag'   171 8 
1 2HJ8 HIS A 88 ? UNP P05161 ? ? 'expression tag'   172 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY                                                          1 
2 1 3D_13C-separated_NOESY                                                          1 
3 1 HNHA                                                                            1 
4 1 'high resolution 2D CH-HSQC (for stereospecific assignment of Val/Leu methyls)' 2 
5 1 '2D 15N,1H heteronuclear NOE'                                                   1 
6 1 '3D TR backbone expts'                                                          1 
7 1 '3D HCCH-COSY, 3D HCCH-TOCSYs'                                                  1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '50 mM ammonium citrate, 5 mM CaCl2' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '0.81 mM U-13C,15N HR2873B, 50 mM ammonium citrate, 5 mM CaCl2, 1x protease inhibitor, 0.02% NaN3, pH 6.5, 5% D2O / 95% H2O'   
'5% D2O / 95% H2O' 
2 '0.9 mM 5%-13C,U-15N HR2873B, 50 mM ammonium citrate, 5 mM CaCl2, 1x protease inhibitor, 0.02% NaN3, pH 6.5, 5% D2O / 95% H2O' 
'5% D2O / 95% H2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 AVANCE Bruker 600 ? 
2 INOVA  Varian 600 ? 
# 
_pdbx_nmr_refine.entry_id           2HJ8 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
;THE STRUCTURES ARE BASED ON A TOTAL OF 976 CONFORMATIONALLY-RESTRICTING NOE-DERIVED DISTANCE CONSTRAINTS, 80 DIHEDRAL ANGLE CONSTRAINTS, AND 40 HYDROGEN       BOND CONSTRAINTS (14.6 CONSTRAINTS PER RESIDUE, 4.8 LONG RANGE CONSTRAINTS PER RESIDUE, COMPUTED FOR RESIDUES 86 to 160 BY PSVS 1.3). STRUCTURE DETERMINATION WAS PERFORMED ITERATIVELY USING AUTOSTRUCTURE (XPLOR-NIH). AFTER A FINAL XPLOR                         
CALCULATION USING THE CONSTRAINTS DERIVED FROM                   
AUTOSTRUCTURE, THE 20 LOWEST ENERGY STRUCTURES OUT OF 100 WERE FURTHER REFINED BY RESTRAINED MOLECULAR DYANMICS/ENERGY MINIMIZATION IN EXPLICIT WATER (CNS). THE N-TERMINAL MET AND UNSTRUCTURED C-TERMINUS OF THE PROTEIN (LRGG + LEHHHHHH TAG) WERE INCLUDED IN ALL STRUCTURE CALCULATIONS BUT HAVE BEEN OMITTED FROM THIS DEPOSITION.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2HJ8 
_pdbx_nmr_details.text       
;THE STRUCTURE WAS DETERMINED USING TRIPLE RESONANCE NMR        
SPECTROSCOPY. AUTOMATED BACKBONE ASSIGNMENTS WERE MADE USING AUTOASSIGN, AND THE SIDE CHAIN ASSIGNMENTS WERE COMPLETED MANUALLY. AUTOMATIC NOESY ASSIGNMENTS AS WELL AS DISTANCE AND HYDROGEN BOND CONSTRAINTS WERE DETERMINED USING AUTOSTRUCTURE. DIHEDRAL        
ANGLE CONSTRAINTS WERE DETERMINED USING HYPER.           COMPLETENESS OF NMR ASSIGNMENTS (EXCLUDING N-TERMINAL MET AND C-TERMINAL HHHHHH):        
BACKBONE, 99.8%, SIDE CHAIN, 95.3%, AROMATICS, 100%,                  
STEREOSPECIFIC METHYL, 95.2%. FINAL STRUCTURE QUALITY FACTORS (FOR RESIDUES 86 TO 160, PSVS 1.3), WHERE ORDERED RESIDUES             
[S(PHI) + S(PSI) > 1.8] COMPRISE 89-94,100-108,111-124,126-132,135-136,139-158: (A) RMSD (ORDERED RESIDUES): BB, 0.6, HEAVY ATOM, 1.1. (B) RAMACHANDRAN STATISTICS FOR ORDERED RESIDUES:          
MOST FAVORED, 86.7%, ADDITIONALLY ALLOWED, 12.7%, GENEROUSLY ALLOWED, 0.6%, DISALLOWED, 0.0%. (C) PROCHECK SCORES FOR ORDERED RESIDUES (RAW/Z-): PHI-PSI, -0.60/-2.05, ALL, -0.44/-2.60. (D) MOLPROBITY CLASH SCORE (RAW/Z-): 28.41/-3.35. (E) RPF SCORES FOR GOODNESS OF FIT TO NOESY DATA (ALL RESIDUES): RECALL, 0.978, PRECISION, 0.910, F-MEASURE, 0.943, DP-SCORE, 0.811.
;
# 
_pdbx_nmr_ensemble.entry_id                                      2HJ8 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with lowest conformational energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2HJ8 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection      XwinNMR       3.5pl6 Bruker 1  
collection      VNMR          6.1C   Varian 2  
'data analysis' AutoAssign    2.2.1  'Zimmerman, Moseley, Montelione' 3  
'data analysis' Sparky        3.110  'Goddard & Kneller' 4  
refinement      AutoStructure 2.1.1  'Huang & Montelione' 5  
refinement      XPLOR-NIH     2.11.2 'Clore et al' 6  
processing      NMRPipe       2.3    'Delaglio et al' 7  
'data analysis' PdbStat       4.1    'Tejero & Montelione' 8  
'data analysis' PSVS          1.3    'Bhattacharya, Hang, Montelione' 9  
refinement      CNS           1.1    
BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE-KUNSTLEVE,JIANG,KUSZEWSKI,NILGES,PANNU,READ,RICE,SIMONSON,WARREN 10 
# 
_exptl.entry_id          2HJ8 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2HJ8 
_struct.title                     
;Solution NMR structure of the C-terminal domain of the interferon alpha-inducible ISG15 protein from Homo sapiens. Northeast Structural Genomics target HR2873B
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HJ8 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
'HR2873B, human ISG15, Northeast Structural Genomics Consortium, Protein Structure Initiative, NESG, PSI-1, SIGNALING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 26 ? GLU A 38 ? THR A 110 GLU A 122 1 ? 13 
HELX_P HELX_P2 2 PRO A 59 ? LEU A 65 ? PRO A 143 LEU A 149 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 16 ? ARG A 22 ? SER A 100 ARG A 106 
A 2 PRO A 4  ? ASN A 11 ? PRO A 88  ASN A 95  
A 3 THR A 70 ? LEU A 75 ? THR A 154 LEU A 159 
A 4 PHE A 45 ? THR A 48 ? PHE A 129 THR A 132 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER A 17 ? O SER A 101 N VAL A 9  ? N VAL A 93  
A 2 3 N ARG A 10 ? N ARG A 94  O MET A 73 ? O MET A 157 
A 3 4 O ASN A 74 ? O ASN A 158 N TRP A 46 ? N TRP A 130 
# 
_database_PDB_matrix.entry_id          2HJ8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HJ8 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ASP A 1 2  ? 13.434  -12.327 1.210   1.00 0.00 ? 86  ASP A N    1  
ATOM 2     C CA   . ASP A 1 2  ? 14.004  -12.413 -0.133  1.00 0.00 ? 86  ASP A CA   1  
ATOM 3     C C    . ASP A 1 2  ? 12.954  -12.142 -1.207  1.00 0.00 ? 86  ASP A C    1  
ATOM 4     O O    . ASP A 1 2  ? 13.198  -12.364 -2.393  1.00 0.00 ? 86  ASP A O    1  
ATOM 5     C CB   . ASP A 1 2  ? 14.632  -13.794 -0.363  1.00 0.00 ? 86  ASP A CB   1  
ATOM 6     C CG   . ASP A 1 2  ? 13.605  -14.878 -0.636  1.00 0.00 ? 86  ASP A CG   1  
ATOM 7     O OD1  . ASP A 1 2  ? 12.699  -15.074 0.199   1.00 0.00 ? 86  ASP A OD1  1  
ATOM 8     O OD2  . ASP A 1 2  ? 13.710  -15.554 -1.680  1.00 0.00 ? 86  ASP A OD2  1  
ATOM 9     H H    . ASP A 1 2  ? 12.964  -13.108 1.581   1.00 0.00 ? 86  ASP A H    1  
ATOM 10    H HA   . ASP A 1 2  ? 14.778  -11.662 -0.211  1.00 0.00 ? 86  ASP A HA   1  
ATOM 11    H HB2  . ASP A 1 2  ? 15.297  -13.739 -1.211  1.00 0.00 ? 86  ASP A HB2  1  
ATOM 12    H HB3  . ASP A 1 2  ? 15.198  -14.074 0.514   1.00 0.00 ? 86  ASP A HB3  1  
ATOM 13    N N    . GLU A 1 3  ? 11.795  -11.648 -0.795  1.00 0.00 ? 87  GLU A N    1  
ATOM 14    C CA   . GLU A 1 3  ? 10.720  -11.350 -1.737  1.00 0.00 ? 87  GLU A CA   1  
ATOM 15    C C    . GLU A 1 3  ? 10.347  -9.862  -1.737  1.00 0.00 ? 87  GLU A C    1  
ATOM 16    O O    . GLU A 1 3  ? 9.325   -9.465  -1.176  1.00 0.00 ? 87  GLU A O    1  
ATOM 17    C CB   . GLU A 1 3  ? 9.486   -12.221 -1.448  1.00 0.00 ? 87  GLU A CB   1  
ATOM 18    C CG   . GLU A 1 3  ? 9.334   -12.665 0.009   1.00 0.00 ? 87  GLU A CG   1  
ATOM 19    C CD   . GLU A 1 3  ? 9.195   -11.514 0.988   1.00 0.00 ? 87  GLU A CD   1  
ATOM 20    O OE1  . GLU A 1 3  ? 8.054   -11.089 1.263   1.00 0.00 ? 87  GLU A OE1  1  
ATOM 21    O OE2  . GLU A 1 3  ? 10.232  -11.048 1.504   1.00 0.00 ? 87  GLU A OE2  1  
ATOM 22    H H    . GLU A 1 3  ? 11.654  -11.474 0.161   1.00 0.00 ? 87  GLU A H    1  
ATOM 23    H HA   . GLU A 1 3  ? 11.088  -11.599 -2.721  1.00 0.00 ? 87  GLU A HA   1  
ATOM 24    H HB2  . GLU A 1 3  ? 8.602   -11.662 -1.719  1.00 0.00 ? 87  GLU A HB2  1  
ATOM 25    H HB3  . GLU A 1 3  ? 9.539   -13.107 -2.065  1.00 0.00 ? 87  GLU A HB3  1  
ATOM 26    H HG2  . GLU A 1 3  ? 8.456   -13.286 0.088   1.00 0.00 ? 87  GLU A HG2  1  
ATOM 27    H HG3  . GLU A 1 3  ? 10.205  -13.245 0.283   1.00 0.00 ? 87  GLU A HG3  1  
ATOM 28    N N    . PRO A 1 4  ? 11.178  -9.011  -2.357  1.00 0.00 ? 88  PRO A N    1  
ATOM 29    C CA   . PRO A 1 4  ? 10.913  -7.588  -2.470  1.00 0.00 ? 88  PRO A CA   1  
ATOM 30    C C    . PRO A 1 4  ? 10.089  -7.266  -3.713  1.00 0.00 ? 88  PRO A C    1  
ATOM 31    O O    . PRO A 1 4  ? 10.568  -7.387  -4.840  1.00 0.00 ? 88  PRO A O    1  
ATOM 32    C CB   . PRO A 1 4  ? 12.315  -6.967  -2.576  1.00 0.00 ? 88  PRO A CB   1  
ATOM 33    C CG   . PRO A 1 4  ? 13.272  -8.110  -2.779  1.00 0.00 ? 88  PRO A CG   1  
ATOM 34    C CD   . PRO A 1 4  ? 12.447  -9.349  -3.000  1.00 0.00 ? 88  PRO A CD   1  
ATOM 35    H HA   . PRO A 1 4  ? 10.410  -7.206  -1.595  1.00 0.00 ? 88  PRO A HA   1  
ATOM 36    H HB2  . PRO A 1 4  ? 12.338  -6.284  -3.413  1.00 0.00 ? 88  PRO A HB2  1  
ATOM 37    H HB3  . PRO A 1 4  ? 12.537  -6.429  -1.667  1.00 0.00 ? 88  PRO A HB3  1  
ATOM 38    H HG2  . PRO A 1 4  ? 13.888  -7.918  -3.644  1.00 0.00 ? 88  PRO A HG2  1  
ATOM 39    H HG3  . PRO A 1 4  ? 13.891  -8.227  -1.902  1.00 0.00 ? 88  PRO A HG3  1  
ATOM 40    H HD2  . PRO A 1 4  ? 12.311  -9.530  -4.056  1.00 0.00 ? 88  PRO A HD2  1  
ATOM 41    H HD3  . PRO A 1 4  ? 12.906  -10.203 -2.524  1.00 0.00 ? 88  PRO A HD3  1  
ATOM 42    N N    . LEU A 1 5  ? 8.848   -6.862  -3.506  1.00 0.00 ? 89  LEU A N    1  
ATOM 43    C CA   . LEU A 1 5  ? 7.967   -6.542  -4.612  1.00 0.00 ? 89  LEU A CA   1  
ATOM 44    C C    . LEU A 1 5  ? 7.996   -5.037  -4.860  1.00 0.00 ? 89  LEU A C    1  
ATOM 45    O O    . LEU A 1 5  ? 7.742   -4.241  -3.955  1.00 0.00 ? 89  LEU A O    1  
ATOM 46    C CB   . LEU A 1 5  ? 6.538   -7.015  -4.315  1.00 0.00 ? 89  LEU A CB   1  
ATOM 47    C CG   . LEU A 1 5  ? 5.750   -7.550  -5.520  1.00 0.00 ? 89  LEU A CG   1  
ATOM 48    C CD1  . LEU A 1 5  ? 5.672   -6.515  -6.632  1.00 0.00 ? 89  LEU A CD1  1  
ATOM 49    C CD2  . LEU A 1 5  ? 6.370   -8.843  -6.034  1.00 0.00 ? 89  LEU A CD2  1  
ATOM 50    H H    . LEU A 1 5  ? 8.525   -6.749  -2.584  1.00 0.00 ? 89  LEU A H    1  
ATOM 51    H HA   . LEU A 1 5  ? 8.335   -7.050  -5.492  1.00 0.00 ? 89  LEU A HA   1  
ATOM 52    H HB2  . LEU A 1 5  ? 6.589   -7.797  -3.572  1.00 0.00 ? 89  LEU A HB2  1  
ATOM 53    H HB3  . LEU A 1 5  ? 5.987   -6.186  -3.898  1.00 0.00 ? 89  LEU A HB3  1  
ATOM 54    H HG   . LEU A 1 5  ? 4.740   -7.769  -5.207  1.00 0.00 ? 89  LEU A HG   1  
ATOM 55    H HD11 . LEU A 1 5  ? 5.114   -6.920  -7.464  1.00 0.00 ? 89  LEU A HD11 1  
ATOM 56    H HD12 . LEU A 1 5  ? 6.670   -6.258  -6.957  1.00 0.00 ? 89  LEU A HD12 1  
ATOM 57    H HD13 . LEU A 1 5  ? 5.175   -5.630  -6.262  1.00 0.00 ? 89  LEU A HD13 1  
ATOM 58    H HD21 . LEU A 1 5  ? 6.351   -9.587  -5.250  1.00 0.00 ? 89  LEU A HD21 1  
ATOM 59    H HD22 . LEU A 1 5  ? 7.391   -8.659  -6.331  1.00 0.00 ? 89  LEU A HD22 1  
ATOM 60    H HD23 . LEU A 1 5  ? 5.804   -9.201  -6.882  1.00 0.00 ? 89  LEU A HD23 1  
ATOM 61    N N    . SER A 1 6  ? 8.336   -4.656  -6.075  1.00 0.00 ? 90  SER A N    1  
ATOM 62    C CA   . SER A 1 6  ? 8.386   -3.256  -6.441  1.00 0.00 ? 90  SER A CA   1  
ATOM 63    C C    . SER A 1 6  ? 7.068   -2.851  -7.096  1.00 0.00 ? 90  SER A C    1  
ATOM 64    O O    . SER A 1 6  ? 6.816   -3.172  -8.256  1.00 0.00 ? 90  SER A O    1  
ATOM 65    C CB   . SER A 1 6  ? 9.560   -3.015  -7.395  1.00 0.00 ? 90  SER A CB   1  
ATOM 66    O OG   . SER A 1 6  ? 10.052  -1.688  -7.291  1.00 0.00 ? 90  SER A OG   1  
ATOM 67    H H    . SER A 1 6  ? 8.555   -5.333  -6.746  1.00 0.00 ? 90  SER A H    1  
ATOM 68    H HA   . SER A 1 6  ? 8.530   -2.675  -5.542  1.00 0.00 ? 90  SER A HA   1  
ATOM 69    H HB2  . SER A 1 6  ? 10.360  -3.698  -7.154  1.00 0.00 ? 90  SER A HB2  1  
ATOM 70    H HB3  . SER A 1 6  ? 9.235   -3.185  -8.410  1.00 0.00 ? 90  SER A HB3  1  
ATOM 71    H HG   . SER A 1 6  ? 10.826  -1.680  -6.706  1.00 0.00 ? 90  SER A HG   1  
ATOM 72    N N    . ILE A 1 7  ? 6.215   -2.179  -6.333  1.00 0.00 ? 91  ILE A N    1  
ATOM 73    C CA   . ILE A 1 7  ? 4.919   -1.744  -6.839  1.00 0.00 ? 91  ILE A CA   1  
ATOM 74    C C    . ILE A 1 7  ? 4.913   -0.235  -7.033  1.00 0.00 ? 91  ILE A C    1  
ATOM 75    O O    . ILE A 1 7  ? 5.772   0.474   -6.502  1.00 0.00 ? 91  ILE A O    1  
ATOM 76    C CB   . ILE A 1 7  ? 3.762   -2.129  -5.890  1.00 0.00 ? 91  ILE A CB   1  
ATOM 77    C CG1  . ILE A 1 7  ? 3.958   -1.487  -4.513  1.00 0.00 ? 91  ILE A CG1  1  
ATOM 78    C CG2  . ILE A 1 7  ? 3.649   -3.641  -5.771  1.00 0.00 ? 91  ILE A CG2  1  
ATOM 79    C CD1  . ILE A 1 7  ? 2.786   -1.684  -3.576  1.00 0.00 ? 91  ILE A CD1  1  
ATOM 80    H H    . ILE A 1 7  ? 6.473   -1.951  -5.413  1.00 0.00 ? 91  ILE A H    1  
ATOM 81    H HA   . ILE A 1 7  ? 4.750   -2.229  -7.798  1.00 0.00 ? 91  ILE A HA   1  
ATOM 82    H HB   . ILE A 1 7  ? 2.841   -1.762  -6.319  1.00 0.00 ? 91  ILE A HB   1  
ATOM 83    H HG12 . ILE A 1 7  ? 4.832   -1.914  -4.044  1.00 0.00 ? 91  ILE A HG12 1  
ATOM 84    H HG13 . ILE A 1 7  ? 4.108   -0.424  -4.640  1.00 0.00 ? 91  ILE A HG13 1  
ATOM 85    H HG21 . ILE A 1 7  ? 3.444   -4.063  -6.742  1.00 0.00 ? 91  ILE A HG21 1  
ATOM 86    H HG22 . ILE A 1 7  ? 2.847   -3.891  -5.094  1.00 0.00 ? 91  ILE A HG22 1  
ATOM 87    H HG23 . ILE A 1 7  ? 4.577   -4.040  -5.393  1.00 0.00 ? 91  ILE A HG23 1  
ATOM 88    H HD11 . ILE A 1 7  ? 2.607   -2.739  -3.438  1.00 0.00 ? 91  ILE A HD11 1  
ATOM 89    H HD12 . ILE A 1 7  ? 1.906   -1.223  -4.000  1.00 0.00 ? 91  ILE A HD12 1  
ATOM 90    H HD13 . ILE A 1 7  ? 3.007   -1.229  -2.623  1.00 0.00 ? 91  ILE A HD13 1  
ATOM 91    N N    . LEU A 1 8  ? 3.942   0.257   -7.779  1.00 0.00 ? 92  LEU A N    1  
ATOM 92    C CA   . LEU A 1 8  ? 3.853   1.676   -8.062  1.00 0.00 ? 92  LEU A CA   1  
ATOM 93    C C    . LEU A 1 8  ? 2.679   2.291   -7.312  1.00 0.00 ? 92  LEU A C    1  
ATOM 94    O O    . LEU A 1 8  ? 1.541   1.873   -7.490  1.00 0.00 ? 92  LEU A O    1  
ATOM 95    C CB   . LEU A 1 8  ? 3.689   1.897   -9.566  1.00 0.00 ? 92  LEU A CB   1  
ATOM 96    C CG   . LEU A 1 8  ? 3.802   3.348   -10.027 1.00 0.00 ? 92  LEU A CG   1  
ATOM 97    C CD1  . LEU A 1 8  ? 5.190   3.893   -9.734  1.00 0.00 ? 92  LEU A CD1  1  
ATOM 98    C CD2  . LEU A 1 8  ? 3.497   3.455   -11.509 1.00 0.00 ? 92  LEU A CD2  1  
ATOM 99    H H    . LEU A 1 8  ? 3.261   -0.349  -8.140  1.00 0.00 ? 92  LEU A H    1  
ATOM 100   H HA   . LEU A 1 8  ? 4.769   2.144   -7.733  1.00 0.00 ? 92  LEU A HA   1  
ATOM 101   H HB2  . LEU A 1 8  ? 4.443   1.318   -10.078 1.00 0.00 ? 92  LEU A HB2  1  
ATOM 102   H HB3  . LEU A 1 8  ? 2.716   1.527   -9.857  1.00 0.00 ? 92  LEU A HB3  1  
ATOM 103   H HG   . LEU A 1 8  ? 3.084   3.950   -9.489  1.00 0.00 ? 92  LEU A HG   1  
ATOM 104   H HD11 . LEU A 1 8  ? 5.386   3.825   -8.674  1.00 0.00 ? 92  LEU A HD11 1  
ATOM 105   H HD12 . LEU A 1 8  ? 5.243   4.925   -10.044 1.00 0.00 ? 92  LEU A HD12 1  
ATOM 106   H HD13 . LEU A 1 8  ? 5.926   3.317   -10.275 1.00 0.00 ? 92  LEU A HD13 1  
ATOM 107   H HD21 . LEU A 1 8  ? 4.212   2.867   -12.065 1.00 0.00 ? 92  LEU A HD21 1  
ATOM 108   H HD22 . LEU A 1 8  ? 3.564   4.489   -11.815 1.00 0.00 ? 92  LEU A HD22 1  
ATOM 109   H HD23 . LEU A 1 8  ? 2.501   3.085   -11.699 1.00 0.00 ? 92  LEU A HD23 1  
ATOM 110   N N    . VAL A 1 9  ? 2.961   3.270   -6.468  1.00 0.00 ? 93  VAL A N    1  
ATOM 111   C CA   . VAL A 1 9  ? 1.922   3.948   -5.709  1.00 0.00 ? 93  VAL A CA   1  
ATOM 112   C C    . VAL A 1 9  ? 1.862   5.420   -6.099  1.00 0.00 ? 93  VAL A C    1  
ATOM 113   O O    . VAL A 1 9  ? 2.825   6.166   -5.912  1.00 0.00 ? 93  VAL A O    1  
ATOM 114   C CB   . VAL A 1 9  ? 2.151   3.821   -4.187  1.00 0.00 ? 93  VAL A CB   1  
ATOM 115   C CG1  . VAL A 1 9  ? 1.084   4.579   -3.411  1.00 0.00 ? 93  VAL A CG1  1  
ATOM 116   C CG2  . VAL A 1 9  ? 2.178   2.356   -3.767  1.00 0.00 ? 93  VAL A CG2  1  
ATOM 117   H H    . VAL A 1 9  ? 3.898   3.555   -6.354  1.00 0.00 ? 93  VAL A H    1  
ATOM 118   H HA   . VAL A 1 9  ? 0.974   3.486   -5.950  1.00 0.00 ? 93  VAL A HA   1  
ATOM 119   H HB   . VAL A 1 9  ? 3.111   4.256   -3.951  1.00 0.00 ? 93  VAL A HB   1  
ATOM 120   H HG11 . VAL A 1 9  ? 1.097   5.619   -3.704  1.00 0.00 ? 93  VAL A HG11 1  
ATOM 121   H HG12 . VAL A 1 9  ? 1.285   4.501   -2.353  1.00 0.00 ? 93  VAL A HG12 1  
ATOM 122   H HG13 . VAL A 1 9  ? 0.114   4.155   -3.624  1.00 0.00 ? 93  VAL A HG13 1  
ATOM 123   H HG21 . VAL A 1 9  ? 2.391   2.288   -2.711  1.00 0.00 ? 93  VAL A HG21 1  
ATOM 124   H HG22 . VAL A 1 9  ? 2.942   1.836   -4.323  1.00 0.00 ? 93  VAL A HG22 1  
ATOM 125   H HG23 . VAL A 1 9  ? 1.217   1.906   -3.970  1.00 0.00 ? 93  VAL A HG23 1  
ATOM 126   N N    . ARG A 1 10 ? 0.734   5.835   -6.647  1.00 0.00 ? 94  ARG A N    1  
ATOM 127   C CA   . ARG A 1 10 ? 0.574   7.203   -7.112  1.00 0.00 ? 94  ARG A CA   1  
ATOM 128   C C    . ARG A 1 10 ? -0.120  8.052   -6.054  1.00 0.00 ? 94  ARG A C    1  
ATOM 129   O O    . ARG A 1 10 ? -1.123  7.634   -5.474  1.00 0.00 ? 94  ARG A O    1  
ATOM 130   C CB   . ARG A 1 10 ? -0.225  7.232   -8.420  1.00 0.00 ? 94  ARG A CB   1  
ATOM 131   C CG   . ARG A 1 10 ? -0.321  8.614   -9.044  1.00 0.00 ? 94  ARG A CG   1  
ATOM 132   C CD   . ARG A 1 10 ? -1.040  8.581   -10.384 1.00 0.00 ? 94  ARG A CD   1  
ATOM 133   N NE   . ARG A 1 10 ? -1.041  9.893   -11.028 1.00 0.00 ? 94  ARG A NE   1  
ATOM 134   C CZ   . ARG A 1 10 ? -0.531  10.138  -12.235 1.00 0.00 ? 94  ARG A CZ   1  
ATOM 135   N NH1  . ARG A 1 10 ? 0.001   9.156   -12.953 1.00 0.00 ? 94  ARG A NH1  1  
ATOM 136   N NH2  . ARG A 1 10 ? -0.556  11.371  -12.719 1.00 0.00 ? 94  ARG A NH2  1  
ATOM 137   H H    . ARG A 1 10 ? -0.017  5.209   -6.727  1.00 0.00 ? 94  ARG A H    1  
ATOM 138   H HA   . ARG A 1 10 ? 1.557   7.608   -7.291  1.00 0.00 ? 94  ARG A HA   1  
ATOM 139   H HB2  . ARG A 1 10 ? 0.247   6.571   -9.132  1.00 0.00 ? 94  ARG A HB2  1  
ATOM 140   H HB3  . ARG A 1 10 ? -1.227  6.878   -8.223  1.00 0.00 ? 94  ARG A HB3  1  
ATOM 141   H HG2  . ARG A 1 10 ? -0.864  9.263   -8.374  1.00 0.00 ? 94  ARG A HG2  1  
ATOM 142   H HG3  . ARG A 1 10 ? 0.677   9.002   -9.191  1.00 0.00 ? 94  ARG A HG3  1  
ATOM 143   H HD2  . ARG A 1 10 ? -0.543  7.869   -11.030 1.00 0.00 ? 94  ARG A HD2  1  
ATOM 144   H HD3  . ARG A 1 10 ? -2.061  8.268   -10.223 1.00 0.00 ? 94  ARG A HD3  1  
ATOM 145   H HE   . ARG A 1 10 ? -1.438  10.637  -10.526 1.00 0.00 ? 94  ARG A HE   1  
ATOM 146   H HH11 . ARG A 1 10 ? 0.024   8.218   -12.594 1.00 0.00 ? 94  ARG A HH11 1  
ATOM 147   H HH12 . ARG A 1 10 ? 0.395   9.346   -13.867 1.00 0.00 ? 94  ARG A HH12 1  
ATOM 148   H HH21 . ARG A 1 10 ? -0.954  12.118  -12.176 1.00 0.00 ? 94  ARG A HH21 1  
ATOM 149   H HH22 . ARG A 1 10 ? -0.171  11.567  -13.630 1.00 0.00 ? 94  ARG A HH22 1  
ATOM 150   N N    . ASN A 1 11 ? 0.431   9.234   -5.798  1.00 0.00 ? 95  ASN A N    1  
ATOM 151   C CA   . ASN A 1 11 ? -0.150  10.165  -4.832  1.00 0.00 ? 95  ASN A CA   1  
ATOM 152   C C    . ASN A 1 11 ? -1.364  10.848  -5.444  1.00 0.00 ? 95  ASN A C    1  
ATOM 153   O O    . ASN A 1 11 ? -1.220  11.877  -6.090  1.00 0.00 ? 95  ASN A O    1  
ATOM 154   C CB   . ASN A 1 11 ? 0.867   11.233  -4.410  1.00 0.00 ? 95  ASN A CB   1  
ATOM 155   C CG   . ASN A 1 11 ? 2.188   10.656  -3.939  1.00 0.00 ? 95  ASN A CG   1  
ATOM 156   O OD1  . ASN A 1 11 ? 2.248   9.556   -3.386  1.00 0.00 ? 95  ASN A OD1  1  
ATOM 157   N ND2  . ASN A 1 11 ? 3.260   11.403  -4.157  1.00 0.00 ? 95  ASN A ND2  1  
ATOM 158   H H    . ASN A 1 11 ? 1.256   9.487   -6.271  1.00 0.00 ? 95  ASN A H    1  
ATOM 159   H HA   . ASN A 1 11 ? -0.460  9.602   -3.965  1.00 0.00 ? 95  ASN A HA   1  
ATOM 160   H HB2  . ASN A 1 11 ? 1.064   11.880  -5.252  1.00 0.00 ? 95  ASN A HB2  1  
ATOM 161   H HB3  . ASN A 1 11 ? 0.447   11.818  -3.606  1.00 0.00 ? 95  ASN A HB3  1  
ATOM 162   H HD21 . ASN A 1 11 ? 3.136   12.271  -4.595  1.00 0.00 ? 95  ASN A HD21 1  
ATOM 163   H HD22 . ASN A 1 11 ? 4.134   11.053  -3.883  1.00 0.00 ? 95  ASN A HD22 1  
ATOM 164   N N    . ASN A 1 12 ? -2.538  10.252  -5.224  1.00 0.00 ? 96  ASN A N    1  
ATOM 165   C CA   . ASN A 1 12 ? -3.826  10.663  -5.816  1.00 0.00 ? 96  ASN A CA   1  
ATOM 166   C C    . ASN A 1 12 ? -3.747  11.038  -7.309  1.00 0.00 ? 96  ASN A C    1  
ATOM 167   O O    . ASN A 1 12 ? -4.156  10.250  -8.161  1.00 0.00 ? 96  ASN A O    1  
ATOM 168   C CB   . ASN A 1 12 ? -4.575  11.727  -4.960  1.00 0.00 ? 96  ASN A CB   1  
ATOM 169   C CG   . ASN A 1 12 ? -3.860  13.059  -4.699  1.00 0.00 ? 96  ASN A CG   1  
ATOM 170   O OD1  . ASN A 1 12 ? -3.154  13.608  -5.538  1.00 0.00 ? 96  ASN A OD1  1  
ATOM 171   N ND2  . ASN A 1 12 ? -4.075  13.607  -3.514  1.00 0.00 ? 96  ASN A ND2  1  
ATOM 172   H H    . ASN A 1 12 ? -2.547  9.481   -4.616  1.00 0.00 ? 96  ASN A H    1  
ATOM 173   H HA   . ASN A 1 12 ? -4.433  9.768   -5.781  1.00 0.00 ? 96  ASN A HA   1  
ATOM 174   H HB2  . ASN A 1 12 ? -5.507  11.956  -5.451  1.00 0.00 ? 96  ASN A HB2  1  
ATOM 175   H HB3  . ASN A 1 12 ? -4.803  11.281  -4.000  1.00 0.00 ? 96  ASN A HB3  1  
ATOM 176   H HD21 . ASN A 1 12 ? -4.665  13.139  -2.891  1.00 0.00 ? 96  ASN A HD21 1  
ATOM 177   H HD22 . ASN A 1 12 ? -3.648  14.471  -3.312  1.00 0.00 ? 96  ASN A HD22 1  
ATOM 178   N N    . LYS A 1 13 ? -3.233  12.210  -7.629  1.00 0.00 ? 97  LYS A N    1  
ATOM 179   C CA   . LYS A 1 13 ? -3.186  12.682  -9.003  1.00 0.00 ? 97  LYS A CA   1  
ATOM 180   C C    . LYS A 1 13 ? -1.752  13.015  -9.413  1.00 0.00 ? 97  LYS A C    1  
ATOM 181   O O    . LYS A 1 13 ? -1.447  13.133  -10.600 1.00 0.00 ? 97  LYS A O    1  
ATOM 182   C CB   . LYS A 1 13 ? -4.065  13.930  -9.143  1.00 0.00 ? 97  LYS A CB   1  
ATOM 183   C CG   . LYS A 1 13 ? -3.466  15.169  -8.489  1.00 0.00 ? 97  LYS A CG   1  
ATOM 184   C CD   . LYS A 1 13 ? -4.455  16.319  -8.429  1.00 0.00 ? 97  LYS A CD   1  
ATOM 185   C CE   . LYS A 1 13 ? -5.460  16.122  -7.311  1.00 0.00 ? 97  LYS A CE   1  
ATOM 186   N NZ   . LYS A 1 13 ? -4.791  16.017  -5.987  1.00 0.00 ? 97  LYS A NZ   1  
ATOM 187   H H    . LYS A 1 13 ? -2.860  12.776  -6.915  1.00 0.00 ? 97  LYS A H    1  
ATOM 188   H HA   . LYS A 1 13 ? -3.569  11.903  -9.642  1.00 0.00 ? 97  LYS A HA   1  
ATOM 189   H HB2  . LYS A 1 13 ? -4.213  14.136  -10.193 1.00 0.00 ? 97  LYS A HB2  1  
ATOM 190   H HB3  . LYS A 1 13 ? -5.023  13.734  -8.683  1.00 0.00 ? 97  LYS A HB3  1  
ATOM 191   H HG2  . LYS A 1 13 ? -3.167  14.919  -7.481  1.00 0.00 ? 97  LYS A HG2  1  
ATOM 192   H HG3  . LYS A 1 13 ? -2.602  15.481  -9.057  1.00 0.00 ? 97  LYS A HG3  1  
ATOM 193   H HD2  . LYS A 1 13 ? -3.917  17.237  -8.256  1.00 0.00 ? 97  LYS A HD2  1  
ATOM 194   H HD3  . LYS A 1 13 ? -4.983  16.380  -9.369  1.00 0.00 ? 97  LYS A HD3  1  
ATOM 195   H HE2  . LYS A 1 13 ? -6.133  16.967  -7.298  1.00 0.00 ? 97  LYS A HE2  1  
ATOM 196   H HE3  . LYS A 1 13 ? -6.019  15.218  -7.498  1.00 0.00 ? 97  LYS A HE3  1  
ATOM 197   H HZ1  . LYS A 1 13 ? -5.501  16.039  -5.217  1.00 0.00 ? 97  LYS A HZ1  1  
ATOM 198   H HZ2  . LYS A 1 13 ? -4.134  16.816  -5.852  1.00 0.00 ? 97  LYS A HZ2  1  
ATOM 199   H HZ3  . LYS A 1 13 ? -4.253  15.129  -5.921  1.00 0.00 ? 97  LYS A HZ3  1  
ATOM 200   N N    . GLY A 1 14 ? -0.875  13.133  -8.421  1.00 0.00 ? 98  GLY A N    1  
ATOM 201   C CA   . GLY A 1 14 ? 0.461   13.646  -8.651  1.00 0.00 ? 98  GLY A CA   1  
ATOM 202   C C    . GLY A 1 14 ? 1.446   12.595  -9.121  1.00 0.00 ? 98  GLY A C    1  
ATOM 203   O O    . GLY A 1 14 ? 1.215   11.918  -10.124 1.00 0.00 ? 98  GLY A O    1  
ATOM 204   H H    . GLY A 1 14 ? -1.137  12.849  -7.516  1.00 0.00 ? 98  GLY A H    1  
ATOM 205   H HA2  . GLY A 1 14 ? 0.407   14.424  -9.397  1.00 0.00 ? 98  GLY A HA2  1  
ATOM 206   H HA3  . GLY A 1 14 ? 0.828   14.075  -7.729  1.00 0.00 ? 98  GLY A HA3  1  
ATOM 207   N N    . ARG A 1 15 ? 2.549   12.461  -8.399  1.00 0.00 ? 99  ARG A N    1  
ATOM 208   C CA   . ARG A 1 15 ? 3.636   11.591  -8.827  1.00 0.00 ? 99  ARG A CA   1  
ATOM 209   C C    . ARG A 1 15 ? 3.343   10.131  -8.504  1.00 0.00 ? 99  ARG A C    1  
ATOM 210   O O    . ARG A 1 15 ? 2.732   9.812   -7.481  1.00 0.00 ? 99  ARG A O    1  
ATOM 211   C CB   . ARG A 1 15 ? 4.963   12.009  -8.180  1.00 0.00 ? 99  ARG A CB   1  
ATOM 212   C CG   . ARG A 1 15 ? 5.013   11.807  -6.675  1.00 0.00 ? 99  ARG A CG   1  
ATOM 213   C CD   . ARG A 1 15 ? 6.364   12.202  -6.104  1.00 0.00 ? 99  ARG A CD   1  
ATOM 214   N NE   . ARG A 1 15 ? 6.640   13.627  -6.279  1.00 0.00 ? 99  ARG A NE   1  
ATOM 215   C CZ   . ARG A 1 15 ? 7.766   14.113  -6.797  1.00 0.00 ? 99  ARG A CZ   1  
ATOM 216   N NH1  . ARG A 1 15 ? 8.731   13.291  -7.202  1.00 0.00 ? 99  ARG A NH1  1  
ATOM 217   N NH2  . ARG A 1 15 ? 7.928   15.424  -6.899  1.00 0.00 ? 99  ARG A NH2  1  
ATOM 218   H H    . ARG A 1 15 ? 2.633   12.956  -7.552  1.00 0.00 ? 99  ARG A H    1  
ATOM 219   H HA   . ARG A 1 15 ? 3.726   11.692  -9.898  1.00 0.00 ? 99  ARG A HA   1  
ATOM 220   H HB2  . ARG A 1 15 ? 5.759   11.430  -8.620  1.00 0.00 ? 99  ARG A HB2  1  
ATOM 221   H HB3  . ARG A 1 15 ? 5.135   13.054  -8.384  1.00 0.00 ? 99  ARG A HB3  1  
ATOM 222   H HG2  . ARG A 1 15 ? 4.249   12.415  -6.214  1.00 0.00 ? 99  ARG A HG2  1  
ATOM 223   H HG3  . ARG A 1 15 ? 4.831   10.766  -6.455  1.00 0.00 ? 99  ARG A HG3  1  
ATOM 224   H HD2  . ARG A 1 15 ? 6.374   11.969  -5.051  1.00 0.00 ? 99  ARG A HD2  1  
ATOM 225   H HD3  . ARG A 1 15 ? 7.132   11.631  -6.606  1.00 0.00 ? 99  ARG A HD3  1  
ATOM 226   H HE   . ARG A 1 15 ? 5.947   14.259  -5.981  1.00 0.00 ? 99  ARG A HE   1  
ATOM 227   H HH11 . ARG A 1 15 ? 8.616   12.303  -7.117  1.00 0.00 ? 99  ARG A HH11 1  
ATOM 228   H HH12 . ARG A 1 15 ? 9.583   13.660  -7.601  1.00 0.00 ? 99  ARG A HH12 1  
ATOM 229   H HH21 . ARG A 1 15 ? 7.203   16.049  -6.580  1.00 0.00 ? 99  ARG A HH21 1  
ATOM 230   H HH22 . ARG A 1 15 ? 8.776   15.805  -7.295  1.00 0.00 ? 99  ARG A HH22 1  
ATOM 231   N N    . SER A 1 16 ? 3.768   9.256   -9.400  1.00 0.00 ? 100 SER A N    1  
ATOM 232   C CA   . SER A 1 16 ? 3.686   7.826   -9.181  1.00 0.00 ? 100 SER A CA   1  
ATOM 233   C C    . SER A 1 16 ? 5.010   7.323   -8.617  1.00 0.00 ? 100 SER A C    1  
ATOM 234   O O    . SER A 1 16 ? 5.996   7.183   -9.346  1.00 0.00 ? 100 SER A O    1  
ATOM 235   C CB   . SER A 1 16 ? 3.353   7.113   -10.496 1.00 0.00 ? 100 SER A CB   1  
ATOM 236   O OG   . SER A 1 16 ? 2.218   7.701   -11.114 1.00 0.00 ? 100 SER A OG   1  
ATOM 237   H H    . SER A 1 16 ? 4.137   9.586   -10.248 1.00 0.00 ? 100 SER A H    1  
ATOM 238   H HA   . SER A 1 16 ? 2.904   7.639   -8.465  1.00 0.00 ? 100 SER A HA   1  
ATOM 239   H HB2  . SER A 1 16 ? 4.195   7.186   -11.168 1.00 0.00 ? 100 SER A HB2  1  
ATOM 240   H HB3  . SER A 1 16 ? 3.139   6.074   -10.296 1.00 0.00 ? 100 SER A HB3  1  
ATOM 241   H HG   . SER A 1 16 ? 1.721   7.021   -11.594 1.00 0.00 ? 100 SER A HG   1  
ATOM 242   N N    . SER A 1 17 ? 5.042   7.086   -7.317  1.00 0.00 ? 101 SER A N    1  
ATOM 243   C CA   . SER A 1 17 ? 6.264   6.678   -6.648  1.00 0.00 ? 101 SER A CA   1  
ATOM 244   C C    . SER A 1 17 ? 6.328   5.161   -6.522  1.00 0.00 ? 101 SER A C    1  
ATOM 245   O O    . SER A 1 17 ? 5.336   4.509   -6.202  1.00 0.00 ? 101 SER A O    1  
ATOM 246   C CB   . SER A 1 17 ? 6.344   7.325   -5.265  1.00 0.00 ? 101 SER A CB   1  
ATOM 247   O OG   . SER A 1 17 ? 6.153   8.728   -5.346  1.00 0.00 ? 101 SER A OG   1  
ATOM 248   H H    . SER A 1 17 ? 4.217   7.177   -6.791  1.00 0.00 ? 101 SER A H    1  
ATOM 249   H HA   . SER A 1 17 ? 7.097   7.016   -7.244  1.00 0.00 ? 101 SER A HA   1  
ATOM 250   H HB2  . SER A 1 17 ? 5.578   6.905   -4.627  1.00 0.00 ? 101 SER A HB2  1  
ATOM 251   H HB3  . SER A 1 17 ? 7.316   7.130   -4.835  1.00 0.00 ? 101 SER A HB3  1  
ATOM 252   H HG   . SER A 1 17 ? 5.736   9.039   -4.530  1.00 0.00 ? 101 SER A HG   1  
ATOM 253   N N    . THR A 1 18 ? 7.491   4.599   -6.799  1.00 0.00 ? 102 THR A N    1  
ATOM 254   C CA   . THR A 1 18 ? 7.687   3.166   -6.674  1.00 0.00 ? 102 THR A CA   1  
ATOM 255   C C    . THR A 1 18 ? 8.071   2.812   -5.236  1.00 0.00 ? 102 THR A C    1  
ATOM 256   O O    . THR A 1 18 ? 9.029   3.361   -4.689  1.00 0.00 ? 102 THR A O    1  
ATOM 257   C CB   . THR A 1 18 ? 8.774   2.684   -7.651  1.00 0.00 ? 102 THR A CB   1  
ATOM 258   O OG1  . THR A 1 18 ? 8.503   3.215   -8.956  1.00 0.00 ? 102 THR A OG1  1  
ATOM 259   C CG2  . THR A 1 18 ? 8.814   1.165   -7.721  1.00 0.00 ? 102 THR A CG2  1  
ATOM 260   H H    . THR A 1 18 ? 8.239   5.163   -7.094  1.00 0.00 ? 102 THR A H    1  
ATOM 261   H HA   . THR A 1 18 ? 6.756   2.677   -6.928  1.00 0.00 ? 102 THR A HA   1  
ATOM 262   H HB   . THR A 1 18 ? 9.735   3.043   -7.313  1.00 0.00 ? 102 THR A HB   1  
ATOM 263   H HG1  . THR A 1 18 ? 7.739   3.800   -8.905  1.00 0.00 ? 102 THR A HG1  1  
ATOM 264   H HG21 . THR A 1 18 ? 9.592   0.857   -8.407  1.00 0.00 ? 102 THR A HG21 1  
ATOM 265   H HG22 . THR A 1 18 ? 7.861   0.794   -8.069  1.00 0.00 ? 102 THR A HG22 1  
ATOM 266   H HG23 . THR A 1 18 ? 9.020   0.763   -6.739  1.00 0.00 ? 102 THR A HG23 1  
ATOM 267   N N    . TYR A 1 19 ? 7.314   1.912   -4.624  1.00 0.00 ? 103 TYR A N    1  
ATOM 268   C CA   . TYR A 1 19 ? 7.533   1.554   -3.228  1.00 0.00 ? 103 TYR A CA   1  
ATOM 269   C C    . TYR A 1 19 ? 8.061   0.132   -3.096  1.00 0.00 ? 103 TYR A C    1  
ATOM 270   O O    . TYR A 1 19 ? 7.696   -0.755  -3.871  1.00 0.00 ? 103 TYR A O    1  
ATOM 271   C CB   . TYR A 1 19 ? 6.239   1.700   -2.422  1.00 0.00 ? 103 TYR A CB   1  
ATOM 272   C CG   . TYR A 1 19 ? 5.873   3.132   -2.096  1.00 0.00 ? 103 TYR A CG   1  
ATOM 273   C CD1  . TYR A 1 19 ? 5.324   3.969   -3.058  1.00 0.00 ? 103 TYR A CD1  1  
ATOM 274   C CD2  . TYR A 1 19 ? 6.072   3.644   -0.821  1.00 0.00 ? 103 TYR A CD2  1  
ATOM 275   C CE1  . TYR A 1 19 ? 4.982   5.273   -2.758  1.00 0.00 ? 103 TYR A CE1  1  
ATOM 276   C CE2  . TYR A 1 19 ? 5.732   4.947   -0.512  1.00 0.00 ? 103 TYR A CE2  1  
ATOM 277   C CZ   . TYR A 1 19 ? 5.189   5.758   -1.484  1.00 0.00 ? 103 TYR A CZ   1  
ATOM 278   O OH   . TYR A 1 19 ? 4.843   7.056   -1.184  1.00 0.00 ? 103 TYR A OH   1  
ATOM 279   H H    . TYR A 1 19 ? 6.599   1.462   -5.130  1.00 0.00 ? 103 TYR A H    1  
ATOM 280   H HA   . TYR A 1 19 ? 8.268   2.235   -2.828  1.00 0.00 ? 103 TYR A HA   1  
ATOM 281   H HB2  . TYR A 1 19 ? 5.423   1.271   -2.985  1.00 0.00 ? 103 TYR A HB2  1  
ATOM 282   H HB3  . TYR A 1 19 ? 6.346   1.165   -1.490  1.00 0.00 ? 103 TYR A HB3  1  
ATOM 283   H HD1  . TYR A 1 19 ? 5.164   3.588   -4.056  1.00 0.00 ? 103 TYR A HD1  1  
ATOM 284   H HD2  . TYR A 1 19 ? 6.497   3.005   -0.063  1.00 0.00 ? 103 TYR A HD2  1  
ATOM 285   H HE1  . TYR A 1 19 ? 4.555   5.908   -3.522  1.00 0.00 ? 103 TYR A HE1  1  
ATOM 286   H HE2  . TYR A 1 19 ? 5.894   5.325   0.487   1.00 0.00 ? 103 TYR A HE2  1  
ATOM 287   H HH   . TYR A 1 19 ? 3.929   7.208   -1.439  1.00 0.00 ? 103 TYR A HH   1  
ATOM 288   N N    . GLU A 1 20 ? 8.917   -0.074  -2.104  1.00 0.00 ? 104 GLU A N    1  
ATOM 289   C CA   . GLU A 1 20 ? 9.513   -1.378  -1.861  1.00 0.00 ? 104 GLU A CA   1  
ATOM 290   C C    . GLU A 1 20 ? 8.717   -2.139  -0.811  1.00 0.00 ? 104 GLU A C    1  
ATOM 291   O O    . GLU A 1 20 ? 8.904   -1.946  0.393   1.00 0.00 ? 104 GLU A O    1  
ATOM 292   C CB   . GLU A 1 20 ? 10.957  -1.219  -1.402  1.00 0.00 ? 104 GLU A CB   1  
ATOM 293   C CG   . GLU A 1 20 ? 11.803  -0.399  -2.353  1.00 0.00 ? 104 GLU A CG   1  
ATOM 294   C CD   . GLU A 1 20 ? 13.151  -0.040  -1.765  1.00 0.00 ? 104 GLU A CD   1  
ATOM 295   O OE1  . GLU A 1 20 ? 13.197  0.799   -0.842  1.00 0.00 ? 104 GLU A OE1  1  
ATOM 296   O OE2  . GLU A 1 20 ? 14.173  -0.592  -2.228  1.00 0.00 ? 104 GLU A OE2  1  
ATOM 297   H H    . GLU A 1 20 ? 9.153   0.671   -1.515  1.00 0.00 ? 104 GLU A H    1  
ATOM 298   H HA   . GLU A 1 20 ? 9.492   -1.933  -2.787  1.00 0.00 ? 104 GLU A HA   1  
ATOM 299   H HB2  . GLU A 1 20 ? 10.964  -0.734  -0.436  1.00 0.00 ? 104 GLU A HB2  1  
ATOM 300   H HB3  . GLU A 1 20 ? 11.403  -2.198  -1.306  1.00 0.00 ? 104 GLU A HB3  1  
ATOM 301   H HG2  . GLU A 1 20 ? 11.962  -0.970  -3.257  1.00 0.00 ? 104 GLU A HG2  1  
ATOM 302   H HG3  . GLU A 1 20 ? 11.270  0.508   -2.591  1.00 0.00 ? 104 GLU A HG3  1  
ATOM 303   N N    . VAL A 1 21 ? 7.822   -2.983  -1.276  1.00 0.00 ? 105 VAL A N    1  
ATOM 304   C CA   . VAL A 1 21 ? 7.000   -3.791  -0.390  1.00 0.00 ? 105 VAL A CA   1  
ATOM 305   C C    . VAL A 1 21 ? 7.427   -5.249  -0.476  1.00 0.00 ? 105 VAL A C    1  
ATOM 306   O O    . VAL A 1 21 ? 8.360   -5.583  -1.204  1.00 0.00 ? 105 VAL A O    1  
ATOM 307   C CB   . VAL A 1 21 ? 5.498   -3.660  -0.716  1.00 0.00 ? 105 VAL A CB   1  
ATOM 308   C CG1  . VAL A 1 21 ? 5.049   -2.216  -0.566  1.00 0.00 ? 105 VAL A CG1  1  
ATOM 309   C CG2  . VAL A 1 21 ? 5.193   -4.178  -2.114  1.00 0.00 ? 105 VAL A CG2  1  
ATOM 310   H H    . VAL A 1 21 ? 7.719   -3.079  -2.251  1.00 0.00 ? 105 VAL A H    1  
ATOM 311   H HA   . VAL A 1 21 ? 7.161   -3.440  0.619   1.00 0.00 ? 105 VAL A HA   1  
ATOM 312   H HB   . VAL A 1 21 ? 4.945   -4.256  -0.006  1.00 0.00 ? 105 VAL A HB   1  
ATOM 313   H HG11 . VAL A 1 21 ? 5.577   -1.599  -1.277  1.00 0.00 ? 105 VAL A HG11 1  
ATOM 314   H HG12 . VAL A 1 21 ? 5.265   -1.875  0.435   1.00 0.00 ? 105 VAL A HG12 1  
ATOM 315   H HG13 . VAL A 1 21 ? 3.987   -2.147  -0.748  1.00 0.00 ? 105 VAL A HG13 1  
ATOM 316   H HG21 . VAL A 1 21 ? 5.465   -5.221  -2.176  1.00 0.00 ? 105 VAL A HG21 1  
ATOM 317   H HG22 . VAL A 1 21 ? 5.762   -3.613  -2.839  1.00 0.00 ? 105 VAL A HG22 1  
ATOM 318   H HG23 . VAL A 1 21 ? 4.138   -4.067  -2.317  1.00 0.00 ? 105 VAL A HG23 1  
ATOM 319   N N    . ARG A 1 22 ? 6.765   -6.112  0.274   1.00 0.00 ? 106 ARG A N    1  
ATOM 320   C CA   . ARG A 1 22 ? 7.087   -7.531  0.254   1.00 0.00 ? 106 ARG A CA   1  
ATOM 321   C C    . ARG A 1 22 ? 5.811   -8.355  0.272   1.00 0.00 ? 106 ARG A C    1  
ATOM 322   O O    . ARG A 1 22 ? 4.733   -7.834  0.562   1.00 0.00 ? 106 ARG A O    1  
ATOM 323   C CB   . ARG A 1 22 ? 7.969   -7.918  1.447   1.00 0.00 ? 106 ARG A CB   1  
ATOM 324   C CG   . ARG A 1 22 ? 9.239   -7.094  1.573   1.00 0.00 ? 106 ARG A CG   1  
ATOM 325   C CD   . ARG A 1 22 ? 10.216  -7.720  2.552   1.00 0.00 ? 106 ARG A CD   1  
ATOM 326   N NE   . ARG A 1 22 ? 9.575   -8.101  3.811   1.00 0.00 ? 106 ARG A NE   1  
ATOM 327   C CZ   . ARG A 1 22 ? 10.178  -8.060  4.998   1.00 0.00 ? 106 ARG A CZ   1  
ATOM 328   N NH1  . ARG A 1 22 ? 11.406  -7.568  5.108   1.00 0.00 ? 106 ARG A NH1  1  
ATOM 329   N NH2  . ARG A 1 22 ? 9.539   -8.496  6.078   1.00 0.00 ? 106 ARG A NH2  1  
ATOM 330   H H    . ARG A 1 22 ? 6.028   -5.795  0.838   1.00 0.00 ? 106 ARG A H    1  
ATOM 331   H HA   . ARG A 1 22 ? 7.621   -7.736  -0.662  1.00 0.00 ? 106 ARG A HA   1  
ATOM 332   H HB2  . ARG A 1 22 ? 7.397   -7.798  2.356   1.00 0.00 ? 106 ARG A HB2  1  
ATOM 333   H HB3  . ARG A 1 22 ? 8.250   -8.956  1.348   1.00 0.00 ? 106 ARG A HB3  1  
ATOM 334   H HG2  . ARG A 1 22 ? 9.711   -7.028  0.605   1.00 0.00 ? 106 ARG A HG2  1  
ATOM 335   H HG3  . ARG A 1 22 ? 8.981   -6.104  1.918   1.00 0.00 ? 106 ARG A HG3  1  
ATOM 336   H HD2  . ARG A 1 22 ? 10.643  -8.601  2.098   1.00 0.00 ? 106 ARG A HD2  1  
ATOM 337   H HD3  . ARG A 1 22 ? 11.001  -7.006  2.759   1.00 0.00 ? 106 ARG A HD3  1  
ATOM 338   H HE   . ARG A 1 22 ? 8.651   -8.437  3.762   1.00 0.00 ? 106 ARG A HE   1  
ATOM 339   H HH11 . ARG A 1 22 ? 11.882  -7.220  4.300   1.00 0.00 ? 106 ARG A HH11 1  
ATOM 340   H HH12 . ARG A 1 22 ? 11.869  -7.548  6.006   1.00 0.00 ? 106 ARG A HH12 1  
ATOM 341   H HH21 . ARG A 1 22 ? 8.608   -8.852  6.000   1.00 0.00 ? 106 ARG A HH21 1  
ATOM 342   H HH22 . ARG A 1 22 ? 9.991   -8.482  6.979   1.00 0.00 ? 106 ARG A HH22 1  
ATOM 343   N N    . LEU A 1 23 ? 5.932   -9.639  -0.027  1.00 0.00 ? 107 LEU A N    1  
ATOM 344   C CA   . LEU A 1 23 ? 4.779   -10.530 -0.025  1.00 0.00 ? 107 LEU A CA   1  
ATOM 345   C C    . LEU A 1 23 ? 4.467   -10.955 1.403   1.00 0.00 ? 107 LEU A C    1  
ATOM 346   O O    . LEU A 1 23 ? 3.342   -11.341 1.722   1.00 0.00 ? 107 LEU A O    1  
ATOM 347   C CB   . LEU A 1 23 ? 5.022   -11.764 -0.906  1.00 0.00 ? 107 LEU A CB   1  
ATOM 348   C CG   . LEU A 1 23 ? 5.073   -11.511 -2.421  1.00 0.00 ? 107 LEU A CG   1  
ATOM 349   C CD1  . LEU A 1 23 ? 6.357   -10.800 -2.821  1.00 0.00 ? 107 LEU A CD1  1  
ATOM 350   C CD2  . LEU A 1 23 ? 4.932   -12.821 -3.179  1.00 0.00 ? 107 LEU A CD2  1  
ATOM 351   H H    . LEU A 1 23 ? 6.821   -10.002 -0.241  1.00 0.00 ? 107 LEU A H    1  
ATOM 352   H HA   . LEU A 1 23 ? 3.936   -9.978  -0.414  1.00 0.00 ? 107 LEU A HA   1  
ATOM 353   H HB2  . LEU A 1 23 ? 5.960   -12.206 -0.609  1.00 0.00 ? 107 LEU A HB2  1  
ATOM 354   H HB3  . LEU A 1 23 ? 4.234   -12.476 -0.710  1.00 0.00 ? 107 LEU A HB3  1  
ATOM 355   H HG   . LEU A 1 23 ? 4.243   -10.876 -2.699  1.00 0.00 ? 107 LEU A HG   1  
ATOM 356   H HD11 . LEU A 1 23 ? 7.205   -11.415 -2.556  1.00 0.00 ? 107 LEU A HD11 1  
ATOM 357   H HD12 . LEU A 1 23 ? 6.423   -9.856  -2.302  1.00 0.00 ? 107 LEU A HD12 1  
ATOM 358   H HD13 . LEU A 1 23 ? 6.357   -10.627 -3.887  1.00 0.00 ? 107 LEU A HD13 1  
ATOM 359   H HD21 . LEU A 1 23 ? 3.990   -13.285 -2.927  1.00 0.00 ? 107 LEU A HD21 1  
ATOM 360   H HD22 . LEU A 1 23 ? 5.742   -13.482 -2.911  1.00 0.00 ? 107 LEU A HD22 1  
ATOM 361   H HD23 . LEU A 1 23 ? 4.965   -12.626 -4.241  1.00 0.00 ? 107 LEU A HD23 1  
ATOM 362   N N    . THR A 1 24 ? 5.484   -10.883 2.250   1.00 0.00 ? 108 THR A N    1  
ATOM 363   C CA   . THR A 1 24 ? 5.331   -11.137 3.673   1.00 0.00 ? 108 THR A CA   1  
ATOM 364   C C    . THR A 1 24 ? 4.673   -9.949  4.377   1.00 0.00 ? 108 THR A C    1  
ATOM 365   O O    . THR A 1 24 ? 4.170   -10.072 5.495   1.00 0.00 ? 108 THR A O    1  
ATOM 366   C CB   . THR A 1 24 ? 6.699   -11.428 4.322   1.00 0.00 ? 108 THR A CB   1  
ATOM 367   O OG1  . THR A 1 24 ? 7.679   -10.500 3.827   1.00 0.00 ? 108 THR A OG1  1  
ATOM 368   C CG2  . THR A 1 24 ? 7.145   -12.855 4.031   1.00 0.00 ? 108 THR A CG2  1  
ATOM 369   H H    . THR A 1 24 ? 6.380   -10.672 1.898   1.00 0.00 ? 108 THR A H    1  
ATOM 370   H HA   . THR A 1 24 ? 4.705   -12.010 3.795   1.00 0.00 ? 108 THR A HA   1  
ATOM 371   H HB   . THR A 1 24 ? 6.607   -11.305 5.391   1.00 0.00 ? 108 THR A HB   1  
ATOM 372   H HG1  . THR A 1 24 ? 7.931   -10.752 2.919   1.00 0.00 ? 108 THR A HG1  1  
ATOM 373   H HG21 . THR A 1 24 ? 6.418   -13.546 4.425   1.00 0.00 ? 108 THR A HG21 1  
ATOM 374   H HG22 . THR A 1 24 ? 8.103   -13.035 4.497   1.00 0.00 ? 108 THR A HG22 1  
ATOM 375   H HG23 . THR A 1 24 ? 7.233   -12.996 2.962   1.00 0.00 ? 108 THR A HG23 1  
ATOM 376   N N    . GLN A 1 25 ? 4.675   -8.803  3.708   1.00 0.00 ? 109 GLN A N    1  
ATOM 377   C CA   . GLN A 1 25 ? 4.057   -7.602  4.246   1.00 0.00 ? 109 GLN A CA   1  
ATOM 378   C C    . GLN A 1 25 ? 2.567   -7.590  3.923   1.00 0.00 ? 109 GLN A C    1  
ATOM 379   O O    . GLN A 1 25 ? 2.163   -7.958  2.822   1.00 0.00 ? 109 GLN A O    1  
ATOM 380   C CB   . GLN A 1 25 ? 4.724   -6.351  3.664   1.00 0.00 ? 109 GLN A CB   1  
ATOM 381   C CG   . GLN A 1 25 ? 4.113   -5.045  4.147   1.00 0.00 ? 109 GLN A CG   1  
ATOM 382   C CD   . GLN A 1 25 ? 4.582   -3.848  3.344   1.00 0.00 ? 109 GLN A CD   1  
ATOM 383   O OE1  . GLN A 1 25 ? 3.988   -3.502  2.329   1.00 0.00 ? 109 GLN A OE1  1  
ATOM 384   N NE2  . GLN A 1 25 ? 5.636   -3.197  3.800   1.00 0.00 ? 109 GLN A NE2  1  
ATOM 385   H H    . GLN A 1 25 ? 5.089   -8.771  2.822   1.00 0.00 ? 109 GLN A H    1  
ATOM 386   H HA   . GLN A 1 25 ? 4.186   -7.609  5.318   1.00 0.00 ? 109 GLN A HA   1  
ATOM 387   H HB2  . GLN A 1 25 ? 5.770   -6.355  3.935   1.00 0.00 ? 109 GLN A HB2  1  
ATOM 388   H HB3  . GLN A 1 25 ? 4.643   -6.382  2.590   1.00 0.00 ? 109 GLN A HB3  1  
ATOM 389   H HG2  . GLN A 1 25 ? 3.038   -5.112  4.068   1.00 0.00 ? 109 GLN A HG2  1  
ATOM 390   H HG3  . GLN A 1 25 ? 4.388   -4.895  5.182   1.00 0.00 ? 109 GLN A HG3  1  
ATOM 391   H HE21 . GLN A 1 25 ? 6.057   -3.516  4.629   1.00 0.00 ? 109 GLN A HE21 1  
ATOM 392   H HE22 . GLN A 1 25 ? 5.951   -2.422  3.295   1.00 0.00 ? 109 GLN A HE22 1  
ATOM 393   N N    . THR A 1 26 ? 1.755   -7.190  4.887   1.00 0.00 ? 110 THR A N    1  
ATOM 394   C CA   . THR A 1 26 ? 0.326   -7.053  4.666   1.00 0.00 ? 110 THR A CA   1  
ATOM 395   C C    . THR A 1 26 ? 0.010   -5.657  4.139   1.00 0.00 ? 110 THR A C    1  
ATOM 396   O O    . THR A 1 26 ? 0.835   -4.746  4.254   1.00 0.00 ? 110 THR A O    1  
ATOM 397   C CB   . THR A 1 26 ? -0.462  -7.289  5.967   1.00 0.00 ? 110 THR A CB   1  
ATOM 398   O OG1  . THR A 1 26 ? 0.052   -6.436  7.001   1.00 0.00 ? 110 THR A OG1  1  
ATOM 399   C CG2  . THR A 1 26 ? -0.371  -8.745  6.403   1.00 0.00 ? 110 THR A CG2  1  
ATOM 400   H H    . THR A 1 26 ? 2.124   -6.978  5.767   1.00 0.00 ? 110 THR A H    1  
ATOM 401   H HA   . THR A 1 26 ? 0.021   -7.789  3.938   1.00 0.00 ? 110 THR A HA   1  
ATOM 402   H HB   . THR A 1 26 ? -1.500  -7.044  5.791   1.00 0.00 ? 110 THR A HB   1  
ATOM 403   H HG1  . THR A 1 26 ? -0.344  -6.687  7.857   1.00 0.00 ? 110 THR A HG1  1  
ATOM 404   H HG21 . THR A 1 26 ? -0.734  -9.380  5.608   1.00 0.00 ? 110 THR A HG21 1  
ATOM 405   H HG22 . THR A 1 26 ? -0.974  -8.894  7.286   1.00 0.00 ? 110 THR A HG22 1  
ATOM 406   H HG23 . THR A 1 26 ? 0.657   -8.992  6.622   1.00 0.00 ? 110 THR A HG23 1  
ATOM 407   N N    . VAL A 1 27 ? -1.182  -5.475  3.577   1.00 0.00 ? 111 VAL A N    1  
ATOM 408   C CA   . VAL A 1 27 ? -1.596  -4.152  3.107   1.00 0.00 ? 111 VAL A CA   1  
ATOM 409   C C    . VAL A 1 27 ? -1.703  -3.191  4.293   1.00 0.00 ? 111 VAL A C    1  
ATOM 410   O O    . VAL A 1 27 ? -1.525  -1.980  4.153   1.00 0.00 ? 111 VAL A O    1  
ATOM 411   C CB   . VAL A 1 27 ? -2.948  -4.195  2.366   1.00 0.00 ? 111 VAL A CB   1  
ATOM 412   C CG1  . VAL A 1 27 ? -3.157  -2.932  1.539   1.00 0.00 ? 111 VAL A CG1  1  
ATOM 413   C CG2  . VAL A 1 27 ? -3.054  -5.441  1.496   1.00 0.00 ? 111 VAL A CG2  1  
ATOM 414   H H    . VAL A 1 27 ? -1.786  -6.240  3.467   1.00 0.00 ? 111 VAL A H    1  
ATOM 415   H HA   . VAL A 1 27 ? -0.840  -3.787  2.426   1.00 0.00 ? 111 VAL A HA   1  
ATOM 416   H HB   . VAL A 1 27 ? -3.730  -4.235  3.104   1.00 0.00 ? 111 VAL A HB   1  
ATOM 417   H HG11 . VAL A 1 27 ? -2.373  -2.851  0.800   1.00 0.00 ? 111 VAL A HG11 1  
ATOM 418   H HG12 . VAL A 1 27 ? -3.133  -2.067  2.186   1.00 0.00 ? 111 VAL A HG12 1  
ATOM 419   H HG13 . VAL A 1 27 ? -4.115  -2.981  1.042   1.00 0.00 ? 111 VAL A HG13 1  
ATOM 420   H HG21 . VAL A 1 27 ? -2.996  -6.320  2.119   1.00 0.00 ? 111 VAL A HG21 1  
ATOM 421   H HG22 . VAL A 1 27 ? -2.244  -5.451  0.784   1.00 0.00 ? 111 VAL A HG22 1  
ATOM 422   H HG23 . VAL A 1 27 ? -3.997  -5.434  0.972   1.00 0.00 ? 111 VAL A HG23 1  
ATOM 423   N N    . ALA A 1 28 ? -1.977  -3.751  5.467   1.00 0.00 ? 112 ALA A N    1  
ATOM 424   C CA   . ALA A 1 28 ? -2.039  -2.973  6.696   1.00 0.00 ? 112 ALA A CA   1  
ATOM 425   C C    . ALA A 1 28 ? -0.670  -2.395  7.039   1.00 0.00 ? 112 ALA A C    1  
ATOM 426   O O    . ALA A 1 28 ? -0.564  -1.264  7.511   1.00 0.00 ? 112 ALA A O    1  
ATOM 427   C CB   . ALA A 1 28 ? -2.550  -3.838  7.836   1.00 0.00 ? 112 ALA A CB   1  
ATOM 428   H H    . ALA A 1 28 ? -2.148  -4.714  5.506   1.00 0.00 ? 112 ALA A H    1  
ATOM 429   H HA   . ALA A 1 28 ? -2.738  -2.161  6.546   1.00 0.00 ? 112 ALA A HA   1  
ATOM 430   H HB1  . ALA A 1 28 ? -3.537  -4.205  7.595   1.00 0.00 ? 112 ALA A HB1  1  
ATOM 431   H HB2  . ALA A 1 28 ? -2.595  -3.249  8.742   1.00 0.00 ? 112 ALA A HB2  1  
ATOM 432   H HB3  . ALA A 1 28 ? -1.881  -4.673  7.981   1.00 0.00 ? 112 ALA A HB3  1  
ATOM 433   N N    . HIS A 1 29 ? 0.378   -3.173  6.790   1.00 0.00 ? 113 HIS A N    1  
ATOM 434   C CA   . HIS A 1 29 ? 1.738   -2.714  7.041   1.00 0.00 ? 113 HIS A CA   1  
ATOM 435   C C    . HIS A 1 29 ? 2.137   -1.646  6.032   1.00 0.00 ? 113 HIS A C    1  
ATOM 436   O O    . HIS A 1 29 ? 2.873   -0.719  6.363   1.00 0.00 ? 113 HIS A O    1  
ATOM 437   C CB   . HIS A 1 29 ? 2.730   -3.880  7.021   1.00 0.00 ? 113 HIS A CB   1  
ATOM 438   C CG   . HIS A 1 29 ? 2.959   -4.481  8.373   1.00 0.00 ? 113 HIS A CG   1  
ATOM 439   N ND1  . HIS A 1 29 ? 4.052   -4.174  9.158   1.00 0.00 ? 113 HIS A ND1  1  
ATOM 440   C CD2  . HIS A 1 29 ? 2.228   -5.371  9.085   1.00 0.00 ? 113 HIS A CD2  1  
ATOM 441   C CE1  . HIS A 1 29 ? 3.981   -4.851  10.289  1.00 0.00 ? 113 HIS A CE1  1  
ATOM 442   N NE2  . HIS A 1 29 ? 2.885   -5.582  10.269  1.00 0.00 ? 113 HIS A NE2  1  
ATOM 443   H H    . HIS A 1 29 ? 0.230   -4.070  6.422   1.00 0.00 ? 113 HIS A H    1  
ATOM 444   H HA   . HIS A 1 29 ? 1.748   -2.268  8.025   1.00 0.00 ? 113 HIS A HA   1  
ATOM 445   H HB2  . HIS A 1 29 ? 2.348   -4.657  6.374   1.00 0.00 ? 113 HIS A HB2  1  
ATOM 446   H HB3  . HIS A 1 29 ? 3.680   -3.537  6.637   1.00 0.00 ? 113 HIS A HB3  1  
ATOM 447   H HD1  . HIS A 1 29 ? 4.781   -3.549  8.921   1.00 0.00 ? 113 HIS A HD1  1  
ATOM 448   H HD2  . HIS A 1 29 ? 1.302   -5.834  8.774   1.00 0.00 ? 113 HIS A HD2  1  
ATOM 449   H HE1  . HIS A 1 29 ? 4.700   -4.815  11.094  1.00 0.00 ? 113 HIS A HE1  1  
ATOM 450   H HE2  . HIS A 1 29 ? 2.574   -6.160  11.006  1.00 0.00 ? 113 HIS A HE2  1  
ATOM 451   N N    . LEU A 1 30 ? 1.640   -1.774  4.806   1.00 0.00 ? 114 LEU A N    1  
ATOM 452   C CA   . LEU A 1 30 ? 1.835   -0.742  3.794   1.00 0.00 ? 114 LEU A CA   1  
ATOM 453   C C    . LEU A 1 30 ? 1.201   0.567   4.258   1.00 0.00 ? 114 LEU A C    1  
ATOM 454   O O    . LEU A 1 30 ? 1.815   1.633   4.175   1.00 0.00 ? 114 LEU A O    1  
ATOM 455   C CB   . LEU A 1 30 ? 1.226   -1.178  2.456   1.00 0.00 ? 114 LEU A CB   1  
ATOM 456   C CG   . LEU A 1 30 ? 1.293   -0.133  1.338   1.00 0.00 ? 114 LEU A CG   1  
ATOM 457   C CD1  . LEU A 1 30 ? 2.738   0.183   0.981   1.00 0.00 ? 114 LEU A CD1  1  
ATOM 458   C CD2  . LEU A 1 30 ? 0.531   -0.612  0.111   1.00 0.00 ? 114 LEU A CD2  1  
ATOM 459   H H    . LEU A 1 30 ? 1.143   -2.587  4.573   1.00 0.00 ? 114 LEU A H    1  
ATOM 460   H HA   . LEU A 1 30 ? 2.897   -0.593  3.669   1.00 0.00 ? 114 LEU A HA   1  
ATOM 461   H HB2  . LEU A 1 30 ? 1.745   -2.065  2.121   1.00 0.00 ? 114 LEU A HB2  1  
ATOM 462   H HB3  . LEU A 1 30 ? 0.188   -1.428  2.621   1.00 0.00 ? 114 LEU A HB3  1  
ATOM 463   H HG   . LEU A 1 30 ? 0.830   0.780   1.681   1.00 0.00 ? 114 LEU A HG   1  
ATOM 464   H HD11 . LEU A 1 30 ? 3.240   0.600   1.843   1.00 0.00 ? 114 LEU A HD11 1  
ATOM 465   H HD12 . LEU A 1 30 ? 2.762   0.897   0.170   1.00 0.00 ? 114 LEU A HD12 1  
ATOM 466   H HD13 . LEU A 1 30 ? 3.239   -0.724  0.676   1.00 0.00 ? 114 LEU A HD13 1  
ATOM 467   H HD21 . LEU A 1 30 ? -0.503  -0.776  0.371   1.00 0.00 ? 114 LEU A HD21 1  
ATOM 468   H HD22 . LEU A 1 30 ? 0.964   -1.537  -0.244  1.00 0.00 ? 114 LEU A HD22 1  
ATOM 469   H HD23 . LEU A 1 30 ? 0.593   0.135   -0.666  1.00 0.00 ? 114 LEU A HD23 1  
ATOM 470   N N    . LYS A 1 31 ? -0.028  0.476   4.766   1.00 0.00 ? 115 LYS A N    1  
ATOM 471   C CA   . LYS A 1 31 ? -0.715  1.638   5.313   1.00 0.00 ? 115 LYS A CA   1  
ATOM 472   C C    . LYS A 1 31 ? 0.091   2.233   6.462   1.00 0.00 ? 115 LYS A C    1  
ATOM 473   O O    . LYS A 1 31 ? 0.198   3.449   6.588   1.00 0.00 ? 115 LYS A O    1  
ATOM 474   C CB   . LYS A 1 31 ? -2.117  1.265   5.815   1.00 0.00 ? 115 LYS A CB   1  
ATOM 475   C CG   . LYS A 1 31 ? -2.947  2.473   6.231   1.00 0.00 ? 115 LYS A CG   1  
ATOM 476   C CD   . LYS A 1 31 ? -4.191  2.080   7.018   1.00 0.00 ? 115 LYS A CD   1  
ATOM 477   C CE   . LYS A 1 31 ? -3.831  1.533   8.392   1.00 0.00 ? 115 LYS A CE   1  
ATOM 478   N NZ   . LYS A 1 31 ? -5.035  1.269   9.226   1.00 0.00 ? 115 LYS A NZ   1  
ATOM 479   H H    . LYS A 1 31 ? -0.486  -0.394  4.760   1.00 0.00 ? 115 LYS A H    1  
ATOM 480   H HA   . LYS A 1 31 ? -0.804  2.376   4.529   1.00 0.00 ? 115 LYS A HA   1  
ATOM 481   H HB2  . LYS A 1 31 ? -2.642  0.744   5.028   1.00 0.00 ? 115 LYS A HB2  1  
ATOM 482   H HB3  . LYS A 1 31 ? -2.018  0.610   6.668   1.00 0.00 ? 115 LYS A HB3  1  
ATOM 483   H HG2  . LYS A 1 31 ? -2.339  3.117   6.848   1.00 0.00 ? 115 LYS A HG2  1  
ATOM 484   H HG3  . LYS A 1 31 ? -3.249  3.008   5.343   1.00 0.00 ? 115 LYS A HG3  1  
ATOM 485   H HD2  . LYS A 1 31 ? -4.816  2.951   7.142   1.00 0.00 ? 115 LYS A HD2  1  
ATOM 486   H HD3  . LYS A 1 31 ? -4.730  1.322   6.467   1.00 0.00 ? 115 LYS A HD3  1  
ATOM 487   H HE2  . LYS A 1 31 ? -3.284  0.609   8.266   1.00 0.00 ? 115 LYS A HE2  1  
ATOM 488   H HE3  . LYS A 1 31 ? -3.206  2.254   8.897   1.00 0.00 ? 115 LYS A HE3  1  
ATOM 489   H HZ1  . LYS A 1 31 ? -5.545  2.163   9.417   1.00 0.00 ? 115 LYS A HZ1  1  
ATOM 490   H HZ2  . LYS A 1 31 ? -4.752  0.845   10.138  1.00 0.00 ? 115 LYS A HZ2  1  
ATOM 491   H HZ3  . LYS A 1 31 ? -5.679  0.609   8.732   1.00 0.00 ? 115 LYS A HZ3  1  
ATOM 492   N N    . GLN A 1 32 ? 0.666   1.363   7.285   1.00 0.00 ? 116 GLN A N    1  
ATOM 493   C CA   . GLN A 1 32 ? 1.430   1.788   8.457   1.00 0.00 ? 116 GLN A CA   1  
ATOM 494   C C    . GLN A 1 32 ? 2.709   2.518   8.051   1.00 0.00 ? 116 GLN A C    1  
ATOM 495   O O    . GLN A 1 32 ? 3.169   3.421   8.752   1.00 0.00 ? 116 GLN A O    1  
ATOM 496   C CB   . GLN A 1 32 ? 1.759   0.583   9.339   1.00 0.00 ? 116 GLN A CB   1  
ATOM 497   C CG   . GLN A 1 32 ? 2.384   0.955   10.674  1.00 0.00 ? 116 GLN A CG   1  
ATOM 498   C CD   . GLN A 1 32 ? 2.550   -0.240  11.590  1.00 0.00 ? 116 GLN A CD   1  
ATOM 499   O OE1  . GLN A 1 32 ? 2.765   -1.365  11.135  1.00 0.00 ? 116 GLN A OE1  1  
ATOM 500   N NE2  . GLN A 1 32 ? 2.434   -0.008  12.886  1.00 0.00 ? 116 GLN A NE2  1  
ATOM 501   H H    . GLN A 1 32 ? 0.570   0.402   7.102   1.00 0.00 ? 116 GLN A H    1  
ATOM 502   H HA   . GLN A 1 32 ? 0.810   2.471   9.019   1.00 0.00 ? 116 GLN A HA   1  
ATOM 503   H HB2  . GLN A 1 32 ? 0.848   0.035   9.533   1.00 0.00 ? 116 GLN A HB2  1  
ATOM 504   H HB3  . GLN A 1 32 ? 2.448   -0.058  8.809   1.00 0.00 ? 116 GLN A HB3  1  
ATOM 505   H HG2  . GLN A 1 32 ? 3.356   1.388   10.494  1.00 0.00 ? 116 GLN A HG2  1  
ATOM 506   H HG3  . GLN A 1 32 ? 1.751   1.680   11.163  1.00 0.00 ? 116 GLN A HG3  1  
ATOM 507   H HE21 . GLN A 1 32 ? 2.252   0.915   13.182  1.00 0.00 ? 116 GLN A HE21 1  
ATOM 508   H HE22 . GLN A 1 32 ? 2.518   -0.770  13.503  1.00 0.00 ? 116 GLN A HE22 1  
ATOM 509   N N    . GLN A 1 33 ? 3.282   2.126   6.922   1.00 0.00 ? 117 GLN A N    1  
ATOM 510   C CA   . GLN A 1 33 ? 4.432   2.830   6.366   1.00 0.00 ? 117 GLN A CA   1  
ATOM 511   C C    . GLN A 1 33 ? 4.028   4.263   6.033   1.00 0.00 ? 117 GLN A C    1  
ATOM 512   O O    . GLN A 1 33 ? 4.668   5.242   6.454   1.00 0.00 ? 117 GLN A O    1  
ATOM 513   C CB   . GLN A 1 33 ? 4.932   2.114   5.108   1.00 0.00 ? 117 GLN A CB   1  
ATOM 514   C CG   . GLN A 1 33 ? 6.223   2.687   4.547   1.00 0.00 ? 117 GLN A CG   1  
ATOM 515   C CD   . GLN A 1 33 ? 6.716   1.921   3.336   1.00 0.00 ? 117 GLN A CD   1  
ATOM 516   O OE1  . GLN A 1 33 ? 6.399   2.261   2.200   1.00 0.00 ? 117 GLN A OE1  1  
ATOM 517   N NE2  . GLN A 1 33 ? 7.481   0.866   3.573   1.00 0.00 ? 117 GLN A NE2  1  
ATOM 518   H H    . GLN A 1 33 ? 2.928   1.337   6.452   1.00 0.00 ? 117 GLN A H    1  
ATOM 519   H HA   . GLN A 1 33 ? 5.213   2.845   7.111   1.00 0.00 ? 117 GLN A HA   1  
ATOM 520   H HB2  . GLN A 1 33 ? 5.099   1.073   5.341   1.00 0.00 ? 117 GLN A HB2  1  
ATOM 521   H HB3  . GLN A 1 33 ? 4.172   2.185   4.344   1.00 0.00 ? 117 GLN A HB3  1  
ATOM 522   H HG2  . GLN A 1 33 ? 6.051   3.714   4.259   1.00 0.00 ? 117 GLN A HG2  1  
ATOM 523   H HG3  . GLN A 1 33 ? 6.983   2.652   5.313   1.00 0.00 ? 117 GLN A HG3  1  
ATOM 524   H HE21 . GLN A 1 33 ? 7.682   0.640   4.511   1.00 0.00 ? 117 GLN A HE21 1  
ATOM 525   H HE22 . GLN A 1 33 ? 7.822   0.359   2.808   1.00 0.00 ? 117 GLN A HE22 1  
ATOM 526   N N    . VAL A 1 34 ? 2.934   4.376   5.298   1.00 0.00 ? 118 VAL A N    1  
ATOM 527   C CA   . VAL A 1 34 ? 2.381   5.671   4.957   1.00 0.00 ? 118 VAL A CA   1  
ATOM 528   C C    . VAL A 1 34 ? 1.964   6.407   6.227   1.00 0.00 ? 118 VAL A C    1  
ATOM 529   O O    . VAL A 1 34 ? 2.059   7.621   6.298   1.00 0.00 ? 118 VAL A O    1  
ATOM 530   C CB   . VAL A 1 34 ? 1.174   5.548   4.001   1.00 0.00 ? 118 VAL A CB   1  
ATOM 531   C CG1  . VAL A 1 34 ? 0.730   6.920   3.517   1.00 0.00 ? 118 VAL A CG1  1  
ATOM 532   C CG2  . VAL A 1 34 ? 1.514   4.653   2.820   1.00 0.00 ? 118 VAL A CG2  1  
ATOM 533   H H    . VAL A 1 34 ? 2.489   3.561   4.974   1.00 0.00 ? 118 VAL A H    1  
ATOM 534   H HA   . VAL A 1 34 ? 3.155   6.241   4.461   1.00 0.00 ? 118 VAL A HA   1  
ATOM 535   H HB   . VAL A 1 34 ? 0.355   5.100   4.543   1.00 0.00 ? 118 VAL A HB   1  
ATOM 536   H HG11 . VAL A 1 34 ? 1.529   7.380   2.957   1.00 0.00 ? 118 VAL A HG11 1  
ATOM 537   H HG12 . VAL A 1 34 ? 0.483   7.539   4.368   1.00 0.00 ? 118 VAL A HG12 1  
ATOM 538   H HG13 . VAL A 1 34 ? -0.139  6.813   2.884   1.00 0.00 ? 118 VAL A HG13 1  
ATOM 539   H HG21 . VAL A 1 34 ? 1.757   3.663   3.175   1.00 0.00 ? 118 VAL A HG21 1  
ATOM 540   H HG22 . VAL A 1 34 ? 2.359   5.064   2.289   1.00 0.00 ? 118 VAL A HG22 1  
ATOM 541   H HG23 . VAL A 1 34 ? 0.665   4.597   2.155   1.00 0.00 ? 118 VAL A HG23 1  
ATOM 542   N N    . SER A 1 35 ? 1.535   5.656   7.240   1.00 0.00 ? 119 SER A N    1  
ATOM 543   C CA   . SER A 1 35 ? 1.153   6.234   8.526   1.00 0.00 ? 119 SER A CA   1  
ATOM 544   C C    . SER A 1 35 ? 2.356   6.870   9.222   1.00 0.00 ? 119 SER A C    1  
ATOM 545   O O    . SER A 1 35 ? 2.208   7.807   10.005  1.00 0.00 ? 119 SER A O    1  
ATOM 546   C CB   . SER A 1 35 ? 0.526   5.170   9.432   1.00 0.00 ? 119 SER A CB   1  
ATOM 547   O OG   . SER A 1 35 ? -0.622  4.597   8.832   1.00 0.00 ? 119 SER A OG   1  
ATOM 548   H H    . SER A 1 35 ? 1.461   4.686   7.113   1.00 0.00 ? 119 SER A H    1  
ATOM 549   H HA   . SER A 1 35 ? 0.419   7.003   8.334   1.00 0.00 ? 119 SER A HA   1  
ATOM 550   H HB2  . SER A 1 35 ? 1.247   4.387   9.617   1.00 0.00 ? 119 SER A HB2  1  
ATOM 551   H HB3  . SER A 1 35 ? 0.239   5.623   10.370  1.00 0.00 ? 119 SER A HB3  1  
ATOM 552   H HG   . SER A 1 35 ? -0.442  4.419   7.900   1.00 0.00 ? 119 SER A HG   1  
ATOM 553   N N    . GLY A 1 36 ? 3.542   6.361   8.931   1.00 0.00 ? 120 GLY A N    1  
ATOM 554   C CA   . GLY A 1 36 ? 4.742   6.938   9.493   1.00 0.00 ? 120 GLY A CA   1  
ATOM 555   C C    . GLY A 1 36 ? 5.089   8.257   8.836   1.00 0.00 ? 120 GLY A C    1  
ATOM 556   O O    . GLY A 1 36 ? 5.594   9.173   9.485   1.00 0.00 ? 120 GLY A O    1  
ATOM 557   H H    . GLY A 1 36 ? 3.604   5.586   8.331   1.00 0.00 ? 120 GLY A H    1  
ATOM 558   H HA2  . GLY A 1 36 ? 4.590   7.100   10.549  1.00 0.00 ? 120 GLY A HA2  1  
ATOM 559   H HA3  . GLY A 1 36 ? 5.561   6.248   9.357   1.00 0.00 ? 120 GLY A HA3  1  
ATOM 560   N N    . LEU A 1 37 ? 4.817   8.355   7.540   1.00 0.00 ? 121 LEU A N    1  
ATOM 561   C CA   . LEU A 1 37 ? 5.105   9.579   6.789   1.00 0.00 ? 121 LEU A CA   1  
ATOM 562   C C    . LEU A 1 37 ? 3.890   10.519  6.732   1.00 0.00 ? 121 LEU A C    1  
ATOM 563   O O    . LEU A 1 37 ? 3.887   11.598  7.320   1.00 0.00 ? 121 LEU A O    1  
ATOM 564   C CB   . LEU A 1 37 ? 5.544   9.223   5.367   1.00 0.00 ? 121 LEU A CB   1  
ATOM 565   C CG   . LEU A 1 37 ? 6.755   8.291   5.273   1.00 0.00 ? 121 LEU A CG   1  
ATOM 566   C CD1  . LEU A 1 37 ? 7.027   7.917   3.824   1.00 0.00 ? 121 LEU A CD1  1  
ATOM 567   C CD2  . LEU A 1 37 ? 7.984   8.939   5.893   1.00 0.00 ? 121 LEU A CD2  1  
ATOM 568   H H    . LEU A 1 37 ? 4.440   7.571   7.069   1.00 0.00 ? 121 LEU A H    1  
ATOM 569   H HA   . LEU A 1 37 ? 5.917   10.089  7.287   1.00 0.00 ? 121 LEU A HA   1  
ATOM 570   H HB2  . LEU A 1 37 ? 4.715   8.748   4.867   1.00 0.00 ? 121 LEU A HB2  1  
ATOM 571   H HB3  . LEU A 1 37 ? 5.784   10.138  4.846   1.00 0.00 ? 121 LEU A HB3  1  
ATOM 572   H HG   . LEU A 1 37 ? 6.544   7.383   5.819   1.00 0.00 ? 121 LEU A HG   1  
ATOM 573   H HD11 . LEU A 1 37 ? 6.157   7.434   3.405   1.00 0.00 ? 121 LEU A HD11 1  
ATOM 574   H HD12 . LEU A 1 37 ? 7.869   7.242   3.781   1.00 0.00 ? 121 LEU A HD12 1  
ATOM 575   H HD13 . LEU A 1 37 ? 7.253   8.809   3.258   1.00 0.00 ? 121 LEU A HD13 1  
ATOM 576   H HD21 . LEU A 1 37 ? 7.793   9.154   6.934   1.00 0.00 ? 121 LEU A HD21 1  
ATOM 577   H HD22 . LEU A 1 37 ? 8.208   9.859   5.370   1.00 0.00 ? 121 LEU A HD22 1  
ATOM 578   H HD23 . LEU A 1 37 ? 8.823   8.266   5.811   1.00 0.00 ? 121 LEU A HD23 1  
ATOM 579   N N    . GLU A 1 38 ? 2.860   10.076  6.026   1.00 0.00 ? 122 GLU A N    1  
ATOM 580   C CA   . GLU A 1 38 ? 1.680   10.883  5.714   1.00 0.00 ? 122 GLU A CA   1  
ATOM 581   C C    . GLU A 1 38 ? 0.519   10.536  6.651   1.00 0.00 ? 122 GLU A C    1  
ATOM 582   O O    . GLU A 1 38 ? -0.624  10.907  6.396   1.00 0.00 ? 122 GLU A O    1  
ATOM 583   C CB   . GLU A 1 38 ? 1.290   10.679  4.248   1.00 0.00 ? 122 GLU A CB   1  
ATOM 584   C CG   . GLU A 1 38 ? 0.294   11.696  3.720   1.00 0.00 ? 122 GLU A CG   1  
ATOM 585   C CD   . GLU A 1 38 ? 0.802   13.115  3.845   1.00 0.00 ? 122 GLU A CD   1  
ATOM 586   O OE1  . GLU A 1 38 ? 0.555   13.746  4.888   1.00 0.00 ? 122 GLU A OE1  1  
ATOM 587   O OE2  . GLU A 1 38 ? 1.441   13.615  2.897   1.00 0.00 ? 122 GLU A OE2  1  
ATOM 588   H H    . GLU A 1 38 ? 2.882   9.148   5.707   1.00 0.00 ? 122 GLU A H    1  
ATOM 589   H HA   . GLU A 1 38 ? 1.944   11.920  5.864   1.00 0.00 ? 122 GLU A HA   1  
ATOM 590   H HB2  . GLU A 1 38 ? 2.178   10.749  3.652   1.00 0.00 ? 122 GLU A HB2  1  
ATOM 591   H HB3  . GLU A 1 38 ? 0.862   9.693   4.134   1.00 0.00 ? 122 GLU A HB3  1  
ATOM 592   H HG2  . GLU A 1 38 ? 0.101   11.488  2.679   1.00 0.00 ? 122 GLU A HG2  1  
ATOM 593   H HG3  . GLU A 1 38 ? -0.624  11.607  4.282   1.00 0.00 ? 122 GLU A HG3  1  
ATOM 594   N N    . GLY A 1 39 ? 0.846   9.748   7.677   1.00 0.00 ? 123 GLY A N    1  
ATOM 595   C CA   . GLY A 1 39 ? -0.100  9.182   8.654   1.00 0.00 ? 123 GLY A CA   1  
ATOM 596   C C    . GLY A 1 39 ? -1.185  10.094  9.236   1.00 0.00 ? 123 GLY A C    1  
ATOM 597   O O    . GLY A 1 39 ? -1.832  9.700   10.202  1.00 0.00 ? 123 GLY A O    1  
ATOM 598   H H    . GLY A 1 39 ? 1.794   9.526   7.781   1.00 0.00 ? 123 GLY A H    1  
ATOM 599   H HA2  . GLY A 1 39 ? -0.600  8.354   8.180   1.00 0.00 ? 123 GLY A HA2  1  
ATOM 600   H HA3  . GLY A 1 39 ? 0.480   8.787   9.476   1.00 0.00 ? 123 GLY A HA3  1  
ATOM 601   N N    . VAL A 1 40 ? -1.328  11.307  8.727   1.00 0.00 ? 124 VAL A N    1  
ATOM 602   C CA   . VAL A 1 40 ? -2.414  12.208  9.110   1.00 0.00 ? 124 VAL A CA   1  
ATOM 603   C C    . VAL A 1 40 ? -3.774  11.502  9.076   1.00 0.00 ? 124 VAL A C    1  
ATOM 604   O O    . VAL A 1 40 ? -4.428  11.482  8.035   1.00 0.00 ? 124 VAL A O    1  
ATOM 605   C CB   . VAL A 1 40 ? -2.485  13.405  8.143   1.00 0.00 ? 124 VAL A CB   1  
ATOM 606   C CG1  . VAL A 1 40 ? -3.609  14.354  8.539   1.00 0.00 ? 124 VAL A CG1  1  
ATOM 607   C CG2  . VAL A 1 40 ? -1.141  14.117  8.061   1.00 0.00 ? 124 VAL A CG2  1  
ATOM 608   H H    . VAL A 1 40 ? -0.697  11.601  8.036   1.00 0.00 ? 124 VAL A H    1  
ATOM 609   H HA   . VAL A 1 40 ? -2.221  12.579  10.107  1.00 0.00 ? 124 VAL A HA   1  
ATOM 610   H HB   . VAL A 1 40 ? -2.716  13.019  7.162   1.00 0.00 ? 124 VAL A HB   1  
ATOM 611   H HG11 . VAL A 1 40 ? -3.454  14.698  9.550   1.00 0.00 ? 124 VAL A HG11 1  
ATOM 612   H HG12 . VAL A 1 40 ? -4.556  13.824  8.477   1.00 0.00 ? 124 VAL A HG12 1  
ATOM 613   H HG13 . VAL A 1 40 ? -3.623  15.197  7.865   1.00 0.00 ? 124 VAL A HG13 1  
ATOM 614   H HG21 . VAL A 1 40 ? -1.243  15.010  7.463   1.00 0.00 ? 124 VAL A HG21 1  
ATOM 615   H HG22 . VAL A 1 40 ? -0.412  13.459  7.598   1.00 0.00 ? 124 VAL A HG22 1  
ATOM 616   H HG23 . VAL A 1 40 ? -0.811  14.381  9.053   1.00 0.00 ? 124 VAL A HG23 1  
ATOM 617   N N    . GLN A 1 41 ? -4.173  10.929  10.218  1.00 0.00 ? 125 GLN A N    1  
ATOM 618   C CA   . GLN A 1 41 ? -5.444  10.209  10.355  1.00 0.00 ? 125 GLN A CA   1  
ATOM 619   C C    . GLN A 1 41 ? -5.595  9.121   9.291   1.00 0.00 ? 125 GLN A C    1  
ATOM 620   O O    . GLN A 1 41 ? -5.908  9.400   8.135   1.00 0.00 ? 125 GLN A O    1  
ATOM 621   C CB   . GLN A 1 41 ? -6.628  11.180  10.313  1.00 0.00 ? 125 GLN A CB   1  
ATOM 622   C CG   . GLN A 1 41 ? -6.741  12.041  11.560  1.00 0.00 ? 125 GLN A CG   1  
ATOM 623   C CD   . GLN A 1 41 ? -7.869  13.048  11.484  1.00 0.00 ? 125 GLN A CD   1  
ATOM 624   O OE1  . GLN A 1 41 ? -7.679  14.179  11.038  1.00 0.00 ? 125 GLN A OE1  1  
ATOM 625   N NE2  . GLN A 1 41 ? -9.053  12.649  11.918  1.00 0.00 ? 125 GLN A NE2  1  
ATOM 626   H H    . GLN A 1 41 ? -3.575  10.974  10.993  1.00 0.00 ? 125 GLN A H    1  
ATOM 627   H HA   . GLN A 1 41 ? -5.433  9.728   11.321  1.00 0.00 ? 125 GLN A HA   1  
ATOM 628   H HB2  . GLN A 1 41 ? -6.517  11.831  9.459   1.00 0.00 ? 125 GLN A HB2  1  
ATOM 629   H HB3  . GLN A 1 41 ? -7.542  10.613  10.208  1.00 0.00 ? 125 GLN A HB3  1  
ATOM 630   H HG2  . GLN A 1 41 ? -6.912  11.398  12.410  1.00 0.00 ? 125 GLN A HG2  1  
ATOM 631   H HG3  . GLN A 1 41 ? -5.811  12.574  11.695  1.00 0.00 ? 125 GLN A HG3  1  
ATOM 632   H HE21 . GLN A 1 41 ? -9.139  11.727  12.266  1.00 0.00 ? 125 GLN A HE21 1  
ATOM 633   H HE22 . GLN A 1 41 ? -9.800  13.286  11.878  1.00 0.00 ? 125 GLN A HE22 1  
ATOM 634   N N    . ASP A 1 42 ? -5.411  7.869   9.704   1.00 0.00 ? 126 ASP A N    1  
ATOM 635   C CA   . ASP A 1 42 ? -5.390  6.733   8.774   1.00 0.00 ? 126 ASP A CA   1  
ATOM 636   C C    . ASP A 1 42 ? -6.770  6.453   8.169   1.00 0.00 ? 126 ASP A C    1  
ATOM 637   O O    . ASP A 1 42 ? -6.978  5.423   7.527   1.00 0.00 ? 126 ASP A O    1  
ATOM 638   C CB   . ASP A 1 42 ? -4.852  5.472   9.469   1.00 0.00 ? 126 ASP A CB   1  
ATOM 639   C CG   . ASP A 1 42 ? -5.867  4.796   10.370  1.00 0.00 ? 126 ASP A CG   1  
ATOM 640   O OD1  . ASP A 1 42 ? -6.480  5.483   11.218  1.00 0.00 ? 126 ASP A OD1  1  
ATOM 641   O OD2  . ASP A 1 42 ? -6.049  3.563   10.243  1.00 0.00 ? 126 ASP A OD2  1  
ATOM 642   H H    . ASP A 1 42 ? -5.285  7.699   10.665  1.00 0.00 ? 126 ASP A H    1  
ATOM 643   H HA   . ASP A 1 42 ? -4.717  6.991   7.970   1.00 0.00 ? 126 ASP A HA   1  
ATOM 644   H HB2  . ASP A 1 42 ? -4.548  4.761   8.716   1.00 0.00 ? 126 ASP A HB2  1  
ATOM 645   H HB3  . ASP A 1 42 ? -3.992  5.740   10.066  1.00 0.00 ? 126 ASP A HB3  1  
ATOM 646   N N    . ASP A 1 43 ? -7.706  7.372   8.371   1.00 0.00 ? 127 ASP A N    1  
ATOM 647   C CA   . ASP A 1 43 ? -9.012  7.278   7.744   1.00 0.00 ? 127 ASP A CA   1  
ATOM 648   C C    . ASP A 1 43 ? -9.239  8.470   6.813   1.00 0.00 ? 127 ASP A C    1  
ATOM 649   O O    . ASP A 1 43 ? -10.249 8.531   6.115   1.00 0.00 ? 127 ASP A O    1  
ATOM 650   C CB   . ASP A 1 43 ? -10.125 7.191   8.792   1.00 0.00 ? 127 ASP A CB   1  
ATOM 651   C CG   . ASP A 1 43 ? -10.352 8.492   9.532   1.00 0.00 ? 127 ASP A CG   1  
ATOM 652   O OD1  . ASP A 1 43 ? -9.406  8.992   10.171  1.00 0.00 ? 127 ASP A OD1  1  
ATOM 653   O OD2  . ASP A 1 43 ? -11.488 9.016   9.487   1.00 0.00 ? 127 ASP A OD2  1  
ATOM 654   H H    . ASP A 1 43 ? -7.509  8.132   8.956   1.00 0.00 ? 127 ASP A H    1  
ATOM 655   H HA   . ASP A 1 43 ? -9.022  6.374   7.150   1.00 0.00 ? 127 ASP A HA   1  
ATOM 656   H HB2  . ASP A 1 43 ? -11.048 6.915   8.303   1.00 0.00 ? 127 ASP A HB2  1  
ATOM 657   H HB3  . ASP A 1 43 ? -9.868  6.428   9.513   1.00 0.00 ? 127 ASP A HB3  1  
ATOM 658   N N    . LEU A 1 44 ? -8.304  9.425   6.808   1.00 0.00 ? 128 LEU A N    1  
ATOM 659   C CA   . LEU A 1 44 ? -8.341  10.507  5.836   1.00 0.00 ? 128 LEU A CA   1  
ATOM 660   C C    . LEU A 1 44 ? -7.496  10.142  4.628   1.00 0.00 ? 128 LEU A C    1  
ATOM 661   O O    . LEU A 1 44 ? -7.784  10.557  3.506   1.00 0.00 ? 128 LEU A O    1  
ATOM 662   C CB   . LEU A 1 44 ? -7.852  11.823  6.441   1.00 0.00 ? 128 LEU A CB   1  
ATOM 663   C CG   . LEU A 1 44 ? -8.806  12.467  7.448   1.00 0.00 ? 128 LEU A CG   1  
ATOM 664   C CD1  . LEU A 1 44 ? -8.245  13.793  7.933   1.00 0.00 ? 128 LEU A CD1  1  
ATOM 665   C CD2  . LEU A 1 44 ? -10.183 12.664  6.828   1.00 0.00 ? 128 LEU A CD2  1  
ATOM 666   H H    . LEU A 1 44 ? -7.570  9.403   7.472   1.00 0.00 ? 128 LEU A H    1  
ATOM 667   H HA   . LEU A 1 44 ? -9.365  10.628  5.515   1.00 0.00 ? 128 LEU A HA   1  
ATOM 668   H HB2  . LEU A 1 44 ? -6.909  11.637  6.938   1.00 0.00 ? 128 LEU A HB2  1  
ATOM 669   H HB3  . LEU A 1 44 ? -7.683  12.524  5.639   1.00 0.00 ? 128 LEU A HB3  1  
ATOM 670   H HG   . LEU A 1 44 ? -8.913  11.814  8.303   1.00 0.00 ? 128 LEU A HG   1  
ATOM 671   H HD11 . LEU A 1 44 ? -8.914  14.219  8.667   1.00 0.00 ? 128 LEU A HD11 1  
ATOM 672   H HD12 . LEU A 1 44 ? -8.146  14.471  7.099   1.00 0.00 ? 128 LEU A HD12 1  
ATOM 673   H HD13 . LEU A 1 44 ? -7.275  13.631  8.383   1.00 0.00 ? 128 LEU A HD13 1  
ATOM 674   H HD21 . LEU A 1 44 ? -10.593 11.706  6.546   1.00 0.00 ? 128 LEU A HD21 1  
ATOM 675   H HD22 . LEU A 1 44 ? -10.098 13.290  5.952   1.00 0.00 ? 128 LEU A HD22 1  
ATOM 676   H HD23 . LEU A 1 44 ? -10.837 13.137  7.546   1.00 0.00 ? 128 LEU A HD23 1  
ATOM 677   N N    . PHE A 1 45 ? -6.450  9.365   4.858   1.00 0.00 ? 129 PHE A N    1  
ATOM 678   C CA   . PHE A 1 45 ? -5.667  8.822   3.765   1.00 0.00 ? 129 PHE A CA   1  
ATOM 679   C C    . PHE A 1 45 ? -5.905  7.321   3.685   1.00 0.00 ? 129 PHE A C    1  
ATOM 680   O O    . PHE A 1 45 ? -5.923  6.630   4.703   1.00 0.00 ? 129 PHE A O    1  
ATOM 681   C CB   . PHE A 1 45 ? -4.169  9.136   3.928   1.00 0.00 ? 129 PHE A CB   1  
ATOM 682   C CG   . PHE A 1 45 ? -3.453  8.289   4.948   1.00 0.00 ? 129 PHE A CG   1  
ATOM 683   C CD1  . PHE A 1 45 ? -3.440  8.649   6.285   1.00 0.00 ? 129 PHE A CD1  1  
ATOM 684   C CD2  . PHE A 1 45 ? -2.790  7.133   4.564   1.00 0.00 ? 129 PHE A CD2  1  
ATOM 685   C CE1  . PHE A 1 45 ? -2.783  7.873   7.217   1.00 0.00 ? 129 PHE A CE1  1  
ATOM 686   C CE2  . PHE A 1 45 ? -2.131  6.353   5.494   1.00 0.00 ? 129 PHE A CE2  1  
ATOM 687   C CZ   . PHE A 1 45 ? -2.129  6.723   6.823   1.00 0.00 ? 129 PHE A CZ   1  
ATOM 688   H H    . PHE A 1 45 ? -6.202  9.146   5.783   1.00 0.00 ? 129 PHE A H    1  
ATOM 689   H HA   . PHE A 1 45 ? -6.023  9.276   2.850   1.00 0.00 ? 129 PHE A HA   1  
ATOM 690   H HB2  . PHE A 1 45 ? -3.676  8.989   2.978   1.00 0.00 ? 129 PHE A HB2  1  
ATOM 691   H HB3  . PHE A 1 45 ? -4.062  10.170  4.221   1.00 0.00 ? 129 PHE A HB3  1  
ATOM 692   H HD1  . PHE A 1 45 ? -3.952  9.548   6.597   1.00 0.00 ? 129 PHE A HD1  1  
ATOM 693   H HD2  . PHE A 1 45 ? -2.792  6.841   3.524   1.00 0.00 ? 129 PHE A HD2  1  
ATOM 694   H HE1  . PHE A 1 45 ? -2.783  8.163   8.258   1.00 0.00 ? 129 PHE A HE1  1  
ATOM 695   H HE2  . PHE A 1 45 ? -1.620  5.455   5.182   1.00 0.00 ? 129 PHE A HE2  1  
ATOM 696   H HZ   . PHE A 1 45 ? -1.615  6.115   7.553   1.00 0.00 ? 129 PHE A HZ   1  
ATOM 697   N N    . TRP A 1 46 ? -6.113  6.825   2.481   1.00 0.00 ? 130 TRP A N    1  
ATOM 698   C CA   . TRP A 1 46 ? -6.417  5.421   2.286   1.00 0.00 ? 130 TRP A CA   1  
ATOM 699   C C    . TRP A 1 46 ? -6.027  4.996   0.876   1.00 0.00 ? 130 TRP A C    1  
ATOM 700   O O    . TRP A 1 46 ? -6.289  5.702   -0.090  1.00 0.00 ? 130 TRP A O    1  
ATOM 701   C CB   . TRP A 1 46 ? -7.904  5.179   2.559   1.00 0.00 ? 130 TRP A CB   1  
ATOM 702   C CG   . TRP A 1 46 ? -8.346  3.758   2.394   1.00 0.00 ? 130 TRP A CG   1  
ATOM 703   C CD1  . TRP A 1 46 ? -9.536  3.344   1.881   1.00 0.00 ? 130 TRP A CD1  1  
ATOM 704   C CD2  . TRP A 1 46 ? -7.618  2.567   2.728   1.00 0.00 ? 130 TRP A CD2  1  
ATOM 705   N NE1  . TRP A 1 46 ? -9.606  1.980   1.886   1.00 0.00 ? 130 TRP A NE1  1  
ATOM 706   C CE2  . TRP A 1 46 ? -8.440  1.478   2.390   1.00 0.00 ? 130 TRP A CE2  1  
ATOM 707   C CE3  . TRP A 1 46 ? -6.356  2.311   3.277   1.00 0.00 ? 130 TRP A CE3  1  
ATOM 708   C CZ2  . TRP A 1 46 ? -8.047  0.163   2.579   1.00 0.00 ? 130 TRP A CZ2  1  
ATOM 709   C CZ3  . TRP A 1 46 ? -5.966  0.999   3.458   1.00 0.00 ? 130 TRP A CZ3  1  
ATOM 710   C CH2  . TRP A 1 46 ? -6.811  -0.060  3.107   1.00 0.00 ? 130 TRP A CH2  1  
ATOM 711   H H    . TRP A 1 46 ? -6.060  7.419   1.696   1.00 0.00 ? 130 TRP A H    1  
ATOM 712   H HA   . TRP A 1 46 ? -5.831  4.855   2.996   1.00 0.00 ? 130 TRP A HA   1  
ATOM 713   H HB2  . TRP A 1 46 ? -8.126  5.475   3.573   1.00 0.00 ? 130 TRP A HB2  1  
ATOM 714   H HB3  . TRP A 1 46 ? -8.487  5.787   1.881   1.00 0.00 ? 130 TRP A HB3  1  
ATOM 715   H HD1  . TRP A 1 46 ? -10.308 4.007   1.536   1.00 0.00 ? 130 TRP A HD1  1  
ATOM 716   H HE1  . TRP A 1 46 ? -10.364 1.450   1.571   1.00 0.00 ? 130 TRP A HE1  1  
ATOM 717   H HE3  . TRP A 1 46 ? -5.692  3.116   3.553   1.00 0.00 ? 130 TRP A HE3  1  
ATOM 718   H HZ2  . TRP A 1 46 ? -8.684  -0.668  2.313   1.00 0.00 ? 130 TRP A HZ2  1  
ATOM 719   H HZ3  . TRP A 1 46 ? -4.991  0.779   3.873   1.00 0.00 ? 130 TRP A HZ3  1  
ATOM 720   H HH2  . TRP A 1 46 ? -6.467  -1.067  3.251   1.00 0.00 ? 130 TRP A HH2  1  
ATOM 721   N N    . LEU A 1 47 ? -5.392  3.846   0.766   1.00 0.00 ? 131 LEU A N    1  
ATOM 722   C CA   . LEU A 1 47 ? -4.857  3.393   -0.505  1.00 0.00 ? 131 LEU A CA   1  
ATOM 723   C C    . LEU A 1 47 ? -5.728  2.294   -1.094  1.00 0.00 ? 131 LEU A C    1  
ATOM 724   O O    . LEU A 1 47 ? -6.094  1.341   -0.411  1.00 0.00 ? 131 LEU A O    1  
ATOM 725   C CB   . LEU A 1 47 ? -3.415  2.886   -0.345  1.00 0.00 ? 131 LEU A CB   1  
ATOM 726   C CG   . LEU A 1 47 ? -2.359  3.943   0.015   1.00 0.00 ? 131 LEU A CG   1  
ATOM 727   C CD1  . LEU A 1 47 ? -2.473  4.369   1.473   1.00 0.00 ? 131 LEU A CD1  1  
ATOM 728   C CD2  . LEU A 1 47 ? -0.964  3.411   -0.270  1.00 0.00 ? 131 LEU A CD2  1  
ATOM 729   H H    . LEU A 1 47 ? -5.306  3.272   1.552   1.00 0.00 ? 131 LEU A H    1  
ATOM 730   H HA   . LEU A 1 47 ? -4.859  4.239   -1.181  1.00 0.00 ? 131 LEU A HA   1  
ATOM 731   H HB2  . LEU A 1 47 ? -3.409  2.132   0.430   1.00 0.00 ? 131 LEU A HB2  1  
ATOM 732   H HB3  . LEU A 1 47 ? -3.119  2.421   -1.274  1.00 0.00 ? 131 LEU A HB3  1  
ATOM 733   H HG   . LEU A 1 47 ? -2.514  4.818   -0.598  1.00 0.00 ? 131 LEU A HG   1  
ATOM 734   H HD11 . LEU A 1 47 ? -1.721  5.113   1.691   1.00 0.00 ? 131 LEU A HD11 1  
ATOM 735   H HD12 . LEU A 1 47 ? -2.325  3.511   2.112   1.00 0.00 ? 131 LEU A HD12 1  
ATOM 736   H HD13 . LEU A 1 47 ? -3.455  4.785   1.652   1.00 0.00 ? 131 LEU A HD13 1  
ATOM 737   H HD21 . LEU A 1 47 ? -0.815  2.490   0.272   1.00 0.00 ? 131 LEU A HD21 1  
ATOM 738   H HD22 . LEU A 1 47 ? -0.230  4.137   0.044   1.00 0.00 ? 131 LEU A HD22 1  
ATOM 739   H HD23 . LEU A 1 47 ? -0.859  3.226   -1.329  1.00 0.00 ? 131 LEU A HD23 1  
ATOM 740   N N    . THR A 1 48 ? -6.056  2.444   -2.362  1.00 0.00 ? 132 THR A N    1  
ATOM 741   C CA   . THR A 1 48 ? -6.887  1.487   -3.068  1.00 0.00 ? 132 THR A CA   1  
ATOM 742   C C    . THR A 1 48 ? -6.285  1.197   -4.439  1.00 0.00 ? 132 THR A C    1  
ATOM 743   O O    . THR A 1 48 ? -5.752  2.095   -5.092  1.00 0.00 ? 132 THR A O    1  
ATOM 744   C CB   . THR A 1 48 ? -8.323  2.027   -3.204  1.00 0.00 ? 132 THR A CB   1  
ATOM 745   O OG1  . THR A 1 48 ? -8.298  3.376   -3.684  1.00 0.00 ? 132 THR A OG1  1  
ATOM 746   C CG2  . THR A 1 48 ? -9.046  1.980   -1.866  1.00 0.00 ? 132 THR A CG2  1  
ATOM 747   H H    . THR A 1 48 ? -5.726  3.230   -2.850  1.00 0.00 ? 132 THR A H    1  
ATOM 748   H HA   . THR A 1 48 ? -6.920  0.567   -2.493  1.00 0.00 ? 132 THR A HA   1  
ATOM 749   H HB   . THR A 1 48 ? -8.859  1.408   -3.909  1.00 0.00 ? 132 THR A HB   1  
ATOM 750   H HG1  . THR A 1 48 ? -8.928  3.903   -3.184  1.00 0.00 ? 132 THR A HG1  1  
ATOM 751   H HG21 . THR A 1 48 ? -8.319  1.917   -1.062  1.00 0.00 ? 132 THR A HG21 1  
ATOM 752   H HG22 . THR A 1 48 ? -9.696  1.120   -1.837  1.00 0.00 ? 132 THR A HG22 1  
ATOM 753   H HG23 . THR A 1 48 ? -9.634  2.877   -1.745  1.00 0.00 ? 132 THR A HG23 1  
ATOM 754   N N    . PHE A 1 49 ? -6.334  -0.058  -4.862  1.00 0.00 ? 133 PHE A N    1  
ATOM 755   C CA   . PHE A 1 49 ? -5.699  -0.445  -6.114  1.00 0.00 ? 133 PHE A CA   1  
ATOM 756   C C    . PHE A 1 49 ? -6.726  -0.695  -7.219  1.00 0.00 ? 133 PHE A C    1  
ATOM 757   O O    . PHE A 1 49 ? -7.004  0.192   -8.021  1.00 0.00 ? 133 PHE A O    1  
ATOM 758   C CB   . PHE A 1 49 ? -4.790  -1.667  -5.909  1.00 0.00 ? 133 PHE A CB   1  
ATOM 759   C CG   . PHE A 1 49 ? -4.305  -2.279  -7.192  1.00 0.00 ? 133 PHE A CG   1  
ATOM 760   C CD1  . PHE A 1 49 ? -3.941  -1.483  -8.266  1.00 0.00 ? 133 PHE A CD1  1  
ATOM 761   C CD2  . PHE A 1 49 ? -4.247  -3.653  -7.331  1.00 0.00 ? 133 PHE A CD2  1  
ATOM 762   C CE1  . PHE A 1 49 ? -3.536  -2.047  -9.457  1.00 0.00 ? 133 PHE A CE1  1  
ATOM 763   C CE2  . PHE A 1 49 ? -3.833  -4.223  -8.517  1.00 0.00 ? 133 PHE A CE2  1  
ATOM 764   C CZ   . PHE A 1 49 ? -3.482  -3.417  -9.582  1.00 0.00 ? 133 PHE A CZ   1  
ATOM 765   H H    . PHE A 1 49 ? -6.806  -0.730  -4.327  1.00 0.00 ? 133 PHE A H    1  
ATOM 766   H HA   . PHE A 1 49 ? -5.084  0.382   -6.421  1.00 0.00 ? 133 PHE A HA   1  
ATOM 767   H HB2  . PHE A 1 49 ? -3.923  -1.370  -5.339  1.00 0.00 ? 133 PHE A HB2  1  
ATOM 768   H HB3  . PHE A 1 49 ? -5.333  -2.422  -5.362  1.00 0.00 ? 133 PHE A HB3  1  
ATOM 769   H HD1  . PHE A 1 49 ? -3.983  -0.408  -8.168  1.00 0.00 ? 133 PHE A HD1  1  
ATOM 770   H HD2  . PHE A 1 49 ? -4.523  -4.283  -6.497  1.00 0.00 ? 133 PHE A HD2  1  
ATOM 771   H HE1  . PHE A 1 49 ? -3.256  -1.416  -10.287 1.00 0.00 ? 133 PHE A HE1  1  
ATOM 772   H HE2  . PHE A 1 49 ? -3.793  -5.297  -8.615  1.00 0.00 ? 133 PHE A HE2  1  
ATOM 773   H HZ   . PHE A 1 49 ? -3.179  -3.858  -10.513 1.00 0.00 ? 133 PHE A HZ   1  
ATOM 774   N N    . GLU A 1 50 ? -7.304  -1.889  -7.246  1.00 0.00 ? 134 GLU A N    1  
ATOM 775   C CA   . GLU A 1 50 ? -8.192  -2.292  -8.341  1.00 0.00 ? 134 GLU A CA   1  
ATOM 776   C C    . GLU A 1 50 ? -9.586  -1.673  -8.200  1.00 0.00 ? 134 GLU A C    1  
ATOM 777   O O    . GLU A 1 50 ? -10.567 -2.208  -8.715  1.00 0.00 ? 134 GLU A O    1  
ATOM 778   C CB   . GLU A 1 50 ? -8.306  -3.819  -8.395  1.00 0.00 ? 134 GLU A CB   1  
ATOM 779   C CG   . GLU A 1 50 ? -7.030  -4.491  -8.865  1.00 0.00 ? 134 GLU A CG   1  
ATOM 780   C CD   . GLU A 1 50 ? -7.112  -6.004  -8.895  1.00 0.00 ? 134 GLU A CD   1  
ATOM 781   O OE1  . GLU A 1 50 ? -8.110  -6.566  -8.403  1.00 0.00 ? 134 GLU A OE1  1  
ATOM 782   O OE2  . GLU A 1 50 ? -6.165  -6.642  -9.414  1.00 0.00 ? 134 GLU A OE2  1  
ATOM 783   H H    . GLU A 1 50 ? -7.123  -2.517  -6.521  1.00 0.00 ? 134 GLU A H    1  
ATOM 784   H HA   . GLU A 1 50 ? -7.740  -1.950  -9.266  1.00 0.00 ? 134 GLU A HA   1  
ATOM 785   H HB2  . GLU A 1 50 ? -8.543  -4.188  -7.407  1.00 0.00 ? 134 GLU A HB2  1  
ATOM 786   H HB3  . GLU A 1 50 ? -9.102  -4.087  -9.072  1.00 0.00 ? 134 GLU A HB3  1  
ATOM 787   H HG2  . GLU A 1 50 ? -6.805  -4.144  -9.862  1.00 0.00 ? 134 GLU A HG2  1  
ATOM 788   H HG3  . GLU A 1 50 ? -6.229  -4.203  -8.200  1.00 0.00 ? 134 GLU A HG3  1  
ATOM 789   N N    . GLY A 1 51 ? -9.663  -0.535  -7.520  1.00 0.00 ? 135 GLY A N    1  
ATOM 790   C CA   . GLY A 1 51 ? -10.945 0.090   -7.248  1.00 0.00 ? 135 GLY A CA   1  
ATOM 791   C C    . GLY A 1 51 ? -11.504 -0.357  -5.916  1.00 0.00 ? 135 GLY A C    1  
ATOM 792   O O    . GLY A 1 51 ? -12.512 0.166   -5.436  1.00 0.00 ? 135 GLY A O    1  
ATOM 793   H H    . GLY A 1 51 ? -8.836  -0.103  -7.217  1.00 0.00 ? 135 GLY A H    1  
ATOM 794   H HA2  . GLY A 1 51 ? -10.819 1.163   -7.237  1.00 0.00 ? 135 GLY A HA2  1  
ATOM 795   H HA3  . GLY A 1 51 ? -11.641 -0.176  -8.028  1.00 0.00 ? 135 GLY A HA3  1  
ATOM 796   N N    . LYS A 1 52 ? -10.834 -1.325  -5.315  1.00 0.00 ? 136 LYS A N    1  
ATOM 797   C CA   . LYS A 1 52 ? -11.250 -1.865  -4.035  1.00 0.00 ? 136 LYS A CA   1  
ATOM 798   C C    . LYS A 1 52 ? -10.227 -1.508  -2.972  1.00 0.00 ? 136 LYS A C    1  
ATOM 799   O O    . LYS A 1 52 ? -9.055  -1.280  -3.287  1.00 0.00 ? 136 LYS A O    1  
ATOM 800   C CB   . LYS A 1 52 ? -11.409 -3.386  -4.118  1.00 0.00 ? 136 LYS A CB   1  
ATOM 801   C CG   . LYS A 1 52 ? -12.472 -3.837  -5.104  1.00 0.00 ? 136 LYS A CG   1  
ATOM 802   C CD   . LYS A 1 52 ? -12.645 -5.346  -5.075  1.00 0.00 ? 136 LYS A CD   1  
ATOM 803   C CE   . LYS A 1 52 ? -13.630 -5.817  -6.133  1.00 0.00 ? 136 LYS A CE   1  
ATOM 804   N NZ   . LYS A 1 52 ? -13.175 -5.476  -7.506  1.00 0.00 ? 136 LYS A NZ   1  
ATOM 805   H H    . LYS A 1 52 ? -10.028 -1.678  -5.739  1.00 0.00 ? 136 LYS A H    1  
ATOM 806   H HA   . LYS A 1 52 ? -12.199 -1.418  -3.775  1.00 0.00 ? 136 LYS A HA   1  
ATOM 807   H HB2  . LYS A 1 52 ? -10.466 -3.818  -4.415  1.00 0.00 ? 136 LYS A HB2  1  
ATOM 808   H HB3  . LYS A 1 52 ? -11.675 -3.761  -3.141  1.00 0.00 ? 136 LYS A HB3  1  
ATOM 809   H HG2  . LYS A 1 52 ? -13.410 -3.371  -4.848  1.00 0.00 ? 136 LYS A HG2  1  
ATOM 810   H HG3  . LYS A 1 52 ? -12.176 -3.536  -6.099  1.00 0.00 ? 136 LYS A HG3  1  
ATOM 811   H HD2  . LYS A 1 52 ? -11.689 -5.810  -5.260  1.00 0.00 ? 136 LYS A HD2  1  
ATOM 812   H HD3  . LYS A 1 52 ? -13.008 -5.639  -4.102  1.00 0.00 ? 136 LYS A HD3  1  
ATOM 813   H HE2  . LYS A 1 52 ? -13.735 -6.888  -6.057  1.00 0.00 ? 136 LYS A HE2  1  
ATOM 814   H HE3  . LYS A 1 52 ? -14.586 -5.348  -5.952  1.00 0.00 ? 136 LYS A HE3  1  
ATOM 815   H HZ1  . LYS A 1 52 ? -13.789 -5.935  -8.213  1.00 0.00 ? 136 LYS A HZ1  1  
ATOM 816   H HZ2  . LYS A 1 52 ? -12.193 -5.801  -7.651  1.00 0.00 ? 136 LYS A HZ2  1  
ATOM 817   H HZ3  . LYS A 1 52 ? -13.211 -4.441  -7.651  1.00 0.00 ? 136 LYS A HZ3  1  
ATOM 818   N N    . PRO A 1 53 ? -10.654 -1.454  -1.704  1.00 0.00 ? 137 PRO A N    1  
ATOM 819   C CA   . PRO A 1 53 ? -9.771  -1.133  -0.582  1.00 0.00 ? 137 PRO A CA   1  
ATOM 820   C C    . PRO A 1 53 ? -8.879  -2.309  -0.204  1.00 0.00 ? 137 PRO A C    1  
ATOM 821   O O    . PRO A 1 53 ? -7.991  -2.183  0.638   1.00 0.00 ? 137 PRO A O    1  
ATOM 822   C CB   . PRO A 1 53 ? -10.764 -0.801  0.534   1.00 0.00 ? 137 PRO A CB   1  
ATOM 823   C CG   . PRO A 1 53 ? -11.936 -1.665  0.245   1.00 0.00 ? 137 PRO A CG   1  
ATOM 824   C CD   . PRO A 1 53 ? -12.043 -1.704  -1.256  1.00 0.00 ? 137 PRO A CD   1  
ATOM 825   H HA   . PRO A 1 53 ? -9.157  -0.273  -0.791  1.00 0.00 ? 137 PRO A HA   1  
ATOM 826   H HB2  . PRO A 1 53 ? -10.324 -1.021  1.495   1.00 0.00 ? 137 PRO A HB2  1  
ATOM 827   H HB3  . PRO A 1 53 ? -11.027 0.242   0.480   1.00 0.00 ? 137 PRO A HB3  1  
ATOM 828   H HG2  . PRO A 1 53 ? -11.770 -2.659  0.639   1.00 0.00 ? 137 PRO A HG2  1  
ATOM 829   H HG3  . PRO A 1 53 ? -12.828 -1.234  0.675   1.00 0.00 ? 137 PRO A HG3  1  
ATOM 830   H HD2  . PRO A 1 53 ? -12.386 -2.673  -1.586  1.00 0.00 ? 137 PRO A HD2  1  
ATOM 831   H HD3  . PRO A 1 53 ? -12.707 -0.927  -1.609  1.00 0.00 ? 137 PRO A HD3  1  
ATOM 832   N N    . LEU A 1 54 ? -9.126  -3.441  -0.854  1.00 0.00 ? 138 LEU A N    1  
ATOM 833   C CA   . LEU A 1 54 ? -8.396  -4.680  -0.602  1.00 0.00 ? 138 LEU A CA   1  
ATOM 834   C C    . LEU A 1 54 ? -8.602  -5.156  0.836   1.00 0.00 ? 138 LEU A C    1  
ATOM 835   O O    . LEU A 1 54 ? -9.275  -4.501  1.638   1.00 0.00 ? 138 LEU A O    1  
ATOM 836   C CB   . LEU A 1 54 ? -6.899  -4.507  -0.896  1.00 0.00 ? 138 LEU A CB   1  
ATOM 837   C CG   . LEU A 1 54 ? -6.555  -4.097  -2.329  1.00 0.00 ? 138 LEU A CG   1  
ATOM 838   C CD1  . LEU A 1 54 ? -5.051  -3.939  -2.483  1.00 0.00 ? 138 LEU A CD1  1  
ATOM 839   C CD2  . LEU A 1 54 ? -7.090  -5.118  -3.323  1.00 0.00 ? 138 LEU A CD2  1  
ATOM 840   H H    . LEU A 1 54 ? -9.830  -3.443  -1.532  1.00 0.00 ? 138 LEU A H    1  
ATOM 841   H HA   . LEU A 1 54 ? -8.793  -5.429  -1.272  1.00 0.00 ? 138 LEU A HA   1  
ATOM 842   H HB2  . LEU A 1 54 ? -6.508  -3.753  -0.227  1.00 0.00 ? 138 LEU A HB2  1  
ATOM 843   H HB3  . LEU A 1 54 ? -6.404  -5.443  -0.685  1.00 0.00 ? 138 LEU A HB3  1  
ATOM 844   H HG   . LEU A 1 54 ? -7.016  -3.145  -2.546  1.00 0.00 ? 138 LEU A HG   1  
ATOM 845   H HD11 . LEU A 1 54 ? -4.819  -3.674  -3.503  1.00 0.00 ? 138 LEU A HD11 1  
ATOM 846   H HD12 . LEU A 1 54 ? -4.564  -4.869  -2.232  1.00 0.00 ? 138 LEU A HD12 1  
ATOM 847   H HD13 . LEU A 1 54 ? -4.703  -3.159  -1.821  1.00 0.00 ? 138 LEU A HD13 1  
ATOM 848   H HD21 . LEU A 1 54 ? -6.838  -4.811  -4.327  1.00 0.00 ? 138 LEU A HD21 1  
ATOM 849   H HD22 . LEU A 1 54 ? -8.165  -5.185  -3.226  1.00 0.00 ? 138 LEU A HD22 1  
ATOM 850   H HD23 . LEU A 1 54 ? -6.650  -6.083  -3.120  1.00 0.00 ? 138 LEU A HD23 1  
ATOM 851   N N    . GLU A 1 55 ? -8.046  -6.311  1.149   1.00 0.00 ? 139 GLU A N    1  
ATOM 852   C CA   . GLU A 1 55 ? -8.117  -6.846  2.493   1.00 0.00 ? 139 GLU A CA   1  
ATOM 853   C C    . GLU A 1 55 ? -6.779  -6.659  3.185   1.00 0.00 ? 139 GLU A C    1  
ATOM 854   O O    . GLU A 1 55 ? -5.827  -7.396  2.934   1.00 0.00 ? 139 GLU A O    1  
ATOM 855   C CB   . GLU A 1 55 ? -8.507  -8.330  2.476   1.00 0.00 ? 139 GLU A CB   1  
ATOM 856   C CG   . GLU A 1 55 ? -9.973  -8.589  2.141   1.00 0.00 ? 139 GLU A CG   1  
ATOM 857   C CD   . GLU A 1 55 ? -10.374 -8.109  0.759   1.00 0.00 ? 139 GLU A CD   1  
ATOM 858   O OE1  . GLU A 1 55 ? -9.773  -8.568  -0.231  1.00 0.00 ? 139 GLU A OE1  1  
ATOM 859   O OE2  . GLU A 1 55 ? -11.301 -7.276  0.656   1.00 0.00 ? 139 GLU A OE2  1  
ATOM 860   H H    . GLU A 1 55 ? -7.575  -6.818  0.458   1.00 0.00 ? 139 GLU A H    1  
ATOM 861   H HA   . GLU A 1 55 ? -8.870  -6.289  3.032   1.00 0.00 ? 139 GLU A HA   1  
ATOM 862   H HB2  . GLU A 1 55 ? -7.899  -8.838  1.742   1.00 0.00 ? 139 GLU A HB2  1  
ATOM 863   H HB3  . GLU A 1 55 ? -8.304  -8.751  3.449   1.00 0.00 ? 139 GLU A HB3  1  
ATOM 864   H HG2  . GLU A 1 55 ? -10.156 -9.652  2.198   1.00 0.00 ? 139 GLU A HG2  1  
ATOM 865   H HG3  . GLU A 1 55 ? -10.586 -8.083  2.873   1.00 0.00 ? 139 GLU A HG3  1  
ATOM 866   N N    . ASP A 1 56 ? -6.709  -5.654  4.044   1.00 0.00 ? 140 ASP A N    1  
ATOM 867   C CA   . ASP A 1 56 ? -5.480  -5.339  4.764   1.00 0.00 ? 140 ASP A CA   1  
ATOM 868   C C    . ASP A 1 56 ? -5.190  -6.387  5.830   1.00 0.00 ? 140 ASP A C    1  
ATOM 869   O O    . ASP A 1 56 ? -4.121  -6.388  6.438   1.00 0.00 ? 140 ASP A O    1  
ATOM 870   C CB   . ASP A 1 56 ? -5.554  -3.938  5.384   1.00 0.00 ? 140 ASP A CB   1  
ATOM 871   C CG   . ASP A 1 56 ? -6.737  -3.757  6.318   1.00 0.00 ? 140 ASP A CG   1  
ATOM 872   O OD1  . ASP A 1 56 ? -7.892  -3.802  5.838   1.00 0.00 ? 140 ASP A OD1  1  
ATOM 873   O OD2  . ASP A 1 56 ? -6.521  -3.541  7.528   1.00 0.00 ? 140 ASP A OD2  1  
ATOM 874   H H    . ASP A 1 56 ? -7.508  -5.102  4.200   1.00 0.00 ? 140 ASP A H    1  
ATOM 875   H HA   . ASP A 1 56 ? -4.677  -5.359  4.050   1.00 0.00 ? 140 ASP A HA   1  
ATOM 876   H HB2  . ASP A 1 56 ? -4.651  -3.754  5.945   1.00 0.00 ? 140 ASP A HB2  1  
ATOM 877   H HB3  . ASP A 1 56 ? -5.631  -3.208  4.591   1.00 0.00 ? 140 ASP A HB3  1  
ATOM 878   N N    . GLN A 1 57 ? -6.157  -7.265  6.056   1.00 0.00 ? 141 GLN A N    1  
ATOM 879   C CA   . GLN A 1 57 ? -5.955  -8.439  6.892   1.00 0.00 ? 141 GLN A CA   1  
ATOM 880   C C    . GLN A 1 57 ? -5.006  -9.421  6.204   1.00 0.00 ? 141 GLN A C    1  
ATOM 881   O O    . GLN A 1 57 ? -4.264  -10.155 6.856   1.00 0.00 ? 141 GLN A O    1  
ATOM 882   C CB   . GLN A 1 57 ? -7.301  -9.116  7.162   1.00 0.00 ? 141 GLN A CB   1  
ATOM 883   C CG   . GLN A 1 57 ? -7.188  -10.455 7.876   1.00 0.00 ? 141 GLN A CG   1  
ATOM 884   C CD   . GLN A 1 57 ? -8.527  -11.139 8.077   1.00 0.00 ? 141 GLN A CD   1  
ATOM 885   O OE1  . GLN A 1 57 ? -8.715  -11.880 9.037   1.00 0.00 ? 141 GLN A OE1  1  
ATOM 886   N NE2  . GLN A 1 57 ? -9.465  -10.906 7.170   1.00 0.00 ? 141 GLN A NE2  1  
ATOM 887   H H    . GLN A 1 57 ? -7.043  -7.108  5.662   1.00 0.00 ? 141 GLN A H    1  
ATOM 888   H HA   . GLN A 1 57 ? -5.520  -8.120  7.827   1.00 0.00 ? 141 GLN A HA   1  
ATOM 889   H HB2  . GLN A 1 57 ? -7.904  -8.459  7.770   1.00 0.00 ? 141 GLN A HB2  1  
ATOM 890   H HB3  . GLN A 1 57 ? -7.801  -9.277  6.219   1.00 0.00 ? 141 GLN A HB3  1  
ATOM 891   H HG2  . GLN A 1 57 ? -6.555  -11.105 7.293   1.00 0.00 ? 141 GLN A HG2  1  
ATOM 892   H HG3  . GLN A 1 57 ? -6.737  -10.291 8.844   1.00 0.00 ? 141 GLN A HG3  1  
ATOM 893   H HE21 . GLN A 1 57 ? -9.252  -10.312 6.422   1.00 0.00 ? 141 GLN A HE21 1  
ATOM 894   H HE22 . GLN A 1 57 ? -10.341 -11.332 7.289   1.00 0.00 ? 141 GLN A HE22 1  
ATOM 895   N N    . LEU A 1 58 ? -5.027  -9.410  4.880   1.00 0.00 ? 142 LEU A N    1  
ATOM 896   C CA   . LEU A 1 58 ? -4.251  -10.353 4.090   1.00 0.00 ? 142 LEU A CA   1  
ATOM 897   C C    . LEU A 1 58 ? -2.936  -9.727  3.633   1.00 0.00 ? 142 LEU A C    1  
ATOM 898   O O    . LEU A 1 58 ? -2.788  -8.500  3.636   1.00 0.00 ? 142 LEU A O    1  
ATOM 899   C CB   . LEU A 1 58 ? -5.070  -10.820 2.883   1.00 0.00 ? 142 LEU A CB   1  
ATOM 900   C CG   . LEU A 1 58 ? -6.362  -11.570 3.224   1.00 0.00 ? 142 LEU A CG   1  
ATOM 901   C CD1  . LEU A 1 58 ? -7.077  -12.000 1.954   1.00 0.00 ? 142 LEU A CD1  1  
ATOM 902   C CD2  . LEU A 1 58 ? -6.065  -12.776 4.106   1.00 0.00 ? 142 LEU A CD2  1  
ATOM 903   H H    . LEU A 1 58 ? -5.561  -8.731  4.416   1.00 0.00 ? 142 LEU A H    1  
ATOM 904   H HA   . LEU A 1 58 ? -4.032  -11.205 4.716   1.00 0.00 ? 142 LEU A HA   1  
ATOM 905   H HB2  . LEU A 1 58 ? -5.328  -9.952  2.292   1.00 0.00 ? 142 LEU A HB2  1  
ATOM 906   H HB3  . LEU A 1 58 ? -4.451  -11.471 2.285   1.00 0.00 ? 142 LEU A HB3  1  
ATOM 907   H HG   . LEU A 1 58 ? -7.020  -10.908 3.770   1.00 0.00 ? 142 LEU A HG   1  
ATOM 908   H HD11 . LEU A 1 58 ? -7.985  -12.526 2.211   1.00 0.00 ? 142 LEU A HD11 1  
ATOM 909   H HD12 . LEU A 1 58 ? -6.433  -12.652 1.383   1.00 0.00 ? 142 LEU A HD12 1  
ATOM 910   H HD13 . LEU A 1 58 ? -7.321  -11.129 1.365   1.00 0.00 ? 142 LEU A HD13 1  
ATOM 911   H HD21 . LEU A 1 58 ? -6.988  -13.274 4.361   1.00 0.00 ? 142 LEU A HD21 1  
ATOM 912   H HD22 . LEU A 1 58 ? -5.572  -12.452 5.010   1.00 0.00 ? 142 LEU A HD22 1  
ATOM 913   H HD23 . LEU A 1 58 ? -5.422  -13.461 3.574   1.00 0.00 ? 142 LEU A HD23 1  
ATOM 914   N N    . PRO A 1 59 ? -1.954  -10.562 3.247   1.00 0.00 ? 143 PRO A N    1  
ATOM 915   C CA   . PRO A 1 59 ? -0.650  -10.089 2.781   1.00 0.00 ? 143 PRO A CA   1  
ATOM 916   C C    . PRO A 1 59 ? -0.732  -9.455  1.395   1.00 0.00 ? 143 PRO A C    1  
ATOM 917   O O    . PRO A 1 59 ? -1.608  -9.792  0.594   1.00 0.00 ? 143 PRO A O    1  
ATOM 918   C CB   . PRO A 1 59 ? 0.215   -11.361 2.737   1.00 0.00 ? 143 PRO A CB   1  
ATOM 919   C CG   . PRO A 1 59 ? -0.591  -12.425 3.408   1.00 0.00 ? 143 PRO A CG   1  
ATOM 920   C CD   . PRO A 1 59 ? -2.027  -12.026 3.232   1.00 0.00 ? 143 PRO A CD   1  
ATOM 921   H HA   . PRO A 1 59 ? -0.217  -9.381  3.472   1.00 0.00 ? 143 PRO A HA   1  
ATOM 922   H HB2  . PRO A 1 59 ? 0.423   -11.617 1.709   1.00 0.00 ? 143 PRO A HB2  1  
ATOM 923   H HB3  . PRO A 1 59 ? 1.143   -11.183 3.261   1.00 0.00 ? 143 PRO A HB3  1  
ATOM 924   H HG2  . PRO A 1 59 ? -0.407  -13.378 2.936   1.00 0.00 ? 143 PRO A HG2  1  
ATOM 925   H HG3  . PRO A 1 59 ? -0.341  -12.468 4.457   1.00 0.00 ? 143 PRO A HG3  1  
ATOM 926   H HD2  . PRO A 1 59 ? -2.407  -12.386 2.284   1.00 0.00 ? 143 PRO A HD2  1  
ATOM 927   H HD3  . PRO A 1 59 ? -2.627  -12.393 4.050   1.00 0.00 ? 143 PRO A HD3  1  
ATOM 928   N N    . LEU A 1 60 ? 0.195   -8.550  1.113   1.00 0.00 ? 144 LEU A N    1  
ATOM 929   C CA   . LEU A 1 60 ? 0.217   -7.837  -0.155  1.00 0.00 ? 144 LEU A CA   1  
ATOM 930   C C    . LEU A 1 60 ? 0.621   -8.744  -1.304  1.00 0.00 ? 144 LEU A C    1  
ATOM 931   O O    . LEU A 1 60 ? 0.372   -8.418  -2.452  1.00 0.00 ? 144 LEU A O    1  
ATOM 932   C CB   . LEU A 1 60 ? 1.171   -6.645  -0.090  1.00 0.00 ? 144 LEU A CB   1  
ATOM 933   C CG   . LEU A 1 60 ? 0.512   -5.301  0.207   1.00 0.00 ? 144 LEU A CG   1  
ATOM 934   C CD1  . LEU A 1 60 ? 1.566   -4.218  0.362   1.00 0.00 ? 144 LEU A CD1  1  
ATOM 935   C CD2  . LEU A 1 60 ? -0.459  -4.931  -0.903  1.00 0.00 ? 144 LEU A CD2  1  
ATOM 936   H H    . LEU A 1 60 ? 0.893   -8.354  1.782   1.00 0.00 ? 144 LEU A H    1  
ATOM 937   H HA   . LEU A 1 60 ? -0.783  -7.472  -0.340  1.00 0.00 ? 144 LEU A HA   1  
ATOM 938   H HB2  . LEU A 1 60 ? 1.904   -6.841  0.677   1.00 0.00 ? 144 LEU A HB2  1  
ATOM 939   H HB3  . LEU A 1 60 ? 1.680   -6.569  -1.039  1.00 0.00 ? 144 LEU A HB3  1  
ATOM 940   H HG   . LEU A 1 60 ? -0.042  -5.371  1.132   1.00 0.00 ? 144 LEU A HG   1  
ATOM 941   H HD11 . LEU A 1 60 ? 2.131   -4.134  -0.555  1.00 0.00 ? 144 LEU A HD11 1  
ATOM 942   H HD12 . LEU A 1 60 ? 2.231   -4.475  1.172   1.00 0.00 ? 144 LEU A HD12 1  
ATOM 943   H HD13 . LEU A 1 60 ? 1.085   -3.277  0.575   1.00 0.00 ? 144 LEU A HD13 1  
ATOM 944   H HD21 . LEU A 1 60 ? -0.924  -3.985  -0.671  1.00 0.00 ? 144 LEU A HD21 1  
ATOM 945   H HD22 . LEU A 1 60 ? -1.218  -5.695  -0.990  1.00 0.00 ? 144 LEU A HD22 1  
ATOM 946   H HD23 . LEU A 1 60 ? 0.077   -4.849  -1.836  1.00 0.00 ? 144 LEU A HD23 1  
ATOM 947   N N    . GLY A 1 61 ? 1.243   -9.876  -0.996  1.00 0.00 ? 145 GLY A N    1  
ATOM 948   C CA   . GLY A 1 61 ? 1.651   -10.802 -2.040  1.00 0.00 ? 145 GLY A CA   1  
ATOM 949   C C    . GLY A 1 61 ? 0.508   -11.182 -2.965  1.00 0.00 ? 145 GLY A C    1  
ATOM 950   O O    . GLY A 1 61 ? 0.656   -11.171 -4.183  1.00 0.00 ? 145 GLY A O    1  
ATOM 951   H H    . GLY A 1 61 ? 1.440   -10.079 -0.058  1.00 0.00 ? 145 GLY A H    1  
ATOM 952   H HA2  . GLY A 1 61 ? 2.434   -10.344 -2.628  1.00 0.00 ? 145 GLY A HA2  1  
ATOM 953   H HA3  . GLY A 1 61 ? 2.037   -11.699 -1.580  1.00 0.00 ? 145 GLY A HA3  1  
ATOM 954   N N    . GLU A 1 62 ? -0.646  -11.464 -2.379  1.00 0.00 ? 146 GLU A N    1  
ATOM 955   C CA   . GLU A 1 62 ? -1.798  -11.943 -3.125  1.00 0.00 ? 146 GLU A CA   1  
ATOM 956   C C    . GLU A 1 62 ? -2.317  -10.908 -4.131  1.00 0.00 ? 146 GLU A C    1  
ATOM 957   O O    . GLU A 1 62 ? -2.753  -11.262 -5.228  1.00 0.00 ? 146 GLU A O    1  
ATOM 958   C CB   . GLU A 1 62 ? -2.905  -12.317 -2.141  1.00 0.00 ? 146 GLU A CB   1  
ATOM 959   C CG   . GLU A 1 62 ? -2.524  -13.441 -1.191  1.00 0.00 ? 146 GLU A CG   1  
ATOM 960   C CD   . GLU A 1 62 ? -2.169  -14.723 -1.918  1.00 0.00 ? 146 GLU A CD   1  
ATOM 961   O OE1  . GLU A 1 62 ? -3.093  -15.482 -2.275  1.00 0.00 ? 146 GLU A OE1  1  
ATOM 962   O OE2  . GLU A 1 62 ? -0.968  -14.976 -2.143  1.00 0.00 ? 146 GLU A OE2  1  
ATOM 963   H H    . GLU A 1 62 ? -0.729  -11.348 -1.412  1.00 0.00 ? 146 GLU A H    1  
ATOM 964   H HA   . GLU A 1 62 ? -1.499  -12.830 -3.662  1.00 0.00 ? 146 GLU A HA   1  
ATOM 965   H HB2  . GLU A 1 62 ? -3.154  -11.446 -1.551  1.00 0.00 ? 146 GLU A HB2  1  
ATOM 966   H HB3  . GLU A 1 62 ? -3.773  -12.622 -2.695  1.00 0.00 ? 146 GLU A HB3  1  
ATOM 967   H HG2  . GLU A 1 62 ? -1.670  -13.130 -0.608  1.00 0.00 ? 146 GLU A HG2  1  
ATOM 968   H HG3  . GLU A 1 62 ? -3.357  -13.637 -0.533  1.00 0.00 ? 146 GLU A HG3  1  
ATOM 969   N N    . TYR A 1 63 ? -2.285  -9.636  -3.755  1.00 0.00 ? 147 TYR A N    1  
ATOM 970   C CA   . TYR A 1 63 ? -2.825  -8.579  -4.606  1.00 0.00 ? 147 TYR A CA   1  
ATOM 971   C C    . TYR A 1 63 ? -1.724  -7.830  -5.355  1.00 0.00 ? 147 TYR A C    1  
ATOM 972   O O    . TYR A 1 63 ? -1.889  -7.453  -6.515  1.00 0.00 ? 147 TYR A O    1  
ATOM 973   C CB   . TYR A 1 63 ? -3.641  -7.593  -3.768  1.00 0.00 ? 147 TYR A CB   1  
ATOM 974   C CG   . TYR A 1 63 ? -4.727  -8.256  -2.956  1.00 0.00 ? 147 TYR A CG   1  
ATOM 975   C CD1  . TYR A 1 63 ? -5.768  -8.932  -3.578  1.00 0.00 ? 147 TYR A CD1  1  
ATOM 976   C CD2  . TYR A 1 63 ? -4.706  -8.216  -1.568  1.00 0.00 ? 147 TYR A CD2  1  
ATOM 977   C CE1  . TYR A 1 63 ? -6.758  -9.549  -2.841  1.00 0.00 ? 147 TYR A CE1  1  
ATOM 978   C CE2  . TYR A 1 63 ? -5.694  -8.829  -0.823  1.00 0.00 ? 147 TYR A CE2  1  
ATOM 979   C CZ   . TYR A 1 63 ? -6.716  -9.496  -1.465  1.00 0.00 ? 147 TYR A CZ   1  
ATOM 980   O OH   . TYR A 1 63 ? -7.703  -10.111 -0.734  1.00 0.00 ? 147 TYR A OH   1  
ATOM 981   H H    . TYR A 1 63 ? -1.884  -9.403  -2.893  1.00 0.00 ? 147 TYR A H    1  
ATOM 982   H HA   . TYR A 1 63 ? -3.479  -9.042  -5.330  1.00 0.00 ? 147 TYR A HA   1  
ATOM 983   H HB2  . TYR A 1 63 ? -2.982  -7.079  -3.084  1.00 0.00 ? 147 TYR A HB2  1  
ATOM 984   H HB3  . TYR A 1 63 ? -4.107  -6.871  -4.422  1.00 0.00 ? 147 TYR A HB3  1  
ATOM 985   H HD1  . TYR A 1 63 ? -5.798  -8.970  -4.657  1.00 0.00 ? 147 TYR A HD1  1  
ATOM 986   H HD2  . TYR A 1 63 ? -3.905  -7.691  -1.069  1.00 0.00 ? 147 TYR A HD2  1  
ATOM 987   H HE1  . TYR A 1 63 ? -7.560  -10.070 -3.344  1.00 0.00 ? 147 TYR A HE1  1  
ATOM 988   H HE2  . TYR A 1 63 ? -5.658  -8.787  0.256   1.00 0.00 ? 147 TYR A HE2  1  
ATOM 989   H HH   . TYR A 1 63 ? -8.243  -9.441  -0.288  1.00 0.00 ? 147 TYR A HH   1  
ATOM 990   N N    . GLY A 1 64 ? -0.602  -7.638  -4.679  1.00 0.00 ? 148 GLY A N    1  
ATOM 991   C CA   . GLY A 1 64 ? 0.453   -6.780  -5.180  1.00 0.00 ? 148 GLY A CA   1  
ATOM 992   C C    . GLY A 1 64 ? 1.589   -7.539  -5.832  1.00 0.00 ? 148 GLY A C    1  
ATOM 993   O O    . GLY A 1 64 ? 2.610   -6.945  -6.159  1.00 0.00 ? 148 GLY A O    1  
ATOM 994   H H    . GLY A 1 64 ? -0.480  -8.092  -3.817  1.00 0.00 ? 148 GLY A H    1  
ATOM 995   H HA2  . GLY A 1 64 ? 0.029   -6.101  -5.906  1.00 0.00 ? 148 GLY A HA2  1  
ATOM 996   H HA3  . GLY A 1 64 ? 0.851   -6.202  -4.358  1.00 0.00 ? 148 GLY A HA3  1  
ATOM 997   N N    . LEU A 1 65 ? 1.428   -8.855  -5.985  1.00 0.00 ? 149 LEU A N    1  
ATOM 998   C CA   . LEU A 1 65 ? 2.402   -9.696  -6.697  1.00 0.00 ? 149 LEU A CA   1  
ATOM 999   C C    . LEU A 1 65 ? 2.821   -9.081  -8.037  1.00 0.00 ? 149 LEU A C    1  
ATOM 1000  O O    . LEU A 1 65 ? 3.911   -9.353  -8.542  1.00 0.00 ? 149 LEU A O    1  
ATOM 1001  C CB   . LEU A 1 65 ? 1.827   -11.101 -6.946  1.00 0.00 ? 149 LEU A CB   1  
ATOM 1002  C CG   . LEU A 1 65 ? 0.747   -11.218 -8.040  1.00 0.00 ? 149 LEU A CG   1  
ATOM 1003  C CD1  . LEU A 1 65 ? 0.348   -12.673 -8.231  1.00 0.00 ? 149 LEU A CD1  1  
ATOM 1004  C CD2  . LEU A 1 65 ? -0.478  -10.377 -7.705  1.00 0.00 ? 149 LEU A CD2  1  
ATOM 1005  H H    . LEU A 1 65 ? 0.641   -9.285  -5.587  1.00 0.00 ? 149 LEU A H    1  
ATOM 1006  H HA   . LEU A 1 65 ? 3.274   -9.785  -6.071  1.00 0.00 ? 149 LEU A HA   1  
ATOM 1007  H HB2  . LEU A 1 65 ? 2.647   -11.754 -7.213  1.00 0.00 ? 149 LEU A HB2  1  
ATOM 1008  H HB3  . LEU A 1 65 ? 1.402   -11.455 -6.020  1.00 0.00 ? 149 LEU A HB3  1  
ATOM 1009  H HG   . LEU A 1 65 ? 1.153   -10.862 -8.977  1.00 0.00 ? 149 LEU A HG   1  
ATOM 1010  H HD11 . LEU A 1 65 ? -0.397  -12.742 -9.010  1.00 0.00 ? 149 LEU A HD11 1  
ATOM 1011  H HD12 . LEU A 1 65 ? -0.060  -13.060 -7.310  1.00 0.00 ? 149 LEU A HD12 1  
ATOM 1012  H HD13 . LEU A 1 65 ? 1.216   -13.250 -8.513  1.00 0.00 ? 149 LEU A HD13 1  
ATOM 1013  H HD21 . LEU A 1 65 ? -0.194  -9.331  -7.656  1.00 0.00 ? 149 LEU A HD21 1  
ATOM 1014  H HD22 . LEU A 1 65 ? -0.879  -10.685 -6.752  1.00 0.00 ? 149 LEU A HD22 1  
ATOM 1015  H HD23 . LEU A 1 65 ? -1.227  -10.509 -8.471  1.00 0.00 ? 149 LEU A HD23 1  
ATOM 1016  N N    . LYS A 1 66 ? 1.940   -8.271  -8.605  1.00 0.00 ? 150 LYS A N    1  
ATOM 1017  C CA   . LYS A 1 66 ? 2.202   -7.602  -9.865  1.00 0.00 ? 150 LYS A CA   1  
ATOM 1018  C C    . LYS A 1 66 ? 3.051   -6.352  -9.642  1.00 0.00 ? 150 LYS A C    1  
ATOM 1019  O O    . LYS A 1 66 ? 2.626   -5.431  -8.952  1.00 0.00 ? 150 LYS A O    1  
ATOM 1020  C CB   . LYS A 1 66 ? 0.875   -7.218  -10.534 1.00 0.00 ? 150 LYS A CB   1  
ATOM 1021  C CG   . LYS A 1 66 ? 0.016   -8.414  -10.918 1.00 0.00 ? 150 LYS A CG   1  
ATOM 1022  C CD   . LYS A 1 66 ? -1.352  -7.994  -11.446 1.00 0.00 ? 150 LYS A CD   1  
ATOM 1023  C CE   . LYS A 1 66 ? -2.219  -7.386  -10.352 1.00 0.00 ? 150 LYS A CE   1  
ATOM 1024  N NZ   . LYS A 1 66 ? -3.591  -7.077  -10.841 1.00 0.00 ? 150 LYS A NZ   1  
ATOM 1025  H H    . LYS A 1 66 ? 1.091   -8.103  -8.149  1.00 0.00 ? 150 LYS A H    1  
ATOM 1026  H HA   . LYS A 1 66 ? 2.739   -8.286  -10.507 1.00 0.00 ? 150 LYS A HA   1  
ATOM 1027  H HB2  . LYS A 1 66 ? 0.309   -6.598  -9.852  1.00 0.00 ? 150 LYS A HB2  1  
ATOM 1028  H HB3  . LYS A 1 66 ? 1.089   -6.650  -11.427 1.00 0.00 ? 150 LYS A HB3  1  
ATOM 1029  H HG2  . LYS A 1 66 ? 0.526   -8.977  -11.685 1.00 0.00 ? 150 LYS A HG2  1  
ATOM 1030  H HG3  . LYS A 1 66 ? -0.123  -9.039  -10.047 1.00 0.00 ? 150 LYS A HG3  1  
ATOM 1031  H HD2  . LYS A 1 66 ? -1.215  -7.264  -12.227 1.00 0.00 ? 150 LYS A HD2  1  
ATOM 1032  H HD3  . LYS A 1 66 ? -1.853  -8.864  -11.848 1.00 0.00 ? 150 LYS A HD3  1  
ATOM 1033  H HE2  . LYS A 1 66 ? -2.286  -8.088  -9.535  1.00 0.00 ? 150 LYS A HE2  1  
ATOM 1034  H HE3  . LYS A 1 66 ? -1.755  -6.474  -10.009 1.00 0.00 ? 150 LYS A HE3  1  
ATOM 1035  H HZ1  . LYS A 1 66 ? -3.557  -6.318  -11.556 1.00 0.00 ? 150 LYS A HZ1  1  
ATOM 1036  H HZ2  . LYS A 1 66 ? -4.196  -6.764  -10.054 1.00 0.00 ? 150 LYS A HZ2  1  
ATOM 1037  H HZ3  . LYS A 1 66 ? -4.017  -7.925  -11.274 1.00 0.00 ? 150 LYS A HZ3  1  
ATOM 1038  N N    . PRO A 1 67 ? 4.258   -6.297  -10.230 1.00 0.00 ? 151 PRO A N    1  
ATOM 1039  C CA   . PRO A 1 67 ? 5.137   -5.119  -10.139 1.00 0.00 ? 151 PRO A CA   1  
ATOM 1040  C C    . PRO A 1 67 ? 4.530   -3.913  -10.856 1.00 0.00 ? 151 PRO A C    1  
ATOM 1041  O O    . PRO A 1 67 ? 5.002   -2.785  -10.735 1.00 0.00 ? 151 PRO A O    1  
ATOM 1042  C CB   . PRO A 1 67 ? 6.429   -5.568  -10.840 1.00 0.00 ? 151 PRO A CB   1  
ATOM 1043  C CG   . PRO A 1 67 ? 6.337   -7.054  -10.931 1.00 0.00 ? 151 PRO A CG   1  
ATOM 1044  C CD   . PRO A 1 67 ? 4.873   -7.372  -11.019 1.00 0.00 ? 151 PRO A CD   1  
ATOM 1045  H HA   . PRO A 1 67 ? 5.348   -4.859  -9.110  1.00 0.00 ? 151 PRO A HA   1  
ATOM 1046  H HB2  . PRO A 1 67 ? 6.484   -5.119  -11.821 1.00 0.00 ? 151 PRO A HB2  1  
ATOM 1047  H HB3  . PRO A 1 67 ? 7.286   -5.266  -10.254 1.00 0.00 ? 151 PRO A HB3  1  
ATOM 1048  H HG2  . PRO A 1 67 ? 6.850   -7.402  -11.816 1.00 0.00 ? 151 PRO A HG2  1  
ATOM 1049  H HG3  . PRO A 1 67 ? 6.766   -7.504  -10.047 1.00 0.00 ? 151 PRO A HG3  1  
ATOM 1050  H HD2  . PRO A 1 67 ? 4.539   -7.339  -12.046 1.00 0.00 ? 151 PRO A HD2  1  
ATOM 1051  H HD3  . PRO A 1 67 ? 4.668   -8.339  -10.582 1.00 0.00 ? 151 PRO A HD3  1  
ATOM 1052  N N    . LEU A 1 68 ? 3.468   -4.179  -11.598 1.00 0.00 ? 152 LEU A N    1  
ATOM 1053  C CA   . LEU A 1 68 ? 2.750   -3.151  -12.329 1.00 0.00 ? 152 LEU A CA   1  
ATOM 1054  C C    . LEU A 1 68 ? 1.502   -2.734  -11.560 1.00 0.00 ? 152 LEU A C    1  
ATOM 1055  O O    . LEU A 1 68 ? 0.729   -1.890  -12.021 1.00 0.00 ? 152 LEU A O    1  
ATOM 1056  C CB   . LEU A 1 68 ? 2.364   -3.667  -13.718 1.00 0.00 ? 152 LEU A CB   1  
ATOM 1057  C CG   . LEU A 1 68 ? 3.533   -4.094  -14.607 1.00 0.00 ? 152 LEU A CG   1  
ATOM 1058  C CD1  . LEU A 1 68 ? 3.019   -4.723  -15.892 1.00 0.00 ? 152 LEU A CD1  1  
ATOM 1059  C CD2  . LEU A 1 68 ? 4.428   -2.904  -14.919 1.00 0.00 ? 152 LEU A CD2  1  
ATOM 1060  H H    . LEU A 1 68 ? 3.155   -5.101  -11.648 1.00 0.00 ? 152 LEU A H    1  
ATOM 1061  H HA   . LEU A 1 68 ? 3.401   -2.296  -12.435 1.00 0.00 ? 152 LEU A HA   1  
ATOM 1062  H HB2  . LEU A 1 68 ? 1.709   -4.516  -13.593 1.00 0.00 ? 152 LEU A HB2  1  
ATOM 1063  H HB3  . LEU A 1 68 ? 1.819   -2.888  -14.231 1.00 0.00 ? 152 LEU A HB3  1  
ATOM 1064  H HG   . LEU A 1 68 ? 4.126   -4.833  -14.086 1.00 0.00 ? 152 LEU A HG   1  
ATOM 1065  H HD11 . LEU A 1 68 ? 3.853   -5.037  -16.500 1.00 0.00 ? 152 LEU A HD11 1  
ATOM 1066  H HD12 . LEU A 1 68 ? 2.427   -4.001  -16.436 1.00 0.00 ? 152 LEU A HD12 1  
ATOM 1067  H HD13 . LEU A 1 68 ? 2.405   -5.579  -15.650 1.00 0.00 ? 152 LEU A HD13 1  
ATOM 1068  H HD21 . LEU A 1 68 ? 4.840   -2.515  -14.000 1.00 0.00 ? 152 LEU A HD21 1  
ATOM 1069  H HD22 . LEU A 1 68 ? 3.846   -2.135  -15.407 1.00 0.00 ? 152 LEU A HD22 1  
ATOM 1070  H HD23 . LEU A 1 68 ? 5.230   -3.217  -15.569 1.00 0.00 ? 152 LEU A HD23 1  
ATOM 1071  N N    . SER A 1 69 ? 1.312   -3.329  -10.386 1.00 0.00 ? 153 SER A N    1  
ATOM 1072  C CA   . SER A 1 69 ? 0.170   -3.015  -9.546  1.00 0.00 ? 153 SER A CA   1  
ATOM 1073  C C    . SER A 1 69 ? 0.274   -1.579  -9.047  1.00 0.00 ? 153 SER A C    1  
ATOM 1074  O O    . SER A 1 69 ? 1.051   -1.270  -8.139  1.00 0.00 ? 153 SER A O    1  
ATOM 1075  C CB   . SER A 1 69 ? 0.070   -4.007  -8.375  1.00 0.00 ? 153 SER A CB   1  
ATOM 1076  O OG   . SER A 1 69 ? -0.901  -3.600  -7.425  1.00 0.00 ? 153 SER A OG   1  
ATOM 1077  H H    . SER A 1 69 ? 1.970   -3.987  -10.071 1.00 0.00 ? 153 SER A H    1  
ATOM 1078  H HA   . SER A 1 69 ? -0.719  -3.103  -10.155 1.00 0.00 ? 153 SER A HA   1  
ATOM 1079  H HB2  . SER A 1 69 ? -0.214  -4.975  -8.758  1.00 0.00 ? 153 SER A HB2  1  
ATOM 1080  H HB3  . SER A 1 69 ? 1.029   -4.089  -7.885  1.00 0.00 ? 153 SER A HB3  1  
ATOM 1081  H HG   . SER A 1 69 ? -0.503  -2.978  -6.810  1.00 0.00 ? 153 SER A HG   1  
ATOM 1082  N N    . THR A 1 70 ? -0.490  -0.698  -9.676  1.00 0.00 ? 154 THR A N    1  
ATOM 1083  C CA   . THR A 1 70 ? -0.456  0.711   -9.349  1.00 0.00 ? 154 THR A CA   1  
ATOM 1084  C C    . THR A 1 70 ? -1.484  1.044   -8.274  1.00 0.00 ? 154 THR A C    1  
ATOM 1085  O O    . THR A 1 70 ? -2.647  1.309   -8.570  1.00 0.00 ? 154 THR A O    1  
ATOM 1086  C CB   . THR A 1 70 ? -0.709  1.569   -10.601 1.00 0.00 ? 154 THR A CB   1  
ATOM 1087  O OG1  . THR A 1 70 ? 0.138   1.116   -11.669 1.00 0.00 ? 154 THR A OG1  1  
ATOM 1088  C CG2  . THR A 1 70 ? -0.430  3.040   -10.321 1.00 0.00 ? 154 THR A CG2  1  
ATOM 1089  H H    . THR A 1 70 ? -1.094  -1.008  -10.380 1.00 0.00 ? 154 THR A H    1  
ATOM 1090  H HA   . THR A 1 70 ? 0.531   0.942   -8.974  1.00 0.00 ? 154 THR A HA   1  
ATOM 1091  H HB   . THR A 1 70 ? -1.741  1.460   -10.897 1.00 0.00 ? 154 THR A HB   1  
ATOM 1092  H HG1  . THR A 1 70 ? 0.570   0.294   -11.404 1.00 0.00 ? 154 THR A HG1  1  
ATOM 1093  H HG21 . THR A 1 70 ? -0.634  3.619   -11.208 1.00 0.00 ? 154 THR A HG21 1  
ATOM 1094  H HG22 . THR A 1 70 ? 0.606   3.165   -10.041 1.00 0.00 ? 154 THR A HG22 1  
ATOM 1095  H HG23 . THR A 1 70 ? -1.065  3.380   -9.516  1.00 0.00 ? 154 THR A HG23 1  
ATOM 1096  N N    . VAL A 1 71 ? -1.048  0.998   -7.028  1.00 0.00 ? 155 VAL A N    1  
ATOM 1097  C CA   . VAL A 1 71 ? -1.907  1.329   -5.907  1.00 0.00 ? 155 VAL A CA   1  
ATOM 1098  C C    . VAL A 1 71 ? -2.034  2.841   -5.798  1.00 0.00 ? 155 VAL A C    1  
ATOM 1099  O O    . VAL A 1 71 ? -1.035  3.556   -5.743  1.00 0.00 ? 155 VAL A O    1  
ATOM 1100  C CB   . VAL A 1 71 ? -1.356  0.754   -4.583  1.00 0.00 ? 155 VAL A CB   1  
ATOM 1101  C CG1  . VAL A 1 71 ? -2.314  1.030   -3.434  1.00 0.00 ? 155 VAL A CG1  1  
ATOM 1102  C CG2  . VAL A 1 71 ? -1.088  -0.740  -4.713  1.00 0.00 ? 155 VAL A CG2  1  
ATOM 1103  H H    . VAL A 1 71 ? -0.113  0.755   -6.858  1.00 0.00 ? 155 VAL A H    1  
ATOM 1104  H HA   . VAL A 1 71 ? -2.884  0.902   -6.089  1.00 0.00 ? 155 VAL A HA   1  
ATOM 1105  H HB   . VAL A 1 71 ? -0.419  1.246   -4.364  1.00 0.00 ? 155 VAL A HB   1  
ATOM 1106  H HG11 . VAL A 1 71 ? -2.447  2.097   -3.329  1.00 0.00 ? 155 VAL A HG11 1  
ATOM 1107  H HG12 . VAL A 1 71 ? -1.907  0.627   -2.520  1.00 0.00 ? 155 VAL A HG12 1  
ATOM 1108  H HG13 . VAL A 1 71 ? -3.267  0.567   -3.642  1.00 0.00 ? 155 VAL A HG13 1  
ATOM 1109  H HG21 . VAL A 1 71 ? -0.386  -0.912  -5.516  1.00 0.00 ? 155 VAL A HG21 1  
ATOM 1110  H HG22 . VAL A 1 71 ? -2.013  -1.255  -4.928  1.00 0.00 ? 155 VAL A HG22 1  
ATOM 1111  H HG23 . VAL A 1 71 ? -0.675  -1.114  -3.787  1.00 0.00 ? 155 VAL A HG23 1  
ATOM 1112  N N    . PHE A 1 72 ? -3.255  3.334   -5.795  1.00 0.00 ? 156 PHE A N    1  
ATOM 1113  C CA   . PHE A 1 72 ? -3.478  4.763   -5.740  1.00 0.00 ? 156 PHE A CA   1  
ATOM 1114  C C    . PHE A 1 72 ? -3.650  5.222   -4.303  1.00 0.00 ? 156 PHE A C    1  
ATOM 1115  O O    . PHE A 1 72 ? -4.582  4.803   -3.609  1.00 0.00 ? 156 PHE A O    1  
ATOM 1116  C CB   . PHE A 1 72 ? -4.692  5.150   -6.581  1.00 0.00 ? 156 PHE A CB   1  
ATOM 1117  C CG   . PHE A 1 72 ? -4.491  4.908   -8.049  1.00 0.00 ? 156 PHE A CG   1  
ATOM 1118  C CD1  . PHE A 1 72 ? -3.742  5.789   -8.808  1.00 0.00 ? 156 PHE A CD1  1  
ATOM 1119  C CD2  . PHE A 1 72 ? -5.048  3.800   -8.665  1.00 0.00 ? 156 PHE A CD2  1  
ATOM 1120  C CE1  . PHE A 1 72 ? -3.553  5.572   -10.159 1.00 0.00 ? 156 PHE A CE1  1  
ATOM 1121  C CE2  . PHE A 1 72 ? -4.864  3.577   -10.016 1.00 0.00 ? 156 PHE A CE2  1  
ATOM 1122  C CZ   . PHE A 1 72 ? -4.115  4.466   -10.764 1.00 0.00 ? 156 PHE A CZ   1  
ATOM 1123  H H    . PHE A 1 72 ? -4.027  2.726   -5.827  1.00 0.00 ? 156 PHE A H    1  
ATOM 1124  H HA   . PHE A 1 72 ? -2.604  5.246   -6.152  1.00 0.00 ? 156 PHE A HA   1  
ATOM 1125  H HB2  . PHE A 1 72 ? -5.545  4.570   -6.262  1.00 0.00 ? 156 PHE A HB2  1  
ATOM 1126  H HB3  . PHE A 1 72 ? -4.902  6.200   -6.442  1.00 0.00 ? 156 PHE A HB3  1  
ATOM 1127  H HD1  . PHE A 1 72 ? -3.303  6.657   -8.336  1.00 0.00 ? 156 PHE A HD1  1  
ATOM 1128  H HD2  . PHE A 1 72 ? -5.633  3.106   -8.081  1.00 0.00 ? 156 PHE A HD2  1  
ATOM 1129  H HE1  . PHE A 1 72 ? -2.966  6.267   -10.741 1.00 0.00 ? 156 PHE A HE1  1  
ATOM 1130  H HE2  . PHE A 1 72 ? -5.305  2.712   -10.486 1.00 0.00 ? 156 PHE A HE2  1  
ATOM 1131  H HZ   . PHE A 1 72 ? -3.967  4.296   -11.819 1.00 0.00 ? 156 PHE A HZ   1  
ATOM 1132  N N    . MET A 1 73 ? -2.727  6.058   -3.856  1.00 0.00 ? 157 MET A N    1  
ATOM 1133  C CA   . MET A 1 73 ? -2.814  6.658   -2.540  1.00 0.00 ? 157 MET A CA   1  
ATOM 1134  C C    . MET A 1 73 ? -3.912  7.705   -2.573  1.00 0.00 ? 157 MET A C    1  
ATOM 1135  O O    . MET A 1 73 ? -3.753  8.774   -3.161  1.00 0.00 ? 157 MET A O    1  
ATOM 1136  C CB   . MET A 1 73 ? -1.465  7.270   -2.140  1.00 0.00 ? 157 MET A CB   1  
ATOM 1137  C CG   . MET A 1 73 ? -1.375  7.706   -0.683  1.00 0.00 ? 157 MET A CG   1  
ATOM 1138  S SD   . MET A 1 73 ? -2.255  9.242   -0.342  1.00 0.00 ? 157 MET A SD   1  
ATOM 1139  C CE   . MET A 1 73 ? -1.772  9.525   1.356   1.00 0.00 ? 157 MET A CE   1  
ATOM 1140  H H    . MET A 1 73 ? -1.970  6.295   -4.440  1.00 0.00 ? 157 MET A H    1  
ATOM 1141  H HA   . MET A 1 73 ? -3.084  5.884   -1.834  1.00 0.00 ? 157 MET A HA   1  
ATOM 1142  H HB2  . MET A 1 73 ? -0.688  6.542   -2.318  1.00 0.00 ? 157 MET A HB2  1  
ATOM 1143  H HB3  . MET A 1 73 ? -1.281  8.134   -2.761  1.00 0.00 ? 157 MET A HB3  1  
ATOM 1144  H HG2  . MET A 1 73 ? -1.795  6.926   -0.065  1.00 0.00 ? 157 MET A HG2  1  
ATOM 1145  H HG3  . MET A 1 73 ? -0.336  7.841   -0.427  1.00 0.00 ? 157 MET A HG3  1  
ATOM 1146  H HE1  . MET A 1 73 ? -0.698  9.612   1.415   1.00 0.00 ? 157 MET A HE1  1  
ATOM 1147  H HE2  . MET A 1 73 ? -2.100  8.699   1.969   1.00 0.00 ? 157 MET A HE2  1  
ATOM 1148  H HE3  . MET A 1 73 ? -2.226  10.438  1.711   1.00 0.00 ? 157 MET A HE3  1  
ATOM 1149  N N    . ASN A 1 74 ? -5.040  7.371   -1.979  1.00 0.00 ? 158 ASN A N    1  
ATOM 1150  C CA   . ASN A 1 74 ? -6.216  8.211   -2.058  1.00 0.00 ? 158 ASN A CA   1  
ATOM 1151  C C    . ASN A 1 74 ? -6.426  8.987   -0.772  1.00 0.00 ? 158 ASN A C    1  
ATOM 1152  O O    . ASN A 1 74 ? -5.979  8.581   0.302   1.00 0.00 ? 158 ASN A O    1  
ATOM 1153  C CB   . ASN A 1 74 ? -7.458  7.367   -2.363  1.00 0.00 ? 158 ASN A CB   1  
ATOM 1154  C CG   . ASN A 1 74 ? -7.709  7.192   -3.849  1.00 0.00 ? 158 ASN A CG   1  
ATOM 1155  O OD1  . ASN A 1 74 ? -8.399  8.002   -4.470  1.00 0.00 ? 158 ASN A OD1  1  
ATOM 1156  N ND2  . ASN A 1 74 ? -7.163  6.134   -4.428  1.00 0.00 ? 158 ASN A ND2  1  
ATOM 1157  H H    . ASN A 1 74 ? -5.080  6.542   -1.454  1.00 0.00 ? 158 ASN A H    1  
ATOM 1158  H HA   . ASN A 1 74 ? -6.068  8.912   -2.865  1.00 0.00 ? 158 ASN A HA   1  
ATOM 1159  H HB2  . ASN A 1 74 ? -7.331  6.387   -1.926  1.00 0.00 ? 158 ASN A HB2  1  
ATOM 1160  H HB3  . ASN A 1 74 ? -8.320  7.837   -1.922  1.00 0.00 ? 158 ASN A HB3  1  
ATOM 1161  H HD21 . ASN A 1 74 ? -6.628  5.523   -3.874  1.00 0.00 ? 158 ASN A HD21 1  
ATOM 1162  H HD22 . ASN A 1 74 ? -7.322  5.997   -5.383  1.00 0.00 ? 158 ASN A HD22 1  
ATOM 1163  N N    . LEU A 1 75 ? -7.094  10.119  -0.896  1.00 0.00 ? 159 LEU A N    1  
ATOM 1164  C CA   . LEU A 1 75 ? -7.486  10.906  0.254   1.00 0.00 ? 159 LEU A CA   1  
ATOM 1165  C C    . LEU A 1 75 ? -9.000  10.963  0.324   1.00 0.00 ? 159 LEU A C    1  
ATOM 1166  O O    . LEU A 1 75 ? -9.664  11.167  -0.695  1.00 0.00 ? 159 LEU A O    1  
ATOM 1167  C CB   . LEU A 1 75 ? -6.917  12.329  0.163   1.00 0.00 ? 159 LEU A CB   1  
ATOM 1168  C CG   . LEU A 1 75 ? -5.391  12.431  0.165   1.00 0.00 ? 159 LEU A CG   1  
ATOM 1169  C CD1  . LEU A 1 75 ? -4.956  13.874  -0.031  1.00 0.00 ? 159 LEU A CD1  1  
ATOM 1170  C CD2  . LEU A 1 75 ? -4.825  11.878  1.462   1.00 0.00 ? 159 LEU A CD2  1  
ATOM 1171  H H    . LEU A 1 75 ? -7.339  10.431  -1.791  1.00 0.00 ? 159 LEU A H    1  
ATOM 1172  H HA   . LEU A 1 75 ? -7.105  10.423  1.141   1.00 0.00 ? 159 LEU A HA   1  
ATOM 1173  H HB2  . LEU A 1 75 ? -7.284  12.779  -0.747  1.00 0.00 ? 159 LEU A HB2  1  
ATOM 1174  H HB3  . LEU A 1 75 ? -7.293  12.897  1.002   1.00 0.00 ? 159 LEU A HB3  1  
ATOM 1175  H HG   . LEU A 1 75 ? -4.996  11.846  -0.652  1.00 0.00 ? 159 LEU A HG   1  
ATOM 1176  H HD11 . LEU A 1 75 ? -3.879  13.930  -0.016  1.00 0.00 ? 159 LEU A HD11 1  
ATOM 1177  H HD12 . LEU A 1 75 ? -5.360  14.483  0.765   1.00 0.00 ? 159 LEU A HD12 1  
ATOM 1178  H HD13 . LEU A 1 75 ? -5.321  14.235  -0.980  1.00 0.00 ? 159 LEU A HD13 1  
ATOM 1179  H HD21 . LEU A 1 75 ? -5.131  10.849  1.577   1.00 0.00 ? 159 LEU A HD21 1  
ATOM 1180  H HD22 . LEU A 1 75 ? -5.193  12.460  2.292   1.00 0.00 ? 159 LEU A HD22 1  
ATOM 1181  H HD23 . LEU A 1 75 ? -3.746  11.932  1.434   1.00 0.00 ? 159 LEU A HD23 1  
ATOM 1182  N N    . ARG A 1 76 ? -9.547  10.756  1.508   1.00 0.00 ? 160 ARG A N    1  
ATOM 1183  C CA   . ARG A 1 76 ? -10.976 10.880  1.698   1.00 0.00 ? 160 ARG A CA   1  
ATOM 1184  C C    . ARG A 1 76 ? -11.331 12.351  1.822   1.00 0.00 ? 160 ARG A C    1  
ATOM 1185  O O    . ARG A 1 76 ? -11.001 13.005  2.812   1.00 0.00 ? 160 ARG A O    1  
ATOM 1186  C CB   . ARG A 1 76 ? -11.444 10.103  2.926   1.00 0.00 ? 160 ARG A CB   1  
ATOM 1187  C CG   . ARG A 1 76 ? -12.943 10.201  3.155   1.00 0.00 ? 160 ARG A CG   1  
ATOM 1188  C CD   . ARG A 1 76 ? -13.386 9.338   4.317   1.00 0.00 ? 160 ARG A CD   1  
ATOM 1189  N NE   . ARG A 1 76 ? -13.237 7.911   4.032   1.00 0.00 ? 160 ARG A NE   1  
ATOM 1190  C CZ   . ARG A 1 76 ? -13.052 6.978   4.964   1.00 0.00 ? 160 ARG A CZ   1  
ATOM 1191  N NH1  . ARG A 1 76 ? -12.922 7.321   6.242   1.00 0.00 ? 160 ARG A NH1  1  
ATOM 1192  N NH2  . ARG A 1 76 ? -12.980 5.700   4.612   1.00 0.00 ? 160 ARG A NH2  1  
ATOM 1193  H H    . ARG A 1 76 ? -8.971  10.527  2.275   1.00 0.00 ? 160 ARG A H    1  
ATOM 1194  H HA   . ARG A 1 76 ? -11.461 10.479  0.818   1.00 0.00 ? 160 ARG A HA   1  
ATOM 1195  H HB2  . ARG A 1 76 ? -11.186 9.062   2.801   1.00 0.00 ? 160 ARG A HB2  1  
ATOM 1196  H HB3  . ARG A 1 76 ? -10.941 10.490  3.800   1.00 0.00 ? 160 ARG A HB3  1  
ATOM 1197  H HG2  . ARG A 1 76 ? -13.200 11.227  3.365   1.00 0.00 ? 160 ARG A HG2  1  
ATOM 1198  H HG3  . ARG A 1 76 ? -13.456 9.874   2.261   1.00 0.00 ? 160 ARG A HG3  1  
ATOM 1199  H HD2  . ARG A 1 76 ? -12.788 9.588   5.180   1.00 0.00 ? 160 ARG A HD2  1  
ATOM 1200  H HD3  . ARG A 1 76 ? -14.424 9.548   4.525   1.00 0.00 ? 160 ARG A HD3  1  
ATOM 1201  H HE   . ARG A 1 76 ? -13.297 7.629   3.085   1.00 0.00 ? 160 ARG A HE   1  
ATOM 1202  H HH11 . ARG A 1 76 ? -12.961 8.290   6.512   1.00 0.00 ? 160 ARG A HH11 1  
ATOM 1203  H HH12 . ARG A 1 76 ? -12.775 6.618   6.938   1.00 0.00 ? 160 ARG A HH12 1  
ATOM 1204  H HH21 . ARG A 1 76 ? -13.067 5.436   3.646   1.00 0.00 ? 160 ARG A HH21 1  
ATOM 1205  H HH22 . ARG A 1 76 ? -12.838 4.989   5.312   1.00 0.00 ? 160 ARG A HH22 1  
ATOM 1206  N N    . ASP A 1 2  ? 8.817   -15.246 -1.530  1.00 0.00 ? 86  ASP A N    2  
ATOM 1207  C CA   . ASP A 1 2  ? 8.654   -13.969 -0.849  1.00 0.00 ? 86  ASP A CA   2  
ATOM 1208  C C    . ASP A 1 2  ? 9.880   -13.109 -1.096  1.00 0.00 ? 86  ASP A C    2  
ATOM 1209  O O    . ASP A 1 2  ? 10.899  -13.236 -0.413  1.00 0.00 ? 86  ASP A O    2  
ATOM 1210  C CB   . ASP A 1 2  ? 8.427   -14.155 0.652   1.00 0.00 ? 86  ASP A CB   2  
ATOM 1211  C CG   . ASP A 1 2  ? 8.169   -12.834 1.355   1.00 0.00 ? 86  ASP A CG   2  
ATOM 1212  O OD1  . ASP A 1 2  ? 7.027   -12.324 1.271   1.00 0.00 ? 86  ASP A OD1  2  
ATOM 1213  O OD2  . ASP A 1 2  ? 9.101   -12.303 1.997   1.00 0.00 ? 86  ASP A OD2  2  
ATOM 1214  H H    . ASP A 1 2  ? 9.214   -16.003 -1.048  1.00 0.00 ? 86  ASP A H    2  
ATOM 1215  H HA   . ASP A 1 2  ? 7.794   -13.475 -1.277  1.00 0.00 ? 86  ASP A HA   2  
ATOM 1216  H HB2  . ASP A 1 2  ? 7.570   -14.794 0.806   1.00 0.00 ? 86  ASP A HB2  2  
ATOM 1217  H HB3  . ASP A 1 2  ? 9.301   -14.612 1.091   1.00 0.00 ? 86  ASP A HB3  2  
ATOM 1218  N N    . GLU A 1 3  ? 9.787   -12.265 -2.102  1.00 0.00 ? 87  GLU A N    2  
ATOM 1219  C CA   . GLU A 1 3  ? 10.909  -11.460 -2.537  1.00 0.00 ? 87  GLU A CA   2  
ATOM 1220  C C    . GLU A 1 3  ? 10.516  -9.992  -2.573  1.00 0.00 ? 87  GLU A C    2  
ATOM 1221  O O    . GLU A 1 3  ? 9.329   -9.669  -2.544  1.00 0.00 ? 87  GLU A O    2  
ATOM 1222  C CB   . GLU A 1 3  ? 11.358  -11.933 -3.921  1.00 0.00 ? 87  GLU A CB   2  
ATOM 1223  C CG   . GLU A 1 3  ? 11.908  -13.346 -3.913  1.00 0.00 ? 87  GLU A CG   2  
ATOM 1224  C CD   . GLU A 1 3  ? 11.901  -13.988 -5.280  1.00 0.00 ? 87  GLU A CD   2  
ATOM 1225  O OE1  . GLU A 1 3  ? 12.613  -13.500 -6.180  1.00 0.00 ? 87  GLU A OE1  2  
ATOM 1226  O OE2  . GLU A 1 3  ? 11.193  -15.006 -5.453  1.00 0.00 ? 87  GLU A OE2  2  
ATOM 1227  H H    . GLU A 1 3  ? 8.930   -12.175 -2.570  1.00 0.00 ? 87  GLU A H    2  
ATOM 1228  H HA   . GLU A 1 3  ? 11.717  -11.593 -1.836  1.00 0.00 ? 87  GLU A HA   2  
ATOM 1229  H HB2  . GLU A 1 3  ? 10.512  -11.899 -4.593  1.00 0.00 ? 87  GLU A HB2  2  
ATOM 1230  H HB3  . GLU A 1 3  ? 12.128  -11.268 -4.287  1.00 0.00 ? 87  GLU A HB3  2  
ATOM 1231  H HG2  . GLU A 1 3  ? 12.924  -13.317 -3.552  1.00 0.00 ? 87  GLU A HG2  2  
ATOM 1232  H HG3  . GLU A 1 3  ? 11.306  -13.945 -3.245  1.00 0.00 ? 87  GLU A HG3  2  
ATOM 1233  N N    . PRO A 1 4  ? 11.507  -9.085  -2.606  1.00 0.00 ? 88  PRO A N    2  
ATOM 1234  C CA   . PRO A 1 4  ? 11.258  -7.648  -2.723  1.00 0.00 ? 88  PRO A CA   2  
ATOM 1235  C C    . PRO A 1 4  ? 10.399  -7.320  -3.937  1.00 0.00 ? 88  PRO A C    2  
ATOM 1236  O O    . PRO A 1 4  ? 10.823  -7.477  -5.087  1.00 0.00 ? 88  PRO A O    2  
ATOM 1237  C CB   . PRO A 1 4  ? 12.652  -7.046  -2.866  1.00 0.00 ? 88  PRO A CB   2  
ATOM 1238  C CG   . PRO A 1 4  ? 13.553  -8.039  -2.229  1.00 0.00 ? 88  PRO A CG   2  
ATOM 1239  C CD   . PRO A 1 4  ? 12.947  -9.384  -2.510  1.00 0.00 ? 88  PRO A CD   2  
ATOM 1240  H HA   . PRO A 1 4  ? 10.781  -7.259  -1.836  1.00 0.00 ? 88  PRO A HA   2  
ATOM 1241  H HB2  . PRO A 1 4  ? 12.884  -6.914  -3.914  1.00 0.00 ? 88  PRO A HB2  2  
ATOM 1242  H HB3  . PRO A 1 4  ? 12.690  -6.094  -2.359  1.00 0.00 ? 88  PRO A HB3  2  
ATOM 1243  H HG2  . PRO A 1 4  ? 14.539  -7.975  -2.663  1.00 0.00 ? 88  PRO A HG2  2  
ATOM 1244  H HG3  . PRO A 1 4  ? 13.597  -7.865  -1.164  1.00 0.00 ? 88  PRO A HG3  2  
ATOM 1245  H HD2  . PRO A 1 4  ? 13.322  -9.782  -3.441  1.00 0.00 ? 88  PRO A HD2  2  
ATOM 1246  H HD3  . PRO A 1 4  ? 13.144  -10.066 -1.698  1.00 0.00 ? 88  PRO A HD3  2  
ATOM 1247  N N    . LEU A 1 5  ? 9.187   -6.894  -3.659  1.00 0.00 ? 89  LEU A N    2  
ATOM 1248  C CA   . LEU A 1 5  ? 8.206   -6.597  -4.681  1.00 0.00 ? 89  LEU A CA   2  
ATOM 1249  C C    . LEU A 1 5  ? 8.026   -5.092  -4.807  1.00 0.00 ? 89  LEU A C    2  
ATOM 1250  O O    . LEU A 1 5  ? 7.491   -4.440  -3.909  1.00 0.00 ? 89  LEU A O    2  
ATOM 1251  C CB   . LEU A 1 5  ? 6.881   -7.272  -4.322  1.00 0.00 ? 89  LEU A CB   2  
ATOM 1252  C CG   . LEU A 1 5  ? 5.715   -7.012  -5.275  1.00 0.00 ? 89  LEU A CG   2  
ATOM 1253  C CD1  . LEU A 1 5  ? 6.034   -7.523  -6.674  1.00 0.00 ? 89  LEU A CD1  2  
ATOM 1254  C CD2  . LEU A 1 5  ? 4.455   -7.671  -4.728  1.00 0.00 ? 89  LEU A CD2  2  
ATOM 1255  H H    . LEU A 1 5  ? 8.936   -6.765  -2.713  1.00 0.00 ? 89  LEU A H    2  
ATOM 1256  H HA   . LEU A 1 5  ? 8.566   -6.991  -5.618  1.00 0.00 ? 89  LEU A HA   2  
ATOM 1257  H HB2  . LEU A 1 5  ? 7.046   -8.340  -4.281  1.00 0.00 ? 89  LEU A HB2  2  
ATOM 1258  H HB3  . LEU A 1 5  ? 6.590   -6.938  -3.337  1.00 0.00 ? 89  LEU A HB3  2  
ATOM 1259  H HG   . LEU A 1 5  ? 5.536   -5.947  -5.338  1.00 0.00 ? 89  LEU A HG   2  
ATOM 1260  H HD11 . LEU A 1 5  ? 6.917   -7.025  -7.047  1.00 0.00 ? 89  LEU A HD11 2  
ATOM 1261  H HD12 . LEU A 1 5  ? 5.202   -7.321  -7.332  1.00 0.00 ? 89  LEU A HD12 2  
ATOM 1262  H HD13 . LEU A 1 5  ? 6.212   -8.588  -6.637  1.00 0.00 ? 89  LEU A HD13 2  
ATOM 1263  H HD21 . LEU A 1 5  ? 3.627   -7.473  -5.394  1.00 0.00 ? 89  LEU A HD21 2  
ATOM 1264  H HD22 . LEU A 1 5  ? 4.235   -7.269  -3.751  1.00 0.00 ? 89  LEU A HD22 2  
ATOM 1265  H HD23 . LEU A 1 5  ? 4.610   -8.736  -4.654  1.00 0.00 ? 89  LEU A HD23 2  
ATOM 1266  N N    . SER A 1 6  ? 8.508   -4.541  -5.907  1.00 0.00 ? 90  SER A N    2  
ATOM 1267  C CA   . SER A 1 6  ? 8.392   -3.126  -6.164  1.00 0.00 ? 90  SER A CA   2  
ATOM 1268  C C    . SER A 1 6  ? 7.006   -2.781  -6.708  1.00 0.00 ? 90  SER A C    2  
ATOM 1269  O O    . SER A 1 6  ? 6.711   -3.021  -7.881  1.00 0.00 ? 90  SER A O    2  
ATOM 1270  C CB   . SER A 1 6  ? 9.467   -2.707  -7.162  1.00 0.00 ? 90  SER A CB   2  
ATOM 1271  O OG   . SER A 1 6  ? 10.759  -3.126  -6.742  1.00 0.00 ? 90  SER A OG   2  
ATOM 1272  H H    . SER A 1 6  ? 8.968   -5.102  -6.561  1.00 0.00 ? 90  SER A H    2  
ATOM 1273  H HA   . SER A 1 6  ? 8.548   -2.600  -5.234  1.00 0.00 ? 90  SER A HA   2  
ATOM 1274  H HB2  . SER A 1 6  ? 9.257   -3.150  -8.125  1.00 0.00 ? 90  SER A HB2  2  
ATOM 1275  H HB3  . SER A 1 6  ? 9.463   -1.637  -7.254  1.00 0.00 ? 90  SER A HB3  2  
ATOM 1276  H HG   . SER A 1 6  ? 10.726  -3.409  -5.808  1.00 0.00 ? 90  SER A HG   2  
ATOM 1277  N N    . ILE A 1 7  ? 6.154   -2.240  -5.849  1.00 0.00 ? 91  ILE A N    2  
ATOM 1278  C CA   . ILE A 1 7  ? 4.827   -1.810  -6.266  1.00 0.00 ? 91  ILE A CA   2  
ATOM 1279  C C    . ILE A 1 7  ? 4.797   -0.297  -6.441  1.00 0.00 ? 91  ILE A C    2  
ATOM 1280  O O    . ILE A 1 7  ? 5.476   0.433   -5.718  1.00 0.00 ? 91  ILE A O    2  
ATOM 1281  C CB   . ILE A 1 7  ? 3.730   -2.230  -5.262  1.00 0.00 ? 91  ILE A CB   2  
ATOM 1282  C CG1  . ILE A 1 7  ? 4.020   -1.656  -3.871  1.00 0.00 ? 91  ILE A CG1  2  
ATOM 1283  C CG2  . ILE A 1 7  ? 3.615   -3.748  -5.205  1.00 0.00 ? 91  ILE A CG2  2  
ATOM 1284  C CD1  . ILE A 1 7  ? 2.919   -1.917  -2.864  1.00 0.00 ? 91  ILE A CD1  2  
ATOM 1285  H H    . ILE A 1 7  ? 6.430   -2.115  -4.912  1.00 0.00 ? 91  ILE A H    2  
ATOM 1286  H HA   . ILE A 1 7  ? 4.611   -2.274  -7.219  1.00 0.00 ? 91  ILE A HA   2  
ATOM 1287  H HB   . ILE A 1 7  ? 2.787   -1.838  -5.614  1.00 0.00 ? 91  ILE A HB   2  
ATOM 1288  H HG12 . ILE A 1 7  ? 4.928   -2.098  -3.490  1.00 0.00 ? 91  ILE A HG12 2  
ATOM 1289  H HG13 . ILE A 1 7  ? 4.151   -0.586  -3.949  1.00 0.00 ? 91  ILE A HG13 2  
ATOM 1290  H HG21 . ILE A 1 7  ? 4.557   -4.169  -4.884  1.00 0.00 ? 91  ILE A HG21 2  
ATOM 1291  H HG22 . ILE A 1 7  ? 3.368   -4.127  -6.185  1.00 0.00 ? 91  ILE A HG22 2  
ATOM 1292  H HG23 . ILE A 1 7  ? 2.840   -4.024  -4.506  1.00 0.00 ? 91  ILE A HG23 2  
ATOM 1293  H HD11 . ILE A 1 7  ? 2.008   -1.441  -3.195  1.00 0.00 ? 91  ILE A HD11 2  
ATOM 1294  H HD12 . ILE A 1 7  ? 3.207   -1.517  -1.904  1.00 0.00 ? 91  ILE A HD12 2  
ATOM 1295  H HD13 . ILE A 1 7  ? 2.757   -2.982  -2.777  1.00 0.00 ? 91  ILE A HD13 2  
ATOM 1296  N N    . LEU A 1 8  ? 4.018   0.175   -7.396  1.00 0.00 ? 92  LEU A N    2  
ATOM 1297  C CA   . LEU A 1 8  ? 3.955   1.599   -7.670  1.00 0.00 ? 92  LEU A CA   2  
ATOM 1298  C C    . LEU A 1 8  ? 2.735   2.218   -7.008  1.00 0.00 ? 92  LEU A C    2  
ATOM 1299  O O    . LEU A 1 8  ? 1.602   1.947   -7.401  1.00 0.00 ? 92  LEU A O    2  
ATOM 1300  C CB   . LEU A 1 8  ? 3.928   1.854   -9.176  1.00 0.00 ? 92  LEU A CB   2  
ATOM 1301  C CG   . LEU A 1 8  ? 3.980   3.327   -9.580  1.00 0.00 ? 92  LEU A CG   2  
ATOM 1302  C CD1  . LEU A 1 8  ? 5.250   3.974   -9.056  1.00 0.00 ? 92  LEU A CD1  2  
ATOM 1303  C CD2  . LEU A 1 8  ? 3.900   3.463   -11.089 1.00 0.00 ? 92  LEU A CD2  2  
ATOM 1304  H H    . LEU A 1 8  ? 3.465   -0.443  -7.921  1.00 0.00 ? 92  LEU A H    2  
ATOM 1305  H HA   . LEU A 1 8  ? 4.843   2.052   -7.255  1.00 0.00 ? 92  LEU A HA   2  
ATOM 1306  H HB2  . LEU A 1 8  ? 4.771   1.349   -9.622  1.00 0.00 ? 92  LEU A HB2  2  
ATOM 1307  H HB3  . LEU A 1 8  ? 3.020   1.426   -9.576  1.00 0.00 ? 92  LEU A HB3  2  
ATOM 1308  H HG   . LEU A 1 8  ? 3.139   3.845   -9.149  1.00 0.00 ? 92  LEU A HG   2  
ATOM 1309  H HD11 . LEU A 1 8  ? 5.272   3.903   -7.977  1.00 0.00 ? 92  LEU A HD11 2  
ATOM 1310  H HD12 . LEU A 1 8  ? 5.273   5.013   -9.348  1.00 0.00 ? 92  LEU A HD12 2  
ATOM 1311  H HD13 . LEU A 1 8  ? 6.110   3.465   -9.466  1.00 0.00 ? 92  LEU A HD13 2  
ATOM 1312  H HD21 . LEU A 1 8  ? 4.724   2.932   -11.542 1.00 0.00 ? 92  LEU A HD21 2  
ATOM 1313  H HD22 . LEU A 1 8  ? 3.953   4.509   -11.356 1.00 0.00 ? 92  LEU A HD22 2  
ATOM 1314  H HD23 . LEU A 1 8  ? 2.967   3.048   -11.439 1.00 0.00 ? 92  LEU A HD23 2  
ATOM 1315  N N    . VAL A 1 9  ? 2.969   3.038   -5.998  1.00 0.00 ? 93  VAL A N    2  
ATOM 1316  C CA   . VAL A 1 9  ? 1.891   3.705   -5.293  1.00 0.00 ? 93  VAL A CA   2  
ATOM 1317  C C    . VAL A 1 9  ? 1.859   5.181   -5.651  1.00 0.00 ? 93  VAL A C    2  
ATOM 1318  O O    . VAL A 1 9  ? 2.819   5.915   -5.406  1.00 0.00 ? 93  VAL A O    2  
ATOM 1319  C CB   . VAL A 1 9  ? 2.018   3.556   -3.762  1.00 0.00 ? 93  VAL A CB   2  
ATOM 1320  C CG1  . VAL A 1 9  ? 0.894   4.303   -3.048  1.00 0.00 ? 93  VAL A CG1  2  
ATOM 1321  C CG2  . VAL A 1 9  ? 2.018   2.085   -3.366  1.00 0.00 ? 93  VAL A CG2  2  
ATOM 1322  H H    . VAL A 1 9  ? 3.899   3.217   -5.728  1.00 0.00 ? 93  VAL A H    2  
ATOM 1323  H HA   . VAL A 1 9  ? 0.960   3.248   -5.603  1.00 0.00 ? 93  VAL A HA   2  
ATOM 1324  H HB   . VAL A 1 9  ? 2.958   3.989   -3.454  1.00 0.00 ? 93  VAL A HB   2  
ATOM 1325  H HG11 . VAL A 1 9  ? 0.941   5.352   -3.303  1.00 0.00 ? 93  VAL A HG11 2  
ATOM 1326  H HG12 . VAL A 1 9  ? 1.005   4.189   -1.981  1.00 0.00 ? 93  VAL A HG12 2  
ATOM 1327  H HG13 . VAL A 1 9  ? -0.060  3.902   -3.356  1.00 0.00 ? 93  VAL A HG13 2  
ATOM 1328  H HG21 . VAL A 1 9  ? 2.101   2.001   -2.295  1.00 0.00 ? 93  VAL A HG21 2  
ATOM 1329  H HG22 . VAL A 1 9  ? 2.857   1.589   -3.833  1.00 0.00 ? 93  VAL A HG22 2  
ATOM 1330  H HG23 . VAL A 1 9  ? 1.099   1.623   -3.696  1.00 0.00 ? 93  VAL A HG23 2  
ATOM 1331  N N    . ARG A 1 10 ? 0.763   5.606   -6.254  1.00 0.00 ? 94  ARG A N    2  
ATOM 1332  C CA   . ARG A 1 10 ? 0.576   7.005   -6.587  1.00 0.00 ? 94  ARG A CA   2  
ATOM 1333  C C    . ARG A 1 10 ? -0.007  7.729   -5.381  1.00 0.00 ? 94  ARG A C    2  
ATOM 1334  O O    . ARG A 1 10 ? -1.200  7.618   -5.096  1.00 0.00 ? 94  ARG A O    2  
ATOM 1335  C CB   . ARG A 1 10 ? -0.343  7.135   -7.804  1.00 0.00 ? 94  ARG A CB   2  
ATOM 1336  C CG   . ARG A 1 10 ? -0.408  8.536   -8.392  1.00 0.00 ? 94  ARG A CG   2  
ATOM 1337  C CD   . ARG A 1 10 ? -1.174  8.534   -9.705  1.00 0.00 ? 94  ARG A CD   2  
ATOM 1338  N NE   . ARG A 1 10 ? -1.165  9.838   -10.365 1.00 0.00 ? 94  ARG A NE   2  
ATOM 1339  C CZ   . ARG A 1 10 ? -0.993  10.000  -11.675 1.00 0.00 ? 94  ARG A CZ   2  
ATOM 1340  N NH1  . ARG A 1 10 ? -0.751  8.952   -12.449 1.00 0.00 ? 94  ARG A NH1  2  
ATOM 1341  N NH2  . ARG A 1 10 ? -1.044  11.214  -12.208 1.00 0.00 ? 94  ARG A NH2  2  
ATOM 1342  H H    . ARG A 1 10 ? 0.054   4.959   -6.470  1.00 0.00 ? 94  ARG A H    2  
ATOM 1343  H HA   . ARG A 1 10 ? 1.544   7.428   -6.821  1.00 0.00 ? 94  ARG A HA   2  
ATOM 1344  H HB2  . ARG A 1 10 ? 0.004   6.465   -8.574  1.00 0.00 ? 94  ARG A HB2  2  
ATOM 1345  H HB3  . ARG A 1 10 ? -1.342  6.847   -7.513  1.00 0.00 ? 94  ARG A HB3  2  
ATOM 1346  H HG2  . ARG A 1 10 ? -0.909  9.189   -7.693  1.00 0.00 ? 94  ARG A HG2  2  
ATOM 1347  H HG3  . ARG A 1 10 ? 0.596   8.894   -8.570  1.00 0.00 ? 94  ARG A HG3  2  
ATOM 1348  H HD2  . ARG A 1 10 ? -0.725  7.806   -10.366 1.00 0.00 ? 94  ARG A HD2  2  
ATOM 1349  H HD3  . ARG A 1 10 ? -2.196  8.249   -9.507  1.00 0.00 ? 94  ARG A HD3  2  
ATOM 1350  H HE   . ARG A 1 10 ? -1.317  10.636  -9.803  1.00 0.00 ? 94  ARG A HE   2  
ATOM 1351  H HH11 . ARG A 1 10 ? -0.687  8.028   -12.051 1.00 0.00 ? 94  ARG A HH11 2  
ATOM 1352  H HH12 . ARG A 1 10 ? -0.639  9.073   -13.441 1.00 0.00 ? 94  ARG A HH12 2  
ATOM 1353  H HH21 . ARG A 1 10 ? -1.214  12.014  -11.626 1.00 0.00 ? 94  ARG A HH21 2  
ATOM 1354  H HH22 . ARG A 1 10 ? -0.911  11.337  -13.196 1.00 0.00 ? 94  ARG A HH22 2  
ATOM 1355  N N    . ASN A 1 11 ? 0.850   8.438   -4.662  1.00 0.00 ? 95  ASN A N    2  
ATOM 1356  C CA   . ASN A 1 11 ? 0.464   9.071   -3.409  1.00 0.00 ? 95  ASN A CA   2  
ATOM 1357  C C    . ASN A 1 11 ? -0.104  10.453  -3.608  1.00 0.00 ? 95  ASN A C    2  
ATOM 1358  O O    . ASN A 1 11 ? -0.263  10.939  -4.731  1.00 0.00 ? 95  ASN A O    2  
ATOM 1359  C CB   . ASN A 1 11 ? 1.649   9.203   -2.444  1.00 0.00 ? 95  ASN A CB   2  
ATOM 1360  C CG   . ASN A 1 11 ? 2.973   9.474   -3.139  1.00 0.00 ? 95  ASN A CG   2  
ATOM 1361  O OD1  . ASN A 1 11 ? 3.696   8.551   -3.515  1.00 0.00 ? 95  ASN A OD1  2  
ATOM 1362  N ND2  . ASN A 1 11 ? 3.304   10.742  -3.309  1.00 0.00 ? 95  ASN A ND2  2  
ATOM 1363  H H    . ASN A 1 11 ? 1.768   8.552   -4.992  1.00 0.00 ? 95  ASN A H    2  
ATOM 1364  H HA   . ASN A 1 11 ? -0.288  8.453   -2.945  1.00 0.00 ? 95  ASN A HA   2  
ATOM 1365  H HB2  . ASN A 1 11 ? 1.448   10.048  -1.786  1.00 0.00 ? 95  ASN A HB2  2  
ATOM 1366  H HB3  . ASN A 1 11 ? 1.737   8.300   -1.859  1.00 0.00 ? 95  ASN A HB3  2  
ATOM 1367  H HD21 . ASN A 1 11 ? 2.682   11.435  -2.981  1.00 0.00 ? 95  ASN A HD21 2  
ATOM 1368  H HD22 . ASN A 1 11 ? 4.152   10.943  -3.750  1.00 0.00 ? 95  ASN A HD22 2  
ATOM 1369  N N    . ASN A 1 12 ? -0.398  11.075  -2.479  1.00 0.00 ? 96  ASN A N    2  
ATOM 1370  C CA   . ASN A 1 12 ? -0.763  12.468  -2.437  1.00 0.00 ? 96  ASN A CA   2  
ATOM 1371  C C    . ASN A 1 12 ? 0.480   13.306  -2.744  1.00 0.00 ? 96  ASN A C    2  
ATOM 1372  O O    . ASN A 1 12 ? 1.579   12.772  -2.896  1.00 0.00 ? 96  ASN A O    2  
ATOM 1373  C CB   . ASN A 1 12 ? -1.353  12.797  -1.051  1.00 0.00 ? 96  ASN A CB   2  
ATOM 1374  C CG   . ASN A 1 12 ? -1.899  14.213  -0.929  1.00 0.00 ? 96  ASN A CG   2  
ATOM 1375  O OD1  . ASN A 1 12 ? -2.216  14.863  -1.925  1.00 0.00 ? 96  ASN A OD1  2  
ATOM 1376  N ND2  . ASN A 1 12 ? -2.074  14.673  0.301   1.00 0.00 ? 96  ASN A ND2  2  
ATOM 1377  H H    . ASN A 1 12 ? -0.358  10.571  -1.637  1.00 0.00 ? 96  ASN A H    2  
ATOM 1378  H HA   . ASN A 1 12 ? -1.509  12.644  -3.199  1.00 0.00 ? 96  ASN A HA   2  
ATOM 1379  H HB2  . ASN A 1 12 ? -2.159  12.110  -0.845  1.00 0.00 ? 96  ASN A HB2  2  
ATOM 1380  H HB3  . ASN A 1 12 ? -0.582  12.665  -0.305  1.00 0.00 ? 96  ASN A HB3  2  
ATOM 1381  H HD21 . ASN A 1 12 ? -1.855  14.082  1.052   1.00 0.00 ? 96  ASN A HD21 2  
ATOM 1382  H HD22 . ASN A 1 12 ? -2.407  15.589  0.411   1.00 0.00 ? 96  ASN A HD22 2  
ATOM 1383  N N    . LYS A 1 13 ? 0.290   14.605  -2.830  1.00 0.00 ? 97  LYS A N    2  
ATOM 1384  C CA   . LYS A 1 13 ? 1.319   15.546  -3.264  1.00 0.00 ? 97  LYS A CA   2  
ATOM 1385  C C    . LYS A 1 13 ? 1.727   15.299  -4.717  1.00 0.00 ? 97  LYS A C    2  
ATOM 1386  O O    . LYS A 1 13 ? 2.753   15.799  -5.177  1.00 0.00 ? 97  LYS A O    2  
ATOM 1387  C CB   . LYS A 1 13 ? 2.523   15.491  -2.321  1.00 0.00 ? 97  LYS A CB   2  
ATOM 1388  C CG   . LYS A 1 13 ? 2.135   15.781  -0.884  1.00 0.00 ? 97  LYS A CG   2  
ATOM 1389  C CD   . LYS A 1 13 ? 3.331   15.820  0.045   1.00 0.00 ? 97  LYS A CD   2  
ATOM 1390  C CE   . LYS A 1 13 ? 2.896   16.196  1.450   1.00 0.00 ? 97  LYS A CE   2  
ATOM 1391  N NZ   . LYS A 1 13 ? 2.122   15.112  2.109   1.00 0.00 ? 97  LYS A NZ   2  
ATOM 1392  H H    . LYS A 1 13 ? -0.573  14.949  -2.554  1.00 0.00 ? 97  LYS A H    2  
ATOM 1393  H HA   . LYS A 1 13 ? 0.888   16.534  -3.206  1.00 0.00 ? 97  LYS A HA   2  
ATOM 1394  H HB2  . LYS A 1 13 ? 2.966   14.506  -2.370  1.00 0.00 ? 97  LYS A HB2  2  
ATOM 1395  H HB3  . LYS A 1 13 ? 3.251   16.225  -2.634  1.00 0.00 ? 97  LYS A HB3  2  
ATOM 1396  H HG2  . LYS A 1 13 ? 1.637   16.737  -0.845  1.00 0.00 ? 97  LYS A HG2  2  
ATOM 1397  H HG3  . LYS A 1 13 ? 1.457   15.010  -0.546  1.00 0.00 ? 97  LYS A HG3  2  
ATOM 1398  H HD2  . LYS A 1 13 ? 3.797   14.848  0.065   1.00 0.00 ? 97  LYS A HD2  2  
ATOM 1399  H HD3  . LYS A 1 13 ? 4.034   16.557  -0.317  1.00 0.00 ? 97  LYS A HD3  2  
ATOM 1400  H HE2  . LYS A 1 13 ? 3.771   16.415  2.042   1.00 0.00 ? 97  LYS A HE2  2  
ATOM 1401  H HE3  . LYS A 1 13 ? 2.273   17.076  1.386   1.00 0.00 ? 97  LYS A HE3  2  
ATOM 1402  H HZ1  . LYS A 1 13 ? 2.729   14.275  2.267   1.00 0.00 ? 97  LYS A HZ1  2  
ATOM 1403  H HZ2  . LYS A 1 13 ? 1.320   14.827  1.515   1.00 0.00 ? 97  LYS A HZ2  2  
ATOM 1404  H HZ3  . LYS A 1 13 ? 1.753   15.436  3.029   1.00 0.00 ? 97  LYS A HZ3  2  
ATOM 1405  N N    . GLY A 1 14 ? 0.895   14.536  -5.428  1.00 0.00 ? 98  GLY A N    2  
ATOM 1406  C CA   . GLY A 1 14 ? 1.083   14.316  -6.852  1.00 0.00 ? 98  GLY A CA   2  
ATOM 1407  C C    . GLY A 1 14 ? 2.413   13.677  -7.210  1.00 0.00 ? 98  GLY A C    2  
ATOM 1408  O O    . GLY A 1 14 ? 3.259   14.313  -7.837  1.00 0.00 ? 98  GLY A O    2  
ATOM 1409  H H    . GLY A 1 14 ? 0.136   14.119  -4.974  1.00 0.00 ? 98  GLY A H    2  
ATOM 1410  H HA2  . GLY A 1 14 ? 0.290   13.677  -7.207  1.00 0.00 ? 98  GLY A HA2  2  
ATOM 1411  H HA3  . GLY A 1 14 ? 1.011   15.269  -7.358  1.00 0.00 ? 98  GLY A HA3  2  
ATOM 1412  N N    . ARG A 1 15 ? 2.606   12.420  -6.820  1.00 0.00 ? 99  ARG A N    2  
ATOM 1413  C CA   . ARG A 1 15 ? 3.821   11.700  -7.179  1.00 0.00 ? 99  ARG A CA   2  
ATOM 1414  C C    . ARG A 1 15 ? 3.590   10.195  -7.120  1.00 0.00 ? 99  ARG A C    2  
ATOM 1415  O O    . ARG A 1 15 ? 2.884   9.701   -6.243  1.00 0.00 ? 99  ARG A O    2  
ATOM 1416  C CB   . ARG A 1 15 ? 4.979   12.098  -6.256  1.00 0.00 ? 99  ARG A CB   2  
ATOM 1417  C CG   . ARG A 1 15 ? 6.330   11.588  -6.727  1.00 0.00 ? 99  ARG A CG   2  
ATOM 1418  C CD   . ARG A 1 15 ? 7.462   12.135  -5.877  1.00 0.00 ? 99  ARG A CD   2  
ATOM 1419  N NE   . ARG A 1 15 ? 8.768   11.829  -6.456  1.00 0.00 ? 99  ARG A NE   2  
ATOM 1420  C CZ   . ARG A 1 15 ? 9.868   12.549  -6.242  1.00 0.00 ? 99  ARG A CZ   2  
ATOM 1421  N NH1  . ARG A 1 15 ? 9.832   13.598  -5.428  1.00 0.00 ? 99  ARG A NH1  2  
ATOM 1422  N NH2  . ARG A 1 15 ? 10.997  12.217  -6.846  1.00 0.00 ? 99  ARG A NH2  2  
ATOM 1423  H H    . ARG A 1 15 ? 1.917   11.966  -6.286  1.00 0.00 ? 99  ARG A H    2  
ATOM 1424  H HA   . ARG A 1 15 ? 4.075   11.971  -8.193  1.00 0.00 ? 99  ARG A HA   2  
ATOM 1425  H HB2  . ARG A 1 15 ? 5.023   13.176  -6.198  1.00 0.00 ? 99  ARG A HB2  2  
ATOM 1426  H HB3  . ARG A 1 15 ? 4.792   11.699  -5.269  1.00 0.00 ? 99  ARG A HB3  2  
ATOM 1427  H HG2  . ARG A 1 15 ? 6.338   10.510  -6.668  1.00 0.00 ? 99  ARG A HG2  2  
ATOM 1428  H HG3  . ARG A 1 15 ? 6.480   11.894  -7.753  1.00 0.00 ? 99  ARG A HG3  2  
ATOM 1429  H HD2  . ARG A 1 15 ? 7.353   13.205  -5.801  1.00 0.00 ? 99  ARG A HD2  2  
ATOM 1430  H HD3  . ARG A 1 15 ? 7.401   11.694  -4.893  1.00 0.00 ? 99  ARG A HD3  2  
ATOM 1431  H HE   . ARG A 1 15 ? 8.827   11.048  -7.061  1.00 0.00 ? 99  ARG A HE   2  
ATOM 1432  H HH11 . ARG A 1 15 ? 8.980   13.851  -4.976  1.00 0.00 ? 99  ARG A HH11 2  
ATOM 1433  H HH12 . ARG A 1 15 ? 10.665  14.143  -5.262  1.00 0.00 ? 99  ARG A HH12 2  
ATOM 1434  H HH21 . ARG A 1 15 ? 11.023  11.425  -7.465  1.00 0.00 ? 99  ARG A HH21 2  
ATOM 1435  H HH22 . ARG A 1 15 ? 11.834  12.761  -6.698  1.00 0.00 ? 99  ARG A HH22 2  
ATOM 1436  N N    . SER A 1 16 ? 4.171   9.473   -8.064  1.00 0.00 ? 100 SER A N    2  
ATOM 1437  C CA   . SER A 1 16 ? 4.078   8.023   -8.079  1.00 0.00 ? 100 SER A CA   2  
ATOM 1438  C C    . SER A 1 16 ? 5.368   7.407   -7.535  1.00 0.00 ? 100 SER A C    2  
ATOM 1439  O O    . SER A 1 16 ? 6.389   7.369   -8.222  1.00 0.00 ? 100 SER A O    2  
ATOM 1440  C CB   . SER A 1 16 ? 3.806   7.523   -9.499  1.00 0.00 ? 100 SER A CB   2  
ATOM 1441  O OG   . SER A 1 16 ? 2.616   8.091   -10.025 1.00 0.00 ? 100 SER A OG   2  
ATOM 1442  H H    . SER A 1 16 ? 4.678   9.931   -8.773  1.00 0.00 ? 100 SER A H    2  
ATOM 1443  H HA   . SER A 1 16 ? 3.257   7.736   -7.439  1.00 0.00 ? 100 SER A HA   2  
ATOM 1444  H HB2  . SER A 1 16 ? 4.630   7.796   -10.140 1.00 0.00 ? 100 SER A HB2  2  
ATOM 1445  H HB3  . SER A 1 16 ? 3.701   6.447   -9.487  1.00 0.00 ? 100 SER A HB3  2  
ATOM 1446  H HG   . SER A 1 16 ? 2.716   9.056   -10.084 1.00 0.00 ? 100 SER A HG   2  
ATOM 1447  N N    . SER A 1 17 ? 5.317   6.937   -6.299  1.00 0.00 ? 101 SER A N    2  
ATOM 1448  C CA   . SER A 1 17 ? 6.493   6.390   -5.641  1.00 0.00 ? 101 SER A CA   2  
ATOM 1449  C C    . SER A 1 17 ? 6.488   4.866   -5.710  1.00 0.00 ? 101 SER A C    2  
ATOM 1450  O O    . SER A 1 17 ? 5.449   4.230   -5.538  1.00 0.00 ? 101 SER A O    2  
ATOM 1451  C CB   . SER A 1 17 ? 6.528   6.851   -4.183  1.00 0.00 ? 101 SER A CB   2  
ATOM 1452  O OG   . SER A 1 17 ? 6.380   8.260   -4.083  1.00 0.00 ? 101 SER A OG   2  
ATOM 1453  H H    . SER A 1 17 ? 4.457   6.940   -5.818  1.00 0.00 ? 101 SER A H    2  
ATOM 1454  H HA   . SER A 1 17 ? 7.368   6.765   -6.153  1.00 0.00 ? 101 SER A HA   2  
ATOM 1455  H HB2  . SER A 1 17 ? 5.723   6.379   -3.640  1.00 0.00 ? 101 SER A HB2  2  
ATOM 1456  H HB3  . SER A 1 17 ? 7.474   6.569   -3.739  1.00 0.00 ? 101 SER A HB3  2  
ATOM 1457  H HG   . SER A 1 17 ? 5.448   8.468   -3.916  1.00 0.00 ? 101 SER A HG   2  
ATOM 1458  N N    . THR A 1 18 ? 7.646   4.283   -5.974  1.00 0.00 ? 102 THR A N    2  
ATOM 1459  C CA   . THR A 1 18 ? 7.775   2.840   -6.000  1.00 0.00 ? 102 THR A CA   2  
ATOM 1460  C C    . THR A 1 18 ? 8.143   2.328   -4.609  1.00 0.00 ? 102 THR A C    2  
ATOM 1461  O O    . THR A 1 18 ? 9.206   2.650   -4.082  1.00 0.00 ? 102 THR A O    2  
ATOM 1462  C CB   . THR A 1 18 ? 8.849   2.398   -7.012  1.00 0.00 ? 102 THR A CB   2  
ATOM 1463  O OG1  . THR A 1 18 ? 8.587   2.995   -8.290  1.00 0.00 ? 102 THR A OG1  2  
ATOM 1464  C CG2  . THR A 1 18 ? 8.871   0.886   -7.158  1.00 0.00 ? 102 THR A CG2  2  
ATOM 1465  H H    . THR A 1 18 ? 8.443   4.838   -6.142  1.00 0.00 ? 102 THR A H    2  
ATOM 1466  H HA   . THR A 1 18 ? 6.824   2.419   -6.299  1.00 0.00 ? 102 THR A HA   2  
ATOM 1467  H HB   . THR A 1 18 ? 9.814   2.727   -6.657  1.00 0.00 ? 102 THR A HB   2  
ATOM 1468  H HG1  . THR A 1 18 ? 8.094   3.814   -8.164  1.00 0.00 ? 102 THR A HG1  2  
ATOM 1469  H HG21 . THR A 1 18 ? 9.633   0.606   -7.871  1.00 0.00 ? 102 THR A HG21 2  
ATOM 1470  H HG22 . THR A 1 18 ? 7.908   0.545   -7.508  1.00 0.00 ? 102 THR A HG22 2  
ATOM 1471  H HG23 . THR A 1 18 ? 9.088   0.433   -6.202  1.00 0.00 ? 102 THR A HG23 2  
ATOM 1472  N N    . TYR A 1 19 ? 7.255   1.553   -4.010  1.00 0.00 ? 103 TYR A N    2  
ATOM 1473  C CA   . TYR A 1 19 ? 7.478   1.039   -2.670  1.00 0.00 ? 103 TYR A CA   2  
ATOM 1474  C C    . TYR A 1 19 ? 7.944   -0.406  -2.716  1.00 0.00 ? 103 TYR A C    2  
ATOM 1475  O O    . TYR A 1 19 ? 7.412   -1.219  -3.474  1.00 0.00 ? 103 TYR A O    2  
ATOM 1476  C CB   . TYR A 1 19 ? 6.209   1.161   -1.827  1.00 0.00 ? 103 TYR A CB   2  
ATOM 1477  C CG   . TYR A 1 19 ? 5.923   2.577   -1.387  1.00 0.00 ? 103 TYR A CG   2  
ATOM 1478  C CD1  . TYR A 1 19 ? 5.213   3.449   -2.200  1.00 0.00 ? 103 TYR A CD1  2  
ATOM 1479  C CD2  . TYR A 1 19 ? 6.372   3.040   -0.159  1.00 0.00 ? 103 TYR A CD2  2  
ATOM 1480  C CE1  . TYR A 1 19 ? 4.959   4.747   -1.801  1.00 0.00 ? 103 TYR A CE1  2  
ATOM 1481  C CE2  . TYR A 1 19 ? 6.120   4.335   0.248   1.00 0.00 ? 103 TYR A CE2  2  
ATOM 1482  C CZ   . TYR A 1 19 ? 5.415   5.184   -0.576  1.00 0.00 ? 103 TYR A CZ   2  
ATOM 1483  O OH   . TYR A 1 19 ? 5.173   6.478   -0.177  1.00 0.00 ? 103 TYR A OH   2  
ATOM 1484  H H    . TYR A 1 19 ? 6.433   1.301   -4.493  1.00 0.00 ? 103 TYR A H    2  
ATOM 1485  H HA   . TYR A 1 19 ? 8.257   1.637   -2.217  1.00 0.00 ? 103 TYR A HA   2  
ATOM 1486  H HB2  . TYR A 1 19 ? 5.365   0.815   -2.405  1.00 0.00 ? 103 TYR A HB2  2  
ATOM 1487  H HB3  . TYR A 1 19 ? 6.312   0.549   -0.943  1.00 0.00 ? 103 TYR A HB3  2  
ATOM 1488  H HD1  . TYR A 1 19 ? 4.857   3.103   -3.159  1.00 0.00 ? 103 TYR A HD1  2  
ATOM 1489  H HD2  . TYR A 1 19 ? 6.927   2.373   0.482   1.00 0.00 ? 103 TYR A HD2  2  
ATOM 1490  H HE1  . TYR A 1 19 ? 4.405   5.411   -2.448  1.00 0.00 ? 103 TYR A HE1  2  
ATOM 1491  H HE2  . TYR A 1 19 ? 6.476   4.675   1.210   1.00 0.00 ? 103 TYR A HE2  2  
ATOM 1492  H HH   . TYR A 1 19 ? 4.263   6.709   -0.378  1.00 0.00 ? 103 TYR A HH   2  
ATOM 1493  N N    . GLU A 1 20 ? 8.944   -0.714  -1.907  1.00 0.00 ? 104 GLU A N    2  
ATOM 1494  C CA   . GLU A 1 20 ? 9.494   -2.057  -1.847  1.00 0.00 ? 104 GLU A CA   2  
ATOM 1495  C C    . GLU A 1 20 ? 8.796   -2.839  -0.743  1.00 0.00 ? 104 GLU A C    2  
ATOM 1496  O O    . GLU A 1 20 ? 9.014   -2.587  0.445   1.00 0.00 ? 104 GLU A O    2  
ATOM 1497  C CB   . GLU A 1 20 ? 10.997  -2.003  -1.576  1.00 0.00 ? 104 GLU A CB   2  
ATOM 1498  C CG   . GLU A 1 20 ? 11.759  -3.195  -2.121  1.00 0.00 ? 104 GLU A CG   2  
ATOM 1499  C CD   . GLU A 1 20 ? 11.892  -3.145  -3.627  1.00 0.00 ? 104 GLU A CD   2  
ATOM 1500  O OE1  . GLU A 1 20 ? 12.538  -2.200  -4.135  1.00 0.00 ? 104 GLU A OE1  2  
ATOM 1501  O OE2  . GLU A 1 20 ? 11.364  -4.042  -4.310  1.00 0.00 ? 104 GLU A OE2  2  
ATOM 1502  H H    . GLU A 1 20 ? 9.319   -0.018  -1.323  1.00 0.00 ? 104 GLU A H    2  
ATOM 1503  H HA   . GLU A 1 20 ? 9.315   -2.538  -2.797  1.00 0.00 ? 104 GLU A HA   2  
ATOM 1504  H HB2  . GLU A 1 20 ? 11.401  -1.109  -2.026  1.00 0.00 ? 104 GLU A HB2  2  
ATOM 1505  H HB3  . GLU A 1 20 ? 11.158  -1.959  -0.508  1.00 0.00 ? 104 GLU A HB3  2  
ATOM 1506  H HG2  . GLU A 1 20 ? 12.746  -3.209  -1.685  1.00 0.00 ? 104 GLU A HG2  2  
ATOM 1507  H HG3  . GLU A 1 20 ? 11.233  -4.101  -1.849  1.00 0.00 ? 104 GLU A HG3  2  
ATOM 1508  N N    . VAL A 1 21 ? 7.934   -3.760  -1.133  1.00 0.00 ? 105 VAL A N    2  
ATOM 1509  C CA   . VAL A 1 21 ? 7.194   -4.561  -0.177  1.00 0.00 ? 105 VAL A CA   2  
ATOM 1510  C C    . VAL A 1 21 ? 7.477   -6.037  -0.398  1.00 0.00 ? 105 VAL A C    2  
ATOM 1511  O O    . VAL A 1 21 ? 8.269   -6.394  -1.263  1.00 0.00 ? 105 VAL A O    2  
ATOM 1512  C CB   . VAL A 1 21 ? 5.670   -4.309  -0.273  1.00 0.00 ? 105 VAL A CB   2  
ATOM 1513  C CG1  . VAL A 1 21 ? 5.350   -2.848  0.007   1.00 0.00 ? 105 VAL A CG1  2  
ATOM 1514  C CG2  . VAL A 1 21 ? 5.130   -4.728  -1.635  1.00 0.00 ? 105 VAL A CG2  2  
ATOM 1515  H H    . VAL A 1 21 ? 7.801   -3.915  -2.097  1.00 0.00 ? 105 VAL A H    2  
ATOM 1516  H HA   . VAL A 1 21 ? 7.523   -4.283  0.814   1.00 0.00 ? 105 VAL A HA   2  
ATOM 1517  H HB   . VAL A 1 21 ? 5.183   -4.907  0.481   1.00 0.00 ? 105 VAL A HB   2  
ATOM 1518  H HG11 . VAL A 1 21 ? 4.282   -2.697  -0.051  1.00 0.00 ? 105 VAL A HG11 2  
ATOM 1519  H HG12 . VAL A 1 21 ? 5.840   -2.224  -0.727  1.00 0.00 ? 105 VAL A HG12 2  
ATOM 1520  H HG13 . VAL A 1 21 ? 5.699   -2.585  0.994   1.00 0.00 ? 105 VAL A HG13 2  
ATOM 1521  H HG21 . VAL A 1 21 ? 5.328   -5.778  -1.793  1.00 0.00 ? 105 VAL A HG21 2  
ATOM 1522  H HG22 . VAL A 1 21 ? 5.617   -4.152  -2.408  1.00 0.00 ? 105 VAL A HG22 2  
ATOM 1523  H HG23 . VAL A 1 21 ? 4.066   -4.551  -1.671  1.00 0.00 ? 105 VAL A HG23 2  
ATOM 1524  N N    . ARG A 1 22 ? 6.860   -6.888  0.399   1.00 0.00 ? 106 ARG A N    2  
ATOM 1525  C CA   . ARG A 1 22 ? 6.970   -8.325  0.204   1.00 0.00 ? 106 ARG A CA   2  
ATOM 1526  C C    . ARG A 1 22 ? 5.583   -8.928  0.079   1.00 0.00 ? 106 ARG A C    2  
ATOM 1527  O O    . ARG A 1 22 ? 4.602   -8.336  0.530   1.00 0.00 ? 106 ARG A O    2  
ATOM 1528  C CB   . ARG A 1 22 ? 7.738   -8.976  1.353   1.00 0.00 ? 106 ARG A CB   2  
ATOM 1529  C CG   . ARG A 1 22 ? 9.193   -8.544  1.425   1.00 0.00 ? 106 ARG A CG   2  
ATOM 1530  C CD   . ARG A 1 22 ? 9.934   -9.270  2.531   1.00 0.00 ? 106 ARG A CD   2  
ATOM 1531  N NE   . ARG A 1 22 ? 9.326   -9.051  3.842   1.00 0.00 ? 106 ARG A NE   2  
ATOM 1532  C CZ   . ARG A 1 22 ? 9.897   -8.344  4.813   1.00 0.00 ? 106 ARG A CZ   2  
ATOM 1533  N NH1  . ARG A 1 22 ? 11.065  -7.742  4.609   1.00 0.00 ? 106 ARG A NH1  2  
ATOM 1534  N NH2  . ARG A 1 22 ? 9.302   -8.232  5.991   1.00 0.00 ? 106 ARG A NH2  2  
ATOM 1535  H H    . ARG A 1 22 ? 6.310   -6.546  1.133   1.00 0.00 ? 106 ARG A H    2  
ATOM 1536  H HA   . ARG A 1 22 ? 7.505   -8.492  -0.719  1.00 0.00 ? 106 ARG A HA   2  
ATOM 1537  H HB2  . ARG A 1 22 ? 7.259   -8.717  2.286   1.00 0.00 ? 106 ARG A HB2  2  
ATOM 1538  H HB3  . ARG A 1 22 ? 7.708   -10.049 1.228   1.00 0.00 ? 106 ARG A HB3  2  
ATOM 1539  H HG2  . ARG A 1 22 ? 9.671   -8.763  0.483   1.00 0.00 ? 106 ARG A HG2  2  
ATOM 1540  H HG3  . ARG A 1 22 ? 9.232   -7.481  1.614   1.00 0.00 ? 106 ARG A HG3  2  
ATOM 1541  H HD2  . ARG A 1 22 ? 9.927   -10.329 2.316   1.00 0.00 ? 106 ARG A HD2  2  
ATOM 1542  H HD3  . ARG A 1 22 ? 10.954  -8.916  2.556   1.00 0.00 ? 106 ARG A HD3  2  
ATOM 1543  H HE   . ARG A 1 22 ? 8.450   -9.472  4.012   1.00 0.00 ? 106 ARG A HE   2  
ATOM 1544  H HH11 . ARG A 1 22 ? 11.529  -7.819  3.717   1.00 0.00 ? 106 ARG A HH11 2  
ATOM 1545  H HH12 . ARG A 1 22 ? 11.488  -7.203  5.345   1.00 0.00 ? 106 ARG A HH12 2  
ATOM 1546  H HH21 . ARG A 1 22 ? 8.418   -8.681  6.154   1.00 0.00 ? 106 ARG A HH21 2  
ATOM 1547  H HH22 . ARG A 1 22 ? 9.736   -7.701  6.729   1.00 0.00 ? 106 ARG A HH22 2  
ATOM 1548  N N    . LEU A 1 23 ? 5.496   -10.100 -0.530  1.00 0.00 ? 107 LEU A N    2  
ATOM 1549  C CA   . LEU A 1 23 ? 4.208   -10.733 -0.773  1.00 0.00 ? 107 LEU A CA   2  
ATOM 1550  C C    . LEU A 1 23 ? 3.549   -11.151 0.535   1.00 0.00 ? 107 LEU A C    2  
ATOM 1551  O O    . LEU A 1 23 ? 2.334   -11.057 0.678   1.00 0.00 ? 107 LEU A O    2  
ATOM 1552  C CB   . LEU A 1 23 ? 4.353   -11.943 -1.705  1.00 0.00 ? 107 LEU A CB   2  
ATOM 1553  C CG   . LEU A 1 23 ? 4.621   -11.610 -3.178  1.00 0.00 ? 107 LEU A CG   2  
ATOM 1554  C CD1  . LEU A 1 23 ? 6.046   -11.118 -3.385  1.00 0.00 ? 107 LEU A CD1  2  
ATOM 1555  C CD2  . LEU A 1 23 ? 4.333   -12.816 -4.058  1.00 0.00 ? 107 LEU A CD2  2  
ATOM 1556  H H    . LEU A 1 23 ? 6.316   -10.555 -0.819  1.00 0.00 ? 107 LEU A H    2  
ATOM 1557  H HA   . LEU A 1 23 ? 3.574   -10.003 -1.254  1.00 0.00 ? 107 LEU A HA   2  
ATOM 1558  H HB2  . LEU A 1 23 ? 5.167   -12.552 -1.342  1.00 0.00 ? 107 LEU A HB2  2  
ATOM 1559  H HB3  . LEU A 1 23 ? 3.443   -12.523 -1.650  1.00 0.00 ? 107 LEU A HB3  2  
ATOM 1560  H HG   . LEU A 1 23 ? 3.954   -10.814 -3.481  1.00 0.00 ? 107 LEU A HG   2  
ATOM 1561  H HD11 . LEU A 1 23 ? 6.203   -10.896 -4.430  1.00 0.00 ? 107 LEU A HD11 2  
ATOM 1562  H HD12 . LEU A 1 23 ? 6.741   -11.884 -3.070  1.00 0.00 ? 107 LEU A HD12 2  
ATOM 1563  H HD13 . LEU A 1 23 ? 6.206   -10.225 -2.798  1.00 0.00 ? 107 LEU A HD13 2  
ATOM 1564  H HD21 . LEU A 1 23 ? 4.491   -12.552 -5.094  1.00 0.00 ? 107 LEU A HD21 2  
ATOM 1565  H HD22 . LEU A 1 23 ? 3.308   -13.126 -3.918  1.00 0.00 ? 107 LEU A HD22 2  
ATOM 1566  H HD23 . LEU A 1 23 ? 4.995   -13.625 -3.787  1.00 0.00 ? 107 LEU A HD23 2  
ATOM 1567  N N    . THR A 1 24 ? 4.359   -11.583 1.491   1.00 0.00 ? 108 THR A N    2  
ATOM 1568  C CA   . THR A 1 24 ? 3.848   -12.027 2.781   1.00 0.00 ? 108 THR A CA   2  
ATOM 1569  C C    . THR A 1 24 ? 3.769   -10.858 3.769   1.00 0.00 ? 108 THR A C    2  
ATOM 1570  O O    . THR A 1 24 ? 3.621   -11.050 4.975   1.00 0.00 ? 108 THR A O    2  
ATOM 1571  C CB   . THR A 1 24 ? 4.742   -13.140 3.363   1.00 0.00 ? 108 THR A CB   2  
ATOM 1572  O OG1  . THR A 1 24 ? 5.246   -13.957 2.297   1.00 0.00 ? 108 THR A OG1  2  
ATOM 1573  C CG2  . THR A 1 24 ? 3.965   -14.011 4.340   1.00 0.00 ? 108 THR A CG2  2  
ATOM 1574  H H    . THR A 1 24 ? 5.332   -11.611 1.323   1.00 0.00 ? 108 THR A H    2  
ATOM 1575  H HA   . THR A 1 24 ? 2.858   -12.427 2.629   1.00 0.00 ? 108 THR A HA   2  
ATOM 1576  H HB   . THR A 1 24 ? 5.572   -12.687 3.886   1.00 0.00 ? 108 THR A HB   2  
ATOM 1577  H HG1  . THR A 1 24 ? 5.936   -13.462 1.820   1.00 0.00 ? 108 THR A HG1  2  
ATOM 1578  H HG21 . THR A 1 24 ? 4.614   -14.781 4.733   1.00 0.00 ? 108 THR A HG21 2  
ATOM 1579  H HG22 . THR A 1 24 ? 3.129   -14.469 3.830   1.00 0.00 ? 108 THR A HG22 2  
ATOM 1580  H HG23 . THR A 1 24 ? 3.598   -13.399 5.152   1.00 0.00 ? 108 THR A HG23 2  
ATOM 1581  N N    . GLN A 1 25 ? 3.867   -9.642  3.252   1.00 0.00 ? 109 GLN A N    2  
ATOM 1582  C CA   . GLN A 1 25 ? 3.780   -8.458  4.089   1.00 0.00 ? 109 GLN A CA   2  
ATOM 1583  C C    . GLN A 1 25 ? 2.341   -7.958  4.137   1.00 0.00 ? 109 GLN A C    2  
ATOM 1584  O O    . GLN A 1 25 ? 1.680   -7.828  3.105   1.00 0.00 ? 109 GLN A O    2  
ATOM 1585  C CB   . GLN A 1 25 ? 4.715   -7.362  3.567   1.00 0.00 ? 109 GLN A CB   2  
ATOM 1586  C CG   . GLN A 1 25 ? 4.813   -6.156  4.483   1.00 0.00 ? 109 GLN A CG   2  
ATOM 1587  C CD   . GLN A 1 25 ? 5.806   -5.120  3.985   1.00 0.00 ? 109 GLN A CD   2  
ATOM 1588  O OE1  . GLN A 1 25 ? 6.989   -5.174  4.310   1.00 0.00 ? 109 GLN A OE1  2  
ATOM 1589  N NE2  . GLN A 1 25 ? 5.332   -4.167  3.199   1.00 0.00 ? 109 GLN A NE2  2  
ATOM 1590  H H    . GLN A 1 25 ? 3.989   -9.538  2.284   1.00 0.00 ? 109 GLN A H    2  
ATOM 1591  H HA   . GLN A 1 25 ? 4.084   -8.736  5.087   1.00 0.00 ? 109 GLN A HA   2  
ATOM 1592  H HB2  . GLN A 1 25 ? 5.704   -7.778  3.453   1.00 0.00 ? 109 GLN A HB2  2  
ATOM 1593  H HB3  . GLN A 1 25 ? 4.358   -7.029  2.604   1.00 0.00 ? 109 GLN A HB3  2  
ATOM 1594  H HG2  . GLN A 1 25 ? 3.839   -5.694  4.552   1.00 0.00 ? 109 GLN A HG2  2  
ATOM 1595  H HG3  . GLN A 1 25 ? 5.123   -6.489  5.462   1.00 0.00 ? 109 GLN A HG3  2  
ATOM 1596  H HE21 . GLN A 1 25 ? 4.378   -4.177  2.977   1.00 0.00 ? 109 GLN A HE21 2  
ATOM 1597  H HE22 . GLN A 1 25 ? 5.961   -3.478  2.875   1.00 0.00 ? 109 GLN A HE22 2  
ATOM 1598  N N    . THR A 1 26 ? 1.858   -7.701  5.342   1.00 0.00 ? 110 THR A N    2  
ATOM 1599  C CA   . THR A 1 26 ? 0.501   -7.232  5.543   1.00 0.00 ? 110 THR A CA   2  
ATOM 1600  C C    . THR A 1 26 ? 0.344   -5.770  5.133   1.00 0.00 ? 110 THR A C    2  
ATOM 1601  O O    . THR A 1 26 ? 1.325   -5.021  5.060   1.00 0.00 ? 110 THR A O    2  
ATOM 1602  C CB   . THR A 1 26 ? 0.085   -7.414  7.013   1.00 0.00 ? 110 THR A CB   2  
ATOM 1603  O OG1  . THR A 1 26 ? 1.181   -7.076  7.876   1.00 0.00 ? 110 THR A OG1  2  
ATOM 1604  C CG2  . THR A 1 26 ? -0.355  -8.847  7.273   1.00 0.00 ? 110 THR A CG2  2  
ATOM 1605  H H    . THR A 1 26 ? 2.431   -7.832  6.123   1.00 0.00 ? 110 THR A H    2  
ATOM 1606  H HA   . THR A 1 26 ? -0.155  -7.833  4.933   1.00 0.00 ? 110 THR A HA   2  
ATOM 1607  H HB   . THR A 1 26 ? -0.746  -6.754  7.221   1.00 0.00 ? 110 THR A HB   2  
ATOM 1608  H HG1  . THR A 1 26 ? 1.031   -7.482  8.751   1.00 0.00 ? 110 THR A HG1  2  
ATOM 1609  H HG21 . THR A 1 26 ? -1.186  -9.091  6.631   1.00 0.00 ? 110 THR A HG21 2  
ATOM 1610  H HG22 . THR A 1 26 ? -0.655  -8.948  8.306   1.00 0.00 ? 110 THR A HG22 2  
ATOM 1611  H HG23 . THR A 1 26 ? 0.466   -9.519  7.070   1.00 0.00 ? 110 THR A HG23 2  
ATOM 1612  N N    . VAL A 1 27 ? -0.895  -5.375  4.870   1.00 0.00 ? 111 VAL A N    2  
ATOM 1613  C CA   . VAL A 1 27 ? -1.205  -4.010  4.461   1.00 0.00 ? 111 VAL A CA   2  
ATOM 1614  C C    . VAL A 1 27 ? -0.863  -3.031  5.576   1.00 0.00 ? 111 VAL A C    2  
ATOM 1615  O O    . VAL A 1 27 ? -0.464  -1.898  5.317   1.00 0.00 ? 111 VAL A O    2  
ATOM 1616  C CB   . VAL A 1 27 ? -2.694  -3.862  4.076   1.00 0.00 ? 111 VAL A CB   2  
ATOM 1617  C CG1  . VAL A 1 27 ? -3.019  -2.432  3.673   1.00 0.00 ? 111 VAL A CG1  2  
ATOM 1618  C CG2  . VAL A 1 27 ? -3.052  -4.821  2.953   1.00 0.00 ? 111 VAL A CG2  2  
ATOM 1619  H H    . VAL A 1 27 ? -1.630  -6.019  4.969   1.00 0.00 ? 111 VAL A H    2  
ATOM 1620  H HA   . VAL A 1 27 ? -0.604  -3.777  3.594   1.00 0.00 ? 111 VAL A HA   2  
ATOM 1621  H HB   . VAL A 1 27 ? -3.294  -4.113  4.939   1.00 0.00 ? 111 VAL A HB   2  
ATOM 1622  H HG11 . VAL A 1 27 ? -2.809  -1.769  4.499   1.00 0.00 ? 111 VAL A HG11 2  
ATOM 1623  H HG12 . VAL A 1 27 ? -4.064  -2.359  3.409   1.00 0.00 ? 111 VAL A HG12 2  
ATOM 1624  H HG13 . VAL A 1 27 ? -2.413  -2.151  2.824   1.00 0.00 ? 111 VAL A HG13 2  
ATOM 1625  H HG21 . VAL A 1 27 ? -2.458  -4.589  2.081   1.00 0.00 ? 111 VAL A HG21 2  
ATOM 1626  H HG22 . VAL A 1 27 ? -4.100  -4.720  2.714   1.00 0.00 ? 111 VAL A HG22 2  
ATOM 1627  H HG23 . VAL A 1 27 ? -2.850  -5.836  3.268   1.00 0.00 ? 111 VAL A HG23 2  
ATOM 1628  N N    . ALA A 1 28 ? -1.004  -3.481  6.816   1.00 0.00 ? 112 ALA A N    2  
ATOM 1629  C CA   . ALA A 1 28 ? -0.640  -2.681  7.979   1.00 0.00 ? 112 ALA A CA   2  
ATOM 1630  C C    . ALA A 1 28 ? 0.812   -2.221  7.887   1.00 0.00 ? 112 ALA A C    2  
ATOM 1631  O O    . ALA A 1 28 ? 1.127   -1.063  8.165   1.00 0.00 ? 112 ALA A O    2  
ATOM 1632  C CB   . ALA A 1 28 ? -0.858  -3.489  9.245   1.00 0.00 ? 112 ALA A CB   2  
ATOM 1633  H H    . ALA A 1 28 ? -1.374  -4.389  6.958   1.00 0.00 ? 112 ALA A H    2  
ATOM 1634  H HA   . ALA A 1 28 ? -1.288  -1.815  8.009   1.00 0.00 ? 112 ALA A HA   2  
ATOM 1635  H HB1  . ALA A 1 28 ? -1.896  -3.776  9.311   1.00 0.00 ? 112 ALA A HB1  2  
ATOM 1636  H HB2  . ALA A 1 28 ? -0.591  -2.896  10.107  1.00 0.00 ? 112 ALA A HB2  2  
ATOM 1637  H HB3  . ALA A 1 28 ? -0.242  -4.377  9.213   1.00 0.00 ? 112 ALA A HB3  2  
ATOM 1638  N N    . HIS A 1 29 ? 1.679   -3.129  7.453   1.00 0.00 ? 113 HIS A N    2  
ATOM 1639  C CA   . HIS A 1 29 ? 3.104   -2.841  7.326   1.00 0.00 ? 113 HIS A CA   2  
ATOM 1640  C C    . HIS A 1 29 ? 3.355   -1.777  6.262   1.00 0.00 ? 113 HIS A C    2  
ATOM 1641  O O    . HIS A 1 29 ? 4.327   -1.028  6.334   1.00 0.00 ? 113 HIS A O    2  
ATOM 1642  C CB   . HIS A 1 29 ? 3.876   -4.121  6.999   1.00 0.00 ? 113 HIS A CB   2  
ATOM 1643  C CG   . HIS A 1 29 ? 4.244   -4.925  8.211   1.00 0.00 ? 113 HIS A CG   2  
ATOM 1644  N ND1  . HIS A 1 29 ? 3.470   -5.955  8.705   1.00 0.00 ? 113 HIS A ND1  2  
ATOM 1645  C CD2  . HIS A 1 29 ? 5.320   -4.844  9.030   1.00 0.00 ? 113 HIS A CD2  2  
ATOM 1646  C CE1  . HIS A 1 29 ? 4.054   -6.468  9.771   1.00 0.00 ? 113 HIS A CE1  2  
ATOM 1647  N NE2  . HIS A 1 29 ? 5.178   -5.813  9.990   1.00 0.00 ? 113 HIS A NE2  2  
ATOM 1648  H H    . HIS A 1 29 ? 1.349   -4.017  7.201   1.00 0.00 ? 113 HIS A H    2  
ATOM 1649  H HA   . HIS A 1 29 ? 3.447   -2.461  8.278   1.00 0.00 ? 113 HIS A HA   2  
ATOM 1650  H HB2  . HIS A 1 29 ? 3.264   -4.745  6.365   1.00 0.00 ? 113 HIS A HB2  2  
ATOM 1651  H HB3  . HIS A 1 29 ? 4.785   -3.869  6.472   1.00 0.00 ? 113 HIS A HB3  2  
ATOM 1652  H HD1  . HIS A 1 29 ? 2.610   -6.264  8.332   1.00 0.00 ? 113 HIS A HD1  2  
ATOM 1653  H HD2  . HIS A 1 29 ? 6.139   -4.146  8.941   1.00 0.00 ? 113 HIS A HD2  2  
ATOM 1654  H HE1  . HIS A 1 29 ? 3.677   -7.292  10.363  1.00 0.00 ? 113 HIS A HE1  2  
ATOM 1655  H HE2  . HIS A 1 29 ? 5.887   -6.105  10.612  1.00 0.00 ? 113 HIS A HE2  2  
ATOM 1656  N N    . LEU A 1 30 ? 2.474   -1.709  5.279   1.00 0.00 ? 114 LEU A N    2  
ATOM 1657  C CA   . LEU A 1 30 ? 2.561   -0.677  4.262   1.00 0.00 ? 114 LEU A CA   2  
ATOM 1658  C C    . LEU A 1 30 ? 1.932   0.612   4.776   1.00 0.00 ? 114 LEU A C    2  
ATOM 1659  O O    . LEU A 1 30 ? 2.521   1.689   4.671   1.00 0.00 ? 114 LEU A O    2  
ATOM 1660  C CB   . LEU A 1 30 ? 1.861   -1.125  2.977   1.00 0.00 ? 114 LEU A CB   2  
ATOM 1661  C CG   . LEU A 1 30 ? 1.887   -0.109  1.831   1.00 0.00 ? 114 LEU A CG   2  
ATOM 1662  C CD1  . LEU A 1 30 ? 3.312   0.159   1.372   1.00 0.00 ? 114 LEU A CD1  2  
ATOM 1663  C CD2  . LEU A 1 30 ? 1.035   -0.591  0.670   1.00 0.00 ? 114 LEU A CD2  2  
ATOM 1664  H H    . LEU A 1 30 ? 1.744   -2.363  5.239   1.00 0.00 ? 114 LEU A H    2  
ATOM 1665  H HA   . LEU A 1 30 ? 3.605   -0.499  4.055   1.00 0.00 ? 114 LEU A HA   2  
ATOM 1666  H HB2  . LEU A 1 30 ? 2.333   -2.036  2.638   1.00 0.00 ? 114 LEU A HB2  2  
ATOM 1667  H HB3  . LEU A 1 30 ? 0.830   -1.342  3.214   1.00 0.00 ? 114 LEU A HB3  2  
ATOM 1668  H HG   . LEU A 1 30 ? 1.474   0.825   2.182   1.00 0.00 ? 114 LEU A HG   2  
ATOM 1669  H HD11 . LEU A 1 30 ? 3.757   -0.763  1.026   1.00 0.00 ? 114 LEU A HD11 2  
ATOM 1670  H HD12 . LEU A 1 30 ? 3.887   0.549   2.199   1.00 0.00 ? 114 LEU A HD12 2  
ATOM 1671  H HD13 . LEU A 1 30 ? 3.301   0.879   0.569   1.00 0.00 ? 114 LEU A HD13 2  
ATOM 1672  H HD21 . LEU A 1 30 ? 1.437   -1.520  0.289   1.00 0.00 ? 114 LEU A HD21 2  
ATOM 1673  H HD22 . LEU A 1 30 ? 1.041   0.152   -0.113  1.00 0.00 ? 114 LEU A HD22 2  
ATOM 1674  H HD23 . LEU A 1 30 ? 0.022   -0.749  1.009   1.00 0.00 ? 114 LEU A HD23 2  
ATOM 1675  N N    . LYS A 1 31 ? 0.744   0.481   5.359   1.00 0.00 ? 115 LYS A N    2  
ATOM 1676  C CA   . LYS A 1 31 ? -0.022  1.628   5.826   1.00 0.00 ? 115 LYS A CA   2  
ATOM 1677  C C    . LYS A 1 31 ? 0.759   2.445   6.845   1.00 0.00 ? 115 LYS A C    2  
ATOM 1678  O O    . LYS A 1 31 ? 0.811   3.662   6.743   1.00 0.00 ? 115 LYS A O    2  
ATOM 1679  C CB   . LYS A 1 31 ? -1.348  1.186   6.453   1.00 0.00 ? 115 LYS A CB   2  
ATOM 1680  C CG   . LYS A 1 31 ? -2.269  2.357   6.765   1.00 0.00 ? 115 LYS A CG   2  
ATOM 1681  C CD   . LYS A 1 31 ? -3.348  1.994   7.773   1.00 0.00 ? 115 LYS A CD   2  
ATOM 1682  C CE   . LYS A 1 31 ? -2.755  1.665   9.135   1.00 0.00 ? 115 LYS A CE   2  
ATOM 1683  N NZ   . LYS A 1 31 ? -3.790  1.633   10.197  1.00 0.00 ? 115 LYS A NZ   2  
ATOM 1684  H H    . LYS A 1 31 ? 0.365   -0.422  5.472   1.00 0.00 ? 115 LYS A H    2  
ATOM 1685  H HA   . LYS A 1 31 ? -0.233  2.253   4.972   1.00 0.00 ? 115 LYS A HA   2  
ATOM 1686  H HB2  . LYS A 1 31 ? -1.857  0.525   5.768   1.00 0.00 ? 115 LYS A HB2  2  
ATOM 1687  H HB3  . LYS A 1 31 ? -1.145  0.659   7.372   1.00 0.00 ? 115 LYS A HB3  2  
ATOM 1688  H HG2  . LYS A 1 31 ? -1.679  3.166   7.168   1.00 0.00 ? 115 LYS A HG2  2  
ATOM 1689  H HG3  . LYS A 1 31 ? -2.741  2.678   5.849   1.00 0.00 ? 115 LYS A HG3  2  
ATOM 1690  H HD2  . LYS A 1 31 ? -4.022  2.831   7.879   1.00 0.00 ? 115 LYS A HD2  2  
ATOM 1691  H HD3  . LYS A 1 31 ? -3.892  1.134   7.410   1.00 0.00 ? 115 LYS A HD3  2  
ATOM 1692  H HE2  . LYS A 1 31 ? -2.277  0.700   9.082   1.00 0.00 ? 115 LYS A HE2  2  
ATOM 1693  H HE3  . LYS A 1 31 ? -2.019  2.416   9.383   1.00 0.00 ? 115 LYS A HE3  2  
ATOM 1694  H HZ1  . LYS A 1 31 ? -4.183  2.595   10.338  1.00 0.00 ? 115 LYS A HZ1  2  
ATOM 1695  H HZ2  . LYS A 1 31 ? -3.376  1.303   11.097  1.00 0.00 ? 115 LYS A HZ2  2  
ATOM 1696  H HZ3  . LYS A 1 31 ? -4.561  0.988   9.931   1.00 0.00 ? 115 LYS A HZ3  2  
ATOM 1697  N N    . GLN A 1 32 ? 1.367   1.779   7.819   1.00 0.00 ? 116 GLN A N    2  
ATOM 1698  C CA   . GLN A 1 32 ? 2.053   2.481   8.901   1.00 0.00 ? 116 GLN A CA   2  
ATOM 1699  C C    . GLN A 1 32 ? 3.261   3.266   8.393   1.00 0.00 ? 116 GLN A C    2  
ATOM 1700  O O    . GLN A 1 32 ? 3.595   4.315   8.940   1.00 0.00 ? 116 GLN A O    2  
ATOM 1701  C CB   . GLN A 1 32 ? 2.464   1.513   10.006  1.00 0.00 ? 116 GLN A CB   2  
ATOM 1702  C CG   . GLN A 1 32 ? 1.279   0.905   10.737  1.00 0.00 ? 116 GLN A CG   2  
ATOM 1703  C CD   . GLN A 1 32 ? 1.693   0.134   11.971  1.00 0.00 ? 116 GLN A CD   2  
ATOM 1704  O OE1  . GLN A 1 32 ? 1.962   -1.063  11.907  1.00 0.00 ? 116 GLN A OE1  2  
ATOM 1705  N NE2  . GLN A 1 32 ? 1.745   0.816   13.104  1.00 0.00 ? 116 GLN A NE2  2  
ATOM 1706  H H    . GLN A 1 32 ? 1.353   0.794   7.815   1.00 0.00 ? 116 GLN A H    2  
ATOM 1707  H HA   . GLN A 1 32 ? 1.347   3.188   9.313   1.00 0.00 ? 116 GLN A HA   2  
ATOM 1708  H HB2  . GLN A 1 32 ? 3.042   0.711   9.571   1.00 0.00 ? 116 GLN A HB2  2  
ATOM 1709  H HB3  . GLN A 1 32 ? 3.075   2.036   10.726  1.00 0.00 ? 116 GLN A HB3  2  
ATOM 1710  H HG2  . GLN A 1 32 ? 0.610   1.701   11.035  1.00 0.00 ? 116 GLN A HG2  2  
ATOM 1711  H HG3  . GLN A 1 32 ? 0.763   0.236   10.065  1.00 0.00 ? 116 GLN A HG3  2  
ATOM 1712  H HE21 . GLN A 1 32 ? 1.513   1.770   13.084  1.00 0.00 ? 116 GLN A HE21 2  
ATOM 1713  H HE22 . GLN A 1 32 ? 2.015   0.337   13.922  1.00 0.00 ? 116 GLN A HE22 2  
ATOM 1714  N N    . GLN A 1 33 ? 3.902   2.781   7.339   1.00 0.00 ? 117 GLN A N    2  
ATOM 1715  C CA   . GLN A 1 33 ? 5.001   3.521   6.731   1.00 0.00 ? 117 GLN A CA   2  
ATOM 1716  C C    . GLN A 1 33 ? 4.452   4.761   6.027   1.00 0.00 ? 117 GLN A C    2  
ATOM 1717  O O    . GLN A 1 33 ? 4.986   5.871   6.159   1.00 0.00 ? 117 GLN A O    2  
ATOM 1718  C CB   . GLN A 1 33 ? 5.780   2.635   5.756   1.00 0.00 ? 117 GLN A CB   2  
ATOM 1719  C CG   . GLN A 1 33 ? 6.458   1.456   6.433   1.00 0.00 ? 117 GLN A CG   2  
ATOM 1720  C CD   . GLN A 1 33 ? 7.290   0.632   5.474   1.00 0.00 ? 117 GLN A CD   2  
ATOM 1721  O OE1  . GLN A 1 33 ? 8.478   0.899   5.284   1.00 0.00 ? 117 GLN A OE1  2  
ATOM 1722  N NE2  . GLN A 1 33 ? 6.678   -0.381  4.877   1.00 0.00 ? 117 GLN A NE2  2  
ATOM 1723  H H    . GLN A 1 33 ? 3.630   1.919   6.961   1.00 0.00 ? 117 GLN A H    2  
ATOM 1724  H HA   . GLN A 1 33 ? 5.662   3.840   7.524   1.00 0.00 ? 117 GLN A HA   2  
ATOM 1725  H HB2  . GLN A 1 33 ? 5.099   2.257   5.008   1.00 0.00 ? 117 GLN A HB2  2  
ATOM 1726  H HB3  . GLN A 1 33 ? 6.539   3.232   5.271   1.00 0.00 ? 117 GLN A HB3  2  
ATOM 1727  H HG2  . GLN A 1 33 ? 7.104   1.827   7.213   1.00 0.00 ? 117 GLN A HG2  2  
ATOM 1728  H HG3  . GLN A 1 33 ? 5.700   0.819   6.865   1.00 0.00 ? 117 GLN A HG3  2  
ATOM 1729  H HE21 . GLN A 1 33 ? 5.731   -0.541  5.091   1.00 0.00 ? 117 GLN A HE21 2  
ATOM 1730  H HE22 . GLN A 1 33 ? 7.192   -0.931  4.243   1.00 0.00 ? 117 GLN A HE22 2  
ATOM 1731  N N    . VAL A 1 34 ? 3.350   4.571   5.309   1.00 0.00 ? 118 VAL A N    2  
ATOM 1732  C CA   . VAL A 1 34 ? 2.625   5.687   4.725   1.00 0.00 ? 118 VAL A CA   2  
ATOM 1733  C C    . VAL A 1 34 ? 2.156   6.621   5.837   1.00 0.00 ? 118 VAL A C    2  
ATOM 1734  O O    . VAL A 1 34 ? 2.159   7.834   5.679   1.00 0.00 ? 118 VAL A O    2  
ATOM 1735  C CB   . VAL A 1 34 ? 1.408   5.210   3.895   1.00 0.00 ? 118 VAL A CB   2  
ATOM 1736  C CG1  . VAL A 1 34 ? 0.666   6.394   3.287   1.00 0.00 ? 118 VAL A CG1  2  
ATOM 1737  C CG2  . VAL A 1 34 ? 1.848   4.242   2.806   1.00 0.00 ? 118 VAL A CG2  2  
ATOM 1738  H H    . VAL A 1 34 ? 3.017   3.655   5.170   1.00 0.00 ? 118 VAL A H    2  
ATOM 1739  H HA   . VAL A 1 34 ? 3.299   6.223   4.072   1.00 0.00 ? 118 VAL A HA   2  
ATOM 1740  H HB   . VAL A 1 34 ? 0.730   4.690   4.555   1.00 0.00 ? 118 VAL A HB   2  
ATOM 1741  H HG11 . VAL A 1 34 ? -0.175  6.035   2.714   1.00 0.00 ? 118 VAL A HG11 2  
ATOM 1742  H HG12 . VAL A 1 34 ? 1.334   6.944   2.641   1.00 0.00 ? 118 VAL A HG12 2  
ATOM 1743  H HG13 . VAL A 1 34 ? 0.315   7.042   4.077   1.00 0.00 ? 118 VAL A HG13 2  
ATOM 1744  H HG21 . VAL A 1 34 ? 2.327   3.386   3.256   1.00 0.00 ? 118 VAL A HG21 2  
ATOM 1745  H HG22 . VAL A 1 34 ? 2.542   4.738   2.145   1.00 0.00 ? 118 VAL A HG22 2  
ATOM 1746  H HG23 . VAL A 1 34 ? 0.985   3.917   2.244   1.00 0.00 ? 118 VAL A HG23 2  
ATOM 1747  N N    . SER A 1 35 ? 1.800   6.037   6.978   1.00 0.00 ? 119 SER A N    2  
ATOM 1748  C CA   . SER A 1 35 ? 1.377   6.799   8.146   1.00 0.00 ? 119 SER A CA   2  
ATOM 1749  C C    . SER A 1 35 ? 2.551   7.570   8.750   1.00 0.00 ? 119 SER A C    2  
ATOM 1750  O O    . SER A 1 35 ? 2.359   8.516   9.512   1.00 0.00 ? 119 SER A O    2  
ATOM 1751  C CB   . SER A 1 35 ? 0.754   5.872   9.195   1.00 0.00 ? 119 SER A CB   2  
ATOM 1752  O OG   . SER A 1 35 ? -0.340  5.147   8.657   1.00 0.00 ? 119 SER A OG   2  
ATOM 1753  H H    . SER A 1 35 ? 1.816   5.057   7.032   1.00 0.00 ? 119 SER A H    2  
ATOM 1754  H HA   . SER A 1 35 ? 0.631   7.507   7.822   1.00 0.00 ? 119 SER A HA   2  
ATOM 1755  H HB2  . SER A 1 35 ? 1.496   5.170   9.536   1.00 0.00 ? 119 SER A HB2  2  
ATOM 1756  H HB3  . SER A 1 35 ? 0.403   6.460   10.030  1.00 0.00 ? 119 SER A HB3  2  
ATOM 1757  H HG   . SER A 1 35 ? -0.117  4.836   7.773   1.00 0.00 ? 119 SER A HG   2  
ATOM 1758  N N    . GLY A 1 36 ? 3.764   7.159   8.411   1.00 0.00 ? 120 GLY A N    2  
ATOM 1759  C CA   . GLY A 1 36 ? 4.935   7.890   8.842   1.00 0.00 ? 120 GLY A CA   2  
ATOM 1760  C C    . GLY A 1 36 ? 5.109   9.174   8.057   1.00 0.00 ? 120 GLY A C    2  
ATOM 1761  O O    . GLY A 1 36 ? 5.492   10.205  8.609   1.00 0.00 ? 120 GLY A O    2  
ATOM 1762  H H    . GLY A 1 36 ? 3.866   6.347   7.870   1.00 0.00 ? 120 GLY A H    2  
ATOM 1763  H HA2  . GLY A 1 36 ? 4.834   8.129   9.890   1.00 0.00 ? 120 GLY A HA2  2  
ATOM 1764  H HA3  . GLY A 1 36 ? 5.807   7.269   8.704   1.00 0.00 ? 120 GLY A HA3  2  
ATOM 1765  N N    . LEU A 1 37 ? 4.829   9.111   6.758   1.00 0.00 ? 121 LEU A N    2  
ATOM 1766  C CA   . LEU A 1 37 ? 4.944   10.292  5.896   1.00 0.00 ? 121 LEU A CA   2  
ATOM 1767  C C    . LEU A 1 37 ? 3.599   11.017  5.737   1.00 0.00 ? 121 LEU A C    2  
ATOM 1768  O O    . LEU A 1 37 ? 3.431   12.147  6.193   1.00 0.00 ? 121 LEU A O    2  
ATOM 1769  C CB   . LEU A 1 37 ? 5.493   9.909   4.512   1.00 0.00 ? 121 LEU A CB   2  
ATOM 1770  C CG   . LEU A 1 37 ? 6.986   9.553   4.455   1.00 0.00 ? 121 LEU A CG   2  
ATOM 1771  C CD1  . LEU A 1 37 ? 7.267   8.214   5.120   1.00 0.00 ? 121 LEU A CD1  2  
ATOM 1772  C CD2  . LEU A 1 37 ? 7.470   9.543   3.013   1.00 0.00 ? 121 LEU A CD2  2  
ATOM 1773  H H    . LEU A 1 37 ? 4.561   8.240   6.366   1.00 0.00 ? 121 LEU A H    2  
ATOM 1774  H HA   . LEU A 1 37 ? 5.643   10.969  6.367   1.00 0.00 ? 121 LEU A HA   2  
ATOM 1775  H HB2  . LEU A 1 37 ? 4.931   9.061   4.150   1.00 0.00 ? 121 LEU A HB2  2  
ATOM 1776  H HB3  . LEU A 1 37 ? 5.322   10.741  3.844   1.00 0.00 ? 121 LEU A HB3  2  
ATOM 1777  H HG   . LEU A 1 37 ? 7.546   10.309  4.986   1.00 0.00 ? 121 LEU A HG   2  
ATOM 1778  H HD11 . LEU A 1 37 ? 6.960   8.255   6.154   1.00 0.00 ? 121 LEU A HD11 2  
ATOM 1779  H HD12 . LEU A 1 37 ? 8.323   7.997   5.065   1.00 0.00 ? 121 LEU A HD12 2  
ATOM 1780  H HD13 . LEU A 1 37 ? 6.713   7.436   4.611   1.00 0.00 ? 121 LEU A HD13 2  
ATOM 1781  H HD21 . LEU A 1 37 ? 7.337   10.524  2.582   1.00 0.00 ? 121 LEU A HD21 2  
ATOM 1782  H HD22 . LEU A 1 37 ? 6.900   8.822   2.447   1.00 0.00 ? 121 LEU A HD22 2  
ATOM 1783  H HD23 . LEU A 1 37 ? 8.516   9.277   2.985   1.00 0.00 ? 121 LEU A HD23 2  
ATOM 1784  N N    . GLU A 1 38 ? 2.650   10.340  5.113   1.00 0.00 ? 122 GLU A N    2  
ATOM 1785  C CA   . GLU A 1 38 ? 1.350   10.911  4.745   1.00 0.00 ? 122 GLU A CA   2  
ATOM 1786  C C    . GLU A 1 38 ? 0.295   10.606  5.810   1.00 0.00 ? 122 GLU A C    2  
ATOM 1787  O O    . GLU A 1 38 ? -0.895  10.798  5.581   1.00 0.00 ? 122 GLU A O    2  
ATOM 1788  C CB   . GLU A 1 38 ? 0.897   10.364  3.393   1.00 0.00 ? 122 GLU A CB   2  
ATOM 1789  C CG   . GLU A 1 38 ? 1.887   10.607  2.261   1.00 0.00 ? 122 GLU A CG   2  
ATOM 1790  C CD   . GLU A 1 38 ? 2.095   12.080  1.973   1.00 0.00 ? 122 GLU A CD   2  
ATOM 1791  O OE1  . GLU A 1 38 ? 1.238   12.686  1.298   1.00 0.00 ? 122 GLU A OE1  2  
ATOM 1792  O OE2  . GLU A 1 38 ? 3.117   12.644  2.425   1.00 0.00 ? 122 GLU A OE2  2  
ATOM 1793  H H    . GLU A 1 38 ? 2.815   9.395   4.899   1.00 0.00 ? 122 GLU A H    2  
ATOM 1794  H HA   . GLU A 1 38 ? 1.470   11.982  4.668   1.00 0.00 ? 122 GLU A HA   2  
ATOM 1795  H HB2  . GLU A 1 38 ? 0.746   9.300   3.486   1.00 0.00 ? 122 GLU A HB2  2  
ATOM 1796  H HB3  . GLU A 1 38 ? -0.038  10.831  3.130   1.00 0.00 ? 122 GLU A HB3  2  
ATOM 1797  H HG2  . GLU A 1 38 ? 2.838   10.170  2.530   1.00 0.00 ? 122 GLU A HG2  2  
ATOM 1798  H HG3  . GLU A 1 38 ? 1.514   10.129  1.368   1.00 0.00 ? 122 GLU A HG3  2  
ATOM 1799  N N    . GLY A 1 39 ? 0.774   10.062  6.929   1.00 0.00 ? 123 GLY A N    2  
ATOM 1800  C CA   . GLY A 1 39 ? -0.031  9.556   8.052   1.00 0.00 ? 123 GLY A CA   2  
ATOM 1801  C C    . GLY A 1 39 ? -1.190  10.403  8.574   1.00 0.00 ? 123 GLY A C    2  
ATOM 1802  O O    . GLY A 1 39 ? -1.692  10.103  9.654   1.00 0.00 ? 123 GLY A O    2  
ATOM 1803  H H    . GLY A 1 39 ? 1.748   9.991   7.002   1.00 0.00 ? 123 GLY A H    2  
ATOM 1804  H HA2  . GLY A 1 39 ? -0.439  8.605   7.756   1.00 0.00 ? 123 GLY A HA2  2  
ATOM 1805  H HA3  . GLY A 1 39 ? 0.647   9.373   8.878   1.00 0.00 ? 123 GLY A HA3  2  
ATOM 1806  N N    . VAL A 1 40 ? -1.550  11.480  7.892   1.00 0.00 ? 124 VAL A N    2  
ATOM 1807  C CA   . VAL A 1 40 ? -2.676  12.335  8.281   1.00 0.00 ? 124 VAL A CA   2  
ATOM 1808  C C    . VAL A 1 40 ? -3.976  11.535  8.510   1.00 0.00 ? 124 VAL A C    2  
ATOM 1809  O O    . VAL A 1 40 ? -4.811  11.436  7.615   1.00 0.00 ? 124 VAL A O    2  
ATOM 1810  C CB   . VAL A 1 40 ? -2.942  13.414  7.204   1.00 0.00 ? 124 VAL A CB   2  
ATOM 1811  C CG1  . VAL A 1 40 ? -4.010  14.399  7.662   1.00 0.00 ? 124 VAL A CG1  2  
ATOM 1812  C CG2  . VAL A 1 40 ? -1.654  14.136  6.847   1.00 0.00 ? 124 VAL A CG2  2  
ATOM 1813  H H    . VAL A 1 40 ? -1.060  11.695  7.070   1.00 0.00 ? 124 VAL A H    2  
ATOM 1814  H HA   . VAL A 1 40 ? -2.409  12.836  9.198   1.00 0.00 ? 124 VAL A HA   2  
ATOM 1815  H HB   . VAL A 1 40 ? -3.305  12.919  6.313   1.00 0.00 ? 124 VAL A HB   2  
ATOM 1816  H HG11 . VAL A 1 40 ? -4.150  15.158  6.908   1.00 0.00 ? 124 VAL A HG11 2  
ATOM 1817  H HG12 . VAL A 1 40 ? -3.700  14.862  8.586   1.00 0.00 ? 124 VAL A HG12 2  
ATOM 1818  H HG13 . VAL A 1 40 ? -4.943  13.870  7.818   1.00 0.00 ? 124 VAL A HG13 2  
ATOM 1819  H HG21 . VAL A 1 40 ? -0.950  13.431  6.427   1.00 0.00 ? 124 VAL A HG21 2  
ATOM 1820  H HG22 . VAL A 1 40 ? -1.231  14.579  7.737   1.00 0.00 ? 124 VAL A HG22 2  
ATOM 1821  H HG23 . VAL A 1 40 ? -1.863  14.911  6.123   1.00 0.00 ? 124 VAL A HG23 2  
ATOM 1822  N N    . GLN A 1 41 ? -4.096  10.949  9.708   1.00 0.00 ? 125 GLN A N    2  
ATOM 1823  C CA   . GLN A 1 41 ? -5.314  10.273  10.180  1.00 0.00 ? 125 GLN A CA   2  
ATOM 1824  C C    . GLN A 1 41 ? -5.730  9.082   9.305   1.00 0.00 ? 125 GLN A C    2  
ATOM 1825  O O    . GLN A 1 41 ? -6.081  9.234   8.136   1.00 0.00 ? 125 GLN A O    2  
ATOM 1826  C CB   . GLN A 1 41 ? -6.475  11.263  10.331  1.00 0.00 ? 125 GLN A CB   2  
ATOM 1827  C CG   . GLN A 1 41 ? -6.406  12.100  11.603  1.00 0.00 ? 125 GLN A CG   2  
ATOM 1828  C CD   . GLN A 1 41 ? -5.270  13.107  11.610  1.00 0.00 ? 125 GLN A CD   2  
ATOM 1829  O OE1  . GLN A 1 41 ? -4.887  13.644  10.574  1.00 0.00 ? 125 GLN A OE1  2  
ATOM 1830  N NE2  . GLN A 1 41 ? -4.715  13.365  12.783  1.00 0.00 ? 125 GLN A NE2  2  
ATOM 1831  H H    . GLN A 1 41 ? -3.313  10.948  10.296  1.00 0.00 ? 125 GLN A H    2  
ATOM 1832  H HA   . GLN A 1 41 ? -5.082  9.883   11.161  1.00 0.00 ? 125 GLN A HA   2  
ATOM 1833  H HB2  . GLN A 1 41 ? -6.471  11.936  9.486   1.00 0.00 ? 125 GLN A HB2  2  
ATOM 1834  H HB3  . GLN A 1 41 ? -7.403  10.712  10.340  1.00 0.00 ? 125 GLN A HB3  2  
ATOM 1835  H HG2  . GLN A 1 41 ? -7.335  12.638  11.709  1.00 0.00 ? 125 GLN A HG2  2  
ATOM 1836  H HG3  . GLN A 1 41 ? -6.283  11.434  12.445  1.00 0.00 ? 125 GLN A HG3  2  
ATOM 1837  H HE21 . GLN A 1 41 ? -5.064  12.896  13.575  1.00 0.00 ? 125 GLN A HE21 2  
ATOM 1838  H HE22 . GLN A 1 41 ? -3.972  14.010  12.817  1.00 0.00 ? 125 GLN A HE22 2  
ATOM 1839  N N    . ASP A 1 42 ? -5.736  7.897   9.922   1.00 0.00 ? 126 ASP A N    2  
ATOM 1840  C CA   . ASP A 1 42 ? -6.124  6.649   9.251   1.00 0.00 ? 126 ASP A CA   2  
ATOM 1841  C C    . ASP A 1 42 ? -7.495  6.777   8.592   1.00 0.00 ? 126 ASP A C    2  
ATOM 1842  O O    . ASP A 1 42 ? -7.788  6.108   7.604   1.00 0.00 ? 126 ASP A O    2  
ATOM 1843  C CB   . ASP A 1 42 ? -6.191  5.487   10.254  1.00 0.00 ? 126 ASP A CB   2  
ATOM 1844  C CG   . ASP A 1 42 ? -4.875  5.184   10.938  1.00 0.00 ? 126 ASP A CG   2  
ATOM 1845  O OD1  . ASP A 1 42 ? -4.548  5.878   11.927  1.00 0.00 ? 126 ASP A OD1  2  
ATOM 1846  O OD2  . ASP A 1 42 ? -4.191  4.227   10.523  1.00 0.00 ? 126 ASP A OD2  2  
ATOM 1847  H H    . ASP A 1 42 ? -5.468  7.860   10.864  1.00 0.00 ? 126 ASP A H    2  
ATOM 1848  H HA   . ASP A 1 42 ? -5.384  6.424   8.498   1.00 0.00 ? 126 ASP A HA   2  
ATOM 1849  H HB2  . ASP A 1 42 ? -6.916  5.726   11.017  1.00 0.00 ? 126 ASP A HB2  2  
ATOM 1850  H HB3  . ASP A 1 42 ? -6.514  4.596   9.731   1.00 0.00 ? 126 ASP A HB3  2  
ATOM 1851  N N    . ASP A 1 43 ? -8.332  7.628   9.161   1.00 0.00 ? 127 ASP A N    2  
ATOM 1852  C CA   . ASP A 1 43 ? -9.699  7.806   8.689   1.00 0.00 ? 127 ASP A CA   2  
ATOM 1853  C C    . ASP A 1 43 ? -9.744  8.632   7.407   1.00 0.00 ? 127 ASP A C    2  
ATOM 1854  O O    . ASP A 1 43 ? -10.676 8.509   6.610   1.00 0.00 ? 127 ASP A O    2  
ATOM 1855  C CB   . ASP A 1 43 ? -10.530 8.481   9.785   1.00 0.00 ? 127 ASP A CB   2  
ATOM 1856  C CG   . ASP A 1 43 ? -11.963 8.755   9.372   1.00 0.00 ? 127 ASP A CG   2  
ATOM 1857  O OD1  . ASP A 1 43 ? -12.801 7.835   9.466   1.00 0.00 ? 127 ASP A OD1  2  
ATOM 1858  O OD2  . ASP A 1 43 ? -12.263 9.901   8.980   1.00 0.00 ? 127 ASP A OD2  2  
ATOM 1859  H H    . ASP A 1 43 ? -8.021  8.158   9.930   1.00 0.00 ? 127 ASP A H    2  
ATOM 1860  H HA   . ASP A 1 43 ? -10.110 6.829   8.489   1.00 0.00 ? 127 ASP A HA   2  
ATOM 1861  H HB2  . ASP A 1 43 ? -10.547 7.844   10.656  1.00 0.00 ? 127 ASP A HB2  2  
ATOM 1862  H HB3  . ASP A 1 43 ? -10.065 9.422   10.047  1.00 0.00 ? 127 ASP A HB3  2  
ATOM 1863  N N    . LEU A 1 44 ? -8.727  9.456   7.194   1.00 0.00 ? 128 LEU A N    2  
ATOM 1864  C CA   . LEU A 1 44 ? -8.720  10.372  6.066   1.00 0.00 ? 128 LEU A CA   2  
ATOM 1865  C C    . LEU A 1 44 ? -8.101  9.736   4.823   1.00 0.00 ? 128 LEU A C    2  
ATOM 1866  O O    . LEU A 1 44 ? -8.556  9.989   3.707   1.00 0.00 ? 128 LEU A O    2  
ATOM 1867  C CB   . LEU A 1 44 ? -7.976  11.657  6.426   1.00 0.00 ? 128 LEU A CB   2  
ATOM 1868  C CG   . LEU A 1 44 ? -8.579  12.442  7.596   1.00 0.00 ? 128 LEU A CG   2  
ATOM 1869  C CD1  . LEU A 1 44 ? -7.718  13.646  7.926   1.00 0.00 ? 128 LEU A CD1  2  
ATOM 1870  C CD2  . LEU A 1 44 ? -10.004 12.874  7.272   1.00 0.00 ? 128 LEU A CD2  2  
ATOM 1871  H H    . LEU A 1 44 ? -7.954  9.445   7.805   1.00 0.00 ? 128 LEU A H    2  
ATOM 1872  H HA   . LEU A 1 44 ? -9.747  10.622  5.846   1.00 0.00 ? 128 LEU A HA   2  
ATOM 1873  H HB2  . LEU A 1 44 ? -6.956  11.404  6.674   1.00 0.00 ? 128 LEU A HB2  2  
ATOM 1874  H HB3  . LEU A 1 44 ? -7.970  12.301  5.557   1.00 0.00 ? 128 LEU A HB3  2  
ATOM 1875  H HG   . LEU A 1 44 ? -8.612  11.804  8.467   1.00 0.00 ? 128 LEU A HG   2  
ATOM 1876  H HD11 . LEU A 1 44 ? -8.147  14.174  8.766   1.00 0.00 ? 128 LEU A HD11 2  
ATOM 1877  H HD12 . LEU A 1 44 ? -7.670  14.304  7.071   1.00 0.00 ? 128 LEU A HD12 2  
ATOM 1878  H HD13 . LEU A 1 44 ? -6.722  13.314  8.182   1.00 0.00 ? 128 LEU A HD13 2  
ATOM 1879  H HD21 . LEU A 1 44 ? -10.617 11.999  7.105   1.00 0.00 ? 128 LEU A HD21 2  
ATOM 1880  H HD22 . LEU A 1 44 ? -10.001 13.486  6.381   1.00 0.00 ? 128 LEU A HD22 2  
ATOM 1881  H HD23 . LEU A 1 44 ? -10.405 13.445  8.098   1.00 0.00 ? 128 LEU A HD23 2  
ATOM 1882  N N    . PHE A 1 45 ? -7.075  8.914   5.003   1.00 0.00 ? 129 PHE A N    2  
ATOM 1883  C CA   . PHE A 1 45 ? -6.400  8.312   3.857   1.00 0.00 ? 129 PHE A CA   2  
ATOM 1884  C C    . PHE A 1 45 ? -6.604  6.800   3.807   1.00 0.00 ? 129 PHE A C    2  
ATOM 1885  O O    . PHE A 1 45 ? -6.608  6.126   4.836   1.00 0.00 ? 129 PHE A O    2  
ATOM 1886  C CB   . PHE A 1 45 ? -4.897  8.649   3.857   1.00 0.00 ? 129 PHE A CB   2  
ATOM 1887  C CG   . PHE A 1 45 ? -4.079  7.946   4.913   1.00 0.00 ? 129 PHE A CG   2  
ATOM 1888  C CD1  . PHE A 1 45 ? -3.913  8.501   6.170   1.00 0.00 ? 129 PHE A CD1  2  
ATOM 1889  C CD2  . PHE A 1 45 ? -3.462  6.733   4.636   1.00 0.00 ? 129 PHE A CD2  2  
ATOM 1890  C CE1  . PHE A 1 45 ? -3.155  7.861   7.132   1.00 0.00 ? 129 PHE A CE1  2  
ATOM 1891  C CE2  . PHE A 1 45 ? -2.701  6.091   5.595   1.00 0.00 ? 129 PHE A CE2  2  
ATOM 1892  C CZ   . PHE A 1 45 ? -2.549  6.655   6.845   1.00 0.00 ? 129 PHE A CZ   2  
ATOM 1893  H H    . PHE A 1 45 ? -6.769  8.707   5.910   1.00 0.00 ? 129 PHE A H    2  
ATOM 1894  H HA   . PHE A 1 45 ? -6.842  8.737   2.967   1.00 0.00 ? 129 PHE A HA   2  
ATOM 1895  H HB2  . PHE A 1 45 ? -4.483  8.387   2.897   1.00 0.00 ? 129 PHE A HB2  2  
ATOM 1896  H HB3  . PHE A 1 45 ? -4.783  9.713   4.007   1.00 0.00 ? 129 PHE A HB3  2  
ATOM 1897  H HD1  . PHE A 1 45 ? -4.386  9.445   6.399   1.00 0.00 ? 129 PHE A HD1  2  
ATOM 1898  H HD2  . PHE A 1 45 ? -3.581  6.289   3.659   1.00 0.00 ? 129 PHE A HD2  2  
ATOM 1899  H HE1  . PHE A 1 45 ? -3.035  8.304   8.111   1.00 0.00 ? 129 PHE A HE1  2  
ATOM 1900  H HE2  . PHE A 1 45 ? -2.227  5.146   5.367   1.00 0.00 ? 129 PHE A HE2  2  
ATOM 1901  H HZ   . PHE A 1 45 ? -1.955  6.153   7.596   1.00 0.00 ? 129 PHE A HZ   2  
ATOM 1902  N N    . TRP A 1 46 ? -6.790  6.281   2.604   1.00 0.00 ? 130 TRP A N    2  
ATOM 1903  C CA   . TRP A 1 46 ? -6.840  4.846   2.378   1.00 0.00 ? 130 TRP A CA   2  
ATOM 1904  C C    . TRP A 1 46 ? -6.404  4.573   0.943   1.00 0.00 ? 130 TRP A C    2  
ATOM 1905  O O    . TRP A 1 46 ? -6.507  5.448   0.091   1.00 0.00 ? 130 TRP A O    2  
ATOM 1906  C CB   . TRP A 1 46 ? -8.248  4.283   2.655   1.00 0.00 ? 130 TRP A CB   2  
ATOM 1907  C CG   . TRP A 1 46 ? -9.179  4.290   1.475   1.00 0.00 ? 130 TRP A CG   2  
ATOM 1908  C CD1  . TRP A 1 46 ? -9.523  3.212   0.711   1.00 0.00 ? 130 TRP A CD1  2  
ATOM 1909  C CD2  . TRP A 1 46 ? -9.884  5.411   0.923   1.00 0.00 ? 130 TRP A CD2  2  
ATOM 1910  N NE1  . TRP A 1 46 ? -10.394 3.593   -0.277  1.00 0.00 ? 130 TRP A NE1  2  
ATOM 1911  C CE2  . TRP A 1 46 ? -10.631 4.935   -0.171  1.00 0.00 ? 130 TRP A CE2  2  
ATOM 1912  C CE3  . TRP A 1 46 ? -9.955  6.770   1.243   1.00 0.00 ? 130 TRP A CE3  2  
ATOM 1913  C CZ2  . TRP A 1 46 ? -11.438 5.763   -0.943  1.00 0.00 ? 130 TRP A CZ2  2  
ATOM 1914  C CZ3  . TRP A 1 46 ? -10.759 7.593   0.476   1.00 0.00 ? 130 TRP A CZ3  2  
ATOM 1915  C CH2  . TRP A 1 46 ? -11.490 7.085   -0.608  1.00 0.00 ? 130 TRP A CH2  2  
ATOM 1916  H H    . TRP A 1 46 ? -6.892  6.886   1.834   1.00 0.00 ? 130 TRP A H    2  
ATOM 1917  H HA   . TRP A 1 46 ? -6.131  4.381   3.049   1.00 0.00 ? 130 TRP A HA   2  
ATOM 1918  H HB2  . TRP A 1 46 ? -8.153  3.262   2.991   1.00 0.00 ? 130 TRP A HB2  2  
ATOM 1919  H HB3  . TRP A 1 46 ? -8.706  4.869   3.441   1.00 0.00 ? 130 TRP A HB3  2  
ATOM 1920  H HD1  . TRP A 1 46 ? -9.156  2.209   0.873   1.00 0.00 ? 130 TRP A HD1  2  
ATOM 1921  H HE1  . TRP A 1 46 ? -10.787 2.997   -0.950  1.00 0.00 ? 130 TRP A HE1  2  
ATOM 1922  H HE3  . TRP A 1 46 ? -9.398  7.176   2.075   1.00 0.00 ? 130 TRP A HE3  2  
ATOM 1923  H HZ2  . TRP A 1 46 ? -12.007 5.389   -1.780  1.00 0.00 ? 130 TRP A HZ2  2  
ATOM 1924  H HZ3  . TRP A 1 46 ? -10.828 8.645   0.708   1.00 0.00 ? 130 TRP A HZ3  2  
ATOM 1925  H HH2  . TRP A 1 46 ? -12.102 7.761   -1.183  1.00 0.00 ? 130 TRP A HH2  2  
ATOM 1926  N N    . LEU A 1 47 ? -5.892  3.388   0.671   1.00 0.00 ? 131 LEU A N    2  
ATOM 1927  C CA   . LEU A 1 47 ? -5.374  3.097   -0.657  1.00 0.00 ? 131 LEU A CA   2  
ATOM 1928  C C    . LEU A 1 47 ? -6.205  2.020   -1.338  1.00 0.00 ? 131 LEU A C    2  
ATOM 1929  O O    . LEU A 1 47 ? -6.769  1.143   -0.676  1.00 0.00 ? 131 LEU A O    2  
ATOM 1930  C CB   . LEU A 1 47 ? -3.902  2.657   -0.596  1.00 0.00 ? 131 LEU A CB   2  
ATOM 1931  C CG   . LEU A 1 47 ? -2.889  3.728   -0.164  1.00 0.00 ? 131 LEU A CG   2  
ATOM 1932  C CD1  . LEU A 1 47 ? -2.982  4.013   1.329   1.00 0.00 ? 131 LEU A CD1  2  
ATOM 1933  C CD2  . LEU A 1 47 ? -1.478  3.293   -0.532  1.00 0.00 ? 131 LEU A CD2  2  
ATOM 1934  H H    . LEU A 1 47 ? -5.870  2.696   1.364   1.00 0.00 ? 131 LEU A H    2  
ATOM 1935  H HA   . LEU A 1 47 ? -5.447  4.008   -1.241  1.00 0.00 ? 131 LEU A HA   2  
ATOM 1936  H HB2  . LEU A 1 47 ? -3.830  1.831   0.098   1.00 0.00 ? 131 LEU A HB2  2  
ATOM 1937  H HB3  . LEU A 1 47 ? -3.617  2.301   -1.575  1.00 0.00 ? 131 LEU A HB3  2  
ATOM 1938  H HG   . LEU A 1 47 ? -3.101  4.647   -0.691  1.00 0.00 ? 131 LEU A HG   2  
ATOM 1939  H HD11 . LEU A 1 47 ? -2.755  3.114   1.882   1.00 0.00 ? 131 LEU A HD11 2  
ATOM 1940  H HD12 . LEU A 1 47 ? -3.983  4.341   1.572   1.00 0.00 ? 131 LEU A HD12 2  
ATOM 1941  H HD13 . LEU A 1 47 ? -2.276  4.786   1.594   1.00 0.00 ? 131 LEU A HD13 2  
ATOM 1942  H HD21 . LEU A 1 47 ? -1.426  3.103   -1.593  1.00 0.00 ? 131 LEU A HD21 2  
ATOM 1943  H HD22 . LEU A 1 47 ? -1.228  2.392   0.008   1.00 0.00 ? 131 LEU A HD22 2  
ATOM 1944  H HD23 . LEU A 1 47 ? -0.781  4.075   -0.273  1.00 0.00 ? 131 LEU A HD23 2  
ATOM 1945  N N    . THR A 1 48 ? -6.276  2.092   -2.659  1.00 0.00 ? 132 THR A N    2  
ATOM 1946  C CA   . THR A 1 48 ? -7.051  1.144   -3.437  1.00 0.00 ? 132 THR A CA   2  
ATOM 1947  C C    . THR A 1 48 ? -6.192  0.500   -4.518  1.00 0.00 ? 132 THR A C    2  
ATOM 1948  O O    . THR A 1 48 ? -5.300  1.136   -5.086  1.00 0.00 ? 132 THR A O    2  
ATOM 1949  C CB   . THR A 1 48 ? -8.263  1.829   -4.114  1.00 0.00 ? 132 THR A CB   2  
ATOM 1950  O OG1  . THR A 1 48 ? -7.810  2.876   -4.983  1.00 0.00 ? 132 THR A OG1  2  
ATOM 1951  C CG2  . THR A 1 48 ? -9.223  2.408   -3.079  1.00 0.00 ? 132 THR A CG2  2  
ATOM 1952  H H    . THR A 1 48 ? -5.787  2.805   -3.130  1.00 0.00 ? 132 THR A H    2  
ATOM 1953  H HA   . THR A 1 48 ? -7.420  0.377   -2.772  1.00 0.00 ? 132 THR A HA   2  
ATOM 1954  H HB   . THR A 1 48 ? -8.792  1.091   -4.699  1.00 0.00 ? 132 THR A HB   2  
ATOM 1955  H HG1  . THR A 1 48 ? -7.465  2.483   -5.803  1.00 0.00 ? 132 THR A HG1  2  
ATOM 1956  H HG21 . THR A 1 48 ? -8.715  3.166   -2.499  1.00 0.00 ? 132 THR A HG21 2  
ATOM 1957  H HG22 . THR A 1 48 ? -9.562  1.621   -2.422  1.00 0.00 ? 132 THR A HG22 2  
ATOM 1958  H HG23 . THR A 1 48 ? -10.073 2.851   -3.580  1.00 0.00 ? 132 THR A HG23 2  
ATOM 1959  N N    . PHE A 1 49 ? -6.455  -0.767  -4.784  1.00 0.00 ? 133 PHE A N    2  
ATOM 1960  C CA   . PHE A 1 49 ? -5.893  -1.439  -5.940  1.00 0.00 ? 133 PHE A CA   2  
ATOM 1961  C C    . PHE A 1 49 ? -7.022  -2.115  -6.694  1.00 0.00 ? 133 PHE A C    2  
ATOM 1962  O O    . PHE A 1 49 ? -7.931  -2.665  -6.066  1.00 0.00 ? 133 PHE A O    2  
ATOM 1963  C CB   . PHE A 1 49 ? -4.829  -2.473  -5.559  1.00 0.00 ? 133 PHE A CB   2  
ATOM 1964  C CG   . PHE A 1 49 ? -4.411  -3.304  -6.741  1.00 0.00 ? 133 PHE A CG   2  
ATOM 1965  C CD1  . PHE A 1 49 ? -3.578  -2.774  -7.714  1.00 0.00 ? 133 PHE A CD1  2  
ATOM 1966  C CD2  . PHE A 1 49 ? -4.889  -4.595  -6.904  1.00 0.00 ? 133 PHE A CD2  2  
ATOM 1967  C CE1  . PHE A 1 49 ? -3.229  -3.517  -8.823  1.00 0.00 ? 133 PHE A CE1  2  
ATOM 1968  C CE2  . PHE A 1 49 ? -4.550  -5.338  -8.016  1.00 0.00 ? 133 PHE A CE2  2  
ATOM 1969  C CZ   . PHE A 1 49 ? -3.717  -4.799  -8.975  1.00 0.00 ? 133 PHE A CZ   2  
ATOM 1970  H H    . PHE A 1 49 ? -7.065  -1.263  -4.193  1.00 0.00 ? 133 PHE A H    2  
ATOM 1971  H HA   . PHE A 1 49 ? -5.448  -0.687  -6.576  1.00 0.00 ? 133 PHE A HA   2  
ATOM 1972  H HB2  . PHE A 1 49 ? -3.955  -1.966  -5.173  1.00 0.00 ? 133 PHE A HB2  2  
ATOM 1973  H HB3  . PHE A 1 49 ? -5.224  -3.137  -4.803  1.00 0.00 ? 133 PHE A HB3  2  
ATOM 1974  H HD1  . PHE A 1 49 ? -3.197  -1.770  -7.595  1.00 0.00 ? 133 PHE A HD1  2  
ATOM 1975  H HD2  . PHE A 1 49 ? -5.541  -5.018  -6.154  1.00 0.00 ? 133 PHE A HD2  2  
ATOM 1976  H HE1  . PHE A 1 49 ? -2.577  -3.092  -9.573  1.00 0.00 ? 133 PHE A HE1  2  
ATOM 1977  H HE2  . PHE A 1 49 ? -4.925  -6.343  -8.133  1.00 0.00 ? 133 PHE A HE2  2  
ATOM 1978  H HZ   . PHE A 1 49 ? -3.455  -5.374  -9.847  1.00 0.00 ? 133 PHE A HZ   2  
ATOM 1979  N N    . GLU A 1 50 ? -6.967  -2.059  -8.033  1.00 0.00 ? 134 GLU A N    2  
ATOM 1980  C CA   . GLU A 1 50 ? -8.018  -2.586  -8.902  1.00 0.00 ? 134 GLU A CA   2  
ATOM 1981  C C    . GLU A 1 50 ? -9.284  -1.723  -8.796  1.00 0.00 ? 134 GLU A C    2  
ATOM 1982  O O    . GLU A 1 50 ? -9.897  -1.356  -9.801  1.00 0.00 ? 134 GLU A O    2  
ATOM 1983  C CB   . GLU A 1 50 ? -8.311  -4.045  -8.536  1.00 0.00 ? 134 GLU A CB   2  
ATOM 1984  C CG   . GLU A 1 50 ? -8.934  -4.863  -9.650  1.00 0.00 ? 134 GLU A CG   2  
ATOM 1985  C CD   . GLU A 1 50 ? -10.386 -4.522  -9.918  1.00 0.00 ? 134 GLU A CD   2  
ATOM 1986  O OE1  . GLU A 1 50 ? -11.226 -4.705  -9.014  1.00 0.00 ? 134 GLU A OE1  2  
ATOM 1987  O OE2  . GLU A 1 50 ? -10.692 -4.066  -11.043 1.00 0.00 ? 134 GLU A OE2  2  
ATOM 1988  H H    . GLU A 1 50 ? -6.182  -1.666  -8.451  1.00 0.00 ? 134 GLU A H    2  
ATOM 1989  H HA   . GLU A 1 50 ? -7.649  -2.548  -9.918  1.00 0.00 ? 134 GLU A HA   2  
ATOM 1990  H HB2  . GLU A 1 50 ? -7.385  -4.519  -8.252  1.00 0.00 ? 134 GLU A HB2  2  
ATOM 1991  H HB3  . GLU A 1 50 ? -8.982  -4.061  -7.691  1.00 0.00 ? 134 GLU A HB3  2  
ATOM 1992  H HG2  . GLU A 1 50 ? -8.374  -4.692  -10.556 1.00 0.00 ? 134 GLU A HG2  2  
ATOM 1993  H HG3  . GLU A 1 50 ? -8.861  -5.901  -9.382  1.00 0.00 ? 134 GLU A HG3  2  
ATOM 1994  N N    . GLY A 1 51 ? -9.627  -1.372  -7.570  1.00 0.00 ? 135 GLY A N    2  
ATOM 1995  C CA   . GLY A 1 51 ? -10.827 -0.625  -7.283  1.00 0.00 ? 135 GLY A CA   2  
ATOM 1996  C C    . GLY A 1 51 ? -11.270 -0.864  -5.857  1.00 0.00 ? 135 GLY A C    2  
ATOM 1997  O O    . GLY A 1 51 ? -12.039 -0.090  -5.289  1.00 0.00 ? 135 GLY A O    2  
ATOM 1998  H H    . GLY A 1 51 ? -9.031  -1.625  -6.829  1.00 0.00 ? 135 GLY A H    2  
ATOM 1999  H HA2  . GLY A 1 51 ? -10.631 0.429   -7.424  1.00 0.00 ? 135 GLY A HA2  2  
ATOM 2000  H HA3  . GLY A 1 51 ? -11.611 -0.936  -7.955  1.00 0.00 ? 135 GLY A HA3  2  
ATOM 2001  N N    . LYS A 1 52 ? -10.766 -1.949  -5.280  1.00 0.00 ? 136 LYS A N    2  
ATOM 2002  C CA   . LYS A 1 52 ? -11.079 -2.308  -3.908  1.00 0.00 ? 136 LYS A CA   2  
ATOM 2003  C C    . LYS A 1 52 ? -10.045 -1.705  -2.964  1.00 0.00 ? 136 LYS A C    2  
ATOM 2004  O O    . LYS A 1 52 ? -8.874  -1.557  -3.330  1.00 0.00 ? 136 LYS A O    2  
ATOM 2005  C CB   . LYS A 1 52 ? -11.092 -3.835  -3.747  1.00 0.00 ? 136 LYS A CB   2  
ATOM 2006  C CG   . LYS A 1 52 ? -11.950 -4.566  -4.771  1.00 0.00 ? 136 LYS A CG   2  
ATOM 2007  C CD   . LYS A 1 52 ? -13.402 -4.123  -4.715  1.00 0.00 ? 136 LYS A CD   2  
ATOM 2008  C CE   . LYS A 1 52 ? -14.270 -4.974  -5.630  1.00 0.00 ? 136 LYS A CE   2  
ATOM 2009  N NZ   . LYS A 1 52 ? -14.287 -6.400  -5.202  1.00 0.00 ? 136 LYS A NZ   2  
ATOM 2010  H H    . LYS A 1 52 ? -10.161 -2.524  -5.792  1.00 0.00 ? 136 LYS A H    2  
ATOM 2011  H HA   . LYS A 1 52 ? -12.057 -1.915  -3.667  1.00 0.00 ? 136 LYS A HA   2  
ATOM 2012  H HB2  . LYS A 1 52 ? -10.081 -4.202  -3.836  1.00 0.00 ? 136 LYS A HB2  2  
ATOM 2013  H HB3  . LYS A 1 52 ? -11.465 -4.076  -2.764  1.00 0.00 ? 136 LYS A HB3  2  
ATOM 2014  H HG2  . LYS A 1 52 ? -11.563 -4.363  -5.757  1.00 0.00 ? 136 LYS A HG2  2  
ATOM 2015  H HG3  . LYS A 1 52 ? -11.901 -5.626  -4.574  1.00 0.00 ? 136 LYS A HG3  2  
ATOM 2016  H HD2  . LYS A 1 52 ? -13.759 -4.219  -3.700  1.00 0.00 ? 136 LYS A HD2  2  
ATOM 2017  H HD3  . LYS A 1 52 ? -13.467 -3.090  -5.027  1.00 0.00 ? 136 LYS A HD3  2  
ATOM 2018  H HE2  . LYS A 1 52 ? -15.278 -4.588  -5.612  1.00 0.00 ? 136 LYS A HE2  2  
ATOM 2019  H HE3  . LYS A 1 52 ? -13.879 -4.912  -6.633  1.00 0.00 ? 136 LYS A HE3  2  
ATOM 2020  H HZ1  . LYS A 1 52 ? -13.325 -6.804  -5.247  1.00 0.00 ? 136 LYS A HZ1  2  
ATOM 2021  H HZ2  . LYS A 1 52 ? -14.913 -6.958  -5.822  1.00 0.00 ? 136 LYS A HZ2  2  
ATOM 2022  H HZ3  . LYS A 1 52 ? -14.637 -6.478  -4.222  1.00 0.00 ? 136 LYS A HZ3  2  
ATOM 2023  N N    . PRO A 1 53 ? -10.459 -1.332  -1.748  1.00 0.00 ? 137 PRO A N    2  
ATOM 2024  C CA   . PRO A 1 53 ? -9.543  -0.836  -0.724  1.00 0.00 ? 137 PRO A CA   2  
ATOM 2025  C C    . PRO A 1 53 ? -8.631  -1.945  -0.211  1.00 0.00 ? 137 PRO A C    2  
ATOM 2026  O O    . PRO A 1 53 ? -9.028  -3.110  -0.163  1.00 0.00 ? 137 PRO A O    2  
ATOM 2027  C CB   . PRO A 1 53 ? -10.468 -0.338  0.398   1.00 0.00 ? 137 PRO A CB   2  
ATOM 2028  C CG   . PRO A 1 53 ? -11.841 -0.321  -0.189  1.00 0.00 ? 137 PRO A CG   2  
ATOM 2029  C CD   . PRO A 1 53 ? -11.845 -1.361  -1.271  1.00 0.00 ? 137 PRO A CD   2  
ATOM 2030  H HA   . PRO A 1 53 ? -8.941  -0.016  -1.094  1.00 0.00 ? 137 PRO A HA   2  
ATOM 2031  H HB2  . PRO A 1 53 ? -10.410 -1.015  1.238   1.00 0.00 ? 137 PRO A HB2  2  
ATOM 2032  H HB3  . PRO A 1 53 ? -10.161 0.650   0.707   1.00 0.00 ? 137 PRO A HB3  2  
ATOM 2033  H HG2  . PRO A 1 53 ? -12.568 -0.567  0.570   1.00 0.00 ? 137 PRO A HG2  2  
ATOM 2034  H HG3  . PRO A 1 53 ? -12.049 0.653   -0.606  1.00 0.00 ? 137 PRO A HG3  2  
ATOM 2035  H HD2  . PRO A 1 53 ? -12.097 -2.331  -0.866  1.00 0.00 ? 137 PRO A HD2  2  
ATOM 2036  H HD3  . PRO A 1 53 ? -12.531 -1.088  -2.060  1.00 0.00 ? 137 PRO A HD3  2  
ATOM 2037  N N    . LEU A 1 54 ? -7.411  -1.586  0.161   1.00 0.00 ? 138 LEU A N    2  
ATOM 2038  C CA   . LEU A 1 54 ? -6.454  -2.565  0.659   1.00 0.00 ? 138 LEU A CA   2  
ATOM 2039  C C    . LEU A 1 54 ? -6.858  -3.071  2.041   1.00 0.00 ? 138 LEU A C    2  
ATOM 2040  O O    . LEU A 1 54 ? -6.775  -2.338  3.032   1.00 0.00 ? 138 LEU A O    2  
ATOM 2041  C CB   . LEU A 1 54 ? -5.044  -1.970  0.720   1.00 0.00 ? 138 LEU A CB   2  
ATOM 2042  C CG   . LEU A 1 54 ? -4.472  -1.486  -0.617  1.00 0.00 ? 138 LEU A CG   2  
ATOM 2043  C CD1  . LEU A 1 54 ? -3.041  -1.009  -0.430  1.00 0.00 ? 138 LEU A CD1  2  
ATOM 2044  C CD2  . LEU A 1 54 ? -4.531  -2.591  -1.662  1.00 0.00 ? 138 LEU A CD2  2  
ATOM 2045  H H    . LEU A 1 54 ? -7.146  -0.643  0.090   1.00 0.00 ? 138 LEU A H    2  
ATOM 2046  H HA   . LEU A 1 54 ? -6.448  -3.400  -0.027  1.00 0.00 ? 138 LEU A HA   2  
ATOM 2047  H HB2  . LEU A 1 54 ? -5.059  -1.135  1.404   1.00 0.00 ? 138 LEU A HB2  2  
ATOM 2048  H HB3  . LEU A 1 54 ? -4.380  -2.723  1.117   1.00 0.00 ? 138 LEU A HB3  2  
ATOM 2049  H HG   . LEU A 1 54 ? -5.058  -0.651  -0.972  1.00 0.00 ? 138 LEU A HG   2  
ATOM 2050  H HD11 . LEU A 1 54 ? -2.648  -0.669  -1.377  1.00 0.00 ? 138 LEU A HD11 2  
ATOM 2051  H HD12 . LEU A 1 54 ? -2.435  -1.823  -0.058  1.00 0.00 ? 138 LEU A HD12 2  
ATOM 2052  H HD13 . LEU A 1 54 ? -3.025  -0.195  0.280   1.00 0.00 ? 138 LEU A HD13 2  
ATOM 2053  H HD21 . LEU A 1 54 ? -5.558  -2.890  -1.811  1.00 0.00 ? 138 LEU A HD21 2  
ATOM 2054  H HD22 . LEU A 1 54 ? -3.956  -3.441  -1.322  1.00 0.00 ? 138 LEU A HD22 2  
ATOM 2055  H HD23 . LEU A 1 54 ? -4.123  -2.229  -2.593  1.00 0.00 ? 138 LEU A HD23 2  
ATOM 2056  N N    . GLU A 1 55 ? -7.314  -4.313  2.101   1.00 0.00 ? 139 GLU A N    2  
ATOM 2057  C CA   . GLU A 1 55 ? -7.650  -4.938  3.369   1.00 0.00 ? 139 GLU A CA   2  
ATOM 2058  C C    . GLU A 1 55 ? -6.458  -5.702  3.921   1.00 0.00 ? 139 GLU A C    2  
ATOM 2059  O O    . GLU A 1 55 ? -5.842  -6.507  3.219   1.00 0.00 ? 139 GLU A O    2  
ATOM 2060  C CB   . GLU A 1 55 ? -8.855  -5.865  3.222   1.00 0.00 ? 139 GLU A CB   2  
ATOM 2061  C CG   . GLU A 1 55 ? -10.178 -5.120  3.175   1.00 0.00 ? 139 GLU A CG   2  
ATOM 2062  C CD   . GLU A 1 55 ? -10.442 -4.345  4.452   1.00 0.00 ? 139 GLU A CD   2  
ATOM 2063  O OE1  . GLU A 1 55 ? -9.927  -3.216  4.593   1.00 0.00 ? 139 GLU A OE1  2  
ATOM 2064  O OE2  . GLU A 1 55 ? -11.154 -4.871  5.336   1.00 0.00 ? 139 GLU A OE2  2  
ATOM 2065  H H    . GLU A 1 55 ? -7.433  -4.821  1.271   1.00 0.00 ? 139 GLU A H    2  
ATOM 2066  H HA   . GLU A 1 55 ? -7.901  -4.150  4.065   1.00 0.00 ? 139 GLU A HA   2  
ATOM 2067  H HB2  . GLU A 1 55 ? -8.751  -6.433  2.310   1.00 0.00 ? 139 GLU A HB2  2  
ATOM 2068  H HB3  . GLU A 1 55 ? -8.880  -6.546  4.061   1.00 0.00 ? 139 GLU A HB3  2  
ATOM 2069  H HG2  . GLU A 1 55 ? -10.155 -4.427  2.347   1.00 0.00 ? 139 GLU A HG2  2  
ATOM 2070  H HG3  . GLU A 1 55 ? -10.976 -5.832  3.028   1.00 0.00 ? 139 GLU A HG3  2  
ATOM 2071  N N    . ASP A 1 56 ? -6.152  -5.445  5.186   1.00 0.00 ? 140 ASP A N    2  
ATOM 2072  C CA   . ASP A 1 56 ? -4.981  -6.020  5.850   1.00 0.00 ? 140 ASP A CA   2  
ATOM 2073  C C    . ASP A 1 56 ? -5.175  -7.512  6.140   1.00 0.00 ? 140 ASP A C    2  
ATOM 2074  O O    . ASP A 1 56 ? -4.254  -8.201  6.581   1.00 0.00 ? 140 ASP A O    2  
ATOM 2075  C CB   . ASP A 1 56 ? -4.698  -5.243  7.139   1.00 0.00 ? 140 ASP A CB   2  
ATOM 2076  C CG   . ASP A 1 56 ? -3.487  -5.747  7.892   1.00 0.00 ? 140 ASP A CG   2  
ATOM 2077  O OD1  . ASP A 1 56 ? -2.375  -5.704  7.335   1.00 0.00 ? 140 ASP A OD1  2  
ATOM 2078  O OD2  . ASP A 1 56 ? -3.645  -6.161  9.061   1.00 0.00 ? 140 ASP A OD2  2  
ATOM 2079  H H    . ASP A 1 56 ? -6.733  -4.838  5.697   1.00 0.00 ? 140 ASP A H    2  
ATOM 2080  H HA   . ASP A 1 56 ? -4.140  -5.905  5.183   1.00 0.00 ? 140 ASP A HA   2  
ATOM 2081  H HB2  . ASP A 1 56 ? -4.530  -4.206  6.892   1.00 0.00 ? 140 ASP A HB2  2  
ATOM 2082  H HB3  . ASP A 1 56 ? -5.559  -5.315  7.790   1.00 0.00 ? 140 ASP A HB3  2  
ATOM 2083  N N    . GLN A 1 57 ? -6.377  -8.008  5.887   1.00 0.00 ? 141 GLN A N    2  
ATOM 2084  C CA   . GLN A 1 57 ? -6.666  -9.429  6.033   1.00 0.00 ? 141 GLN A CA   2  
ATOM 2085  C C    . GLN A 1 57 ? -6.034  -10.210 4.880   1.00 0.00 ? 141 GLN A C    2  
ATOM 2086  O O    . GLN A 1 57 ? -5.919  -11.434 4.920   1.00 0.00 ? 141 GLN A O    2  
ATOM 2087  C CB   . GLN A 1 57 ? -8.180  -9.658  6.066   1.00 0.00 ? 141 GLN A CB   2  
ATOM 2088  C CG   . GLN A 1 57 ? -8.582  -11.057 6.504   1.00 0.00 ? 141 GLN A CG   2  
ATOM 2089  C CD   . GLN A 1 57 ? -10.085 -11.259 6.501   1.00 0.00 ? 141 GLN A CD   2  
ATOM 2090  O OE1  . GLN A 1 57 ? -10.762 -10.991 7.493   1.00 0.00 ? 141 GLN A OE1  2  
ATOM 2091  N NE2  . GLN A 1 57 ? -10.612 -11.742 5.389   1.00 0.00 ? 141 GLN A NE2  2  
ATOM 2092  H H    . GLN A 1 57 ? -7.094  -7.399  5.606   1.00 0.00 ? 141 GLN A H    2  
ATOM 2093  H HA   . GLN A 1 57 ? -6.234  -9.764  6.964   1.00 0.00 ? 141 GLN A HA   2  
ATOM 2094  H HB2  . GLN A 1 57 ? -8.624  -8.949  6.750   1.00 0.00 ? 141 GLN A HB2  2  
ATOM 2095  H HB3  . GLN A 1 57 ? -8.578  -9.486  5.077   1.00 0.00 ? 141 GLN A HB3  2  
ATOM 2096  H HG2  . GLN A 1 57 ? -8.137  -11.772 5.830   1.00 0.00 ? 141 GLN A HG2  2  
ATOM 2097  H HG3  . GLN A 1 57 ? -8.212  -11.227 7.505   1.00 0.00 ? 141 GLN A HG3  2  
ATOM 2098  H HE21 . GLN A 1 57 ? -10.012 -11.938 4.639   1.00 0.00 ? 141 GLN A HE21 2  
ATOM 2099  H HE22 . GLN A 1 57 ? -11.580 -11.893 5.361   1.00 0.00 ? 141 GLN A HE22 2  
ATOM 2100  N N    . LEU A 1 58 ? -5.622  -9.483  3.850   1.00 0.00 ? 142 LEU A N    2  
ATOM 2101  C CA   . LEU A 1 58 ? -4.982  -10.082 2.692   1.00 0.00 ? 142 LEU A CA   2  
ATOM 2102  C C    . LEU A 1 58 ? -3.582  -9.508  2.517   1.00 0.00 ? 142 LEU A C    2  
ATOM 2103  O O    . LEU A 1 58 ? -3.392  -8.292  2.570   1.00 0.00 ? 142 LEU A O    2  
ATOM 2104  C CB   . LEU A 1 58 ? -5.816  -9.832  1.434   1.00 0.00 ? 142 LEU A CB   2  
ATOM 2105  C CG   . LEU A 1 58 ? -7.228  -10.419 1.464   1.00 0.00 ? 142 LEU A CG   2  
ATOM 2106  C CD1  . LEU A 1 58 ? -8.016  -9.982  0.236   1.00 0.00 ? 142 LEU A CD1  2  
ATOM 2107  C CD2  . LEU A 1 58 ? -7.175  -11.938 1.549   1.00 0.00 ? 142 LEU A CD2  2  
ATOM 2108  H H    . LEU A 1 58 ? -5.738  -8.507  3.877   1.00 0.00 ? 142 LEU A H    2  
ATOM 2109  H HA   . LEU A 1 58 ? -4.906  -11.144 2.862   1.00 0.00 ? 142 LEU A HA   2  
ATOM 2110  H HB2  . LEU A 1 58 ? -5.895  -8.765  1.289   1.00 0.00 ? 142 LEU A HB2  2  
ATOM 2111  H HB3  . LEU A 1 58 ? -5.290  -10.255 0.591   1.00 0.00 ? 142 LEU A HB3  2  
ATOM 2112  H HG   . LEU A 1 58 ? -7.742  -10.052 2.340   1.00 0.00 ? 142 LEU A HG   2  
ATOM 2113  H HD11 . LEU A 1 58 ? -7.522  -10.337 -0.655  1.00 0.00 ? 142 LEU A HD11 2  
ATOM 2114  H HD12 . LEU A 1 58 ? -8.078  -8.903  0.210   1.00 0.00 ? 142 LEU A HD12 2  
ATOM 2115  H HD13 . LEU A 1 58 ? -9.015  -10.397 0.283   1.00 0.00 ? 142 LEU A HD13 2  
ATOM 2116  H HD21 . LEU A 1 58 ? -6.626  -12.232 2.431   1.00 0.00 ? 142 LEU A HD21 2  
ATOM 2117  H HD22 . LEU A 1 58 ? -6.682  -12.330 0.673   1.00 0.00 ? 142 LEU A HD22 2  
ATOM 2118  H HD23 . LEU A 1 58 ? -8.180  -12.333 1.603   1.00 0.00 ? 142 LEU A HD23 2  
ATOM 2119  N N    . PRO A 1 59 ? -2.583  -10.380 2.323   1.00 0.00 ? 143 PRO A N    2  
ATOM 2120  C CA   . PRO A 1 59 ? -1.189  -9.959  2.132   1.00 0.00 ? 143 PRO A CA   2  
ATOM 2121  C C    . PRO A 1 59 ? -1.015  -9.107  0.874   1.00 0.00 ? 143 PRO A C    2  
ATOM 2122  O O    . PRO A 1 59 ? -1.725  -9.295  -0.116  1.00 0.00 ? 143 PRO A O    2  
ATOM 2123  C CB   . PRO A 1 59 ? -0.425  -11.284 1.999   1.00 0.00 ? 143 PRO A CB   2  
ATOM 2124  C CG   . PRO A 1 59 ? -1.334  -12.319 2.570   1.00 0.00 ? 143 PRO A CG   2  
ATOM 2125  C CD   . PRO A 1 59 ? -2.725  -11.842 2.283   1.00 0.00 ? 143 PRO A CD   2  
ATOM 2126  H HA   . PRO A 1 59 ? -0.823  -9.413  2.988   1.00 0.00 ? 143 PRO A HA   2  
ATOM 2127  H HB2  . PRO A 1 59 ? -0.214  -11.477 0.958   1.00 0.00 ? 143 PRO A HB2  2  
ATOM 2128  H HB3  . PRO A 1 59 ? 0.499   -11.223 2.552   1.00 0.00 ? 143 PRO A HB3  2  
ATOM 2129  H HG2  . PRO A 1 59 ? -1.155  -13.270 2.091   1.00 0.00 ? 143 PRO A HG2  2  
ATOM 2130  H HG3  . PRO A 1 59 ? -1.175  -12.398 3.636   1.00 0.00 ? 143 PRO A HG3  2  
ATOM 2131  H HD2  . PRO A 1 59 ? -3.045  -12.174 1.305   1.00 0.00 ? 143 PRO A HD2  2  
ATOM 2132  H HD3  . PRO A 1 59 ? -3.409  -12.183 3.045   1.00 0.00 ? 143 PRO A HD3  2  
ATOM 2133  N N    . LEU A 1 60 ? -0.056  -8.182  0.913   1.00 0.00 ? 144 LEU A N    2  
ATOM 2134  C CA   . LEU A 1 60 ? 0.172   -7.251  -0.192  1.00 0.00 ? 144 LEU A CA   2  
ATOM 2135  C C    . LEU A 1 60 ? 0.512   -7.975  -1.491  1.00 0.00 ? 144 LEU A C    2  
ATOM 2136  O O    . LEU A 1 60 ? 0.276   -7.446  -2.579  1.00 0.00 ? 144 LEU A O    2  
ATOM 2137  C CB   . LEU A 1 60 ? 1.288   -6.264  0.160   1.00 0.00 ? 144 LEU A CB   2  
ATOM 2138  C CG   . LEU A 1 60 ? 0.923   -5.220  1.216   1.00 0.00 ? 144 LEU A CG   2  
ATOM 2139  C CD1  . LEU A 1 60 ? 2.156   -4.435  1.631   1.00 0.00 ? 144 LEU A CD1  2  
ATOM 2140  C CD2  . LEU A 1 60 ? -0.149  -4.283  0.686   1.00 0.00 ? 144 LEU A CD2  2  
ATOM 2141  H H    . LEU A 1 60 ? 0.515   -8.119  1.712   1.00 0.00 ? 144 LEU A H    2  
ATOM 2142  H HA   . LEU A 1 60 ? -0.742  -6.696  -0.341  1.00 0.00 ? 144 LEU A HA   2  
ATOM 2143  H HB2  . LEU A 1 60 ? 2.137   -6.828  0.519   1.00 0.00 ? 144 LEU A HB2  2  
ATOM 2144  H HB3  . LEU A 1 60 ? 1.578   -5.744  -0.741  1.00 0.00 ? 144 LEU A HB3  2  
ATOM 2145  H HG   . LEU A 1 60 ? 0.530   -5.719  2.090   1.00 0.00 ? 144 LEU A HG   2  
ATOM 2146  H HD11 . LEU A 1 60 ? 1.879   -3.695  2.368   1.00 0.00 ? 144 LEU A HD11 2  
ATOM 2147  H HD12 . LEU A 1 60 ? 2.578   -3.944  0.766   1.00 0.00 ? 144 LEU A HD12 2  
ATOM 2148  H HD13 . LEU A 1 60 ? 2.886   -5.109  2.054   1.00 0.00 ? 144 LEU A HD13 2  
ATOM 2149  H HD21 . LEU A 1 60 ? -1.045  -4.845  0.468   1.00 0.00 ? 144 LEU A HD21 2  
ATOM 2150  H HD22 . LEU A 1 60 ? 0.204   -3.806  -0.216  1.00 0.00 ? 144 LEU A HD22 2  
ATOM 2151  H HD23 . LEU A 1 60 ? -0.368  -3.530  1.429   1.00 0.00 ? 144 LEU A HD23 2  
ATOM 2152  N N    . GLY A 1 61 ? 1.056   -9.181  -1.380  1.00 0.00 ? 145 GLY A N    2  
ATOM 2153  C CA   . GLY A 1 61 ? 1.373   -9.964  -2.559  1.00 0.00 ? 145 GLY A CA   2  
ATOM 2154  C C    . GLY A 1 61 ? 0.147   -10.282 -3.391  1.00 0.00 ? 145 GLY A C    2  
ATOM 2155  O O    . GLY A 1 61 ? 0.245   -10.451 -4.601  1.00 0.00 ? 145 GLY A O    2  
ATOM 2156  H H    . GLY A 1 61 ? 1.251   -9.543  -0.488  1.00 0.00 ? 145 GLY A H    2  
ATOM 2157  H HA2  . GLY A 1 61 ? 2.074   -9.410  -3.167  1.00 0.00 ? 145 GLY A HA2  2  
ATOM 2158  H HA3  . GLY A 1 61 ? 1.833   -10.891 -2.250  1.00 0.00 ? 145 GLY A HA3  2  
ATOM 2159  N N    . GLU A 1 62 ? -1.009  -10.342 -2.750  1.00 0.00 ? 146 GLU A N    2  
ATOM 2160  C CA   . GLU A 1 62 ? -2.250  -10.654 -3.437  1.00 0.00 ? 146 GLU A CA   2  
ATOM 2161  C C    . GLU A 1 62 ? -2.706  -9.488  -4.308  1.00 0.00 ? 146 GLU A C    2  
ATOM 2162  O O    . GLU A 1 62 ? -3.489  -9.665  -5.241  1.00 0.00 ? 146 GLU A O    2  
ATOM 2163  C CB   . GLU A 1 62 ? -3.326  -11.000 -2.414  1.00 0.00 ? 146 GLU A CB   2  
ATOM 2164  C CG   . GLU A 1 62 ? -3.024  -12.264 -1.623  1.00 0.00 ? 146 GLU A CG   2  
ATOM 2165  C CD   . GLU A 1 62 ? -3.021  -13.504 -2.491  1.00 0.00 ? 146 GLU A CD   2  
ATOM 2166  O OE1  . GLU A 1 62 ? -1.977  -13.810 -3.100  1.00 0.00 ? 146 GLU A OE1  2  
ATOM 2167  O OE2  . GLU A 1 62 ? -4.069  -14.176 -2.571  1.00 0.00 ? 146 GLU A OE2  2  
ATOM 2168  H H    . GLU A 1 62 ? -1.035  -10.169 -1.784  1.00 0.00 ? 146 GLU A H    2  
ATOM 2169  H HA   . GLU A 1 62 ? -2.073  -11.511 -4.068  1.00 0.00 ? 146 GLU A HA   2  
ATOM 2170  H HB2  . GLU A 1 62 ? -3.424  -10.179 -1.719  1.00 0.00 ? 146 GLU A HB2  2  
ATOM 2171  H HB3  . GLU A 1 62 ? -4.257  -11.138 -2.929  1.00 0.00 ? 146 GLU A HB3  2  
ATOM 2172  H HG2  . GLU A 1 62 ? -2.052  -12.161 -1.161  1.00 0.00 ? 146 GLU A HG2  2  
ATOM 2173  H HG3  . GLU A 1 62 ? -3.775  -12.379 -0.856  1.00 0.00 ? 146 GLU A HG3  2  
ATOM 2174  N N    . TYR A 1 63 ? -2.214  -8.298  -3.994  1.00 0.00 ? 147 TYR A N    2  
ATOM 2175  C CA   . TYR A 1 63 ? -2.566  -7.102  -4.746  1.00 0.00 ? 147 TYR A CA   2  
ATOM 2176  C C    . TYR A 1 63 ? -1.459  -6.743  -5.733  1.00 0.00 ? 147 TYR A C    2  
ATOM 2177  O O    . TYR A 1 63 ? -1.714  -6.439  -6.895  1.00 0.00 ? 147 TYR A O    2  
ATOM 2178  C CB   . TYR A 1 63 ? -2.790  -5.915  -3.800  1.00 0.00 ? 147 TYR A CB   2  
ATOM 2179  C CG   . TYR A 1 63 ? -3.772  -6.173  -2.677  1.00 0.00 ? 147 TYR A CG   2  
ATOM 2180  C CD1  . TYR A 1 63 ? -5.134  -5.957  -2.849  1.00 0.00 ? 147 TYR A CD1  2  
ATOM 2181  C CD2  . TYR A 1 63 ? -3.330  -6.617  -1.437  1.00 0.00 ? 147 TYR A CD2  2  
ATOM 2182  C CE1  . TYR A 1 63 ? -6.027  -6.182  -1.819  1.00 0.00 ? 147 TYR A CE1  2  
ATOM 2183  C CE2  . TYR A 1 63 ? -4.216  -6.840  -0.403  1.00 0.00 ? 147 TYR A CE2  2  
ATOM 2184  C CZ   . TYR A 1 63 ? -5.564  -6.621  -0.597  1.00 0.00 ? 147 TYR A CZ   2  
ATOM 2185  O OH   . TYR A 1 63 ? -6.447  -6.839  0.434   1.00 0.00 ? 147 TYR A OH   2  
ATOM 2186  H H    . TYR A 1 63 ? -1.594  -8.224  -3.239  1.00 0.00 ? 147 TYR A H    2  
ATOM 2187  H HA   . TYR A 1 63 ? -3.476  -7.299  -5.290  1.00 0.00 ? 147 TYR A HA   2  
ATOM 2188  H HB2  . TYR A 1 63 ? -1.846  -5.643  -3.355  1.00 0.00 ? 147 TYR A HB2  2  
ATOM 2189  H HB3  . TYR A 1 63 ? -3.160  -5.079  -4.376  1.00 0.00 ? 147 TYR A HB3  2  
ATOM 2190  H HD1  . TYR A 1 63 ? -5.496  -5.612  -3.810  1.00 0.00 ? 147 TYR A HD1  2  
ATOM 2191  H HD2  . TYR A 1 63 ? -2.274  -6.789  -1.287  1.00 0.00 ? 147 TYR A HD2  2  
ATOM 2192  H HE1  . TYR A 1 63 ? -7.080  -6.010  -1.972  1.00 0.00 ? 147 TYR A HE1  2  
ATOM 2193  H HE2  . TYR A 1 63 ? -3.852  -7.186  0.554   1.00 0.00 ? 147 TYR A HE2  2  
ATOM 2194  H HH   . TYR A 1 63 ? -6.016  -6.637  1.276   1.00 0.00 ? 147 TYR A HH   2  
ATOM 2195  N N    . GLY A 1 64 ? -0.225  -6.793  -5.252  1.00 0.00 ? 148 GLY A N    2  
ATOM 2196  C CA   . GLY A 1 64 ? 0.903   -6.303  -6.021  1.00 0.00 ? 148 GLY A CA   2  
ATOM 2197  C C    . GLY A 1 64 ? 1.697   -7.394  -6.714  1.00 0.00 ? 148 GLY A C    2  
ATOM 2198  O O    . GLY A 1 64 ? 2.757   -7.107  -7.264  1.00 0.00 ? 148 GLY A O    2  
ATOM 2199  H H    . GLY A 1 64 ? -0.076  -7.165  -4.355  1.00 0.00 ? 148 GLY A H    2  
ATOM 2200  H HA2  . GLY A 1 64 ? 0.535   -5.621  -6.769  1.00 0.00 ? 148 GLY A HA2  2  
ATOM 2201  H HA3  . GLY A 1 64 ? 1.565   -5.765  -5.358  1.00 0.00 ? 148 GLY A HA3  2  
ATOM 2202  N N    . LEU A 1 65 ? 1.199   -8.635  -6.655  1.00 0.00 ? 149 LEU A N    2  
ATOM 2203  C CA   . LEU A 1 65 ? 1.883   -9.826  -7.207  1.00 0.00 ? 149 LEU A CA   2  
ATOM 2204  C C    . LEU A 1 65 ? 2.683   -9.549  -8.481  1.00 0.00 ? 149 LEU A C    2  
ATOM 2205  O O    . LEU A 1 65 ? 3.789   -10.066 -8.647  1.00 0.00 ? 149 LEU A O    2  
ATOM 2206  C CB   . LEU A 1 65 ? 0.880   -10.962 -7.483  1.00 0.00 ? 149 LEU A CB   2  
ATOM 2207  C CG   . LEU A 1 65 ? -0.161  -10.703 -8.582  1.00 0.00 ? 149 LEU A CG   2  
ATOM 2208  C CD1  . LEU A 1 65 ? -0.774  -12.015 -9.048  1.00 0.00 ? 149 LEU A CD1  2  
ATOM 2209  C CD2  . LEU A 1 65 ? -1.254  -9.768  -8.087  1.00 0.00 ? 149 LEU A CD2  2  
ATOM 2210  H H    . LEU A 1 65 ? 0.336   -8.769  -6.205  1.00 0.00 ? 149 LEU A H    2  
ATOM 2211  H HA   . LEU A 1 65 ? 2.572   -10.165 -6.455  1.00 0.00 ? 149 LEU A HA   2  
ATOM 2212  H HB2  . LEU A 1 65 ? 1.442   -11.841 -7.758  1.00 0.00 ? 149 LEU A HB2  2  
ATOM 2213  H HB3  . LEU A 1 65 ? 0.352   -11.170 -6.564  1.00 0.00 ? 149 LEU A HB3  2  
ATOM 2214  H HG   . LEU A 1 65 ? 0.323   -10.238 -9.428  1.00 0.00 ? 149 LEU A HG   2  
ATOM 2215  H HD11 . LEU A 1 65 ? -1.492  -11.818 -9.831  1.00 0.00 ? 149 LEU A HD11 2  
ATOM 2216  H HD12 . LEU A 1 65 ? -1.268  -12.497 -8.219  1.00 0.00 ? 149 LEU A HD12 2  
ATOM 2217  H HD13 . LEU A 1 65 ? 0.005   -12.660 -9.427  1.00 0.00 ? 149 LEU A HD13 2  
ATOM 2218  H HD21 . LEU A 1 65 ? -1.750  -10.210 -7.236  1.00 0.00 ? 149 LEU A HD21 2  
ATOM 2219  H HD22 . LEU A 1 65 ? -1.972  -9.602  -8.876  1.00 0.00 ? 149 LEU A HD22 2  
ATOM 2220  H HD23 . LEU A 1 65 ? -0.815  -8.825  -7.796  1.00 0.00 ? 149 LEU A HD23 2  
ATOM 2221  N N    . LYS A 1 66 ? 2.126   -8.752  -9.375  1.00 0.00 ? 150 LYS A N    2  
ATOM 2222  C CA   . LYS A 1 66 ? 2.811   -8.401  -10.607 1.00 0.00 ? 150 LYS A CA   2  
ATOM 2223  C C    . LYS A 1 66 ? 3.621   -7.119  -10.414 1.00 0.00 ? 150 LYS A C    2  
ATOM 2224  O O    . LYS A 1 66 ? 3.060   -6.071  -10.087 1.00 0.00 ? 150 LYS A O    2  
ATOM 2225  C CB   . LYS A 1 66 ? 1.802   -8.224  -11.743 1.00 0.00 ? 150 LYS A CB   2  
ATOM 2226  C CG   . LYS A 1 66 ? 2.446   -7.942  -13.089 1.00 0.00 ? 150 LYS A CG   2  
ATOM 2227  C CD   . LYS A 1 66 ? 1.416   -7.921  -14.204 1.00 0.00 ? 150 LYS A CD   2  
ATOM 2228  C CE   . LYS A 1 66 ? 2.057   -7.652  -15.554 1.00 0.00 ? 150 LYS A CE   2  
ATOM 2229  N NZ   . LYS A 1 66 ? 1.070   -7.742  -16.660 1.00 0.00 ? 150 LYS A NZ   2  
ATOM 2230  H H    . LYS A 1 66 ? 1.242   -8.377  -9.192  1.00 0.00 ? 150 LYS A H    2  
ATOM 2231  H HA   . LYS A 1 66 ? 3.485   -9.206  -10.856 1.00 0.00 ? 150 LYS A HA   2  
ATOM 2232  H HB2  . LYS A 1 66 ? 1.214   -9.124  -11.828 1.00 0.00 ? 150 LYS A HB2  2  
ATOM 2233  H HB3  . LYS A 1 66 ? 1.146   -7.399  -11.500 1.00 0.00 ? 150 LYS A HB3  2  
ATOM 2234  H HG2  . LYS A 1 66 ? 2.938   -6.982  -13.050 1.00 0.00 ? 150 LYS A HG2  2  
ATOM 2235  H HG3  . LYS A 1 66 ? 3.173   -8.715  -13.297 1.00 0.00 ? 150 LYS A HG3  2  
ATOM 2236  H HD2  . LYS A 1 66 ? 0.918   -8.878  -14.239 1.00 0.00 ? 150 LYS A HD2  2  
ATOM 2237  H HD3  . LYS A 1 66 ? 0.694   -7.144  -13.998 1.00 0.00 ? 150 LYS A HD3  2  
ATOM 2238  H HE2  . LYS A 1 66 ? 2.486   -6.661  -15.545 1.00 0.00 ? 150 LYS A HE2  2  
ATOM 2239  H HE3  . LYS A 1 66 ? 2.838   -8.380  -15.720 1.00 0.00 ? 150 LYS A HE3  2  
ATOM 2240  H HZ1  . LYS A 1 66 ? 1.528   -7.535  -17.572 1.00 0.00 ? 150 LYS A HZ1  2  
ATOM 2241  H HZ2  . LYS A 1 66 ? 0.297   -7.058  -16.509 1.00 0.00 ? 150 LYS A HZ2  2  
ATOM 2242  H HZ3  . LYS A 1 66 ? 0.663   -8.702  -16.700 1.00 0.00 ? 150 LYS A HZ3  2  
ATOM 2243  N N    . PRO A 1 67 ? 4.952   -7.191  -10.606 1.00 0.00 ? 151 PRO A N    2  
ATOM 2244  C CA   . PRO A 1 67 ? 5.849   -6.038  -10.450 1.00 0.00 ? 151 PRO A CA   2  
ATOM 2245  C C    . PRO A 1 67 ? 5.590   -4.959  -11.500 1.00 0.00 ? 151 PRO A C    2  
ATOM 2246  O O    . PRO A 1 67 ? 6.281   -4.888  -12.518 1.00 0.00 ? 151 PRO A O    2  
ATOM 2247  C CB   . PRO A 1 67 ? 7.256   -6.629  -10.620 1.00 0.00 ? 151 PRO A CB   2  
ATOM 2248  C CG   . PRO A 1 67 ? 7.083   -8.108  -10.502 1.00 0.00 ? 151 PRO A CG   2  
ATOM 2249  C CD   . PRO A 1 67 ? 5.692   -8.403  -10.980 1.00 0.00 ? 151 PRO A CD   2  
ATOM 2250  H HA   . PRO A 1 67 ? 5.760   -5.602  -9.466  1.00 0.00 ? 151 PRO A HA   2  
ATOM 2251  H HB2  . PRO A 1 67 ? 7.646   -6.354  -11.589 1.00 0.00 ? 151 PRO A HB2  2  
ATOM 2252  H HB3  . PRO A 1 67 ? 7.905   -6.248  -9.845  1.00 0.00 ? 151 PRO A HB3  2  
ATOM 2253  H HG2  . PRO A 1 67 ? 7.806   -8.613  -11.126 1.00 0.00 ? 151 PRO A HG2  2  
ATOM 2254  H HG3  . PRO A 1 67 ? 7.198   -8.411  -9.473  1.00 0.00 ? 151 PRO A HG3  2  
ATOM 2255  H HD2  . PRO A 1 67 ? 5.682   -8.545  -12.050 1.00 0.00 ? 151 PRO A HD2  2  
ATOM 2256  H HD3  . PRO A 1 67 ? 5.293   -9.270  -10.475 1.00 0.00 ? 151 PRO A HD3  2  
ATOM 2257  N N    . LEU A 1 68 ? 4.570   -4.144  -11.231 1.00 0.00 ? 152 LEU A N    2  
ATOM 2258  C CA   . LEU A 1 68 ? 4.132   -3.064  -12.117 1.00 0.00 ? 152 LEU A CA   2  
ATOM 2259  C C    . LEU A 1 68 ? 2.776   -2.555  -11.638 1.00 0.00 ? 152 LEU A C    2  
ATOM 2260  O O    . LEU A 1 68 ? 2.423   -1.396  -11.863 1.00 0.00 ? 152 LEU A O    2  
ATOM 2261  C CB   . LEU A 1 68 ? 4.027   -3.540  -13.579 1.00 0.00 ? 152 LEU A CB   2  
ATOM 2262  C CG   . LEU A 1 68 ? 3.930   -2.432  -14.638 1.00 0.00 ? 152 LEU A CG   2  
ATOM 2263  C CD1  . LEU A 1 68 ? 4.522   -2.909  -15.954 1.00 0.00 ? 152 LEU A CD1  2  
ATOM 2264  C CD2  . LEU A 1 68 ? 2.485   -2.010  -14.851 1.00 0.00 ? 152 LEU A CD2  2  
ATOM 2265  H H    . LEU A 1 68 ? 4.092   -4.273  -10.385 1.00 0.00 ? 152 LEU A H    2  
ATOM 2266  H HA   . LEU A 1 68 ? 4.853   -2.261  -12.052 1.00 0.00 ? 152 LEU A HA   2  
ATOM 2267  H HB2  . LEU A 1 68 ? 4.894   -4.143  -13.801 1.00 0.00 ? 152 LEU A HB2  2  
ATOM 2268  H HB3  . LEU A 1 68 ? 3.147   -4.162  -13.668 1.00 0.00 ? 152 LEU A HB3  2  
ATOM 2269  H HG   . LEU A 1 68 ? 4.491   -1.569  -14.310 1.00 0.00 ? 152 LEU A HG   2  
ATOM 2270  H HD11 . LEU A 1 68 ? 5.544   -3.218  -15.801 1.00 0.00 ? 152 LEU A HD11 2  
ATOM 2271  H HD12 . LEU A 1 68 ? 4.493   -2.105  -16.675 1.00 0.00 ? 152 LEU A HD12 2  
ATOM 2272  H HD13 . LEU A 1 68 ? 3.945   -3.744  -16.324 1.00 0.00 ? 152 LEU A HD13 2  
ATOM 2273  H HD21 . LEU A 1 68 ? 1.911   -2.861  -15.185 1.00 0.00 ? 152 LEU A HD21 2  
ATOM 2274  H HD22 . LEU A 1 68 ? 2.443   -1.231  -15.598 1.00 0.00 ? 152 LEU A HD22 2  
ATOM 2275  H HD23 . LEU A 1 68 ? 2.076   -1.642  -13.922 1.00 0.00 ? 152 LEU A HD23 2  
ATOM 2276  N N    . SER A 1 69 ? 2.034   -3.444  -10.969 1.00 0.00 ? 153 SER A N    2  
ATOM 2277  C CA   . SER A 1 69 ? 0.703   -3.134  -10.447 1.00 0.00 ? 153 SER A CA   2  
ATOM 2278  C C    . SER A 1 69 ? 0.684   -1.781  -9.739  1.00 0.00 ? 153 SER A C    2  
ATOM 2279  O O    . SER A 1 69 ? 1.478   -1.524  -8.831  1.00 0.00 ? 153 SER A O    2  
ATOM 2280  C CB   . SER A 1 69 ? 0.263   -4.235  -9.482  1.00 0.00 ? 153 SER A CB   2  
ATOM 2281  O OG   . SER A 1 69 ? 0.424   -5.516  -10.074 1.00 0.00 ? 153 SER A OG   2  
ATOM 2282  H H    . SER A 1 69 ? 2.388   -4.348  -10.830 1.00 0.00 ? 153 SER A H    2  
ATOM 2283  H HA   . SER A 1 69 ? 0.019   -3.103  -11.281 1.00 0.00 ? 153 SER A HA   2  
ATOM 2284  H HB2  . SER A 1 69 ? 0.862   -4.187  -8.585  1.00 0.00 ? 153 SER A HB2  2  
ATOM 2285  H HB3  . SER A 1 69 ? -0.779  -4.096  -9.230  1.00 0.00 ? 153 SER A HB3  2  
ATOM 2286  H HG   . SER A 1 69 ? 1.302   -5.857  -9.859  1.00 0.00 ? 153 SER A HG   2  
ATOM 2287  N N    . THR A 1 70 ? -0.222  -0.918  -10.170 1.00 0.00 ? 154 THR A N    2  
ATOM 2288  C CA   . THR A 1 70 ? -0.290  0.433   -9.653  1.00 0.00 ? 154 THR A CA   2  
ATOM 2289  C C    . THR A 1 70 ? -1.351  0.557   -8.565  1.00 0.00 ? 154 THR A C    2  
ATOM 2290  O O    . THR A 1 70 ? -2.531  0.288   -8.794  1.00 0.00 ? 154 THR A O    2  
ATOM 2291  C CB   . THR A 1 70 ? -0.590  1.435   -10.782 1.00 0.00 ? 154 THR A CB   2  
ATOM 2292  O OG1  . THR A 1 70 ? 0.323   1.220   -11.867 1.00 0.00 ? 154 THR A OG1  2  
ATOM 2293  C CG2  . THR A 1 70 ? -0.467  2.872   -10.291 1.00 0.00 ? 154 THR A CG2  2  
ATOM 2294  H H    . THR A 1 70 ? -0.877  -1.204  -10.849 1.00 0.00 ? 154 THR A H    2  
ATOM 2295  H HA   . THR A 1 70 ? 0.674   0.677   -9.231  1.00 0.00 ? 154 THR A HA   2  
ATOM 2296  H HB   . THR A 1 70 ? -1.599  1.271   -11.131 1.00 0.00 ? 154 THR A HB   2  
ATOM 2297  H HG1  . THR A 1 70 ? 0.805   0.398   -11.720 1.00 0.00 ? 154 THR A HG1  2  
ATOM 2298  H HG21 . THR A 1 70 ? 0.542   3.051   -9.949  1.00 0.00 ? 154 THR A HG21 2  
ATOM 2299  H HG22 . THR A 1 70 ? -1.159  3.036   -9.477  1.00 0.00 ? 154 THR A HG22 2  
ATOM 2300  H HG23 . THR A 1 70 ? -0.697  3.548   -11.102 1.00 0.00 ? 154 THR A HG23 2  
ATOM 2301  N N    . VAL A 1 71 ? -0.913  0.956   -7.380  1.00 0.00 ? 155 VAL A N    2  
ATOM 2302  C CA   . VAL A 1 71 ? -1.809  1.193   -6.263  1.00 0.00 ? 155 VAL A CA   2  
ATOM 2303  C C    . VAL A 1 71 ? -2.070  2.689   -6.134  1.00 0.00 ? 155 VAL A C    2  
ATOM 2304  O O    . VAL A 1 71 ? -1.140  3.496   -6.190  1.00 0.00 ? 155 VAL A O    2  
ATOM 2305  C CB   . VAL A 1 71 ? -1.218  0.657   -4.938  1.00 0.00 ? 155 VAL A CB   2  
ATOM 2306  C CG1  . VAL A 1 71 ? -2.180  0.876   -3.779  1.00 0.00 ? 155 VAL A CG1  2  
ATOM 2307  C CG2  . VAL A 1 71 ? -0.864  -0.818  -5.069  1.00 0.00 ? 155 VAL A CG2  2  
ATOM 2308  H H    . VAL A 1 71 ? 0.053   1.115   -7.259  1.00 0.00 ? 155 VAL A H    2  
ATOM 2309  H HA   . VAL A 1 71 ? -2.741  0.685   -6.461  1.00 0.00 ? 155 VAL A HA   2  
ATOM 2310  H HB   . VAL A 1 71 ? -0.312  1.204   -4.728  1.00 0.00 ? 155 VAL A HB   2  
ATOM 2311  H HG11 . VAL A 1 71 ? -3.097  0.337   -3.964  1.00 0.00 ? 155 VAL A HG11 2  
ATOM 2312  H HG12 . VAL A 1 71 ? -2.397  1.930   -3.684  1.00 0.00 ? 155 VAL A HG12 2  
ATOM 2313  H HG13 . VAL A 1 71 ? -1.731  0.519   -2.865  1.00 0.00 ? 155 VAL A HG13 2  
ATOM 2314  H HG21 . VAL A 1 71 ? -0.448  -1.173  -4.139  1.00 0.00 ? 155 VAL A HG21 2  
ATOM 2315  H HG22 . VAL A 1 71 ? -0.138  -0.944  -5.861  1.00 0.00 ? 155 VAL A HG22 2  
ATOM 2316  H HG23 . VAL A 1 71 ? -1.755  -1.383  -5.304  1.00 0.00 ? 155 VAL A HG23 2  
ATOM 2317  N N    . PHE A 1 72 ? -3.327  3.063   -5.979  1.00 0.00 ? 156 PHE A N    2  
ATOM 2318  C CA   . PHE A 1 72 ? -3.686  4.467   -5.898  1.00 0.00 ? 156 PHE A CA   2  
ATOM 2319  C C    . PHE A 1 72 ? -3.990  4.871   -4.464  1.00 0.00 ? 156 PHE A C    2  
ATOM 2320  O O    . PHE A 1 72 ? -4.826  4.260   -3.794  1.00 0.00 ? 156 PHE A O    2  
ATOM 2321  C CB   . PHE A 1 72 ? -4.884  4.769   -6.801  1.00 0.00 ? 156 PHE A CB   2  
ATOM 2322  C CG   . PHE A 1 72 ? -4.574  4.648   -8.269  1.00 0.00 ? 156 PHE A CG   2  
ATOM 2323  C CD1  . PHE A 1 72 ? -4.061  5.726   -8.972  1.00 0.00 ? 156 PHE A CD1  2  
ATOM 2324  C CD2  . PHE A 1 72 ? -4.790  3.455   -8.944  1.00 0.00 ? 156 PHE A CD2  2  
ATOM 2325  C CE1  . PHE A 1 72 ? -3.769  5.618   -10.319 1.00 0.00 ? 156 PHE A CE1  2  
ATOM 2326  C CE2  . PHE A 1 72 ? -4.501  3.344   -10.291 1.00 0.00 ? 156 PHE A CE2  2  
ATOM 2327  C CZ   . PHE A 1 72 ? -3.991  4.426   -10.979 1.00 0.00 ? 156 PHE A CZ   2  
ATOM 2328  H H    . PHE A 1 72 ? -4.032  2.379   -5.909  1.00 0.00 ? 156 PHE A H    2  
ATOM 2329  H HA   . PHE A 1 72 ? -2.838  5.041   -6.241  1.00 0.00 ? 156 PHE A HA   2  
ATOM 2330  H HB2  . PHE A 1 72 ? -5.682  4.078   -6.573  1.00 0.00 ? 156 PHE A HB2  2  
ATOM 2331  H HB3  . PHE A 1 72 ? -5.224  5.778   -6.612  1.00 0.00 ? 156 PHE A HB3  2  
ATOM 2332  H HD1  . PHE A 1 72 ? -3.885  6.660   -8.460  1.00 0.00 ? 156 PHE A HD1  2  
ATOM 2333  H HD2  . PHE A 1 72 ? -5.193  2.609   -8.410  1.00 0.00 ? 156 PHE A HD2  2  
ATOM 2334  H HE1  . PHE A 1 72 ? -3.370  6.467   -10.855 1.00 0.00 ? 156 PHE A HE1  2  
ATOM 2335  H HE2  . PHE A 1 72 ? -4.675  2.408   -10.806 1.00 0.00 ? 156 PHE A HE2  2  
ATOM 2336  H HZ   . PHE A 1 72 ? -3.764  4.341   -12.033 1.00 0.00 ? 156 PHE A HZ   2  
ATOM 2337  N N    . MET A 1 73 ? -3.295  5.892   -3.988  1.00 0.00 ? 157 MET A N    2  
ATOM 2338  C CA   . MET A 1 73 ? -3.554  6.429   -2.667  1.00 0.00 ? 157 MET A CA   2  
ATOM 2339  C C    . MET A 1 73 ? -4.741  7.379   -2.734  1.00 0.00 ? 157 MET A C    2  
ATOM 2340  O O    . MET A 1 73 ? -4.806  8.253   -3.601  1.00 0.00 ? 157 MET A O    2  
ATOM 2341  C CB   . MET A 1 73 ? -2.328  7.156   -2.121  1.00 0.00 ? 157 MET A CB   2  
ATOM 2342  C CG   . MET A 1 73 ? -2.535  7.705   -0.723  1.00 0.00 ? 157 MET A CG   2  
ATOM 2343  S SD   . MET A 1 73 ? -1.144  8.680   -0.130  1.00 0.00 ? 157 MET A SD   2  
ATOM 2344  C CE   . MET A 1 73 ? -1.779  9.191   1.463   1.00 0.00 ? 157 MET A CE   2  
ATOM 2345  H H    . MET A 1 73 ? -2.593  6.303   -4.542  1.00 0.00 ? 157 MET A H    2  
ATOM 2346  H HA   . MET A 1 73 ? -3.802  5.605   -2.013  1.00 0.00 ? 157 MET A HA   2  
ATOM 2347  H HB2  . MET A 1 73 ? -1.495  6.469   -2.099  1.00 0.00 ? 157 MET A HB2  2  
ATOM 2348  H HB3  . MET A 1 73 ? -2.088  7.980   -2.778  1.00 0.00 ? 157 MET A HB3  2  
ATOM 2349  H HG2  . MET A 1 73 ? -3.415  8.327   -0.726  1.00 0.00 ? 157 MET A HG2  2  
ATOM 2350  H HG3  . MET A 1 73 ? -2.688  6.875   -0.047  1.00 0.00 ? 157 MET A HG3  2  
ATOM 2351  H HE1  . MET A 1 73 ? -1.988  8.317   2.064   1.00 0.00 ? 157 MET A HE1  2  
ATOM 2352  H HE2  . MET A 1 73 ? -2.687  9.757   1.324   1.00 0.00 ? 157 MET A HE2  2  
ATOM 2353  H HE3  . MET A 1 73 ? -1.046  9.802   1.963   1.00 0.00 ? 157 MET A HE3  2  
ATOM 2354  N N    . ASN A 1 74 ? -5.681  7.196   -1.829  1.00 0.00 ? 158 ASN A N    2  
ATOM 2355  C CA   . ASN A 1 74 ? -6.904  7.977   -1.837  1.00 0.00 ? 158 ASN A CA   2  
ATOM 2356  C C    . ASN A 1 74 ? -7.067  8.751   -0.541  1.00 0.00 ? 158 ASN A C    2  
ATOM 2357  O O    . ASN A 1 74 ? -6.680  8.282   0.530   1.00 0.00 ? 158 ASN A O    2  
ATOM 2358  C CB   . ASN A 1 74 ? -8.106  7.061   -2.057  1.00 0.00 ? 158 ASN A CB   2  
ATOM 2359  C CG   . ASN A 1 74 ? -8.236  6.597   -3.493  1.00 0.00 ? 158 ASN A CG   2  
ATOM 2360  O OD1  . ASN A 1 74 ? -8.852  7.268   -4.319  1.00 0.00 ? 158 ASN A OD1  2  
ATOM 2361  N ND2  . ASN A 1 74 ? -7.659  5.450   -3.800  1.00 0.00 ? 158 ASN A ND2  2  
ATOM 2362  H H    . ASN A 1 74 ? -5.554  6.521   -1.128  1.00 0.00 ? 158 ASN A H    2  
ATOM 2363  H HA   . ASN A 1 74 ? -6.844  8.678   -2.657  1.00 0.00 ? 158 ASN A HA   2  
ATOM 2364  H HB2  . ASN A 1 74 ? -8.000  6.189   -1.427  1.00 0.00 ? 158 ASN A HB2  2  
ATOM 2365  H HB3  . ASN A 1 74 ? -9.004  7.584   -1.782  1.00 0.00 ? 158 ASN A HB3  2  
ATOM 2366  H HD21 . ASN A 1 74 ? -7.181  4.967   -3.094  1.00 0.00 ? 158 ASN A HD21 2  
ATOM 2367  H HD22 . ASN A 1 74 ? -7.740  5.116   -4.720  1.00 0.00 ? 158 ASN A HD22 2  
ATOM 2368  N N    . LEU A 1 75 ? -7.635  9.939   -0.652  1.00 0.00 ? 159 LEU A N    2  
ATOM 2369  C CA   . LEU A 1 75 ? -7.907  10.780  0.502   1.00 0.00 ? 159 LEU A CA   2  
ATOM 2370  C C    . LEU A 1 75 ? -9.383  11.149  0.511   1.00 0.00 ? 159 LEU A C    2  
ATOM 2371  O O    . LEU A 1 75 ? -9.954  11.448  -0.540  1.00 0.00 ? 159 LEU A O    2  
ATOM 2372  C CB   . LEU A 1 75 ? -7.059  12.059  0.454   1.00 0.00 ? 159 LEU A CB   2  
ATOM 2373  C CG   . LEU A 1 75 ? -5.558  11.852  0.316   1.00 0.00 ? 159 LEU A CG   2  
ATOM 2374  C CD1  . LEU A 1 75 ? -4.878  13.184  0.084   1.00 0.00 ? 159 LEU A CD1  2  
ATOM 2375  C CD2  . LEU A 1 75 ? -4.990  11.180  1.554   1.00 0.00 ? 159 LEU A CD2  2  
ATOM 2376  H H    . LEU A 1 75 ? -7.889  10.263  -1.541  1.00 0.00 ? 159 LEU A H    2  
ATOM 2377  H HA   . LEU A 1 75 ? -7.672  10.222  1.396   1.00 0.00 ? 159 LEU A HA   2  
ATOM 2378  H HB2  . LEU A 1 75 ? -7.391  12.658  -0.381  1.00 0.00 ? 159 LEU A HB2  2  
ATOM 2379  H HB3  . LEU A 1 75 ? -7.233  12.616  1.363   1.00 0.00 ? 159 LEU A HB3  2  
ATOM 2380  H HG   . LEU A 1 75 ? -5.363  11.217  -0.535  1.00 0.00 ? 159 LEU A HG   2  
ATOM 2381  H HD11 . LEU A 1 75 ? -5.261  13.631  -0.822  1.00 0.00 ? 159 LEU A HD11 2  
ATOM 2382  H HD12 . LEU A 1 75 ? -3.813  13.032  -0.014  1.00 0.00 ? 159 LEU A HD12 2  
ATOM 2383  H HD13 . LEU A 1 75 ? -5.073  13.840  0.919   1.00 0.00 ? 159 LEU A HD13 2  
ATOM 2384  H HD21 . LEU A 1 75 ? -5.190  11.792  2.420   1.00 0.00 ? 159 LEU A HD21 2  
ATOM 2385  H HD22 . LEU A 1 75 ? -3.923  11.056  1.439   1.00 0.00 ? 159 LEU A HD22 2  
ATOM 2386  H HD23 . LEU A 1 75 ? -5.451  10.212  1.681   1.00 0.00 ? 159 LEU A HD23 2  
ATOM 2387  N N    . ARG A 1 76 ? -10.003 11.110  1.678   1.00 0.00 ? 160 ARG A N    2  
ATOM 2388  C CA   . ARG A 1 76 ? -11.397 11.501  1.793   1.00 0.00 ? 160 ARG A CA   2  
ATOM 2389  C C    . ARG A 1 76 ? -11.497 13.018  1.865   1.00 0.00 ? 160 ARG A C    2  
ATOM 2390  O O    . ARG A 1 76 ? -11.149 13.627  2.878   1.00 0.00 ? 160 ARG A O    2  
ATOM 2391  C CB   . ARG A 1 76 ? -12.057 10.865  3.018   1.00 0.00 ? 160 ARG A CB   2  
ATOM 2392  C CG   . ARG A 1 76 ? -13.358 10.154  2.683   1.00 0.00 ? 160 ARG A CG   2  
ATOM 2393  C CD   . ARG A 1 76 ? -14.149 9.780   3.927   1.00 0.00 ? 160 ARG A CD   2  
ATOM 2394  N NE   . ARG A 1 76 ? -13.373 8.963   4.862   1.00 0.00 ? 160 ARG A NE   2  
ATOM 2395  C CZ   . ARG A 1 76 ? -13.822 7.837   5.415   1.00 0.00 ? 160 ARG A CZ   2  
ATOM 2396  N NH1  . ARG A 1 76 ? -14.994 7.329   5.050   1.00 0.00 ? 160 ARG A NH1  2  
ATOM 2397  N NH2  . ARG A 1 76 ? -13.084 7.206   6.317   1.00 0.00 ? 160 ARG A NH2  2  
ATOM 2398  H H    . ARG A 1 76 ? -9.513  10.811  2.477   1.00 0.00 ? 160 ARG A H    2  
ATOM 2399  H HA   . ARG A 1 76 ? -11.907 11.163  0.905   1.00 0.00 ? 160 ARG A HA   2  
ATOM 2400  H HB2  . ARG A 1 76 ? -11.375 10.146  3.451   1.00 0.00 ? 160 ARG A HB2  2  
ATOM 2401  H HB3  . ARG A 1 76 ? -12.265 11.637  3.746   1.00 0.00 ? 160 ARG A HB3  2  
ATOM 2402  H HG2  . ARG A 1 76 ? -13.963 10.806  2.072   1.00 0.00 ? 160 ARG A HG2  2  
ATOM 2403  H HG3  . ARG A 1 76 ? -13.130 9.254   2.131   1.00 0.00 ? 160 ARG A HG3  2  
ATOM 2404  H HD2  . ARG A 1 76 ? -14.455 10.686  4.426   1.00 0.00 ? 160 ARG A HD2  2  
ATOM 2405  H HD3  . ARG A 1 76 ? -15.025 9.226   3.621   1.00 0.00 ? 160 ARG A HD3  2  
ATOM 2406  H HE   . ARG A 1 76 ? -12.480 9.291   5.114   1.00 0.00 ? 160 ARG A HE   2  
ATOM 2407  H HH11 . ARG A 1 76 ? -15.553 7.789   4.347   1.00 0.00 ? 160 ARG A HH11 2  
ATOM 2408  H HH12 . ARG A 1 76 ? -15.331 6.477   5.472   1.00 0.00 ? 160 ARG A HH12 2  
ATOM 2409  H HH21 . ARG A 1 76 ? -12.186 7.577   6.583   1.00 0.00 ? 160 ARG A HH21 2  
ATOM 2410  H HH22 . ARG A 1 76 ? -13.417 6.361   6.744   1.00 0.00 ? 160 ARG A HH22 2  
ATOM 2411  N N    . ASP A 1 2  ? 10.996  -14.203 0.492   1.00 0.00 ? 86  ASP A N    3  
ATOM 2412  C CA   . ASP A 1 2  ? 10.783  -12.869 1.042   1.00 0.00 ? 86  ASP A CA   3  
ATOM 2413  C C    . ASP A 1 2  ? 11.416  -11.848 0.116   1.00 0.00 ? 86  ASP A C    3  
ATOM 2414  O O    . ASP A 1 2  ? 12.414  -11.210 0.455   1.00 0.00 ? 86  ASP A O    3  
ATOM 2415  C CB   . ASP A 1 2  ? 11.382  -12.745 2.448   1.00 0.00 ? 86  ASP A CB   3  
ATOM 2416  C CG   . ASP A 1 2  ? 10.707  -13.643 3.460   1.00 0.00 ? 86  ASP A CG   3  
ATOM 2417  O OD1  . ASP A 1 2  ? 9.704   -13.220 4.065   1.00 0.00 ? 86  ASP A OD1  3  
ATOM 2418  O OD2  . ASP A 1 2  ? 11.186  -14.779 3.665   1.00 0.00 ? 86  ASP A OD2  3  
ATOM 2419  H H    . ASP A 1 2  ? 11.738  -14.747 0.833   1.00 0.00 ? 86  ASP A H    3  
ATOM 2420  H HA   . ASP A 1 2  ? 9.719   -12.691 1.089   1.00 0.00 ? 86  ASP A HA   3  
ATOM 2421  H HB2  . ASP A 1 2  ? 12.429  -13.007 2.407   1.00 0.00 ? 86  ASP A HB2  3  
ATOM 2422  H HB3  . ASP A 1 2  ? 11.288  -11.723 2.782   1.00 0.00 ? 86  ASP A HB3  3  
ATOM 2423  N N    . GLU A 1 3  ? 10.853  -11.734 -1.074  1.00 0.00 ? 87  GLU A N    3  
ATOM 2424  C CA   . GLU A 1 3  ? 11.430  -10.915 -2.121  1.00 0.00 ? 87  GLU A CA   3  
ATOM 2425  C C    . GLU A 1 3  ? 10.931  -9.479  -2.020  1.00 0.00 ? 87  GLU A C    3  
ATOM 2426  O O    . GLU A 1 3  ? 9.750   -9.241  -1.766  1.00 0.00 ? 87  GLU A O    3  
ATOM 2427  C CB   . GLU A 1 3  ? 11.080  -11.497 -3.494  1.00 0.00 ? 87  GLU A CB   3  
ATOM 2428  C CG   . GLU A 1 3  ? 11.403  -12.979 -3.632  1.00 0.00 ? 87  GLU A CG   3  
ATOM 2429  C CD   . GLU A 1 3  ? 12.851  -13.294 -3.318  1.00 0.00 ? 87  GLU A CD   3  
ATOM 2430  O OE1  . GLU A 1 3  ? 13.732  -12.887 -4.098  1.00 0.00 ? 87  GLU A OE1  3  
ATOM 2431  O OE2  . GLU A 1 3  ? 13.111  -13.952 -2.285  1.00 0.00 ? 87  GLU A OE2  3  
ATOM 2432  H H    . GLU A 1 3  ? 10.019  -12.220 -1.254  1.00 0.00 ? 87  GLU A H    3  
ATOM 2433  H HA   . GLU A 1 3  ? 12.504  -10.923 -1.998  1.00 0.00 ? 87  GLU A HA   3  
ATOM 2434  H HB2  . GLU A 1 3  ? 10.023  -11.364 -3.670  1.00 0.00 ? 87  GLU A HB2  3  
ATOM 2435  H HB3  . GLU A 1 3  ? 11.632  -10.958 -4.252  1.00 0.00 ? 87  GLU A HB3  3  
ATOM 2436  H HG2  . GLU A 1 3  ? 10.775  -13.535 -2.953  1.00 0.00 ? 87  GLU A HG2  3  
ATOM 2437  H HG3  . GLU A 1 3  ? 11.195  -13.287 -4.646  1.00 0.00 ? 87  GLU A HG3  3  
ATOM 2438  N N    . PRO A 1 4  ? 11.833  -8.507  -2.196  1.00 0.00 ? 88  PRO A N    3  
ATOM 2439  C CA   . PRO A 1 4  ? 11.474  -7.091  -2.216  1.00 0.00 ? 88  PRO A CA   3  
ATOM 2440  C C    . PRO A 1 4  ? 10.579  -6.753  -3.407  1.00 0.00 ? 88  PRO A C    3  
ATOM 2441  O O    . PRO A 1 4  ? 11.058  -6.525  -4.517  1.00 0.00 ? 88  PRO A O    3  
ATOM 2442  C CB   . PRO A 1 4  ? 12.823  -6.369  -2.333  1.00 0.00 ? 88  PRO A CB   3  
ATOM 2443  C CG   . PRO A 1 4  ? 13.844  -7.386  -1.949  1.00 0.00 ? 88  PRO A CG   3  
ATOM 2444  C CD   . PRO A 1 4  ? 13.278  -8.710  -2.370  1.00 0.00 ? 88  PRO A CD   3  
ATOM 2445  H HA   . PRO A 1 4  ? 10.980  -6.794  -1.301  1.00 0.00 ? 88  PRO A HA   3  
ATOM 2446  H HB2  . PRO A 1 4  ? 12.963  -6.032  -3.349  1.00 0.00 ? 88  PRO A HB2  3  
ATOM 2447  H HB3  . PRO A 1 4  ? 12.839  -5.523  -1.662  1.00 0.00 ? 88  PRO A HB3  3  
ATOM 2448  H HG2  . PRO A 1 4  ? 14.771  -7.193  -2.468  1.00 0.00 ? 88  PRO A HG2  3  
ATOM 2449  H HG3  . PRO A 1 4  ? 13.999  -7.368  -0.880  1.00 0.00 ? 88  PRO A HG3  3  
ATOM 2450  H HD2  . PRO A 1 4  ? 13.518  -8.915  -3.402  1.00 0.00 ? 88  PRO A HD2  3  
ATOM 2451  H HD3  . PRO A 1 4  ? 13.638  -9.500  -1.729  1.00 0.00 ? 88  PRO A HD3  3  
ATOM 2452  N N    . LEU A 1 5  ? 9.277   -6.751  -3.169  1.00 0.00 ? 89  LEU A N    3  
ATOM 2453  C CA   . LEU A 1 5  ? 8.304   -6.483  -4.214  1.00 0.00 ? 89  LEU A CA   3  
ATOM 2454  C C    . LEU A 1 5  ? 8.096   -4.985  -4.367  1.00 0.00 ? 89  LEU A C    3  
ATOM 2455  O O    . LEU A 1 5  ? 7.506   -4.333  -3.509  1.00 0.00 ? 89  LEU A O    3  
ATOM 2456  C CB   . LEU A 1 5  ? 6.978   -7.180  -3.894  1.00 0.00 ? 89  LEU A CB   3  
ATOM 2457  C CG   . LEU A 1 5  ? 5.836   -6.914  -4.878  1.00 0.00 ? 89  LEU A CG   3  
ATOM 2458  C CD1  . LEU A 1 5  ? 6.213   -7.347  -6.288  1.00 0.00 ? 89  LEU A CD1  3  
ATOM 2459  C CD2  . LEU A 1 5  ? 4.576   -7.632  -4.419  1.00 0.00 ? 89  LEU A CD2  3  
ATOM 2460  H H    . LEU A 1 5  ? 8.958   -6.922  -2.255  1.00 0.00 ? 89  LEU A H    3  
ATOM 2461  H HA   . LEU A 1 5  ? 8.693   -6.878  -5.140  1.00 0.00 ? 89  LEU A HA   3  
ATOM 2462  H HB2  . LEU A 1 5  ? 7.155   -8.245  -3.863  1.00 0.00 ? 89  LEU A HB2  3  
ATOM 2463  H HB3  . LEU A 1 5  ? 6.657   -6.860  -2.914  1.00 0.00 ? 89  LEU A HB3  3  
ATOM 2464  H HG   . LEU A 1 5  ? 5.627   -5.853  -4.899  1.00 0.00 ? 89  LEU A HG   3  
ATOM 2465  H HD11 . LEU A 1 5  ? 5.397   -7.127  -6.962  1.00 0.00 ? 89  LEU A HD11 3  
ATOM 2466  H HD12 . LEU A 1 5  ? 6.412   -8.408  -6.300  1.00 0.00 ? 89  LEU A HD12 3  
ATOM 2467  H HD13 . LEU A 1 5  ? 7.095   -6.810  -6.605  1.00 0.00 ? 89  LEU A HD13 3  
ATOM 2468  H HD21 . LEU A 1 5  ? 3.792   -7.483  -5.147  1.00 0.00 ? 89  LEU A HD21 3  
ATOM 2469  H HD22 . LEU A 1 5  ? 4.262   -7.237  -3.465  1.00 0.00 ? 89  LEU A HD22 3  
ATOM 2470  H HD23 . LEU A 1 5  ? 4.779   -8.689  -4.322  1.00 0.00 ? 89  LEU A HD23 3  
ATOM 2471  N N    . SER A 1 6  ? 8.614   -4.442  -5.452  1.00 0.00 ? 90  SER A N    3  
ATOM 2472  C CA   . SER A 1 6  ? 8.486   -3.033  -5.732  1.00 0.00 ? 90  SER A CA   3  
ATOM 2473  C C    . SER A 1 6  ? 7.188   -2.750  -6.486  1.00 0.00 ? 90  SER A C    3  
ATOM 2474  O O    . SER A 1 6  ? 7.084   -3.013  -7.682  1.00 0.00 ? 90  SER A O    3  
ATOM 2475  C CB   . SER A 1 6  ? 9.696   -2.578  -6.541  1.00 0.00 ? 90  SER A CB   3  
ATOM 2476  O OG   . SER A 1 6  ? 10.902  -2.901  -5.864  1.00 0.00 ? 90  SER A OG   3  
ATOM 2477  H H    . SER A 1 6  ? 9.103   -5.003  -6.086  1.00 0.00 ? 90  SER A H    3  
ATOM 2478  H HA   . SER A 1 6  ? 8.467   -2.503  -4.792  1.00 0.00 ? 90  SER A HA   3  
ATOM 2479  H HB2  . SER A 1 6  ? 9.692   -3.069  -7.503  1.00 0.00 ? 90  SER A HB2  3  
ATOM 2480  H HB3  . SER A 1 6  ? 9.650   -1.516  -6.679  1.00 0.00 ? 90  SER A HB3  3  
ATOM 2481  H HG   . SER A 1 6  ? 10.710  -3.517  -5.147  1.00 0.00 ? 90  SER A HG   3  
ATOM 2482  N N    . ILE A 1 7  ? 6.200   -2.237  -5.766  1.00 0.00 ? 91  ILE A N    3  
ATOM 2483  C CA   . ILE A 1 7  ? 4.905   -1.916  -6.352  1.00 0.00 ? 91  ILE A CA   3  
ATOM 2484  C C    . ILE A 1 7  ? 4.791   -0.413  -6.574  1.00 0.00 ? 91  ILE A C    3  
ATOM 2485  O O    . ILE A 1 7  ? 5.486   0.366   -5.923  1.00 0.00 ? 91  ILE A O    3  
ATOM 2486  C CB   . ILE A 1 7  ? 3.739   -2.389  -5.456  1.00 0.00 ? 91  ILE A CB   3  
ATOM 2487  C CG1  . ILE A 1 7  ? 3.819   -1.731  -4.074  1.00 0.00 ? 91  ILE A CG1  3  
ATOM 2488  C CG2  . ILE A 1 7  ? 3.749   -3.907  -5.338  1.00 0.00 ? 91  ILE A CG2  3  
ATOM 2489  C CD1  . ILE A 1 7  ? 2.664   -2.085  -3.163  1.00 0.00 ? 91  ILE A CD1  3  
ATOM 2490  H H    . ILE A 1 7  ? 6.351   -2.052  -4.813  1.00 0.00 ? 91  ILE A H    3  
ATOM 2491  H HA   . ILE A 1 7  ? 4.833   -2.418  -7.305  1.00 0.00 ? 91  ILE A HA   3  
ATOM 2492  H HB   . ILE A 1 7  ? 2.812   -2.099  -5.932  1.00 0.00 ? 91  ILE A HB   3  
ATOM 2493  H HG12 . ILE A 1 7  ? 4.731   -2.041  -3.588  1.00 0.00 ? 91  ILE A HG12 3  
ATOM 2494  H HG13 . ILE A 1 7  ? 3.828   -0.658  -4.195  1.00 0.00 ? 91  ILE A HG13 3  
ATOM 2495  H HG21 . ILE A 1 7  ? 4.691   -4.230  -4.921  1.00 0.00 ? 91  ILE A HG21 3  
ATOM 2496  H HG22 . ILE A 1 7  ? 3.620   -4.346  -6.315  1.00 0.00 ? 91  ILE A HG22 3  
ATOM 2497  H HG23 . ILE A 1 7  ? 2.943   -4.225  -4.693  1.00 0.00 ? 91  ILE A HG23 3  
ATOM 2498  H HD11 . ILE A 1 7  ? 2.797   -1.597  -2.208  1.00 0.00 ? 91  ILE A HD11 3  
ATOM 2499  H HD12 . ILE A 1 7  ? 2.634   -3.155  -3.020  1.00 0.00 ? 91  ILE A HD12 3  
ATOM 2500  H HD13 . ILE A 1 7  ? 1.739   -1.755  -3.611  1.00 0.00 ? 91  ILE A HD13 3  
ATOM 2501  N N    . LEU A 1 8  ? 3.918   -0.005  -7.477  1.00 0.00 ? 92  LEU A N    3  
ATOM 2502  C CA   . LEU A 1 8  ? 3.793   1.402   -7.812  1.00 0.00 ? 92  LEU A CA   3  
ATOM 2503  C C    . LEU A 1 8  ? 2.555   2.006   -7.167  1.00 0.00 ? 92  LEU A C    3  
ATOM 2504  O O    . LEU A 1 8  ? 1.433   1.794   -7.623  1.00 0.00 ? 92  LEU A O    3  
ATOM 2505  C CB   . LEU A 1 8  ? 3.746   1.589   -9.328  1.00 0.00 ? 92  LEU A CB   3  
ATOM 2506  C CG   . LEU A 1 8  ? 3.775   3.042   -9.804  1.00 0.00 ? 92  LEU A CG   3  
ATOM 2507  C CD1  . LEU A 1 8  ? 5.040   3.734   -9.324  1.00 0.00 ? 92  LEU A CD1  3  
ATOM 2508  C CD2  . LEU A 1 8  ? 3.687   3.103   -11.315 1.00 0.00 ? 92  LEU A CD2  3  
ATOM 2509  H H    . LEU A 1 8  ? 3.332   -0.658  -7.916  1.00 0.00 ? 92  LEU A H    3  
ATOM 2510  H HA   . LEU A 1 8  ? 4.665   1.911   -7.426  1.00 0.00 ? 92  LEU A HA   3  
ATOM 2511  H HB2  . LEU A 1 8  ? 4.594   1.073   -9.758  1.00 0.00 ? 92  LEU A HB2  3  
ATOM 2512  H HB3  . LEU A 1 8  ? 2.843   1.129   -9.699  1.00 0.00 ? 92  LEU A HB3  3  
ATOM 2513  H HG   . LEU A 1 8  ? 2.925   3.569   -9.394  1.00 0.00 ? 92  LEU A HG   3  
ATOM 2514  H HD11 . LEU A 1 8  ? 5.059   4.748   -9.694  1.00 0.00 ? 92  LEU A HD11 3  
ATOM 2515  H HD12 . LEU A 1 8  ? 5.903   3.200   -9.693  1.00 0.00 ? 92  LEU A HD12 3  
ATOM 2516  H HD13 . LEU A 1 8  ? 5.056   3.743   -8.244  1.00 0.00 ? 92  LEU A HD13 3  
ATOM 2517  H HD21 . LEU A 1 8  ? 4.508   2.544   -11.740 1.00 0.00 ? 92  LEU A HD21 3  
ATOM 2518  H HD22 . LEU A 1 8  ? 3.746   4.133   -11.636 1.00 0.00 ? 92  LEU A HD22 3  
ATOM 2519  H HD23 . LEU A 1 8  ? 2.751   2.675   -11.640 1.00 0.00 ? 92  LEU A HD23 3  
ATOM 2520  N N    . VAL A 1 9  ? 2.765   2.750   -6.096  1.00 0.00 ? 93  VAL A N    3  
ATOM 2521  C CA   . VAL A 1 9  ? 1.671   3.401   -5.399  1.00 0.00 ? 93  VAL A CA   3  
ATOM 2522  C C    . VAL A 1 9  ? 1.706   4.901   -5.661  1.00 0.00 ? 93  VAL A C    3  
ATOM 2523  O O    . VAL A 1 9  ? 2.719   5.564   -5.422  1.00 0.00 ? 93  VAL A O    3  
ATOM 2524  C CB   . VAL A 1 9  ? 1.729   3.144   -3.877  1.00 0.00 ? 93  VAL A CB   3  
ATOM 2525  C CG1  . VAL A 1 9  ? 0.550   3.799   -3.173  1.00 0.00 ? 93  VAL A CG1  3  
ATOM 2526  C CG2  . VAL A 1 9  ? 1.762   1.650   -3.583  1.00 0.00 ? 93  VAL A CG2  3  
ATOM 2527  H H    . VAL A 1 9  ? 3.685   2.877   -5.772  1.00 0.00 ? 93  VAL A H    3  
ATOM 2528  H HA   . VAL A 1 9  ? 0.743   3.002   -5.780  1.00 0.00 ? 93  VAL A HA   3  
ATOM 2529  H HB   . VAL A 1 9  ? 2.637   3.585   -3.493  1.00 0.00 ? 93  VAL A HB   3  
ATOM 2530  H HG11 . VAL A 1 9  ? 0.596   3.583   -2.116  1.00 0.00 ? 93  VAL A HG11 3  
ATOM 2531  H HG12 . VAL A 1 9  ? -0.372  3.412   -3.581  1.00 0.00 ? 93  VAL A HG12 3  
ATOM 2532  H HG13 . VAL A 1 9  ? 0.592   4.867   -3.325  1.00 0.00 ? 93  VAL A HG13 3  
ATOM 2533  H HG21 . VAL A 1 9  ? 0.866   1.188   -3.965  1.00 0.00 ? 93  VAL A HG21 3  
ATOM 2534  H HG22 . VAL A 1 9  ? 1.822   1.495   -2.516  1.00 0.00 ? 93  VAL A HG22 3  
ATOM 2535  H HG23 . VAL A 1 9  ? 2.625   1.209   -4.060  1.00 0.00 ? 93  VAL A HG23 3  
ATOM 2536  N N    . ARG A 1 10 ? 0.609   5.429   -6.172  1.00 0.00 ? 94  ARG A N    3  
ATOM 2537  C CA   . ARG A 1 10 ? 0.512   6.850   -6.427  1.00 0.00 ? 94  ARG A CA   3  
ATOM 2538  C C    . ARG A 1 10 ? -0.026  7.564   -5.207  1.00 0.00 ? 94  ARG A C    3  
ATOM 2539  O O    . ARG A 1 10 ? -0.990  7.118   -4.581  1.00 0.00 ? 94  ARG A O    3  
ATOM 2540  C CB   . ARG A 1 10 ? -0.365  7.146   -7.642  1.00 0.00 ? 94  ARG A CB   3  
ATOM 2541  C CG   . ARG A 1 10 ? 0.197   6.587   -8.933  1.00 0.00 ? 94  ARG A CG   3  
ATOM 2542  C CD   . ARG A 1 10 ? -0.511  7.163   -10.147 1.00 0.00 ? 94  ARG A CD   3  
ATOM 2543  N NE   . ARG A 1 10 ? -0.284  8.602   -10.267 1.00 0.00 ? 94  ARG A NE   3  
ATOM 2544  C CZ   . ARG A 1 10 ? -0.307  9.274   -11.415 1.00 0.00 ? 94  ARG A CZ   3  
ATOM 2545  N NH1  . ARG A 1 10 ? -0.599  8.659   -12.556 1.00 0.00 ? 94  ARG A NH1  3  
ATOM 2546  N NH2  . ARG A 1 10 ? -0.042  10.574  -11.419 1.00 0.00 ? 94  ARG A NH2  3  
ATOM 2547  H H    . ARG A 1 10 ? -0.162  4.846   -6.362  1.00 0.00 ? 94  ARG A H    3  
ATOM 2548  H HA   . ARG A 1 10 ? 1.510   7.214   -6.623  1.00 0.00 ? 94  ARG A HA   3  
ATOM 2549  H HB2  . ARG A 1 10 ? -1.344  6.719   -7.482  1.00 0.00 ? 94  ARG A HB2  3  
ATOM 2550  H HB3  . ARG A 1 10 ? -0.461  8.217   -7.751  1.00 0.00 ? 94  ARG A HB3  3  
ATOM 2551  H HG2  . ARG A 1 10 ? 1.247   6.833   -8.991  1.00 0.00 ? 94  ARG A HG2  3  
ATOM 2552  H HG3  . ARG A 1 10 ? 0.078   5.518   -8.925  1.00 0.00 ? 94  ARG A HG3  3  
ATOM 2553  H HD2  . ARG A 1 10 ? -0.138  6.672   -11.033 1.00 0.00 ? 94  ARG A HD2  3  
ATOM 2554  H HD3  . ARG A 1 10 ? -1.571  6.979   -10.052 1.00 0.00 ? 94  ARG A HD3  3  
ATOM 2555  H HE   . ARG A 1 10 ? -0.083  9.091   -9.441  1.00 0.00 ? 94  ARG A HE   3  
ATOM 2556  H HH11 . ARG A 1 10 ? -0.819  7.675   -12.565 1.00 0.00 ? 94  ARG A HH11 3  
ATOM 2557  H HH12 . ARG A 1 10 ? -0.589  9.171   -13.424 1.00 0.00 ? 94  ARG A HH12 3  
ATOM 2558  H HH21 . ARG A 1 10 ? 0.177   11.048  -10.562 1.00 0.00 ? 94  ARG A HH21 3  
ATOM 2559  H HH22 . ARG A 1 10 ? -0.069  11.094  -12.281 1.00 0.00 ? 94  ARG A HH22 3  
ATOM 2560  N N    . ASN A 1 11 ? 0.608   8.666   -4.879  1.00 0.00 ? 95  ASN A N    3  
ATOM 2561  C CA   . ASN A 1 11 ? 0.251   9.428   -3.694  1.00 0.00 ? 95  ASN A CA   3  
ATOM 2562  C C    . ASN A 1 11 ? -0.629  10.614  -4.056  1.00 0.00 ? 95  ASN A C    3  
ATOM 2563  O O    . ASN A 1 11 ? -0.790  10.948  -5.232  1.00 0.00 ? 95  ASN A O    3  
ATOM 2564  C CB   . ASN A 1 11 ? 1.502   9.905   -2.950  1.00 0.00 ? 95  ASN A CB   3  
ATOM 2565  C CG   . ASN A 1 11 ? 2.532   10.540  -3.867  1.00 0.00 ? 95  ASN A CG   3  
ATOM 2566  O OD1  . ASN A 1 11 ? 2.446   11.722  -4.200  1.00 0.00 ? 95  ASN A OD1  3  
ATOM 2567  N ND2  . ASN A 1 11 ? 3.527   9.758   -4.263  1.00 0.00 ? 95  ASN A ND2  3  
ATOM 2568  H H    . ASN A 1 11 ? 1.326   8.991   -5.464  1.00 0.00 ? 95  ASN A H    3  
ATOM 2569  H HA   . ASN A 1 11 ? -0.309  8.774   -3.045  1.00 0.00 ? 95  ASN A HA   3  
ATOM 2570  H HB2  . ASN A 1 11 ? 1.211   10.637  -2.212  1.00 0.00 ? 95  ASN A HB2  3  
ATOM 2571  H HB3  . ASN A 1 11 ? 1.959   9.063   -2.453  1.00 0.00 ? 95  ASN A HB3  3  
ATOM 2572  H HD21 . ASN A 1 11 ? 3.540   8.828   -3.946  1.00 0.00 ? 95  ASN A HD21 3  
ATOM 2573  H HD22 . ASN A 1 11 ? 4.210   10.140  -4.850  1.00 0.00 ? 95  ASN A HD22 3  
ATOM 2574  N N    . ASN A 1 12 ? -1.178  11.258  -3.032  1.00 0.00 ? 96  ASN A N    3  
ATOM 2575  C CA   . ASN A 1 12 ? -2.123  12.354  -3.219  1.00 0.00 ? 96  ASN A CA   3  
ATOM 2576  C C    . ASN A 1 12 ? -1.446  13.589  -3.799  1.00 0.00 ? 96  ASN A C    3  
ATOM 2577  O O    . ASN A 1 12 ? -2.110  14.470  -4.340  1.00 0.00 ? 96  ASN A O    3  
ATOM 2578  C CB   . ASN A 1 12 ? -2.809  12.716  -1.899  1.00 0.00 ? 96  ASN A CB   3  
ATOM 2579  C CG   . ASN A 1 12 ? -1.828  13.098  -0.803  1.00 0.00 ? 96  ASN A CG   3  
ATOM 2580  O OD1  . ASN A 1 12 ? -1.404  14.251  -0.703  1.00 0.00 ? 96  ASN A OD1  3  
ATOM 2581  N ND2  . ASN A 1 12 ? -1.494  12.141  0.051   1.00 0.00 ? 96  ASN A ND2  3  
ATOM 2582  H H    . ASN A 1 12 ? -0.934  10.991  -2.121  1.00 0.00 ? 96  ASN A H    3  
ATOM 2583  H HA   . ASN A 1 12 ? -2.875  12.017  -3.916  1.00 0.00 ? 96  ASN A HA   3  
ATOM 2584  H HB2  . ASN A 1 12 ? -3.470  13.553  -2.065  1.00 0.00 ? 96  ASN A HB2  3  
ATOM 2585  H HB3  . ASN A 1 12 ? -3.388  11.871  -1.560  1.00 0.00 ? 96  ASN A HB3  3  
ATOM 2586  H HD21 . ASN A 1 12 ? -1.894  11.250  -0.065  1.00 0.00 ? 96  ASN A HD21 3  
ATOM 2587  H HD22 . ASN A 1 12 ? -0.857  12.362  0.771   1.00 0.00 ? 96  ASN A HD22 3  
ATOM 2588  N N    . LYS A 1 13 ? -0.126  13.655  -3.680  1.00 0.00 ? 97  LYS A N    3  
ATOM 2589  C CA   . LYS A 1 13 ? 0.633   14.760  -4.249  1.00 0.00 ? 97  LYS A CA   3  
ATOM 2590  C C    . LYS A 1 13 ? 0.837   14.573  -5.752  1.00 0.00 ? 97  LYS A C    3  
ATOM 2591  O O    . LYS A 1 13 ? 1.499   15.380  -6.406  1.00 0.00 ? 97  LYS A O    3  
ATOM 2592  C CB   . LYS A 1 13 ? 1.965   14.901  -3.517  1.00 0.00 ? 97  LYS A CB   3  
ATOM 2593  C CG   . LYS A 1 13 ? 1.790   15.409  -2.099  1.00 0.00 ? 97  LYS A CG   3  
ATOM 2594  C CD   . LYS A 1 13 ? 3.006   15.137  -1.234  1.00 0.00 ? 97  LYS A CD   3  
ATOM 2595  C CE   . LYS A 1 13 ? 2.815   15.710  0.161   1.00 0.00 ? 97  LYS A CE   3  
ATOM 2596  N NZ   . LYS A 1 13 ? 1.506   15.320  0.755   1.00 0.00 ? 97  LYS A NZ   3  
ATOM 2597  H H    . LYS A 1 13 ? 0.350   12.954  -3.180  1.00 0.00 ? 97  LYS A H    3  
ATOM 2598  H HA   . LYS A 1 13 ? 0.058   15.660  -4.094  1.00 0.00 ? 97  LYS A HA   3  
ATOM 2599  H HB2  . LYS A 1 13 ? 2.451   13.935  -3.479  1.00 0.00 ? 97  LYS A HB2  3  
ATOM 2600  H HB3  . LYS A 1 13 ? 2.594   15.595  -4.056  1.00 0.00 ? 97  LYS A HB3  3  
ATOM 2601  H HG2  . LYS A 1 13 ? 1.619   16.474  -2.129  1.00 0.00 ? 97  LYS A HG2  3  
ATOM 2602  H HG3  . LYS A 1 13 ? 0.932   14.922  -1.658  1.00 0.00 ? 97  LYS A HG3  3  
ATOM 2603  H HD2  . LYS A 1 13 ? 3.154   14.071  -1.158  1.00 0.00 ? 97  LYS A HD2  3  
ATOM 2604  H HD3  . LYS A 1 13 ? 3.873   15.594  -1.688  1.00 0.00 ? 97  LYS A HD3  3  
ATOM 2605  H HE2  . LYS A 1 13 ? 3.609   15.348  0.795   1.00 0.00 ? 97  LYS A HE2  3  
ATOM 2606  H HE3  . LYS A 1 13 ? 2.866   16.786  0.101   1.00 0.00 ? 97  LYS A HE3  3  
ATOM 2607  H HZ1  . LYS A 1 13 ? 1.445   14.281  0.858   1.00 0.00 ? 97  LYS A HZ1  3  
ATOM 2608  H HZ2  . LYS A 1 13 ? 0.725   15.641  0.146   1.00 0.00 ? 97  LYS A HZ2  3  
ATOM 2609  H HZ3  . LYS A 1 13 ? 1.392   15.754  1.693   1.00 0.00 ? 97  LYS A HZ3  3  
ATOM 2610  N N    . GLY A 1 14 ? 0.268   13.500  -6.290  1.00 0.00 ? 98  GLY A N    3  
ATOM 2611  C CA   . GLY A 1 14 ? 0.229   13.313  -7.727  1.00 0.00 ? 98  GLY A CA   3  
ATOM 2612  C C    . GLY A 1 14 ? 1.360   12.454  -8.249  1.00 0.00 ? 98  GLY A C    3  
ATOM 2613  O O    . GLY A 1 14 ? 1.350   12.052  -9.414  1.00 0.00 ? 98  GLY A O    3  
ATOM 2614  H H    . GLY A 1 14 ? -0.131  12.821  -5.699  1.00 0.00 ? 98  GLY A H    3  
ATOM 2615  H HA2  . GLY A 1 14 ? -0.708  12.844  -7.988  1.00 0.00 ? 98  GLY A HA2  3  
ATOM 2616  H HA3  . GLY A 1 14 ? 0.277   14.280  -8.203  1.00 0.00 ? 98  GLY A HA3  3  
ATOM 2617  N N    . ARG A 1 15 ? 2.327   12.155  -7.397  1.00 0.00 ? 99  ARG A N    3  
ATOM 2618  C CA   . ARG A 1 15 ? 3.496   11.400  -7.818  1.00 0.00 ? 99  ARG A CA   3  
ATOM 2619  C C    . ARG A 1 15 ? 3.229   9.902   -7.792  1.00 0.00 ? 99  ARG A C    3  
ATOM 2620  O O    . ARG A 1 15 ? 2.297   9.432   -7.136  1.00 0.00 ? 99  ARG A O    3  
ATOM 2621  C CB   . ARG A 1 15 ? 4.702   11.716  -6.931  1.00 0.00 ? 99  ARG A CB   3  
ATOM 2622  C CG   . ARG A 1 15 ? 5.229   13.131  -7.090  1.00 0.00 ? 99  ARG A CG   3  
ATOM 2623  C CD   . ARG A 1 15 ? 6.583   13.294  -6.421  1.00 0.00 ? 99  ARG A CD   3  
ATOM 2624  N NE   . ARG A 1 15 ? 7.582   12.400  -7.002  1.00 0.00 ? 99  ARG A NE   3  
ATOM 2625  C CZ   . ARG A 1 15 ? 8.898   12.609  -6.938  1.00 0.00 ? 99  ARG A CZ   3  
ATOM 2626  N NH1  . ARG A 1 15 ? 9.382   13.698  -6.357  1.00 0.00 ? 99  ARG A NH1  3  
ATOM 2627  N NH2  . ARG A 1 15 ? 9.735   11.726  -7.467  1.00 0.00 ? 99  ARG A NH2  3  
ATOM 2628  H H    . ARG A 1 15 ? 2.247   12.436  -6.459  1.00 0.00 ? 99  ARG A H    3  
ATOM 2629  H HA   . ARG A 1 15 ? 3.726   11.690  -8.831  1.00 0.00 ? 99  ARG A HA   3  
ATOM 2630  H HB2  . ARG A 1 15 ? 4.417   11.578  -5.898  1.00 0.00 ? 99  ARG A HB2  3  
ATOM 2631  H HB3  . ARG A 1 15 ? 5.501   11.029  -7.170  1.00 0.00 ? 99  ARG A HB3  3  
ATOM 2632  H HG2  . ARG A 1 15 ? 5.328   13.352  -8.142  1.00 0.00 ? 99  ARG A HG2  3  
ATOM 2633  H HG3  . ARG A 1 15 ? 4.528   13.818  -6.639  1.00 0.00 ? 99  ARG A HG3  3  
ATOM 2634  H HD2  . ARG A 1 15 ? 6.911   14.314  -6.542  1.00 0.00 ? 99  ARG A HD2  3  
ATOM 2635  H HD3  . ARG A 1 15 ? 6.481   13.069  -5.371  1.00 0.00 ? 99  ARG A HD3  3  
ATOM 2636  H HE   . ARG A 1 15 ? 7.250   11.594  -7.464  1.00 0.00 ? 99  ARG A HE   3  
ATOM 2637  H HH11 . ARG A 1 15 ? 8.758   14.383  -5.961  1.00 0.00 ? 99  ARG A HH11 3  
ATOM 2638  H HH12 . ARG A 1 15 ? 10.382  13.842  -6.306  1.00 0.00 ? 99  ARG A HH12 3  
ATOM 2639  H HH21 . ARG A 1 15 ? 9.381   10.898  -7.917  1.00 0.00 ? 99  ARG A HH21 3  
ATOM 2640  H HH22 . ARG A 1 15 ? 10.726  11.885  -7.431  1.00 0.00 ? 99  ARG A HH22 3  
ATOM 2641  N N    . SER A 1 16 ? 4.054   9.163   -8.516  1.00 0.00 ? 100 SER A N    3  
ATOM 2642  C CA   . SER A 1 16 ? 3.986   7.714   -8.531  1.00 0.00 ? 100 SER A CA   3  
ATOM 2643  C C    . SER A 1 16 ? 5.245   7.149   -7.893  1.00 0.00 ? 100 SER A C    3  
ATOM 2644  O O    . SER A 1 16 ? 6.326   7.214   -8.478  1.00 0.00 ? 100 SER A O    3  
ATOM 2645  C CB   . SER A 1 16 ? 3.851   7.205   -9.968  1.00 0.00 ? 100 SER A CB   3  
ATOM 2646  O OG   . SER A 1 16 ? 2.854   7.927   -10.670 1.00 0.00 ? 100 SER A OG   3  
ATOM 2647  H H    . SER A 1 16 ? 4.745   9.608   -9.053  1.00 0.00 ? 100 SER A H    3  
ATOM 2648  H HA   . SER A 1 16 ? 3.124   7.406   -7.957  1.00 0.00 ? 100 SER A HA   3  
ATOM 2649  H HB2  . SER A 1 16 ? 4.794   7.329   -10.481 1.00 0.00 ? 100 SER A HB2  3  
ATOM 2650  H HB3  . SER A 1 16 ? 3.582   6.159   -9.955  1.00 0.00 ? 100 SER A HB3  3  
ATOM 2651  H HG   . SER A 1 16 ? 3.261   8.701   -11.085 1.00 0.00 ? 100 SER A HG   3  
ATOM 2652  N N    . SER A 1 17 ? 5.115   6.622   -6.689  1.00 0.00 ? 101 SER A N    3  
ATOM 2653  C CA   . SER A 1 17 ? 6.267   6.137   -5.957  1.00 0.00 ? 101 SER A CA   3  
ATOM 2654  C C    . SER A 1 17 ? 6.301   4.613   -5.939  1.00 0.00 ? 101 SER A C    3  
ATOM 2655  O O    . SER A 1 17 ? 5.303   3.956   -5.642  1.00 0.00 ? 101 SER A O    3  
ATOM 2656  C CB   . SER A 1 17 ? 6.251   6.694   -4.534  1.00 0.00 ? 101 SER A CB   3  
ATOM 2657  O OG   . SER A 1 17 ? 6.277   8.113   -4.550  1.00 0.00 ? 101 SER A OG   3  
ATOM 2658  H H    . SER A 1 17 ? 4.223   6.547   -6.283  1.00 0.00 ? 101 SER A H    3  
ATOM 2659  H HA   . SER A 1 17 ? 7.153   6.496   -6.462  1.00 0.00 ? 101 SER A HA   3  
ATOM 2660  H HB2  . SER A 1 17 ? 5.352   6.369   -4.032  1.00 0.00 ? 101 SER A HB2  3  
ATOM 2661  H HB3  . SER A 1 17 ? 7.115   6.335   -3.998  1.00 0.00 ? 101 SER A HB3  3  
ATOM 2662  H HG   . SER A 1 17 ? 7.159   8.410   -4.815  1.00 0.00 ? 101 SER A HG   3  
ATOM 2663  N N    . THR A 1 18 ? 7.451   4.059   -6.278  1.00 0.00 ? 102 THR A N    3  
ATOM 2664  C CA   . THR A 1 18 ? 7.640   2.624   -6.253  1.00 0.00 ? 102 THR A CA   3  
ATOM 2665  C C    . THR A 1 18 ? 8.067   2.191   -4.850  1.00 0.00 ? 102 THR A C    3  
ATOM 2666  O O    . THR A 1 18 ? 9.205   2.426   -4.433  1.00 0.00 ? 102 THR A O    3  
ATOM 2667  C CB   . THR A 1 18 ? 8.699   2.176   -7.282  1.00 0.00 ? 102 THR A CB   3  
ATOM 2668  O OG1  . THR A 1 18 ? 8.403   2.736   -8.569  1.00 0.00 ? 102 THR A OG1  3  
ATOM 2669  C CG2  . THR A 1 18 ? 8.741   0.663   -7.396  1.00 0.00 ? 102 THR A CG2  3  
ATOM 2670  H H    . THR A 1 18 ? 8.203   4.635   -6.538  1.00 0.00 ? 102 THR A H    3  
ATOM 2671  H HA   . THR A 1 18 ? 6.696   2.154   -6.504  1.00 0.00 ? 102 THR A HA   3  
ATOM 2672  H HB   . THR A 1 18 ? 9.670   2.524   -6.958  1.00 0.00 ? 102 THR A HB   3  
ATOM 2673  H HG1  . THR A 1 18 ? 8.153   3.665   -8.466  1.00 0.00 ? 102 THR A HG1  3  
ATOM 2674  H HG21 . THR A 1 18 ? 9.487   0.379   -8.123  1.00 0.00 ? 102 THR A HG21 3  
ATOM 2675  H HG22 . THR A 1 18 ? 7.773   0.300   -7.711  1.00 0.00 ? 102 THR A HG22 3  
ATOM 2676  H HG23 . THR A 1 18 ? 8.991   0.235   -6.436  1.00 0.00 ? 102 THR A HG23 3  
ATOM 2677  N N    . TYR A 1 19 ? 7.148   1.593   -4.113  1.00 0.00 ? 103 TYR A N    3  
ATOM 2678  C CA   . TYR A 1 19 ? 7.417   1.182   -2.745  1.00 0.00 ? 103 TYR A CA   3  
ATOM 2679  C C    . TYR A 1 19 ? 7.935   -0.246  -2.704  1.00 0.00 ? 103 TYR A C    3  
ATOM 2680  O O    . TYR A 1 19 ? 7.384   -1.133  -3.361  1.00 0.00 ? 103 TYR A O    3  
ATOM 2681  C CB   . TYR A 1 19 ? 6.157   1.293   -1.883  1.00 0.00 ? 103 TYR A CB   3  
ATOM 2682  C CG   . TYR A 1 19 ? 5.722   2.716   -1.606  1.00 0.00 ? 103 TYR A CG   3  
ATOM 2683  C CD1  . TYR A 1 19 ? 6.204   3.404   -0.498  1.00 0.00 ? 103 TYR A CD1  3  
ATOM 2684  C CD2  . TYR A 1 19 ? 4.827   3.366   -2.444  1.00 0.00 ? 103 TYR A CD2  3  
ATOM 2685  C CE1  . TYR A 1 19 ? 5.803   4.701   -0.235  1.00 0.00 ? 103 TYR A CE1  3  
ATOM 2686  C CE2  . TYR A 1 19 ? 4.421   4.660   -2.186  1.00 0.00 ? 103 TYR A CE2  3  
ATOM 2687  C CZ   . TYR A 1 19 ? 4.912   5.325   -1.083  1.00 0.00 ? 103 TYR A CZ   3  
ATOM 2688  O OH   . TYR A 1 19 ? 4.507   6.615   -0.824  1.00 0.00 ? 103 TYR A OH   3  
ATOM 2689  H H    . TYR A 1 19 ? 6.266   1.401   -4.510  1.00 0.00 ? 103 TYR A H    3  
ATOM 2690  H HA   . TYR A 1 19 ? 8.175   1.839   -2.344  1.00 0.00 ? 103 TYR A HA   3  
ATOM 2691  H HB2  . TYR A 1 19 ? 5.343   0.794   -2.386  1.00 0.00 ? 103 TYR A HB2  3  
ATOM 2692  H HB3  . TYR A 1 19 ? 6.338   0.811   -0.934  1.00 0.00 ? 103 TYR A HB3  3  
ATOM 2693  H HD1  . TYR A 1 19 ? 6.903   2.915   0.162   1.00 0.00 ? 103 TYR A HD1  3  
ATOM 2694  H HD2  . TYR A 1 19 ? 4.444   2.845   -3.306  1.00 0.00 ? 103 TYR A HD2  3  
ATOM 2695  H HE1  . TYR A 1 19 ? 6.188   5.222   0.631   1.00 0.00 ? 103 TYR A HE1  3  
ATOM 2696  H HE2  . TYR A 1 19 ? 3.723   5.149   -2.851  1.00 0.00 ? 103 TYR A HE2  3  
ATOM 2697  H HH   . TYR A 1 19 ? 5.275   7.160   -0.637  1.00 0.00 ? 103 TYR A HH   3  
ATOM 2698  N N    . GLU A 1 20 ? 8.988   -0.470  -1.936  1.00 0.00 ? 104 GLU A N    3  
ATOM 2699  C CA   . GLU A 1 20 ? 9.538   -1.801  -1.784  1.00 0.00 ? 104 GLU A CA   3  
ATOM 2700  C C    . GLU A 1 20 ? 8.859   -2.504  -0.621  1.00 0.00 ? 104 GLU A C    3  
ATOM 2701  O O    . GLU A 1 20 ? 9.238   -2.325  0.537   1.00 0.00 ? 104 GLU A O    3  
ATOM 2702  C CB   . GLU A 1 20 ? 11.044  -1.748  -1.544  1.00 0.00 ? 104 GLU A CB   3  
ATOM 2703  C CG   . GLU A 1 20 ? 11.697  -3.119  -1.567  1.00 0.00 ? 104 GLU A CG   3  
ATOM 2704  C CD   . GLU A 1 20 ? 13.016  -3.152  -0.830  1.00 0.00 ? 104 GLU A CD   3  
ATOM 2705  O OE1  . GLU A 1 20 ? 14.022  -2.657  -1.374  1.00 0.00 ? 104 GLU A OE1  3  
ATOM 2706  O OE2  . GLU A 1 20 ? 13.049  -3.685  0.296   1.00 0.00 ? 104 GLU A OE2  3  
ATOM 2707  H H    . GLU A 1 20 ? 9.399   0.278   -1.448  1.00 0.00 ? 104 GLU A H    3  
ATOM 2708  H HA   . GLU A 1 20 ? 9.342   -2.351  -2.691  1.00 0.00 ? 104 GLU A HA   3  
ATOM 2709  H HB2  . GLU A 1 20 ? 11.499  -1.141  -2.312  1.00 0.00 ? 104 GLU A HB2  3  
ATOM 2710  H HB3  . GLU A 1 20 ? 11.229  -1.298  -0.582  1.00 0.00 ? 104 GLU A HB3  3  
ATOM 2711  H HG2  . GLU A 1 20 ? 11.028  -3.833  -1.108  1.00 0.00 ? 104 GLU A HG2  3  
ATOM 2712  H HG3  . GLU A 1 20 ? 11.869  -3.400  -2.595  1.00 0.00 ? 104 GLU A HG3  3  
ATOM 2713  N N    . VAL A 1 21 ? 7.847   -3.288  -0.929  1.00 0.00 ? 105 VAL A N    3  
ATOM 2714  C CA   . VAL A 1 21 ? 7.087   -3.976  0.094   1.00 0.00 ? 105 VAL A CA   3  
ATOM 2715  C C    . VAL A 1 21 ? 7.367   -5.467  0.055   1.00 0.00 ? 105 VAL A C    3  
ATOM 2716  O O    . VAL A 1 21 ? 7.921   -5.982  -0.913  1.00 0.00 ? 105 VAL A O    3  
ATOM 2717  C CB   . VAL A 1 21 ? 5.569   -3.740  -0.073  1.00 0.00 ? 105 VAL A CB   3  
ATOM 2718  C CG1  . VAL A 1 21 ? 5.249   -2.256  0.006   1.00 0.00 ? 105 VAL A CG1  3  
ATOM 2719  C CG2  . VAL A 1 21 ? 5.062   -4.330  -1.383  1.00 0.00 ? 105 VAL A CG2  3  
ATOM 2720  H H    . VAL A 1 21 ? 7.608   -3.420  -1.874  1.00 0.00 ? 105 VAL A H    3  
ATOM 2721  H HA   . VAL A 1 21 ? 7.389   -3.587  1.053   1.00 0.00 ? 105 VAL A HA   3  
ATOM 2722  H HB   . VAL A 1 21 ? 5.058   -4.237  0.740   1.00 0.00 ? 105 VAL A HB   3  
ATOM 2723  H HG11 . VAL A 1 21 ? 4.183   -2.112  -0.093  1.00 0.00 ? 105 VAL A HG11 3  
ATOM 2724  H HG12 . VAL A 1 21 ? 5.756   -1.736  -0.794  1.00 0.00 ? 105 VAL A HG12 3  
ATOM 2725  H HG13 . VAL A 1 21 ? 5.580   -1.865  0.957   1.00 0.00 ? 105 VAL A HG13 3  
ATOM 2726  H HG21 . VAL A 1 21 ? 5.207   -5.401  -1.379  1.00 0.00 ? 105 VAL A HG21 3  
ATOM 2727  H HG22 . VAL A 1 21 ? 5.607   -3.897  -2.208  1.00 0.00 ? 105 VAL A HG22 3  
ATOM 2728  H HG23 . VAL A 1 21 ? 4.009   -4.109  -1.493  1.00 0.00 ? 105 VAL A HG23 3  
ATOM 2729  N N    . ARG A 1 22 ? 7.012   -6.157  1.119   1.00 0.00 ? 106 ARG A N    3  
ATOM 2730  C CA   . ARG A 1 22 ? 7.096   -7.601  1.133   1.00 0.00 ? 106 ARG A CA   3  
ATOM 2731  C C    . ARG A 1 22 ? 5.694   -8.183  1.151   1.00 0.00 ? 106 ARG A C    3  
ATOM 2732  O O    . ARG A 1 22 ? 4.780   -7.593  1.724   1.00 0.00 ? 106 ARG A O    3  
ATOM 2733  C CB   . ARG A 1 22 ? 7.929   -8.109  2.314   1.00 0.00 ? 106 ARG A CB   3  
ATOM 2734  C CG   . ARG A 1 22 ? 9.411   -7.788  2.183   1.00 0.00 ? 106 ARG A CG   3  
ATOM 2735  C CD   . ARG A 1 22 ? 9.733   -6.366  2.626   1.00 0.00 ? 106 ARG A CD   3  
ATOM 2736  N NE   . ARG A 1 22 ? 10.998  -5.878  2.065   1.00 0.00 ? 106 ARG A NE   3  
ATOM 2737  C CZ   . ARG A 1 22 ? 12.207  -6.326  2.413   1.00 0.00 ? 106 ARG A CZ   3  
ATOM 2738  N NH1  . ARG A 1 22 ? 12.340  -7.285  3.323   1.00 0.00 ? 106 ARG A NH1  3  
ATOM 2739  N NH2  . ARG A 1 22 ? 13.290  -5.794  1.861   1.00 0.00 ? 106 ARG A NH2  3  
ATOM 2740  H H    . ARG A 1 22 ? 6.682   -5.685  1.912   1.00 0.00 ? 106 ARG A H    3  
ATOM 2741  H HA   . ARG A 1 22 ? 7.577   -7.903  0.213   1.00 0.00 ? 106 ARG A HA   3  
ATOM 2742  H HB2  . ARG A 1 22 ? 7.562   -7.657  3.223   1.00 0.00 ? 106 ARG A HB2  3  
ATOM 2743  H HB3  . ARG A 1 22 ? 7.819   -9.181  2.384   1.00 0.00 ? 106 ARG A HB3  3  
ATOM 2744  H HG2  . ARG A 1 22 ? 9.973   -8.479  2.792   1.00 0.00 ? 106 ARG A HG2  3  
ATOM 2745  H HG3  . ARG A 1 22 ? 9.701   -7.907  1.148   1.00 0.00 ? 106 ARG A HG3  3  
ATOM 2746  H HD2  . ARG A 1 22 ? 8.935   -5.714  2.305   1.00 0.00 ? 106 ARG A HD2  3  
ATOM 2747  H HD3  . ARG A 1 22 ? 9.799   -6.347  3.705   1.00 0.00 ? 106 ARG A HD3  3  
ATOM 2748  H HE   . ARG A 1 22 ? 10.941  -5.162  1.392   1.00 0.00 ? 106 ARG A HE   3  
ATOM 2749  H HH11 . ARG A 1 22 ? 11.527  -7.692  3.761   1.00 0.00 ? 106 ARG A HH11 3  
ATOM 2750  H HH12 . ARG A 1 22 ? 13.258  -7.611  3.583   1.00 0.00 ? 106 ARG A HH12 3  
ATOM 2751  H HH21 . ARG A 1 22 ? 13.202  -5.045  1.181   1.00 0.00 ? 106 ARG A HH21 3  
ATOM 2752  H HH22 . ARG A 1 22 ? 14.206  -6.139  2.099   1.00 0.00 ? 106 ARG A HH22 3  
ATOM 2753  N N    . LEU A 1 23 ? 5.528   -9.332  0.518   1.00 0.00 ? 107 LEU A N    3  
ATOM 2754  C CA   . LEU A 1 23 ? 4.207   -9.917  0.310   1.00 0.00 ? 107 LEU A CA   3  
ATOM 2755  C C    . LEU A 1 23 ? 3.505   -10.213 1.634   1.00 0.00 ? 107 LEU A C    3  
ATOM 2756  O O    . LEU A 1 23 ? 2.290   -10.051 1.753   1.00 0.00 ? 107 LEU A O    3  
ATOM 2757  C CB   . LEU A 1 23 ? 4.307   -11.207 -0.519  1.00 0.00 ? 107 LEU A CB   3  
ATOM 2758  C CG   . LEU A 1 23 ? 4.716   -11.033 -1.994  1.00 0.00 ? 107 LEU A CG   3  
ATOM 2759  C CD1  . LEU A 1 23 ? 6.191   -10.677 -2.131  1.00 0.00 ? 107 LEU A CD1  3  
ATOM 2760  C CD2  . LEU A 1 23 ? 4.401   -12.296 -2.785  1.00 0.00 ? 107 LEU A CD2  3  
ATOM 2761  H H    . LEU A 1 23 ? 6.316   -9.806  0.179   1.00 0.00 ? 107 LEU A H    3  
ATOM 2762  H HA   . LEU A 1 23 ? 3.614   -9.198  -0.237  1.00 0.00 ? 107 LEU A HA   3  
ATOM 2763  H HB2  . LEU A 1 23 ? 5.027   -11.855 -0.045  1.00 0.00 ? 107 LEU A HB2  3  
ATOM 2764  H HB3  . LEU A 1 23 ? 3.343   -11.695 -0.496  1.00 0.00 ? 107 LEU A HB3  3  
ATOM 2765  H HG   . LEU A 1 23 ? 4.140   -10.224 -2.422  1.00 0.00 ? 107 LEU A HG   3  
ATOM 2766  H HD11 . LEU A 1 23 ? 6.379   -9.726  -1.656  1.00 0.00 ? 107 LEU A HD11 3  
ATOM 2767  H HD12 . LEU A 1 23 ? 6.450   -10.613 -3.179  1.00 0.00 ? 107 LEU A HD12 3  
ATOM 2768  H HD13 . LEU A 1 23 ? 6.792   -11.440 -1.659  1.00 0.00 ? 107 LEU A HD13 3  
ATOM 2769  H HD21 . LEU A 1 23 ? 3.339   -12.491 -2.740  1.00 0.00 ? 107 LEU A HD21 3  
ATOM 2770  H HD22 . LEU A 1 23 ? 4.940   -13.130 -2.363  1.00 0.00 ? 107 LEU A HD22 3  
ATOM 2771  H HD23 . LEU A 1 23 ? 4.699   -12.159 -3.815  1.00 0.00 ? 107 LEU A HD23 3  
ATOM 2772  N N    . THR A 1 24 ? 4.278   -10.613 2.631   1.00 0.00 ? 108 THR A N    3  
ATOM 2773  C CA   . THR A 1 24 ? 3.725   -11.076 3.894   1.00 0.00 ? 108 THR A CA   3  
ATOM 2774  C C    . THR A 1 24 ? 3.732   -10.000 4.981   1.00 0.00 ? 108 THR A C    3  
ATOM 2775  O O    . THR A 1 24 ? 3.442   -10.285 6.140   1.00 0.00 ? 108 THR A O    3  
ATOM 2776  C CB   . THR A 1 24 ? 4.516   -12.301 4.375   1.00 0.00 ? 108 THR A CB   3  
ATOM 2777  O OG1  . THR A 1 24 ? 5.919   -12.054 4.193   1.00 0.00 ? 108 THR A OG1  3  
ATOM 2778  C CG2  . THR A 1 24 ? 4.111   -13.546 3.602   1.00 0.00 ? 108 THR A CG2  3  
ATOM 2779  H H    . THR A 1 24 ? 5.252   -10.612 2.514   1.00 0.00 ? 108 THR A H    3  
ATOM 2780  H HA   . THR A 1 24 ? 2.706   -11.387 3.716   1.00 0.00 ? 108 THR A HA   3  
ATOM 2781  H HB   . THR A 1 24 ? 4.313   -12.456 5.426   1.00 0.00 ? 108 THR A HB   3  
ATOM 2782  H HG1  . THR A 1 24 ? 6.325   -11.848 5.045   1.00 0.00 ? 108 THR A HG1  3  
ATOM 2783  H HG21 . THR A 1 24 ? 4.662   -14.396 3.975   1.00 0.00 ? 108 THR A HG21 3  
ATOM 2784  H HG22 . THR A 1 24 ? 4.331   -13.407 2.553   1.00 0.00 ? 108 THR A HG22 3  
ATOM 2785  H HG23 . THR A 1 24 ? 3.052   -13.721 3.725   1.00 0.00 ? 108 THR A HG23 3  
ATOM 2786  N N    . GLN A 1 25 ? 4.041   -8.760  4.615   1.00 0.00 ? 109 GLN A N    3  
ATOM 2787  C CA   . GLN A 1 25 ? 4.073   -7.677  5.599   1.00 0.00 ? 109 GLN A CA   3  
ATOM 2788  C C    . GLN A 1 25 ? 2.663   -7.155  5.872   1.00 0.00 ? 109 GLN A C    3  
ATOM 2789  O O    . GLN A 1 25 ? 2.455   -6.360  6.785   1.00 0.00 ? 109 GLN A O    3  
ATOM 2790  C CB   . GLN A 1 25 ? 4.968   -6.531  5.118   1.00 0.00 ? 109 GLN A CB   3  
ATOM 2791  C CG   . GLN A 1 25 ? 4.347   -5.695  4.010   1.00 0.00 ? 109 GLN A CG   3  
ATOM 2792  C CD   . GLN A 1 25 ? 5.189   -4.494  3.633   1.00 0.00 ? 109 GLN A CD   3  
ATOM 2793  O OE1  . GLN A 1 25 ? 6.413   -4.529  3.714   1.00 0.00 ? 109 GLN A OE1  3  
ATOM 2794  N NE2  . GLN A 1 25 ? 4.535   -3.417  3.233   1.00 0.00 ? 109 GLN A NE2  3  
ATOM 2795  H H    . GLN A 1 25 ? 4.254   -8.571  3.676   1.00 0.00 ? 109 GLN A H    3  
ATOM 2796  H HA   . GLN A 1 25 ? 4.478   -8.079  6.518   1.00 0.00 ? 109 GLN A HA   3  
ATOM 2797  H HB2  . GLN A 1 25 ? 5.177   -5.880  5.953   1.00 0.00 ? 109 GLN A HB2  3  
ATOM 2798  H HB3  . GLN A 1 25 ? 5.896   -6.943  4.753   1.00 0.00 ? 109 GLN A HB3  3  
ATOM 2799  H HG2  . GLN A 1 25 ? 4.225   -6.316  3.135   1.00 0.00 ? 109 GLN A HG2  3  
ATOM 2800  H HG3  . GLN A 1 25 ? 3.379   -5.349  4.341   1.00 0.00 ? 109 GLN A HG3  3  
ATOM 2801  H HE21 . GLN A 1 25 ? 3.556   -3.454  3.201   1.00 0.00 ? 109 GLN A HE21 3  
ATOM 2802  H HE22 . GLN A 1 25 ? 5.057   -2.617  2.987   1.00 0.00 ? 109 GLN A HE22 3  
ATOM 2803  N N    . THR A 1 26 ? 1.716   -7.627  5.057   1.00 0.00 ? 110 THR A N    3  
ATOM 2804  C CA   . THR A 1 26 ? 0.307   -7.205  5.065   1.00 0.00 ? 110 THR A CA   3  
ATOM 2805  C C    . THR A 1 26 ? 0.165   -5.728  4.683   1.00 0.00 ? 110 THR A C    3  
ATOM 2806  O O    . THR A 1 26 ? 1.126   -4.952  4.759   1.00 0.00 ? 110 THR A O    3  
ATOM 2807  C CB   . THR A 1 26 ? -0.425  -7.476  6.412   1.00 0.00 ? 110 THR A CB   3  
ATOM 2808  O OG1  . THR A 1 26 ? 0.056   -6.615  7.447   1.00 0.00 ? 110 THR A OG1  3  
ATOM 2809  C CG2  . THR A 1 26 ? -0.262  -8.928  6.840   1.00 0.00 ? 110 THR A CG2  3  
ATOM 2810  H H    . THR A 1 26 ? 1.983   -8.295  4.406   1.00 0.00 ? 110 THR A H    3  
ATOM 2811  H HA   . THR A 1 26 ? -0.192  -7.786  4.301   1.00 0.00 ? 110 THR A HA   3  
ATOM 2812  H HB   . THR A 1 26 ? -1.480  -7.285  6.266   1.00 0.00 ? 110 THR A HB   3  
ATOM 2813  H HG1  . THR A 1 26 ? 1.022   -6.593  7.425   1.00 0.00 ? 110 THR A HG1  3  
ATOM 2814  H HG21 . THR A 1 26 ? -0.684  -9.578  6.086   1.00 0.00 ? 110 THR A HG21 3  
ATOM 2815  H HG22 . THR A 1 26 ? -0.775  -9.085  7.777   1.00 0.00 ? 110 THR A HG22 3  
ATOM 2816  H HG23 . THR A 1 26 ? 0.788   -9.151  6.961   1.00 0.00 ? 110 THR A HG23 3  
ATOM 2817  N N    . VAL A 1 27 ? -1.026  -5.346  4.243   1.00 0.00 ? 111 VAL A N    3  
ATOM 2818  C CA   . VAL A 1 27 ? -1.290  -3.964  3.863   1.00 0.00 ? 111 VAL A CA   3  
ATOM 2819  C C    . VAL A 1 27 ? -1.150  -3.051  5.082   1.00 0.00 ? 111 VAL A C    3  
ATOM 2820  O O    . VAL A 1 27 ? -0.910  -1.850  4.952   1.00 0.00 ? 111 VAL A O    3  
ATOM 2821  C CB   . VAL A 1 27 ? -2.691  -3.804  3.229   1.00 0.00 ? 111 VAL A CB   3  
ATOM 2822  C CG1  . VAL A 1 27 ? -2.934  -2.371  2.773   1.00 0.00 ? 111 VAL A CG1  3  
ATOM 2823  C CG2  . VAL A 1 27 ? -2.854  -4.769  2.064   1.00 0.00 ? 111 VAL A CG2  3  
ATOM 2824  H H    . VAL A 1 27 ? -1.749  -6.010  4.170   1.00 0.00 ? 111 VAL A H    3  
ATOM 2825  H HA   . VAL A 1 27 ? -0.550  -3.678  3.128   1.00 0.00 ? 111 VAL A HA   3  
ATOM 2826  H HB   . VAL A 1 27 ? -3.431  -4.050  3.973   1.00 0.00 ? 111 VAL A HB   3  
ATOM 2827  H HG11 . VAL A 1 27 ? -2.820  -1.701  3.614   1.00 0.00 ? 111 VAL A HG11 3  
ATOM 2828  H HG12 . VAL A 1 27 ? -3.934  -2.282  2.377   1.00 0.00 ? 111 VAL A HG12 3  
ATOM 2829  H HG13 . VAL A 1 27 ? -2.219  -2.110  2.005   1.00 0.00 ? 111 VAL A HG13 3  
ATOM 2830  H HG21 . VAL A 1 27 ? -2.093  -4.571  1.323   1.00 0.00 ? 111 VAL A HG21 3  
ATOM 2831  H HG22 . VAL A 1 27 ? -3.830  -4.639  1.620   1.00 0.00 ? 111 VAL A HG22 3  
ATOM 2832  H HG23 . VAL A 1 27 ? -2.754  -5.784  2.421   1.00 0.00 ? 111 VAL A HG23 3  
ATOM 2833  N N    . ALA A 1 28 ? -1.261  -3.646  6.267   1.00 0.00 ? 112 ALA A N    3  
ATOM 2834  C CA   . ALA A 1 28 ? -1.070  -2.919  7.515   1.00 0.00 ? 112 ALA A CA   3  
ATOM 2835  C C    . ALA A 1 28 ? 0.316   -2.288  7.569   1.00 0.00 ? 112 ALA A C    3  
ATOM 2836  O O    . ALA A 1 28 ? 0.466   -1.140  7.985   1.00 0.00 ? 112 ALA A O    3  
ATOM 2837  C CB   . ALA A 1 28 ? -1.273  -3.842  8.706   1.00 0.00 ? 112 ALA A CB   3  
ATOM 2838  H H    . ALA A 1 28 ? -1.475  -4.604  6.304   1.00 0.00 ? 112 ALA A H    3  
ATOM 2839  H HA   . ALA A 1 28 ? -1.814  -2.137  7.563   1.00 0.00 ? 112 ALA A HA   3  
ATOM 2840  H HB1  . ALA A 1 28 ? -1.156  -3.278  9.621   1.00 0.00 ? 112 ALA A HB1  3  
ATOM 2841  H HB2  . ALA A 1 28 ? -0.538  -4.634  8.677   1.00 0.00 ? 112 ALA A HB2  3  
ATOM 2842  H HB3  . ALA A 1 28 ? -2.264  -4.269  8.670   1.00 0.00 ? 112 ALA A HB3  3  
ATOM 2843  N N    . HIS A 1 29 ? 1.332   -3.028  7.123   1.00 0.00 ? 113 HIS A N    3  
ATOM 2844  C CA   . HIS A 1 29 ? 2.696   -2.518  7.145   1.00 0.00 ? 113 HIS A CA   3  
ATOM 2845  C C    . HIS A 1 29 ? 2.860   -1.402  6.122   1.00 0.00 ? 113 HIS A C    3  
ATOM 2846  O O    . HIS A 1 29 ? 3.573   -0.431  6.361   1.00 0.00 ? 113 HIS A O    3  
ATOM 2847  C CB   . HIS A 1 29 ? 3.715   -3.623  6.862   1.00 0.00 ? 113 HIS A CB   3  
ATOM 2848  C CG   . HIS A 1 29 ? 5.119   -3.233  7.227   1.00 0.00 ? 113 HIS A CG   3  
ATOM 2849  N ND1  . HIS A 1 29 ? 6.080   -2.897  6.295   1.00 0.00 ? 113 HIS A ND1  3  
ATOM 2850  C CD2  . HIS A 1 29 ? 5.716   -3.113  8.435   1.00 0.00 ? 113 HIS A CD2  3  
ATOM 2851  C CE1  . HIS A 1 29 ? 7.202   -2.591  6.917   1.00 0.00 ? 113 HIS A CE1  3  
ATOM 2852  N NE2  . HIS A 1 29 ? 7.011   -2.713  8.216   1.00 0.00 ? 113 HIS A NE2  3  
ATOM 2853  H H    . HIS A 1 29 ? 1.156   -3.936  6.778   1.00 0.00 ? 113 HIS A H    3  
ATOM 2854  H HA   . HIS A 1 29 ? 2.879   -2.114  8.130   1.00 0.00 ? 113 HIS A HA   3  
ATOM 2855  H HB2  . HIS A 1 29 ? 3.451   -4.511  7.418   1.00 0.00 ? 113 HIS A HB2  3  
ATOM 2856  H HB3  . HIS A 1 29 ? 3.699   -3.849  5.806   1.00 0.00 ? 113 HIS A HB3  3  
ATOM 2857  H HD1  . HIS A 1 29 ? 5.961   -2.889  5.321   1.00 0.00 ? 113 HIS A HD1  3  
ATOM 2858  H HD2  . HIS A 1 29 ? 5.257   -3.299  9.396   1.00 0.00 ? 113 HIS A HD2  3  
ATOM 2859  H HE1  . HIS A 1 29 ? 8.123   -2.282  6.441   1.00 0.00 ? 113 HIS A HE1  3  
ATOM 2860  H HE2  . HIS A 1 29 ? 7.734   -2.737  8.887   1.00 0.00 ? 113 HIS A HE2  3  
ATOM 2861  N N    . LEU A 1 30 ? 2.191   -1.547  4.984   1.00 0.00 ? 114 LEU A N    3  
ATOM 2862  C CA   . LEU A 1 30 ? 2.253   -0.537  3.935   1.00 0.00 ? 114 LEU A CA   3  
ATOM 2863  C C    . LEU A 1 30 ? 1.583   0.747   4.411   1.00 0.00 ? 114 LEU A C    3  
ATOM 2864  O O    . LEU A 1 30 ? 2.107   1.843   4.219   1.00 0.00 ? 114 LEU A O    3  
ATOM 2865  C CB   . LEU A 1 30 ? 1.584   -1.044  2.650   1.00 0.00 ? 114 LEU A CB   3  
ATOM 2866  C CG   . LEU A 1 30 ? 1.557   -0.045  1.487   1.00 0.00 ? 114 LEU A CG   3  
ATOM 2867  C CD1  . LEU A 1 30 ? 2.971   0.351   1.084   1.00 0.00 ? 114 LEU A CD1  3  
ATOM 2868  C CD2  . LEU A 1 30 ? 0.810   -0.633  0.299   1.00 0.00 ? 114 LEU A CD2  3  
ATOM 2869  H H    . LEU A 1 30 ? 1.635   -2.345  4.853   1.00 0.00 ? 114 LEU A H    3  
ATOM 2870  H HA   . LEU A 1 30 ? 3.292   -0.331  3.735   1.00 0.00 ? 114 LEU A HA   3  
ATOM 2871  H HB2  . LEU A 1 30 ? 2.110   -1.930  2.322   1.00 0.00 ? 114 LEU A HB2  3  
ATOM 2872  H HB3  . LEU A 1 30 ? 0.565   -1.318  2.882   1.00 0.00 ? 114 LEU A HB3  3  
ATOM 2873  H HG   . LEU A 1 30 ? 1.039   0.848   1.803   1.00 0.00 ? 114 LEU A HG   3  
ATOM 2874  H HD11 . LEU A 1 30 ? 3.476   0.794   1.931   1.00 0.00 ? 114 LEU A HD11 3  
ATOM 2875  H HD12 . LEU A 1 30 ? 2.927   1.068   0.277   1.00 0.00 ? 114 LEU A HD12 3  
ATOM 2876  H HD13 . LEU A 1 30 ? 3.513   -0.525  0.759   1.00 0.00 ? 114 LEU A HD13 3  
ATOM 2877  H HD21 . LEU A 1 30 ? 1.326   -1.515  -0.050  1.00 0.00 ? 114 LEU A HD21 3  
ATOM 2878  H HD22 . LEU A 1 30 ? 0.769   0.097   -0.496  1.00 0.00 ? 114 LEU A HD22 3  
ATOM 2879  H HD23 . LEU A 1 30 ? -0.193  -0.897  0.599   1.00 0.00 ? 114 LEU A HD23 3  
ATOM 2880  N N    . LYS A 1 31 ? 0.433   0.594   5.052   1.00 0.00 ? 115 LYS A N    3  
ATOM 2881  C CA   . LYS A 1 31 ? -0.294  1.733   5.595   1.00 0.00 ? 115 LYS A CA   3  
ATOM 2882  C C    . LYS A 1 31 ? 0.502   2.382   6.720   1.00 0.00 ? 115 LYS A C    3  
ATOM 2883  O O    . LYS A 1 31 ? 0.392   3.578   6.954   1.00 0.00 ? 115 LYS A O    3  
ATOM 2884  C CB   . LYS A 1 31 ? -1.679  1.294   6.091   1.00 0.00 ? 115 LYS A CB   3  
ATOM 2885  C CG   . LYS A 1 31 ? -2.580  2.445   6.523   1.00 0.00 ? 115 LYS A CG   3  
ATOM 2886  C CD   . LYS A 1 31 ? -4.030  1.997   6.660   1.00 0.00 ? 115 LYS A CD   3  
ATOM 2887  C CE   . LYS A 1 31 ? -4.219  0.996   7.789   1.00 0.00 ? 115 LYS A CE   3  
ATOM 2888  N NZ   . LYS A 1 31 ? -4.341  1.659   9.116   1.00 0.00 ? 115 LYS A NZ   3  
ATOM 2889  H H    . LYS A 1 31 ? 0.059   -0.308  5.155   1.00 0.00 ? 115 LYS A H    3  
ATOM 2890  H HA   . LYS A 1 31 ? -0.418  2.450   4.797   1.00 0.00 ? 115 LYS A HA   3  
ATOM 2891  H HB2  . LYS A 1 31 ? -2.177  0.758   5.297   1.00 0.00 ? 115 LYS A HB2  3  
ATOM 2892  H HB3  . LYS A 1 31 ? -1.552  0.631   6.933   1.00 0.00 ? 115 LYS A HB3  3  
ATOM 2893  H HG2  . LYS A 1 31 ? -2.237  2.817   7.478   1.00 0.00 ? 115 LYS A HG2  3  
ATOM 2894  H HG3  . LYS A 1 31 ? -2.521  3.232   5.785   1.00 0.00 ? 115 LYS A HG3  3  
ATOM 2895  H HD2  . LYS A 1 31 ? -4.646  2.861   6.856   1.00 0.00 ? 115 LYS A HD2  3  
ATOM 2896  H HD3  . LYS A 1 31 ? -4.343  1.538   5.733   1.00 0.00 ? 115 LYS A HD3  3  
ATOM 2897  H HE2  . LYS A 1 31 ? -5.115  0.425   7.601   1.00 0.00 ? 115 LYS A HE2  3  
ATOM 2898  H HE3  . LYS A 1 31 ? -3.368  0.330   7.806   1.00 0.00 ? 115 LYS A HE3  3  
ATOM 2899  H HZ1  . LYS A 1 31 ? -3.565  2.344   9.258   1.00 0.00 ? 115 LYS A HZ1  3  
ATOM 2900  H HZ2  . LYS A 1 31 ? -4.306  0.946   9.877   1.00 0.00 ? 115 LYS A HZ2  3  
ATOM 2901  H HZ3  . LYS A 1 31 ? -5.252  2.165   9.179   1.00 0.00 ? 115 LYS A HZ3  3  
ATOM 2902  N N    . GLN A 1 32 ? 1.321   1.586   7.398   1.00 0.00 ? 116 GLN A N    3  
ATOM 2903  C CA   . GLN A 1 32 ? 2.178   2.090   8.464   1.00 0.00 ? 116 GLN A CA   3  
ATOM 2904  C C    . GLN A 1 32 ? 3.376   2.842   7.881   1.00 0.00 ? 116 GLN A C    3  
ATOM 2905  O O    . GLN A 1 32 ? 3.842   3.825   8.456   1.00 0.00 ? 116 GLN A O    3  
ATOM 2906  C CB   . GLN A 1 32 ? 2.642   0.941   9.357   1.00 0.00 ? 116 GLN A CB   3  
ATOM 2907  C CG   . GLN A 1 32 ? 3.414   1.388   10.587  1.00 0.00 ? 116 GLN A CG   3  
ATOM 2908  C CD   . GLN A 1 32 ? 3.738   0.230   11.507  1.00 0.00 ? 116 GLN A CD   3  
ATOM 2909  O OE1  . GLN A 1 32 ? 4.786   -0.405  11.385  1.00 0.00 ? 116 GLN A OE1  3  
ATOM 2910  N NE2  . GLN A 1 32 ? 2.832   -0.060  12.426  1.00 0.00 ? 116 GLN A NE2  3  
ATOM 2911  H H    . GLN A 1 32 ? 1.340   0.628   7.182   1.00 0.00 ? 116 GLN A H    3  
ATOM 2912  H HA   . GLN A 1 32 ? 1.592   2.785   9.058   1.00 0.00 ? 116 GLN A HA   3  
ATOM 2913  H HB2  . GLN A 1 32 ? 1.776   0.388   9.685   1.00 0.00 ? 116 GLN A HB2  3  
ATOM 2914  H HB3  . GLN A 1 32 ? 3.277   0.285   8.779   1.00 0.00 ? 116 GLN A HB3  3  
ATOM 2915  H HG2  . GLN A 1 32 ? 4.339   1.848   10.272  1.00 0.00 ? 116 GLN A HG2  3  
ATOM 2916  H HG3  . GLN A 1 32 ? 2.818   2.107   11.131  1.00 0.00 ? 116 GLN A HG3  3  
ATOM 2917  H HE21 . GLN A 1 32 ? 2.014   0.486   12.461  1.00 0.00 ? 116 GLN A HE21 3  
ATOM 2918  H HE22 . GLN A 1 32 ? 3.006   -0.816  13.029  1.00 0.00 ? 116 GLN A HE22 3  
ATOM 2919  N N    . GLN A 1 33 ? 3.876   2.384   6.741   1.00 0.00 ? 117 GLN A N    3  
ATOM 2920  C CA   . GLN A 1 33 ? 4.897   3.130   6.012   1.00 0.00 ? 117 GLN A CA   3  
ATOM 2921  C C    . GLN A 1 33 ? 4.334   4.499   5.633   1.00 0.00 ? 117 GLN A C    3  
ATOM 2922  O O    . GLN A 1 33 ? 4.946   5.551   5.884   1.00 0.00 ? 117 GLN A O    3  
ATOM 2923  C CB   . GLN A 1 33 ? 5.332   2.358   4.761   1.00 0.00 ? 117 GLN A CB   3  
ATOM 2924  C CG   . GLN A 1 33 ? 6.128   1.098   5.069   1.00 0.00 ? 117 GLN A CG   3  
ATOM 2925  C CD   . GLN A 1 33 ? 6.348   0.217   3.850   1.00 0.00 ? 117 GLN A CD   3  
ATOM 2926  O OE1  . GLN A 1 33 ? 5.564   -0.692  3.574   1.00 0.00 ? 117 GLN A OE1  3  
ATOM 2927  N NE2  . GLN A 1 33 ? 7.407   0.487   3.102   1.00 0.00 ? 117 GLN A NE2  3  
ATOM 2928  H H    . GLN A 1 33 ? 3.558   1.525   6.386   1.00 0.00 ? 117 GLN A H    3  
ATOM 2929  H HA   . GLN A 1 33 ? 5.746   3.266   6.664   1.00 0.00 ? 117 GLN A HA   3  
ATOM 2930  H HB2  . GLN A 1 33 ? 4.451   2.074   4.202   1.00 0.00 ? 117 GLN A HB2  3  
ATOM 2931  H HB3  . GLN A 1 33 ? 5.943   3.003   4.147   1.00 0.00 ? 117 GLN A HB3  3  
ATOM 2932  H HG2  . GLN A 1 33 ? 7.090   1.385   5.465   1.00 0.00 ? 117 GLN A HG2  3  
ATOM 2933  H HG3  . GLN A 1 33 ? 5.592   0.526   5.814   1.00 0.00 ? 117 GLN A HG3  3  
ATOM 2934  H HE21 . GLN A 1 33 ? 7.989   1.238   3.371   1.00 0.00 ? 117 GLN A HE21 3  
ATOM 2935  H HE22 . GLN A 1 33 ? 7.574   -0.071  2.315   1.00 0.00 ? 117 GLN A HE22 3  
ATOM 2936  N N    . VAL A 1 34 ? 3.136   4.474   5.068   1.00 0.00 ? 118 VAL A N    3  
ATOM 2937  C CA   . VAL A 1 34 ? 2.418   5.696   4.762   1.00 0.00 ? 118 VAL A CA   3  
ATOM 2938  C C    . VAL A 1 34 ? 2.163   6.487   6.042   1.00 0.00 ? 118 VAL A C    3  
ATOM 2939  O O    . VAL A 1 34 ? 2.335   7.695   6.062   1.00 0.00 ? 118 VAL A O    3  
ATOM 2940  C CB   . VAL A 1 34 ? 1.075   5.412   4.049   1.00 0.00 ? 118 VAL A CB   3  
ATOM 2941  C CG1  . VAL A 1 34 ? 0.345   6.709   3.731   1.00 0.00 ? 118 VAL A CG1  3  
ATOM 2942  C CG2  . VAL A 1 34 ? 1.302   4.605   2.779   1.00 0.00 ? 118 VAL A CG2  3  
ATOM 2943  H H    . VAL A 1 34 ? 2.725   3.608   4.846   1.00 0.00 ? 118 VAL A H    3  
ATOM 2944  H HA   . VAL A 1 34 ? 3.035   6.290   4.103   1.00 0.00 ? 118 VAL A HA   3  
ATOM 2945  H HB   . VAL A 1 34 ? 0.453   4.829   4.713   1.00 0.00 ? 118 VAL A HB   3  
ATOM 2946  H HG11 . VAL A 1 34 ? 0.138   7.241   4.648   1.00 0.00 ? 118 VAL A HG11 3  
ATOM 2947  H HG12 . VAL A 1 34 ? -0.585  6.483   3.229   1.00 0.00 ? 118 VAL A HG12 3  
ATOM 2948  H HG13 . VAL A 1 34 ? 0.961   7.321   3.089   1.00 0.00 ? 118 VAL A HG13 3  
ATOM 2949  H HG21 . VAL A 1 34 ? 1.949   5.157   2.113   1.00 0.00 ? 118 VAL A HG21 3  
ATOM 2950  H HG22 . VAL A 1 34 ? 0.354   4.426   2.292   1.00 0.00 ? 118 VAL A HG22 3  
ATOM 2951  H HG23 . VAL A 1 34 ? 1.762   3.659   3.030   1.00 0.00 ? 118 VAL A HG23 3  
ATOM 2952  N N    . SER A 1 35 ? 1.810   5.786   7.119   1.00 0.00 ? 119 SER A N    3  
ATOM 2953  C CA   . SER A 1 35 ? 1.511   6.433   8.393   1.00 0.00 ? 119 SER A CA   3  
ATOM 2954  C C    . SER A 1 35 ? 2.759   7.093   8.981   1.00 0.00 ? 119 SER A C    3  
ATOM 2955  O O    . SER A 1 35 ? 2.669   7.906   9.898   1.00 0.00 ? 119 SER A O    3  
ATOM 2956  C CB   . SER A 1 35 ? 0.914   5.428   9.391   1.00 0.00 ? 119 SER A CB   3  
ATOM 2957  O OG   . SER A 1 35 ? 1.904   4.605   9.982   1.00 0.00 ? 119 SER A OG   3  
ATOM 2958  H H    . SER A 1 35 ? 1.723   4.810   7.048   1.00 0.00 ? 119 SER A H    3  
ATOM 2959  H HA   . SER A 1 35 ? 0.779   7.202   8.199   1.00 0.00 ? 119 SER A HA   3  
ATOM 2960  H HB2  . SER A 1 35 ? 0.403   5.961   10.173  1.00 0.00 ? 119 SER A HB2  3  
ATOM 2961  H HB3  . SER A 1 35 ? 0.209   4.795   8.873   1.00 0.00 ? 119 SER A HB3  3  
ATOM 2962  H HG   . SER A 1 35 ? 2.674   4.556   9.401   1.00 0.00 ? 119 SER A HG   3  
ATOM 2963  N N    . GLY A 1 36 ? 3.921   6.738   8.451   1.00 0.00 ? 120 GLY A N    3  
ATOM 2964  C CA   . GLY A 1 36 ? 5.145   7.386   8.862   1.00 0.00 ? 120 GLY A CA   3  
ATOM 2965  C C    . GLY A 1 36 ? 5.340   8.711   8.156   1.00 0.00 ? 120 GLY A C    3  
ATOM 2966  O O    . GLY A 1 36 ? 5.699   9.708   8.778   1.00 0.00 ? 120 GLY A O    3  
ATOM 2967  H H    . GLY A 1 36 ? 3.947   6.027   7.776   1.00 0.00 ? 120 GLY A H    3  
ATOM 2968  H HA2  . GLY A 1 36 ? 5.112   7.557   9.928   1.00 0.00 ? 120 GLY A HA2  3  
ATOM 2969  H HA3  . GLY A 1 36 ? 5.979   6.741   8.633   1.00 0.00 ? 120 GLY A HA3  3  
ATOM 2970  N N    . LEU A 1 37 ? 5.086   8.721   6.853   1.00 0.00 ? 121 LEU A N    3  
ATOM 2971  C CA   . LEU A 1 37 ? 5.268   9.933   6.047   1.00 0.00 ? 121 LEU A CA   3  
ATOM 2972  C C    . LEU A 1 37 ? 3.986   10.777  5.970   1.00 0.00 ? 121 LEU A C    3  
ATOM 2973  O O    . LEU A 1 37 ? 3.964   11.936  6.381   1.00 0.00 ? 121 LEU A O    3  
ATOM 2974  C CB   . LEU A 1 37 ? 5.724   9.564   4.633   1.00 0.00 ? 121 LEU A CB   3  
ATOM 2975  C CG   . LEU A 1 37 ? 7.071   8.844   4.547   1.00 0.00 ? 121 LEU A CG   3  
ATOM 2976  C CD1  . LEU A 1 37 ? 7.391   8.486   3.104   1.00 0.00 ? 121 LEU A CD1  3  
ATOM 2977  C CD2  . LEU A 1 37 ? 8.175   9.709   5.141   1.00 0.00 ? 121 LEU A CD2  3  
ATOM 2978  H H    . LEU A 1 37 ? 4.785   7.886   6.416   1.00 0.00 ? 121 LEU A H    3  
ATOM 2979  H HA   . LEU A 1 37 ? 6.040   10.524  6.516   1.00 0.00 ? 121 LEU A HA   3  
ATOM 2980  H HB2  . LEU A 1 37 ? 4.973   8.927   4.188   1.00 0.00 ? 121 LEU A HB2  3  
ATOM 2981  H HB3  . LEU A 1 37 ? 5.791   10.470  4.048   1.00 0.00 ? 121 LEU A HB3  3  
ATOM 2982  H HG   . LEU A 1 37 ? 7.019   7.928   5.114   1.00 0.00 ? 121 LEU A HG   3  
ATOM 2983  H HD11 . LEU A 1 37 ? 8.357   8.006   3.058   1.00 0.00 ? 121 LEU A HD11 3  
ATOM 2984  H HD12 . LEU A 1 37 ? 7.405   9.383   2.504   1.00 0.00 ? 121 LEU A HD12 3  
ATOM 2985  H HD13 . LEU A 1 37 ? 6.636   7.813   2.725   1.00 0.00 ? 121 LEU A HD13 3  
ATOM 2986  H HD21 . LEU A 1 37 ? 9.122   9.197   5.047   1.00 0.00 ? 121 LEU A HD21 3  
ATOM 2987  H HD22 . LEU A 1 37 ? 7.967   9.888   6.186   1.00 0.00 ? 121 LEU A HD22 3  
ATOM 2988  H HD23 . LEU A 1 37 ? 8.219   10.651  4.617   1.00 0.00 ? 121 LEU A HD23 3  
ATOM 2989  N N    . GLU A 1 38 ? 2.932   10.176  5.440   1.00 0.00 ? 122 GLU A N    3  
ATOM 2990  C CA   . GLU A 1 38 ? 1.659   10.854  5.181   1.00 0.00 ? 122 GLU A CA   3  
ATOM 2991  C C    . GLU A 1 38 ? 0.650   10.531  6.282   1.00 0.00 ? 122 GLU A C    3  
ATOM 2992  O O    . GLU A 1 38 ? -0.537  10.796  6.135   1.00 0.00 ? 122 GLU A O    3  
ATOM 2993  C CB   . GLU A 1 38 ? 1.109   10.446  3.814   1.00 0.00 ? 122 GLU A CB   3  
ATOM 2994  C CG   . GLU A 1 38 ? 0.037   11.380  3.275   1.00 0.00 ? 122 GLU A CG   3  
ATOM 2995  C CD   . GLU A 1 38 ? 0.605   12.713  2.839   1.00 0.00 ? 122 GLU A CD   3  
ATOM 2996  O OE1  . GLU A 1 38 ? 1.029   13.506  3.710   1.00 0.00 ? 122 GLU A OE1  3  
ATOM 2997  O OE2  . GLU A 1 38 ? 0.637   12.978  1.619   1.00 0.00 ? 122 GLU A OE2  3  
ATOM 2998  H H    . GLU A 1 38 ? 2.997   9.218   5.229   1.00 0.00 ? 122 GLU A H    3  
ATOM 2999  H HA   . GLU A 1 38 ? 1.846   11.917  5.183   1.00 0.00 ? 122 GLU A HA   3  
ATOM 3000  H HB2  . GLU A 1 38 ? 1.921   10.436  3.113   1.00 0.00 ? 122 GLU A HB2  3  
ATOM 3001  H HB3  . GLU A 1 38 ? 0.690   9.451   3.885   1.00 0.00 ? 122 GLU A HB3  3  
ATOM 3002  H HG2  . GLU A 1 38 ? -0.437  10.912  2.425   1.00 0.00 ? 122 GLU A HG2  3  
ATOM 3003  H HG3  . GLU A 1 38 ? -0.696  11.552  4.049   1.00 0.00 ? 122 GLU A HG3  3  
ATOM 3004  N N    . GLY A 1 39 ? 1.158   9.886   7.334   1.00 0.00 ? 123 GLY A N    3  
ATOM 3005  C CA   . GLY A 1 39 ? 0.378   9.321   8.448   1.00 0.00 ? 123 GLY A CA   3  
ATOM 3006  C C    . GLY A 1 39 ? -0.725  10.169  9.074   1.00 0.00 ? 123 GLY A C    3  
ATOM 3007  O O    . GLY A 1 39 ? -1.219  9.802   10.136  1.00 0.00 ? 123 GLY A O    3  
ATOM 3008  H H    . GLY A 1 39 ? 2.130   9.777   7.361   1.00 0.00 ? 123 GLY A H    3  
ATOM 3009  H HA2  . GLY A 1 39 ? -0.081  8.412   8.095   1.00 0.00 ? 123 GLY A HA2  3  
ATOM 3010  H HA3  . GLY A 1 39 ? 1.076   9.050   9.228   1.00 0.00 ? 123 GLY A HA3  3  
ATOM 3011  N N    . VAL A 1 40 ? -1.042  11.311  8.489   1.00 0.00 ? 124 VAL A N    3  
ATOM 3012  C CA   . VAL A 1 40 ? -2.152  12.151  8.924   1.00 0.00 ? 124 VAL A CA   3  
ATOM 3013  C C    . VAL A 1 40 ? -3.452  11.354  9.096   1.00 0.00 ? 124 VAL A C    3  
ATOM 3014  O O    . VAL A 1 40 ? -4.255  11.280  8.172   1.00 0.00 ? 124 VAL A O    3  
ATOM 3015  C CB   . VAL A 1 40 ? -2.416  13.270  7.896   1.00 0.00 ? 124 VAL A CB   3  
ATOM 3016  C CG1  . VAL A 1 40 ? -3.495  14.218  8.401   1.00 0.00 ? 124 VAL A CG1  3  
ATOM 3017  C CG2  . VAL A 1 40 ? -1.129  14.010  7.562   1.00 0.00 ? 124 VAL A CG2  3  
ATOM 3018  H H    . VAL A 1 40 ? -0.525  11.593  7.706   1.00 0.00 ? 124 VAL A H    3  
ATOM 3019  H HA   . VAL A 1 40 ? -1.884  12.612  9.865   1.00 0.00 ? 124 VAL A HA   3  
ATOM 3020  H HB   . VAL A 1 40 ? -2.782  12.809  6.989   1.00 0.00 ? 124 VAL A HB   3  
ATOM 3021  H HG11 . VAL A 1 40 ? -3.644  15.010  7.684   1.00 0.00 ? 124 VAL A HG11 3  
ATOM 3022  H HG12 . VAL A 1 40 ? -3.193  14.637  9.349   1.00 0.00 ? 124 VAL A HG12 3  
ATOM 3023  H HG13 . VAL A 1 40 ? -4.420  13.664  8.527   1.00 0.00 ? 124 VAL A HG13 3  
ATOM 3024  H HG21 . VAL A 1 40 ? -0.685  14.390  8.469   1.00 0.00 ? 124 VAL A HG21 3  
ATOM 3025  H HG22 . VAL A 1 40 ? -1.348  14.833  6.897   1.00 0.00 ? 124 VAL A HG22 3  
ATOM 3026  H HG23 . VAL A 1 40 ? -0.437  13.331  7.075   1.00 0.00 ? 124 VAL A HG23 3  
ATOM 3027  N N    . GLN A 1 41 ? -3.622  10.753  10.278  1.00 0.00 ? 125 GLN A N    3  
ATOM 3028  C CA   . GLN A 1 41 ? -4.832  10.012  10.644  1.00 0.00 ? 125 GLN A CA   3  
ATOM 3029  C C    . GLN A 1 41 ? -5.148  8.891   9.650   1.00 0.00 ? 125 GLN A C    3  
ATOM 3030  O O    . GLN A 1 41 ? -5.624  9.141   8.542   1.00 0.00 ? 125 GLN A O    3  
ATOM 3031  C CB   . GLN A 1 41 ? -6.037  10.953  10.786  1.00 0.00 ? 125 GLN A CB   3  
ATOM 3032  C CG   . GLN A 1 41 ? -6.011  11.853  12.021  1.00 0.00 ? 125 GLN A CG   3  
ATOM 3033  C CD   . GLN A 1 41 ? -4.867  12.856  12.023  1.00 0.00 ? 125 GLN A CD   3  
ATOM 3034  O OE1  . GLN A 1 41 ? -4.991  13.954  11.481  1.00 0.00 ? 125 GLN A OE1  3  
ATOM 3035  N NE2  . GLN A 1 41 ? -3.762  12.502  12.663  1.00 0.00 ? 125 GLN A NE2  3  
ATOM 3036  H H    . GLN A 1 41 ? -2.889  10.796  10.926  1.00 0.00 ? 125 GLN A H    3  
ATOM 3037  H HA   . GLN A 1 41 ? -4.644  9.559   11.607  1.00 0.00 ? 125 GLN A HA   3  
ATOM 3038  H HB2  . GLN A 1 41 ? -6.083  11.587  9.913   1.00 0.00 ? 125 GLN A HB2  3  
ATOM 3039  H HB3  . GLN A 1 41 ? -6.935  10.355  10.825  1.00 0.00 ? 125 GLN A HB3  3  
ATOM 3040  H HG2  . GLN A 1 41 ? -6.941  12.398  12.067  1.00 0.00 ? 125 GLN A HG2  3  
ATOM 3041  H HG3  . GLN A 1 41 ? -5.922  11.229  12.900  1.00 0.00 ? 125 GLN A HG3  3  
ATOM 3042  H HE21 . GLN A 1 41 ? -3.739  11.622  13.101  1.00 0.00 ? 125 GLN A HE21 3  
ATOM 3043  H HE22 . GLN A 1 41 ? -3.007  13.131  12.668  1.00 0.00 ? 125 GLN A HE22 3  
ATOM 3044  N N    . ASP A 1 42 ? -4.915  7.653   10.077  1.00 0.00 ? 126 ASP A N    3  
ATOM 3045  C CA   . ASP A 1 42 ? -5.175  6.465   9.251   1.00 0.00 ? 126 ASP A CA   3  
ATOM 3046  C C    . ASP A 1 42 ? -6.591  6.474   8.676   1.00 0.00 ? 126 ASP A C    3  
ATOM 3047  O O    . ASP A 1 42 ? -6.860  5.848   7.654   1.00 0.00 ? 126 ASP A O    3  
ATOM 3048  C CB   . ASP A 1 42 ? -4.993  5.178   10.072  1.00 0.00 ? 126 ASP A CB   3  
ATOM 3049  C CG   . ASP A 1 42 ? -3.549  4.875   10.421  1.00 0.00 ? 126 ASP A CG   3  
ATOM 3050  O OD1  . ASP A 1 42 ? -2.980  5.582   11.279  1.00 0.00 ? 126 ASP A OD1  3  
ATOM 3051  O OD2  . ASP A 1 42 ? -2.991  3.899   9.868   1.00 0.00 ? 126 ASP A OD2  3  
ATOM 3052  H H    . ASP A 1 42 ? -4.547  7.528   10.980  1.00 0.00 ? 126 ASP A H    3  
ATOM 3053  H HA   . ASP A 1 42 ? -4.468  6.466   8.436   1.00 0.00 ? 126 ASP A HA   3  
ATOM 3054  H HB2  . ASP A 1 42 ? -5.545  5.272   10.993  1.00 0.00 ? 126 ASP A HB2  3  
ATOM 3055  H HB3  . ASP A 1 42 ? -5.387  4.344   9.510   1.00 0.00 ? 126 ASP A HB3  3  
ATOM 3056  N N    . ASP A 1 43 ? -7.489  7.185   9.341   1.00 0.00 ? 127 ASP A N    3  
ATOM 3057  C CA   . ASP A 1 43 ? -8.891  7.208   8.951   1.00 0.00 ? 127 ASP A CA   3  
ATOM 3058  C C    . ASP A 1 43 ? -9.151  8.186   7.802   1.00 0.00 ? 127 ASP A C    3  
ATOM 3059  O O    . ASP A 1 43 ? -10.143 8.054   7.084   1.00 0.00 ? 127 ASP A O    3  
ATOM 3060  C CB   . ASP A 1 43 ? -9.757  7.564   10.163  1.00 0.00 ? 127 ASP A CB   3  
ATOM 3061  C CG   . ASP A 1 43 ? -11.239 7.605   9.849   1.00 0.00 ? 127 ASP A CG   3  
ATOM 3062  O OD1  . ASP A 1 43 ? -11.808 6.555   9.480   1.00 0.00 ? 127 ASP A OD1  3  
ATOM 3063  O OD2  . ASP A 1 43 ? -11.848 8.687   9.988   1.00 0.00 ? 127 ASP A OD2  3  
ATOM 3064  H H    . ASP A 1 43 ? -7.198  7.713   10.117  1.00 0.00 ? 127 ASP A H    3  
ATOM 3065  H HA   . ASP A 1 43 ? -9.154  6.214   8.619   1.00 0.00 ? 127 ASP A HA   3  
ATOM 3066  H HB2  . ASP A 1 43 ? -9.597  6.828   10.936  1.00 0.00 ? 127 ASP A HB2  3  
ATOM 3067  H HB3  . ASP A 1 43 ? -9.460  8.535   10.533  1.00 0.00 ? 127 ASP A HB3  3  
ATOM 3068  N N    . LEU A 1 44 ? -8.254  9.149   7.603   1.00 0.00 ? 128 LEU A N    3  
ATOM 3069  C CA   . LEU A 1 44 ? -8.470  10.177  6.592   1.00 0.00 ? 128 LEU A CA   3  
ATOM 3070  C C    . LEU A 1 44 ? -8.093  9.697   5.192   1.00 0.00 ? 128 LEU A C    3  
ATOM 3071  O O    . LEU A 1 44 ? -8.463  10.326  4.198   1.00 0.00 ? 128 LEU A O    3  
ATOM 3072  C CB   . LEU A 1 44 ? -7.679  11.436  6.936   1.00 0.00 ? 128 LEU A CB   3  
ATOM 3073  C CG   . LEU A 1 44 ? -8.098  12.136  8.229   1.00 0.00 ? 128 LEU A CG   3  
ATOM 3074  C CD1  . LEU A 1 44 ? -7.188  13.319  8.499   1.00 0.00 ? 128 LEU A CD1  3  
ATOM 3075  C CD2  . LEU A 1 44 ? -9.547  12.591  8.147   1.00 0.00 ? 128 LEU A CD2  3  
ATOM 3076  H H    . LEU A 1 44 ? -7.427  9.174   8.143   1.00 0.00 ? 128 LEU A H    3  
ATOM 3077  H HA   . LEU A 1 44 ? -9.522  10.419  6.597   1.00 0.00 ? 128 LEU A HA   3  
ATOM 3078  H HB2  . LEU A 1 44 ? -6.635  11.170  7.018   1.00 0.00 ? 128 LEU A HB2  3  
ATOM 3079  H HB3  . LEU A 1 44 ? -7.792  12.136  6.123   1.00 0.00 ? 128 LEU A HB3  3  
ATOM 3080  H HG   . LEU A 1 44 ? -8.008  11.446  9.058   1.00 0.00 ? 128 LEU A HG   3  
ATOM 3081  H HD11 . LEU A 1 44 ? -7.508  13.823  9.398   1.00 0.00 ? 128 LEU A HD11 3  
ATOM 3082  H HD12 . LEU A 1 44 ? -7.232  14.004  7.665   1.00 0.00 ? 128 LEU A HD12 3  
ATOM 3083  H HD13 . LEU A 1 44 ? -6.174  12.967  8.622   1.00 0.00 ? 128 LEU A HD13 3  
ATOM 3084  H HD21 . LEU A 1 44 ? -9.644  13.339  7.376   1.00 0.00 ? 128 LEU A HD21 3  
ATOM 3085  H HD22 . LEU A 1 44 ? -9.848  13.007  9.097   1.00 0.00 ? 128 LEU A HD22 3  
ATOM 3086  H HD23 . LEU A 1 44 ? -10.175 11.745  7.907   1.00 0.00 ? 128 LEU A HD23 3  
ATOM 3087  N N    . PHE A 1 45 ? -7.364  8.592   5.106   1.00 0.00 ? 129 PHE A N    3  
ATOM 3088  C CA   . PHE A 1 45 ? -6.939  8.077   3.810   1.00 0.00 ? 129 PHE A CA   3  
ATOM 3089  C C    . PHE A 1 45 ? -7.170  6.577   3.694   1.00 0.00 ? 129 PHE A C    3  
ATOM 3090  O O    . PHE A 1 45 ? -7.157  5.845   4.687   1.00 0.00 ? 129 PHE A O    3  
ATOM 3091  C CB   . PHE A 1 45 ? -5.459  8.407   3.550   1.00 0.00 ? 129 PHE A CB   3  
ATOM 3092  C CG   . PHE A 1 45 ? -4.487  7.760   4.504   1.00 0.00 ? 129 PHE A CG   3  
ATOM 3093  C CD1  . PHE A 1 45 ? -4.140  8.383   5.694   1.00 0.00 ? 129 PHE A CD1  3  
ATOM 3094  C CD2  . PHE A 1 45 ? -3.908  6.536   4.201   1.00 0.00 ? 129 PHE A CD2  3  
ATOM 3095  C CE1  . PHE A 1 45 ? -3.237  7.797   6.561   1.00 0.00 ? 129 PHE A CE1  3  
ATOM 3096  C CE2  . PHE A 1 45 ? -3.007  5.947   5.066   1.00 0.00 ? 129 PHE A CE2  3  
ATOM 3097  C CZ   . PHE A 1 45 ? -2.671  6.578   6.248   1.00 0.00 ? 129 PHE A CZ   3  
ATOM 3098  H H    . PHE A 1 45 ? -7.107  8.117   5.924   1.00 0.00 ? 129 PHE A H    3  
ATOM 3099  H HA   . PHE A 1 45 ? -7.535  8.569   3.058   1.00 0.00 ? 129 PHE A HA   3  
ATOM 3100  H HB2  . PHE A 1 45 ? -5.200  8.084   2.552   1.00 0.00 ? 129 PHE A HB2  3  
ATOM 3101  H HB3  . PHE A 1 45 ? -5.326  9.477   3.617   1.00 0.00 ? 129 PHE A HB3  3  
ATOM 3102  H HD1  . PHE A 1 45 ? -4.584  9.336   5.943   1.00 0.00 ? 129 PHE A HD1  3  
ATOM 3103  H HD2  . PHE A 1 45 ? -4.172  6.040   3.279   1.00 0.00 ? 129 PHE A HD2  3  
ATOM 3104  H HE1  . PHE A 1 45 ? -2.975  8.290   7.485   1.00 0.00 ? 129 PHE A HE1  3  
ATOM 3105  H HE2  . PHE A 1 45 ? -2.565  4.993   4.817   1.00 0.00 ? 129 PHE A HE2  3  
ATOM 3106  H HZ   . PHE A 1 45 ? -1.964  6.120   6.923   1.00 0.00 ? 129 PHE A HZ   3  
ATOM 3107  N N    . TRP A 1 46 ? -7.392  6.130   2.470   1.00 0.00 ? 130 TRP A N    3  
ATOM 3108  C CA   . TRP A 1 46 ? -7.482  4.714   2.163   1.00 0.00 ? 130 TRP A CA   3  
ATOM 3109  C C    . TRP A 1 46 ? -6.980  4.512   0.741   1.00 0.00 ? 130 TRP A C    3  
ATOM 3110  O O    . TRP A 1 46 ? -6.983  5.447   -0.051  1.00 0.00 ? 130 TRP A O    3  
ATOM 3111  C CB   . TRP A 1 46 ? -8.922  4.193   2.340   1.00 0.00 ? 130 TRP A CB   3  
ATOM 3112  C CG   . TRP A 1 46 ? -9.784  4.279   1.112   1.00 0.00 ? 130 TRP A CG   3  
ATOM 3113  C CD1  . TRP A 1 46 ? -10.204 3.229   0.345   1.00 0.00 ? 130 TRP A CD1  3  
ATOM 3114  C CD2  . TRP A 1 46 ? -10.334 5.458   0.509   1.00 0.00 ? 130 TRP A CD2  3  
ATOM 3115  N NE1  . TRP A 1 46 ? -10.977 3.681   -0.692  1.00 0.00 ? 130 TRP A NE1  3  
ATOM 3116  C CE2  . TRP A 1 46 ? -11.072 5.043   -0.614  1.00 0.00 ? 130 TRP A CE2  3  
ATOM 3117  C CE3  . TRP A 1 46 ? -10.278 6.823   0.809   1.00 0.00 ? 130 TRP A CE3  3  
ATOM 3118  C CZ2  . TRP A 1 46 ? -11.743 5.936   -1.439  1.00 0.00 ? 130 TRP A CZ2  3  
ATOM 3119  C CZ3  . TRP A 1 46 ? -10.945 7.711   -0.013  1.00 0.00 ? 130 TRP A CZ3  3  
ATOM 3120  C CH2  . TRP A 1 46 ? -11.672 7.262   -1.125  1.00 0.00 ? 130 TRP A CH2  3  
ATOM 3121  H H    . TRP A 1 46 ? -7.490  6.781   1.736   1.00 0.00 ? 130 TRP A H    3  
ATOM 3122  H HA   . TRP A 1 46 ? -6.825  4.187   2.844   1.00 0.00 ? 130 TRP A HA   3  
ATOM 3123  H HB2  . TRP A 1 46 ? -8.883  3.159   2.640   1.00 0.00 ? 130 TRP A HB2  3  
ATOM 3124  H HB3  . TRP A 1 46 ? -9.402  4.766   3.121   1.00 0.00 ? 130 TRP A HB3  3  
ATOM 3125  H HD1  . TRP A 1 46 ? -9.954  2.196   0.540   1.00 0.00 ? 130 TRP A HD1  3  
ATOM 3126  H HE1  . TRP A 1 46 ? -11.395 3.119   -1.380  1.00 0.00 ? 130 TRP A HE1  3  
ATOM 3127  H HE3  . TRP A 1 46 ? -9.722  7.185   1.662   1.00 0.00 ? 130 TRP A HE3  3  
ATOM 3128  H HZ2  . TRP A 1 46 ? -12.306 5.607   -2.300  1.00 0.00 ? 130 TRP A HZ2  3  
ATOM 3129  H HZ3  . TRP A 1 46 ? -10.913 8.769   0.199   1.00 0.00 ? 130 TRP A HZ3  3  
ATOM 3130  H HH2  . TRP A 1 46 ? -12.177 7.988   -1.742  1.00 0.00 ? 130 TRP A HH2  3  
ATOM 3131  N N    . LEU A 1 47 ? -6.539  3.315   0.407   1.00 0.00 ? 131 LEU A N    3  
ATOM 3132  C CA   . LEU A 1 47 ? -5.896  3.104   -0.881  1.00 0.00 ? 131 LEU A CA   3  
ATOM 3133  C C    . LEU A 1 47 ? -6.592  2.015   -1.687  1.00 0.00 ? 131 LEU A C    3  
ATOM 3134  O O    . LEU A 1 47 ? -6.942  0.954   -1.163  1.00 0.00 ? 131 LEU A O    3  
ATOM 3135  C CB   . LEU A 1 47 ? -4.400  2.779   -0.711  1.00 0.00 ? 131 LEU A CB   3  
ATOM 3136  C CG   . LEU A 1 47 ? -4.047  1.564   0.164   1.00 0.00 ? 131 LEU A CG   3  
ATOM 3137  C CD1  . LEU A 1 47 ? -2.643  1.086   -0.161  1.00 0.00 ? 131 LEU A CD1  3  
ATOM 3138  C CD2  . LEU A 1 47 ? -4.137  1.906   1.647   1.00 0.00 ? 131 LEU A CD2  3  
ATOM 3139  H H    . LEU A 1 47 ? -6.663  2.561   1.016   1.00 0.00 ? 131 LEU A H    3  
ATOM 3140  H HA   . LEU A 1 47 ? -5.983  4.033   -1.432  1.00 0.00 ? 131 LEU A HA   3  
ATOM 3141  H HB2  . LEU A 1 47 ? -3.983  2.611   -1.693  1.00 0.00 ? 131 LEU A HB2  3  
ATOM 3142  H HB3  . LEU A 1 47 ? -3.918  3.648   -0.285  1.00 0.00 ? 131 LEU A HB3  3  
ATOM 3143  H HG   . LEU A 1 47 ? -4.737  0.759   -0.043  1.00 0.00 ? 131 LEU A HG   3  
ATOM 3144  H HD11 . LEU A 1 47 ? -1.940  1.888   0.022   1.00 0.00 ? 131 LEU A HD11 3  
ATOM 3145  H HD12 . LEU A 1 47 ? -2.594  0.796   -1.200  1.00 0.00 ? 131 LEU A HD12 3  
ATOM 3146  H HD13 . LEU A 1 47 ? -2.396  0.240   0.462   1.00 0.00 ? 131 LEU A HD13 3  
ATOM 3147  H HD21 . LEU A 1 47 ? -3.462  2.720   1.870   1.00 0.00 ? 131 LEU A HD21 3  
ATOM 3148  H HD22 . LEU A 1 47 ? -3.860  1.041   2.232   1.00 0.00 ? 131 LEU A HD22 3  
ATOM 3149  H HD23 . LEU A 1 47 ? -5.145  2.197   1.892   1.00 0.00 ? 131 LEU A HD23 3  
ATOM 3150  N N    . THR A 1 48 ? -6.785  2.294   -2.968  1.00 0.00 ? 132 THR A N    3  
ATOM 3151  C CA   . THR A 1 48 ? -7.466  1.383   -3.872  1.00 0.00 ? 132 THR A CA   3  
ATOM 3152  C C    . THR A 1 48 ? -6.505  0.917   -4.957  1.00 0.00 ? 132 THR A C    3  
ATOM 3153  O O    . THR A 1 48 ? -5.811  1.732   -5.566  1.00 0.00 ? 132 THR A O    3  
ATOM 3154  C CB   . THR A 1 48 ? -8.686  2.065   -4.531  1.00 0.00 ? 132 THR A CB   3  
ATOM 3155  O OG1  . THR A 1 48 ? -8.279  3.284   -5.165  1.00 0.00 ? 132 THR A OG1  3  
ATOM 3156  C CG2  . THR A 1 48 ? -9.773  2.370   -3.511  1.00 0.00 ? 132 THR A CG2  3  
ATOM 3157  H H    . THR A 1 48 ? -6.437  3.143   -3.326  1.00 0.00 ? 132 THR A H    3  
ATOM 3158  H HA   . THR A 1 48 ? -7.806  0.529   -3.307  1.00 0.00 ? 132 THR A HA   3  
ATOM 3159  H HB   . THR A 1 48 ? -9.092  1.398   -5.280  1.00 0.00 ? 132 THR A HB   3  
ATOM 3160  H HG1  . THR A 1 48 ? -7.443  3.146   -5.624  1.00 0.00 ? 132 THR A HG1  3  
ATOM 3161  H HG21 . THR A 1 48 ? -9.383  3.040   -2.759  1.00 0.00 ? 132 THR A HG21 3  
ATOM 3162  H HG22 . THR A 1 48 ? -10.094 1.452   -3.043  1.00 0.00 ? 132 THR A HG22 3  
ATOM 3163  H HG23 . THR A 1 48 ? -10.613 2.836   -4.007  1.00 0.00 ? 132 THR A HG23 3  
ATOM 3164  N N    . PHE A 1 49 ? -6.457  -0.385  -5.196  1.00 0.00 ? 133 PHE A N    3  
ATOM 3165  C CA   . PHE A 1 49 ? -5.545  -0.922  -6.189  1.00 0.00 ? 133 PHE A CA   3  
ATOM 3166  C C    . PHE A 1 49 ? -6.227  -1.079  -7.552  1.00 0.00 ? 133 PHE A C    3  
ATOM 3167  O O    . PHE A 1 49 ? -6.231  -0.152  -8.358  1.00 0.00 ? 133 PHE A O    3  
ATOM 3168  C CB   . PHE A 1 49 ? -4.929  -2.249  -5.706  1.00 0.00 ? 133 PHE A CB   3  
ATOM 3169  C CG   . PHE A 1 49 ? -4.260  -3.026  -6.804  1.00 0.00 ? 133 PHE A CG   3  
ATOM 3170  C CD1  . PHE A 1 49 ? -3.356  -2.410  -7.651  1.00 0.00 ? 133 PHE A CD1  3  
ATOM 3171  C CD2  . PHE A 1 49 ? -4.591  -4.351  -7.027  1.00 0.00 ? 133 PHE A CD2  3  
ATOM 3172  C CE1  . PHE A 1 49 ? -2.786  -3.102  -8.695  1.00 0.00 ? 133 PHE A CE1  3  
ATOM 3173  C CE2  . PHE A 1 49 ? -4.033  -5.046  -8.078  1.00 0.00 ? 133 PHE A CE2  3  
ATOM 3174  C CZ   . PHE A 1 49 ? -3.130  -4.419  -8.913  1.00 0.00 ? 133 PHE A CZ   3  
ATOM 3175  H H    . PHE A 1 49 ? -7.050  -0.990  -4.700  1.00 0.00 ? 133 PHE A H    3  
ATOM 3176  H HA   . PHE A 1 49 ? -4.748  -0.206  -6.304  1.00 0.00 ? 133 PHE A HA   3  
ATOM 3177  H HB2  . PHE A 1 49 ? -4.190  -2.040  -4.947  1.00 0.00 ? 133 PHE A HB2  3  
ATOM 3178  H HB3  . PHE A 1 49 ? -5.708  -2.869  -5.286  1.00 0.00 ? 133 PHE A HB3  3  
ATOM 3179  H HD1  . PHE A 1 49 ? -3.085  -1.378  -7.480  1.00 0.00 ? 133 PHE A HD1  3  
ATOM 3180  H HD2  . PHE A 1 49 ? -5.297  -4.839  -6.371  1.00 0.00 ? 133 PHE A HD2  3  
ATOM 3181  H HE1  . PHE A 1 49 ? -2.079  -2.613  -9.347  1.00 0.00 ? 133 PHE A HE1  3  
ATOM 3182  H HE2  . PHE A 1 49 ? -4.299  -6.080  -8.244  1.00 0.00 ? 133 PHE A HE2  3  
ATOM 3183  H HZ   . PHE A 1 49 ? -2.705  -4.954  -9.741  1.00 0.00 ? 133 PHE A HZ   3  
ATOM 3184  N N    . GLU A 1 50 ? -6.829  -2.234  -7.793  1.00 0.00 ? 134 GLU A N    3  
ATOM 3185  C CA   . GLU A 1 50 ? -7.331  -2.562  -9.120  1.00 0.00 ? 134 GLU A CA   3  
ATOM 3186  C C    . GLU A 1 50 ? -8.829  -2.285  -9.205  1.00 0.00 ? 134 GLU A C    3  
ATOM 3187  O O    . GLU A 1 50 ? -9.547  -2.871  -10.013 1.00 0.00 ? 134 GLU A O    3  
ATOM 3188  C CB   . GLU A 1 50 ? -7.021  -4.026  -9.441  1.00 0.00 ? 134 GLU A CB   3  
ATOM 3189  C CG   . GLU A 1 50 ? -7.070  -4.347  -10.927 1.00 0.00 ? 134 GLU A CG   3  
ATOM 3190  C CD   . GLU A 1 50 ? -6.170  -5.504  -11.307 1.00 0.00 ? 134 GLU A CD   3  
ATOM 3191  O OE1  . GLU A 1 50 ? -6.529  -6.665  -11.024 1.00 0.00 ? 134 GLU A OE1  3  
ATOM 3192  O OE2  . GLU A 1 50 ? -5.095  -5.258  -11.896 1.00 0.00 ? 134 GLU A OE2  3  
ATOM 3193  H H    . GLU A 1 50 ? -6.931  -2.879  -7.066  1.00 0.00 ? 134 GLU A H    3  
ATOM 3194  H HA   . GLU A 1 50 ? -6.809  -1.938  -9.830  1.00 0.00 ? 134 GLU A HA   3  
ATOM 3195  H HB2  . GLU A 1 50 ? -6.031  -4.257  -9.077  1.00 0.00 ? 134 GLU A HB2  3  
ATOM 3196  H HB3  . GLU A 1 50 ? -7.738  -4.653  -8.933  1.00 0.00 ? 134 GLU A HB3  3  
ATOM 3197  H HG2  . GLU A 1 50 ? -8.085  -4.601  -11.196 1.00 0.00 ? 134 GLU A HG2  3  
ATOM 3198  H HG3  . GLU A 1 50 ? -6.761  -3.474  -11.482 1.00 0.00 ? 134 GLU A HG3  3  
ATOM 3199  N N    . GLY A 1 51 ? -9.290  -1.371  -8.367  1.00 0.00 ? 135 GLY A N    3  
ATOM 3200  C CA   . GLY A 1 51 ? -10.696 -1.019  -8.346  1.00 0.00 ? 135 GLY A CA   3  
ATOM 3201  C C    . GLY A 1 51 ? -11.241 -0.975  -6.938  1.00 0.00 ? 135 GLY A C    3  
ATOM 3202  O O    . GLY A 1 51 ? -12.061 -0.123  -6.603  1.00 0.00 ? 135 GLY A O    3  
ATOM 3203  H H    . GLY A 1 51 ? -8.668  -0.918  -7.763  1.00 0.00 ? 135 GLY A H    3  
ATOM 3204  H HA2  . GLY A 1 51 ? -10.822 -0.049  -8.802  1.00 0.00 ? 135 GLY A HA2  3  
ATOM 3205  H HA3  . GLY A 1 51 ? -11.248 -1.751  -8.914  1.00 0.00 ? 135 GLY A HA3  3  
ATOM 3206  N N    . LYS A 1 52 ? -10.774 -1.895  -6.109  1.00 0.00 ? 136 LYS A N    3  
ATOM 3207  C CA   . LYS A 1 52 ? -11.196 -1.955  -4.719  1.00 0.00 ? 136 LYS A CA   3  
ATOM 3208  C C    . LYS A 1 52 ? -10.015 -1.719  -3.780  1.00 0.00 ? 136 LYS A C    3  
ATOM 3209  O O    . LYS A 1 52 ? -8.857  -1.917  -4.165  1.00 0.00 ? 136 LYS A O    3  
ATOM 3210  C CB   . LYS A 1 52 ? -11.873 -3.298  -4.421  1.00 0.00 ? 136 LYS A CB   3  
ATOM 3211  C CG   . LYS A 1 52 ? -13.338 -3.336  -4.827  1.00 0.00 ? 136 LYS A CG   3  
ATOM 3212  C CD   . LYS A 1 52 ? -14.102 -2.201  -4.168  1.00 0.00 ? 136 LYS A CD   3  
ATOM 3213  C CE   . LYS A 1 52 ? -15.565 -2.184  -4.566  1.00 0.00 ? 136 LYS A CE   3  
ATOM 3214  N NZ   . LYS A 1 52 ? -16.240 -0.953  -4.082  1.00 0.00 ? 136 LYS A NZ   3  
ATOM 3215  H H    . LYS A 1 52 ? -10.130 -2.553  -6.439  1.00 0.00 ? 136 LYS A H    3  
ATOM 3216  H HA   . LYS A 1 52 ? -11.914 -1.165  -4.564  1.00 0.00 ? 136 LYS A HA   3  
ATOM 3217  H HB2  . LYS A 1 52 ? -11.353 -4.079  -4.957  1.00 0.00 ? 136 LYS A HB2  3  
ATOM 3218  H HB3  . LYS A 1 52 ? -11.811 -3.494  -3.361  1.00 0.00 ? 136 LYS A HB3  3  
ATOM 3219  H HG2  . LYS A 1 52 ? -13.410 -3.234  -5.900  1.00 0.00 ? 136 LYS A HG2  3  
ATOM 3220  H HG3  . LYS A 1 52 ? -13.766 -4.277  -4.519  1.00 0.00 ? 136 LYS A HG3  3  
ATOM 3221  H HD2  . LYS A 1 52 ? -14.036 -2.316  -3.096  1.00 0.00 ? 136 LYS A HD2  3  
ATOM 3222  H HD3  . LYS A 1 52 ? -13.650 -1.263  -4.455  1.00 0.00 ? 136 LYS A HD3  3  
ATOM 3223  H HE2  . LYS A 1 52 ? -15.633 -2.224  -5.644  1.00 0.00 ? 136 LYS A HE2  3  
ATOM 3224  H HE3  . LYS A 1 52 ? -16.053 -3.046  -4.139  1.00 0.00 ? 136 LYS A HE3  3  
ATOM 3225  H HZ1  . LYS A 1 52 ? -15.913 -0.129  -4.627  1.00 0.00 ? 136 LYS A HZ1  3  
ATOM 3226  H HZ2  . LYS A 1 52 ? -16.019 -0.794  -3.074  1.00 0.00 ? 136 LYS A HZ2  3  
ATOM 3227  H HZ3  . LYS A 1 52 ? -17.270 -1.040  -4.189  1.00 0.00 ? 136 LYS A HZ3  3  
ATOM 3228  N N    . PRO A 1 53 ? -10.296 -1.263  -2.547  1.00 0.00 ? 137 PRO A N    3  
ATOM 3229  C CA   . PRO A 1 53 ? -9.268  -1.001  -1.537  1.00 0.00 ? 137 PRO A CA   3  
ATOM 3230  C C    . PRO A 1 53 ? -8.611  -2.275  -1.019  1.00 0.00 ? 137 PRO A C    3  
ATOM 3231  O O    . PRO A 1 53 ? -9.212  -3.354  -1.028  1.00 0.00 ? 137 PRO A O    3  
ATOM 3232  C CB   . PRO A 1 53 ? -10.038 -0.306  -0.411  1.00 0.00 ? 137 PRO A CB   3  
ATOM 3233  C CG   . PRO A 1 53 ? -11.445 -0.766  -0.569  1.00 0.00 ? 137 PRO A CG   3  
ATOM 3234  C CD   . PRO A 1 53 ? -11.650 -0.957  -2.043  1.00 0.00 ? 137 PRO A CD   3  
ATOM 3235  H HA   . PRO A 1 53 ? -8.506  -0.339  -1.915  1.00 0.00 ? 137 PRO A HA   3  
ATOM 3236  H HB2  . PRO A 1 53 ? -9.631  -0.602  0.545   1.00 0.00 ? 137 PRO A HB2  3  
ATOM 3237  H HB3  . PRO A 1 53 ? -9.958  0.764   -0.527  1.00 0.00 ? 137 PRO A HB3  3  
ATOM 3238  H HG2  . PRO A 1 53 ? -11.587 -1.700  -0.045  1.00 0.00 ? 137 PRO A HG2  3  
ATOM 3239  H HG3  . PRO A 1 53 ? -12.122 -0.015  -0.188  1.00 0.00 ? 137 PRO A HG3  3  
ATOM 3240  H HD2  . PRO A 1 53 ? -12.326 -1.783  -2.226  1.00 0.00 ? 137 PRO A HD2  3  
ATOM 3241  H HD3  . PRO A 1 53 ? -12.029 -0.051  -2.491  1.00 0.00 ? 137 PRO A HD3  3  
ATOM 3242  N N    . LEU A 1 54 ? -7.375  -2.144  -0.571  1.00 0.00 ? 138 LEU A N    3  
ATOM 3243  C CA   . LEU A 1 54 ? -6.647  -3.267  -0.008  1.00 0.00 ? 138 LEU A CA   3  
ATOM 3244  C C    . LEU A 1 54 ? -6.802  -3.274  1.505   1.00 0.00 ? 138 LEU A C    3  
ATOM 3245  O O    . LEU A 1 54 ? -6.464  -2.297  2.177   1.00 0.00 ? 138 LEU A O    3  
ATOM 3246  C CB   . LEU A 1 54 ? -5.167  -3.186  -0.384  1.00 0.00 ? 138 LEU A CB   3  
ATOM 3247  C CG   . LEU A 1 54 ? -4.871  -3.178  -1.885  1.00 0.00 ? 138 LEU A CG   3  
ATOM 3248  C CD1  . LEU A 1 54 ? -3.375  -3.075  -2.132  1.00 0.00 ? 138 LEU A CD1  3  
ATOM 3249  C CD2  . LEU A 1 54 ? -5.440  -4.420  -2.551  1.00 0.00 ? 138 LEU A CD2  3  
ATOM 3250  H H    . LEU A 1 54 ? -6.941  -1.266  -0.617  1.00 0.00 ? 138 LEU A H    3  
ATOM 3251  H HA   . LEU A 1 54 ? -7.069  -4.177  -0.410  1.00 0.00 ? 138 LEU A HA   3  
ATOM 3252  H HB2  . LEU A 1 54 ? -4.760  -2.282  0.045   1.00 0.00 ? 138 LEU A HB2  3  
ATOM 3253  H HB3  . LEU A 1 54 ? -4.660  -4.030  0.057   1.00 0.00 ? 138 LEU A HB3  3  
ATOM 3254  H HG   . LEU A 1 54 ? -5.341  -2.315  -2.332  1.00 0.00 ? 138 LEU A HG   3  
ATOM 3255  H HD11 . LEU A 1 54 ? -3.186  -3.073  -3.195  1.00 0.00 ? 138 LEU A HD11 3  
ATOM 3256  H HD12 . LEU A 1 54 ? -2.874  -3.918  -1.678  1.00 0.00 ? 138 LEU A HD12 3  
ATOM 3257  H HD13 . LEU A 1 54 ? -3.003  -2.159  -1.699  1.00 0.00 ? 138 LEU A HD13 3  
ATOM 3258  H HD21 . LEU A 1 54 ? -5.221  -4.395  -3.607  1.00 0.00 ? 138 LEU A HD21 3  
ATOM 3259  H HD22 . LEU A 1 54 ? -6.510  -4.446  -2.405  1.00 0.00 ? 138 LEU A HD22 3  
ATOM 3260  H HD23 . LEU A 1 54 ? -4.997  -5.302  -2.111  1.00 0.00 ? 138 LEU A HD23 3  
ATOM 3261  N N    . GLU A 1 55 ? -7.330  -4.366  2.035   1.00 0.00 ? 139 GLU A N    3  
ATOM 3262  C CA   . GLU A 1 55 ? -7.546  -4.486  3.469   1.00 0.00 ? 139 GLU A CA   3  
ATOM 3263  C C    . GLU A 1 55 ? -6.277  -4.968  4.164   1.00 0.00 ? 139 GLU A C    3  
ATOM 3264  O O    . GLU A 1 55 ? -5.522  -5.765  3.608   1.00 0.00 ? 139 GLU A O    3  
ATOM 3265  C CB   . GLU A 1 55 ? -8.700  -5.445  3.760   1.00 0.00 ? 139 GLU A CB   3  
ATOM 3266  C CG   . GLU A 1 55 ? -10.012 -5.025  3.117   1.00 0.00 ? 139 GLU A CG   3  
ATOM 3267  C CD   . GLU A 1 55 ? -11.157 -5.940  3.486   1.00 0.00 ? 139 GLU A CD   3  
ATOM 3268  O OE1  . GLU A 1 55 ? -11.343 -6.972  2.811   1.00 0.00 ? 139 GLU A OE1  3  
ATOM 3269  O OE2  . GLU A 1 55 ? -11.882 -5.629  4.455   1.00 0.00 ? 139 GLU A OE2  3  
ATOM 3270  H H    . GLU A 1 55 ? -7.579  -5.111  1.450   1.00 0.00 ? 139 GLU A H    3  
ATOM 3271  H HA   . GLU A 1 55 ? -7.799  -3.507  3.847   1.00 0.00 ? 139 GLU A HA   3  
ATOM 3272  H HB2  . GLU A 1 55 ? -8.439  -6.428  3.394   1.00 0.00 ? 139 GLU A HB2  3  
ATOM 3273  H HB3  . GLU A 1 55 ? -8.849  -5.497  4.829   1.00 0.00 ? 139 GLU A HB3  3  
ATOM 3274  H HG2  . GLU A 1 55 ? -10.254 -4.026  3.440   1.00 0.00 ? 139 GLU A HG2  3  
ATOM 3275  H HG3  . GLU A 1 55 ? -9.892  -5.036  2.042   1.00 0.00 ? 139 GLU A HG3  3  
ATOM 3276  N N    . ASP A 1 56 ? -6.064  -4.490  5.386   1.00 0.00 ? 140 ASP A N    3  
ATOM 3277  C CA   . ASP A 1 56 ? -4.870  -4.830  6.162   1.00 0.00 ? 140 ASP A CA   3  
ATOM 3278  C C    . ASP A 1 56 ? -4.785  -6.329  6.431   1.00 0.00 ? 140 ASP A C    3  
ATOM 3279  O O    . ASP A 1 56 ? -3.706  -6.865  6.680   1.00 0.00 ? 140 ASP A O    3  
ATOM 3280  C CB   . ASP A 1 56 ? -4.864  -4.068  7.489   1.00 0.00 ? 140 ASP A CB   3  
ATOM 3281  C CG   . ASP A 1 56 ? -5.989  -4.486  8.416   1.00 0.00 ? 140 ASP A CG   3  
ATOM 3282  O OD1  . ASP A 1 56 ? -7.134  -4.033  8.208   1.00 0.00 ? 140 ASP A OD1  3  
ATOM 3283  O OD2  . ASP A 1 56 ? -5.731  -5.259  9.363   1.00 0.00 ? 140 ASP A OD2  3  
ATOM 3284  H H    . ASP A 1 56 ? -6.726  -3.879  5.779   1.00 0.00 ? 140 ASP A H    3  
ATOM 3285  H HA   . ASP A 1 56 ? -4.008  -4.531  5.587   1.00 0.00 ? 140 ASP A HA   3  
ATOM 3286  H HB2  . ASP A 1 56 ? -3.927  -4.246  7.991   1.00 0.00 ? 140 ASP A HB2  3  
ATOM 3287  H HB3  . ASP A 1 56 ? -4.963  -3.011  7.287   1.00 0.00 ? 140 ASP A HB3  3  
ATOM 3288  N N    . GLN A 1 57 ? -5.927  -7.002  6.361   1.00 0.00 ? 141 GLN A N    3  
ATOM 3289  C CA   . GLN A 1 57 ? -5.994  -8.441  6.604   1.00 0.00 ? 141 GLN A CA   3  
ATOM 3290  C C    . GLN A 1 57 ? -5.400  -9.225  5.438   1.00 0.00 ? 141 GLN A C    3  
ATOM 3291  O O    . GLN A 1 57 ? -5.101  -10.409 5.568   1.00 0.00 ? 141 GLN A O    3  
ATOM 3292  C CB   . GLN A 1 57 ? -7.444  -8.883  6.802   1.00 0.00 ? 141 GLN A CB   3  
ATOM 3293  C CG   . GLN A 1 57 ? -8.205  -8.074  7.836   1.00 0.00 ? 141 GLN A CG   3  
ATOM 3294  C CD   . GLN A 1 57 ? -9.613  -8.596  8.058   1.00 0.00 ? 141 GLN A CD   3  
ATOM 3295  O OE1  . GLN A 1 57 ? -10.174 -8.461  9.143   1.00 0.00 ? 141 GLN A OE1  3  
ATOM 3296  N NE2  . GLN A 1 57 ? -10.194 -9.200  7.031   1.00 0.00 ? 141 GLN A NE2  3  
ATOM 3297  H H    . GLN A 1 57 ? -6.749  -6.515  6.147   1.00 0.00 ? 141 GLN A H    3  
ATOM 3298  H HA   . GLN A 1 57 ? -5.434  -8.659  7.500   1.00 0.00 ? 141 GLN A HA   3  
ATOM 3299  H HB2  . GLN A 1 57 ? -7.966  -8.802  5.860   1.00 0.00 ? 141 GLN A HB2  3  
ATOM 3300  H HB3  . GLN A 1 57 ? -7.449  -9.917  7.114   1.00 0.00 ? 141 GLN A HB3  3  
ATOM 3301  H HG2  . GLN A 1 57 ? -7.671  -8.116  8.773   1.00 0.00 ? 141 GLN A HG2  3  
ATOM 3302  H HG3  . GLN A 1 57 ? -8.264  -7.049  7.501   1.00 0.00 ? 141 GLN A HG3  3  
ATOM 3303  H HE21 . GLN A 1 57 ? -9.693  -9.276  6.191   1.00 0.00 ? 141 GLN A HE21 3  
ATOM 3304  H HE22 . GLN A 1 57 ? -11.098 -9.570  7.161   1.00 0.00 ? 141 GLN A HE22 3  
ATOM 3305  N N    . LEU A 1 58 ? -5.231  -8.563  4.304   1.00 0.00 ? 142 LEU A N    3  
ATOM 3306  C CA   . LEU A 1 58 ? -4.831  -9.243  3.082   1.00 0.00 ? 142 LEU A CA   3  
ATOM 3307  C C    . LEU A 1 58 ? -3.349  -9.036  2.786   1.00 0.00 ? 142 LEU A C    3  
ATOM 3308  O O    . LEU A 1 58 ? -2.801  -7.953  3.003   1.00 0.00 ? 142 LEU A O    3  
ATOM 3309  C CB   . LEU A 1 58 ? -5.683  -8.742  1.909   1.00 0.00 ? 142 LEU A CB   3  
ATOM 3310  C CG   . LEU A 1 58 ? -7.192  -8.933  2.084   1.00 0.00 ? 142 LEU A CG   3  
ATOM 3311  C CD1  . LEU A 1 58 ? -7.945  -8.270  0.944   1.00 0.00 ? 142 LEU A CD1  3  
ATOM 3312  C CD2  . LEU A 1 58 ? -7.540  -10.413 2.162   1.00 0.00 ? 142 LEU A CD2  3  
ATOM 3313  H H    . LEU A 1 58 ? -5.356  -7.589  4.290   1.00 0.00 ? 142 LEU A H    3  
ATOM 3314  H HA   . LEU A 1 58 ? -5.015  -10.298 3.217   1.00 0.00 ? 142 LEU A HA   3  
ATOM 3315  H HB2  . LEU A 1 58 ? -5.484  -7.690  1.770   1.00 0.00 ? 142 LEU A HB2  3  
ATOM 3316  H HB3  . LEU A 1 58 ? -5.377  -9.270  1.017   1.00 0.00 ? 142 LEU A HB3  3  
ATOM 3317  H HG   . LEU A 1 58 ? -7.504  -8.464  3.005   1.00 0.00 ? 142 LEU A HG   3  
ATOM 3318  H HD11 . LEU A 1 58 ? -7.653  -8.725  0.009   1.00 0.00 ? 142 LEU A HD11 3  
ATOM 3319  H HD12 . LEU A 1 58 ? -7.705  -7.216  0.922   1.00 0.00 ? 142 LEU A HD12 3  
ATOM 3320  H HD13 . LEU A 1 58 ? -9.006  -8.396  1.092   1.00 0.00 ? 142 LEU A HD13 3  
ATOM 3321  H HD21 . LEU A 1 58 ? -8.608  -10.524 2.277   1.00 0.00 ? 142 LEU A HD21 3  
ATOM 3322  H HD22 . LEU A 1 58 ? -7.039  -10.857 3.010   1.00 0.00 ? 142 LEU A HD22 3  
ATOM 3323  H HD23 . LEU A 1 58 ? -7.224  -10.906 1.255   1.00 0.00 ? 142 LEU A HD23 3  
ATOM 3324  N N    . PRO A 1 59 ? -2.674  -10.094 2.314   1.00 0.00 ? 143 PRO A N    3  
ATOM 3325  C CA   . PRO A 1 59 ? -1.288  -10.014 1.856   1.00 0.00 ? 143 PRO A CA   3  
ATOM 3326  C C    . PRO A 1 59 ? -1.189  -9.254  0.537   1.00 0.00 ? 143 PRO A C    3  
ATOM 3327  O O    . PRO A 1 59 ? -2.067  -9.366  -0.320  1.00 0.00 ? 143 PRO A O    3  
ATOM 3328  C CB   . PRO A 1 59 ? -0.871  -11.479 1.663   1.00 0.00 ? 143 PRO A CB   3  
ATOM 3329  C CG   . PRO A 1 59 ? -1.953  -12.290 2.296   1.00 0.00 ? 143 PRO A CG   3  
ATOM 3330  C CD   . PRO A 1 59 ? -3.199  -11.459 2.204   1.00 0.00 ? 143 PRO A CD   3  
ATOM 3331  H HA   . PRO A 1 59 ? -0.649  -9.545  2.592   1.00 0.00 ? 143 PRO A HA   3  
ATOM 3332  H HB2  . PRO A 1 59 ? -0.790  -11.691 0.606   1.00 0.00 ? 143 PRO A HB2  3  
ATOM 3333  H HB3  . PRO A 1 59 ? 0.080   -11.650 2.142   1.00 0.00 ? 143 PRO A HB3  3  
ATOM 3334  H HG2  . PRO A 1 59 ? -2.082  -13.218 1.756   1.00 0.00 ? 143 PRO A HG2  3  
ATOM 3335  H HG3  . PRO A 1 59 ? -1.710  -12.488 3.329   1.00 0.00 ? 143 PRO A HG3  3  
ATOM 3336  H HD2  . PRO A 1 59 ? -3.691  -11.612 1.254   1.00 0.00 ? 143 PRO A HD2  3  
ATOM 3337  H HD3  . PRO A 1 59 ? -3.869  -11.684 3.022   1.00 0.00 ? 143 PRO A HD3  3  
ATOM 3338  N N    . LEU A 1 60 ? -0.117  -8.490  0.370   1.00 0.00 ? 144 LEU A N    3  
ATOM 3339  C CA   . LEU A 1 60 ? 0.026   -7.637  -0.804  1.00 0.00 ? 144 LEU A CA   3  
ATOM 3340  C C    . LEU A 1 60 ? 0.295   -8.465  -2.049  1.00 0.00 ? 144 LEU A C    3  
ATOM 3341  O O    . LEU A 1 60 ? -0.164  -8.123  -3.132  1.00 0.00 ? 144 LEU A O    3  
ATOM 3342  C CB   . LEU A 1 60 ? 1.159   -6.617  -0.633  1.00 0.00 ? 144 LEU A CB   3  
ATOM 3343  C CG   . LEU A 1 60 ? 1.082   -5.734  0.613   1.00 0.00 ? 144 LEU A CG   3  
ATOM 3344  C CD1  . LEU A 1 60 ? 1.693   -6.444  1.806   1.00 0.00 ? 144 LEU A CD1  3  
ATOM 3345  C CD2  . LEU A 1 60 ? 1.775   -4.406  0.368   1.00 0.00 ? 144 LEU A CD2  3  
ATOM 3346  H H    . LEU A 1 60 ? 0.591   -8.504  1.047   1.00 0.00 ? 144 LEU A H    3  
ATOM 3347  H HA   . LEU A 1 60 ? -0.904  -7.106  -0.938  1.00 0.00 ? 144 LEU A HA   3  
ATOM 3348  H HB2  . LEU A 1 60 ? 2.095   -7.156  -0.603  1.00 0.00 ? 144 LEU A HB2  3  
ATOM 3349  H HB3  . LEU A 1 60 ? 1.166   -5.973  -1.500  1.00 0.00 ? 144 LEU A HB3  3  
ATOM 3350  H HG   . LEU A 1 60 ? 0.045   -5.535  0.838   1.00 0.00 ? 144 LEU A HG   3  
ATOM 3351  H HD11 . LEU A 1 60 ? 1.143   -7.353  2.005   1.00 0.00 ? 144 LEU A HD11 3  
ATOM 3352  H HD12 . LEU A 1 60 ? 1.647   -5.800  2.671   1.00 0.00 ? 144 LEU A HD12 3  
ATOM 3353  H HD13 . LEU A 1 60 ? 2.723   -6.688  1.592   1.00 0.00 ? 144 LEU A HD13 3  
ATOM 3354  H HD21 . LEU A 1 60 ? 1.746   -3.813  1.271   1.00 0.00 ? 144 LEU A HD21 3  
ATOM 3355  H HD22 . LEU A 1 60 ? 1.270   -3.877  -0.425  1.00 0.00 ? 144 LEU A HD22 3  
ATOM 3356  H HD23 . LEU A 1 60 ? 2.802   -4.583  0.087   1.00 0.00 ? 144 LEU A HD23 3  
ATOM 3357  N N    . GLY A 1 61 ? 1.015   -9.567  -1.880  1.00 0.00 ? 145 GLY A N    3  
ATOM 3358  C CA   . GLY A 1 61 ? 1.467   -10.353 -3.013  1.00 0.00 ? 145 GLY A CA   3  
ATOM 3359  C C    . GLY A 1 61 ? 0.341   -10.880 -3.875  1.00 0.00 ? 145 GLY A C    3  
ATOM 3360  O O    . GLY A 1 61 ? 0.509   -11.042 -5.080  1.00 0.00 ? 145 GLY A O    3  
ATOM 3361  H H    . GLY A 1 61 ? 1.232   -9.859  -0.972  1.00 0.00 ? 145 GLY A H    3  
ATOM 3362  H HA2  . GLY A 1 61 ? 2.106   -9.736  -3.627  1.00 0.00 ? 145 GLY A HA2  3  
ATOM 3363  H HA3  . GLY A 1 61 ? 2.045   -11.189 -2.645  1.00 0.00 ? 145 GLY A HA3  3  
ATOM 3364  N N    . GLU A 1 62 ? -0.811  -11.135 -3.266  1.00 0.00 ? 146 GLU A N    3  
ATOM 3365  C CA   . GLU A 1 62 ? -1.955  -11.670 -3.989  1.00 0.00 ? 146 GLU A CA   3  
ATOM 3366  C C    . GLU A 1 62 ? -2.399  -10.714 -5.100  1.00 0.00 ? 146 GLU A C    3  
ATOM 3367  O O    . GLU A 1 62 ? -2.740  -11.138 -6.203  1.00 0.00 ? 146 GLU A O    3  
ATOM 3368  C CB   . GLU A 1 62 ? -3.113  -11.931 -3.018  1.00 0.00 ? 146 GLU A CB   3  
ATOM 3369  C CG   . GLU A 1 62 ? -4.271  -12.695 -3.638  1.00 0.00 ? 146 GLU A CG   3  
ATOM 3370  C CD   . GLU A 1 62 ? -5.410  -12.922 -2.666  1.00 0.00 ? 146 GLU A CD   3  
ATOM 3371  O OE1  . GLU A 1 62 ? -5.213  -13.642 -1.663  1.00 0.00 ? 146 GLU A OE1  3  
ATOM 3372  O OE2  . GLU A 1 62 ? -6.512  -12.383 -2.900  1.00 0.00 ? 146 GLU A OE2  3  
ATOM 3373  H H    . GLU A 1 62 ? -0.891  -10.962 -2.305  1.00 0.00 ? 146 GLU A H    3  
ATOM 3374  H HA   . GLU A 1 62 ? -1.656  -12.606 -4.436  1.00 0.00 ? 146 GLU A HA   3  
ATOM 3375  H HB2  . GLU A 1 62 ? -2.743  -12.501 -2.180  1.00 0.00 ? 146 GLU A HB2  3  
ATOM 3376  H HB3  . GLU A 1 62 ? -3.487  -10.983 -2.660  1.00 0.00 ? 146 GLU A HB3  3  
ATOM 3377  H HG2  . GLU A 1 62 ? -4.646  -12.133 -4.482  1.00 0.00 ? 146 GLU A HG2  3  
ATOM 3378  H HG3  . GLU A 1 62 ? -3.912  -13.655 -3.978  1.00 0.00 ? 146 GLU A HG3  3  
ATOM 3379  N N    . TYR A 1 63 ? -2.400  -9.423  -4.796  1.00 0.00 ? 147 TYR A N    3  
ATOM 3380  C CA   . TYR A 1 63 ? -2.833  -8.411  -5.751  1.00 0.00 ? 147 TYR A CA   3  
ATOM 3381  C C    . TYR A 1 63 ? -1.641  -7.705  -6.400  1.00 0.00 ? 147 TYR A C    3  
ATOM 3382  O O    . TYR A 1 63 ? -1.710  -7.276  -7.550  1.00 0.00 ? 147 TYR A O    3  
ATOM 3383  C CB   . TYR A 1 63 ? -3.737  -7.396  -5.050  1.00 0.00 ? 147 TYR A CB   3  
ATOM 3384  C CG   . TYR A 1 63 ? -4.831  -8.051  -4.238  1.00 0.00 ? 147 TYR A CG   3  
ATOM 3385  C CD1  . TYR A 1 63 ? -5.897  -8.686  -4.860  1.00 0.00 ? 147 TYR A CD1  3  
ATOM 3386  C CD2  . TYR A 1 63 ? -4.781  -8.059  -2.850  1.00 0.00 ? 147 TYR A CD2  3  
ATOM 3387  C CE1  . TYR A 1 63 ? -6.883  -9.309  -4.123  1.00 0.00 ? 147 TYR A CE1  3  
ATOM 3388  C CE2  . TYR A 1 63 ? -5.766  -8.677  -2.105  1.00 0.00 ? 147 TYR A CE2  3  
ATOM 3389  C CZ   . TYR A 1 63 ? -6.813  -9.303  -2.746  1.00 0.00 ? 147 TYR A CZ   3  
ATOM 3390  O OH   . TYR A 1 63 ? -7.788  -9.933  -2.011  1.00 0.00 ? 147 TYR A OH   3  
ATOM 3391  H H    . TYR A 1 63 ? -2.095  -9.142  -3.907  1.00 0.00 ? 147 TYR A H    3  
ATOM 3392  H HA   . TYR A 1 63 ? -3.401  -8.908  -6.522  1.00 0.00 ? 147 TYR A HA   3  
ATOM 3393  H HB2  . TYR A 1 63 ? -3.144  -6.789  -4.383  1.00 0.00 ? 147 TYR A HB2  3  
ATOM 3394  H HB3  . TYR A 1 63 ? -4.204  -6.761  -5.790  1.00 0.00 ? 147 TYR A HB3  3  
ATOM 3395  H HD1  . TYR A 1 63 ? -5.952  -8.687  -5.940  1.00 0.00 ? 147 TYR A HD1  3  
ATOM 3396  H HD2  . TYR A 1 63 ? -3.961  -7.564  -2.351  1.00 0.00 ? 147 TYR A HD2  3  
ATOM 3397  H HE1  . TYR A 1 63 ? -7.707  -9.798  -4.626  1.00 0.00 ? 147 TYR A HE1  3  
ATOM 3398  H HE2  . TYR A 1 63 ? -5.710  -8.671  -1.027  1.00 0.00 ? 147 TYR A HE2  3  
ATOM 3399  H HH   . TYR A 1 63 ? -7.767  -10.880 -2.212  1.00 0.00 ? 147 TYR A HH   3  
ATOM 3400  N N    . GLY A 1 64 ? -0.550  -7.609  -5.656  1.00 0.00 ? 148 GLY A N    3  
ATOM 3401  C CA   . GLY A 1 64 ? 0.596   -6.826  -6.085  1.00 0.00 ? 148 GLY A CA   3  
ATOM 3402  C C    . GLY A 1 64 ? 1.703   -7.658  -6.706  1.00 0.00 ? 148 GLY A C    3  
ATOM 3403  O O    . GLY A 1 64 ? 2.784   -7.139  -6.967  1.00 0.00 ? 148 GLY A O    3  
ATOM 3404  H H    . GLY A 1 64 ? -0.519  -8.070  -4.789  1.00 0.00 ? 148 GLY A H    3  
ATOM 3405  H HA2  . GLY A 1 64 ? 0.262   -6.098  -6.810  1.00 0.00 ? 148 GLY A HA2  3  
ATOM 3406  H HA3  . GLY A 1 64 ? 0.998   -6.302  -5.230  1.00 0.00 ? 148 GLY A HA3  3  
ATOM 3407  N N    . LEU A 1 65 ? 1.439   -8.951  -6.907  1.00 0.00 ? 149 LEU A N    3  
ATOM 3408  C CA   . LEU A 1 65 ? 2.394   -9.894  -7.518  1.00 0.00 ? 149 LEU A CA   3  
ATOM 3409  C C    . LEU A 1 65 ? 3.155   -9.294  -8.708  1.00 0.00 ? 149 LEU A C    3  
ATOM 3410  O O    . LEU A 1 65 ? 4.299   -9.665  -8.976  1.00 0.00 ? 149 LEU A O    3  
ATOM 3411  C CB   . LEU A 1 65 ? 1.669   -11.169 -7.983  1.00 0.00 ? 149 LEU A CB   3  
ATOM 3412  C CG   . LEU A 1 65 ? 0.763   -11.024 -9.218  1.00 0.00 ? 149 LEU A CG   3  
ATOM 3413  C CD1  . LEU A 1 65 ? 0.327   -12.393 -9.711  1.00 0.00 ? 149 LEU A CD1  3  
ATOM 3414  C CD2  . LEU A 1 65 ? -0.460  -10.165 -8.916  1.00 0.00 ? 149 LEU A CD2  3  
ATOM 3415  H H    . LEU A 1 65 ? 0.569   -9.299  -6.619  1.00 0.00 ? 149 LEU A H    3  
ATOM 3416  H HA   . LEU A 1 65 ? 3.110   -10.166 -6.760  1.00 0.00 ? 149 LEU A HA   3  
ATOM 3417  H HB2  . LEU A 1 65 ? 2.417   -11.918 -8.200  1.00 0.00 ? 149 LEU A HB2  3  
ATOM 3418  H HB3  . LEU A 1 65 ? 1.064   -11.523 -7.163  1.00 0.00 ? 149 LEU A HB3  3  
ATOM 3419  H HG   . LEU A 1 65 ? 1.321   -10.546 -10.011 1.00 0.00 ? 149 LEU A HG   3  
ATOM 3420  H HD11 . LEU A 1 65 ? -0.218  -12.903 -8.928  1.00 0.00 ? 149 LEU A HD11 3  
ATOM 3421  H HD12 . LEU A 1 65 ? 1.198   -12.973 -9.980  1.00 0.00 ? 149 LEU A HD12 3  
ATOM 3422  H HD13 . LEU A 1 65 ? -0.311  -12.278 -10.575 1.00 0.00 ? 149 LEU A HD13 3  
ATOM 3423  H HD21 . LEU A 1 65 ? -0.142  -9.179  -8.607  1.00 0.00 ? 149 LEU A HD21 3  
ATOM 3424  H HD22 . LEU A 1 65 ? -1.036  -10.623 -8.127  1.00 0.00 ? 149 LEU A HD22 3  
ATOM 3425  H HD23 . LEU A 1 65 ? -1.069  -10.084 -9.805  1.00 0.00 ? 149 LEU A HD23 3  
ATOM 3426  N N    . LYS A 1 66 ? 2.511   -8.388  -9.426  1.00 0.00 ? 150 LYS A N    3  
ATOM 3427  C CA   . LYS A 1 66 ? 3.145   -7.712  -10.545 1.00 0.00 ? 150 LYS A CA   3  
ATOM 3428  C C    . LYS A 1 66 ? 3.782   -6.401  -10.081 1.00 0.00 ? 150 LYS A C    3  
ATOM 3429  O O    . LYS A 1 66 ? 3.122   -5.570  -9.462  1.00 0.00 ? 150 LYS A O    3  
ATOM 3430  C CB   . LYS A 1 66 ? 2.113   -7.457  -11.653 1.00 0.00 ? 150 LYS A CB   3  
ATOM 3431  C CG   . LYS A 1 66 ? 0.897   -6.671  -11.190 1.00 0.00 ? 150 LYS A CG   3  
ATOM 3432  C CD   . LYS A 1 66 ? -0.272  -6.824  -12.148 1.00 0.00 ? 150 LYS A CD   3  
ATOM 3433  C CE   . LYS A 1 66 ? -1.485  -6.044  -11.666 1.00 0.00 ? 150 LYS A CE   3  
ATOM 3434  N NZ   . LYS A 1 66 ? -2.711  -6.381  -12.438 1.00 0.00 ? 150 LYS A NZ   3  
ATOM 3435  H H    . LYS A 1 66 ? 1.593   -8.154  -9.184  1.00 0.00 ? 150 LYS A H    3  
ATOM 3436  H HA   . LYS A 1 66 ? 3.920   -8.361  -10.928 1.00 0.00 ? 150 LYS A HA   3  
ATOM 3437  H HB2  . LYS A 1 66 ? 2.588   -6.905  -12.450 1.00 0.00 ? 150 LYS A HB2  3  
ATOM 3438  H HB3  . LYS A 1 66 ? 1.774   -8.407  -12.038 1.00 0.00 ? 150 LYS A HB3  3  
ATOM 3439  H HG2  . LYS A 1 66 ? 0.599   -7.028  -10.215 1.00 0.00 ? 150 LYS A HG2  3  
ATOM 3440  H HG3  . LYS A 1 66 ? 1.163   -5.625  -11.126 1.00 0.00 ? 150 LYS A HG3  3  
ATOM 3441  H HD2  . LYS A 1 66 ? 0.019   -6.454  -13.120 1.00 0.00 ? 150 LYS A HD2  3  
ATOM 3442  H HD3  . LYS A 1 66 ? -0.531  -7.870  -12.221 1.00 0.00 ? 150 LYS A HD3  3  
ATOM 3443  H HE2  . LYS A 1 66 ? -1.654  -6.276  -10.625 1.00 0.00 ? 150 LYS A HE2  3  
ATOM 3444  H HE3  . LYS A 1 66 ? -1.282  -4.988  -11.770 1.00 0.00 ? 150 LYS A HE3  3  
ATOM 3445  H HZ1  . LYS A 1 66 ? -2.976  -7.374  -12.270 1.00 0.00 ? 150 LYS A HZ1  3  
ATOM 3446  H HZ2  . LYS A 1 66 ? -2.542  -6.250  -13.457 1.00 0.00 ? 150 LYS A HZ2  3  
ATOM 3447  H HZ3  . LYS A 1 66 ? -3.505  -5.769  -12.142 1.00 0.00 ? 150 LYS A HZ3  3  
ATOM 3448  N N    . PRO A 1 67 ? 5.080   -6.198  -10.368 1.00 0.00 ? 151 PRO A N    3  
ATOM 3449  C CA   . PRO A 1 67 ? 5.807   -4.978  -9.974  1.00 0.00 ? 151 PRO A CA   3  
ATOM 3450  C C    . PRO A 1 67 ? 5.327   -3.731  -10.720 1.00 0.00 ? 151 PRO A C    3  
ATOM 3451  O O    . PRO A 1 67 ? 5.916   -2.655  -10.606 1.00 0.00 ? 151 PRO A O    3  
ATOM 3452  C CB   . PRO A 1 67 ? 7.260   -5.295  -10.335 1.00 0.00 ? 151 PRO A CB   3  
ATOM 3453  C CG   . PRO A 1 67 ? 7.174   -6.339  -11.394 1.00 0.00 ? 151 PRO A CG   3  
ATOM 3454  C CD   . PRO A 1 67 ? 5.952   -7.152  -11.074 1.00 0.00 ? 151 PRO A CD   3  
ATOM 3455  H HA   . PRO A 1 67 ? 5.730   -4.805  -8.910  1.00 0.00 ? 151 PRO A HA   3  
ATOM 3456  H HB2  . PRO A 1 67 ? 7.746   -4.402  -10.699 1.00 0.00 ? 151 PRO A HB2  3  
ATOM 3457  H HB3  . PRO A 1 67 ? 7.779   -5.663  -9.462  1.00 0.00 ? 151 PRO A HB3  3  
ATOM 3458  H HG2  . PRO A 1 67 ? 7.074   -5.872  -12.363 1.00 0.00 ? 151 PRO A HG2  3  
ATOM 3459  H HG3  . PRO A 1 67 ? 8.057   -6.961  -11.367 1.00 0.00 ? 151 PRO A HG3  3  
ATOM 3460  H HD2  . PRO A 1 67 ? 5.483   -7.504  -11.981 1.00 0.00 ? 151 PRO A HD2  3  
ATOM 3461  H HD3  . PRO A 1 67 ? 6.210   -7.984  -10.433 1.00 0.00 ? 151 PRO A HD3  3  
ATOM 3462  N N    . LEU A 1 68 ? 4.266   -3.890  -11.495 1.00 0.00 ? 152 LEU A N    3  
ATOM 3463  C CA   . LEU A 1 68 ? 3.644   -2.779  -12.196 1.00 0.00 ? 152 LEU A CA   3  
ATOM 3464  C C    . LEU A 1 68 ? 2.262   -2.505  -11.618 1.00 0.00 ? 152 LEU A C    3  
ATOM 3465  O O    . LEU A 1 68 ? 1.497   -1.702  -12.158 1.00 0.00 ? 152 LEU A O    3  
ATOM 3466  C CB   . LEU A 1 68 ? 3.534   -3.083  -13.692 1.00 0.00 ? 152 LEU A CB   3  
ATOM 3467  C CG   . LEU A 1 68 ? 4.866   -3.266  -14.423 1.00 0.00 ? 152 LEU A CG   3  
ATOM 3468  C CD1  . LEU A 1 68 ? 4.627   -3.649  -15.875 1.00 0.00 ? 152 LEU A CD1  3  
ATOM 3469  C CD2  . LEU A 1 68 ? 5.699   -1.995  -14.334 1.00 0.00 ? 152 LEU A CD2  3  
ATOM 3470  H H    . LEU A 1 68 ? 3.888   -4.787  -11.597 1.00 0.00 ? 152 LEU A H    3  
ATOM 3471  H HA   . LEU A 1 68 ? 4.263   -1.906  -12.056 1.00 0.00 ? 152 LEU A HA   3  
ATOM 3472  H HB2  . LEU A 1 68 ? 2.954   -3.987  -13.811 1.00 0.00 ? 152 LEU A HB2  3  
ATOM 3473  H HB3  . LEU A 1 68 ? 3.001   -2.271  -14.163 1.00 0.00 ? 152 LEU A HB3  3  
ATOM 3474  H HG   . LEU A 1 68 ? 5.421   -4.066  -13.953 1.00 0.00 ? 152 LEU A HG   3  
ATOM 3475  H HD11 . LEU A 1 68 ? 4.072   -4.574  -15.914 1.00 0.00 ? 152 LEU A HD11 3  
ATOM 3476  H HD12 . LEU A 1 68 ? 5.576   -3.777  -16.374 1.00 0.00 ? 152 LEU A HD12 3  
ATOM 3477  H HD13 . LEU A 1 68 ? 4.064   -2.869  -16.365 1.00 0.00 ? 152 LEU A HD13 3  
ATOM 3478  H HD21 . LEU A 1 68 ? 5.888   -1.759  -13.297 1.00 0.00 ? 152 LEU A HD21 3  
ATOM 3479  H HD22 . LEU A 1 68 ? 5.165   -1.179  -14.797 1.00 0.00 ? 152 LEU A HD22 3  
ATOM 3480  H HD23 . LEU A 1 68 ? 6.639   -2.145  -14.844 1.00 0.00 ? 152 LEU A HD23 3  
ATOM 3481  N N    . SER A 1 69 ? 1.946   -3.190  -10.523 1.00 0.00 ? 153 SER A N    3  
ATOM 3482  C CA   . SER A 1 69 ? 0.670   -3.007  -9.850  1.00 0.00 ? 153 SER A CA   3  
ATOM 3483  C C    . SER A 1 69 ? 0.550   -1.573  -9.343  1.00 0.00 ? 153 SER A C    3  
ATOM 3484  O O    . SER A 1 69 ? 1.353   -1.118  -8.530  1.00 0.00 ? 153 SER A O    3  
ATOM 3485  C CB   . SER A 1 69 ? 0.530   -4.019  -8.704  1.00 0.00 ? 153 SER A CB   3  
ATOM 3486  O OG   . SER A 1 69 ? 1.669   -4.005  -7.864  1.00 0.00 ? 153 SER A OG   3  
ATOM 3487  H H    . SER A 1 69 ? 2.592   -3.831  -10.152 1.00 0.00 ? 153 SER A H    3  
ATOM 3488  H HA   . SER A 1 69 ? -0.114  -3.185  -10.571 1.00 0.00 ? 153 SER A HA   3  
ATOM 3489  H HB2  . SER A 1 69 ? -0.341  -3.781  -8.114  1.00 0.00 ? 153 SER A HB2  3  
ATOM 3490  H HB3  . SER A 1 69 ? 0.419   -5.009  -9.119  1.00 0.00 ? 153 SER A HB3  3  
ATOM 3491  H HG   . SER A 1 69 ? 2.304   -4.663  -8.174  1.00 0.00 ? 153 SER A HG   3  
ATOM 3492  N N    . THR A 1 70 ? -0.440  -0.857  -9.854  1.00 0.00 ? 154 THR A N    3  
ATOM 3493  C CA   . THR A 1 70 ? -0.599  0.548   -9.535  1.00 0.00 ? 154 THR A CA   3  
ATOM 3494  C C    . THR A 1 70 ? -1.692  0.762   -8.495  1.00 0.00 ? 154 THR A C    3  
ATOM 3495  O O    . THR A 1 70 ? -2.882  0.631   -8.789  1.00 0.00 ? 154 THR A O    3  
ATOM 3496  C CB   . THR A 1 70 ? -0.920  1.363   -10.800 1.00 0.00 ? 154 THR A CB   3  
ATOM 3497  O OG1  . THR A 1 70 ? -0.002  1.011   -11.847 1.00 0.00 ? 154 THR A OG1  3  
ATOM 3498  C CG2  . THR A 1 70 ? -0.828  2.858   -10.525 1.00 0.00 ? 154 THR A CG2  3  
ATOM 3499  H H    . THR A 1 70 ? -1.084  -1.286  -10.459 1.00 0.00 ? 154 THR A H    3  
ATOM 3500  H HA   . THR A 1 70 ? 0.339   0.905   -9.132  1.00 0.00 ? 154 THR A HA   3  
ATOM 3501  H HB   . THR A 1 70 ? -1.925  1.130   -11.120 1.00 0.00 ? 154 THR A HB   3  
ATOM 3502  H HG1  . THR A 1 70 ? 0.364   0.131   -11.671 1.00 0.00 ? 154 THR A HG1  3  
ATOM 3503  H HG21 . THR A 1 70 ? -1.516  3.118   -9.737  1.00 0.00 ? 154 THR A HG21 3  
ATOM 3504  H HG22 . THR A 1 70 ? -1.081  3.405   -11.421 1.00 0.00 ? 154 THR A HG22 3  
ATOM 3505  H HG23 . THR A 1 70 ? 0.179   3.108   -10.223 1.00 0.00 ? 154 THR A HG23 3  
ATOM 3506  N N    . VAL A 1 71 ? -1.276  1.078   -7.279  1.00 0.00 ? 155 VAL A N    3  
ATOM 3507  C CA   . VAL A 1 71 ? -2.203  1.356   -6.192  1.00 0.00 ? 155 VAL A CA   3  
ATOM 3508  C C    . VAL A 1 71 ? -2.351  2.864   -6.025  1.00 0.00 ? 155 VAL A C    3  
ATOM 3509  O O    . VAL A 1 71 ? -1.377  3.603   -6.146  1.00 0.00 ? 155 VAL A O    3  
ATOM 3510  C CB   . VAL A 1 71 ? -1.721  0.738   -4.863  1.00 0.00 ? 155 VAL A CB   3  
ATOM 3511  C CG1  . VAL A 1 71 ? -2.777  0.895   -3.775  1.00 0.00 ? 155 VAL A CG1  3  
ATOM 3512  C CG2  . VAL A 1 71 ? -1.348  -0.725  -5.053  1.00 0.00 ? 155 VAL A CG2  3  
ATOM 3513  H H    . VAL A 1 71 ? -0.309  1.138   -7.110  1.00 0.00 ? 155 VAL A H    3  
ATOM 3514  H HA   . VAL A 1 71 ? -3.165  0.932   -6.443  1.00 0.00 ? 155 VAL A HA   3  
ATOM 3515  H HB   . VAL A 1 71 ? -0.837  1.273   -4.545  1.00 0.00 ? 155 VAL A HB   3  
ATOM 3516  H HG11 . VAL A 1 71 ? -2.959  1.944   -3.599  1.00 0.00 ? 155 VAL A HG11 3  
ATOM 3517  H HG12 . VAL A 1 71 ? -2.431  0.431   -2.864  1.00 0.00 ? 155 VAL A HG12 3  
ATOM 3518  H HG13 . VAL A 1 71 ? -3.695  0.421   -4.094  1.00 0.00 ? 155 VAL A HG13 3  
ATOM 3519  H HG21 . VAL A 1 71 ? -2.215  -1.277  -5.385  1.00 0.00 ? 155 VAL A HG21 3  
ATOM 3520  H HG22 . VAL A 1 71 ? -0.999  -1.135  -4.116  1.00 0.00 ? 155 VAL A HG22 3  
ATOM 3521  H HG23 . VAL A 1 71 ? -0.566  -0.804  -5.793  1.00 0.00 ? 155 VAL A HG23 3  
ATOM 3522  N N    . PHE A 1 72 ? -3.565  3.317   -5.769  1.00 0.00 ? 156 PHE A N    3  
ATOM 3523  C CA   . PHE A 1 72 ? -3.825  4.737   -5.602  1.00 0.00 ? 156 PHE A CA   3  
ATOM 3524  C C    . PHE A 1 72 ? -4.152  5.050   -4.149  1.00 0.00 ? 156 PHE A C    3  
ATOM 3525  O O    . PHE A 1 72 ? -5.126  4.529   -3.601  1.00 0.00 ? 156 PHE A O    3  
ATOM 3526  C CB   . PHE A 1 72 ? -4.988  5.176   -6.498  1.00 0.00 ? 156 PHE A CB   3  
ATOM 3527  C CG   . PHE A 1 72 ? -4.792  4.845   -7.952  1.00 0.00 ? 156 PHE A CG   3  
ATOM 3528  C CD1  . PHE A 1 72 ? -3.992  5.639   -8.755  1.00 0.00 ? 156 PHE A CD1  3  
ATOM 3529  C CD2  . PHE A 1 72 ? -5.406  3.735   -8.512  1.00 0.00 ? 156 PHE A CD2  3  
ATOM 3530  C CE1  . PHE A 1 72 ? -3.812  5.339   -10.092 1.00 0.00 ? 156 PHE A CE1  3  
ATOM 3531  C CE2  . PHE A 1 72 ? -5.231  3.429   -9.848  1.00 0.00 ? 156 PHE A CE2  3  
ATOM 3532  C CZ   . PHE A 1 72 ? -4.430  4.231   -10.639 1.00 0.00 ? 156 PHE A CZ   3  
ATOM 3533  H H    . PHE A 1 72 ? -4.310  2.679   -5.688  1.00 0.00 ? 156 PHE A H    3  
ATOM 3534  H HA   . PHE A 1 72 ? -2.934  5.276   -5.887  1.00 0.00 ? 156 PHE A HA   3  
ATOM 3535  H HB2  . PHE A 1 72 ? -5.892  4.689   -6.168  1.00 0.00 ? 156 PHE A HB2  3  
ATOM 3536  H HB3  . PHE A 1 72 ? -5.111  6.246   -6.416  1.00 0.00 ? 156 PHE A HB3  3  
ATOM 3537  H HD1  . PHE A 1 72 ? -3.507  6.506   -8.330  1.00 0.00 ? 156 PHE A HD1  3  
ATOM 3538  H HD2  . PHE A 1 72 ? -6.033  3.107   -7.894  1.00 0.00 ? 156 PHE A HD2  3  
ATOM 3539  H HE1  . PHE A 1 72 ? -3.186  5.968   -10.707 1.00 0.00 ? 156 PHE A HE1  3  
ATOM 3540  H HE2  . PHE A 1 72 ? -5.717  2.563   -10.272 1.00 0.00 ? 156 PHE A HE2  3  
ATOM 3541  H HZ   . PHE A 1 72 ? -4.291  3.995   -11.683 1.00 0.00 ? 156 PHE A HZ   3  
ATOM 3542  N N    . MET A 1 73 ? -3.328  5.879   -3.519  1.00 0.00 ? 157 MET A N    3  
ATOM 3543  C CA   . MET A 1 73 ? -3.599  6.329   -2.164  1.00 0.00 ? 157 MET A CA   3  
ATOM 3544  C C    . MET A 1 73 ? -4.597  7.476   -2.209  1.00 0.00 ? 157 MET A C    3  
ATOM 3545  O O    . MET A 1 73 ? -4.263  8.594   -2.601  1.00 0.00 ? 157 MET A O    3  
ATOM 3546  C CB   . MET A 1 73 ? -2.313  6.770   -1.460  1.00 0.00 ? 157 MET A CB   3  
ATOM 3547  C CG   . MET A 1 73 ? -2.527  7.140   -0.002  1.00 0.00 ? 157 MET A CG   3  
ATOM 3548  S SD   . MET A 1 73 ? -1.970  8.812   0.387   1.00 0.00 ? 157 MET A SD   3  
ATOM 3549  C CE   . MET A 1 73 ? -0.200  8.633   0.198   1.00 0.00 ? 157 MET A CE   3  
ATOM 3550  H H    . MET A 1 73 ? -2.521  6.204   -3.980  1.00 0.00 ? 157 MET A H    3  
ATOM 3551  H HA   . MET A 1 73 ? -4.038  5.505   -1.622  1.00 0.00 ? 157 MET A HA   3  
ATOM 3552  H HB2  . MET A 1 73 ? -1.597  5.964   -1.504  1.00 0.00 ? 157 MET A HB2  3  
ATOM 3553  H HB3  . MET A 1 73 ? -1.911  7.631   -1.971  1.00 0.00 ? 157 MET A HB3  3  
ATOM 3554  H HG2  . MET A 1 73 ? -3.578  7.060   0.226   1.00 0.00 ? 157 MET A HG2  3  
ATOM 3555  H HG3  . MET A 1 73 ? -1.976  6.443   0.613   1.00 0.00 ? 157 MET A HG3  3  
ATOM 3556  H HE1  . MET A 1 73 ? 0.025   8.322   -0.812  1.00 0.00 ? 157 MET A HE1  3  
ATOM 3557  H HE2  . MET A 1 73 ? 0.164   7.891   0.894   1.00 0.00 ? 157 MET A HE2  3  
ATOM 3558  H HE3  . MET A 1 73 ? 0.281   9.579   0.398   1.00 0.00 ? 157 MET A HE3  3  
ATOM 3559  N N    . ASN A 1 74 ? -5.820  7.187   -1.815  1.00 0.00 ? 158 ASN A N    3  
ATOM 3560  C CA   . ASN A 1 74 ? -6.915  8.126   -1.962  1.00 0.00 ? 158 ASN A CA   3  
ATOM 3561  C C    . ASN A 1 74 ? -7.193  8.873   -0.669  1.00 0.00 ? 158 ASN A C    3  
ATOM 3562  O O    . ASN A 1 74 ? -7.226  8.284   0.413   1.00 0.00 ? 158 ASN A O    3  
ATOM 3563  C CB   . ASN A 1 74 ? -8.177  7.389   -2.418  1.00 0.00 ? 158 ASN A CB   3  
ATOM 3564  C CG   . ASN A 1 74 ? -8.205  7.126   -3.914  1.00 0.00 ? 158 ASN A CG   3  
ATOM 3565  O OD1  . ASN A 1 74 ? -7.680  7.907   -4.709  1.00 0.00 ? 158 ASN A OD1  3  
ATOM 3566  N ND2  . ASN A 1 74 ? -8.829  6.028   -4.309  1.00 0.00 ? 158 ASN A ND2  3  
ATOM 3567  H H    . ASN A 1 74 ? -5.994  6.317   -1.394  1.00 0.00 ? 158 ASN A H    3  
ATOM 3568  H HA   . ASN A 1 74 ? -6.638  8.839   -2.722  1.00 0.00 ? 158 ASN A HA   3  
ATOM 3569  H HB2  . ASN A 1 74 ? -8.228  6.437   -1.909  1.00 0.00 ? 158 ASN A HB2  3  
ATOM 3570  H HB3  . ASN A 1 74 ? -9.041  7.975   -2.156  1.00 0.00 ? 158 ASN A HB3  3  
ATOM 3571  H HD21 . ASN A 1 74 ? -9.234  5.454   -3.627  1.00 0.00 ? 158 ASN A HD21 3  
ATOM 3572  H HD22 . ASN A 1 74 ? -8.859  5.831   -5.269  1.00 0.00 ? 158 ASN A HD22 3  
ATOM 3573  N N    . LEU A 1 75 ? -7.376  10.178  -0.795  1.00 0.00 ? 159 LEU A N    3  
ATOM 3574  C CA   . LEU A 1 75 ? -7.782  11.011  0.325   1.00 0.00 ? 159 LEU A CA   3  
ATOM 3575  C C    . LEU A 1 75 ? -9.264  11.342  0.206   1.00 0.00 ? 159 LEU A C    3  
ATOM 3576  O O    . LEU A 1 75 ? -9.974  10.743  -0.608  1.00 0.00 ? 159 LEU A O    3  
ATOM 3577  C CB   . LEU A 1 75 ? -6.975  12.315  0.365   1.00 0.00 ? 159 LEU A CB   3  
ATOM 3578  C CG   . LEU A 1 75 ? -5.504  12.181  0.764   1.00 0.00 ? 159 LEU A CG   3  
ATOM 3579  C CD1  . LEU A 1 75 ? -4.852  13.552  0.817   1.00 0.00 ? 159 LEU A CD1  3  
ATOM 3580  C CD2  . LEU A 1 75 ? -5.375  11.487  2.109   1.00 0.00 ? 159 LEU A CD2  3  
ATOM 3581  H H    . LEU A 1 75 ? -7.242  10.592  -1.674  1.00 0.00 ? 159 LEU A H    3  
ATOM 3582  H HA   . LEU A 1 75 ? -7.616  10.458  1.237   1.00 0.00 ? 159 LEU A HA   3  
ATOM 3583  H HB2  . LEU A 1 75 ? -7.016  12.765  -0.615  1.00 0.00 ? 159 LEU A HB2  3  
ATOM 3584  H HB3  . LEU A 1 75 ? -7.450  12.983  1.066   1.00 0.00 ? 159 LEU A HB3  3  
ATOM 3585  H HG   . LEU A 1 75 ? -4.986  11.587  0.025   1.00 0.00 ? 159 LEU A HG   3  
ATOM 3586  H HD11 . LEU A 1 75 ? -3.820  13.448  1.114   1.00 0.00 ? 159 LEU A HD11 3  
ATOM 3587  H HD12 . LEU A 1 75 ? -5.373  14.172  1.532   1.00 0.00 ? 159 LEU A HD12 3  
ATOM 3588  H HD13 . LEU A 1 75 ? -4.900  14.012  -0.160  1.00 0.00 ? 159 LEU A HD13 3  
ATOM 3589  H HD21 . LEU A 1 75 ? -4.330  11.375  2.358   1.00 0.00 ? 159 LEU A HD21 3  
ATOM 3590  H HD22 . LEU A 1 75 ? -5.839  10.513  2.058   1.00 0.00 ? 159 LEU A HD22 3  
ATOM 3591  H HD23 . LEU A 1 75 ? -5.863  12.079  2.868   1.00 0.00 ? 159 LEU A HD23 3  
ATOM 3592  N N    . ARG A 1 76 ? -9.709  12.301  1.019   1.00 0.00 ? 160 ARG A N    3  
ATOM 3593  C CA   . ARG A 1 76 ? -11.073 12.837  0.969   1.00 0.00 ? 160 ARG A CA   3  
ATOM 3594  C C    . ARG A 1 76 ? -12.070 11.905  1.641   1.00 0.00 ? 160 ARG A C    3  
ATOM 3595  O O    . ARG A 1 76 ? -12.120 10.707  1.373   1.00 0.00 ? 160 ARG A O    3  
ATOM 3596  C CB   . ARG A 1 76 ? -11.509 13.141  -0.467  1.00 0.00 ? 160 ARG A CB   3  
ATOM 3597  C CG   . ARG A 1 76 ? -10.596 14.124  -1.176  1.00 0.00 ? 160 ARG A CG   3  
ATOM 3598  C CD   . ARG A 1 76 ? -11.065 14.401  -2.591  1.00 0.00 ? 160 ARG A CD   3  
ATOM 3599  N NE   . ARG A 1 76 ? -10.164 15.312  -3.294  1.00 0.00 ? 160 ARG A NE   3  
ATOM 3600  C CZ   . ARG A 1 76 ? -10.561 16.206  -4.196  1.00 0.00 ? 160 ARG A CZ   3  
ATOM 3601  N NH1  . ARG A 1 76 ? -11.836 16.268  -4.558  1.00 0.00 ? 160 ARG A NH1  3  
ATOM 3602  N NH2  . ARG A 1 76 ? -9.675  17.022  -4.754  1.00 0.00 ? 160 ARG A NH2  3  
ATOM 3603  H H    . ARG A 1 76 ? -9.097  12.654  1.695   1.00 0.00 ? 160 ARG A H    3  
ATOM 3604  H HA   . ARG A 1 76 ? -11.065 13.765  1.522   1.00 0.00 ? 160 ARG A HA   3  
ATOM 3605  H HB2  . ARG A 1 76 ? -11.517 12.220  -1.031  1.00 0.00 ? 160 ARG A HB2  3  
ATOM 3606  H HB3  . ARG A 1 76 ? -12.506 13.555  -0.449  1.00 0.00 ? 160 ARG A HB3  3  
ATOM 3607  H HG2  . ARG A 1 76 ? -10.583 15.052  -0.625  1.00 0.00 ? 160 ARG A HG2  3  
ATOM 3608  H HG3  . ARG A 1 76 ? -9.598  13.711  -1.210  1.00 0.00 ? 160 ARG A HG3  3  
ATOM 3609  H HD2  . ARG A 1 76 ? -11.114 13.465  -3.128  1.00 0.00 ? 160 ARG A HD2  3  
ATOM 3610  H HD3  . ARG A 1 76 ? -12.049 14.841  -2.546  1.00 0.00 ? 160 ARG A HD3  3  
ATOM 3611  H HE   . ARG A 1 76 ? -9.202  15.259  -3.070  1.00 0.00 ? 160 ARG A HE   3  
ATOM 3612  H HH11 . ARG A 1 76 ? -12.508 15.637  -4.157  1.00 0.00 ? 160 ARG A HH11 3  
ATOM 3613  H HH12 . ARG A 1 76 ? -12.138 16.958  -5.235  1.00 0.00 ? 160 ARG A HH12 3  
ATOM 3614  H HH21 . ARG A 1 76 ? -8.705  16.963  -4.500  1.00 0.00 ? 160 ARG A HH21 3  
ATOM 3615  H HH22 . ARG A 1 76 ? -9.974  17.712  -5.423  1.00 0.00 ? 160 ARG A HH22 3  
ATOM 3616  N N    . ASP A 1 2  ? 14.018  -12.777 -0.935  1.00 0.00 ? 86  ASP A N    4  
ATOM 3617  C CA   . ASP A 1 2  ? 14.772  -11.570 -1.291  1.00 0.00 ? 86  ASP A CA   4  
ATOM 3618  C C    . ASP A 1 2  ? 14.170  -10.850 -2.494  1.00 0.00 ? 86  ASP A C    4  
ATOM 3619  O O    . ASP A 1 2  ? 14.861  -10.090 -3.172  1.00 0.00 ? 86  ASP A O    4  
ATOM 3620  C CB   . ASP A 1 2  ? 16.227  -11.920 -1.607  1.00 0.00 ? 86  ASP A CB   4  
ATOM 3621  C CG   . ASP A 1 2  ? 16.956  -12.536 -0.435  1.00 0.00 ? 86  ASP A CG   4  
ATOM 3622  O OD1  . ASP A 1 2  ? 17.368  -11.795 0.480   1.00 0.00 ? 86  ASP A OD1  4  
ATOM 3623  O OD2  . ASP A 1 2  ? 17.139  -13.769 -0.428  1.00 0.00 ? 86  ASP A OD2  4  
ATOM 3624  H H    . ASP A 1 2  ? 14.342  -13.648 -1.252  1.00 0.00 ? 86  ASP A H    4  
ATOM 3625  H HA   . ASP A 1 2  ? 14.750  -10.904 -0.441  1.00 0.00 ? 86  ASP A HA   4  
ATOM 3626  H HB2  . ASP A 1 2  ? 16.249  -12.622 -2.428  1.00 0.00 ? 86  ASP A HB2  4  
ATOM 3627  H HB3  . ASP A 1 2  ? 16.748  -11.021 -1.899  1.00 0.00 ? 86  ASP A HB3  4  
ATOM 3628  N N    . GLU A 1 3  ? 12.893  -11.078 -2.757  1.00 0.00 ? 87  GLU A N    4  
ATOM 3629  C CA   . GLU A 1 3  ? 12.224  -10.434 -3.880  1.00 0.00 ? 87  GLU A CA   4  
ATOM 3630  C C    . GLU A 1 3  ? 11.928  -8.974  -3.555  1.00 0.00 ? 87  GLU A C    4  
ATOM 3631  O O    . GLU A 1 3  ? 11.177  -8.681  -2.625  1.00 0.00 ? 87  GLU A O    4  
ATOM 3632  C CB   . GLU A 1 3  ? 10.910  -11.147 -4.242  1.00 0.00 ? 87  GLU A CB   4  
ATOM 3633  C CG   . GLU A 1 3  ? 11.074  -12.580 -4.733  1.00 0.00 ? 87  GLU A CG   4  
ATOM 3634  C CD   . GLU A 1 3  ? 11.450  -13.537 -3.626  1.00 0.00 ? 87  GLU A CD   4  
ATOM 3635  O OE1  . GLU A 1 3  ? 10.633  -13.741 -2.707  1.00 0.00 ? 87  GLU A OE1  4  
ATOM 3636  O OE2  . GLU A 1 3  ? 12.574  -14.073 -3.650  1.00 0.00 ? 87  GLU A OE2  4  
ATOM 3637  H H    . GLU A 1 3  ? 12.385  -11.683 -2.177  1.00 0.00 ? 87  GLU A H    4  
ATOM 3638  H HA   . GLU A 1 3  ? 12.890  -10.475 -4.728  1.00 0.00 ? 87  GLU A HA   4  
ATOM 3639  H HB2  . GLU A 1 3  ? 10.279  -11.166 -3.366  1.00 0.00 ? 87  GLU A HB2  4  
ATOM 3640  H HB3  . GLU A 1 3  ? 10.416  -10.579 -5.015  1.00 0.00 ? 87  GLU A HB3  4  
ATOM 3641  H HG2  . GLU A 1 3  ? 10.141  -12.908 -5.167  1.00 0.00 ? 87  GLU A HG2  4  
ATOM 3642  H HG3  . GLU A 1 3  ? 11.848  -12.602 -5.488  1.00 0.00 ? 87  GLU A HG3  4  
ATOM 3643  N N    . PRO A 1 4  ? 12.529  -8.040  -4.300  1.00 0.00 ? 88  PRO A N    4  
ATOM 3644  C CA   . PRO A 1 4  ? 12.234  -6.623  -4.157  1.00 0.00 ? 88  PRO A CA   4  
ATOM 3645  C C    . PRO A 1 4  ? 10.979  -6.248  -4.938  1.00 0.00 ? 88  PRO A C    4  
ATOM 3646  O O    . PRO A 1 4  ? 11.048  -5.830  -6.098  1.00 0.00 ? 88  PRO A O    4  
ATOM 3647  C CB   . PRO A 1 4  ? 13.475  -5.948  -4.739  1.00 0.00 ? 88  PRO A CB   4  
ATOM 3648  C CG   . PRO A 1 4  ? 13.987  -6.904  -5.765  1.00 0.00 ? 88  PRO A CG   4  
ATOM 3649  C CD   . PRO A 1 4  ? 13.542  -8.285  -5.344  1.00 0.00 ? 88  PRO A CD   4  
ATOM 3650  H HA   . PRO A 1 4  ? 12.115  -6.343  -3.119  1.00 0.00 ? 88  PRO A HA   4  
ATOM 3651  H HB2  . PRO A 1 4  ? 13.197  -5.002  -5.181  1.00 0.00 ? 88  PRO A HB2  4  
ATOM 3652  H HB3  . PRO A 1 4  ? 14.200  -5.787  -3.956  1.00 0.00 ? 88  PRO A HB3  4  
ATOM 3653  H HG2  . PRO A 1 4  ? 13.568  -6.658  -6.731  1.00 0.00 ? 88  PRO A HG2  4  
ATOM 3654  H HG3  . PRO A 1 4  ? 15.064  -6.856  -5.804  1.00 0.00 ? 88  PRO A HG3  4  
ATOM 3655  H HD2  . PRO A 1 4  ? 13.108  -8.811  -6.184  1.00 0.00 ? 88  PRO A HD2  4  
ATOM 3656  H HD3  . PRO A 1 4  ? 14.377  -8.842  -4.945  1.00 0.00 ? 88  PRO A HD3  4  
ATOM 3657  N N    . LEU A 1 5  ? 9.828   -6.448  -4.314  1.00 0.00 ? 89  LEU A N    4  
ATOM 3658  C CA   . LEU A 1 5  ? 8.564   -6.216  -4.984  1.00 0.00 ? 89  LEU A CA   4  
ATOM 3659  C C    . LEU A 1 5  ? 8.183   -4.747  -4.899  1.00 0.00 ? 89  LEU A C    4  
ATOM 3660  O O    . LEU A 1 5  ? 7.889   -4.224  -3.823  1.00 0.00 ? 89  LEU A O    4  
ATOM 3661  C CB   . LEU A 1 5  ? 7.468   -7.100  -4.387  1.00 0.00 ? 89  LEU A CB   4  
ATOM 3662  C CG   . LEU A 1 5  ? 6.147   -7.100  -5.157  1.00 0.00 ? 89  LEU A CG   4  
ATOM 3663  C CD1  . LEU A 1 5  ? 6.372   -7.509  -6.608  1.00 0.00 ? 89  LEU A CD1  4  
ATOM 3664  C CD2  . LEU A 1 5  ? 5.150   -8.038  -4.494  1.00 0.00 ? 89  LEU A CD2  4  
ATOM 3665  H H    . LEU A 1 5  ? 9.828   -6.747  -3.379  1.00 0.00 ? 89  LEU A H    4  
ATOM 3666  H HA   . LEU A 1 5  ? 8.693   -6.477  -6.026  1.00 0.00 ? 89  LEU A HA   4  
ATOM 3667  H HB2  . LEU A 1 5  ? 7.835   -8.116  -4.344  1.00 0.00 ? 89  LEU A HB2  4  
ATOM 3668  H HB3  . LEU A 1 5  ? 7.269   -6.762  -3.381  1.00 0.00 ? 89  LEU A HB3  4  
ATOM 3669  H HG   . LEU A 1 5  ? 5.730   -6.103  -5.148  1.00 0.00 ? 89  LEU A HG   4  
ATOM 3670  H HD11 . LEU A 1 5  ? 6.778   -8.509  -6.644  1.00 0.00 ? 89  LEU A HD11 4  
ATOM 3671  H HD12 . LEU A 1 5  ? 7.065   -6.822  -7.073  1.00 0.00 ? 89  LEU A HD12 4  
ATOM 3672  H HD13 . LEU A 1 5  ? 5.431   -7.483  -7.141  1.00 0.00 ? 89  LEU A HD13 4  
ATOM 3673  H HD21 . LEU A 1 5  ? 5.561   -9.037  -4.457  1.00 0.00 ? 89  LEU A HD21 4  
ATOM 3674  H HD22 . LEU A 1 5  ? 4.234   -8.051  -5.069  1.00 0.00 ? 89  LEU A HD22 4  
ATOM 3675  H HD23 . LEU A 1 5  ? 4.940   -7.696  -3.492  1.00 0.00 ? 89  LEU A HD23 4  
ATOM 3676  N N    . SER A 1 6  ? 8.232   -4.085  -6.040  1.00 0.00 ? 90  SER A N    4  
ATOM 3677  C CA   . SER A 1 6  ? 7.914   -2.683  -6.130  1.00 0.00 ? 90  SER A CA   4  
ATOM 3678  C C    . SER A 1 6  ? 6.425   -2.474  -6.378  1.00 0.00 ? 90  SER A C    4  
ATOM 3679  O O    . SER A 1 6  ? 5.907   -2.834  -7.435  1.00 0.00 ? 90  SER A O    4  
ATOM 3680  C CB   . SER A 1 6  ? 8.715   -2.069  -7.273  1.00 0.00 ? 90  SER A CB   4  
ATOM 3681  O OG   . SER A 1 6  ? 10.098  -2.347  -7.131  1.00 0.00 ? 90  SER A OG   4  
ATOM 3682  H H    . SER A 1 6  ? 8.509   -4.551  -6.850  1.00 0.00 ? 90  SER A H    4  
ATOM 3683  H HA   . SER A 1 6  ? 8.194   -2.208  -5.204  1.00 0.00 ? 90  SER A HA   4  
ATOM 3684  H HB2  . SER A 1 6  ? 8.372   -2.480  -8.213  1.00 0.00 ? 90  SER A HB2  4  
ATOM 3685  H HB3  . SER A 1 6  ? 8.572   -1.007  -7.273  1.00 0.00 ? 90  SER A HB3  4  
ATOM 3686  H HG   . SER A 1 6  ? 10.383  -2.085  -6.231  1.00 0.00 ? 90  SER A HG   4  
ATOM 3687  N N    . ILE A 1 7  ? 5.735   -1.909  -5.405  1.00 0.00 ? 91  ILE A N    4  
ATOM 3688  C CA   . ILE A 1 7  ? 4.346   -1.530  -5.601  1.00 0.00 ? 91  ILE A CA   4  
ATOM 3689  C C    . ILE A 1 7  ? 4.238   -0.020  -5.710  1.00 0.00 ? 91  ILE A C    4  
ATOM 3690  O O    . ILE A 1 7  ? 4.852   0.719   -4.934  1.00 0.00 ? 91  ILE A O    4  
ATOM 3691  C CB   . ILE A 1 7  ? 3.419   -2.049  -4.480  1.00 0.00 ? 91  ILE A CB   4  
ATOM 3692  C CG1  . ILE A 1 7  ? 3.889   -1.560  -3.106  1.00 0.00 ? 91  ILE A CG1  4  
ATOM 3693  C CG2  . ILE A 1 7  ? 3.353   -3.570  -4.521  1.00 0.00 ? 91  ILE A CG2  4  
ATOM 3694  C CD1  . ILE A 1 7  ? 2.960   -1.947  -1.976  1.00 0.00 ? 91  ILE A CD1  4  
ATOM 3695  H H    . ILE A 1 7  ? 6.168   -1.736  -4.539  1.00 0.00 ? 91  ILE A H    4  
ATOM 3696  H HA   . ILE A 1 7  ? 4.021   -1.966  -6.534  1.00 0.00 ? 91  ILE A HA   4  
ATOM 3697  H HB   . ILE A 1 7  ? 2.426   -1.670  -4.667  1.00 0.00 ? 91  ILE A HB   4  
ATOM 3698  H HG12 . ILE A 1 7  ? 4.861   -1.977  -2.896  1.00 0.00 ? 91  ILE A HG12 4  
ATOM 3699  H HG13 . ILE A 1 7  ? 3.962   -0.480  -3.123  1.00 0.00 ? 91  ILE A HG13 4  
ATOM 3700  H HG21 . ILE A 1 7  ? 2.686   -3.921  -3.748  1.00 0.00 ? 91  ILE A HG21 4  
ATOM 3701  H HG22 . ILE A 1 7  ? 4.339   -3.979  -4.359  1.00 0.00 ? 91  ILE A HG22 4  
ATOM 3702  H HG23 . ILE A 1 7  ? 2.985   -3.888  -5.485  1.00 0.00 ? 91  ILE A HG23 4  
ATOM 3703  H HD11 . ILE A 1 7  ? 3.346   -1.562  -1.042  1.00 0.00 ? 91  ILE A HD11 4  
ATOM 3704  H HD12 . ILE A 1 7  ? 2.890   -3.023  -1.921  1.00 0.00 ? 91  ILE A HD12 4  
ATOM 3705  H HD13 . ILE A 1 7  ? 1.980   -1.530  -2.157  1.00 0.00 ? 91  ILE A HD13 4  
ATOM 3706  N N    . LEU A 1 8  ? 3.476   0.439   -6.681  1.00 0.00 ? 92  LEU A N    4  
ATOM 3707  C CA   . LEU A 1 8  ? 3.388   1.858   -6.952  1.00 0.00 ? 92  LEU A CA   4  
ATOM 3708  C C    . LEU A 1 8  ? 2.217   2.473   -6.205  1.00 0.00 ? 92  LEU A C    4  
ATOM 3709  O O    . LEU A 1 8  ? 1.063   2.335   -6.615  1.00 0.00 ? 92  LEU A O    4  
ATOM 3710  C CB   . LEU A 1 8  ? 3.250   2.114   -8.454  1.00 0.00 ? 92  LEU A CB   4  
ATOM 3711  C CG   . LEU A 1 8  ? 3.379   3.578   -8.868  1.00 0.00 ? 92  LEU A CG   4  
ATOM 3712  C CD1  . LEU A 1 8  ? 4.779   4.090   -8.563  1.00 0.00 ? 92  LEU A CD1  4  
ATOM 3713  C CD2  . LEU A 1 8  ? 3.060   3.744   -10.342 1.00 0.00 ? 92  LEU A CD2  4  
ATOM 3714  H H    . LEU A 1 8  ? 2.949   -0.189  -7.222  1.00 0.00 ? 92  LEU A H    4  
ATOM 3715  H HA   . LEU A 1 8  ? 4.300   2.316   -6.602  1.00 0.00 ? 92  LEU A HA   4  
ATOM 3716  H HB2  . LEU A 1 8  ? 4.016   1.546   -8.965  1.00 0.00 ? 92  LEU A HB2  4  
ATOM 3717  H HB3  . LEU A 1 8  ? 2.285   1.756   -8.773  1.00 0.00 ? 92  LEU A HB3  4  
ATOM 3718  H HG   . LEU A 1 8  ? 2.676   4.171   -8.300  1.00 0.00 ? 92  LEU A HG   4  
ATOM 3719  H HD11 . LEU A 1 8  ? 4.850   5.130   -8.842  1.00 0.00 ? 92  LEU A HD11 4  
ATOM 3720  H HD12 . LEU A 1 8  ? 5.502   3.515   -9.124  1.00 0.00 ? 92  LEU A HD12 4  
ATOM 3721  H HD13 . LEU A 1 8  ? 4.978   3.984   -7.506  1.00 0.00 ? 92  LEU A HD13 4  
ATOM 3722  H HD21 . LEU A 1 8  ? 3.748   3.151   -10.928 1.00 0.00 ? 92  LEU A HD21 4  
ATOM 3723  H HD22 . LEU A 1 8  ? 3.157   4.784   -10.615 1.00 0.00 ? 92  LEU A HD22 4  
ATOM 3724  H HD23 . LEU A 1 8  ? 2.051   3.413   -10.530 1.00 0.00 ? 92  LEU A HD23 4  
ATOM 3725  N N    . VAL A 1 9  ? 2.517   3.133   -5.102  1.00 0.00 ? 93  VAL A N    4  
ATOM 3726  C CA   . VAL A 1 9  ? 1.502   3.817   -4.330  1.00 0.00 ? 93  VAL A CA   4  
ATOM 3727  C C    . VAL A 1 9  ? 1.277   5.199   -4.921  1.00 0.00 ? 93  VAL A C    4  
ATOM 3728  O O    . VAL A 1 9  ? 2.062   6.126   -4.709  1.00 0.00 ? 93  VAL A O    4  
ATOM 3729  C CB   . VAL A 1 9  ? 1.887   3.930   -2.841  1.00 0.00 ? 93  VAL A CB   4  
ATOM 3730  C CG1  . VAL A 1 9  ? 0.769   4.589   -2.045  1.00 0.00 ? 93  VAL A CG1  4  
ATOM 3731  C CG2  . VAL A 1 9  ? 2.213   2.556   -2.272  1.00 0.00 ? 93  VAL A CG2  4  
ATOM 3732  H H    . VAL A 1 9  ? 3.453   3.175   -4.807  1.00 0.00 ? 93  VAL A H    4  
ATOM 3733  H HA   . VAL A 1 9  ? 0.585   3.247   -4.406  1.00 0.00 ? 93  VAL A HA   4  
ATOM 3734  H HB   . VAL A 1 9  ? 2.767   4.548   -2.761  1.00 0.00 ? 93  VAL A HB   4  
ATOM 3735  H HG11 . VAL A 1 9  ? 0.598   5.586   -2.424  1.00 0.00 ? 93  VAL A HG11 4  
ATOM 3736  H HG12 . VAL A 1 9  ? 1.050   4.642   -1.005  1.00 0.00 ? 93  VAL A HG12 4  
ATOM 3737  H HG13 . VAL A 1 9  ? -0.136  4.007   -2.144  1.00 0.00 ? 93  VAL A HG13 4  
ATOM 3738  H HG21 . VAL A 1 9  ? 1.360   1.905   -2.386  1.00 0.00 ? 93  VAL A HG21 4  
ATOM 3739  H HG22 . VAL A 1 9  ? 2.459   2.650   -1.225  1.00 0.00 ? 93  VAL A HG22 4  
ATOM 3740  H HG23 . VAL A 1 9  ? 3.057   2.141   -2.803  1.00 0.00 ? 93  VAL A HG23 4  
ATOM 3741  N N    . ARG A 1 10 ? 0.224   5.313   -5.703  1.00 0.00 ? 94  ARG A N    4  
ATOM 3742  C CA   . ARG A 1 10 ? -0.061  6.534   -6.427  1.00 0.00 ? 94  ARG A CA   4  
ATOM 3743  C C    . ARG A 1 10 ? -1.079  7.363   -5.655  1.00 0.00 ? 94  ARG A C    4  
ATOM 3744  O O    . ARG A 1 10 ? -2.286  7.145   -5.771  1.00 0.00 ? 94  ARG A O    4  
ATOM 3745  C CB   . ARG A 1 10 ? -0.578  6.187   -7.827  1.00 0.00 ? 94  ARG A CB   4  
ATOM 3746  C CG   . ARG A 1 10 ? -0.499  7.327   -8.829  1.00 0.00 ? 94  ARG A CG   4  
ATOM 3747  C CD   . ARG A 1 10 ? -0.840  6.846   -10.233 1.00 0.00 ? 94  ARG A CD   4  
ATOM 3748  N NE   . ARG A 1 10 ? -0.598  7.875   -11.243 1.00 0.00 ? 94  ARG A NE   4  
ATOM 3749  C CZ   . ARG A 1 10 ? -0.128  7.629   -12.466 1.00 0.00 ? 94  ARG A CZ   4  
ATOM 3750  N NH1  . ARG A 1 10 ? 0.202   6.392   -12.822 1.00 0.00 ? 94  ARG A NH1  4  
ATOM 3751  N NH2  . ARG A 1 10 ? 0.026   8.621   -13.334 1.00 0.00 ? 94  ARG A NH2  4  
ATOM 3752  H H    . ARG A 1 10 ? -0.392  4.550   -5.786  1.00 0.00 ? 94  ARG A H    4  
ATOM 3753  H HA   . ARG A 1 10 ? 0.859   7.093   -6.514  1.00 0.00 ? 94  ARG A HA   4  
ATOM 3754  H HB2  . ARG A 1 10 ? 0.001   5.363   -8.216  1.00 0.00 ? 94  ARG A HB2  4  
ATOM 3755  H HB3  . ARG A 1 10 ? -1.610  5.880   -7.749  1.00 0.00 ? 94  ARG A HB3  4  
ATOM 3756  H HG2  . ARG A 1 10 ? -1.197  8.100   -8.544  1.00 0.00 ? 94  ARG A HG2  4  
ATOM 3757  H HG3  . ARG A 1 10 ? 0.504   7.726   -8.829  1.00 0.00 ? 94  ARG A HG3  4  
ATOM 3758  H HD2  . ARG A 1 10 ? -0.236  5.982   -10.463 1.00 0.00 ? 94  ARG A HD2  4  
ATOM 3759  H HD3  . ARG A 1 10 ? -1.884  6.569   -10.261 1.00 0.00 ? 94  ARG A HD3  4  
ATOM 3760  H HE   . ARG A 1 10 ? -0.809  8.809   -10.995 1.00 0.00 ? 94  ARG A HE   4  
ATOM 3761  H HH11 . ARG A 1 10 ? 0.099   5.636   -12.175 1.00 0.00 ? 94  ARG A HH11 4  
ATOM 3762  H HH12 . ARG A 1 10 ? 0.556   6.210   -13.751 1.00 0.00 ? 94  ARG A HH12 4  
ATOM 3763  H HH21 . ARG A 1 10 ? -0.214  9.569   -13.077 1.00 0.00 ? 94  ARG A HH21 4  
ATOM 3764  H HH22 . ARG A 1 10 ? 0.384   8.435   -14.250 1.00 0.00 ? 94  ARG A HH22 4  
ATOM 3765  N N    . ASN A 1 11 ? -0.585  8.287   -4.840  1.00 0.00 ? 95  ASN A N    4  
ATOM 3766  C CA   . ASN A 1 11 ? -1.452  9.108   -4.007  1.00 0.00 ? 95  ASN A CA   4  
ATOM 3767  C C    . ASN A 1 11 ? -2.066  10.227  -4.825  1.00 0.00 ? 95  ASN A C    4  
ATOM 3768  O O    . ASN A 1 11 ? -1.386  10.861  -5.641  1.00 0.00 ? 95  ASN A O    4  
ATOM 3769  C CB   . ASN A 1 11 ? -0.704  9.663   -2.782  1.00 0.00 ? 95  ASN A CB   4  
ATOM 3770  C CG   . ASN A 1 11 ? 0.556   10.426  -3.132  1.00 0.00 ? 95  ASN A CG   4  
ATOM 3771  O OD1  . ASN A 1 11 ? 0.528   11.637  -3.343  1.00 0.00 ? 95  ASN A OD1  4  
ATOM 3772  N ND2  . ASN A 1 11 ? 1.681   9.723   -3.177  1.00 0.00 ? 95  ASN A ND2  4  
ATOM 3773  H H    . ASN A 1 11 ? 0.385   8.430   -4.812  1.00 0.00 ? 95  ASN A H    4  
ATOM 3774  H HA   . ASN A 1 11 ? -2.255  8.472   -3.660  1.00 0.00 ? 95  ASN A HA   4  
ATOM 3775  H HB2  . ASN A 1 11 ? -1.361  10.330  -2.244  1.00 0.00 ? 95  ASN A HB2  4  
ATOM 3776  H HB3  . ASN A 1 11 ? -0.433  8.838   -2.134  1.00 0.00 ? 95  ASN A HB3  4  
ATOM 3777  H HD21 . ASN A 1 11 ? 1.637   8.762   -2.987  1.00 0.00 ? 95  ASN A HD21 4  
ATOM 3778  H HD22 . ASN A 1 11 ? 2.513   10.192  -3.400  1.00 0.00 ? 95  ASN A HD22 4  
ATOM 3779  N N    . ASN A 1 12 ? -3.365  10.439  -4.609  1.00 0.00 ? 96  ASN A N    4  
ATOM 3780  C CA   . ASN A 1 12 ? -4.168  11.352  -5.418  1.00 0.00 ? 96  ASN A CA   4  
ATOM 3781  C C    . ASN A 1 12 ? -4.312  10.781  -6.829  1.00 0.00 ? 96  ASN A C    4  
ATOM 3782  O O    . ASN A 1 12 ? -5.345  10.202  -7.164  1.00 0.00 ? 96  ASN A O    4  
ATOM 3783  C CB   . ASN A 1 12 ? -3.557  12.763  -5.444  1.00 0.00 ? 96  ASN A CB   4  
ATOM 3784  C CG   . ASN A 1 12 ? -4.368  13.747  -6.265  1.00 0.00 ? 96  ASN A CG   4  
ATOM 3785  O OD1  . ASN A 1 12 ? -4.153  13.893  -7.465  1.00 0.00 ? 96  ASN A OD1  4  
ATOM 3786  N ND2  . ASN A 1 12 ? -5.300  14.434  -5.621  1.00 0.00 ? 96  ASN A ND2  4  
ATOM 3787  H H    . ASN A 1 12 ? -3.804  9.948   -3.880  1.00 0.00 ? 96  ASN A H    4  
ATOM 3788  H HA   . ASN A 1 12 ? -5.150  11.404  -4.969  1.00 0.00 ? 96  ASN A HA   4  
ATOM 3789  H HB2  . ASN A 1 12 ? -3.492  13.137  -4.434  1.00 0.00 ? 96  ASN A HB2  4  
ATOM 3790  H HB3  . ASN A 1 12 ? -2.564  12.706  -5.867  1.00 0.00 ? 96  ASN A HB3  4  
ATOM 3791  H HD21 . ASN A 1 12 ? -5.414  14.272  -4.662  1.00 0.00 ? 96  ASN A HD21 4  
ATOM 3792  H HD22 . ASN A 1 12 ? -5.837  15.087  -6.131  1.00 0.00 ? 96  ASN A HD22 4  
ATOM 3793  N N    . LYS A 1 13 ? -3.246  10.924  -7.616  1.00 0.00 ? 97  LYS A N    4  
ATOM 3794  C CA   . LYS A 1 13 ? -3.134  10.343  -8.958  1.00 0.00 ? 97  LYS A CA   4  
ATOM 3795  C C    . LYS A 1 13 ? -1.922  10.930  -9.675  1.00 0.00 ? 97  LYS A C    4  
ATOM 3796  O O    . LYS A 1 13 ? -1.381  10.323  -10.593 1.00 0.00 ? 97  LYS A O    4  
ATOM 3797  C CB   . LYS A 1 13 ? -4.399  10.548  -9.810  1.00 0.00 ? 97  LYS A CB   4  
ATOM 3798  C CG   . LYS A 1 13 ? -4.757  11.999  -10.101 1.00 0.00 ? 97  LYS A CG   4  
ATOM 3799  C CD   . LYS A 1 13 ? -5.957  12.078  -11.032 1.00 0.00 ? 97  LYS A CD   4  
ATOM 3800  C CE   . LYS A 1 13 ? -7.195  11.439  -10.412 1.00 0.00 ? 97  LYS A CE   4  
ATOM 3801  N NZ   . LYS A 1 13 ? -8.287  11.245  -11.407 1.00 0.00 ? 97  LYS A NZ   4  
ATOM 3802  H H    . LYS A 1 13 ? -2.483  11.424  -7.265  1.00 0.00 ? 97  LYS A H    4  
ATOM 3803  H HA   . LYS A 1 13 ? -2.970  9.281   -8.833  1.00 0.00 ? 97  LYS A HA   4  
ATOM 3804  H HB2  . LYS A 1 13 ? -4.259  10.045  -10.755 1.00 0.00 ? 97  LYS A HB2  4  
ATOM 3805  H HB3  . LYS A 1 13 ? -5.233  10.093  -9.296  1.00 0.00 ? 97  LYS A HB3  4  
ATOM 3806  H HG2  . LYS A 1 13 ? -4.995  12.498  -9.172  1.00 0.00 ? 97  LYS A HG2  4  
ATOM 3807  H HG3  . LYS A 1 13 ? -3.914  12.484  -10.570 1.00 0.00 ? 97  LYS A HG3  4  
ATOM 3808  H HD2  . LYS A 1 13 ? -6.168  13.116  -11.245 1.00 0.00 ? 97  LYS A HD2  4  
ATOM 3809  H HD3  . LYS A 1 13 ? -5.720  11.562  -11.949 1.00 0.00 ? 97  LYS A HD3  4  
ATOM 3810  H HE2  . LYS A 1 13 ? -6.922  10.480  -10.003 1.00 0.00 ? 97  LYS A HE2  4  
ATOM 3811  H HE3  . LYS A 1 13 ? -7.555  12.079  -9.617  1.00 0.00 ? 97  LYS A HE3  4  
ATOM 3812  H HZ1  . LYS A 1 13 ? -9.153  10.911  -10.928 1.00 0.00 ? 97  LYS A HZ1  4  
ATOM 3813  H HZ2  . LYS A 1 13 ? -8.005  10.530  -12.114 1.00 0.00 ? 97  LYS A HZ2  4  
ATOM 3814  H HZ3  . LYS A 1 13 ? -8.496  12.140  -11.900 1.00 0.00 ? 97  LYS A HZ3  4  
ATOM 3815  N N    . GLY A 1 14 ? -1.496  12.111  -9.244  1.00 0.00 ? 98  GLY A N    4  
ATOM 3816  C CA   . GLY A 1 14 ? -0.330  12.736  -9.838  1.00 0.00 ? 98  GLY A CA   4  
ATOM 3817  C C    . GLY A 1 14 ? 0.977   12.196  -9.288  1.00 0.00 ? 98  GLY A C    4  
ATOM 3818  O O    . GLY A 1 14 ? 1.945   12.013  -10.029 1.00 0.00 ? 98  GLY A O    4  
ATOM 3819  H H    . GLY A 1 14 ? -1.990  12.575  -8.537  1.00 0.00 ? 98  GLY A H    4  
ATOM 3820  H HA2  . GLY A 1 14 ? -0.354  12.571  -10.905 1.00 0.00 ? 98  GLY A HA2  4  
ATOM 3821  H HA3  . GLY A 1 14 ? -0.374  13.798  -9.650  1.00 0.00 ? 98  GLY A HA3  4  
ATOM 3822  N N    . ARG A 1 15 ? 1.011   11.928  -7.989  1.00 0.00 ? 99  ARG A N    4  
ATOM 3823  C CA   . ARG A 1 15 ? 2.232   11.465  -7.343  1.00 0.00 ? 99  ARG A CA   4  
ATOM 3824  C C    . ARG A 1 15 ? 2.293   9.946   -7.281  1.00 0.00 ? 99  ARG A C    4  
ATOM 3825  O O    . ARG A 1 15 ? 1.584   9.315   -6.498  1.00 0.00 ? 99  ARG A O    4  
ATOM 3826  C CB   . ARG A 1 15 ? 2.352   12.034  -5.930  1.00 0.00 ? 99  ARG A CB   4  
ATOM 3827  C CG   . ARG A 1 15 ? 2.829   13.474  -5.877  1.00 0.00 ? 99  ARG A CG   4  
ATOM 3828  C CD   . ARG A 1 15 ? 2.903   13.969  -4.442  1.00 0.00 ? 99  ARG A CD   4  
ATOM 3829  N NE   . ARG A 1 15 ? 3.654   15.217  -4.328  1.00 0.00 ? 99  ARG A NE   4  
ATOM 3830  C CZ   . ARG A 1 15 ? 3.805   15.893  -3.189  1.00 0.00 ? 99  ARG A CZ   4  
ATOM 3831  N NH1  . ARG A 1 15 ? 3.200   15.486  -2.081  1.00 0.00 ? 99  ARG A NH1  4  
ATOM 3832  N NH2  . ARG A 1 15 ? 4.552   16.989  -3.169  1.00 0.00 ? 99  ARG A NH2  4  
ATOM 3833  H H    . ARG A 1 15 ? 0.195   12.030  -7.458  1.00 0.00 ? 99  ARG A H    4  
ATOM 3834  H HA   . ARG A 1 15 ? 3.066   11.817  -7.931  1.00 0.00 ? 99  ARG A HA   4  
ATOM 3835  H HB2  . ARG A 1 15 ? 1.384   11.985  -5.454  1.00 0.00 ? 99  ARG A HB2  4  
ATOM 3836  H HB3  . ARG A 1 15 ? 3.049   11.429  -5.373  1.00 0.00 ? 99  ARG A HB3  4  
ATOM 3837  H HG2  . ARG A 1 15 ? 3.810   13.537  -6.324  1.00 0.00 ? 99  ARG A HG2  4  
ATOM 3838  H HG3  . ARG A 1 15 ? 2.138   14.094  -6.428  1.00 0.00 ? 99  ARG A HG3  4  
ATOM 3839  H HD2  . ARG A 1 15 ? 1.899   14.133  -4.080  1.00 0.00 ? 99  ARG A HD2  4  
ATOM 3840  H HD3  . ARG A 1 15 ? 3.384   13.213  -3.838  1.00 0.00 ? 99  ARG A HD3  4  
ATOM 3841  H HE   . ARG A 1 15 ? 4.097   15.558  -5.145  1.00 0.00 ? 99  ARG A HE   4  
ATOM 3842  H HH11 . ARG A 1 15 ? 2.622   14.659  -2.092  1.00 0.00 ? 99  ARG A HH11 4  
ATOM 3843  H HH12 . ARG A 1 15 ? 3.324   15.993  -1.217  1.00 0.00 ? 99  ARG A HH12 4  
ATOM 3844  H HH21 . ARG A 1 15 ? 5.006   17.306  -4.008  1.00 0.00 ? 99  ARG A HH21 4  
ATOM 3845  H HH22 . ARG A 1 15 ? 4.668   17.507  -2.320  1.00 0.00 ? 99  ARG A HH22 4  
ATOM 3846  N N    . SER A 1 16 ? 3.144   9.363   -8.106  1.00 0.00 ? 100 SER A N    4  
ATOM 3847  C CA   . SER A 1 16 ? 3.381   7.932   -8.072  1.00 0.00 ? 100 SER A CA   4  
ATOM 3848  C C    . SER A 1 16 ? 4.621   7.632   -7.238  1.00 0.00 ? 100 SER A C    4  
ATOM 3849  O O    . SER A 1 16 ? 5.742   7.947   -7.640  1.00 0.00 ? 100 SER A O    4  
ATOM 3850  C CB   . SER A 1 16 ? 3.556   7.399   -9.493  1.00 0.00 ? 100 SER A CB   4  
ATOM 3851  O OG   . SER A 1 16 ? 2.466   7.778   -10.314 1.00 0.00 ? 100 SER A OG   4  
ATOM 3852  H H    . SER A 1 16 ? 3.622   9.911   -8.764  1.00 0.00 ? 100 SER A H    4  
ATOM 3853  H HA   . SER A 1 16 ? 2.524   7.459   -7.618  1.00 0.00 ? 100 SER A HA   4  
ATOM 3854  H HB2  . SER A 1 16 ? 4.466   7.798   -9.915  1.00 0.00 ? 100 SER A HB2  4  
ATOM 3855  H HB3  . SER A 1 16 ? 3.614   6.320   -9.464  1.00 0.00 ? 100 SER A HB3  4  
ATOM 3856  H HG   . SER A 1 16 ? 2.802   8.201   -11.118 1.00 0.00 ? 100 SER A HG   4  
ATOM 3857  N N    . SER A 1 17 ? 4.419   7.054   -6.064  1.00 0.00 ? 101 SER A N    4  
ATOM 3858  C CA   . SER A 1 17 ? 5.524   6.744   -5.171  1.00 0.00 ? 101 SER A CA   4  
ATOM 3859  C C    . SER A 1 17 ? 5.713   5.234   -5.053  1.00 0.00 ? 101 SER A C    4  
ATOM 3860  O O    . SER A 1 17 ? 4.861   4.527   -4.518  1.00 0.00 ? 101 SER A O    4  
ATOM 3861  C CB   . SER A 1 17 ? 5.263   7.361   -3.795  1.00 0.00 ? 101 SER A CB   4  
ATOM 3862  O OG   . SER A 1 17 ? 5.028   8.759   -3.901  1.00 0.00 ? 101 SER A OG   4  
ATOM 3863  H H    . SER A 1 17 ? 3.504   6.825   -5.787  1.00 0.00 ? 101 SER A H    4  
ATOM 3864  H HA   . SER A 1 17 ? 6.421   7.178   -5.589  1.00 0.00 ? 101 SER A HA   4  
ATOM 3865  H HB2  . SER A 1 17 ? 4.394   6.899   -3.351  1.00 0.00 ? 101 SER A HB2  4  
ATOM 3866  H HB3  . SER A 1 17 ? 6.122   7.200   -3.158  1.00 0.00 ? 101 SER A HB3  4  
ATOM 3867  H HG   . SER A 1 17 ? 5.131   9.030   -4.820  1.00 0.00 ? 101 SER A HG   4  
ATOM 3868  N N    . THR A 1 18 ? 6.830   4.743   -5.571  1.00 0.00 ? 102 THR A N    4  
ATOM 3869  C CA   . THR A 1 18 ? 7.130   3.323   -5.527  1.00 0.00 ? 102 THR A CA   4  
ATOM 3870  C C    . THR A 1 18 ? 7.599   2.918   -4.131  1.00 0.00 ? 102 THR A C    4  
ATOM 3871  O O    . THR A 1 18 ? 8.577   3.463   -3.614  1.00 0.00 ? 102 THR A O    4  
ATOM 3872  C CB   . THR A 1 18 ? 8.226   2.960   -6.546  1.00 0.00 ? 102 THR A CB   4  
ATOM 3873  O OG1  . THR A 1 18 ? 7.977   3.620   -7.794  1.00 0.00 ? 102 THR A OG1  4  
ATOM 3874  C CG2  . THR A 1 18 ? 8.272   1.459   -6.768  1.00 0.00 ? 102 THR A CG2  4  
ATOM 3875  H H    . THR A 1 18 ? 7.468   5.352   -5.995  1.00 0.00 ? 102 THR A H    4  
ATOM 3876  H HA   . THR A 1 18 ? 6.233   2.775   -5.775  1.00 0.00 ? 102 THR A HA   4  
ATOM 3877  H HB   . THR A 1 18 ? 9.180   3.280   -6.159  1.00 0.00 ? 102 THR A HB   4  
ATOM 3878  H HG1  . THR A 1 18 ? 8.635   4.320   -7.918  1.00 0.00 ? 102 THR A HG1  4  
ATOM 3879  H HG21 . THR A 1 18 ? 8.485   0.963   -5.832  1.00 0.00 ? 102 THR A HG21 4  
ATOM 3880  H HG22 . THR A 1 18 ? 9.043   1.226   -7.485  1.00 0.00 ? 102 THR A HG22 4  
ATOM 3881  H HG23 . THR A 1 18 ? 7.317   1.123   -7.144  1.00 0.00 ? 102 THR A HG23 4  
ATOM 3882  N N    . TYR A 1 19 ? 6.896   1.978   -3.523  1.00 0.00 ? 103 TYR A N    4  
ATOM 3883  C CA   . TYR A 1 19 ? 7.275   1.474   -2.214  1.00 0.00 ? 103 TYR A CA   4  
ATOM 3884  C C    . TYR A 1 19 ? 7.745   0.033   -2.313  1.00 0.00 ? 103 TYR A C    4  
ATOM 3885  O O    . TYR A 1 19 ? 7.102   -0.801  -2.953  1.00 0.00 ? 103 TYR A O    4  
ATOM 3886  C CB   . TYR A 1 19 ? 6.112   1.590   -1.224  1.00 0.00 ? 103 TYR A CB   4  
ATOM 3887  C CG   . TYR A 1 19 ? 5.977   2.962   -0.599  1.00 0.00 ? 103 TYR A CG   4  
ATOM 3888  C CD1  . TYR A 1 19 ? 5.290   3.983   -1.244  1.00 0.00 ? 103 TYR A CD1  4  
ATOM 3889  C CD2  . TYR A 1 19 ? 6.541   3.234   0.642   1.00 0.00 ? 103 TYR A CD2  4  
ATOM 3890  C CE1  . TYR A 1 19 ? 5.172   5.234   -0.672  1.00 0.00 ? 103 TYR A CE1  4  
ATOM 3891  C CE2  . TYR A 1 19 ? 6.425   4.483   1.221   1.00 0.00 ? 103 TYR A CE2  4  
ATOM 3892  C CZ   . TYR A 1 19 ? 5.738   5.479   0.562   1.00 0.00 ? 103 TYR A CZ   4  
ATOM 3893  O OH   . TYR A 1 19 ? 5.622   6.724   1.135   1.00 0.00 ? 103 TYR A OH   4  
ATOM 3894  H H    . TYR A 1 19 ? 6.102   1.601   -3.972  1.00 0.00 ? 103 TYR A H    4  
ATOM 3895  H HA   . TYR A 1 19 ? 8.096   2.077   -1.858  1.00 0.00 ? 103 TYR A HA   4  
ATOM 3896  H HB2  . TYR A 1 19 ? 5.188   1.367   -1.737  1.00 0.00 ? 103 TYR A HB2  4  
ATOM 3897  H HB3  . TYR A 1 19 ? 6.256   0.876   -0.426  1.00 0.00 ? 103 TYR A HB3  4  
ATOM 3898  H HD1  . TYR A 1 19 ? 4.846   3.788   -2.209  1.00 0.00 ? 103 TYR A HD1  4  
ATOM 3899  H HD2  . TYR A 1 19 ? 7.078   2.452   1.156   1.00 0.00 ? 103 TYR A HD2  4  
ATOM 3900  H HE1  . TYR A 1 19 ? 4.634   6.015   -1.189  1.00 0.00 ? 103 TYR A HE1  4  
ATOM 3901  H HE2  . TYR A 1 19 ? 6.870   4.675   2.187   1.00 0.00 ? 103 TYR A HE2  4  
ATOM 3902  H HH   . TYR A 1 19 ? 6.472   6.987   1.493   1.00 0.00 ? 103 TYR A HH   4  
ATOM 3903  N N    . GLU A 1 20 ? 8.881   -0.245  -1.694  1.00 0.00 ? 104 GLU A N    4  
ATOM 3904  C CA   . GLU A 1 20 ? 9.435   -1.584  -1.688  1.00 0.00 ? 104 GLU A CA   4  
ATOM 3905  C C    . GLU A 1 20 ? 8.779   -2.429  -0.623  1.00 0.00 ? 104 GLU A C    4  
ATOM 3906  O O    . GLU A 1 20 ? 8.679   -2.027  0.539   1.00 0.00 ? 104 GLU A O    4  
ATOM 3907  C CB   . GLU A 1 20 ? 10.934  -1.551  -1.452  1.00 0.00 ? 104 GLU A CB   4  
ATOM 3908  C CG   . GLU A 1 20 ? 11.725  -1.046  -2.638  1.00 0.00 ? 104 GLU A CG   4  
ATOM 3909  C CD   . GLU A 1 20 ? 11.545  -1.905  -3.868  1.00 0.00 ? 104 GLU A CD   4  
ATOM 3910  O OE1  . GLU A 1 20 ? 12.208  -2.961  -3.953  1.00 0.00 ? 104 GLU A OE1  4  
ATOM 3911  O OE2  . GLU A 1 20 ? 10.753  -1.532  -4.750  1.00 0.00 ? 104 GLU A OE2  4  
ATOM 3912  H H    . GLU A 1 20 ? 9.356   0.471   -1.223  1.00 0.00 ? 104 GLU A H    4  
ATOM 3913  H HA   . GLU A 1 20 ? 9.241   -2.029  -2.655  1.00 0.00 ? 104 GLU A HA   4  
ATOM 3914  H HB2  . GLU A 1 20 ? 11.141  -0.906  -0.610  1.00 0.00 ? 104 GLU A HB2  4  
ATOM 3915  H HB3  . GLU A 1 20 ? 11.273  -2.551  -1.221  1.00 0.00 ? 104 GLU A HB3  4  
ATOM 3916  H HG2  . GLU A 1 20 ? 11.414  -0.038  -2.866  1.00 0.00 ? 104 GLU A HG2  4  
ATOM 3917  H HG3  . GLU A 1 20 ? 12.763  -1.052  -2.368  1.00 0.00 ? 104 GLU A HG3  4  
ATOM 3918  N N    . VAL A 1 21 ? 8.348   -3.603  -1.024  1.00 0.00 ? 105 VAL A N    4  
ATOM 3919  C CA   . VAL A 1 21 ? 7.666   -4.520  -0.128  1.00 0.00 ? 105 VAL A CA   4  
ATOM 3920  C C    . VAL A 1 21 ? 7.994   -5.963  -0.481  1.00 0.00 ? 105 VAL A C    4  
ATOM 3921  O O    . VAL A 1 21 ? 8.751   -6.233  -1.415  1.00 0.00 ? 105 VAL A O    4  
ATOM 3922  C CB   . VAL A 1 21 ? 6.124   -4.348  -0.157  1.00 0.00 ? 105 VAL A CB   4  
ATOM 3923  C CG1  . VAL A 1 21 ? 5.704   -2.981  0.363   1.00 0.00 ? 105 VAL A CG1  4  
ATOM 3924  C CG2  . VAL A 1 21 ? 5.576   -4.578  -1.558  1.00 0.00 ? 105 VAL A CG2  4  
ATOM 3925  H H    . VAL A 1 21 ? 8.510   -3.870  -1.959  1.00 0.00 ? 105 VAL A H    4  
ATOM 3926  H HA   . VAL A 1 21 ? 8.009   -4.319  0.876   1.00 0.00 ? 105 VAL A HA   4  
ATOM 3927  H HB   . VAL A 1 21 ? 5.694   -5.093  0.494   1.00 0.00 ? 105 VAL A HB   4  
ATOM 3928  H HG11 . VAL A 1 21 ? 6.032   -2.871  1.386   1.00 0.00 ? 105 VAL A HG11 4  
ATOM 3929  H HG12 . VAL A 1 21 ? 4.628   -2.895  0.319   1.00 0.00 ? 105 VAL A HG12 4  
ATOM 3930  H HG13 . VAL A 1 21 ? 6.153   -2.208  -0.246  1.00 0.00 ? 105 VAL A HG13 4  
ATOM 3931  H HG21 . VAL A 1 21 ? 4.502   -4.465  -1.548  1.00 0.00 ? 105 VAL A HG21 4  
ATOM 3932  H HG22 . VAL A 1 21 ? 5.831   -5.576  -1.882  1.00 0.00 ? 105 VAL A HG22 4  
ATOM 3933  H HG23 . VAL A 1 21 ? 6.007   -3.858  -2.238  1.00 0.00 ? 105 VAL A HG23 4  
ATOM 3934  N N    . ARG A 1 22 ? 7.419   -6.879  0.279   1.00 0.00 ? 106 ARG A N    4  
ATOM 3935  C CA   . ARG A 1 22 ? 7.541   -8.301  0.011   1.00 0.00 ? 106 ARG A CA   4  
ATOM 3936  C C    . ARG A 1 22 ? 6.191   -8.968  0.228   1.00 0.00 ? 106 ARG A C    4  
ATOM 3937  O O    . ARG A 1 22 ? 5.269   -8.342  0.751   1.00 0.00 ? 106 ARG A O    4  
ATOM 3938  C CB   . ARG A 1 22 ? 8.615   -8.932  0.903   1.00 0.00 ? 106 ARG A CB   4  
ATOM 3939  C CG   . ARG A 1 22 ? 10.032  -8.600  0.456   1.00 0.00 ? 106 ARG A CG   4  
ATOM 3940  C CD   . ARG A 1 22 ? 11.073  -9.075  1.454   1.00 0.00 ? 106 ARG A CD   4  
ATOM 3941  N NE   . ARG A 1 22 ? 11.048  -8.293  2.688   1.00 0.00 ? 106 ARG A NE   4  
ATOM 3942  C CZ   . ARG A 1 22 ? 12.032  -7.472  3.061   1.00 0.00 ? 106 ARG A CZ   4  
ATOM 3943  N NH1  . ARG A 1 22 ? 13.071  -7.261  2.264   1.00 0.00 ? 106 ARG A NH1  4  
ATOM 3944  N NH2  . ARG A 1 22 ? 11.973  -6.838  4.226   1.00 0.00 ? 106 ARG A NH2  4  
ATOM 3945  H H    . ARG A 1 22 ? 6.879   -6.591  1.045   1.00 0.00 ? 106 ARG A H    4  
ATOM 3946  H HA   . ARG A 1 22 ? 7.825   -8.421  -1.024  1.00 0.00 ? 106 ARG A HA   4  
ATOM 3947  H HB2  . ARG A 1 22 ? 8.483   -8.580  1.916   1.00 0.00 ? 106 ARG A HB2  4  
ATOM 3948  H HB3  . ARG A 1 22 ? 8.498   -10.005 0.884   1.00 0.00 ? 106 ARG A HB3  4  
ATOM 3949  H HG2  . ARG A 1 22 ? 10.221  -9.075  -0.493  1.00 0.00 ? 106 ARG A HG2  4  
ATOM 3950  H HG3  . ARG A 1 22 ? 10.122  -7.527  0.345   1.00 0.00 ? 106 ARG A HG3  4  
ATOM 3951  H HD2  . ARG A 1 22 ? 10.874  -10.110 1.692   1.00 0.00 ? 106 ARG A HD2  4  
ATOM 3952  H HD3  . ARG A 1 22 ? 12.051  -8.991  1.003   1.00 0.00 ? 106 ARG A HD3  4  
ATOM 3953  H HE   . ARG A 1 22 ? 10.262  -8.401  3.279   1.00 0.00 ? 106 ARG A HE   4  
ATOM 3954  H HH11 . ARG A 1 22 ? 13.123  -7.716  1.364   1.00 0.00 ? 106 ARG A HH11 4  
ATOM 3955  H HH12 . ARG A 1 22 ? 13.805  -6.644  2.551   1.00 0.00 ? 106 ARG A HH12 4  
ATOM 3956  H HH21 . ARG A 1 22 ? 11.187  -6.973  4.842   1.00 0.00 ? 106 ARG A HH21 4  
ATOM 3957  H HH22 . ARG A 1 22 ? 12.714  -6.212  4.493   1.00 0.00 ? 106 ARG A HH22 4  
ATOM 3958  N N    . LEU A 1 23 ? 6.068   -10.226 -0.167  1.00 0.00 ? 107 LEU A N    4  
ATOM 3959  C CA   . LEU A 1 23 ? 4.785   -10.917 -0.096  1.00 0.00 ? 107 LEU A CA   4  
ATOM 3960  C C    . LEU A 1 23 ? 4.417   -11.263 1.344   1.00 0.00 ? 107 LEU A C    4  
ATOM 3961  O O    . LEU A 1 23 ? 3.286   -11.654 1.628   1.00 0.00 ? 107 LEU A O    4  
ATOM 3962  C CB   . LEU A 1 23 ? 4.786   -12.180 -0.967  1.00 0.00 ? 107 LEU A CB   4  
ATOM 3963  C CG   . LEU A 1 23 ? 4.909   -11.938 -2.479  1.00 0.00 ? 107 LEU A CG   4  
ATOM 3964  C CD1  . LEU A 1 23 ? 6.354   -11.689 -2.882  1.00 0.00 ? 107 LEU A CD1  4  
ATOM 3965  C CD2  . LEU A 1 23 ? 4.321   -13.104 -3.260  1.00 0.00 ? 107 LEU A CD2  4  
ATOM 3966  H H    . LEU A 1 23 ? 6.851   -10.701 -0.517  1.00 0.00 ? 107 LEU A H    4  
ATOM 3967  H HA   . LEU A 1 23 ? 4.036   -10.240 -0.478  1.00 0.00 ? 107 LEU A HA   4  
ATOM 3968  H HB2  . LEU A 1 23 ? 5.612   -12.804 -0.657  1.00 0.00 ? 107 LEU A HB2  4  
ATOM 3969  H HB3  . LEU A 1 23 ? 3.866   -12.719 -0.787  1.00 0.00 ? 107 LEU A HB3  4  
ATOM 3970  H HG   . LEU A 1 23 ? 4.343   -11.053 -2.734  1.00 0.00 ? 107 LEU A HG   4  
ATOM 3971  H HD11 . LEU A 1 23 ? 6.408   -11.508 -3.945  1.00 0.00 ? 107 LEU A HD11 4  
ATOM 3972  H HD12 . LEU A 1 23 ? 6.952   -12.553 -2.633  1.00 0.00 ? 107 LEU A HD12 4  
ATOM 3973  H HD13 . LEU A 1 23 ? 6.731   -10.827 -2.351  1.00 0.00 ? 107 LEU A HD13 4  
ATOM 3974  H HD21 . LEU A 1 23 ? 4.854   -14.009 -3.010  1.00 0.00 ? 107 LEU A HD21 4  
ATOM 3975  H HD22 . LEU A 1 23 ? 4.415   -12.910 -4.318  1.00 0.00 ? 107 LEU A HD22 4  
ATOM 3976  H HD23 . LEU A 1 23 ? 3.279   -13.216 -3.006  1.00 0.00 ? 107 LEU A HD23 4  
ATOM 3977  N N    . THR A 1 24 ? 5.372   -11.095 2.252   1.00 0.00 ? 108 THR A N    4  
ATOM 3978  C CA   . THR A 1 24 ? 5.137   -11.344 3.668   1.00 0.00 ? 108 THR A CA   4  
ATOM 3979  C C    . THR A 1 24 ? 4.545   -10.102 4.345   1.00 0.00 ? 108 THR A C    4  
ATOM 3980  O O    . THR A 1 24 ? 4.276   -10.097 5.549   1.00 0.00 ? 108 THR A O    4  
ATOM 3981  C CB   . THR A 1 24 ? 6.454   -11.734 4.367   1.00 0.00 ? 108 THR A CB   4  
ATOM 3982  O OG1  . THR A 1 24 ? 7.257   -12.523 3.476   1.00 0.00 ? 108 THR A OG1  4  
ATOM 3983  C CG2  . THR A 1 24 ? 6.176   -12.523 5.639   1.00 0.00 ? 108 THR A CG2  4  
ATOM 3984  H H    . THR A 1 24 ? 6.261   -10.812 1.962   1.00 0.00 ? 108 THR A H    4  
ATOM 3985  H HA   . THR A 1 24 ? 4.443   -12.163 3.758   1.00 0.00 ? 108 THR A HA   4  
ATOM 3986  H HB   . THR A 1 24 ? 6.990   -10.831 4.626   1.00 0.00 ? 108 THR A HB   4  
ATOM 3987  H HG1  . THR A 1 24 ? 7.715   -13.213 3.978   1.00 0.00 ? 108 THR A HG1  4  
ATOM 3988  H HG21 . THR A 1 24 ? 5.644   -13.428 5.393   1.00 0.00 ? 108 THR A HG21 4  
ATOM 3989  H HG22 . THR A 1 24 ? 5.578   -11.923 6.310   1.00 0.00 ? 108 THR A HG22 4  
ATOM 3990  H HG23 . THR A 1 24 ? 7.111   -12.775 6.117   1.00 0.00 ? 108 THR A HG23 4  
ATOM 3991  N N    . GLN A 1 25 ? 4.342   -9.050  3.564   1.00 0.00 ? 109 GLN A N    4  
ATOM 3992  C CA   . GLN A 1 25 ? 3.806   -7.805  4.089   1.00 0.00 ? 109 GLN A CA   4  
ATOM 3993  C C    . GLN A 1 25 ? 2.282   -7.813  4.100   1.00 0.00 ? 109 GLN A C    4  
ATOM 3994  O O    . GLN A 1 25 ? 1.642   -8.254  3.146   1.00 0.00 ? 109 GLN A O    4  
ATOM 3995  C CB   . GLN A 1 25 ? 4.306   -6.621  3.263   1.00 0.00 ? 109 GLN A CB   4  
ATOM 3996  C CG   . GLN A 1 25 ? 5.734   -6.215  3.572   1.00 0.00 ? 109 GLN A CG   4  
ATOM 3997  C CD   . GLN A 1 25 ? 5.859   -5.549  4.927   1.00 0.00 ? 109 GLN A CD   4  
ATOM 3998  O OE1  . GLN A 1 25 ? 6.095   -6.200  5.944   1.00 0.00 ? 109 GLN A OE1  4  
ATOM 3999  N NE2  . GLN A 1 25 ? 5.679   -4.241  4.949   1.00 0.00 ? 109 GLN A NE2  4  
ATOM 4000  H H    . GLN A 1 25 ? 4.549   -9.116  2.609   1.00 0.00 ? 109 GLN A H    4  
ATOM 4001  H HA   . GLN A 1 25 ? 4.160   -7.693  5.102   1.00 0.00 ? 109 GLN A HA   4  
ATOM 4002  H HB2  . GLN A 1 25 ? 4.246   -6.879  2.217   1.00 0.00 ? 109 GLN A HB2  4  
ATOM 4003  H HB3  . GLN A 1 25 ? 3.666   -5.772  3.452   1.00 0.00 ? 109 GLN A HB3  4  
ATOM 4004  H HG2  . GLN A 1 25 ? 6.359   -7.096  3.561   1.00 0.00 ? 109 GLN A HG2  4  
ATOM 4005  H HG3  . GLN A 1 25 ? 6.071   -5.524  2.813   1.00 0.00 ? 109 GLN A HG3  4  
ATOM 4006  H HE21 . GLN A 1 25 ? 5.479   -3.786  4.103   1.00 0.00 ? 109 GLN A HE21 4  
ATOM 4007  H HE22 . GLN A 1 25 ? 5.746   -3.781  5.810   1.00 0.00 ? 109 GLN A HE22 4  
ATOM 4008  N N    . THR A 1 26 ? 1.714   -7.335  5.195   1.00 0.00 ? 110 THR A N    4  
ATOM 4009  C CA   . THR A 1 26 ? 0.275   -7.180  5.316   1.00 0.00 ? 110 THR A CA   4  
ATOM 4010  C C    . THR A 1 26 ? -0.135  -5.762  4.943   1.00 0.00 ? 110 THR A C    4  
ATOM 4011  O O    . THR A 1 26 ? 0.718   -4.876  4.834   1.00 0.00 ? 110 THR A O    4  
ATOM 4012  C CB   . THR A 1 26 ? -0.183  -7.496  6.750   1.00 0.00 ? 110 THR A CB   4  
ATOM 4013  O OG1  . THR A 1 26 ? 0.626   -6.775  7.693   1.00 0.00 ? 110 THR A OG1  4  
ATOM 4014  C CG2  . THR A 1 26 ? -0.083  -8.989  7.022   1.00 0.00 ? 110 THR A CG2  4  
ATOM 4015  H H    . THR A 1 26 ? 2.277   -7.080  5.950   1.00 0.00 ? 110 THR A H    4  
ATOM 4016  H HA   . THR A 1 26 ? -0.202  -7.874  4.645   1.00 0.00 ? 110 THR A HA   4  
ATOM 4017  H HB   . THR A 1 26 ? -1.214  -7.192  6.859   1.00 0.00 ? 110 THR A HB   4  
ATOM 4018  H HG1  . THR A 1 26 ? 0.458   -7.117  8.586   1.00 0.00 ? 110 THR A HG1  4  
ATOM 4019  H HG21 . THR A 1 26 ? -0.416  -9.194  8.029   1.00 0.00 ? 110 THR A HG21 4  
ATOM 4020  H HG22 . THR A 1 26 ? 0.942   -9.308  6.912   1.00 0.00 ? 110 THR A HG22 4  
ATOM 4021  H HG23 . THR A 1 26 ? -0.704  -9.527  6.319   1.00 0.00 ? 110 THR A HG23 4  
ATOM 4022  N N    . VAL A 1 27 ? -1.432  -5.548  4.746   1.00 0.00 ? 111 VAL A N    4  
ATOM 4023  C CA   . VAL A 1 27 ? -1.944  -4.218  4.437   1.00 0.00 ? 111 VAL A CA   4  
ATOM 4024  C C    . VAL A 1 27 ? -1.614  -3.262  5.577   1.00 0.00 ? 111 VAL A C    4  
ATOM 4025  O O    . VAL A 1 27 ? -1.226  -2.116  5.353   1.00 0.00 ? 111 VAL A O    4  
ATOM 4026  C CB   . VAL A 1 27 ? -3.467  -4.232  4.193   1.00 0.00 ? 111 VAL A CB   4  
ATOM 4027  C CG1  . VAL A 1 27 ? -3.982  -2.836  3.876   1.00 0.00 ? 111 VAL A CG1  4  
ATOM 4028  C CG2  . VAL A 1 27 ? -3.817  -5.200  3.073   1.00 0.00 ? 111 VAL A CG2  4  
ATOM 4029  H H    . VAL A 1 27 ? -2.059  -6.297  4.819   1.00 0.00 ? 111 VAL A H    4  
ATOM 4030  H HA   . VAL A 1 27 ? -1.454  -3.872  3.537   1.00 0.00 ? 111 VAL A HA   4  
ATOM 4031  H HB   . VAL A 1 27 ? -3.951  -4.572  5.096   1.00 0.00 ? 111 VAL A HB   4  
ATOM 4032  H HG11 . VAL A 1 27 ? -5.046  -2.878  3.699   1.00 0.00 ? 111 VAL A HG11 4  
ATOM 4033  H HG12 . VAL A 1 27 ? -3.484  -2.459  2.995   1.00 0.00 ? 111 VAL A HG12 4  
ATOM 4034  H HG13 . VAL A 1 27 ? -3.784  -2.181  4.710   1.00 0.00 ? 111 VAL A HG13 4  
ATOM 4035  H HG21 . VAL A 1 27 ? -4.884  -5.180  2.904   1.00 0.00 ? 111 VAL A HG21 4  
ATOM 4036  H HG22 . VAL A 1 27 ? -3.516  -6.197  3.353   1.00 0.00 ? 111 VAL A HG22 4  
ATOM 4037  H HG23 . VAL A 1 27 ? -3.304  -4.907  2.169   1.00 0.00 ? 111 VAL A HG23 4  
ATOM 4038  N N    . ALA A 1 28 ? -1.756  -3.761  6.801   1.00 0.00 ? 112 ALA A N    4  
ATOM 4039  C CA   . ALA A 1 28 ? -1.347  -3.034  7.995   1.00 0.00 ? 112 ALA A CA   4  
ATOM 4040  C C    . ALA A 1 28 ? 0.111   -2.590  7.890   1.00 0.00 ? 112 ALA A C    4  
ATOM 4041  O O    . ALA A 1 28 ? 0.435   -1.425  8.116   1.00 0.00 ? 112 ALA A O    4  
ATOM 4042  C CB   . ALA A 1 28 ? -1.538  -3.915  9.219   1.00 0.00 ? 112 ALA A CB   4  
ATOM 4043  H H    . ALA A 1 28 ? -2.173  -4.649  6.907   1.00 0.00 ? 112 ALA A H    4  
ATOM 4044  H HA   . ALA A 1 28 ? -1.978  -2.163  8.098   1.00 0.00 ? 112 ALA A HA   4  
ATOM 4045  H HB1  . ALA A 1 28 ? -1.224  -3.381  10.103  1.00 0.00 ? 112 ALA A HB1  4  
ATOM 4046  H HB2  . ALA A 1 28 ? -0.943  -4.814  9.106   1.00 0.00 ? 112 ALA A HB2  4  
ATOM 4047  H HB3  . ALA A 1 28 ? -2.581  -4.186  9.309   1.00 0.00 ? 112 ALA A HB3  4  
ATOM 4048  N N    . HIS A 1 29 ? 0.976   -3.523  7.510   1.00 0.00 ? 113 HIS A N    4  
ATOM 4049  C CA   . HIS A 1 29 ? 2.410   -3.260  7.409   1.00 0.00 ? 113 HIS A CA   4  
ATOM 4050  C C    . HIS A 1 29 ? 2.721   -2.213  6.345   1.00 0.00 ? 113 HIS A C    4  
ATOM 4051  O O    . HIS A 1 29 ? 3.749   -1.540  6.414   1.00 0.00 ? 113 HIS A O    4  
ATOM 4052  C CB   . HIS A 1 29 ? 3.167   -4.552  7.106   1.00 0.00 ? 113 HIS A CB   4  
ATOM 4053  C CG   . HIS A 1 29 ? 3.618   -5.287  8.328   1.00 0.00 ? 113 HIS A CG   4  
ATOM 4054  N ND1  . HIS A 1 29 ? 4.804   -5.986  8.385   1.00 0.00 ? 113 HIS A ND1  4  
ATOM 4055  C CD2  . HIS A 1 29 ? 3.039   -5.431  9.544   1.00 0.00 ? 113 HIS A CD2  4  
ATOM 4056  C CE1  . HIS A 1 29 ? 4.936   -6.523  9.583   1.00 0.00 ? 113 HIS A CE1  4  
ATOM 4057  N NE2  . HIS A 1 29 ? 3.880   -6.201  10.303  1.00 0.00 ? 113 HIS A NE2  4  
ATOM 4058  H H    . HIS A 1 29 ? 0.641   -4.416  7.280   1.00 0.00 ? 113 HIS A H    4  
ATOM 4059  H HA   . HIS A 1 29 ? 2.739   -2.885  8.365   1.00 0.00 ? 113 HIS A HA   4  
ATOM 4060  H HB2  . HIS A 1 29 ? 2.527   -5.213  6.542   1.00 0.00 ? 113 HIS A HB2  4  
ATOM 4061  H HB3  . HIS A 1 29 ? 4.043   -4.318  6.516   1.00 0.00 ? 113 HIS A HB3  4  
ATOM 4062  H HD1  . HIS A 1 29 ? 5.453   -6.087  7.649   1.00 0.00 ? 113 HIS A HD1  4  
ATOM 4063  H HD2  . HIS A 1 29 ? 2.089   -5.021  9.855   1.00 0.00 ? 113 HIS A HD2  4  
ATOM 4064  H HE1  . HIS A 1 29 ? 5.765   -7.127  9.915   1.00 0.00 ? 113 HIS A HE1  4  
ATOM 4065  H HE2  . HIS A 1 29 ? 3.701   -6.515  11.225  1.00 0.00 ? 113 HIS A HE2  4  
ATOM 4066  N N    . LEU A 1 30 ? 1.847   -2.089  5.358   1.00 0.00 ? 114 LEU A N    4  
ATOM 4067  C CA   . LEU A 1 30 ? 2.006   -1.071  4.329   1.00 0.00 ? 114 LEU A CA   4  
ATOM 4068  C C    . LEU A 1 30 ? 1.443   0.259   4.814   1.00 0.00 ? 114 LEU A C    4  
ATOM 4069  O O    . LEU A 1 30 ? 2.057   1.311   4.630   1.00 0.00 ? 114 LEU A O    4  
ATOM 4070  C CB   . LEU A 1 30 ? 1.308   -1.497  3.035   1.00 0.00 ? 114 LEU A CB   4  
ATOM 4071  C CG   . LEU A 1 30 ? 1.385   -0.487  1.887   1.00 0.00 ? 114 LEU A CG   4  
ATOM 4072  C CD1  . LEU A 1 30 ? 2.826   -0.289  1.442   1.00 0.00 ? 114 LEU A CD1  4  
ATOM 4073  C CD2  . LEU A 1 30 ? 0.520   -0.942  0.722   1.00 0.00 ? 114 LEU A CD2  4  
ATOM 4074  H H    . LEU A 1 30 ? 1.077   -2.698  5.319   1.00 0.00 ? 114 LEU A H    4  
ATOM 4075  H HA   . LEU A 1 30 ? 3.062   -0.952  4.137   1.00 0.00 ? 114 LEU A HA   4  
ATOM 4076  H HB2  . LEU A 1 30 ? 1.754   -2.422  2.702   1.00 0.00 ? 114 LEU A HB2  4  
ATOM 4077  H HB3  . LEU A 1 30 ? 0.266   -1.677  3.254   1.00 0.00 ? 114 LEU A HB3  4  
ATOM 4078  H HG   . LEU A 1 30 ? 1.010   0.467   2.228   1.00 0.00 ? 114 LEU A HG   4  
ATOM 4079  H HD11 . LEU A 1 30 ? 2.858   0.441   0.646   1.00 0.00 ? 114 LEU A HD11 4  
ATOM 4080  H HD12 . LEU A 1 30 ? 3.224   -1.228  1.084   1.00 0.00 ? 114 LEU A HD12 4  
ATOM 4081  H HD13 . LEU A 1 30 ? 3.415   0.059   2.275   1.00 0.00 ? 114 LEU A HD13 4  
ATOM 4082  H HD21 . LEU A 1 30 ? 0.590   -0.225  -0.082  1.00 0.00 ? 114 LEU A HD21 4  
ATOM 4083  H HD22 . LEU A 1 30 ? -0.507  -1.021  1.048   1.00 0.00 ? 114 LEU A HD22 4  
ATOM 4084  H HD23 . LEU A 1 30 ? 0.862   -1.906  0.378   1.00 0.00 ? 114 LEU A HD23 4  
ATOM 4085  N N    . LYS A 1 31 ? 0.278   0.196   5.448   1.00 0.00 ? 115 LYS A N    4  
ATOM 4086  C CA   . LYS A 1 31 ? -0.390  1.383   5.959   1.00 0.00 ? 115 LYS A CA   4  
ATOM 4087  C C    . LYS A 1 31 ? 0.489   2.093   6.981   1.00 0.00 ? 115 LYS A C    4  
ATOM 4088  O O    . LYS A 1 31 ? 0.537   3.316   7.007   1.00 0.00 ? 115 LYS A O    4  
ATOM 4089  C CB   . LYS A 1 31 ? -1.748  1.009   6.566   1.00 0.00 ? 115 LYS A CB   4  
ATOM 4090  C CG   . LYS A 1 31 ? -2.555  2.194   7.086   1.00 0.00 ? 115 LYS A CG   4  
ATOM 4091  C CD   . LYS A 1 31 ? -4.018  1.818   7.292   1.00 0.00 ? 115 LYS A CD   4  
ATOM 4092  C CE   . LYS A 1 31 ? -4.823  2.946   7.928   1.00 0.00 ? 115 LYS A CE   4  
ATOM 4093  N NZ   . LYS A 1 31 ? -4.579  3.062   9.392   1.00 0.00 ? 115 LYS A NZ   4  
ATOM 4094  H H    . LYS A 1 31 ? -0.153  -0.681  5.572   1.00 0.00 ? 115 LYS A H    4  
ATOM 4095  H HA   . LYS A 1 31 ? -0.553  2.049   5.125   1.00 0.00 ? 115 LYS A HA   4  
ATOM 4096  H HB2  . LYS A 1 31 ? -2.338  0.507   5.812   1.00 0.00 ? 115 LYS A HB2  4  
ATOM 4097  H HB3  . LYS A 1 31 ? -1.582  0.328   7.388   1.00 0.00 ? 115 LYS A HB3  4  
ATOM 4098  H HG2  . LYS A 1 31 ? -2.138  2.516   8.029   1.00 0.00 ? 115 LYS A HG2  4  
ATOM 4099  H HG3  . LYS A 1 31 ? -2.497  3.000   6.369   1.00 0.00 ? 115 LYS A HG3  4  
ATOM 4100  H HD2  . LYS A 1 31 ? -4.453  1.582   6.334   1.00 0.00 ? 115 LYS A HD2  4  
ATOM 4101  H HD3  . LYS A 1 31 ? -4.065  0.949   7.933   1.00 0.00 ? 115 LYS A HD3  4  
ATOM 4102  H HE2  . LYS A 1 31 ? -4.548  3.875   7.456   1.00 0.00 ? 115 LYS A HE2  4  
ATOM 4103  H HE3  . LYS A 1 31 ? -5.874  2.756   7.762   1.00 0.00 ? 115 LYS A HE3  4  
ATOM 4104  H HZ1  . LYS A 1 31 ? -5.195  3.803   9.802   1.00 0.00 ? 115 LYS A HZ1  4  
ATOM 4105  H HZ2  . LYS A 1 31 ? -3.583  3.317   9.576   1.00 0.00 ? 115 LYS A HZ2  4  
ATOM 4106  H HZ3  . LYS A 1 31 ? -4.784  2.158   9.864   1.00 0.00 ? 115 LYS A HZ3  4  
ATOM 4107  N N    . GLN A 1 32 ? 1.197   1.324   7.802   1.00 0.00 ? 116 GLN A N    4  
ATOM 4108  C CA   . GLN A 1 32 ? 2.100   1.892   8.804   1.00 0.00 ? 116 GLN A CA   4  
ATOM 4109  C C    . GLN A 1 32 ? 3.261   2.639   8.149   1.00 0.00 ? 116 GLN A C    4  
ATOM 4110  O O    . GLN A 1 32 ? 3.682   3.683   8.642   1.00 0.00 ? 116 GLN A O    4  
ATOM 4111  C CB   . GLN A 1 32 ? 2.648   0.800   9.724   1.00 0.00 ? 116 GLN A CB   4  
ATOM 4112  C CG   . GLN A 1 32 ? 1.587   0.111   10.565  1.00 0.00 ? 116 GLN A CG   4  
ATOM 4113  C CD   . GLN A 1 32 ? 2.166   -0.962  11.467  1.00 0.00 ? 116 GLN A CD   4  
ATOM 4114  O OE1  . GLN A 1 32 ? 2.273   -2.129  11.083  1.00 0.00 ? 116 GLN A OE1  4  
ATOM 4115  N NE2  . GLN A 1 32 ? 2.543   -0.572  12.674  1.00 0.00 ? 116 GLN A NE2  4  
ATOM 4116  H H    . GLN A 1 32 ? 1.103   0.346   7.741   1.00 0.00 ? 116 GLN A H    4  
ATOM 4117  H HA   . GLN A 1 32 ? 1.530   2.596   9.398   1.00 0.00 ? 116 GLN A HA   4  
ATOM 4118  H HB2  . GLN A 1 32 ? 3.141   0.051   9.119   1.00 0.00 ? 116 GLN A HB2  4  
ATOM 4119  H HB3  . GLN A 1 32 ? 3.373   1.243   10.391  1.00 0.00 ? 116 GLN A HB3  4  
ATOM 4120  H HG2  . GLN A 1 32 ? 1.097   0.851   11.178  1.00 0.00 ? 116 GLN A HG2  4  
ATOM 4121  H HG3  . GLN A 1 32 ? 0.864   -0.345  9.904   1.00 0.00 ? 116 GLN A HG3  4  
ATOM 4122  H HE21 . GLN A 1 32 ? 2.427   0.370   12.916  1.00 0.00 ? 116 GLN A HE21 4  
ATOM 4123  H HE22 . GLN A 1 32 ? 2.935   -1.240  13.279  1.00 0.00 ? 116 GLN A HE22 4  
ATOM 4124  N N    . GLN A 1 33 ? 3.778   2.109   7.041   1.00 0.00 ? 117 GLN A N    4  
ATOM 4125  C CA   . GLN A 1 33 ? 4.857   2.779   6.316   1.00 0.00 ? 117 GLN A CA   4  
ATOM 4126  C C    . GLN A 1 33 ? 4.368   4.119   5.788   1.00 0.00 ? 117 GLN A C    4  
ATOM 4127  O O    . GLN A 1 33 ? 4.998   5.161   6.007   1.00 0.00 ? 117 GLN A O    4  
ATOM 4128  C CB   . GLN A 1 33 ? 5.381   1.917   5.163   1.00 0.00 ? 117 GLN A CB   4  
ATOM 4129  C CG   . GLN A 1 33 ? 6.090   0.653   5.618   1.00 0.00 ? 117 GLN A CG   4  
ATOM 4130  C CD   . GLN A 1 33 ? 6.772   -0.080  4.479   1.00 0.00 ? 117 GLN A CD   4  
ATOM 4131  O OE1  . GLN A 1 33 ? 7.205   0.523   3.500   1.00 0.00 ? 117 GLN A OE1  4  
ATOM 4132  N NE2  . GLN A 1 33 ? 6.879   -1.393  4.601   1.00 0.00 ? 117 GLN A NE2  4  
ATOM 4133  H H    . GLN A 1 33 ? 3.422   1.262   6.701   1.00 0.00 ? 117 GLN A H    4  
ATOM 4134  H HA   . GLN A 1 33 ? 5.661   2.957   7.015   1.00 0.00 ? 117 GLN A HA   4  
ATOM 4135  H HB2  . GLN A 1 33 ? 4.549   1.630   4.534   1.00 0.00 ? 117 GLN A HB2  4  
ATOM 4136  H HB3  . GLN A 1 33 ? 6.076   2.503   4.578   1.00 0.00 ? 117 GLN A HB3  4  
ATOM 4137  H HG2  . GLN A 1 33 ? 6.837   0.921   6.352   1.00 0.00 ? 117 GLN A HG2  4  
ATOM 4138  H HG3  . GLN A 1 33 ? 5.366   -0.008  6.072   1.00 0.00 ? 117 GLN A HG3  4  
ATOM 4139  H HE21 . GLN A 1 33 ? 6.519   -1.812  5.408   1.00 0.00 ? 117 GLN A HE21 4  
ATOM 4140  H HE22 . GLN A 1 33 ? 7.318   -1.888  3.879   1.00 0.00 ? 117 GLN A HE22 4  
ATOM 4141  N N    . VAL A 1 34 ? 3.222   4.088   5.120   1.00 0.00 ? 118 VAL A N    4  
ATOM 4142  C CA   . VAL A 1 34 ? 2.583   5.304   4.653   1.00 0.00 ? 118 VAL A CA   4  
ATOM 4143  C C    . VAL A 1 34 ? 2.323   6.234   5.831   1.00 0.00 ? 118 VAL A C    4  
ATOM 4144  O O    . VAL A 1 34 ? 2.616   7.421   5.765   1.00 0.00 ? 118 VAL A O    4  
ATOM 4145  C CB   . VAL A 1 34 ? 1.253   5.007   3.927   1.00 0.00 ? 118 VAL A CB   4  
ATOM 4146  C CG1  . VAL A 1 34 ? 0.608   6.297   3.435   1.00 0.00 ? 118 VAL A CG1  4  
ATOM 4147  C CG2  . VAL A 1 34 ? 1.477   4.045   2.771   1.00 0.00 ? 118 VAL A CG2  4  
ATOM 4148  H H    . VAL A 1 34 ? 2.800   3.219   4.934   1.00 0.00 ? 118 VAL A H    4  
ATOM 4149  H HA   . VAL A 1 34 ? 3.255   5.793   3.957   1.00 0.00 ? 118 VAL A HA   4  
ATOM 4150  H HB   . VAL A 1 34 ? 0.579   4.541   4.630   1.00 0.00 ? 118 VAL A HB   4  
ATOM 4151  H HG11 . VAL A 1 34 ? -0.302  6.063   2.905   1.00 0.00 ? 118 VAL A HG11 4  
ATOM 4152  H HG12 . VAL A 1 34 ? 1.290   6.810   2.772   1.00 0.00 ? 118 VAL A HG12 4  
ATOM 4153  H HG13 . VAL A 1 34 ? 0.382   6.931   4.278   1.00 0.00 ? 118 VAL A HG13 4  
ATOM 4154  H HG21 . VAL A 1 34 ? 2.154   4.490   2.056   1.00 0.00 ? 118 VAL A HG21 4  
ATOM 4155  H HG22 . VAL A 1 34 ? 0.535   3.833   2.291   1.00 0.00 ? 118 VAL A HG22 4  
ATOM 4156  H HG23 . VAL A 1 34 ? 1.905   3.127   3.146   1.00 0.00 ? 118 VAL A HG23 4  
ATOM 4157  N N    . SER A 1 35 ? 1.822   5.660   6.922   1.00 0.00 ? 119 SER A N    4  
ATOM 4158  C CA   . SER A 1 35 ? 1.507   6.404   8.139   1.00 0.00 ? 119 SER A CA   4  
ATOM 4159  C C    . SER A 1 35 ? 2.749   7.050   8.756   1.00 0.00 ? 119 SER A C    4  
ATOM 4160  O O    . SER A 1 35 ? 2.643   8.017   9.510   1.00 0.00 ? 119 SER A O    4  
ATOM 4161  C CB   . SER A 1 35 ? 0.833   5.476   9.150   1.00 0.00 ? 119 SER A CB   4  
ATOM 4162  O OG   . SER A 1 35 ? -0.445  5.074   8.693   1.00 0.00 ? 119 SER A OG   4  
ATOM 4163  H H    . SER A 1 35 ? 1.648   4.691   6.906   1.00 0.00 ? 119 SER A H    4  
ATOM 4164  H HA   . SER A 1 35 ? 0.811   7.185   7.873   1.00 0.00 ? 119 SER A HA   4  
ATOM 4165  H HB2  . SER A 1 35 ? 1.440   4.594   9.278   1.00 0.00 ? 119 SER A HB2  4  
ATOM 4166  H HB3  . SER A 1 35 ? 0.728   5.977   10.097  1.00 0.00 ? 119 SER A HB3  4  
ATOM 4167  H HG   . SER A 1 35 ? -0.341  4.460   7.953   1.00 0.00 ? 119 SER A HG   4  
ATOM 4168  N N    . GLY A 1 36 ? 3.916   6.518   8.433   1.00 0.00 ? 120 GLY A N    4  
ATOM 4169  C CA   . GLY A 1 36 ? 5.149   7.092   8.927   1.00 0.00 ? 120 GLY A CA   4  
ATOM 4170  C C    . GLY A 1 36 ? 5.559   8.328   8.151   1.00 0.00 ? 120 GLY A C    4  
ATOM 4171  O O    . GLY A 1 36 ? 6.037   9.303   8.729   1.00 0.00 ? 120 GLY A O    4  
ATOM 4172  H H    . GLY A 1 36 ? 3.942   5.722   7.862   1.00 0.00 ? 120 GLY A H    4  
ATOM 4173  H HA2  . GLY A 1 36 ? 5.020   7.358   9.966   1.00 0.00 ? 120 GLY A HA2  4  
ATOM 4174  H HA3  . GLY A 1 36 ? 5.934   6.354   8.850   1.00 0.00 ? 120 GLY A HA3  4  
ATOM 4175  N N    . LEU A 1 37 ? 5.369   8.289   6.837   1.00 0.00 ? 121 LEU A N    4  
ATOM 4176  C CA   . LEU A 1 37 ? 5.759   9.405   5.976   1.00 0.00 ? 121 LEU A CA   4  
ATOM 4177  C C    . LEU A 1 37 ? 4.589   10.359  5.715   1.00 0.00 ? 121 LEU A C    4  
ATOM 4178  O O    . LEU A 1 37 ? 4.607   11.516  6.133   1.00 0.00 ? 121 LEU A O    4  
ATOM 4179  C CB   . LEU A 1 37 ? 6.309   8.892   4.637   1.00 0.00 ? 121 LEU A CB   4  
ATOM 4180  C CG   . LEU A 1 37 ? 7.689   8.213   4.684   1.00 0.00 ? 121 LEU A CG   4  
ATOM 4181  C CD1  . LEU A 1 37 ? 8.683   9.065   5.458   1.00 0.00 ? 121 LEU A CD1  4  
ATOM 4182  C CD2  . LEU A 1 37 ? 7.600   6.813   5.279   1.00 0.00 ? 121 LEU A CD2  4  
ATOM 4183  H H    . LEU A 1 37 ? 4.965   7.484   6.433   1.00 0.00 ? 121 LEU A H    4  
ATOM 4184  H HA   . LEU A 1 37 ? 6.542   9.950   6.483   1.00 0.00 ? 121 LEU A HA   4  
ATOM 4185  H HB2  . LEU A 1 37 ? 5.601   8.181   4.238   1.00 0.00 ? 121 LEU A HB2  4  
ATOM 4186  H HB3  . LEU A 1 37 ? 6.370   9.726   3.956   1.00 0.00 ? 121 LEU A HB3  4  
ATOM 4187  H HG   . LEU A 1 37 ? 8.061   8.118   3.673   1.00 0.00 ? 121 LEU A HG   4  
ATOM 4188  H HD11 . LEU A 1 37 ? 8.340   9.185   6.475   1.00 0.00 ? 121 LEU A HD11 4  
ATOM 4189  H HD12 . LEU A 1 37 ? 8.767   10.035  4.992   1.00 0.00 ? 121 LEU A HD12 4  
ATOM 4190  H HD13 . LEU A 1 37 ? 9.650   8.581   5.458   1.00 0.00 ? 121 LEU A HD13 4  
ATOM 4191  H HD21 . LEU A 1 37 ? 8.582   6.365   5.291   1.00 0.00 ? 121 LEU A HD21 4  
ATOM 4192  H HD22 . LEU A 1 37 ? 6.933   6.208   4.682   1.00 0.00 ? 121 LEU A HD22 4  
ATOM 4193  H HD23 . LEU A 1 37 ? 7.221   6.876   6.289   1.00 0.00 ? 121 LEU A HD23 4  
ATOM 4194  N N    . GLU A 1 38 ? 3.574   9.852   5.032   1.00 0.00 ? 122 GLU A N    4  
ATOM 4195  C CA   . GLU A 1 38 ? 2.430   10.649  4.582   1.00 0.00 ? 122 GLU A CA   4  
ATOM 4196  C C    . GLU A 1 38 ? 1.245   10.442  5.519   1.00 0.00 ? 122 GLU A C    4  
ATOM 4197  O O    . GLU A 1 38 ? 0.124   10.853  5.225   1.00 0.00 ? 122 GLU A O    4  
ATOM 4198  C CB   . GLU A 1 38 ? 2.052   10.257  3.157   1.00 0.00 ? 122 GLU A CB   4  
ATOM 4199  C CG   . GLU A 1 38 ? 1.276   11.324  2.405   1.00 0.00 ? 122 GLU A CG   4  
ATOM 4200  C CD   . GLU A 1 38 ? 2.157   12.477  1.976   1.00 0.00 ? 122 GLU A CD   4  
ATOM 4201  O OE1  . GLU A 1 38 ? 2.474   13.344  2.818   1.00 0.00 ? 122 GLU A OE1  4  
ATOM 4202  O OE2  . GLU A 1 38 ? 2.558   12.515  0.794   1.00 0.00 ? 122 GLU A OE2  4  
ATOM 4203  H H    . GLU A 1 38 ? 3.575   8.891   4.834   1.00 0.00 ? 122 GLU A H    4  
ATOM 4204  H HA   . GLU A 1 38 ? 2.716   11.690  4.603   1.00 0.00 ? 122 GLU A HA   4  
ATOM 4205  H HB2  . GLU A 1 38 ? 2.956   10.059  2.612   1.00 0.00 ? 122 GLU A HB2  4  
ATOM 4206  H HB3  . GLU A 1 38 ? 1.455   9.357   3.188   1.00 0.00 ? 122 GLU A HB3  4  
ATOM 4207  H HG2  . GLU A 1 38 ? 0.836   10.878  1.525   1.00 0.00 ? 122 GLU A HG2  4  
ATOM 4208  H HG3  . GLU A 1 38 ? 0.495   11.702  3.048   1.00 0.00 ? 122 GLU A HG3  4  
ATOM 4209  N N    . GLY A 1 39 ? 1.521   9.753   6.621   1.00 0.00 ? 123 GLY A N    4  
ATOM 4210  C CA   . GLY A 1 39 ? 0.512   9.302   7.578   1.00 0.00 ? 123 GLY A CA   4  
ATOM 4211  C C    . GLY A 1 39 ? -0.391  10.375  8.168   1.00 0.00 ? 123 GLY A C    4  
ATOM 4212  O O    . GLY A 1 39 ? -1.114  10.090  9.120   1.00 0.00 ? 123 GLY A O    4  
ATOM 4213  H H    . GLY A 1 39 ? 2.458   9.531   6.795   1.00 0.00 ? 123 GLY A H    4  
ATOM 4214  H HA2  . GLY A 1 39 ? -0.115  8.578   7.084   1.00 0.00 ? 123 GLY A HA2  4  
ATOM 4215  H HA3  . GLY A 1 39 ? 1.025   8.803   8.390   1.00 0.00 ? 123 GLY A HA3  4  
ATOM 4216  N N    . VAL A 1 40 ? -0.292  11.598  7.662   1.00 0.00 ? 124 VAL A N    4  
ATOM 4217  C CA   . VAL A 1 40 ? -1.183  12.699  8.028   1.00 0.00 ? 124 VAL A CA   4  
ATOM 4218  C C    . VAL A 1 40 ? -2.637  12.242  8.128   1.00 0.00 ? 124 VAL A C    4  
ATOM 4219  O O    . VAL A 1 40 ? -3.353  12.253  7.128   1.00 0.00 ? 124 VAL A O    4  
ATOM 4220  C CB   . VAL A 1 40 ? -1.117  13.817  6.970   1.00 0.00 ? 124 VAL A CB   4  
ATOM 4221  C CG1  . VAL A 1 40 ? -2.045  14.965  7.342   1.00 0.00 ? 124 VAL A CG1  4  
ATOM 4222  C CG2  . VAL A 1 40 ? 0.317   14.290  6.763   1.00 0.00 ? 124 VAL A CG2  4  
ATOM 4223  H H    . VAL A 1 40 ? 0.401   11.767  6.995   1.00 0.00 ? 124 VAL A H    4  
ATOM 4224  H HA   . VAL A 1 40 ? -0.865  13.101  8.978   1.00 0.00 ? 124 VAL A HA   4  
ATOM 4225  H HB   . VAL A 1 40 ? -1.468  13.402  6.035   1.00 0.00 ? 124 VAL A HB   4  
ATOM 4226  H HG11 . VAL A 1 40 ? -3.064  14.589  7.404   1.00 0.00 ? 124 VAL A HG11 4  
ATOM 4227  H HG12 . VAL A 1 40 ? -1.991  15.734  6.586   1.00 0.00 ? 124 VAL A HG12 4  
ATOM 4228  H HG13 . VAL A 1 40 ? -1.754  15.371  8.297   1.00 0.00 ? 124 VAL A HG13 4  
ATOM 4229  H HG21 . VAL A 1 40 ? 0.322   15.144  6.102   1.00 0.00 ? 124 VAL A HG21 4  
ATOM 4230  H HG22 . VAL A 1 40 ? 0.899   13.489  6.318   1.00 0.00 ? 124 VAL A HG22 4  
ATOM 4231  H HG23 . VAL A 1 40 ? 0.749   14.565  7.714   1.00 0.00 ? 124 VAL A HG23 4  
ATOM 4232  N N    . GLN A 1 41 ? -3.052  11.850  9.337   1.00 0.00 ? 125 GLN A N    4  
ATOM 4233  C CA   . GLN A 1 41 ? -4.401  11.348  9.594   1.00 0.00 ? 125 GLN A CA   4  
ATOM 4234  C C    . GLN A 1 41 ? -4.770  10.208  8.648   1.00 0.00 ? 125 GLN A C    4  
ATOM 4235  O O    . GLN A 1 41 ? -5.075  10.426  7.476   1.00 0.00 ? 125 GLN A O    4  
ATOM 4236  C CB   . GLN A 1 41 ? -5.436  12.474  9.489   1.00 0.00 ? 125 GLN A CB   4  
ATOM 4237  C CG   . GLN A 1 41 ? -5.304  13.550  10.560  1.00 0.00 ? 125 GLN A CG   4  
ATOM 4238  C CD   . GLN A 1 41 ? -5.821  13.127  11.930  1.00 0.00 ? 125 GLN A CD   4  
ATOM 4239  O OE1  . GLN A 1 41 ? -6.307  13.958  12.694  1.00 0.00 ? 125 GLN A OE1  4  
ATOM 4240  N NE2  . GLN A 1 41 ? -5.722  11.846  12.253  1.00 0.00 ? 125 GLN A NE2  4  
ATOM 4241  H H    . GLN A 1 41 ? -2.414  11.879  10.080  1.00 0.00 ? 125 GLN A H    4  
ATOM 4242  H HA   . GLN A 1 41 ? -4.413  10.966  10.604  1.00 0.00 ? 125 GLN A HA   4  
ATOM 4243  H HB2  . GLN A 1 41 ? -5.335  12.948  8.524   1.00 0.00 ? 125 GLN A HB2  4  
ATOM 4244  H HB3  . GLN A 1 41 ? -6.424  12.045  9.563   1.00 0.00 ? 125 GLN A HB3  4  
ATOM 4245  H HG2  . GLN A 1 41 ? -4.261  13.806  10.659  1.00 0.00 ? 125 GLN A HG2  4  
ATOM 4246  H HG3  . GLN A 1 41 ? -5.855  14.421  10.239  1.00 0.00 ? 125 GLN A HG3  4  
ATOM 4247  H HE21 . GLN A 1 41 ? -5.324  11.231  11.606  1.00 0.00 ? 125 GLN A HE21 4  
ATOM 4248  H HE22 . GLN A 1 41 ? -6.054  11.561  13.134  1.00 0.00 ? 125 GLN A HE22 4  
ATOM 4249  N N    . ASP A 1 42 ? -4.789  8.988   9.168   1.00 0.00 ? 126 ASP A N    4  
ATOM 4250  C CA   . ASP A 1 42 ? -5.141  7.824   8.356   1.00 0.00 ? 126 ASP A CA   4  
ATOM 4251  C C    . ASP A 1 42 ? -6.622  7.863   7.983   1.00 0.00 ? 126 ASP A C    4  
ATOM 4252  O O    . ASP A 1 42 ? -7.142  6.963   7.322   1.00 0.00 ? 126 ASP A O    4  
ATOM 4253  C CB   . ASP A 1 42 ? -4.774  6.508   9.064   1.00 0.00 ? 126 ASP A CB   4  
ATOM 4254  C CG   . ASP A 1 42 ? -5.647  6.183   10.261  1.00 0.00 ? 126 ASP A CG   4  
ATOM 4255  O OD1  . ASP A 1 42 ? -5.761  7.027   11.170  1.00 0.00 ? 126 ASP A OD1  4  
ATOM 4256  O OD2  . ASP A 1 42 ? -6.190  5.056   10.307  1.00 0.00 ? 126 ASP A OD2  4  
ATOM 4257  H H    . ASP A 1 42 ? -4.566  8.864   10.121  1.00 0.00 ? 126 ASP A H    4  
ATOM 4258  H HA   . ASP A 1 42 ? -4.565  7.892   7.440   1.00 0.00 ? 126 ASP A HA   4  
ATOM 4259  H HB2  . ASP A 1 42 ? -4.858  5.697   8.358   1.00 0.00 ? 126 ASP A HB2  4  
ATOM 4260  H HB3  . ASP A 1 42 ? -3.748  6.572   9.399   1.00 0.00 ? 126 ASP A HB3  4  
ATOM 4261  N N    . ASP A 1 43 ? -7.285  8.928   8.414   1.00 0.00 ? 127 ASP A N    4  
ATOM 4262  C CA   . ASP A 1 43 ? -8.634  9.244   7.973   1.00 0.00 ? 127 ASP A CA   4  
ATOM 4263  C C    . ASP A 1 43 ? -8.592  9.811   6.560   1.00 0.00 ? 127 ASP A C    4  
ATOM 4264  O O    . ASP A 1 43 ? -9.510  9.596   5.764   1.00 0.00 ? 127 ASP A O    4  
ATOM 4265  C CB   . ASP A 1 43 ? -9.275  10.295  8.890   1.00 0.00 ? 127 ASP A CB   4  
ATOM 4266  C CG   . ASP A 1 43 ? -9.241  9.921   10.355  1.00 0.00 ? 127 ASP A CG   4  
ATOM 4267  O OD1  . ASP A 1 43 ? -8.170  10.051  10.980  1.00 0.00 ? 127 ASP A OD1  4  
ATOM 4268  O OD2  . ASP A 1 43 ? -10.295 9.537   10.904  1.00 0.00 ? 127 ASP A OD2  4  
ATOM 4269  H H    . ASP A 1 43 ? -6.851  9.520   9.065   1.00 0.00 ? 127 ASP A H    4  
ATOM 4270  H HA   . ASP A 1 43 ? -9.224  8.342   7.985   1.00 0.00 ? 127 ASP A HA   4  
ATOM 4271  H HB2  . ASP A 1 43 ? -8.753  11.233  8.771   1.00 0.00 ? 127 ASP A HB2  4  
ATOM 4272  H HB3  . ASP A 1 43 ? -10.308 10.430  8.598   1.00 0.00 ? 127 ASP A HB3  4  
ATOM 4273  N N    . LEU A 1 44 ? -7.519  10.544  6.257   1.00 0.00 ? 128 LEU A N    4  
ATOM 4274  C CA   . LEU A 1 44 ? -7.414  11.256  4.995   1.00 0.00 ? 128 LEU A CA   4  
ATOM 4275  C C    . LEU A 1 44 ? -7.011  10.339  3.844   1.00 0.00 ? 128 LEU A C    4  
ATOM 4276  O O    . LEU A 1 44 ? -7.439  10.550  2.713   1.00 0.00 ? 128 LEU A O    4  
ATOM 4277  C CB   . LEU A 1 44 ? -6.416  12.406  5.121   1.00 0.00 ? 128 LEU A CB   4  
ATOM 4278  C CG   . LEU A 1 44 ? -6.784  13.472  6.157   1.00 0.00 ? 128 LEU A CG   4  
ATOM 4279  C CD1  . LEU A 1 44 ? -5.680  14.511  6.270   1.00 0.00 ? 128 LEU A CD1  4  
ATOM 4280  C CD2  . LEU A 1 44 ? -8.106  14.134  5.797   1.00 0.00 ? 128 LEU A CD2  4  
ATOM 4281  H H    . LEU A 1 44 ? -6.773  10.615  6.906   1.00 0.00 ? 128 LEU A H    4  
ATOM 4282  H HA   . LEU A 1 44 ? -8.388  11.670  4.774   1.00 0.00 ? 128 LEU A HA   4  
ATOM 4283  H HB2  . LEU A 1 44 ? -5.453  11.990  5.385   1.00 0.00 ? 128 LEU A HB2  4  
ATOM 4284  H HB3  . LEU A 1 44 ? -6.330  12.885  4.158   1.00 0.00 ? 128 LEU A HB3  4  
ATOM 4285  H HG   . LEU A 1 44 ? -6.898  13.004  7.124   1.00 0.00 ? 128 LEU A HG   4  
ATOM 4286  H HD11 . LEU A 1 44 ? -5.951  15.245  7.014   1.00 0.00 ? 128 LEU A HD11 4  
ATOM 4287  H HD12 . LEU A 1 44 ? -5.544  14.999  5.317   1.00 0.00 ? 128 LEU A HD12 4  
ATOM 4288  H HD13 . LEU A 1 44 ? -4.760  14.025  6.562   1.00 0.00 ? 128 LEU A HD13 4  
ATOM 4289  H HD21 . LEU A 1 44 ? -8.031  14.586  4.820   1.00 0.00 ? 128 LEU A HD21 4  
ATOM 4290  H HD22 . LEU A 1 44 ? -8.340  14.893  6.528   1.00 0.00 ? 128 LEU A HD22 4  
ATOM 4291  H HD23 . LEU A 1 44 ? -8.891  13.390  5.790   1.00 0.00 ? 128 LEU A HD23 4  
ATOM 4292  N N    . PHE A 1 45 ? -6.196  9.326   4.106   1.00 0.00 ? 129 PHE A N    4  
ATOM 4293  C CA   . PHE A 1 45 ? -5.761  8.452   3.024   1.00 0.00 ? 129 PHE A CA   4  
ATOM 4294  C C    . PHE A 1 45 ? -6.457  7.095   3.069   1.00 0.00 ? 129 PHE A C    4  
ATOM 4295  O O    . PHE A 1 45 ? -6.393  6.368   4.060   1.00 0.00 ? 129 PHE A O    4  
ATOM 4296  C CB   . PHE A 1 45 ? -4.229  8.300   2.982   1.00 0.00 ? 129 PHE A CB   4  
ATOM 4297  C CG   . PHE A 1 45 ? -3.580  7.738   4.222   1.00 0.00 ? 129 PHE A CG   4  
ATOM 4298  C CD1  . PHE A 1 45 ? -3.167  8.575   5.248   1.00 0.00 ? 129 PHE A CD1  4  
ATOM 4299  C CD2  . PHE A 1 45 ? -3.354  6.373   4.347   1.00 0.00 ? 129 PHE A CD2  4  
ATOM 4300  C CE1  . PHE A 1 45 ? -2.544  8.061   6.371   1.00 0.00 ? 129 PHE A CE1  4  
ATOM 4301  C CE2  . PHE A 1 45 ? -2.736  5.856   5.470   1.00 0.00 ? 129 PHE A CE2  4  
ATOM 4302  C CZ   . PHE A 1 45 ? -2.331  6.701   6.482   1.00 0.00 ? 129 PHE A CZ   4  
ATOM 4303  H H    . PHE A 1 45 ? -5.894  9.163   5.024   1.00 0.00 ? 129 PHE A H    4  
ATOM 4304  H HA   . PHE A 1 45 ? -6.067  8.937   2.106   1.00 0.00 ? 129 PHE A HA   4  
ATOM 4305  H HB2  . PHE A 1 45 ? -3.972  7.645   2.164   1.00 0.00 ? 129 PHE A HB2  4  
ATOM 4306  H HB3  . PHE A 1 45 ? -3.792  9.273   2.795   1.00 0.00 ? 129 PHE A HB3  4  
ATOM 4307  H HD1  . PHE A 1 45 ? -3.337  9.638   5.165   1.00 0.00 ? 129 PHE A HD1  4  
ATOM 4308  H HD2  . PHE A 1 45 ? -3.670  5.711   3.555   1.00 0.00 ? 129 PHE A HD2  4  
ATOM 4309  H HE1  . PHE A 1 45 ? -2.225  8.723   7.164   1.00 0.00 ? 129 PHE A HE1  4  
ATOM 4310  H HE2  . PHE A 1 45 ? -2.566  4.793   5.557   1.00 0.00 ? 129 PHE A HE2  4  
ATOM 4311  H HZ   . PHE A 1 45 ? -1.847  6.298   7.359   1.00 0.00 ? 129 PHE A HZ   4  
ATOM 4312  N N    . TRP A 1 46 ? -7.143  6.786   1.981   1.00 0.00 ? 130 TRP A N    4  
ATOM 4313  C CA   . TRP A 1 46 ? -7.805  5.504   1.801   1.00 0.00 ? 130 TRP A CA   4  
ATOM 4314  C C    . TRP A 1 46 ? -7.450  4.970   0.418   1.00 0.00 ? 130 TRP A C    4  
ATOM 4315  O O    . TRP A 1 46 ? -7.946  5.455   -0.591  1.00 0.00 ? 130 TRP A O    4  
ATOM 4316  C CB   . TRP A 1 46 ? -9.323  5.668   1.954   1.00 0.00 ? 130 TRP A CB   4  
ATOM 4317  C CG   . TRP A 1 46 ? -10.106 4.404   1.759   1.00 0.00 ? 130 TRP A CG   4  
ATOM 4318  C CD1  . TRP A 1 46 ? -10.050 3.274   2.524   1.00 0.00 ? 130 TRP A CD1  4  
ATOM 4319  C CD2  . TRP A 1 46 ? -11.084 4.153   0.742   1.00 0.00 ? 130 TRP A CD2  4  
ATOM 4320  N NE1  . TRP A 1 46 ? -10.923 2.330   2.037   1.00 0.00 ? 130 TRP A NE1  4  
ATOM 4321  C CE2  . TRP A 1 46 ? -11.568 2.848   0.941   1.00 0.00 ? 130 TRP A CE2  4  
ATOM 4322  C CE3  . TRP A 1 46 ? -11.588 4.905   -0.327  1.00 0.00 ? 130 TRP A CE3  4  
ATOM 4323  C CZ2  . TRP A 1 46 ? -12.541 2.282   0.121   1.00 0.00 ? 130 TRP A CZ2  4  
ATOM 4324  C CZ3  . TRP A 1 46 ? -12.554 4.342   -1.140  1.00 0.00 ? 130 TRP A CZ3  4  
ATOM 4325  C CH2  . TRP A 1 46 ? -13.019 3.040   -0.913  1.00 0.00 ? 130 TRP A CH2  4  
ATOM 4326  H H    . TRP A 1 46 ? -7.207  7.453   1.259   1.00 0.00 ? 130 TRP A H    4  
ATOM 4327  H HA   . TRP A 1 46 ? -7.436  4.823   2.553   1.00 0.00 ? 130 TRP A HA   4  
ATOM 4328  H HB2  . TRP A 1 46 ? -9.537  6.036   2.946   1.00 0.00 ? 130 TRP A HB2  4  
ATOM 4329  H HB3  . TRP A 1 46 ? -9.670  6.390   1.229   1.00 0.00 ? 130 TRP A HB3  4  
ATOM 4330  H HD1  . TRP A 1 46 ? -9.402  3.148   3.380   1.00 0.00 ? 130 TRP A HD1  4  
ATOM 4331  H HE1  . TRP A 1 46 ? -11.062 1.431   2.415   1.00 0.00 ? 130 TRP A HE1  4  
ATOM 4332  H HE3  . TRP A 1 46 ? -11.242 5.909   -0.516  1.00 0.00 ? 130 TRP A HE3  4  
ATOM 4333  H HZ2  . TRP A 1 46 ? -12.912 1.281   0.282   1.00 0.00 ? 130 TRP A HZ2  4  
ATOM 4334  H HZ3  . TRP A 1 46 ? -12.959 4.907   -1.966  1.00 0.00 ? 130 TRP A HZ3  4  
ATOM 4335  H HH2  . TRP A 1 46 ? -13.775 2.640   -1.574  1.00 0.00 ? 130 TRP A HH2  4  
ATOM 4336  N N    . LEU A 1 47 ? -6.563  3.996   0.373   1.00 0.00 ? 131 LEU A N    4  
ATOM 4337  C CA   . LEU A 1 47 ? -6.001  3.548   -0.891  1.00 0.00 ? 131 LEU A CA   4  
ATOM 4338  C C    . LEU A 1 47 ? -6.724  2.321   -1.436  1.00 0.00 ? 131 LEU A C    4  
ATOM 4339  O O    . LEU A 1 47 ? -7.101  1.413   -0.693  1.00 0.00 ? 131 LEU A O    4  
ATOM 4340  C CB   . LEU A 1 47 ? -4.487  3.283   -0.765  1.00 0.00 ? 131 LEU A CB   4  
ATOM 4341  C CG   . LEU A 1 47 ? -4.039  2.083   0.086   1.00 0.00 ? 131 LEU A CG   4  
ATOM 4342  C CD1  . LEU A 1 47 ? -2.547  1.856   -0.092  1.00 0.00 ? 131 LEU A CD1  4  
ATOM 4343  C CD2  . LEU A 1 47 ? -4.344  2.286   1.564   1.00 0.00 ? 131 LEU A CD2  4  
ATOM 4344  H H    . LEU A 1 47 ? -6.291  3.561   1.201   1.00 0.00 ? 131 LEU A H    4  
ATOM 4345  H HA   . LEU A 1 47 ? -6.145  4.355   -1.599  1.00 0.00 ? 131 LEU A HA   4  
ATOM 4346  H HB2  . LEU A 1 47 ? -4.093  3.145   -1.760  1.00 0.00 ? 131 LEU A HB2  4  
ATOM 4347  H HB3  . LEU A 1 47 ? -4.033  4.171   -0.347  1.00 0.00 ? 131 LEU A HB3  4  
ATOM 4348  H HG   . LEU A 1 47 ? -4.557  1.197   -0.250  1.00 0.00 ? 131 LEU A HG   4  
ATOM 4349  H HD11 . LEU A 1 47 ? -2.336  1.660   -1.134  1.00 0.00 ? 131 LEU A HD11 4  
ATOM 4350  H HD12 . LEU A 1 47 ? -2.236  1.011   0.503   1.00 0.00 ? 131 LEU A HD12 4  
ATOM 4351  H HD13 . LEU A 1 47 ? -2.009  2.739   0.223   1.00 0.00 ? 131 LEU A HD13 4  
ATOM 4352  H HD21 . LEU A 1 47 ? -3.750  1.600   2.149   1.00 0.00 ? 131 LEU A HD21 4  
ATOM 4353  H HD22 . LEU A 1 47 ? -5.390  2.092   1.747   1.00 0.00 ? 131 LEU A HD22 4  
ATOM 4354  H HD23 . LEU A 1 47 ? -4.107  3.303   1.847   1.00 0.00 ? 131 LEU A HD23 4  
ATOM 4355  N N    . THR A 1 48 ? -6.908  2.315   -2.749  1.00 0.00 ? 132 THR A N    4  
ATOM 4356  C CA   . THR A 1 48 ? -7.618  1.253   -3.434  1.00 0.00 ? 132 THR A CA   4  
ATOM 4357  C C    . THR A 1 48 ? -6.772  0.716   -4.588  1.00 0.00 ? 132 THR A C    4  
ATOM 4358  O O    . THR A 1 48 ? -6.044  1.469   -5.233  1.00 0.00 ? 132 THR A O    4  
ATOM 4359  C CB   . THR A 1 48 ? -8.971  1.755   -3.984  1.00 0.00 ? 132 THR A CB   4  
ATOM 4360  O OG1  . THR A 1 48 ? -8.764  2.851   -4.889  1.00 0.00 ? 132 THR A OG1  4  
ATOM 4361  C CG2  . THR A 1 48 ? -9.884  2.208   -2.859  1.00 0.00 ? 132 THR A CG2  4  
ATOM 4362  H H    . THR A 1 48 ? -6.539  3.056   -3.285  1.00 0.00 ? 132 THR A H    4  
ATOM 4363  H HA   . THR A 1 48 ? -7.806  0.457   -2.727  1.00 0.00 ? 132 THR A HA   4  
ATOM 4364  H HB   . THR A 1 48 ? -9.452  0.946   -4.515  1.00 0.00 ? 132 THR A HB   4  
ATOM 4365  H HG1  . THR A 1 48 ? -8.977  3.682   -4.437  1.00 0.00 ? 132 THR A HG1  4  
ATOM 4366  H HG21 . THR A 1 48 ? -9.433  3.052   -2.349  1.00 0.00 ? 132 THR A HG21 4  
ATOM 4367  H HG22 . THR A 1 48 ? -10.022 1.398   -2.161  1.00 0.00 ? 132 THR A HG22 4  
ATOM 4368  H HG23 . THR A 1 48 ? -10.839 2.502   -3.266  1.00 0.00 ? 132 THR A HG23 4  
ATOM 4369  N N    . PHE A 1 49 ? -6.857  -0.581  -4.848  1.00 0.00 ? 133 PHE A N    4  
ATOM 4370  C CA   . PHE A 1 49 ? -6.071  -1.180  -5.921  1.00 0.00 ? 133 PHE A CA   4  
ATOM 4371  C C    . PHE A 1 49 ? -6.948  -1.586  -7.102  1.00 0.00 ? 133 PHE A C    4  
ATOM 4372  O O    . PHE A 1 49 ? -6.935  -0.940  -8.150  1.00 0.00 ? 133 PHE A O    4  
ATOM 4373  C CB   . PHE A 1 49 ? -5.275  -2.388  -5.401  1.00 0.00 ? 133 PHE A CB   4  
ATOM 4374  C CG   . PHE A 1 49 ? -4.750  -3.268  -6.502  1.00 0.00 ? 133 PHE A CG   4  
ATOM 4375  C CD1  . PHE A 1 49 ? -3.807  -2.796  -7.401  1.00 0.00 ? 133 PHE A CD1  4  
ATOM 4376  C CD2  . PHE A 1 49 ? -5.235  -4.555  -6.659  1.00 0.00 ? 133 PHE A CD2  4  
ATOM 4377  C CE1  . PHE A 1 49 ? -3.356  -3.595  -8.432  1.00 0.00 ? 133 PHE A CE1  4  
ATOM 4378  C CE2  . PHE A 1 49 ? -4.795  -5.354  -7.693  1.00 0.00 ? 133 PHE A CE2  4  
ATOM 4379  C CZ   . PHE A 1 49 ? -3.855  -4.875  -8.579  1.00 0.00 ? 133 PHE A CZ   4  
ATOM 4380  H H    . PHE A 1 49 ? -7.458  -1.144  -4.312  1.00 0.00 ? 133 PHE A H    4  
ATOM 4381  H HA   . PHE A 1 49 ? -5.375  -0.434  -6.263  1.00 0.00 ? 133 PHE A HA   4  
ATOM 4382  H HB2  . PHE A 1 49 ? -4.433  -2.037  -4.823  1.00 0.00 ? 133 PHE A HB2  4  
ATOM 4383  H HB3  . PHE A 1 49 ? -5.916  -2.988  -4.771  1.00 0.00 ? 133 PHE A HB3  4  
ATOM 4384  H HD1  . PHE A 1 49 ? -3.418  -1.795  -7.284  1.00 0.00 ? 133 PHE A HD1  4  
ATOM 4385  H HD2  . PHE A 1 49 ? -5.969  -4.933  -5.963  1.00 0.00 ? 133 PHE A HD2  4  
ATOM 4386  H HE1  . PHE A 1 49 ? -2.618  -3.216  -9.125  1.00 0.00 ? 133 PHE A HE1  4  
ATOM 4387  H HE2  . PHE A 1 49 ? -5.181  -6.356  -7.804  1.00 0.00 ? 133 PHE A HE2  4  
ATOM 4388  H HZ   . PHE A 1 49 ? -3.517  -5.496  -9.393  1.00 0.00 ? 133 PHE A HZ   4  
ATOM 4389  N N    . GLU A 1 50 ? -7.725  -2.636  -6.912  1.00 0.00 ? 134 GLU A N    4  
ATOM 4390  C CA   . GLU A 1 50 ? -8.480  -3.258  -7.995  1.00 0.00 ? 134 GLU A CA   4  
ATOM 4391  C C    . GLU A 1 50 ? -9.886  -2.657  -8.084  1.00 0.00 ? 134 GLU A C    4  
ATOM 4392  O O    . GLU A 1 50 ? -10.849 -3.334  -8.457  1.00 0.00 ? 134 GLU A O    4  
ATOM 4393  C CB   . GLU A 1 50 ? -8.568  -4.763  -7.727  1.00 0.00 ? 134 GLU A CB   4  
ATOM 4394  C CG   . GLU A 1 50 ? -8.971  -5.590  -8.935  1.00 0.00 ? 134 GLU A CG   4  
ATOM 4395  C CD   . GLU A 1 50 ? -9.236  -7.037  -8.581  1.00 0.00 ? 134 GLU A CD   4  
ATOM 4396  O OE1  . GLU A 1 50 ? -8.269  -7.811  -8.465  1.00 0.00 ? 134 GLU A OE1  4  
ATOM 4397  O OE2  . GLU A 1 50 ? -10.420 -7.406  -8.420  1.00 0.00 ? 134 GLU A OE2  4  
ATOM 4398  H H    . GLU A 1 50 ? -7.790  -3.013  -6.014  1.00 0.00 ? 134 GLU A H    4  
ATOM 4399  H HA   . GLU A 1 50 ? -7.947  -3.093  -8.923  1.00 0.00 ? 134 GLU A HA   4  
ATOM 4400  H HB2  . GLU A 1 50 ? -7.602  -5.111  -7.389  1.00 0.00 ? 134 GLU A HB2  4  
ATOM 4401  H HB3  . GLU A 1 50 ? -9.293  -4.933  -6.945  1.00 0.00 ? 134 GLU A HB3  4  
ATOM 4402  H HG2  . GLU A 1 50 ? -9.868  -5.167  -9.361  1.00 0.00 ? 134 GLU A HG2  4  
ATOM 4403  H HG3  . GLU A 1 50 ? -8.175  -5.552  -9.663  1.00 0.00 ? 134 GLU A HG3  4  
ATOM 4404  N N    . GLY A 1 51 ? -10.002 -1.377  -7.753  1.00 0.00 ? 135 GLY A N    4  
ATOM 4405  C CA   . GLY A 1 51 ? -11.313 -0.775  -7.594  1.00 0.00 ? 135 GLY A CA   4  
ATOM 4406  C C    . GLY A 1 51 ? -11.900 -1.143  -6.254  1.00 0.00 ? 135 GLY A C    4  
ATOM 4407  O O    . GLY A 1 51 ? -13.081 -0.926  -5.983  1.00 0.00 ? 135 GLY A O    4  
ATOM 4408  H H    . GLY A 1 51 ? -9.195  -0.831  -7.632  1.00 0.00 ? 135 GLY A H    4  
ATOM 4409  H HA2  . GLY A 1 51 ? -11.223 0.300   -7.664  1.00 0.00 ? 135 GLY A HA2  4  
ATOM 4410  H HA3  . GLY A 1 51 ? -11.965 -1.131  -8.378  1.00 0.00 ? 135 GLY A HA3  4  
ATOM 4411  N N    . LYS A 1 52 ? -11.046 -1.710  -5.419  1.00 0.00 ? 136 LYS A N    4  
ATOM 4412  C CA   . LYS A 1 52 ? -11.416 -2.169  -4.097  1.00 0.00 ? 136 LYS A CA   4  
ATOM 4413  C C    . LYS A 1 52 ? -10.370 -1.710  -3.094  1.00 0.00 ? 136 LYS A C    4  
ATOM 4414  O O    . LYS A 1 52 ? -9.194  -1.559  -3.450  1.00 0.00 ? 136 LYS A O    4  
ATOM 4415  C CB   . LYS A 1 52 ? -11.505 -3.700  -4.069  1.00 0.00 ? 136 LYS A CB   4  
ATOM 4416  C CG   . LYS A 1 52 ? -10.209 -4.384  -4.482  1.00 0.00 ? 136 LYS A CG   4  
ATOM 4417  C CD   . LYS A 1 52 ? -10.199 -5.877  -4.170  1.00 0.00 ? 136 LYS A CD   4  
ATOM 4418  C CE   . LYS A 1 52 ? -11.269 -6.645  -4.933  1.00 0.00 ? 136 LYS A CE   4  
ATOM 4419  N NZ   . LYS A 1 52 ? -12.571 -6.671  -4.214  1.00 0.00 ? 136 LYS A NZ   4  
ATOM 4420  H H    . LYS A 1 52 ? -10.116 -1.813  -5.703  1.00 0.00 ? 136 LYS A H    4  
ATOM 4421  H HA   . LYS A 1 52 ? -12.374 -1.746  -3.840  1.00 0.00 ? 136 LYS A HA   4  
ATOM 4422  H HB2  . LYS A 1 52 ? -11.754 -4.018  -3.067  1.00 0.00 ? 136 LYS A HB2  4  
ATOM 4423  H HB3  . LYS A 1 52 ? -12.286 -4.017  -4.744  1.00 0.00 ? 136 LYS A HB3  4  
ATOM 4424  H HG2  . LYS A 1 52 ? -10.072 -4.254  -5.544  1.00 0.00 ? 136 LYS A HG2  4  
ATOM 4425  H HG3  . LYS A 1 52 ? -9.390  -3.915  -3.957  1.00 0.00 ? 136 LYS A HG3  4  
ATOM 4426  H HD2  . LYS A 1 52 ? -9.233  -6.279  -4.435  1.00 0.00 ? 136 LYS A HD2  4  
ATOM 4427  H HD3  . LYS A 1 52 ? -10.362 -6.010  -3.111  1.00 0.00 ? 136 LYS A HD3  4  
ATOM 4428  H HE2  . LYS A 1 52 ? -11.412 -6.175  -5.895  1.00 0.00 ? 136 LYS A HE2  4  
ATOM 4429  H HE3  . LYS A 1 52 ? -10.928 -7.658  -5.077  1.00 0.00 ? 136 LYS A HE3  4  
ATOM 4430  H HZ1  . LYS A 1 52 ? -13.272 -7.206  -4.772  1.00 0.00 ? 136 LYS A HZ1  4  
ATOM 4431  H HZ2  . LYS A 1 52 ? -12.925 -5.707  -4.064  1.00 0.00 ? 136 LYS A HZ2  4  
ATOM 4432  H HZ3  . LYS A 1 52 ? -12.457 -7.140  -3.287  1.00 0.00 ? 136 LYS A HZ3  4  
ATOM 4433  N N    . PRO A 1 53 ? -10.774 -1.468  -1.847  1.00 0.00 ? 137 PRO A N    4  
ATOM 4434  C CA   . PRO A 1 53 ? -9.836  -1.161  -0.772  1.00 0.00 ? 137 PRO A CA   4  
ATOM 4435  C C    . PRO A 1 53 ? -8.975  -2.372  -0.432  1.00 0.00 ? 137 PRO A C    4  
ATOM 4436  O O    . PRO A 1 53 ? -9.404  -3.516  -0.609  1.00 0.00 ? 137 PRO A O    4  
ATOM 4437  C CB   . PRO A 1 53 ? -10.741 -0.804  0.408   1.00 0.00 ? 137 PRO A CB   4  
ATOM 4438  C CG   . PRO A 1 53 ? -12.043 -1.466  0.111   1.00 0.00 ? 137 PRO A CG   4  
ATOM 4439  C CD   . PRO A 1 53 ? -12.174 -1.462  -1.386  1.00 0.00 ? 137 PRO A CD   4  
ATOM 4440  H HA   . PRO A 1 53 ? -9.204  -0.321  -1.021  1.00 0.00 ? 137 PRO A HA   4  
ATOM 4441  H HB2  . PRO A 1 53 ? -10.308 -1.181  1.323   1.00 0.00 ? 137 PRO A HB2  4  
ATOM 4442  H HB3  . PRO A 1 53 ? -10.849 0.268   0.469   1.00 0.00 ? 137 PRO A HB3  4  
ATOM 4443  H HG2  . PRO A 1 53 ? -12.037 -2.478  0.486   1.00 0.00 ? 137 PRO A HG2  4  
ATOM 4444  H HG3  . PRO A 1 53 ? -12.850 -0.904  0.557   1.00 0.00 ? 137 PRO A HG3  4  
ATOM 4445  H HD2  . PRO A 1 53 ? -12.695 -2.346  -1.724  1.00 0.00 ? 137 PRO A HD2  4  
ATOM 4446  H HD3  . PRO A 1 53 ? -12.684 -0.571  -1.719  1.00 0.00 ? 137 PRO A HD3  4  
ATOM 4447  N N    . LEU A 1 54 ? -7.762  -2.127  0.033   1.00 0.00 ? 138 LEU A N    4  
ATOM 4448  C CA   . LEU A 1 54 ? -6.879  -3.210  0.437   1.00 0.00 ? 138 LEU A CA   4  
ATOM 4449  C C    . LEU A 1 54 ? -7.345  -3.787  1.766   1.00 0.00 ? 138 LEU A C    4  
ATOM 4450  O O    . LEU A 1 54 ? -7.249  -3.133  2.804   1.00 0.00 ? 138 LEU A O    4  
ATOM 4451  C CB   . LEU A 1 54 ? -5.432  -2.724  0.545   1.00 0.00 ? 138 LEU A CB   4  
ATOM 4452  C CG   . LEU A 1 54 ? -4.791  -2.286  -0.774  1.00 0.00 ? 138 LEU A CG   4  
ATOM 4453  C CD1  . LEU A 1 54 ? -3.350  -1.864  -0.547  1.00 0.00 ? 138 LEU A CD1  4  
ATOM 4454  C CD2  . LEU A 1 54 ? -4.862  -3.406  -1.802  1.00 0.00 ? 138 LEU A CD2  4  
ATOM 4455  H H    . LEU A 1 54 ? -7.455  -1.199  0.115   1.00 0.00 ? 138 LEU A H    4  
ATOM 4456  H HA   . LEU A 1 54 ? -6.937  -3.983  -0.317  1.00 0.00 ? 138 LEU A HA   4  
ATOM 4457  H HB2  . LEU A 1 54 ? -5.408  -1.889  1.230   1.00 0.00 ? 138 LEU A HB2  4  
ATOM 4458  H HB3  . LEU A 1 54 ? -4.836  -3.525  0.960   1.00 0.00 ? 138 LEU A HB3  4  
ATOM 4459  H HG   . LEU A 1 54 ? -5.333  -1.436  -1.165  1.00 0.00 ? 138 LEU A HG   4  
ATOM 4460  H HD11 . LEU A 1 54 ? -2.917  -1.546  -1.483  1.00 0.00 ? 138 LEU A HD11 4  
ATOM 4461  H HD12 . LEU A 1 54 ? -2.789  -2.700  -0.155  1.00 0.00 ? 138 LEU A HD12 4  
ATOM 4462  H HD13 . LEU A 1 54 ? -3.321  -1.048  0.162   1.00 0.00 ? 138 LEU A HD13 4  
ATOM 4463  H HD21 . LEU A 1 54 ? -4.314  -4.264  -1.438  1.00 0.00 ? 138 LEU A HD21 4  
ATOM 4464  H HD22 . LEU A 1 54 ? -4.430  -3.071  -2.732  1.00 0.00 ? 138 LEU A HD22 4  
ATOM 4465  H HD23 . LEU A 1 54 ? -5.896  -3.682  -1.964  1.00 0.00 ? 138 LEU A HD23 4  
ATOM 4466  N N    . GLU A 1 55 ? -7.877  -4.999  1.722   1.00 0.00 ? 139 GLU A N    4  
ATOM 4467  C CA   . GLU A 1 55 ? -8.396  -5.648  2.914   1.00 0.00 ? 139 GLU A CA   4  
ATOM 4468  C C    . GLU A 1 55 ? -7.249  -6.240  3.717   1.00 0.00 ? 139 GLU A C    4  
ATOM 4469  O O    . GLU A 1 55 ? -6.493  -7.075  3.210   1.00 0.00 ? 139 GLU A O    4  
ATOM 4470  C CB   . GLU A 1 55 ? -9.386  -6.748  2.523   1.00 0.00 ? 139 GLU A CB   4  
ATOM 4471  C CG   . GLU A 1 55 ? -10.422 -6.303  1.498   1.00 0.00 ? 139 GLU A CG   4  
ATOM 4472  C CD   . GLU A 1 55 ? -11.445 -5.316  2.039   1.00 0.00 ? 139 GLU A CD   4  
ATOM 4473  O OE1  . GLU A 1 55 ? -11.115 -4.522  2.950   1.00 0.00 ? 139 GLU A OE1  4  
ATOM 4474  O OE2  . GLU A 1 55 ? -12.588 -5.320  1.532   1.00 0.00 ? 139 GLU A OE2  4  
ATOM 4475  H H    . GLU A 1 55 ? -7.919  -5.472  0.866   1.00 0.00 ? 139 GLU A H    4  
ATOM 4476  H HA   . GLU A 1 55 ? -8.904  -4.906  3.510   1.00 0.00 ? 139 GLU A HA   4  
ATOM 4477  H HB2  . GLU A 1 55 ? -8.835  -7.578  2.106   1.00 0.00 ? 139 GLU A HB2  4  
ATOM 4478  H HB3  . GLU A 1 55 ? -9.906  -7.082  3.408   1.00 0.00 ? 139 GLU A HB3  4  
ATOM 4479  H HG2  . GLU A 1 55 ? -9.907  -5.836  0.671   1.00 0.00 ? 139 GLU A HG2  4  
ATOM 4480  H HG3  . GLU A 1 55 ? -10.946 -7.176  1.140   1.00 0.00 ? 139 GLU A HG3  4  
ATOM 4481  N N    . ASP A 1 56 ? -7.123  -5.820  4.971   1.00 0.00 ? 140 ASP A N    4  
ATOM 4482  C CA   . ASP A 1 56 ? -6.025  -6.254  5.825   1.00 0.00 ? 140 ASP A CA   4  
ATOM 4483  C C    . ASP A 1 56 ? -6.300  -7.651  6.386   1.00 0.00 ? 140 ASP A C    4  
ATOM 4484  O O    . ASP A 1 56 ? -6.286  -7.887  7.594   1.00 0.00 ? 140 ASP A O    4  
ATOM 4485  C CB   . ASP A 1 56 ? -5.798  -5.234  6.949   1.00 0.00 ? 140 ASP A CB   4  
ATOM 4486  C CG   . ASP A 1 56 ? -4.587  -5.549  7.809   1.00 0.00 ? 140 ASP A CG   4  
ATOM 4487  O OD1  . ASP A 1 56 ? -3.510  -5.853  7.251   1.00 0.00 ? 140 ASP A OD1  4  
ATOM 4488  O OD2  . ASP A 1 56 ? -4.712  -5.495  9.052   1.00 0.00 ? 140 ASP A OD2  4  
ATOM 4489  H H    . ASP A 1 56 ? -7.795  -5.199  5.338   1.00 0.00 ? 140 ASP A H    4  
ATOM 4490  H HA   . ASP A 1 56 ? -5.135  -6.300  5.213   1.00 0.00 ? 140 ASP A HA   4  
ATOM 4491  H HB2  . ASP A 1 56 ? -5.656  -4.259  6.510   1.00 0.00 ? 140 ASP A HB2  4  
ATOM 4492  H HB3  . ASP A 1 56 ? -6.672  -5.211  7.584   1.00 0.00 ? 140 ASP A HB3  4  
ATOM 4493  N N    . GLN A 1 57 ? -6.593  -8.568  5.478   1.00 0.00 ? 141 GLN A N    4  
ATOM 4494  C CA   . GLN A 1 57 ? -6.781  -9.970  5.814   1.00 0.00 ? 141 GLN A CA   4  
ATOM 4495  C C    . GLN A 1 57 ? -5.943  -10.840 4.887   1.00 0.00 ? 141 GLN A C    4  
ATOM 4496  O O    . GLN A 1 57 ? -5.835  -12.052 5.081   1.00 0.00 ? 141 GLN A O    4  
ATOM 4497  C CB   . GLN A 1 57 ? -8.253  -10.356 5.682   1.00 0.00 ? 141 GLN A CB   4  
ATOM 4498  C CG   . GLN A 1 57 ? -8.824  -10.057 4.303   1.00 0.00 ? 141 GLN A CG   4  
ATOM 4499  C CD   . GLN A 1 57 ? -10.179 -10.690 4.071   1.00 0.00 ? 141 GLN A CD   4  
ATOM 4500  O OE1  . GLN A 1 57 ? -10.537 -11.007 2.937   1.00 0.00 ? 141 GLN A OE1  4  
ATOM 4501  N NE2  . GLN A 1 57 ? -10.943 -10.877 5.131   1.00 0.00 ? 141 GLN A NE2  4  
ATOM 4502  H H    . GLN A 1 57 ? -6.700  -8.282  4.544   1.00 0.00 ? 141 GLN A H    4  
ATOM 4503  H HA   . GLN A 1 57 ? -6.460  -10.121 6.833   1.00 0.00 ? 141 GLN A HA   4  
ATOM 4504  H HB2  . GLN A 1 57 ? -8.358  -11.414 5.872   1.00 0.00 ? 141 GLN A HB2  4  
ATOM 4505  H HB3  . GLN A 1 57 ? -8.828  -9.805  6.413   1.00 0.00 ? 141 GLN A HB3  4  
ATOM 4506  H HG2  . GLN A 1 57 ? -8.920  -8.987  4.195   1.00 0.00 ? 141 GLN A HG2  4  
ATOM 4507  H HG3  . GLN A 1 57 ? -8.138  -10.431 3.556   1.00 0.00 ? 141 GLN A HG3  4  
ATOM 4508  H HE21 . GLN A 1 57 ? -10.600 -10.598 6.011   1.00 0.00 ? 141 GLN A HE21 4  
ATOM 4509  H HE22 . GLN A 1 57 ? -11.823 -11.288 5.002   1.00 0.00 ? 141 GLN A HE22 4  
ATOM 4510  N N    . LEU A 1 58 ? -5.353  -10.212 3.878   1.00 0.00 ? 142 LEU A N    4  
ATOM 4511  C CA   . LEU A 1 58 ? -4.598  -10.922 2.862   1.00 0.00 ? 142 LEU A CA   4  
ATOM 4512  C C    . LEU A 1 58 ? -3.209  -10.309 2.729   1.00 0.00 ? 142 LEU A C    4  
ATOM 4513  O O    . LEU A 1 58 ? -3.006  -9.150  3.095   1.00 0.00 ? 142 LEU A O    4  
ATOM 4514  C CB   . LEU A 1 58 ? -5.337  -10.855 1.520   1.00 0.00 ? 142 LEU A CB   4  
ATOM 4515  C CG   . LEU A 1 58 ? -6.764  -11.414 1.528   1.00 0.00 ? 142 LEU A CG   4  
ATOM 4516  C CD1  . LEU A 1 58 ? -7.424  -11.202 0.177   1.00 0.00 ? 142 LEU A CD1  4  
ATOM 4517  C CD2  . LEU A 1 58 ? -6.763  -12.893 1.889   1.00 0.00 ? 142 LEU A CD2  4  
ATOM 4518  H H    . LEU A 1 58 ? -5.409  -9.237  3.822   1.00 0.00 ? 142 LEU A H    4  
ATOM 4519  H HA   . LEU A 1 58 ? -4.504  -11.954 3.171   1.00 0.00 ? 142 LEU A HA   4  
ATOM 4520  H HB2  . LEU A 1 58 ? -5.381  -9.821  1.211   1.00 0.00 ? 142 LEU A HB2  4  
ATOM 4521  H HB3  . LEU A 1 58 ? -4.762  -11.407 0.791   1.00 0.00 ? 142 LEU A HB3  4  
ATOM 4522  H HG   . LEU A 1 58 ? -7.345  -10.888 2.272   1.00 0.00 ? 142 LEU A HG   4  
ATOM 4523  H HD11 . LEU A 1 58 ? -8.444  -11.552 0.217   1.00 0.00 ? 142 LEU A HD11 4  
ATOM 4524  H HD12 . LEU A 1 58 ? -6.882  -11.751 -0.580  1.00 0.00 ? 142 LEU A HD12 4  
ATOM 4525  H HD13 . LEU A 1 58 ? -7.413  -10.150 -0.066  1.00 0.00 ? 142 LEU A HD13 4  
ATOM 4526  H HD21 . LEU A 1 58 ? -6.180  -13.441 1.165   1.00 0.00 ? 142 LEU A HD21 4  
ATOM 4527  H HD22 . LEU A 1 58 ? -7.780  -13.264 1.891   1.00 0.00 ? 142 LEU A HD22 4  
ATOM 4528  H HD23 . LEU A 1 58 ? -6.332  -13.022 2.870   1.00 0.00 ? 142 LEU A HD23 4  
ATOM 4529  N N    . PRO A 1 59 ? -2.233  -11.074 2.219   1.00 0.00 ? 143 PRO A N    4  
ATOM 4530  C CA   . PRO A 1 59 ? -0.874  -10.578 2.039   1.00 0.00 ? 143 PRO A CA   4  
ATOM 4531  C C    . PRO A 1 59 ? -0.761  -9.666  0.823   1.00 0.00 ? 143 PRO A C    4  
ATOM 4532  O O    . PRO A 1 59 ? -1.430  -9.878  -0.191  1.00 0.00 ? 143 PRO A O    4  
ATOM 4533  C CB   . PRO A 1 59 ? -0.059  -11.855 1.836   1.00 0.00 ? 143 PRO A CB   4  
ATOM 4534  C CG   . PRO A 1 59 ? -1.015  -12.817 1.220   1.00 0.00 ? 143 PRO A CG   4  
ATOM 4535  C CD   . PRO A 1 59 ? -2.376  -12.477 1.775   1.00 0.00 ? 143 PRO A CD   4  
ATOM 4536  H HA   . PRO A 1 59 ? -0.523  -10.057 2.915   1.00 0.00 ? 143 PRO A HA   4  
ATOM 4537  H HB2  . PRO A 1 59 ? 0.775   -11.653 1.181   1.00 0.00 ? 143 PRO A HB2  4  
ATOM 4538  H HB3  . PRO A 1 59 ? 0.299   -12.214 2.789   1.00 0.00 ? 143 PRO A HB3  4  
ATOM 4539  H HG2  . PRO A 1 59 ? -1.012  -12.699 0.146   1.00 0.00 ? 143 PRO A HG2  4  
ATOM 4540  H HG3  . PRO A 1 59 ? -0.744  -13.827 1.487   1.00 0.00 ? 143 PRO A HG3  4  
ATOM 4541  H HD2  . PRO A 1 59 ? -3.127  -12.561 1.005   1.00 0.00 ? 143 PRO A HD2  4  
ATOM 4542  H HD3  . PRO A 1 59 ? -2.615  -13.122 2.608   1.00 0.00 ? 143 PRO A HD3  4  
ATOM 4543  N N    . LEU A 1 60 ? 0.094   -8.657  0.923   1.00 0.00 ? 144 LEU A N    4  
ATOM 4544  C CA   . LEU A 1 60 ? 0.280   -7.699  -0.160  1.00 0.00 ? 144 LEU A CA   4  
ATOM 4545  C C    . LEU A 1 60 ? 0.808   -8.375  -1.417  1.00 0.00 ? 144 LEU A C    4  
ATOM 4546  O O    . LEU A 1 60 ? 0.628   -7.868  -2.515  1.00 0.00 ? 144 LEU A O    4  
ATOM 4547  C CB   . LEU A 1 60 ? 1.237   -6.580  0.259   1.00 0.00 ? 144 LEU A CB   4  
ATOM 4548  C CG   . LEU A 1 60 ? 0.708   -5.629  1.330   1.00 0.00 ? 144 LEU A CG   4  
ATOM 4549  C CD1  . LEU A 1 60 ? 1.763   -4.593  1.672   1.00 0.00 ? 144 LEU A CD1  4  
ATOM 4550  C CD2  . LEU A 1 60 ? -0.567  -4.949  0.860   1.00 0.00 ? 144 LEU A CD2  4  
ATOM 4551  H H    . LEU A 1 60 ? 0.609   -8.545  1.757   1.00 0.00 ? 144 LEU A H    4  
ATOM 4552  H HA   . LEU A 1 60 ? -0.683  -7.266  -0.382  1.00 0.00 ? 144 LEU A HA   4  
ATOM 4553  H HB2  . LEU A 1 60 ? 2.146   -7.033  0.628   1.00 0.00 ? 144 LEU A HB2  4  
ATOM 4554  H HB3  . LEU A 1 60 ? 1.479   -5.998  -0.618  1.00 0.00 ? 144 LEU A HB3  4  
ATOM 4555  H HG   . LEU A 1 60 ? 0.481   -6.190  2.225   1.00 0.00 ? 144 LEU A HG   4  
ATOM 4556  H HD11 . LEU A 1 60 ? 1.373   -3.916  2.416   1.00 0.00 ? 144 LEU A HD11 4  
ATOM 4557  H HD12 . LEU A 1 60 ? 2.025   -4.038  0.782   1.00 0.00 ? 144 LEU A HD12 4  
ATOM 4558  H HD13 . LEU A 1 60 ? 2.641   -5.086  2.059   1.00 0.00 ? 144 LEU A HD13 4  
ATOM 4559  H HD21 . LEU A 1 60 ? -1.316  -5.696  0.646   1.00 0.00 ? 144 LEU A HD21 4  
ATOM 4560  H HD22 . LEU A 1 60 ? -0.361  -4.379  -0.034  1.00 0.00 ? 144 LEU A HD22 4  
ATOM 4561  H HD23 . LEU A 1 60 ? -0.927  -4.288  1.634   1.00 0.00 ? 144 LEU A HD23 4  
ATOM 4562  N N    . GLY A 1 61 ? 1.449   -9.526  -1.249  1.00 0.00 ? 145 GLY A N    4  
ATOM 4563  C CA   . GLY A 1 61 ? 1.994   -10.248 -2.380  1.00 0.00 ? 145 GLY A CA   4  
ATOM 4564  C C    . GLY A 1 61 ? 0.951   -10.601 -3.428  1.00 0.00 ? 145 GLY A C    4  
ATOM 4565  O O    . GLY A 1 61 ? 1.239   -10.587 -4.621  1.00 0.00 ? 145 GLY A O    4  
ATOM 4566  H H    . GLY A 1 61 ? 1.557   -9.888  -0.345  1.00 0.00 ? 145 GLY A H    4  
ATOM 4567  H HA2  . GLY A 1 61 ? 2.757   -9.641  -2.843  1.00 0.00 ? 145 GLY A HA2  4  
ATOM 4568  H HA3  . GLY A 1 61 ? 2.445   -11.161 -2.021  1.00 0.00 ? 145 GLY A HA3  4  
ATOM 4569  N N    . GLU A 1 62 ? -0.270  -10.898 -2.995  1.00 0.00 ? 146 GLU A N    4  
ATOM 4570  C CA   . GLU A 1 62 ? -1.305  -11.325 -3.927  1.00 0.00 ? 146 GLU A CA   4  
ATOM 4571  C C    . GLU A 1 62 ? -1.880  -10.132 -4.691  1.00 0.00 ? 146 GLU A C    4  
ATOM 4572  O O    . GLU A 1 62 ? -2.405  -10.281 -5.791  1.00 0.00 ? 146 GLU A O    4  
ATOM 4573  C CB   . GLU A 1 62 ? -2.412  -12.083 -3.192  1.00 0.00 ? 146 GLU A CB   4  
ATOM 4574  C CG   . GLU A 1 62 ? -3.391  -12.771 -4.132  1.00 0.00 ? 146 GLU A CG   4  
ATOM 4575  C CD   . GLU A 1 62 ? -4.391  -13.655 -3.419  1.00 0.00 ? 146 GLU A CD   4  
ATOM 4576  O OE1  . GLU A 1 62 ? -4.087  -14.849 -3.203  1.00 0.00 ? 146 GLU A OE1  4  
ATOM 4577  O OE2  . GLU A 1 62 ? -5.495  -13.172 -3.103  1.00 0.00 ? 146 GLU A OE2  4  
ATOM 4578  H H    . GLU A 1 62 ? -0.476  -10.827 -2.038  1.00 0.00 ? 146 GLU A H    4  
ATOM 4579  H HA   . GLU A 1 62 ? -0.842  -11.992 -4.638  1.00 0.00 ? 146 GLU A HA   4  
ATOM 4580  H HB2  . GLU A 1 62 ? -1.962  -12.833 -2.559  1.00 0.00 ? 146 GLU A HB2  4  
ATOM 4581  H HB3  . GLU A 1 62 ? -2.963  -11.387 -2.578  1.00 0.00 ? 146 GLU A HB3  4  
ATOM 4582  H HG2  . GLU A 1 62 ? -3.935  -12.014 -4.675  1.00 0.00 ? 146 GLU A HG2  4  
ATOM 4583  H HG3  . GLU A 1 62 ? -2.830  -13.377 -4.828  1.00 0.00 ? 146 GLU A HG3  4  
ATOM 4584  N N    . TYR A 1 63 ? -1.769  -8.946  -4.106  1.00 0.00 ? 147 TYR A N    4  
ATOM 4585  C CA   . TYR A 1 63 ? -2.225  -7.725  -4.767  1.00 0.00 ? 147 TYR A CA   4  
ATOM 4586  C C    . TYR A 1 63 ? -1.092  -7.094  -5.572  1.00 0.00 ? 147 TYR A C    4  
ATOM 4587  O O    . TYR A 1 63 ? -1.296  -6.588  -6.673  1.00 0.00 ? 147 TYR A O    4  
ATOM 4588  C CB   . TYR A 1 63 ? -2.730  -6.702  -3.743  1.00 0.00 ? 147 TYR A CB   4  
ATOM 4589  C CG   . TYR A 1 63 ? -4.004  -7.088  -3.023  1.00 0.00 ? 147 TYR A CG   4  
ATOM 4590  C CD1  . TYR A 1 63 ? -5.241  -6.915  -3.629  1.00 0.00 ? 147 TYR A CD1  4  
ATOM 4591  C CD2  . TYR A 1 63 ? -3.971  -7.599  -1.732  1.00 0.00 ? 147 TYR A CD2  4  
ATOM 4592  C CE1  . TYR A 1 63 ? -6.411  -7.245  -2.970  1.00 0.00 ? 147 TYR A CE1  4  
ATOM 4593  C CE2  . TYR A 1 63 ? -5.137  -7.929  -1.066  1.00 0.00 ? 147 TYR A CE2  4  
ATOM 4594  C CZ   . TYR A 1 63 ? -6.354  -7.750  -1.689  1.00 0.00 ? 147 TYR A CZ   4  
ATOM 4595  O OH   . TYR A 1 63 ? -7.518  -8.068  -1.026  1.00 0.00 ? 147 TYR A OH   4  
ATOM 4596  H H    . TYR A 1 63 ? -1.366  -8.888  -3.215  1.00 0.00 ? 147 TYR A H    4  
ATOM 4597  H HA   . TYR A 1 63 ? -3.032  -7.988  -5.435  1.00 0.00 ? 147 TYR A HA   4  
ATOM 4598  H HB2  . TYR A 1 63 ? -1.967  -6.552  -2.994  1.00 0.00 ? 147 TYR A HB2  4  
ATOM 4599  H HB3  . TYR A 1 63 ? -2.909  -5.765  -4.249  1.00 0.00 ? 147 TYR A HB3  4  
ATOM 4600  H HD1  . TYR A 1 63 ? -5.285  -6.518  -4.633  1.00 0.00 ? 147 TYR A HD1  4  
ATOM 4601  H HD2  . TYR A 1 63 ? -3.017  -7.739  -1.247  1.00 0.00 ? 147 TYR A HD2  4  
ATOM 4602  H HE1  . TYR A 1 63 ? -7.364  -7.104  -3.458  1.00 0.00 ? 147 TYR A HE1  4  
ATOM 4603  H HE2  . TYR A 1 63 ? -5.091  -8.325  -0.064  1.00 0.00 ? 147 TYR A HE2  4  
ATOM 4604  H HH   . TYR A 1 63 ? -8.088  -8.591  -1.607  1.00 0.00 ? 147 TYR A HH   4  
ATOM 4605  N N    . GLY A 1 64 ? 0.104   -7.142  -5.004  1.00 0.00 ? 148 GLY A N    4  
ATOM 4606  C CA   . GLY A 1 64 ? 1.242   -6.443  -5.565  1.00 0.00 ? 148 GLY A CA   4  
ATOM 4607  C C    . GLY A 1 64 ? 2.155   -7.329  -6.385  1.00 0.00 ? 148 GLY A C    4  
ATOM 4608  O O    . GLY A 1 64 ? 3.228   -6.888  -6.783  1.00 0.00 ? 148 GLY A O    4  
ATOM 4609  H H    . GLY A 1 64 ? 0.219   -7.660  -4.176  1.00 0.00 ? 148 GLY A H    4  
ATOM 4610  H HA2  . GLY A 1 64 ? 0.878   -5.646  -6.197  1.00 0.00 ? 148 GLY A HA2  4  
ATOM 4611  H HA3  . GLY A 1 64 ? 1.815   -6.011  -4.758  1.00 0.00 ? 148 GLY A HA3  4  
ATOM 4612  N N    . LEU A 1 65 ? 1.745   -8.584  -6.601  1.00 0.00 ? 149 LEU A N    4  
ATOM 4613  C CA   . LEU A 1 65 ? 2.508   -9.549  -7.415  1.00 0.00 ? 149 LEU A CA   4  
ATOM 4614  C C    . LEU A 1 65 ? 3.095   -8.911  -8.680  1.00 0.00 ? 149 LEU A C    4  
ATOM 4615  O O    . LEU A 1 65 ? 4.157   -9.314  -9.155  1.00 0.00 ? 149 LEU A O    4  
ATOM 4616  C CB   . LEU A 1 65 ? 1.635   -10.756 -7.808  1.00 0.00 ? 149 LEU A CB   4  
ATOM 4617  C CG   . LEU A 1 65 ? 0.572   -10.508 -8.892  1.00 0.00 ? 149 LEU A CG   4  
ATOM 4618  C CD1  . LEU A 1 65 ? -0.012  -11.828 -9.367  1.00 0.00 ? 149 LEU A CD1  4  
ATOM 4619  C CD2  . LEU A 1 65 ? -0.541  -9.604  -8.383  1.00 0.00 ? 149 LEU A CD2  4  
ATOM 4620  H H    . LEU A 1 65 ? 0.915   -8.885  -6.175  1.00 0.00 ? 149 LEU A H    4  
ATOM 4621  H HA   . LEU A 1 65 ? 3.325   -9.903  -6.807  1.00 0.00 ? 149 LEU A HA   4  
ATOM 4622  H HB2  . LEU A 1 65 ? 2.287   -11.542 -8.157  1.00 0.00 ? 149 LEU A HB2  4  
ATOM 4623  H HB3  . LEU A 1 65 ? 1.129   -11.105 -6.919  1.00 0.00 ? 149 LEU A HB3  4  
ATOM 4624  H HG   . LEU A 1 65 ? 1.038   -10.025 -9.738  1.00 0.00 ? 149 LEU A HG   4  
ATOM 4625  H HD11 . LEU A 1 65 ? -0.462  -12.344 -8.532  1.00 0.00 ? 149 LEU A HD11 4  
ATOM 4626  H HD12 . LEU A 1 65 ? 0.774   -12.438 -9.787  1.00 0.00 ? 149 LEU A HD12 4  
ATOM 4627  H HD13 . LEU A 1 65 ? -0.763  -11.639 -10.121 1.00 0.00 ? 149 LEU A HD13 4  
ATOM 4628  H HD21 . LEU A 1 65 ? -0.126  -8.643  -8.112  1.00 0.00 ? 149 LEU A HD21 4  
ATOM 4629  H HD22 . LEU A 1 65 ? -1.001  -10.054 -7.515  1.00 0.00 ? 149 LEU A HD22 4  
ATOM 4630  H HD23 . LEU A 1 65 ? -1.281  -9.472  -9.157  1.00 0.00 ? 149 LEU A HD23 4  
ATOM 4631  N N    . LYS A 1 66 ? 2.393   -7.930  -9.228  1.00 0.00 ? 150 LYS A N    4  
ATOM 4632  C CA   . LYS A 1 66 ? 2.900   -7.155  -10.346 1.00 0.00 ? 150 LYS A CA   4  
ATOM 4633  C C    . LYS A 1 66 ? 3.812   -6.042  -9.832  1.00 0.00 ? 150 LYS A C    4  
ATOM 4634  O O    . LYS A 1 66 ? 3.353   -5.128  -9.148  1.00 0.00 ? 150 LYS A O    4  
ATOM 4635  C CB   . LYS A 1 66 ? 1.731   -6.564  -11.141 1.00 0.00 ? 150 LYS A CB   4  
ATOM 4636  C CG   . LYS A 1 66 ? 2.158   -5.619  -12.254 1.00 0.00 ? 150 LYS A CG   4  
ATOM 4637  C CD   . LYS A 1 66 ? 0.961   -5.026  -12.977 1.00 0.00 ? 150 LYS A CD   4  
ATOM 4638  C CE   . LYS A 1 66 ? 0.188   -6.083  -13.752 1.00 0.00 ? 150 LYS A CE   4  
ATOM 4639  N NZ   . LYS A 1 66 ? 0.987   -6.649  -14.869 1.00 0.00 ? 150 LYS A NZ   4  
ATOM 4640  H H    . LYS A 1 66 ? 1.514   -7.714  -8.858  1.00 0.00 ? 150 LYS A H    4  
ATOM 4641  H HA   . LYS A 1 66 ? 3.469   -7.814  -10.984 1.00 0.00 ? 150 LYS A HA   4  
ATOM 4642  H HB2  . LYS A 1 66 ? 1.169   -7.374  -11.582 1.00 0.00 ? 150 LYS A HB2  4  
ATOM 4643  H HB3  . LYS A 1 66 ? 1.092   -6.020  -10.463 1.00 0.00 ? 150 LYS A HB3  4  
ATOM 4644  H HG2  . LYS A 1 66 ? 2.738   -4.816  -11.825 1.00 0.00 ? 150 LYS A HG2  4  
ATOM 4645  H HG3  . LYS A 1 66 ? 2.763   -6.164  -12.964 1.00 0.00 ? 150 LYS A HG3  4  
ATOM 4646  H HD2  . LYS A 1 66 ? 0.304   -4.573  -12.252 1.00 0.00 ? 150 LYS A HD2  4  
ATOM 4647  H HD3  . LYS A 1 66 ? 1.311   -4.273  -13.668 1.00 0.00 ? 150 LYS A HD3  4  
ATOM 4648  H HE2  . LYS A 1 66 ? -0.081  -6.880  -13.075 1.00 0.00 ? 150 LYS A HE2  4  
ATOM 4649  H HE3  . LYS A 1 66 ? -0.710  -5.635  -14.152 1.00 0.00 ? 150 LYS A HE3  4  
ATOM 4650  H HZ1  . LYS A 1 66 ? 0.436   -7.380  -15.368 1.00 0.00 ? 150 LYS A HZ1  4  
ATOM 4651  H HZ2  . LYS A 1 66 ? 1.868   -7.078  -14.511 1.00 0.00 ? 150 LYS A HZ2  4  
ATOM 4652  H HZ3  . LYS A 1 66 ? 1.232   -5.895  -15.552 1.00 0.00 ? 150 LYS A HZ3  4  
ATOM 4653  N N    . PRO A 1 67 ? 5.114   -6.095  -10.168 1.00 0.00 ? 151 PRO A N    4  
ATOM 4654  C CA   . PRO A 1 67 ? 6.113   -5.107  -9.719  1.00 0.00 ? 151 PRO A CA   4  
ATOM 4655  C C    . PRO A 1 67 ? 5.915   -3.715  -10.336 1.00 0.00 ? 151 PRO A C    4  
ATOM 4656  O O    . PRO A 1 67 ? 6.838   -2.900  -10.369 1.00 0.00 ? 151 PRO A O    4  
ATOM 4657  C CB   . PRO A 1 67 ? 7.450   -5.703  -10.183 1.00 0.00 ? 151 PRO A CB   4  
ATOM 4658  C CG   . PRO A 1 67 ? 7.155   -7.120  -10.544 1.00 0.00 ? 151 PRO A CG   4  
ATOM 4659  C CD   . PRO A 1 67 ? 5.726   -7.144  -10.990 1.00 0.00 ? 151 PRO A CD   4  
ATOM 4660  H HA   . PRO A 1 67 ? 6.117   -5.019  -8.643  1.00 0.00 ? 151 PRO A HA   4  
ATOM 4661  H HB2  . PRO A 1 67 ? 7.815   -5.149  -11.036 1.00 0.00 ? 151 PRO A HB2  4  
ATOM 4662  H HB3  . PRO A 1 67 ? 8.169   -5.644  -9.380  1.00 0.00 ? 151 PRO A HB3  4  
ATOM 4663  H HG2  . PRO A 1 67 ? 7.804   -7.438  -11.347 1.00 0.00 ? 151 PRO A HG2  4  
ATOM 4664  H HG3  . PRO A 1 67 ? 7.288   -7.754  -9.680  1.00 0.00 ? 151 PRO A HG3  4  
ATOM 4665  H HD2  . PRO A 1 67 ? 5.650   -6.908  -12.041 1.00 0.00 ? 151 PRO A HD2  4  
ATOM 4666  H HD3  . PRO A 1 67 ? 5.280   -8.106  -10.779 1.00 0.00 ? 151 PRO A HD3  4  
ATOM 4667  N N    . LEU A 1 68 ? 4.708   -3.459  -10.813 1.00 0.00 ? 152 LEU A N    4  
ATOM 4668  C CA   . LEU A 1 68 ? 4.338   -2.168  -11.381 1.00 0.00 ? 152 LEU A CA   4  
ATOM 4669  C C    . LEU A 1 68 ? 2.874   -1.882  -11.086 1.00 0.00 ? 152 LEU A C    4  
ATOM 4670  O O    . LEU A 1 68 ? 2.240   -1.054  -11.743 1.00 0.00 ? 152 LEU A O    4  
ATOM 4671  C CB   . LEU A 1 68 ? 4.578   -2.148  -12.894 1.00 0.00 ? 152 LEU A CB   4  
ATOM 4672  C CG   . LEU A 1 68 ? 6.041   -2.027  -13.323 1.00 0.00 ? 152 LEU A CG   4  
ATOM 4673  C CD1  . LEU A 1 68 ? 6.162   -2.145  -14.832 1.00 0.00 ? 152 LEU A CD1  4  
ATOM 4674  C CD2  . LEU A 1 68 ? 6.629   -0.705  -12.850 1.00 0.00 ? 152 LEU A CD2  4  
ATOM 4675  H H    . LEU A 1 68 ? 4.030   -4.164  -10.768 1.00 0.00 ? 152 LEU A H    4  
ATOM 4676  H HA   . LEU A 1 68 ? 4.947   -1.409  -10.914 1.00 0.00 ? 152 LEU A HA   4  
ATOM 4677  H HB2  . LEU A 1 68 ? 4.177   -3.059  -13.312 1.00 0.00 ? 152 LEU A HB2  4  
ATOM 4678  H HB3  . LEU A 1 68 ? 4.035   -1.312  -13.311 1.00 0.00 ? 152 LEU A HB3  4  
ATOM 4679  H HG   . LEU A 1 68 ? 6.610   -2.829  -12.878 1.00 0.00 ? 152 LEU A HG   4  
ATOM 4680  H HD11 . LEU A 1 68 ? 5.783   -3.105  -15.150 1.00 0.00 ? 152 LEU A HD11 4  
ATOM 4681  H HD12 . LEU A 1 68 ? 7.198   -2.054  -15.118 1.00 0.00 ? 152 LEU A HD12 4  
ATOM 4682  H HD13 . LEU A 1 68 ? 5.588   -1.359  -15.301 1.00 0.00 ? 152 LEU A HD13 4  
ATOM 4683  H HD21 . LEU A 1 68 ? 6.072   0.112   -13.280 1.00 0.00 ? 152 LEU A HD21 4  
ATOM 4684  H HD22 . LEU A 1 68 ? 7.662   -0.640  -13.158 1.00 0.00 ? 152 LEU A HD22 4  
ATOM 4685  H HD23 . LEU A 1 68 ? 6.571   -0.652  -11.771 1.00 0.00 ? 152 LEU A HD23 4  
ATOM 4686  N N    . SER A 1 69 ? 2.351   -2.579  -10.085 1.00 0.00 ? 153 SER A N    4  
ATOM 4687  C CA   . SER A 1 69 ? 0.956   -2.454  -9.697  1.00 0.00 ? 153 SER A CA   4  
ATOM 4688  C C    . SER A 1 69 ? 0.666   -1.054  -9.167  1.00 0.00 ? 153 SER A C    4  
ATOM 4689  O O    . SER A 1 69 ? 1.357   -0.563  -8.276  1.00 0.00 ? 153 SER A O    4  
ATOM 4690  C CB   . SER A 1 69 ? 0.613   -3.516  -8.645  1.00 0.00 ? 153 SER A CB   4  
ATOM 4691  O OG   . SER A 1 69 ? 1.621   -3.588  -7.649  1.00 0.00 ? 153 SER A OG   4  
ATOM 4692  H H    . SER A 1 69 ? 2.932   -3.184  -9.574  1.00 0.00 ? 153 SER A H    4  
ATOM 4693  H HA   . SER A 1 69 ? 0.352   -2.624  -10.578 1.00 0.00 ? 153 SER A HA   4  
ATOM 4694  H HB2  . SER A 1 69 ? -0.324  -3.264  -8.172  1.00 0.00 ? 153 SER A HB2  4  
ATOM 4695  H HB3  . SER A 1 69 ? 0.528   -4.482  -9.125  1.00 0.00 ? 153 SER A HB3  4  
ATOM 4696  H HG   . SER A 1 69 ? 2.266   -4.266  -7.887  1.00 0.00 ? 153 SER A HG   4  
ATOM 4697  N N    . THR A 1 70 ? -0.348  -0.413  -9.725  1.00 0.00 ? 154 THR A N    4  
ATOM 4698  C CA   . THR A 1 70 ? -0.688  0.940   -9.335  1.00 0.00 ? 154 THR A CA   4  
ATOM 4699  C C    . THR A 1 70 ? -1.774  0.941   -8.262  1.00 0.00 ? 154 THR A C    4  
ATOM 4700  O O    . THR A 1 70 ? -2.955  0.750   -8.558  1.00 0.00 ? 154 THR A O    4  
ATOM 4701  C CB   . THR A 1 70 ? -1.158  1.767   -10.547 1.00 0.00 ? 154 THR A CB   4  
ATOM 4702  O OG1  . THR A 1 70 ? -0.205  1.651   -11.613 1.00 0.00 ? 154 THR A OG1  4  
ATOM 4703  C CG2  . THR A 1 70 ? -1.324  3.231   -10.173 1.00 0.00 ? 154 THR A CG2  4  
ATOM 4704  H H    . THR A 1 70 ? -0.893  -0.865  -10.407 1.00 0.00 ? 154 THR A H    4  
ATOM 4705  H HA   . THR A 1 70 ? 0.202   1.405   -8.935  1.00 0.00 ? 154 THR A HA   4  
ATOM 4706  H HB   . THR A 1 70 ? -2.112  1.383   -10.881 1.00 0.00 ? 154 THR A HB   4  
ATOM 4707  H HG1  . THR A 1 70 ? 0.373   0.899   -11.439 1.00 0.00 ? 154 THR A HG1  4  
ATOM 4708  H HG21 . THR A 1 70 ? -0.382  3.616   -9.806  1.00 0.00 ? 154 THR A HG21 4  
ATOM 4709  H HG22 . THR A 1 70 ? -2.075  3.324   -9.406  1.00 0.00 ? 154 THR A HG22 4  
ATOM 4710  H HG23 . THR A 1 70 ? -1.626  3.792   -11.046 1.00 0.00 ? 154 THR A HG23 4  
ATOM 4711  N N    . VAL A 1 71 ? -1.363  1.129   -7.020  1.00 0.00 ? 155 VAL A N    4  
ATOM 4712  C CA   . VAL A 1 71 ? -2.299  1.223   -5.914  1.00 0.00 ? 155 VAL A CA   4  
ATOM 4713  C C    . VAL A 1 71 ? -2.651  2.684   -5.681  1.00 0.00 ? 155 VAL A C    4  
ATOM 4714  O O    . VAL A 1 71 ? -1.807  3.480   -5.271  1.00 0.00 ? 155 VAL A O    4  
ATOM 4715  C CB   . VAL A 1 71 ? -1.720  0.612   -4.619  1.00 0.00 ? 155 VAL A CB   4  
ATOM 4716  C CG1  . VAL A 1 71 ? -2.758  0.628   -3.506  1.00 0.00 ? 155 VAL A CG1  4  
ATOM 4717  C CG2  . VAL A 1 71 ? -1.222  -0.805  -4.869  1.00 0.00 ? 155 VAL A CG2  4  
ATOM 4718  H H    . VAL A 1 71 ? -0.399  1.224   -6.841  1.00 0.00 ? 155 VAL A H    4  
ATOM 4719  H HA   . VAL A 1 71 ? -3.197  0.684   -6.182  1.00 0.00 ? 155 VAL A HA   4  
ATOM 4720  H HB   . VAL A 1 71 ? -0.881  1.214   -4.303  1.00 0.00 ? 155 VAL A HB   4  
ATOM 4721  H HG11 . VAL A 1 71 ? -3.064  1.647   -3.313  1.00 0.00 ? 155 VAL A HG11 4  
ATOM 4722  H HG12 . VAL A 1 71 ? -2.331  0.204   -2.610  1.00 0.00 ? 155 VAL A HG12 4  
ATOM 4723  H HG13 . VAL A 1 71 ? -3.617  0.045   -3.806  1.00 0.00 ? 155 VAL A HG13 4  
ATOM 4724  H HG21 . VAL A 1 71 ? -0.808  -1.209  -3.957  1.00 0.00 ? 155 VAL A HG21 4  
ATOM 4725  H HG22 . VAL A 1 71 ? -0.459  -0.789  -5.635  1.00 0.00 ? 155 VAL A HG22 4  
ATOM 4726  H HG23 . VAL A 1 71 ? -2.045  -1.423  -5.195  1.00 0.00 ? 155 VAL A HG23 4  
ATOM 4727  N N    . PHE A 1 72 ? -3.891  3.036   -5.971  1.00 0.00 ? 156 PHE A N    4  
ATOM 4728  C CA   . PHE A 1 72 ? -4.329  4.415   -5.885  1.00 0.00 ? 156 PHE A CA   4  
ATOM 4729  C C    . PHE A 1 72 ? -4.616  4.807   -4.447  1.00 0.00 ? 156 PHE A C    4  
ATOM 4730  O O    . PHE A 1 72 ? -5.648  4.446   -3.883  1.00 0.00 ? 156 PHE A O    4  
ATOM 4731  C CB   . PHE A 1 72 ? -5.567  4.640   -6.753  1.00 0.00 ? 156 PHE A CB   4  
ATOM 4732  C CG   . PHE A 1 72 ? -5.301  4.468   -8.219  1.00 0.00 ? 156 PHE A CG   4  
ATOM 4733  C CD1  . PHE A 1 72 ? -4.765  5.507   -8.959  1.00 0.00 ? 156 PHE A CD1  4  
ATOM 4734  C CD2  . PHE A 1 72 ? -5.582  3.269   -8.856  1.00 0.00 ? 156 PHE A CD2  4  
ATOM 4735  C CE1  . PHE A 1 72 ? -4.513  5.356   -10.306 1.00 0.00 ? 156 PHE A CE1  4  
ATOM 4736  C CE2  . PHE A 1 72 ? -5.330  3.111   -10.205 1.00 0.00 ? 156 PHE A CE2  4  
ATOM 4737  C CZ   . PHE A 1 72 ? -4.795  4.158   -10.932 1.00 0.00 ? 156 PHE A CZ   4  
ATOM 4738  H H    . PHE A 1 72 ? -4.539  2.345   -6.232  1.00 0.00 ? 156 PHE A H    4  
ATOM 4739  H HA   . PHE A 1 72 ? -3.527  5.036   -6.256  1.00 0.00 ? 156 PHE A HA   4  
ATOM 4740  H HB2  . PHE A 1 72 ? -6.332  3.934   -6.470  1.00 0.00 ? 156 PHE A HB2  4  
ATOM 4741  H HB3  . PHE A 1 72 ? -5.931  5.644   -6.597  1.00 0.00 ? 156 PHE A HB3  4  
ATOM 4742  H HD1  . PHE A 1 72 ? -4.545  6.444   -8.472  1.00 0.00 ? 156 PHE A HD1  4  
ATOM 4743  H HD2  . PHE A 1 72 ? -6.001  2.450   -8.286  1.00 0.00 ? 156 PHE A HD2  4  
ATOM 4744  H HE1  . PHE A 1 72 ? -4.095  6.175   -10.874 1.00 0.00 ? 156 PHE A HE1  4  
ATOM 4745  H HE2  . PHE A 1 72 ? -5.553  2.172   -10.691 1.00 0.00 ? 156 PHE A HE2  4  
ATOM 4746  H HZ   . PHE A 1 72 ? -4.596  4.037   -11.986 1.00 0.00 ? 156 PHE A HZ   4  
ATOM 4747  N N    . MET A 1 73 ? -3.684  5.531   -3.857  1.00 0.00 ? 157 MET A N    4  
ATOM 4748  C CA   . MET A 1 73 ? -3.855  6.055   -2.516  1.00 0.00 ? 157 MET A CA   4  
ATOM 4749  C C    . MET A 1 73 ? -4.791  7.258   -2.569  1.00 0.00 ? 157 MET A C    4  
ATOM 4750  O O    . MET A 1 73 ? -4.365  8.394   -2.798  1.00 0.00 ? 157 MET A O    4  
ATOM 4751  C CB   . MET A 1 73 ? -2.490  6.418   -1.922  1.00 0.00 ? 157 MET A CB   4  
ATOM 4752  C CG   . MET A 1 73 ? -2.537  7.082   -0.556  1.00 0.00 ? 157 MET A CG   4  
ATOM 4753  S SD   . MET A 1 73 ? -0.892  7.568   0.003   1.00 0.00 ? 157 MET A SD   4  
ATOM 4754  C CE   . MET A 1 73 ? -1.281  8.620   1.395   1.00 0.00 ? 157 MET A CE   4  
ATOM 4755  H H    . MET A 1 73 ? -2.856  5.732   -4.346  1.00 0.00 ? 157 MET A H    4  
ATOM 4756  H HA   . MET A 1 73 ? -4.313  5.284   -1.914  1.00 0.00 ? 157 MET A HA   4  
ATOM 4757  H HB2  . MET A 1 73 ? -1.908  5.515   -1.826  1.00 0.00 ? 157 MET A HB2  4  
ATOM 4758  H HB3  . MET A 1 73 ? -1.983  7.085   -2.599  1.00 0.00 ? 157 MET A HB3  4  
ATOM 4759  H HG2  . MET A 1 73 ? -3.164  7.957   -0.613  1.00 0.00 ? 157 MET A HG2  4  
ATOM 4760  H HG3  . MET A 1 73 ? -2.953  6.385   0.156   1.00 0.00 ? 157 MET A HG3  4  
ATOM 4761  H HE1  . MET A 1 73 ? -1.806  8.045   2.143   1.00 0.00 ? 157 MET A HE1  4  
ATOM 4762  H HE2  . MET A 1 73 ? -1.905  9.438   1.066   1.00 0.00 ? 157 MET A HE2  4  
ATOM 4763  H HE3  . MET A 1 73 ? -0.367  9.011   1.817   1.00 0.00 ? 157 MET A HE3  4  
ATOM 4764  N N    . ASN A 1 74 ? -6.079  6.987   -2.407  1.00 0.00 ? 158 ASN A N    4  
ATOM 4765  C CA   . ASN A 1 74 ? -7.102  8.005   -2.576  1.00 0.00 ? 158 ASN A CA   4  
ATOM 4766  C C    . ASN A 1 74 ? -7.106  8.953   -1.390  1.00 0.00 ? 158 ASN A C    4  
ATOM 4767  O O    . ASN A 1 74 ? -7.099  8.523   -0.237  1.00 0.00 ? 158 ASN A O    4  
ATOM 4768  C CB   . ASN A 1 74 ? -8.485  7.364   -2.732  1.00 0.00 ? 158 ASN A CB   4  
ATOM 4769  C CG   . ASN A 1 74 ? -8.575  6.377   -3.888  1.00 0.00 ? 158 ASN A CG   4  
ATOM 4770  O OD1  . ASN A 1 74 ? -9.359  5.429   -3.848  1.00 0.00 ? 158 ASN A OD1  4  
ATOM 4771  N ND2  . ASN A 1 74 ? -7.775  6.584   -4.920  1.00 0.00 ? 158 ASN A ND2  4  
ATOM 4772  H H    . ASN A 1 74 ? -6.351  6.076   -2.157  1.00 0.00 ? 158 ASN A H    4  
ATOM 4773  H HA   . ASN A 1 74 ? -6.870  8.565   -3.470  1.00 0.00 ? 158 ASN A HA   4  
ATOM 4774  H HB2  . ASN A 1 74 ? -8.729  6.838   -1.822  1.00 0.00 ? 158 ASN A HB2  4  
ATOM 4775  H HB3  . ASN A 1 74 ? -9.212  8.141   -2.893  1.00 0.00 ? 158 ASN A HB3  4  
ATOM 4776  H HD21 . ASN A 1 74 ? -7.170  7.348   -4.891  1.00 0.00 ? 158 ASN A HD21 4  
ATOM 4777  H HD22 . ASN A 1 74 ? -7.820  5.956   -5.673  1.00 0.00 ? 158 ASN A HD22 4  
ATOM 4778  N N    . LEU A 1 75 ? -7.100  10.244  -1.673  1.00 0.00 ? 159 LEU A N    4  
ATOM 4779  C CA   . LEU A 1 75 ? -7.106  11.247  -0.622  1.00 0.00 ? 159 LEU A CA   4  
ATOM 4780  C C    . LEU A 1 75 ? -8.526  11.738  -0.373  1.00 0.00 ? 159 LEU A C    4  
ATOM 4781  O O    . LEU A 1 75 ? -9.152  12.344  -1.243  1.00 0.00 ? 159 LEU A O    4  
ATOM 4782  C CB   . LEU A 1 75 ? -6.183  12.413  -0.987  1.00 0.00 ? 159 LEU A CB   4  
ATOM 4783  C CG   . LEU A 1 75 ? -4.708  12.035  -1.148  1.00 0.00 ? 159 LEU A CG   4  
ATOM 4784  C CD1  . LEU A 1 75 ? -3.872  13.271  -1.430  1.00 0.00 ? 159 LEU A CD1  4  
ATOM 4785  C CD2  . LEU A 1 75 ? -4.195  11.324  0.095   1.00 0.00 ? 159 LEU A CD2  4  
ATOM 4786  H H    . LEU A 1 75 ? -7.100  10.531  -2.607  1.00 0.00 ? 159 LEU A H    4  
ATOM 4787  H HA   . LEU A 1 75 ? -6.739  10.781  0.279   1.00 0.00 ? 159 LEU A HA   4  
ATOM 4788  H HB2  . LEU A 1 75 ? -6.527  12.844  -1.916  1.00 0.00 ? 159 LEU A HB2  4  
ATOM 4789  H HB3  . LEU A 1 75 ? -6.257  13.162  -0.212  1.00 0.00 ? 159 LEU A HB3  4  
ATOM 4790  H HG   . LEU A 1 75 ? -4.604  11.363  -1.988  1.00 0.00 ? 159 LEU A HG   4  
ATOM 4791  H HD11 . LEU A 1 75 ? -3.987  13.975  -0.619  1.00 0.00 ? 159 LEU A HD11 4  
ATOM 4792  H HD12 . LEU A 1 75 ? -4.200  13.726  -2.353  1.00 0.00 ? 159 LEU A HD12 4  
ATOM 4793  H HD13 . LEU A 1 75 ? -2.832  12.989  -1.517  1.00 0.00 ? 159 LEU A HD13 4  
ATOM 4794  H HD21 . LEU A 1 75 ? -3.155  11.067  -0.041  1.00 0.00 ? 159 LEU A HD21 4  
ATOM 4795  H HD22 . LEU A 1 75 ? -4.771  10.425  0.261   1.00 0.00 ? 159 LEU A HD22 4  
ATOM 4796  H HD23 . LEU A 1 75 ? -4.294  11.977  0.949   1.00 0.00 ? 159 LEU A HD23 4  
ATOM 4797  N N    . ARG A 1 76 ? -9.023  11.448  0.817   1.00 0.00 ? 160 ARG A N    4  
ATOM 4798  C CA   . ARG A 1 76 ? -10.382 11.782  1.195   1.00 0.00 ? 160 ARG A CA   4  
ATOM 4799  C C    . ARG A 1 76 ? -10.417 13.074  1.999   1.00 0.00 ? 160 ARG A C    4  
ATOM 4800  O O    . ARG A 1 76 ? -9.909  13.142  3.119   1.00 0.00 ? 160 ARG A O    4  
ATOM 4801  C CB   . ARG A 1 76 ? -10.983 10.641  2.010   1.00 0.00 ? 160 ARG A CB   4  
ATOM 4802  C CG   . ARG A 1 76 ? -12.347 10.953  2.595   1.00 0.00 ? 160 ARG A CG   4  
ATOM 4803  C CD   . ARG A 1 76 ? -12.808 9.824   3.489   1.00 0.00 ? 160 ARG A CD   4  
ATOM 4804  N NE   . ARG A 1 76 ? -14.025 10.152  4.226   1.00 0.00 ? 160 ARG A NE   4  
ATOM 4805  C CZ   . ARG A 1 76 ? -14.581 9.353   5.137   1.00 0.00 ? 160 ARG A CZ   4  
ATOM 4806  N NH1  . ARG A 1 76 ? -13.994 8.214   5.479   1.00 0.00 ? 160 ARG A NH1  4  
ATOM 4807  N NH2  . ARG A 1 76 ? -15.713 9.708   5.731   1.00 0.00 ? 160 ARG A NH2  4  
ATOM 4808  H H    . ARG A 1 76 ? -8.444  11.002  1.480   1.00 0.00 ? 160 ARG A H    4  
ATOM 4809  H HA   . ARG A 1 76 ? -10.959 11.914  0.292   1.00 0.00 ? 160 ARG A HA   4  
ATOM 4810  H HB2  . ARG A 1 76 ? -11.081 9.772   1.374   1.00 0.00 ? 160 ARG A HB2  4  
ATOM 4811  H HB3  . ARG A 1 76 ? -10.311 10.407  2.824   1.00 0.00 ? 160 ARG A HB3  4  
ATOM 4812  H HG2  . ARG A 1 76 ? -12.282 11.861  3.176   1.00 0.00 ? 160 ARG A HG2  4  
ATOM 4813  H HG3  . ARG A 1 76 ? -13.058 11.080  1.792   1.00 0.00 ? 160 ARG A HG3  4  
ATOM 4814  H HD2  . ARG A 1 76 ? -12.990 8.958   2.877   1.00 0.00 ? 160 ARG A HD2  4  
ATOM 4815  H HD3  . ARG A 1 76 ? -12.021 9.606   4.194   1.00 0.00 ? 160 ARG A HD3  4  
ATOM 4816  H HE   . ARG A 1 76 ? -14.458 11.018  4.024   1.00 0.00 ? 160 ARG A HE   4  
ATOM 4817  H HH11 . ARG A 1 76 ? -13.117 7.946   5.059   1.00 0.00 ? 160 ARG A HH11 4  
ATOM 4818  H HH12 . ARG A 1 76 ? -14.429 7.607   6.151   1.00 0.00 ? 160 ARG A HH12 4  
ATOM 4819  H HH21 . ARG A 1 76 ? -16.157 10.576  5.499   1.00 0.00 ? 160 ARG A HH21 4  
ATOM 4820  H HH22 . ARG A 1 76 ? -16.131 9.100   6.420   1.00 0.00 ? 160 ARG A HH22 4  
ATOM 4821  N N    . ASP A 1 2  ? 16.474  -12.257 -1.109  1.00 0.00 ? 86  ASP A N    5  
ATOM 4822  C CA   . ASP A 1 2  ? 15.318  -12.206 -0.218  1.00 0.00 ? 86  ASP A CA   5  
ATOM 4823  C C    . ASP A 1 2  ? 14.160  -11.655 -1.025  1.00 0.00 ? 86  ASP A C    5  
ATOM 4824  O O    . ASP A 1 2  ? 12.984  -11.900 -0.738  1.00 0.00 ? 86  ASP A O    5  
ATOM 4825  C CB   . ASP A 1 2  ? 15.605  -11.312 0.998   1.00 0.00 ? 86  ASP A CB   5  
ATOM 4826  C CG   . ASP A 1 2  ? 14.425  -11.184 1.939   1.00 0.00 ? 86  ASP A CG   5  
ATOM 4827  O OD1  . ASP A 1 2  ? 14.121  -12.156 2.666   1.00 0.00 ? 86  ASP A OD1  5  
ATOM 4828  O OD2  . ASP A 1 2  ? 13.806  -10.102 1.967   1.00 0.00 ? 86  ASP A OD2  5  
ATOM 4829  H H    . ASP A 1 2  ? 16.331  -12.057 -2.065  1.00 0.00 ? 86  ASP A H    5  
ATOM 4830  H HA   . ASP A 1 2  ? 15.087  -13.210 0.107   1.00 0.00 ? 86  ASP A HA   5  
ATOM 4831  H HB2  . ASP A 1 2  ? 16.433  -11.729 1.551   1.00 0.00 ? 86  ASP A HB2  5  
ATOM 4832  H HB3  . ASP A 1 2  ? 15.876  -10.324 0.652   1.00 0.00 ? 86  ASP A HB3  5  
ATOM 4833  N N    . GLU A 1 3  ? 14.548  -10.889 -2.044  1.00 0.00 ? 87  GLU A N    5  
ATOM 4834  C CA   . GLU A 1 3  ? 13.663  -10.422 -3.100  1.00 0.00 ? 87  GLU A CA   5  
ATOM 4835  C C    . GLU A 1 3  ? 12.580  -9.478  -2.590  1.00 0.00 ? 87  GLU A C    5  
ATOM 4836  O O    . GLU A 1 3  ? 11.448  -9.883  -2.322  1.00 0.00 ? 87  GLU A O    5  
ATOM 4837  C CB   . GLU A 1 3  ? 13.051  -11.603 -3.866  1.00 0.00 ? 87  GLU A CB   5  
ATOM 4838  C CG   . GLU A 1 3  ? 13.997  -12.243 -4.880  1.00 0.00 ? 87  GLU A CG   5  
ATOM 4839  C CD   . GLU A 1 3  ? 15.216  -12.893 -4.247  1.00 0.00 ? 87  GLU A CD   5  
ATOM 4840  O OE1  . GLU A 1 3  ? 16.209  -12.181 -3.968  1.00 0.00 ? 87  GLU A OE1  5  
ATOM 4841  O OE2  . GLU A 1 3  ? 15.193  -14.122 -4.036  1.00 0.00 ? 87  GLU A OE2  5  
ATOM 4842  H H    . GLU A 1 3  ? 15.486  -10.618 -2.079  1.00 0.00 ? 87  GLU A H    5  
ATOM 4843  H HA   . GLU A 1 3  ? 14.277  -9.866  -3.790  1.00 0.00 ? 87  GLU A HA   5  
ATOM 4844  H HB2  . GLU A 1 3  ? 12.760  -12.360 -3.156  1.00 0.00 ? 87  GLU A HB2  5  
ATOM 4845  H HB3  . GLU A 1 3  ? 12.171  -11.261 -4.393  1.00 0.00 ? 87  GLU A HB3  5  
ATOM 4846  H HG2  . GLU A 1 3  ? 13.455  -13.001 -5.426  1.00 0.00 ? 87  GLU A HG2  5  
ATOM 4847  H HG3  . GLU A 1 3  ? 14.334  -11.481 -5.569  1.00 0.00 ? 87  GLU A HG3  5  
ATOM 4848  N N    . PRO A 1 4  ? 12.935  -8.201  -2.410  1.00 0.00 ? 88  PRO A N    5  
ATOM 4849  C CA   . PRO A 1 4  ? 11.969  -7.148  -2.140  1.00 0.00 ? 88  PRO A CA   5  
ATOM 4850  C C    . PRO A 1 4  ? 11.200  -6.773  -3.403  1.00 0.00 ? 88  PRO A C    5  
ATOM 4851  O O    . PRO A 1 4  ? 11.786  -6.589  -4.474  1.00 0.00 ? 88  PRO A O    5  
ATOM 4852  C CB   . PRO A 1 4  ? 12.825  -5.964  -1.660  1.00 0.00 ? 88  PRO A CB   5  
ATOM 4853  C CG   . PRO A 1 4  ? 14.204  -6.508  -1.488  1.00 0.00 ? 88  PRO A CG   5  
ATOM 4854  C CD   . PRO A 1 4  ? 14.306  -7.682  -2.415  1.00 0.00 ? 88  PRO A CD   5  
ATOM 4855  H HA   . PRO A 1 4  ? 11.274  -7.436  -1.366  1.00 0.00 ? 88  PRO A HA   5  
ATOM 4856  H HB2  . PRO A 1 4  ? 12.801  -5.180  -2.404  1.00 0.00 ? 88  PRO A HB2  5  
ATOM 4857  H HB3  . PRO A 1 4  ? 12.430  -5.591  -0.727  1.00 0.00 ? 88  PRO A HB3  5  
ATOM 4858  H HG2  . PRO A 1 4  ? 14.934  -5.756  -1.755  1.00 0.00 ? 88  PRO A HG2  5  
ATOM 4859  H HG3  . PRO A 1 4  ? 14.351  -6.824  -0.467  1.00 0.00 ? 88  PRO A HG3  5  
ATOM 4860  H HD2  . PRO A 1 4  ? 14.599  -7.362  -3.403  1.00 0.00 ? 88  PRO A HD2  5  
ATOM 4861  H HD3  . PRO A 1 4  ? 14.998  -8.415  -2.027  1.00 0.00 ? 88  PRO A HD3  5  
ATOM 4862  N N    . LEU A 1 5  ? 9.891   -6.688  -3.277  1.00 0.00 ? 89  LEU A N    5  
ATOM 4863  C CA   . LEU A 1 5  ? 9.031   -6.299  -4.382  1.00 0.00 ? 89  LEU A CA   5  
ATOM 4864  C C    . LEU A 1 5  ? 8.817   -4.792  -4.343  1.00 0.00 ? 89  LEU A C    5  
ATOM 4865  O O    . LEU A 1 5  ? 8.955   -4.177  -3.289  1.00 0.00 ? 89  LEU A O    5  
ATOM 4866  C CB   . LEU A 1 5  ? 7.695   -7.043  -4.277  1.00 0.00 ? 89  LEU A CB   5  
ATOM 4867  C CG   . LEU A 1 5  ? 6.610   -6.631  -5.273  1.00 0.00 ? 89  LEU A CG   5  
ATOM 4868  C CD1  . LEU A 1 5  ? 7.022   -6.949  -6.701  1.00 0.00 ? 89  LEU A CD1  5  
ATOM 4869  C CD2  . LEU A 1 5  ? 5.306   -7.322  -4.923  1.00 0.00 ? 89  LEU A CD2  5  
ATOM 4870  H H    . LEU A 1 5  ? 9.485   -6.877  -2.403  1.00 0.00 ? 89  LEU A H    5  
ATOM 4871  H HA   . LEU A 1 5  ? 9.522   -6.565  -5.304  1.00 0.00 ? 89  LEU A HA   5  
ATOM 4872  H HB2  . LEU A 1 5  ? 7.887   -8.096  -4.409  1.00 0.00 ? 89  LEU A HB2  5  
ATOM 4873  H HB3  . LEU A 1 5  ? 7.304   -6.893  -3.280  1.00 0.00 ? 89  LEU A HB3  5  
ATOM 4874  H HG   . LEU A 1 5  ? 6.450   -5.565  -5.202  1.00 0.00 ? 89  LEU A HG   5  
ATOM 4875  H HD11 . LEU A 1 5  ? 6.257   -6.603  -7.382  1.00 0.00 ? 89  LEU A HD11 5  
ATOM 4876  H HD12 . LEU A 1 5  ? 7.149   -8.015  -6.808  1.00 0.00 ? 89  LEU A HD12 5  
ATOM 4877  H HD13 . LEU A 1 5  ? 7.954   -6.450  -6.922  1.00 0.00 ? 89  LEU A HD13 5  
ATOM 4878  H HD21 . LEU A 1 5  ? 4.536   -7.010  -5.613  1.00 0.00 ? 89  LEU A HD21 5  
ATOM 4879  H HD22 . LEU A 1 5  ? 5.017   -7.055  -3.916  1.00 0.00 ? 89  LEU A HD22 5  
ATOM 4880  H HD23 . LEU A 1 5  ? 5.437   -8.391  -4.988  1.00 0.00 ? 89  LEU A HD23 5  
ATOM 4881  N N    . SER A 1 6  ? 8.500   -4.193  -5.476  1.00 0.00 ? 90  SER A N    5  
ATOM 4882  C CA   . SER A 1 6  ? 8.279   -2.765  -5.524  1.00 0.00 ? 90  SER A CA   5  
ATOM 4883  C C    . SER A 1 6  ? 6.983   -2.463  -6.263  1.00 0.00 ? 90  SER A C    5  
ATOM 4884  O O    . SER A 1 6  ? 6.736   -2.991  -7.346  1.00 0.00 ? 90  SER A O    5  
ATOM 4885  C CB   . SER A 1 6  ? 9.464   -2.065  -6.194  1.00 0.00 ? 90  SER A CB   5  
ATOM 4886  O OG   . SER A 1 6  ? 9.470   -0.675  -5.906  1.00 0.00 ? 90  SER A OG   5  
ATOM 4887  H H    . SER A 1 6  ? 8.404   -4.722  -6.297  1.00 0.00 ? 90  SER A H    5  
ATOM 4888  H HA   . SER A 1 6  ? 8.190   -2.408  -4.507  1.00 0.00 ? 90  SER A HA   5  
ATOM 4889  H HB2  . SER A 1 6  ? 10.386  -2.497  -5.836  1.00 0.00 ? 90  SER A HB2  5  
ATOM 4890  H HB3  . SER A 1 6  ? 9.396   -2.198  -7.264  1.00 0.00 ? 90  SER A HB3  5  
ATOM 4891  H HG   . SER A 1 6  ? 9.106   -0.530  -5.020  1.00 0.00 ? 90  SER A HG   5  
ATOM 4892  N N    . ILE A 1 7  ? 6.146   -1.632  -5.659  1.00 0.00 ? 91  ILE A N    5  
ATOM 4893  C CA   . ILE A 1 7  ? 4.877   -1.252  -6.258  1.00 0.00 ? 91  ILE A CA   5  
ATOM 4894  C C    . ILE A 1 7  ? 4.751   0.264   -6.283  1.00 0.00 ? 91  ILE A C    5  
ATOM 4895  O O    . ILE A 1 7  ? 5.310   0.955   -5.426  1.00 0.00 ? 91  ILE A O    5  
ATOM 4896  C CB   . ILE A 1 7  ? 3.672   -1.853  -5.498  1.00 0.00 ? 91  ILE A CB   5  
ATOM 4897  C CG1  . ILE A 1 7  ? 3.713   -1.456  -4.019  1.00 0.00 ? 91  ILE A CG1  5  
ATOM 4898  C CG2  . ILE A 1 7  ? 3.644   -3.368  -5.653  1.00 0.00 ? 91  ILE A CG2  5  
ATOM 4899  C CD1  . ILE A 1 7  ? 2.498   -1.905  -3.236  1.00 0.00 ? 91  ILE A CD1  5  
ATOM 4900  H H    . ILE A 1 7  ? 6.397   -1.250  -4.790  1.00 0.00 ? 91  ILE A H    5  
ATOM 4901  H HA   . ILE A 1 7  ? 4.861   -1.625  -7.274  1.00 0.00 ? 91  ILE A HA   5  
ATOM 4902  H HB   . ILE A 1 7  ? 2.770   -1.460  -5.941  1.00 0.00 ? 91  ILE A HB   5  
ATOM 4903  H HG12 . ILE A 1 7  ? 4.586   -1.896  -3.558  1.00 0.00 ? 91  ILE A HG12 5  
ATOM 4904  H HG13 . ILE A 1 7  ? 3.779   -0.380  -3.946  1.00 0.00 ? 91  ILE A HG13 5  
ATOM 4905  H HG21 . ILE A 1 7  ? 3.532   -3.621  -6.698  1.00 0.00 ? 91  ILE A HG21 5  
ATOM 4906  H HG22 . ILE A 1 7  ? 2.813   -3.771  -5.093  1.00 0.00 ? 91  ILE A HG22 5  
ATOM 4907  H HG23 . ILE A 1 7  ? 4.568   -3.785  -5.280  1.00 0.00 ? 91  ILE A HG23 5  
ATOM 4908  H HD11 . ILE A 1 7  ? 2.590   -1.586  -2.208  1.00 0.00 ? 91  ILE A HD11 5  
ATOM 4909  H HD12 . ILE A 1 7  ? 2.421   -2.981  -3.275  1.00 0.00 ? 91  ILE A HD12 5  
ATOM 4910  H HD13 . ILE A 1 7  ? 1.609   -1.465  -3.668  1.00 0.00 ? 91  ILE A HD13 5  
ATOM 4911  N N    . LEU A 1 8  ? 4.027   0.782   -7.258  1.00 0.00 ? 92  LEU A N    5  
ATOM 4912  C CA   . LEU A 1 8  ? 3.891   2.220   -7.412  1.00 0.00 ? 92  LEU A CA   5  
ATOM 4913  C C    . LEU A 1 8  ? 2.647   2.725   -6.692  1.00 0.00 ? 92  LEU A C    5  
ATOM 4914  O O    . LEU A 1 8  ? 1.520   2.395   -7.065  1.00 0.00 ? 92  LEU A O    5  
ATOM 4915  C CB   . LEU A 1 8  ? 3.834   2.595   -8.893  1.00 0.00 ? 92  LEU A CB   5  
ATOM 4916  C CG   . LEU A 1 8  ? 3.772   4.095   -9.184  1.00 0.00 ? 92  LEU A CG   5  
ATOM 4917  C CD1  . LEU A 1 8  ? 5.001   4.796   -8.619  1.00 0.00 ? 92  LEU A CD1  5  
ATOM 4918  C CD2  . LEU A 1 8  ? 3.671   4.331   -10.682 1.00 0.00 ? 92  LEU A CD2  5  
ATOM 4919  H H    . LEU A 1 8  ? 3.565   0.185   -7.885  1.00 0.00 ? 92  LEU A H    5  
ATOM 4920  H HA   . LEU A 1 8  ? 4.760   2.683   -6.967  1.00 0.00 ? 92  LEU A HA   5  
ATOM 4921  H HB2  . LEU A 1 8  ? 4.715   2.197   -9.376  1.00 0.00 ? 92  LEU A HB2  5  
ATOM 4922  H HB3  . LEU A 1 8  ? 2.963   2.130   -9.327  1.00 0.00 ? 92  LEU A HB3  5  
ATOM 4923  H HG   . LEU A 1 8  ? 2.894   4.515   -8.714  1.00 0.00 ? 92  LEU A HG   5  
ATOM 4924  H HD11 . LEU A 1 8  ? 5.891   4.363   -9.051  1.00 0.00 ? 92  LEU A HD11 5  
ATOM 4925  H HD12 . LEU A 1 8  ? 5.024   4.673   -7.546  1.00 0.00 ? 92  LEU A HD12 5  
ATOM 4926  H HD13 . LEU A 1 8  ? 4.959   5.849   -8.860  1.00 0.00 ? 92  LEU A HD13 5  
ATOM 4927  H HD21 . LEU A 1 8  ? 2.810   3.810   -11.071 1.00 0.00 ? 92  LEU A HD21 5  
ATOM 4928  H HD22 . LEU A 1 8  ? 4.565   3.963   -11.162 1.00 0.00 ? 92  LEU A HD22 5  
ATOM 4929  H HD23 . LEU A 1 8  ? 3.570   5.389   -10.873 1.00 0.00 ? 92  LEU A HD23 5  
ATOM 4930  N N    . VAL A 1 9  ? 2.862   3.516   -5.652  1.00 0.00 ? 93  VAL A N    5  
ATOM 4931  C CA   . VAL A 1 9  ? 1.769   4.121   -4.912  1.00 0.00 ? 93  VAL A CA   5  
ATOM 4932  C C    . VAL A 1 9  ? 1.561   5.555   -5.382  1.00 0.00 ? 93  VAL A C    5  
ATOM 4933  O O    . VAL A 1 9  ? 2.428   6.415   -5.206  1.00 0.00 ? 93  VAL A O    5  
ATOM 4934  C CB   . VAL A 1 9  ? 2.036   4.098   -3.391  1.00 0.00 ? 93  VAL A CB   5  
ATOM 4935  C CG1  . VAL A 1 9  ? 0.884   4.737   -2.628  1.00 0.00 ? 93  VAL A CG1  5  
ATOM 4936  C CG2  . VAL A 1 9  ? 2.268   2.671   -2.913  1.00 0.00 ? 93  VAL A CG2  5  
ATOM 4937  H H    . VAL A 1 9  ? 3.788   3.709   -5.379  1.00 0.00 ? 93  VAL A H    5  
ATOM 4938  H HA   . VAL A 1 9  ? 0.873   3.551   -5.113  1.00 0.00 ? 93  VAL A HA   5  
ATOM 4939  H HB   . VAL A 1 9  ? 2.931   4.669   -3.196  1.00 0.00 ? 93  VAL A HB   5  
ATOM 4940  H HG11 . VAL A 1 9  ? 1.111   4.741   -1.571  1.00 0.00 ? 93  VAL A HG11 5  
ATOM 4941  H HG12 . VAL A 1 9  ? -0.019  4.171   -2.799  1.00 0.00 ? 93  VAL A HG12 5  
ATOM 4942  H HG13 . VAL A 1 9  ? 0.746   5.751   -2.970  1.00 0.00 ? 93  VAL A HG13 5  
ATOM 4943  H HG21 . VAL A 1 9  ? 3.125   2.254   -3.423  1.00 0.00 ? 93  VAL A HG21 5  
ATOM 4944  H HG22 . VAL A 1 9  ? 1.395   2.071   -3.129  1.00 0.00 ? 93  VAL A HG22 5  
ATOM 4945  H HG23 . VAL A 1 9  ? 2.449   2.672   -1.848  1.00 0.00 ? 93  VAL A HG23 5  
ATOM 4946  N N    . ARG A 1 10 ? 0.423   5.795   -6.005  1.00 0.00 ? 94  ARG A N    5  
ATOM 4947  C CA   . ARG A 1 10 ? 0.101   7.098   -6.566  1.00 0.00 ? 94  ARG A CA   5  
ATOM 4948  C C    . ARG A 1 10 ? -1.018  7.741   -5.763  1.00 0.00 ? 94  ARG A C    5  
ATOM 4949  O O    . ARG A 1 10 ? -2.137  7.230   -5.734  1.00 0.00 ? 94  ARG A O    5  
ATOM 4950  C CB   . ARG A 1 10 ? -0.329  6.929   -8.025  1.00 0.00 ? 94  ARG A CB   5  
ATOM 4951  C CG   . ARG A 1 10 ? -0.700  8.226   -8.721  1.00 0.00 ? 94  ARG A CG   5  
ATOM 4952  C CD   . ARG A 1 10 ? -1.242  7.951   -10.112 1.00 0.00 ? 94  ARG A CD   5  
ATOM 4953  N NE   . ARG A 1 10 ? -1.564  9.177   -10.832 1.00 0.00 ? 94  ARG A NE   5  
ATOM 4954  C CZ   . ARG A 1 10 ? -1.274  9.379   -12.116 1.00 0.00 ? 94  ARG A CZ   5  
ATOM 4955  N NH1  . ARG A 1 10 ? -0.623  8.451   -12.807 1.00 0.00 ? 94  ARG A NH1  5  
ATOM 4956  N NH2  . ARG A 1 10 ? -1.620  10.513  -12.705 1.00 0.00 ? 94  ARG A NH2  5  
ATOM 4957  H H    . ARG A 1 10 ? -0.236  5.068   -6.083  1.00 0.00 ? 94  ARG A H    5  
ATOM 4958  H HA   . ARG A 1 10 ? 0.981   7.721   -6.519  1.00 0.00 ? 94  ARG A HA   5  
ATOM 4959  H HB2  . ARG A 1 10 ? 0.482   6.475   -8.573  1.00 0.00 ? 94  ARG A HB2  5  
ATOM 4960  H HB3  . ARG A 1 10 ? -1.185  6.272   -8.059  1.00 0.00 ? 94  ARG A HB3  5  
ATOM 4961  H HG2  . ARG A 1 10 ? -1.456  8.734   -8.142  1.00 0.00 ? 94  ARG A HG2  5  
ATOM 4962  H HG3  . ARG A 1 10 ? 0.179   8.848   -8.800  1.00 0.00 ? 94  ARG A HG3  5  
ATOM 4963  H HD2  . ARG A 1 10 ? -0.499  7.400   -10.672 1.00 0.00 ? 94  ARG A HD2  5  
ATOM 4964  H HD3  . ARG A 1 10 ? -2.137  7.352   -10.021 1.00 0.00 ? 94  ARG A HD3  5  
ATOM 4965  H HE   . ARG A 1 10 ? -2.037  9.883   -10.334 1.00 0.00 ? 94  ARG A HE   5  
ATOM 4966  H HH11 . ARG A 1 10 ? -0.346  7.586   -12.367 1.00 0.00 ? 94  ARG A HH11 5  
ATOM 4967  H HH12 . ARG A 1 10 ? -0.409  8.600   -13.777 1.00 0.00 ? 94  ARG A HH12 5  
ATOM 4968  H HH21 . ARG A 1 10 ? -2.110  11.224  -12.188 1.00 0.00 ? 94  ARG A HH21 5  
ATOM 4969  H HH22 . ARG A 1 10 ? -1.397  10.669  -13.676 1.00 0.00 ? 94  ARG A HH22 5  
ATOM 4970  N N    . ASN A 1 11 ? -0.722  8.850   -5.101  1.00 0.00 ? 95  ASN A N    5  
ATOM 4971  C CA   . ASN A 1 11 ? -1.721  9.508   -4.278  1.00 0.00 ? 95  ASN A CA   5  
ATOM 4972  C C    . ASN A 1 11 ? -2.433  10.615  -5.050  1.00 0.00 ? 95  ASN A C    5  
ATOM 4973  O O    . ASN A 1 11 ? -1.810  11.361  -5.806  1.00 0.00 ? 95  ASN A O    5  
ATOM 4974  C CB   . ASN A 1 11 ? -1.120  10.024  -2.952  1.00 0.00 ? 95  ASN A CB   5  
ATOM 4975  C CG   . ASN A 1 11 ? 0.050   10.984  -3.105  1.00 0.00 ? 95  ASN A CG   5  
ATOM 4976  O OD1  . ASN A 1 11 ? 0.074   11.829  -3.989  1.00 0.00 ? 95  ASN A OD1  5  
ATOM 4977  N ND2  . ASN A 1 11 ? 1.041   10.846  -2.235  1.00 0.00 ? 95  ASN A ND2  5  
ATOM 4978  H H    . ASN A 1 11 ? 0.179   9.241   -5.185  1.00 0.00 ? 95  ASN A H    5  
ATOM 4979  H HA   . ASN A 1 11 ? -2.460  8.756   -4.035  1.00 0.00 ? 95  ASN A HA   5  
ATOM 4980  H HB2  . ASN A 1 11 ? -1.893  10.536  -2.402  1.00 0.00 ? 95  ASN A HB2  5  
ATOM 4981  H HB3  . ASN A 1 11 ? -0.786  9.174   -2.370  1.00 0.00 ? 95  ASN A HB3  5  
ATOM 4982  H HD21 . ASN A 1 11 ? 0.964   10.146  -1.553  1.00 0.00 ? 95  ASN A HD21 5  
ATOM 4983  H HD22 . ASN A 1 11 ? 1.812   11.455  -2.304  1.00 0.00 ? 95  ASN A HD22 5  
ATOM 4984  N N    . ASN A 1 12 ? -3.760  10.635  -4.871  1.00 0.00 ? 96  ASN A N    5  
ATOM 4985  C CA   . ASN A 1 12 ? -4.700  11.608  -5.467  1.00 0.00 ? 96  ASN A CA   5  
ATOM 4986  C C    . ASN A 1 12 ? -4.160  12.402  -6.672  1.00 0.00 ? 96  ASN A C    5  
ATOM 4987  O O    . ASN A 1 12 ? -4.441  12.059  -7.822  1.00 0.00 ? 96  ASN A O    5  
ATOM 4988  C CB   . ASN A 1 12 ? -5.274  12.569  -4.398  1.00 0.00 ? 96  ASN A CB   5  
ATOM 4989  C CG   . ASN A 1 12 ? -4.236  13.420  -3.676  1.00 0.00 ? 96  ASN A CG   5  
ATOM 4990  O OD1  . ASN A 1 12 ? -3.121  12.985  -3.407  1.00 0.00 ? 96  ASN A OD1  5  
ATOM 4991  N ND2  . ASN A 1 12 ? -4.596  14.658  -3.384  1.00 0.00 ? 96  ASN A ND2  5  
ATOM 4992  H H    . ASN A 1 12 ? -4.141  9.937   -4.295  1.00 0.00 ? 96  ASN A H    5  
ATOM 4993  H HA   . ASN A 1 12 ? -5.529  11.019  -5.834  1.00 0.00 ? 96  ASN A HA   5  
ATOM 4994  H HB2  . ASN A 1 12 ? -5.971  13.239  -4.876  1.00 0.00 ? 96  ASN A HB2  5  
ATOM 4995  H HB3  . ASN A 1 12 ? -5.806  11.988  -3.658  1.00 0.00 ? 96  ASN A HB3  5  
ATOM 4996  H HD21 . ASN A 1 12 ? -5.497  14.955  -3.646  1.00 0.00 ? 96  ASN A HD21 5  
ATOM 4997  H HD22 . ASN A 1 12 ? -3.949  15.229  -2.920  1.00 0.00 ? 96  ASN A HD22 5  
ATOM 4998  N N    . LYS A 1 13 ? -3.387  13.448  -6.410  1.00 0.00 ? 97  LYS A N    5  
ATOM 4999  C CA   . LYS A 1 13 ? -3.067  14.442  -7.425  1.00 0.00 ? 97  LYS A CA   5  
ATOM 5000  C C    . LYS A 1 13 ? -1.599  14.868  -7.337  1.00 0.00 ? 97  LYS A C    5  
ATOM 5001  O O    . LYS A 1 13 ? -1.165  15.788  -8.029  1.00 0.00 ? 97  LYS A O    5  
ATOM 5002  C CB   . LYS A 1 13 ? -4.000  15.650  -7.206  1.00 0.00 ? 97  LYS A CB   5  
ATOM 5003  C CG   . LYS A 1 13 ? -3.827  16.825  -8.164  1.00 0.00 ? 97  LYS A CG   5  
ATOM 5004  C CD   . LYS A 1 13 ? -4.394  16.548  -9.551  1.00 0.00 ? 97  LYS A CD   5  
ATOM 5005  C CE   . LYS A 1 13 ? -3.435  15.748  -10.414 1.00 0.00 ? 97  LYS A CE   5  
ATOM 5006  N NZ   . LYS A 1 13 ? -2.108  16.415  -10.538 1.00 0.00 ? 97  LYS A NZ   5  
ATOM 5007  H H    . LYS A 1 13 ? -3.012  13.547  -5.507  1.00 0.00 ? 97  LYS A H    5  
ATOM 5008  H HA   . LYS A 1 13 ? -3.259  14.013  -8.396  1.00 0.00 ? 97  LYS A HA   5  
ATOM 5009  H HB2  . LYS A 1 13 ? -5.018  15.307  -7.293  1.00 0.00 ? 97  LYS A HB2  5  
ATOM 5010  H HB3  . LYS A 1 13 ? -3.847  16.015  -6.202  1.00 0.00 ? 97  LYS A HB3  5  
ATOM 5011  H HG2  . LYS A 1 13 ? -4.333  17.684  -7.751  1.00 0.00 ? 97  LYS A HG2  5  
ATOM 5012  H HG3  . LYS A 1 13 ? -2.770  17.043  -8.256  1.00 0.00 ? 97  LYS A HG3  5  
ATOM 5013  H HD2  . LYS A 1 13 ? -5.316  15.994  -9.449  1.00 0.00 ? 97  LYS A HD2  5  
ATOM 5014  H HD3  . LYS A 1 13 ? -4.596  17.493  -10.036 1.00 0.00 ? 97  LYS A HD3  5  
ATOM 5015  H HE2  . LYS A 1 13 ? -3.294  14.775  -9.966  1.00 0.00 ? 97  LYS A HE2  5  
ATOM 5016  H HE3  . LYS A 1 13 ? -3.867  15.634  -11.396 1.00 0.00 ? 97  LYS A HE3  5  
ATOM 5017  H HZ1  . LYS A 1 13 ? -1.578  16.331  -9.644  1.00 0.00 ? 97  LYS A HZ1  5  
ATOM 5018  H HZ2  . LYS A 1 13 ? -2.230  17.426  -10.755 1.00 0.00 ? 97  LYS A HZ2  5  
ATOM 5019  H HZ3  . LYS A 1 13 ? -1.551  15.973  -11.301 1.00 0.00 ? 97  LYS A HZ3  5  
ATOM 5020  N N    . GLY A 1 14 ? -0.821  14.175  -6.523  1.00 0.00 ? 98  GLY A N    5  
ATOM 5021  C CA   . GLY A 1 14 ? 0.514   14.654  -6.239  1.00 0.00 ? 98  GLY A CA   5  
ATOM 5022  C C    . GLY A 1 14 ? 1.625   13.683  -6.588  1.00 0.00 ? 98  GLY A C    5  
ATOM 5023  O O    . GLY A 1 14 ? 2.276   13.821  -7.625  1.00 0.00 ? 98  GLY A O    5  
ATOM 5024  H H    . GLY A 1 14 ? -1.142  13.331  -6.134  1.00 0.00 ? 98  GLY A H    5  
ATOM 5025  H HA2  . GLY A 1 14 ? 0.674   15.564  -6.796  1.00 0.00 ? 98  GLY A HA2  5  
ATOM 5026  H HA3  . GLY A 1 14 ? 0.577   14.881  -5.185  1.00 0.00 ? 98  GLY A HA3  5  
ATOM 5027  N N    . ARG A 1 15 ? 1.829   12.698  -5.733  1.00 0.00 ? 99  ARG A N    5  
ATOM 5028  C CA   . ARG A 1 15 ? 3.045   11.899  -5.764  1.00 0.00 ? 99  ARG A CA   5  
ATOM 5029  C C    . ARG A 1 15 ? 2.788   10.465  -6.211  1.00 0.00 ? 99  ARG A C    5  
ATOM 5030  O O    . ARG A 1 15 ? 1.828   9.825   -5.783  1.00 0.00 ? 99  ARG A O    5  
ATOM 5031  C CB   . ARG A 1 15 ? 3.667   11.882  -4.366  1.00 0.00 ? 99  ARG A CB   5  
ATOM 5032  C CG   . ARG A 1 15 ? 5.076   11.316  -4.318  1.00 0.00 ? 99  ARG A CG   5  
ATOM 5033  C CD   . ARG A 1 15 ? 6.060   12.257  -4.990  1.00 0.00 ? 99  ARG A CD   5  
ATOM 5034  N NE   . ARG A 1 15 ? 6.108   13.558  -4.325  1.00 0.00 ? 99  ARG A NE   5  
ATOM 5035  C CZ   . ARG A 1 15 ? 6.667   14.647  -4.853  1.00 0.00 ? 99  ARG A CZ   5  
ATOM 5036  N NH1  . ARG A 1 15 ? 7.263   14.580  -6.036  1.00 0.00 ? 99  ARG A NH1  5  
ATOM 5037  N NH2  . ARG A 1 15 ? 6.650   15.795  -4.185  1.00 0.00 ? 99  ARG A NH2  5  
ATOM 5038  H H    . ARG A 1 15 ? 1.135   12.486  -5.063  1.00 0.00 ? 99  ARG A H    5  
ATOM 5039  H HA   . ARG A 1 15 ? 3.735   12.364  -6.449  1.00 0.00 ? 99  ARG A HA   5  
ATOM 5040  H HB2  . ARG A 1 15 ? 3.697   12.893  -3.988  1.00 0.00 ? 99  ARG A HB2  5  
ATOM 5041  H HB3  . ARG A 1 15 ? 3.043   11.285  -3.714  1.00 0.00 ? 99  ARG A HB3  5  
ATOM 5042  H HG2  . ARG A 1 15 ? 5.368   11.182  -3.287  1.00 0.00 ? 99  ARG A HG2  5  
ATOM 5043  H HG3  . ARG A 1 15 ? 5.094   10.366  -4.829  1.00 0.00 ? 99  ARG A HG3  5  
ATOM 5044  H HD2  . ARG A 1 15 ? 7.043   11.813  -4.961  1.00 0.00 ? 99  ARG A HD2  5  
ATOM 5045  H HD3  . ARG A 1 15 ? 5.757   12.400  -6.014  1.00 0.00 ? 99  ARG A HD3  5  
ATOM 5046  H HE   . ARG A 1 15 ? 5.688   13.624  -3.432  1.00 0.00 ? 99  ARG A HE   5  
ATOM 5047  H HH11 . ARG A 1 15 ? 7.299   13.708  -6.534  1.00 0.00 ? 99  ARG A HH11 5  
ATOM 5048  H HH12 . ARG A 1 15 ? 7.677   15.406  -6.441  1.00 0.00 ? 99  ARG A HH12 5  
ATOM 5049  H HH21 . ARG A 1 15 ? 6.218   15.850  -3.276  1.00 0.00 ? 99  ARG A HH21 5  
ATOM 5050  H HH22 . ARG A 1 15 ? 7.067   16.619  -4.582  1.00 0.00 ? 99  ARG A HH22 5  
ATOM 5051  N N    . SER A 1 16 ? 3.659   9.966   -7.072  1.00 0.00 ? 100 SER A N    5  
ATOM 5052  C CA   . SER A 1 16 ? 3.707   8.552   -7.386  1.00 0.00 ? 100 SER A CA   5  
ATOM 5053  C C    . SER A 1 16 ? 5.049   7.997   -6.923  1.00 0.00 ? 100 SER A C    5  
ATOM 5054  O O    . SER A 1 16 ? 6.088   8.291   -7.514  1.00 0.00 ? 100 SER A O    5  
ATOM 5055  C CB   . SER A 1 16 ? 3.499   8.314   -8.889  1.00 0.00 ? 100 SER A CB   5  
ATOM 5056  O OG   . SER A 1 16 ? 4.315   9.172   -9.676  1.00 0.00 ? 100 SER A OG   5  
ATOM 5057  H H    . SER A 1 16 ? 4.299   10.572  -7.516  1.00 0.00 ? 100 SER A H    5  
ATOM 5058  H HA   . SER A 1 16 ? 2.917   8.062   -6.834  1.00 0.00 ? 100 SER A HA   5  
ATOM 5059  H HB2  . SER A 1 16 ? 3.748   7.289   -9.124  1.00 0.00 ? 100 SER A HB2  5  
ATOM 5060  H HB3  . SER A 1 16 ? 2.461   8.495   -9.138  1.00 0.00 ? 100 SER A HB3  5  
ATOM 5061  H HG   . SER A 1 16 ? 5.228   8.839   -9.678  1.00 0.00 ? 100 SER A HG   5  
ATOM 5062  N N    . SER A 1 17 ? 5.035   7.236   -5.841  1.00 0.00 ? 101 SER A N    5  
ATOM 5063  C CA   . SER A 1 17 ? 6.266   6.729   -5.258  1.00 0.00 ? 101 SER A CA   5  
ATOM 5064  C C    . SER A 1 17 ? 6.287   5.207   -5.282  1.00 0.00 ? 101 SER A C    5  
ATOM 5065  O O    . SER A 1 17 ? 5.304   4.553   -4.928  1.00 0.00 ? 101 SER A O    5  
ATOM 5066  C CB   . SER A 1 17 ? 6.422   7.249   -3.828  1.00 0.00 ? 101 SER A CB   5  
ATOM 5067  O OG   . SER A 1 17 ? 7.705   6.952   -3.312  1.00 0.00 ? 101 SER A OG   5  
ATOM 5068  H H    . SER A 1 17 ? 4.173   6.999   -5.426  1.00 0.00 ? 101 SER A H    5  
ATOM 5069  H HA   . SER A 1 17 ? 7.090   7.093   -5.855  1.00 0.00 ? 101 SER A HA   5  
ATOM 5070  H HB2  . SER A 1 17 ? 6.286   8.321   -3.822  1.00 0.00 ? 101 SER A HB2  5  
ATOM 5071  H HB3  . SER A 1 17 ? 5.678   6.789   -3.196  1.00 0.00 ? 101 SER A HB3  5  
ATOM 5072  H HG   . SER A 1 17 ? 8.259   7.741   -3.364  1.00 0.00 ? 101 SER A HG   5  
ATOM 5073  N N    . THR A 1 18 ? 7.403   4.652   -5.721  1.00 0.00 ? 102 THR A N    5  
ATOM 5074  C CA   . THR A 1 18 ? 7.556   3.213   -5.816  1.00 0.00 ? 102 THR A CA   5  
ATOM 5075  C C    . THR A 1 18 ? 8.140   2.658   -4.513  1.00 0.00 ? 102 THR A C    5  
ATOM 5076  O O    . THR A 1 18 ? 9.344   2.757   -4.271  1.00 0.00 ? 102 THR A O    5  
ATOM 5077  C CB   . THR A 1 18 ? 8.482   2.849   -6.990  1.00 0.00 ? 102 THR A CB   5  
ATOM 5078  O OG1  . THR A 1 18 ? 8.445   3.893   -7.973  1.00 0.00 ? 102 THR A OG1  5  
ATOM 5079  C CG2  . THR A 1 18 ? 8.059   1.538   -7.631  1.00 0.00 ? 102 THR A CG2  5  
ATOM 5080  H H    . THR A 1 18 ? 8.149   5.226   -5.990  1.00 0.00 ? 102 THR A H    5  
ATOM 5081  H HA   . THR A 1 18 ? 6.581   2.778   -5.994  1.00 0.00 ? 102 THR A HA   5  
ATOM 5082  H HB   . THR A 1 18 ? 9.489   2.750   -6.617  1.00 0.00 ? 102 THR A HB   5  
ATOM 5083  H HG1  . THR A 1 18 ? 9.123   4.551   -7.765  1.00 0.00 ? 102 THR A HG1  5  
ATOM 5084  H HG21 . THR A 1 18 ? 8.124   0.744   -6.901  1.00 0.00 ? 102 THR A HG21 5  
ATOM 5085  H HG22 . THR A 1 18 ? 8.713   1.318   -8.462  1.00 0.00 ? 102 THR A HG22 5  
ATOM 5086  H HG23 . THR A 1 18 ? 7.042   1.620   -7.983  1.00 0.00 ? 102 THR A HG23 5  
ATOM 5087  N N    . TYR A 1 19 ? 7.281   2.097   -3.670  1.00 0.00 ? 103 TYR A N    5  
ATOM 5088  C CA   . TYR A 1 19 ? 7.703   1.593   -2.365  1.00 0.00 ? 103 TYR A CA   5  
ATOM 5089  C C    . TYR A 1 19 ? 8.111   0.126   -2.449  1.00 0.00 ? 103 TYR A C    5  
ATOM 5090  O O    . TYR A 1 19 ? 7.824   -0.555  -3.438  1.00 0.00 ? 103 TYR A O    5  
ATOM 5091  C CB   . TYR A 1 19 ? 6.581   1.758   -1.335  1.00 0.00 ? 103 TYR A CB   5  
ATOM 5092  C CG   . TYR A 1 19 ? 6.313   3.195   -0.926  1.00 0.00 ? 103 TYR A CG   5  
ATOM 5093  C CD1  . TYR A 1 19 ? 7.035   3.788   0.101   1.00 0.00 ? 103 TYR A CD1  5  
ATOM 5094  C CD2  . TYR A 1 19 ? 5.335   3.950   -1.560  1.00 0.00 ? 103 TYR A CD2  5  
ATOM 5095  C CE1  . TYR A 1 19 ? 6.791   5.094   0.486   1.00 0.00 ? 103 TYR A CE1  5  
ATOM 5096  C CE2  . TYR A 1 19 ? 5.086   5.255   -1.184  1.00 0.00 ? 103 TYR A CE2  5  
ATOM 5097  C CZ   . TYR A 1 19 ? 5.814   5.824   -0.159  1.00 0.00 ? 103 TYR A CZ   5  
ATOM 5098  O OH   . TYR A 1 19 ? 5.565   7.127   0.219   1.00 0.00 ? 103 TYR A OH   5  
ATOM 5099  H H    . TYR A 1 19 ? 6.340   2.010   -3.936  1.00 0.00 ? 103 TYR A H    5  
ATOM 5100  H HA   . TYR A 1 19 ? 8.559   2.170   -2.048  1.00 0.00 ? 103 TYR A HA   5  
ATOM 5101  H HB2  . TYR A 1 19 ? 5.666   1.360   -1.750  1.00 0.00 ? 103 TYR A HB2  5  
ATOM 5102  H HB3  . TYR A 1 19 ? 6.838   1.201   -0.446  1.00 0.00 ? 103 TYR A HB3  5  
ATOM 5103  H HD1  . TYR A 1 19 ? 7.801   3.214   0.606   1.00 0.00 ? 103 TYR A HD1  5  
ATOM 5104  H HD2  . TYR A 1 19 ? 4.764   3.503   -2.361  1.00 0.00 ? 103 TYR A HD2  5  
ATOM 5105  H HE1  . TYR A 1 19 ? 7.362   5.538   1.287   1.00 0.00 ? 103 TYR A HE1  5  
ATOM 5106  H HE2  . TYR A 1 19 ? 4.321   5.826   -1.690  1.00 0.00 ? 103 TYR A HE2  5  
ATOM 5107  H HH   . TYR A 1 19 ? 4.615   7.260   0.287   1.00 0.00 ? 103 TYR A HH   5  
ATOM 5108  N N    . GLU A 1 20 ? 8.777   -0.355  -1.405  1.00 0.00 ? 104 GLU A N    5  
ATOM 5109  C CA   . GLU A 1 20 ? 9.217   -1.740  -1.354  1.00 0.00 ? 104 GLU A CA   5  
ATOM 5110  C C    . GLU A 1 20 ? 8.325   -2.561  -0.427  1.00 0.00 ? 104 GLU A C    5  
ATOM 5111  O O    . GLU A 1 20 ? 8.075   -2.186  0.724   1.00 0.00 ? 104 GLU A O    5  
ATOM 5112  C CB   . GLU A 1 20 ? 10.680  -1.822  -0.907  1.00 0.00 ? 104 GLU A CB   5  
ATOM 5113  C CG   . GLU A 1 20 ? 10.937  -1.226  0.469   1.00 0.00 ? 104 GLU A CG   5  
ATOM 5114  C CD   . GLU A 1 20 ? 12.406  -1.173  0.818   1.00 0.00 ? 104 GLU A CD   5  
ATOM 5115  O OE1  . GLU A 1 20 ? 13.066  -0.178  0.454   1.00 0.00 ? 104 GLU A OE1  5  
ATOM 5116  O OE2  . GLU A 1 20 ? 12.906  -2.119  1.462   1.00 0.00 ? 104 GLU A OE2  5  
ATOM 5117  H H    . GLU A 1 20 ? 8.980   0.238   -0.651  1.00 0.00 ? 104 GLU A H    5  
ATOM 5118  H HA   . GLU A 1 20 ? 9.136   -2.143  -2.353  1.00 0.00 ? 104 GLU A HA   5  
ATOM 5119  H HB2  . GLU A 1 20 ? 10.979  -2.859  -0.887  1.00 0.00 ? 104 GLU A HB2  5  
ATOM 5120  H HB3  . GLU A 1 20 ? 11.292  -1.294  -1.623  1.00 0.00 ? 104 GLU A HB3  5  
ATOM 5121  H HG2  . GLU A 1 20 ? 10.542  -0.223  0.491   1.00 0.00 ? 104 GLU A HG2  5  
ATOM 5122  H HG3  . GLU A 1 20 ? 10.428  -1.829  1.209   1.00 0.00 ? 104 GLU A HG3  5  
ATOM 5123  N N    . VAL A 1 21 ? 7.847   -3.680  -0.939  1.00 0.00 ? 105 VAL A N    5  
ATOM 5124  C CA   . VAL A 1 21 ? 6.920   -4.538  -0.216  1.00 0.00 ? 105 VAL A CA   5  
ATOM 5125  C C    . VAL A 1 21 ? 7.264   -6.007  -0.433  1.00 0.00 ? 105 VAL A C    5  
ATOM 5126  O O    . VAL A 1 21 ? 8.235   -6.332  -1.117  1.00 0.00 ? 105 VAL A O    5  
ATOM 5127  C CB   . VAL A 1 21 ? 5.462   -4.296  -0.666  1.00 0.00 ? 105 VAL A CB   5  
ATOM 5128  C CG1  . VAL A 1 21 ? 5.017   -2.882  -0.330  1.00 0.00 ? 105 VAL A CG1  5  
ATOM 5129  C CG2  . VAL A 1 21 ? 5.305   -4.563  -2.156  1.00 0.00 ? 105 VAL A CG2  5  
ATOM 5130  H H    . VAL A 1 21 ? 8.138   -3.951  -1.842  1.00 0.00 ? 105 VAL A H    5  
ATOM 5131  H HA   . VAL A 1 21 ? 6.996   -4.307  0.836   1.00 0.00 ? 105 VAL A HA   5  
ATOM 5132  H HB   . VAL A 1 21 ? 4.825   -4.985  -0.133  1.00 0.00 ? 105 VAL A HB   5  
ATOM 5133  H HG11 . VAL A 1 21 ? 3.992   -2.745  -0.645  1.00 0.00 ? 105 VAL A HG11 5  
ATOM 5134  H HG12 . VAL A 1 21 ? 5.648   -2.174  -0.847  1.00 0.00 ? 105 VAL A HG12 5  
ATOM 5135  H HG13 . VAL A 1 21 ? 5.092   -2.722  0.735   1.00 0.00 ? 105 VAL A HG13 5  
ATOM 5136  H HG21 . VAL A 1 21 ? 4.286   -4.360  -2.451  1.00 0.00 ? 105 VAL A HG21 5  
ATOM 5137  H HG22 . VAL A 1 21 ? 5.539   -5.597  -2.363  1.00 0.00 ? 105 VAL A HG22 5  
ATOM 5138  H HG23 . VAL A 1 21 ? 5.975   -3.923  -2.708  1.00 0.00 ? 105 VAL A HG23 5  
ATOM 5139  N N    . ARG A 1 22 ? 6.482   -6.890  0.167   1.00 0.00 ? 106 ARG A N    5  
ATOM 5140  C CA   . ARG A 1 22 ? 6.627   -8.320  -0.057  1.00 0.00 ? 106 ARG A CA   5  
ATOM 5141  C C    . ARG A 1 22 ? 5.261   -8.927  -0.340  1.00 0.00 ? 106 ARG A C    5  
ATOM 5142  O O    . ARG A 1 22 ? 4.238   -8.294  -0.092  1.00 0.00 ? 106 ARG A O    5  
ATOM 5143  C CB   . ARG A 1 22 ? 7.264   -9.003  1.159   1.00 0.00 ? 106 ARG A CB   5  
ATOM 5144  C CG   . ARG A 1 22 ? 8.654   -8.485  1.491   1.00 0.00 ? 106 ARG A CG   5  
ATOM 5145  C CD   . ARG A 1 22 ? 9.283   -9.251  2.644   1.00 0.00 ? 106 ARG A CD   5  
ATOM 5146  N NE   . ARG A 1 22 ? 9.454   -10.674 2.341   1.00 0.00 ? 106 ARG A NE   5  
ATOM 5147  C CZ   . ARG A 1 22 ? 10.394  -11.158 1.524   1.00 0.00 ? 106 ARG A CZ   5  
ATOM 5148  N NH1  . ARG A 1 22 ? 11.232  -10.337 0.903   1.00 0.00 ? 106 ARG A NH1  5  
ATOM 5149  N NH2  . ARG A 1 22 ? 10.513  -12.466 1.340   1.00 0.00 ? 106 ARG A NH2  5  
ATOM 5150  H H    . ARG A 1 22 ? 5.777   -6.574  0.773   1.00 0.00 ? 106 ARG A H    5  
ATOM 5151  H HA   . ARG A 1 22 ? 7.263   -8.460  -0.920  1.00 0.00 ? 106 ARG A HA   5  
ATOM 5152  H HB2  . ARG A 1 22 ? 6.631   -8.847  2.019   1.00 0.00 ? 106 ARG A HB2  5  
ATOM 5153  H HB3  . ARG A 1 22 ? 7.338   -10.061 0.961   1.00 0.00 ? 106 ARG A HB3  5  
ATOM 5154  H HG2  . ARG A 1 22 ? 9.283   -8.589  0.619   1.00 0.00 ? 106 ARG A HG2  5  
ATOM 5155  H HG3  . ARG A 1 22 ? 8.581   -7.441  1.760   1.00 0.00 ? 106 ARG A HG3  5  
ATOM 5156  H HD2  . ARG A 1 22 ? 10.251  -8.822  2.855   1.00 0.00 ? 106 ARG A HD2  5  
ATOM 5157  H HD3  . ARG A 1 22 ? 8.649   -9.148  3.514   1.00 0.00 ? 106 ARG A HD3  5  
ATOM 5158  H HE   . ARG A 1 22 ? 8.848   -11.303 2.788   1.00 0.00 ? 106 ARG A HE   5  
ATOM 5159  H HH11 . ARG A 1 22 ? 11.169  -9.348  1.045   1.00 0.00 ? 106 ARG A HH11 5  
ATOM 5160  H HH12 . ARG A 1 22 ? 11.946  -10.707 0.297   1.00 0.00 ? 106 ARG A HH12 5  
ATOM 5161  H HH21 . ARG A 1 22 ? 9.904   -13.103 1.816   1.00 0.00 ? 106 ARG A HH21 5  
ATOM 5162  H HH22 . ARG A 1 22 ? 11.221  -12.824 0.723   1.00 0.00 ? 106 ARG A HH22 5  
ATOM 5163  N N    . LEU A 1 23 ? 5.241   -10.137 -0.872  1.00 0.00 ? 107 LEU A N    5  
ATOM 5164  C CA   . LEU A 1 23 ? 3.978   -10.824 -1.115  1.00 0.00 ? 107 LEU A CA   5  
ATOM 5165  C C    . LEU A 1 23 ? 3.490   -11.488 0.161   1.00 0.00 ? 107 LEU A C    5  
ATOM 5166  O O    . LEU A 1 23 ? 2.298   -11.473 0.468   1.00 0.00 ? 107 LEU A O    5  
ATOM 5167  C CB   . LEU A 1 23 ? 4.114   -11.878 -2.228  1.00 0.00 ? 107 LEU A CB   5  
ATOM 5168  C CG   . LEU A 1 23 ? 4.345   -11.337 -3.646  1.00 0.00 ? 107 LEU A CG   5  
ATOM 5169  C CD1  . LEU A 1 23 ? 5.748   -10.764 -3.789  1.00 0.00 ? 107 LEU A CD1  5  
ATOM 5170  C CD2  . LEU A 1 23 ? 4.109   -12.433 -4.676  1.00 0.00 ? 107 LEU A CD2  5  
ATOM 5171  H H    . LEU A 1 23 ? 6.083   -10.571 -1.119  1.00 0.00 ? 107 LEU A H    5  
ATOM 5172  H HA   . LEU A 1 23 ? 3.253   -10.082 -1.418  1.00 0.00 ? 107 LEU A HA   5  
ATOM 5173  H HB2  . LEU A 1 23 ? 4.940   -12.522 -1.977  1.00 0.00 ? 107 LEU A HB2  5  
ATOM 5174  H HB3  . LEU A 1 23 ? 3.211   -12.472 -2.240  1.00 0.00 ? 107 LEU A HB3  5  
ATOM 5175  H HG   . LEU A 1 23 ? 3.640   -10.540 -3.839  1.00 0.00 ? 107 LEU A HG   5  
ATOM 5176  H HD11 . LEU A 1 23 ? 6.476   -11.542 -3.611  1.00 0.00 ? 107 LEU A HD11 5  
ATOM 5177  H HD12 . LEU A 1 23 ? 5.886   -9.970  -3.068  1.00 0.00 ? 107 LEU A HD12 5  
ATOM 5178  H HD13 . LEU A 1 23 ? 5.877   -10.369 -4.785  1.00 0.00 ? 107 LEU A HD13 5  
ATOM 5179  H HD21 . LEU A 1 23 ? 4.796   -13.247 -4.500  1.00 0.00 ? 107 LEU A HD21 5  
ATOM 5180  H HD22 . LEU A 1 23 ? 4.266   -12.035 -5.667  1.00 0.00 ? 107 LEU A HD22 5  
ATOM 5181  H HD23 . LEU A 1 23 ? 3.093   -12.794 -4.589  1.00 0.00 ? 107 LEU A HD23 5  
ATOM 5182  N N    . THR A 1 24 ? 4.427   -12.050 0.911   1.00 0.00 ? 108 THR A N    5  
ATOM 5183  C CA   . THR A 1 24 ? 4.112   -12.707 2.160   1.00 0.00 ? 108 THR A CA   5  
ATOM 5184  C C    . THR A 1 24 ? 4.232   -11.721 3.323   1.00 0.00 ? 108 THR A C    5  
ATOM 5185  O O    . THR A 1 24 ? 5.132   -11.817 4.158   1.00 0.00 ? 108 THR A O    5  
ATOM 5186  C CB   . THR A 1 24 ? 5.029   -13.926 2.392   1.00 0.00 ? 108 THR A CB   5  
ATOM 5187  O OG1  . THR A 1 24 ? 5.092   -14.711 1.190   1.00 0.00 ? 108 THR A OG1  5  
ATOM 5188  C CG2  . THR A 1 24 ? 4.517   -14.790 3.536   1.00 0.00 ? 108 THR A CG2  5  
ATOM 5189  H H    . THR A 1 24 ? 5.356   -12.020 0.614   1.00 0.00 ? 108 THR A H    5  
ATOM 5190  H HA   . THR A 1 24 ? 3.091   -13.058 2.102   1.00 0.00 ? 108 THR A HA   5  
ATOM 5191  H HB   . THR A 1 24 ? 6.021   -13.574 2.638   1.00 0.00 ? 108 THR A HB   5  
ATOM 5192  H HG1  . THR A 1 24 ? 4.192   -14.933 0.912   1.00 0.00 ? 108 THR A HG1  5  
ATOM 5193  H HG21 . THR A 1 24 ? 4.518   -14.215 4.451   1.00 0.00 ? 108 THR A HG21 5  
ATOM 5194  H HG22 . THR A 1 24 ? 5.156   -15.653 3.653   1.00 0.00 ? 108 THR A HG22 5  
ATOM 5195  H HG23 . THR A 1 24 ? 3.511   -15.115 3.315   1.00 0.00 ? 108 THR A HG23 5  
ATOM 5196  N N    . GLN A 1 25 ? 3.347   -10.735 3.317   1.00 0.00 ? 109 GLN A N    5  
ATOM 5197  C CA   . GLN A 1 25 ? 3.241   -9.767  4.398   1.00 0.00 ? 109 GLN A CA   5  
ATOM 5198  C C    . GLN A 1 25 ? 1.840   -9.178  4.392   1.00 0.00 ? 109 GLN A C    5  
ATOM 5199  O O    . GLN A 1 25 ? 1.145   -9.233  3.370   1.00 0.00 ? 109 GLN A O    5  
ATOM 5200  C CB   . GLN A 1 25 ? 4.308   -8.663  4.267   1.00 0.00 ? 109 GLN A CB   5  
ATOM 5201  C CG   . GLN A 1 25 ? 4.250   -7.880  2.963   1.00 0.00 ? 109 GLN A CG   5  
ATOM 5202  C CD   . GLN A 1 25 ? 3.553   -6.540  3.104   1.00 0.00 ? 109 GLN A CD   5  
ATOM 5203  O OE1  . GLN A 1 25 ? 2.340   -6.440  2.968   1.00 0.00 ? 109 GLN A OE1  5  
ATOM 5204  N NE2  . GLN A 1 25 ? 4.327   -5.494  3.344   1.00 0.00 ? 109 GLN A NE2  5  
ATOM 5205  H H    . GLN A 1 25 ? 2.740   -10.652 2.551   1.00 0.00 ? 109 GLN A H    5  
ATOM 5206  H HA   . GLN A 1 25 ? 3.388   -10.296 5.330   1.00 0.00 ? 109 GLN A HA   5  
ATOM 5207  H HB2  . GLN A 1 25 ? 4.186   -7.965  5.082   1.00 0.00 ? 109 GLN A HB2  5  
ATOM 5208  H HB3  . GLN A 1 25 ? 5.286   -9.115  4.343   1.00 0.00 ? 109 GLN A HB3  5  
ATOM 5209  H HG2  . GLN A 1 25 ? 5.259   -7.705  2.620   1.00 0.00 ? 109 GLN A HG2  5  
ATOM 5210  H HG3  . GLN A 1 25 ? 3.720   -8.471  2.231   1.00 0.00 ? 109 GLN A HG3  5  
ATOM 5211  H HE21 . GLN A 1 25 ? 5.299   -5.639  3.415   1.00 0.00 ? 109 GLN A HE21 5  
ATOM 5212  H HE22 . GLN A 1 25 ? 3.902   -4.620  3.444   1.00 0.00 ? 109 GLN A HE22 5  
ATOM 5213  N N    . THR A 1 26 ? 1.418   -8.644  5.524   1.00 0.00 ? 110 THR A N    5  
ATOM 5214  C CA   . THR A 1 26 ? 0.099   -8.059  5.636   1.00 0.00 ? 110 THR A CA   5  
ATOM 5215  C C    . THR A 1 26 ? 0.143   -6.589  5.242   1.00 0.00 ? 110 THR A C    5  
ATOM 5216  O O    . THR A 1 26 ? 1.133   -5.901  5.507   1.00 0.00 ? 110 THR A O    5  
ATOM 5217  C CB   . THR A 1 26 ? -0.455  -8.212  7.067   1.00 0.00 ? 110 THR A CB   5  
ATOM 5218  O OG1  . THR A 1 26 ? 0.550   -7.852  8.029   1.00 0.00 ? 110 THR A OG1  5  
ATOM 5219  C CG2  . THR A 1 26 ? -0.912  -9.639  7.322   1.00 0.00 ? 110 THR A CG2  5  
ATOM 5220  H H    . THR A 1 26 ? 2.014   -8.625  6.300   1.00 0.00 ? 110 THR A H    5  
ATOM 5221  H HA   . THR A 1 26 ? -0.558  -8.584  4.957   1.00 0.00 ? 110 THR A HA   5  
ATOM 5222  H HB   . THR A 1 26 ? -1.302  -7.553  7.182   1.00 0.00 ? 110 THR A HB   5  
ATOM 5223  H HG1  . THR A 1 26 ? 0.122   -7.644  8.874   1.00 0.00 ? 110 THR A HG1  5  
ATOM 5224  H HG21 . THR A 1 26 ? -1.690  -9.901  6.621   1.00 0.00 ? 110 THR A HG21 5  
ATOM 5225  H HG22 . THR A 1 26 ? -1.294  -9.719  8.330   1.00 0.00 ? 110 THR A HG22 5  
ATOM 5226  H HG23 . THR A 1 26 ? -0.076  -10.313 7.202   1.00 0.00 ? 110 THR A HG23 5  
ATOM 5227  N N    . VAL A 1 27 ? -0.928  -6.113  4.611   1.00 0.00 ? 111 VAL A N    5  
ATOM 5228  C CA   . VAL A 1 27 ? -1.002  -4.732  4.127   1.00 0.00 ? 111 VAL A CA   5  
ATOM 5229  C C    . VAL A 1 27 ? -0.773  -3.730  5.268   1.00 0.00 ? 111 VAL A C    5  
ATOM 5230  O O    . VAL A 1 27 ? -0.425  -2.571  5.033   1.00 0.00 ? 111 VAL A O    5  
ATOM 5231  C CB   . VAL A 1 27 ? -2.357  -4.449  3.436   1.00 0.00 ? 111 VAL A CB   5  
ATOM 5232  C CG1  . VAL A 1 27 ? -2.403  -3.039  2.866   1.00 0.00 ? 111 VAL A CG1  5  
ATOM 5233  C CG2  . VAL A 1 27 ? -2.630  -5.473  2.342   1.00 0.00 ? 111 VAL A CG2  5  
ATOM 5234  H H    . VAL A 1 27 ? -1.691  -6.712  4.455   1.00 0.00 ? 111 VAL A H    5  
ATOM 5235  H HA   . VAL A 1 27 ? -0.218  -4.600  3.394   1.00 0.00 ? 111 VAL A HA   5  
ATOM 5236  H HB   . VAL A 1 27 ? -3.136  -4.534  4.176   1.00 0.00 ? 111 VAL A HB   5  
ATOM 5237  H HG11 . VAL A 1 27 ? -1.606  -2.917  2.148   1.00 0.00 ? 111 VAL A HG11 5  
ATOM 5238  H HG12 . VAL A 1 27 ? -2.279  -2.324  3.665   1.00 0.00 ? 111 VAL A HG12 5  
ATOM 5239  H HG13 . VAL A 1 27 ? -3.353  -2.876  2.380   1.00 0.00 ? 111 VAL A HG13 5  
ATOM 5240  H HG21 . VAL A 1 27 ? -3.586  -5.269  1.883   1.00 0.00 ? 111 VAL A HG21 5  
ATOM 5241  H HG22 . VAL A 1 27 ? -2.641  -6.465  2.771   1.00 0.00 ? 111 VAL A HG22 5  
ATOM 5242  H HG23 . VAL A 1 27 ? -1.853  -5.413  1.593   1.00 0.00 ? 111 VAL A HG23 5  
ATOM 5243  N N    . ALA A 1 28 ? -0.944  -4.189  6.505   1.00 0.00 ? 112 ALA A N    5  
ATOM 5244  C CA   . ALA A 1 28 ? -0.634  -3.380  7.676   1.00 0.00 ? 112 ALA A CA   5  
ATOM 5245  C C    . ALA A 1 28 ? 0.812   -2.896  7.630   1.00 0.00 ? 112 ALA A C    5  
ATOM 5246  O O    . ALA A 1 28 ? 1.117   -1.776  8.035   1.00 0.00 ? 112 ALA A O    5  
ATOM 5247  C CB   . ALA A 1 28 ? -0.882  -4.180  8.949   1.00 0.00 ? 112 ALA A CB   5  
ATOM 5248  H H    . ALA A 1 28 ? -1.295  -5.099  6.632   1.00 0.00 ? 112 ALA A H    5  
ATOM 5249  H HA   . ALA A 1 28 ? -1.291  -2.525  7.680   1.00 0.00 ? 112 ALA A HA   5  
ATOM 5250  H HB1  . ALA A 1 28 ? -0.712  -3.548  9.808   1.00 0.00 ? 112 ALA A HB1  5  
ATOM 5251  H HB2  . ALA A 1 28 ? -0.205  -5.021  8.982   1.00 0.00 ? 112 ALA A HB2  5  
ATOM 5252  H HB3  . ALA A 1 28 ? -1.902  -4.538  8.960   1.00 0.00 ? 112 ALA A HB3  5  
ATOM 5253  N N    . HIS A 1 29 ? 1.690   -3.736  7.089   1.00 0.00 ? 113 HIS A N    5  
ATOM 5254  C CA   . HIS A 1 29 ? 3.105   -3.411  6.988   1.00 0.00 ? 113 HIS A CA   5  
ATOM 5255  C C    . HIS A 1 29 ? 3.357   -2.386  5.894   1.00 0.00 ? 113 HIS A C    5  
ATOM 5256  O O    . HIS A 1 29 ? 4.416   -1.777  5.840   1.00 0.00 ? 113 HIS A O    5  
ATOM 5257  C CB   . HIS A 1 29 ? 3.933   -4.672  6.740   1.00 0.00 ? 113 HIS A CB   5  
ATOM 5258  C CG   . HIS A 1 29 ? 4.482   -5.260  7.995   1.00 0.00 ? 113 HIS A CG   5  
ATOM 5259  N ND1  . HIS A 1 29 ? 5.788   -5.084  8.389   1.00 0.00 ? 113 HIS A ND1  5  
ATOM 5260  C CD2  . HIS A 1 29 ? 3.897   -6.009  8.956   1.00 0.00 ? 113 HIS A CD2  5  
ATOM 5261  C CE1  . HIS A 1 29 ? 5.985   -5.698  9.537   1.00 0.00 ? 113 HIS A CE1  5  
ATOM 5262  N NE2  . HIS A 1 29 ? 4.853   -6.267  9.904   1.00 0.00 ? 113 HIS A NE2  5  
ATOM 5263  H H    . HIS A 1 29 ? 1.369   -4.596  6.731   1.00 0.00 ? 113 HIS A H    5  
ATOM 5264  H HA   . HIS A 1 29 ? 3.404   -2.982  7.931   1.00 0.00 ? 113 HIS A HA   5  
ATOM 5265  H HB2  . HIS A 1 29 ? 3.311   -5.419  6.267   1.00 0.00 ? 113 HIS A HB2  5  
ATOM 5266  H HB3  . HIS A 1 29 ? 4.762   -4.436  6.090   1.00 0.00 ? 113 HIS A HB3  5  
ATOM 5267  H HD1  . HIS A 1 29 ? 6.478   -4.575  7.892   1.00 0.00 ? 113 HIS A HD1  5  
ATOM 5268  H HD2  . HIS A 1 29 ? 2.868   -6.343  8.975   1.00 0.00 ? 113 HIS A HD2  5  
ATOM 5269  H HE1  . HIS A 1 29 ? 6.914   -5.729  10.085  1.00 0.00 ? 113 HIS A HE1  5  
ATOM 5270  H HE2  . HIS A 1 29 ? 4.758   -6.902  10.654  1.00 0.00 ? 113 HIS A HE2  5  
ATOM 5271  N N    . LEU A 1 30 ? 2.380   -2.197  5.024   1.00 0.00 ? 114 LEU A N    5  
ATOM 5272  C CA   . LEU A 1 30 ? 2.469   -1.165  4.004   1.00 0.00 ? 114 LEU A CA   5  
ATOM 5273  C C    . LEU A 1 30 ? 1.833   0.122   4.508   1.00 0.00 ? 114 LEU A C    5  
ATOM 5274  O O    . LEU A 1 30 ? 2.462   1.183   4.512   1.00 0.00 ? 114 LEU A O    5  
ATOM 5275  C CB   . LEU A 1 30 ? 1.773   -1.611  2.714   1.00 0.00 ? 114 LEU A CB   5  
ATOM 5276  C CG   . LEU A 1 30 ? 1.749   -0.560  1.598   1.00 0.00 ? 114 LEU A CG   5  
ATOM 5277  C CD1  . LEU A 1 30 ? 3.161   -0.239  1.132   1.00 0.00 ? 114 LEU A CD1  5  
ATOM 5278  C CD2  . LEU A 1 30 ? 0.889   -1.028  0.432   1.00 0.00 ? 114 LEU A CD2  5  
ATOM 5279  H H    . LEU A 1 30 ? 1.579   -2.762  5.069   1.00 0.00 ? 114 LEU A H    5  
ATOM 5280  H HA   . LEU A 1 30 ? 3.514   -0.986  3.800   1.00 0.00 ? 114 LEU A HA   5  
ATOM 5281  H HB2  . LEU A 1 30 ? 2.276   -2.493  2.341   1.00 0.00 ? 114 LEU A HB2  5  
ATOM 5282  H HB3  . LEU A 1 30 ? 0.752   -1.872  2.951   1.00 0.00 ? 114 LEU A HB3  5  
ATOM 5283  H HG   . LEU A 1 30 ? 1.316   0.351   1.986   1.00 0.00 ? 114 LEU A HG   5  
ATOM 5284  H HD11 . LEU A 1 30 ? 3.723   0.182   1.953   1.00 0.00 ? 114 LEU A HD11 5  
ATOM 5285  H HD12 . LEU A 1 30 ? 3.122   0.472   0.321   1.00 0.00 ? 114 LEU A HD12 5  
ATOM 5286  H HD13 . LEU A 1 30 ? 3.644   -1.146  0.797   1.00 0.00 ? 114 LEU A HD13 5  
ATOM 5287  H HD21 . LEU A 1 30 ? 0.905   -0.282  -0.349  1.00 0.00 ? 114 LEU A HD21 5  
ATOM 5288  H HD22 . LEU A 1 30 ? -0.128  -1.171  0.770   1.00 0.00 ? 114 LEU A HD22 5  
ATOM 5289  H HD23 . LEU A 1 30 ? 1.276   -1.960  0.050   1.00 0.00 ? 114 LEU A HD23 5  
ATOM 5290  N N    . LYS A 1 31 ? 0.590   0.006   4.964   1.00 0.00 ? 115 LYS A N    5  
ATOM 5291  C CA   . LYS A 1 31 ? -0.201  1.161   5.359   1.00 0.00 ? 115 LYS A CA   5  
ATOM 5292  C C    . LYS A 1 31 ? 0.448   1.915   6.515   1.00 0.00 ? 115 LYS A C    5  
ATOM 5293  O O    . LYS A 1 31 ? 0.466   3.141   6.511   1.00 0.00 ? 115 LYS A O    5  
ATOM 5294  C CB   . LYS A 1 31 ? -1.630  0.736   5.721   1.00 0.00 ? 115 LYS A CB   5  
ATOM 5295  C CG   . LYS A 1 31 ? -2.571  1.908   5.963   1.00 0.00 ? 115 LYS A CG   5  
ATOM 5296  C CD   . LYS A 1 31 ? -4.034  1.495   5.864   1.00 0.00 ? 115 LYS A CD   5  
ATOM 5297  C CE   . LYS A 1 31 ? -4.451  0.543   6.977   1.00 0.00 ? 115 LYS A CE   5  
ATOM 5298  N NZ   . LYS A 1 31 ? -4.460  1.207   8.309   1.00 0.00 ? 115 LYS A NZ   5  
ATOM 5299  H H    . LYS A 1 31 ? 0.192   -0.895  5.033   1.00 0.00 ? 115 LYS A H    5  
ATOM 5300  H HA   . LYS A 1 31 ? -0.247  1.826   4.509   1.00 0.00 ? 115 LYS A HA   5  
ATOM 5301  H HB2  . LYS A 1 31 ? -2.032  0.138   4.916   1.00 0.00 ? 115 LYS A HB2  5  
ATOM 5302  H HB3  . LYS A 1 31 ? -1.599  0.136   6.619   1.00 0.00 ? 115 LYS A HB3  5  
ATOM 5303  H HG2  . LYS A 1 31 ? -2.387  2.303   6.952   1.00 0.00 ? 115 LYS A HG2  5  
ATOM 5304  H HG3  . LYS A 1 31 ? -2.371  2.672   5.226   1.00 0.00 ? 115 LYS A HG3  5  
ATOM 5305  H HD2  . LYS A 1 31 ? -4.646  2.382   5.922   1.00 0.00 ? 115 LYS A HD2  5  
ATOM 5306  H HD3  . LYS A 1 31 ? -4.194  1.010   4.912   1.00 0.00 ? 115 LYS A HD3  5  
ATOM 5307  H HE2  . LYS A 1 31 ? -5.442  0.174   6.764   1.00 0.00 ? 115 LYS A HE2  5  
ATOM 5308  H HE3  . LYS A 1 31 ? -3.757  -0.284  7.002   1.00 0.00 ? 115 LYS A HE3  5  
ATOM 5309  H HZ1  . LYS A 1 31 ? -4.935  0.596   9.010   1.00 0.00 ? 115 LYS A HZ1  5  
ATOM 5310  H HZ2  . LYS A 1 31 ? -4.964  2.122   8.257   1.00 0.00 ? 115 LYS A HZ2  5  
ATOM 5311  H HZ3  . LYS A 1 31 ? -3.485  1.382   8.625   1.00 0.00 ? 115 LYS A HZ3  5  
ATOM 5312  N N    . GLN A 1 32 ? 1.008   1.194   7.482   1.00 0.00 ? 116 GLN A N    5  
ATOM 5313  C CA   . GLN A 1 32 ? 1.618   1.836   8.645   1.00 0.00 ? 116 GLN A CA   5  
ATOM 5314  C C    . GLN A 1 32 ? 2.897   2.588   8.264   1.00 0.00 ? 116 GLN A C    5  
ATOM 5315  O O    . GLN A 1 32 ? 3.218   3.614   8.863   1.00 0.00 ? 116 GLN A O    5  
ATOM 5316  C CB   . GLN A 1 32 ? 1.904   0.817   9.750   1.00 0.00 ? 116 GLN A CB   5  
ATOM 5317  C CG   . GLN A 1 32 ? 2.454   1.451   11.018  1.00 0.00 ? 116 GLN A CG   5  
ATOM 5318  C CD   . GLN A 1 32 ? 2.607   0.463   12.153  1.00 0.00 ? 116 GLN A CD   5  
ATOM 5319  O OE1  . GLN A 1 32 ? 3.647   -0.181  12.292  1.00 0.00 ? 116 GLN A OE1  5  
ATOM 5320  N NE2  . GLN A 1 32 ? 1.590   0.366   12.993  1.00 0.00 ? 116 GLN A NE2  5  
ATOM 5321  H H    . GLN A 1 32 ? 1.000   0.213   7.420   1.00 0.00 ? 116 GLN A H    5  
ATOM 5322  H HA   . GLN A 1 32 ? 0.904   2.557   9.022   1.00 0.00 ? 116 GLN A HA   5  
ATOM 5323  H HB2  . GLN A 1 32 ? 0.988   0.300   9.996   1.00 0.00 ? 116 GLN A HB2  5  
ATOM 5324  H HB3  . GLN A 1 32 ? 2.625   0.100   9.388   1.00 0.00 ? 116 GLN A HB3  5  
ATOM 5325  H HG2  . GLN A 1 32 ? 3.422   1.873   10.801  1.00 0.00 ? 116 GLN A HG2  5  
ATOM 5326  H HG3  . GLN A 1 32 ? 1.782   2.238   11.332  1.00 0.00 ? 116 GLN A HG3  5  
ATOM 5327  H HE21 . GLN A 1 32 ? 0.797   0.936   12.837  1.00 0.00 ? 116 GLN A HE21 5  
ATOM 5328  H HE22 . GLN A 1 32 ? 1.664   -0.265  13.737  1.00 0.00 ? 116 GLN A HE22 5  
ATOM 5329  N N    . GLN A 1 33 ? 3.620   2.096   7.266   1.00 0.00 ? 117 GLN A N    5  
ATOM 5330  C CA   . GLN A 1 33 ? 4.801   2.802   6.774   1.00 0.00 ? 117 GLN A CA   5  
ATOM 5331  C C    . GLN A 1 33 ? 4.365   4.091   6.087   1.00 0.00 ? 117 GLN A C    5  
ATOM 5332  O O    . GLN A 1 33 ? 4.927   5.168   6.318   1.00 0.00 ? 117 GLN A O    5  
ATOM 5333  C CB   . GLN A 1 33 ? 5.604   1.930   5.810   1.00 0.00 ? 117 GLN A CB   5  
ATOM 5334  C CG   . GLN A 1 33 ? 6.128   0.649   6.441   1.00 0.00 ? 117 GLN A CG   5  
ATOM 5335  C CD   . GLN A 1 33 ? 6.970   -0.184  5.495   1.00 0.00 ? 117 GLN A CD   5  
ATOM 5336  O OE1  . GLN A 1 33 ? 7.868   -0.909  5.925   1.00 0.00 ? 117 GLN A OE1  5  
ATOM 5337  N NE2  . GLN A 1 33 ? 6.686   -0.093  4.204   1.00 0.00 ? 117 GLN A NE2  5  
ATOM 5338  H H    . GLN A 1 33 ? 3.355   1.251   6.849   1.00 0.00 ? 117 GLN A H    5  
ATOM 5339  H HA   . GLN A 1 33 ? 5.419   3.054   7.626   1.00 0.00 ? 117 GLN A HA   5  
ATOM 5340  H HB2  . GLN A 1 33 ? 4.975   1.661   4.974   1.00 0.00 ? 117 GLN A HB2  5  
ATOM 5341  H HB3  . GLN A 1 33 ? 6.447   2.498   5.445   1.00 0.00 ? 117 GLN A HB3  5  
ATOM 5342  H HG2  . GLN A 1 33 ? 6.733   0.911   7.295   1.00 0.00 ? 117 GLN A HG2  5  
ATOM 5343  H HG3  . GLN A 1 33 ? 5.285   0.056   6.767   1.00 0.00 ? 117 GLN A HG3  5  
ATOM 5344  H HE21 . GLN A 1 33 ? 5.956   0.499   3.931   1.00 0.00 ? 117 GLN A HE21 5  
ATOM 5345  H HE22 . GLN A 1 33 ? 7.218   -0.623  3.576   1.00 0.00 ? 117 GLN A HE22 5  
ATOM 5346  N N    . VAL A 1 34 ? 3.330   3.977   5.265   1.00 0.00 ? 118 VAL A N    5  
ATOM 5347  C CA   . VAL A 1 34 ? 2.714   5.141   4.655   1.00 0.00 ? 118 VAL A CA   5  
ATOM 5348  C C    . VAL A 1 34 ? 2.193   6.072   5.744   1.00 0.00 ? 118 VAL A C    5  
ATOM 5349  O O    . VAL A 1 34 ? 2.277   7.287   5.625   1.00 0.00 ? 118 VAL A O    5  
ATOM 5350  C CB   . VAL A 1 34 ? 1.559   4.741   3.705   1.00 0.00 ? 118 VAL A CB   5  
ATOM 5351  C CG1  . VAL A 1 34 ? 0.937   5.967   3.054   1.00 0.00 ? 118 VAL A CG1  5  
ATOM 5352  C CG2  . VAL A 1 34 ? 2.053   3.772   2.640   1.00 0.00 ? 118 VAL A CG2  5  
ATOM 5353  H H    . VAL A 1 34 ? 2.975   3.082   5.061   1.00 0.00 ? 118 VAL A H    5  
ATOM 5354  H HA   . VAL A 1 34 ? 3.471   5.659   4.079   1.00 0.00 ? 118 VAL A HA   5  
ATOM 5355  H HB   . VAL A 1 34 ? 0.797   4.244   4.287   1.00 0.00 ? 118 VAL A HB   5  
ATOM 5356  H HG11 . VAL A 1 34 ? 0.548   6.622   3.820   1.00 0.00 ? 118 VAL A HG11 5  
ATOM 5357  H HG12 . VAL A 1 34 ? 0.135   5.660   2.399   1.00 0.00 ? 118 VAL A HG12 5  
ATOM 5358  H HG13 . VAL A 1 34 ? 1.689   6.492   2.481   1.00 0.00 ? 118 VAL A HG13 5  
ATOM 5359  H HG21 . VAL A 1 34 ? 1.229   3.491   1.999   1.00 0.00 ? 118 VAL A HG21 5  
ATOM 5360  H HG22 . VAL A 1 34 ? 2.456   2.890   3.115   1.00 0.00 ? 118 VAL A HG22 5  
ATOM 5361  H HG23 . VAL A 1 34 ? 2.823   4.247   2.050   1.00 0.00 ? 118 VAL A HG23 5  
ATOM 5362  N N    . SER A 1 35 ? 1.701   5.480   6.826   1.00 0.00 ? 119 SER A N    5  
ATOM 5363  C CA   . SER A 1 35 ? 1.200   6.238   7.965   1.00 0.00 ? 119 SER A CA   5  
ATOM 5364  C C    . SER A 1 35 ? 2.342   6.880   8.756   1.00 0.00 ? 119 SER A C    5  
ATOM 5365  O O    . SER A 1 35 ? 2.119   7.770   9.577   1.00 0.00 ? 119 SER A O    5  
ATOM 5366  C CB   . SER A 1 35 ? 0.369   5.331   8.866   1.00 0.00 ? 119 SER A CB   5  
ATOM 5367  O OG   . SER A 1 35 ? -0.747  4.816   8.167   1.00 0.00 ? 119 SER A OG   5  
ATOM 5368  H H    . SER A 1 35 ? 1.664   4.498   6.857   1.00 0.00 ? 119 SER A H    5  
ATOM 5369  H HA   . SER A 1 35 ? 0.566   7.024   7.581   1.00 0.00 ? 119 SER A HA   5  
ATOM 5370  H HB2  . SER A 1 35 ? 0.977   4.507   9.201   1.00 0.00 ? 119 SER A HB2  5  
ATOM 5371  H HB3  . SER A 1 35 ? 0.022   5.891   9.720   1.00 0.00 ? 119 SER A HB3  5  
ATOM 5372  H HG   . SER A 1 35 ? -0.475  4.553   7.278   1.00 0.00 ? 119 SER A HG   5  
ATOM 5373  N N    . GLY A 1 36 ? 3.563   6.427   8.508   1.00 0.00 ? 120 GLY A N    5  
ATOM 5374  C CA   . GLY A 1 36 ? 4.712   7.043   9.138   1.00 0.00 ? 120 GLY A CA   5  
ATOM 5375  C C    . GLY A 1 36 ? 5.096   8.334   8.447   1.00 0.00 ? 120 GLY A C    5  
ATOM 5376  O O    . GLY A 1 36 ? 5.460   9.315   9.098   1.00 0.00 ? 120 GLY A O    5  
ATOM 5377  H H    . GLY A 1 36 ? 3.685   5.666   7.898   1.00 0.00 ? 120 GLY A H    5  
ATOM 5378  H HA2  . GLY A 1 36 ? 4.476   7.252   10.170  1.00 0.00 ? 120 GLY A HA2  5  
ATOM 5379  H HA3  . GLY A 1 36 ? 5.546   6.359   9.096   1.00 0.00 ? 120 GLY A HA3  5  
ATOM 5380  N N    . LEU A 1 37 ? 5.009   8.335   7.120   1.00 0.00 ? 121 LEU A N    5  
ATOM 5381  C CA   . LEU A 1 37 ? 5.353   9.517   6.332   1.00 0.00 ? 121 LEU A CA   5  
ATOM 5382  C C    . LEU A 1 37 ? 4.117   10.368  6.012   1.00 0.00 ? 121 LEU A C    5  
ATOM 5383  O O    . LEU A 1 37 ? 3.988   11.503  6.474   1.00 0.00 ? 121 LEU A O    5  
ATOM 5384  C CB   . LEU A 1 37 ? 6.047   9.110   5.021   1.00 0.00 ? 121 LEU A CB   5  
ATOM 5385  C CG   . LEU A 1 37 ? 7.500   8.630   5.141   1.00 0.00 ? 121 LEU A CG   5  
ATOM 5386  C CD1  . LEU A 1 37 ? 7.585   7.258   5.802   1.00 0.00 ? 121 LEU A CD1  5  
ATOM 5387  C CD2  . LEU A 1 37 ? 8.155   8.599   3.766   1.00 0.00 ? 121 LEU A CD2  5  
ATOM 5388  H H    . LEU A 1 37 ? 4.718   7.509   6.661   1.00 0.00 ? 121 LEU A H    5  
ATOM 5389  H HA   . LEU A 1 37 ? 6.037   10.112  6.917   1.00 0.00 ? 121 LEU A HA   5  
ATOM 5390  H HB2  . LEU A 1 37 ? 5.468   8.317   4.572   1.00 0.00 ? 121 LEU A HB2  5  
ATOM 5391  H HB3  . LEU A 1 37 ? 6.027   9.960   4.354   1.00 0.00 ? 121 LEU A HB3  5  
ATOM 5392  H HG   . LEU A 1 37 ? 8.048   9.330   5.754   1.00 0.00 ? 121 LEU A HG   5  
ATOM 5393  H HD11 . LEU A 1 37 ? 7.089   6.527   5.182   1.00 0.00 ? 121 LEU A HD11 5  
ATOM 5394  H HD12 . LEU A 1 37 ? 7.103   7.295   6.767   1.00 0.00 ? 121 LEU A HD12 5  
ATOM 5395  H HD13 . LEU A 1 37 ? 8.621   6.980   5.928   1.00 0.00 ? 121 LEU A HD13 5  
ATOM 5396  H HD21 . LEU A 1 37 ? 8.148   9.593   3.342   1.00 0.00 ? 121 LEU A HD21 5  
ATOM 5397  H HD22 . LEU A 1 37 ? 7.608   7.928   3.120   1.00 0.00 ? 121 LEU A HD22 5  
ATOM 5398  H HD23 . LEU A 1 37 ? 9.175   8.257   3.860   1.00 0.00 ? 121 LEU A HD23 5  
ATOM 5399  N N    . GLU A 1 38 ? 3.204   9.791   5.241   1.00 0.00 ? 122 GLU A N    5  
ATOM 5400  C CA   . GLU A 1 38 ? 2.036   10.499  4.713   1.00 0.00 ? 122 GLU A CA   5  
ATOM 5401  C C    . GLU A 1 38 ? 0.814   10.252  5.594   1.00 0.00 ? 122 GLU A C    5  
ATOM 5402  O O    . GLU A 1 38 ? -0.305  10.597  5.228   1.00 0.00 ? 122 GLU A O    5  
ATOM 5403  C CB   . GLU A 1 38 ? 1.731   10.035  3.288   1.00 0.00 ? 122 GLU A CB   5  
ATOM 5404  C CG   . GLU A 1 38 ? 2.961   9.865   2.406   1.00 0.00 ? 122 GLU A CG   5  
ATOM 5405  C CD   . GLU A 1 38 ? 3.776   11.134  2.263   1.00 0.00 ? 122 GLU A CD   5  
ATOM 5406  O OE1  . GLU A 1 38 ? 3.225   12.153  1.795   1.00 0.00 ? 122 GLU A OE1  5  
ATOM 5407  O OE2  . GLU A 1 38 ? 4.978   11.114  2.603   1.00 0.00 ? 122 GLU A OE2  5  
ATOM 5408  H H    . GLU A 1 38 ? 3.310   8.840   5.022   1.00 0.00 ? 122 GLU A H    5  
ATOM 5409  H HA   . GLU A 1 38 ? 2.257   11.556  4.701   1.00 0.00 ? 122 GLU A HA   5  
ATOM 5410  H HB2  . GLU A 1 38 ? 1.215   9.091   3.337   1.00 0.00 ? 122 GLU A HB2  5  
ATOM 5411  H HB3  . GLU A 1 38 ? 1.082   10.762  2.821   1.00 0.00 ? 122 GLU A HB3  5  
ATOM 5412  H HG2  . GLU A 1 38 ? 3.592   9.102   2.838   1.00 0.00 ? 122 GLU A HG2  5  
ATOM 5413  H HG3  . GLU A 1 38 ? 2.641   9.547   1.424   1.00 0.00 ? 122 GLU A HG3  5  
ATOM 5414  N N    . GLY A 1 39 ? 1.068   9.610   6.734   1.00 0.00 ? 123 GLY A N    5  
ATOM 5415  C CA   . GLY A 1 39 ? 0.041   9.064   7.622   1.00 0.00 ? 123 GLY A CA   5  
ATOM 5416  C C    . GLY A 1 39 ? -1.054  10.002  8.111   1.00 0.00 ? 123 GLY A C    5  
ATOM 5417  O O    . GLY A 1 39 ? -1.798  9.622   9.011   1.00 0.00 ? 123 GLY A O    5  
ATOM 5418  H H    . GLY A 1 39 ? 2.007   9.498   6.988   1.00 0.00 ? 123 GLY A H    5  
ATOM 5419  H HA2  . GLY A 1 39 ? -0.437  8.249   7.108   1.00 0.00 ? 123 GLY A HA2  5  
ATOM 5420  H HA3  . GLY A 1 39 ? 0.543   8.654   8.489   1.00 0.00 ? 123 GLY A HA3  5  
ATOM 5421  N N    . VAL A 1 40 ? -1.113  11.223  7.588   1.00 0.00 ? 124 VAL A N    5  
ATOM 5422  C CA   . VAL A 1 40 ? -2.154  12.193  7.941   1.00 0.00 ? 124 VAL A CA   5  
ATOM 5423  C C    . VAL A 1 40 ? -3.546  11.555  8.006   1.00 0.00 ? 124 VAL A C    5  
ATOM 5424  O O    . VAL A 1 40 ? -4.237  11.459  6.993   1.00 0.00 ? 124 VAL A O    5  
ATOM 5425  C CB   . VAL A 1 40 ? -2.205  13.345  6.918   1.00 0.00 ? 124 VAL A CB   5  
ATOM 5426  C CG1  . VAL A 1 40 ? -3.281  14.354  7.304   1.00 0.00 ? 124 VAL A CG1  5  
ATOM 5427  C CG2  . VAL A 1 40 ? -0.839  14.008  6.780   1.00 0.00 ? 124 VAL A CG2  5  
ATOM 5428  H H    . VAL A 1 40 ? -0.444  11.477  6.920   1.00 0.00 ? 124 VAL A H    5  
ATOM 5429  H HA   . VAL A 1 40 ? -1.910  12.612  8.909   1.00 0.00 ? 124 VAL A HA   5  
ATOM 5430  H HB   . VAL A 1 40 ? -2.472  12.925  5.960   1.00 0.00 ? 124 VAL A HB   5  
ATOM 5431  H HG11 . VAL A 1 40 ? -4.237  13.843  7.377   1.00 0.00 ? 124 VAL A HG11 5  
ATOM 5432  H HG12 . VAL A 1 40 ? -3.341  15.126  6.553   1.00 0.00 ? 124 VAL A HG12 5  
ATOM 5433  H HG13 . VAL A 1 40 ? -3.038  14.796  8.259   1.00 0.00 ? 124 VAL A HG13 5  
ATOM 5434  H HG21 . VAL A 1 40 ? -0.516  14.376  7.741   1.00 0.00 ? 124 VAL A HG21 5  
ATOM 5435  H HG22 . VAL A 1 40 ? -0.910  14.831  6.085   1.00 0.00 ? 124 VAL A HG22 5  
ATOM 5436  H HG23 . VAL A 1 40 ? -0.124  13.284  6.410   1.00 0.00 ? 124 VAL A HG23 5  
ATOM 5437  N N    . GLN A 1 41 ? -3.928  11.126  9.211   1.00 0.00 ? 125 GLN A N    5  
ATOM 5438  C CA   . GLN A 1 41 ? -5.226  10.510  9.476   1.00 0.00 ? 125 GLN A CA   5  
ATOM 5439  C C    . GLN A 1 41 ? -5.456  9.273   8.603   1.00 0.00 ? 125 GLN A C    5  
ATOM 5440  O O    . GLN A 1 41 ? -5.702  9.374   7.402   1.00 0.00 ? 125 GLN A O    5  
ATOM 5441  C CB   . GLN A 1 41 ? -6.352  11.531  9.293   1.00 0.00 ? 125 GLN A CB   5  
ATOM 5442  C CG   . GLN A 1 41 ? -7.685  11.076  9.862   1.00 0.00 ? 125 GLN A CG   5  
ATOM 5443  C CD   . GLN A 1 41 ? -8.669  12.218  10.020  1.00 0.00 ? 125 GLN A CD   5  
ATOM 5444  O OE1  . GLN A 1 41 ? -8.708  12.877  11.060  1.00 0.00 ? 125 GLN A OE1  5  
ATOM 5445  N NE2  . GLN A 1 41 ? -9.471  12.461  8.996   1.00 0.00 ? 125 GLN A NE2  5  
ATOM 5446  H H    . GLN A 1 41 ? -3.295  11.211  9.952   1.00 0.00 ? 125 GLN A H    5  
ATOM 5447  H HA   . GLN A 1 41 ? -5.222  10.194  10.510  1.00 0.00 ? 125 GLN A HA   5  
ATOM 5448  H HB2  . GLN A 1 41 ? -6.070  12.451  9.782   1.00 0.00 ? 125 GLN A HB2  5  
ATOM 5449  H HB3  . GLN A 1 41 ? -6.481  11.718  8.238   1.00 0.00 ? 125 GLN A HB3  5  
ATOM 5450  H HG2  . GLN A 1 41 ? -8.114  10.342  9.196   1.00 0.00 ? 125 GLN A HG2  5  
ATOM 5451  H HG3  . GLN A 1 41 ? -7.516  10.628  10.830  1.00 0.00 ? 125 GLN A HG3  5  
ATOM 5452  H HE21 . GLN A 1 41 ? -9.388  11.899  8.199   1.00 0.00 ? 125 GLN A HE21 5  
ATOM 5453  H HE22 . GLN A 1 41 ? -10.119 13.198  9.077   1.00 0.00 ? 125 GLN A HE22 5  
ATOM 5454  N N    . ASP A 1 42 ? -5.422  8.107   9.241   1.00 0.00 ? 126 ASP A N    5  
ATOM 5455  C CA   . ASP A 1 42 ? -5.554  6.812   8.557   1.00 0.00 ? 126 ASP A CA   5  
ATOM 5456  C C    . ASP A 1 42 ? -6.900  6.694   7.820   1.00 0.00 ? 126 ASP A C    5  
ATOM 5457  O O    . ASP A 1 42 ? -7.142  5.745   7.074   1.00 0.00 ? 126 ASP A O    5  
ATOM 5458  C CB   . ASP A 1 42 ? -5.401  5.688   9.593   1.00 0.00 ? 126 ASP A CB   5  
ATOM 5459  C CG   . ASP A 1 42 ? -5.440  4.286   9.005   1.00 0.00 ? 126 ASP A CG   5  
ATOM 5460  O OD1  . ASP A 1 42 ? -4.560  3.943   8.190   1.00 0.00 ? 126 ASP A OD1  5  
ATOM 5461  O OD2  . ASP A 1 42 ? -6.320  3.498   9.408   1.00 0.00 ? 126 ASP A OD2  5  
ATOM 5462  H H    . ASP A 1 42 ? -5.304  8.110   10.214  1.00 0.00 ? 126 ASP A H    5  
ATOM 5463  H HA   . ASP A 1 42 ? -4.753  6.735   7.835   1.00 0.00 ? 126 ASP A HA   5  
ATOM 5464  H HB2  . ASP A 1 42 ? -4.456  5.807   10.102  1.00 0.00 ? 126 ASP A HB2  5  
ATOM 5465  H HB3  . ASP A 1 42 ? -6.200  5.772   10.316  1.00 0.00 ? 126 ASP A HB3  5  
ATOM 5466  N N    . ASP A 1 43 ? -7.764  7.681   8.022   1.00 0.00 ? 127 ASP A N    5  
ATOM 5467  C CA   . ASP A 1 43 ? -9.075  7.700   7.391   1.00 0.00 ? 127 ASP A CA   5  
ATOM 5468  C C    . ASP A 1 43 ? -9.076  8.545   6.117   1.00 0.00 ? 127 ASP A C    5  
ATOM 5469  O O    . ASP A 1 43 ? -9.969  8.401   5.284   1.00 0.00 ? 127 ASP A O    5  
ATOM 5470  C CB   . ASP A 1 43 ? -10.124 8.247   8.360   1.00 0.00 ? 127 ASP A CB   5  
ATOM 5471  C CG   . ASP A 1 43 ? -10.258 7.405   9.610   1.00 0.00 ? 127 ASP A CG   5  
ATOM 5472  O OD1  . ASP A 1 43 ? -9.509  7.654   10.575  1.00 0.00 ? 127 ASP A OD1  5  
ATOM 5473  O OD2  . ASP A 1 43 ? -11.122 6.506   9.642   1.00 0.00 ? 127 ASP A OD2  5  
ATOM 5474  H H    . ASP A 1 43 ? -7.509  8.415   8.616   1.00 0.00 ? 127 ASP A H    5  
ATOM 5475  H HA   . ASP A 1 43 ? -9.332  6.684   7.135   1.00 0.00 ? 127 ASP A HA   5  
ATOM 5476  H HB2  . ASP A 1 43 ? -9.848  9.248   8.651   1.00 0.00 ? 127 ASP A HB2  5  
ATOM 5477  H HB3  . ASP A 1 43 ? -11.083 8.273   7.862   1.00 0.00 ? 127 ASP A HB3  5  
ATOM 5478  N N    . LEU A 1 44 ? -8.088  9.432   5.965   1.00 0.00 ? 128 LEU A N    5  
ATOM 5479  C CA   . LEU A 1 44 ? -8.065  10.333  4.817   1.00 0.00 ? 128 LEU A CA   5  
ATOM 5480  C C    . LEU A 1 44 ? -7.554  9.634   3.561   1.00 0.00 ? 128 LEU A C    5  
ATOM 5481  O O    . LEU A 1 44 ? -8.077  9.846   2.465   1.00 0.00 ? 128 LEU A O    5  
ATOM 5482  C CB   . LEU A 1 44 ? -7.211  11.568  5.116   1.00 0.00 ? 128 LEU A CB   5  
ATOM 5483  C CG   . LEU A 1 44 ? -7.824  12.556  6.111   1.00 0.00 ? 128 LEU A CG   5  
ATOM 5484  C CD1  . LEU A 1 44 ? -6.878  13.721  6.355   1.00 0.00 ? 128 LEU A CD1  5  
ATOM 5485  C CD2  . LEU A 1 44 ? -9.170  13.058  5.603   1.00 0.00 ? 128 LEU A CD2  5  
ATOM 5486  H H    . LEU A 1 44 ? -7.356  9.476   6.626   1.00 0.00 ? 128 LEU A H    5  
ATOM 5487  H HA   . LEU A 1 44 ? -9.079  10.652  4.639   1.00 0.00 ? 128 LEU A HA   5  
ATOM 5488  H HB2  . LEU A 1 44 ? -6.259  11.238  5.509   1.00 0.00 ? 128 LEU A HB2  5  
ATOM 5489  H HB3  . LEU A 1 44 ? -7.034  12.092  4.188   1.00 0.00 ? 128 LEU A HB3  5  
ATOM 5490  H HG   . LEU A 1 44 ? -7.985  12.056  7.055   1.00 0.00 ? 128 LEU A HG   5  
ATOM 5491  H HD11 . LEU A 1 44 ? -6.709  14.247  5.428   1.00 0.00 ? 128 LEU A HD11 5  
ATOM 5492  H HD12 . LEU A 1 44 ? -5.940  13.345  6.733   1.00 0.00 ? 128 LEU A HD12 5  
ATOM 5493  H HD13 . LEU A 1 44 ? -7.315  14.394  7.078   1.00 0.00 ? 128 LEU A HD13 5  
ATOM 5494  H HD21 . LEU A 1 44 ? -9.029  13.572  4.664   1.00 0.00 ? 128 LEU A HD21 5  
ATOM 5495  H HD22 . LEU A 1 44 ? -9.601  13.734  6.326   1.00 0.00 ? 128 LEU A HD22 5  
ATOM 5496  H HD23 . LEU A 1 44 ? -9.831  12.217  5.455   1.00 0.00 ? 128 LEU A HD23 5  
ATOM 5497  N N    . PHE A 1 45 ? -6.540  8.793   3.710   1.00 0.00 ? 129 PHE A N    5  
ATOM 5498  C CA   . PHE A 1 45 ? -5.966  8.127   2.554   1.00 0.00 ? 129 PHE A CA   5  
ATOM 5499  C C    . PHE A 1 45 ? -6.548  6.727   2.370   1.00 0.00 ? 129 PHE A C    5  
ATOM 5500  O O    . PHE A 1 45 ? -6.106  5.754   2.977   1.00 0.00 ? 129 PHE A O    5  
ATOM 5501  C CB   . PHE A 1 45 ? -4.426  8.109   2.615   1.00 0.00 ? 129 PHE A CB   5  
ATOM 5502  C CG   . PHE A 1 45 ? -3.817  7.450   3.829   1.00 0.00 ? 129 PHE A CG   5  
ATOM 5503  C CD1  . PHE A 1 45 ? -3.750  8.118   5.043   1.00 0.00 ? 129 PHE A CD1  5  
ATOM 5504  C CD2  . PHE A 1 45 ? -3.287  6.171   3.745   1.00 0.00 ? 129 PHE A CD2  5  
ATOM 5505  C CE1  . PHE A 1 45 ? -3.173  7.520   6.147   1.00 0.00 ? 129 PHE A CE1  5  
ATOM 5506  C CE2  . PHE A 1 45 ? -2.706  5.569   4.846   1.00 0.00 ? 129 PHE A CE2  5  
ATOM 5507  C CZ   . PHE A 1 45 ? -2.650  6.244   6.048   1.00 0.00 ? 129 PHE A CZ   5  
ATOM 5508  H H    . PHE A 1 45 ? -6.181  8.613   4.604   1.00 0.00 ? 129 PHE A H    5  
ATOM 5509  H HA   . PHE A 1 45 ? -6.256  8.710   1.690   1.00 0.00 ? 129 PHE A HA   5  
ATOM 5510  H HB2  . PHE A 1 45 ? -4.055  7.589   1.747   1.00 0.00 ? 129 PHE A HB2  5  
ATOM 5511  H HB3  . PHE A 1 45 ? -4.070  9.128   2.584   1.00 0.00 ? 129 PHE A HB3  5  
ATOM 5512  H HD1  . PHE A 1 45 ? -4.156  9.115   5.121   1.00 0.00 ? 129 PHE A HD1  5  
ATOM 5513  H HD2  . PHE A 1 45 ? -3.333  5.640   2.804   1.00 0.00 ? 129 PHE A HD2  5  
ATOM 5514  H HE1  . PHE A 1 45 ? -3.130  8.049   7.090   1.00 0.00 ? 129 PHE A HE1  5  
ATOM 5515  H HE2  . PHE A 1 45 ? -2.296  4.571   4.767   1.00 0.00 ? 129 PHE A HE2  5  
ATOM 5516  H HZ   . PHE A 1 45 ? -2.195  5.774   6.911   1.00 0.00 ? 129 PHE A HZ   5  
ATOM 5517  N N    . TRP A 1 46 ? -7.571  6.647   1.534   1.00 0.00 ? 130 TRP A N    5  
ATOM 5518  C CA   . TRP A 1 46 ? -8.183  5.376   1.190   1.00 0.00 ? 130 TRP A CA   5  
ATOM 5519  C C    . TRP A 1 46 ? -7.486  4.797   -0.032  1.00 0.00 ? 130 TRP A C    5  
ATOM 5520  O O    . TRP A 1 46 ? -7.870  5.054   -1.170  1.00 0.00 ? 130 TRP A O    5  
ATOM 5521  C CB   . TRP A 1 46 ? -9.686  5.555   0.935   1.00 0.00 ? 130 TRP A CB   5  
ATOM 5522  C CG   . TRP A 1 46 ? -10.384 4.318   0.441   1.00 0.00 ? 130 TRP A CG   5  
ATOM 5523  C CD1  . TRP A 1 46 ? -10.501 3.120   1.091   1.00 0.00 ? 130 TRP A CD1  5  
ATOM 5524  C CD2  . TRP A 1 46 ? -11.077 4.167   -0.803  1.00 0.00 ? 130 TRP A CD2  5  
ATOM 5525  N NE1  . TRP A 1 46 ? -11.226 2.240   0.329   1.00 0.00 ? 130 TRP A NE1  5  
ATOM 5526  C CE2  . TRP A 1 46 ? -11.590 2.856   -0.839  1.00 0.00 ? 130 TRP A CE2  5  
ATOM 5527  C CE3  . TRP A 1 46 ? -11.312 5.011   -1.890  1.00 0.00 ? 130 TRP A CE3  5  
ATOM 5528  C CZ2  . TRP A 1 46 ? -12.324 2.373   -1.917  1.00 0.00 ? 130 TRP A CZ2  5  
ATOM 5529  C CZ3  . TRP A 1 46 ? -12.042 4.531   -2.962  1.00 0.00 ? 130 TRP A CZ3  5  
ATOM 5530  C CH2  . TRP A 1 46 ? -12.541 3.222   -2.968  1.00 0.00 ? 130 TRP A CH2  5  
ATOM 5531  H H    . TRP A 1 46 ? -7.920  7.471   1.126   1.00 0.00 ? 130 TRP A H    5  
ATOM 5532  H HA   . TRP A 1 46 ? -8.043  4.703   2.023   1.00 0.00 ? 130 TRP A HA   5  
ATOM 5533  H HB2  . TRP A 1 46 ? -10.164 5.856   1.856   1.00 0.00 ? 130 TRP A HB2  5  
ATOM 5534  H HB3  . TRP A 1 46 ? -9.827  6.330   0.197   1.00 0.00 ? 130 TRP A HB3  5  
ATOM 5535  H HD1  . TRP A 1 46 ? -10.078 2.908   2.060   1.00 0.00 ? 130 TRP A HD1  5  
ATOM 5536  H HE1  . TRP A 1 46 ? -11.452 1.319   0.583   1.00 0.00 ? 130 TRP A HE1  5  
ATOM 5537  H HE3  . TRP A 1 46 ? -10.936 6.022   -1.901  1.00 0.00 ? 130 TRP A HE3  5  
ATOM 5538  H HZ2  . TRP A 1 46 ? -12.713 1.365   -1.936  1.00 0.00 ? 130 TRP A HZ2  5  
ATOM 5539  H HZ3  . TRP A 1 46 ? -12.233 5.170   -3.808  1.00 0.00 ? 130 TRP A HZ3  5  
ATOM 5540  H HH2  . TRP A 1 46 ? -13.105 2.887   -3.826  1.00 0.00 ? 130 TRP A HH2  5  
ATOM 5541  N N    . LEU A 1 47 ? -6.426  4.058   0.202   1.00 0.00 ? 131 LEU A N    5  
ATOM 5542  C CA   . LEU A 1 47 ? -5.647  3.516   -0.895  1.00 0.00 ? 131 LEU A CA   5  
ATOM 5543  C C    . LEU A 1 47 ? -6.204  2.168   -1.335  1.00 0.00 ? 131 LEU A C    5  
ATOM 5544  O O    . LEU A 1 47 ? -6.617  1.349   -0.513  1.00 0.00 ? 131 LEU A O    5  
ATOM 5545  C CB   . LEU A 1 47 ? -4.157  3.390   -0.525  1.00 0.00 ? 131 LEU A CB   5  
ATOM 5546  C CG   . LEU A 1 47 ? -3.777  2.262   0.449   1.00 0.00 ? 131 LEU A CG   5  
ATOM 5547  C CD1  . LEU A 1 47 ? -2.270  2.071   0.464   1.00 0.00 ? 131 LEU A CD1  5  
ATOM 5548  C CD2  . LEU A 1 47 ? -4.272  2.554   1.863   1.00 0.00 ? 131 LEU A CD2  5  
ATOM 5549  H H    . LEU A 1 47 ? -6.162  3.871   1.125   1.00 0.00 ? 131 LEU A H    5  
ATOM 5550  H HA   . LEU A 1 47 ? -5.745  4.213   -1.723  1.00 0.00 ? 131 LEU A HA   5  
ATOM 5551  H HB2  . LEU A 1 47 ? -3.599  3.244   -1.438  1.00 0.00 ? 131 LEU A HB2  5  
ATOM 5552  H HB3  . LEU A 1 47 ? -3.845  4.326   -0.086  1.00 0.00 ? 131 LEU A HB3  5  
ATOM 5553  H HG   . LEU A 1 47 ? -4.230  1.336   0.118   1.00 0.00 ? 131 LEU A HG   5  
ATOM 5554  H HD11 . LEU A 1 47 ? -1.932  1.798   -0.525  1.00 0.00 ? 131 LEU A HD11 5  
ATOM 5555  H HD12 . LEU A 1 47 ? -2.013  1.287   1.161   1.00 0.00 ? 131 LEU A HD12 5  
ATOM 5556  H HD13 . LEU A 1 47 ? -1.795  2.991   0.766   1.00 0.00 ? 131 LEU A HD13 5  
ATOM 5557  H HD21 . LEU A 1 47 ? -4.001  3.564   2.134   1.00 0.00 ? 131 LEU A HD21 5  
ATOM 5558  H HD22 . LEU A 1 47 ? -3.814  1.861   2.553   1.00 0.00 ? 131 LEU A HD22 5  
ATOM 5559  H HD23 . LEU A 1 47 ? -5.343  2.442   1.902   1.00 0.00 ? 131 LEU A HD23 5  
ATOM 5560  N N    . THR A 1 48 ? -6.230  1.954   -2.640  1.00 0.00 ? 132 THR A N    5  
ATOM 5561  C CA   . THR A 1 48 ? -6.729  0.718   -3.208  1.00 0.00 ? 132 THR A CA   5  
ATOM 5562  C C    . THR A 1 48 ? -6.033  0.430   -4.529  1.00 0.00 ? 132 THR A C    5  
ATOM 5563  O O    . THR A 1 48 ? -5.467  1.328   -5.151  1.00 0.00 ? 132 THR A O    5  
ATOM 5564  C CB   . THR A 1 48 ? -8.264  0.759   -3.400  1.00 0.00 ? 132 THR A CB   5  
ATOM 5565  O OG1  . THR A 1 48 ? -8.698  -0.289  -4.273  1.00 0.00 ? 132 THR A OG1  5  
ATOM 5566  C CG2  . THR A 1 48 ? -8.728  2.109   -3.930  1.00 0.00 ? 132 THR A CG2  5  
ATOM 5567  H H    . THR A 1 48 ? -5.900  2.657   -3.246  1.00 0.00 ? 132 THR A H    5  
ATOM 5568  H HA   . THR A 1 48 ? -6.498  -0.081  -2.517  1.00 0.00 ? 132 THR A HA   5  
ATOM 5569  H HB   . THR A 1 48 ? -8.717  0.598   -2.436  1.00 0.00 ? 132 THR A HB   5  
ATOM 5570  H HG1  . THR A 1 48 ? -9.126  -0.980  -3.752  1.00 0.00 ? 132 THR A HG1  5  
ATOM 5571  H HG21 . THR A 1 48 ? -8.520  2.875   -3.195  1.00 0.00 ? 132 THR A HG21 5  
ATOM 5572  H HG22 . THR A 1 48 ? -9.791  2.075   -4.121  1.00 0.00 ? 132 THR A HG22 5  
ATOM 5573  H HG23 . THR A 1 48 ? -8.204  2.337   -4.846  1.00 0.00 ? 132 THR A HG23 5  
ATOM 5574  N N    . PHE A 1 49 ? -6.069  -0.821  -4.944  1.00 0.00 ? 133 PHE A N    5  
ATOM 5575  C CA   . PHE A 1 49 ? -5.354  -1.247  -6.137  1.00 0.00 ? 133 PHE A CA   5  
ATOM 5576  C C    . PHE A 1 49 ? -6.290  -1.418  -7.333  1.00 0.00 ? 133 PHE A C    5  
ATOM 5577  O O    . PHE A 1 49 ? -6.312  -0.589  -8.240  1.00 0.00 ? 133 PHE A O    5  
ATOM 5578  C CB   . PHE A 1 49 ? -4.583  -2.548  -5.859  1.00 0.00 ? 133 PHE A CB   5  
ATOM 5579  C CG   . PHE A 1 49 ? -4.171  -3.273  -7.110  1.00 0.00 ? 133 PHE A CG   5  
ATOM 5580  C CD1  . PHE A 1 49 ? -3.345  -2.667  -8.040  1.00 0.00 ? 133 PHE A CD1  5  
ATOM 5581  C CD2  . PHE A 1 49 ? -4.652  -4.546  -7.372  1.00 0.00 ? 133 PHE A CD2  5  
ATOM 5582  C CE1  . PHE A 1 49 ? -3.004  -3.319  -9.206  1.00 0.00 ? 133 PHE A CE1  5  
ATOM 5583  C CE2  . PHE A 1 49 ? -4.321  -5.199  -8.540  1.00 0.00 ? 133 PHE A CE2  5  
ATOM 5584  C CZ   . PHE A 1 49 ? -3.496  -4.586  -9.457  1.00 0.00 ? 133 PHE A CZ   5  
ATOM 5585  H H    . PHE A 1 49 ? -6.607  -1.470  -4.442  1.00 0.00 ? 133 PHE A H    5  
ATOM 5586  H HA   . PHE A 1 49 ? -4.645  -0.475  -6.376  1.00 0.00 ? 133 PHE A HA   5  
ATOM 5587  H HB2  . PHE A 1 49 ? -3.689  -2.317  -5.297  1.00 0.00 ? 133 PHE A HB2  5  
ATOM 5588  H HB3  . PHE A 1 49 ? -5.207  -3.209  -5.278  1.00 0.00 ? 133 PHE A HB3  5  
ATOM 5589  H HD1  . PHE A 1 49 ? -2.959  -1.677  -7.844  1.00 0.00 ? 133 PHE A HD1  5  
ATOM 5590  H HD2  . PHE A 1 49 ? -5.298  -5.027  -6.652  1.00 0.00 ? 133 PHE A HD2  5  
ATOM 5591  H HE1  . PHE A 1 49 ? -2.355  -2.839  -9.924  1.00 0.00 ? 133 PHE A HE1  5  
ATOM 5592  H HE2  . PHE A 1 49 ? -4.701  -6.191  -8.735  1.00 0.00 ? 133 PHE A HE2  5  
ATOM 5593  H HZ   . PHE A 1 49 ? -3.246  -5.089  -10.374 1.00 0.00 ? 133 PHE A HZ   5  
ATOM 5594  N N    . GLU A 1 50 ? -7.064  -2.491  -7.322  1.00 0.00 ? 134 GLU A N    5  
ATOM 5595  C CA   . GLU A 1 50 ? -7.870  -2.865  -8.476  1.00 0.00 ? 134 GLU A CA   5  
ATOM 5596  C C    . GLU A 1 50 ? -9.318  -2.392  -8.302  1.00 0.00 ? 134 GLU A C    5  
ATOM 5597  O O    . GLU A 1 50 ? -10.237 -2.906  -8.939  1.00 0.00 ? 134 GLU A O    5  
ATOM 5598  C CB   . GLU A 1 50 ? -7.828  -4.387  -8.663  1.00 0.00 ? 134 GLU A CB   5  
ATOM 5599  C CG   . GLU A 1 50 ? -8.241  -4.847  -10.053 1.00 0.00 ? 134 GLU A CG   5  
ATOM 5600  C CD   . GLU A 1 50 ? -7.425  -4.182  -11.144 1.00 0.00 ? 134 GLU A CD   5  
ATOM 5601  O OE1  . GLU A 1 50 ? -6.267  -4.589  -11.354 1.00 0.00 ? 134 GLU A OE1  5  
ATOM 5602  O OE2  . GLU A 1 50 ? -7.944  -3.252  -11.800 1.00 0.00 ? 134 GLU A OE2  5  
ATOM 5603  H H    . GLU A 1 50 ? -7.085  -3.050  -6.521  1.00 0.00 ? 134 GLU A H    5  
ATOM 5604  H HA   . GLU A 1 50 ? -7.438  -2.397  -9.351  1.00 0.00 ? 134 GLU A HA   5  
ATOM 5605  H HB2  . GLU A 1 50 ? -6.823  -4.730  -8.480  1.00 0.00 ? 134 GLU A HB2  5  
ATOM 5606  H HB3  . GLU A 1 50 ? -8.492  -4.845  -7.944  1.00 0.00 ? 134 GLU A HB3  5  
ATOM 5607  H HG2  . GLU A 1 50 ? -8.105  -5.914  -10.121 1.00 0.00 ? 134 GLU A HG2  5  
ATOM 5608  H HG3  . GLU A 1 50 ? -9.284  -4.605  -10.204 1.00 0.00 ? 134 GLU A HG3  5  
ATOM 5609  N N    . GLY A 1 51 ? -9.513  -1.403  -7.439  1.00 0.00 ? 135 GLY A N    5  
ATOM 5610  C CA   . GLY A 1 51 ? -10.857 -0.946  -7.136  1.00 0.00 ? 135 GLY A CA   5  
ATOM 5611  C C    . GLY A 1 51 ? -11.430 -1.665  -5.932  1.00 0.00 ? 135 GLY A C    5  
ATOM 5612  O O    . GLY A 1 51 ? -12.614 -1.548  -5.621  1.00 0.00 ? 135 GLY A O    5  
ATOM 5613  H H    . GLY A 1 51 ? -8.741  -0.972  -7.016  1.00 0.00 ? 135 GLY A H    5  
ATOM 5614  H HA2  . GLY A 1 51 ? -10.832 0.114   -6.934  1.00 0.00 ? 135 GLY A HA2  5  
ATOM 5615  H HA3  . GLY A 1 51 ? -11.495 -1.131  -7.988  1.00 0.00 ? 135 GLY A HA3  5  
ATOM 5616  N N    . LYS A 1 52 ? -10.577 -2.419  -5.262  1.00 0.00 ? 136 LYS A N    5  
ATOM 5617  C CA   . LYS A 1 52 ? -10.961 -3.151  -4.068  1.00 0.00 ? 136 LYS A CA   5  
ATOM 5618  C C    . LYS A 1 52 ? -10.051 -2.706  -2.929  1.00 0.00 ? 136 LYS A C    5  
ATOM 5619  O O    . LYS A 1 52 ? -8.829  -2.778  -3.056  1.00 0.00 ? 136 LYS A O    5  
ATOM 5620  C CB   . LYS A 1 52 ? -10.844 -4.664  -4.338  1.00 0.00 ? 136 LYS A CB   5  
ATOM 5621  C CG   . LYS A 1 52 ? -11.456 -5.566  -3.267  1.00 0.00 ? 136 LYS A CG   5  
ATOM 5622  C CD   . LYS A 1 52 ? -10.498 -5.813  -2.112  1.00 0.00 ? 136 LYS A CD   5  
ATOM 5623  C CE   . LYS A 1 52 ? -11.087 -6.779  -1.092  1.00 0.00 ? 136 LYS A CE   5  
ATOM 5624  N NZ   . LYS A 1 52 ? -10.151 -7.040  0.036   1.00 0.00 ? 136 LYS A NZ   5  
ATOM 5625  H H    . LYS A 1 52 ? -9.653  -2.477  -5.575  1.00 0.00 ? 136 LYS A H    5  
ATOM 5626  H HA   . LYS A 1 52 ? -11.985 -2.898  -3.832  1.00 0.00 ? 136 LYS A HA   5  
ATOM 5627  H HB2  . LYS A 1 52 ? -11.334 -4.886  -5.274  1.00 0.00 ? 136 LYS A HB2  5  
ATOM 5628  H HB3  . LYS A 1 52 ? -9.798  -4.915  -4.427  1.00 0.00 ? 136 LYS A HB3  5  
ATOM 5629  H HG2  . LYS A 1 52 ? -12.350 -5.099  -2.884  1.00 0.00 ? 136 LYS A HG2  5  
ATOM 5630  H HG3  . LYS A 1 52 ? -11.712 -6.514  -3.719  1.00 0.00 ? 136 LYS A HG3  5  
ATOM 5631  H HD2  . LYS A 1 52 ? -9.580  -6.229  -2.500  1.00 0.00 ? 136 LYS A HD2  5  
ATOM 5632  H HD3  . LYS A 1 52 ? -10.290 -4.872  -1.625  1.00 0.00 ? 136 LYS A HD3  5  
ATOM 5633  H HE2  . LYS A 1 52 ? -11.998 -6.353  -0.699  1.00 0.00 ? 136 LYS A HE2  5  
ATOM 5634  H HE3  . LYS A 1 52 ? -11.311 -7.712  -1.588  1.00 0.00 ? 136 LYS A HE3  5  
ATOM 5635  H HZ1  . LYS A 1 52 ? -10.038 -6.181  0.622   1.00 0.00 ? 136 LYS A HZ1  5  
ATOM 5636  H HZ2  . LYS A 1 52 ? -9.216  -7.322  -0.331  1.00 0.00 ? 136 LYS A HZ2  5  
ATOM 5637  H HZ3  . LYS A 1 52 ? -10.517 -7.808  0.637   1.00 0.00 ? 136 LYS A HZ3  5  
ATOM 5638  N N    . PRO A 1 53 ? -10.627 -2.194  -1.829  1.00 0.00 ? 137 PRO A N    5  
ATOM 5639  C CA   . PRO A 1 53 ? -9.853  -1.657  -0.703  1.00 0.00 ? 137 PRO A CA   5  
ATOM 5640  C C    . PRO A 1 53 ? -8.919  -2.697  -0.095  1.00 0.00 ? 137 PRO A C    5  
ATOM 5641  O O    . PRO A 1 53 ? -9.175  -3.898  -0.172  1.00 0.00 ? 137 PRO A O    5  
ATOM 5642  C CB   . PRO A 1 53 ? -10.916 -1.221  0.312   1.00 0.00 ? 137 PRO A CB   5  
ATOM 5643  C CG   . PRO A 1 53 ? -12.185 -1.117  -0.466  1.00 0.00 ? 137 PRO A CG   5  
ATOM 5644  C CD   . PRO A 1 53 ? -12.073 -2.107  -1.592  1.00 0.00 ? 137 PRO A CD   5  
ATOM 5645  H HA   . PRO A 1 53 ? -9.270  -0.798  -1.004  1.00 0.00 ? 137 PRO A HA   5  
ATOM 5646  H HB2  . PRO A 1 53 ? -10.992 -1.955  1.100   1.00 0.00 ? 137 PRO A HB2  5  
ATOM 5647  H HB3  . PRO A 1 53 ? -10.636 -0.267  0.731   1.00 0.00 ? 137 PRO A HB3  5  
ATOM 5648  H HG2  . PRO A 1 53 ? -13.025 -1.365  0.166   1.00 0.00 ? 137 PRO A HG2  5  
ATOM 5649  H HG3  . PRO A 1 53 ? -12.292 -0.116  -0.858  1.00 0.00 ? 137 PRO A HG3  5  
ATOM 5650  H HD2  . PRO A 1 53 ? -12.475 -3.065  -1.296  1.00 0.00 ? 137 PRO A HD2  5  
ATOM 5651  H HD3  . PRO A 1 53 ? -12.585 -1.739  -2.470  1.00 0.00 ? 137 PRO A HD3  5  
ATOM 5652  N N    . LEU A 1 54 ? -7.831  -2.234  0.498   1.00 0.00 ? 138 LEU A N    5  
ATOM 5653  C CA   . LEU A 1 54 ? -6.810  -3.135  1.004   1.00 0.00 ? 138 LEU A CA   5  
ATOM 5654  C C    . LEU A 1 54 ? -6.893  -3.268  2.522   1.00 0.00 ? 138 LEU A C    5  
ATOM 5655  O O    . LEU A 1 54 ? -6.389  -2.413  3.253   1.00 0.00 ? 138 LEU A O    5  
ATOM 5656  C CB   . LEU A 1 54 ? -5.415  -2.636  0.604   1.00 0.00 ? 138 LEU A CB   5  
ATOM 5657  C CG   . LEU A 1 54 ? -5.231  -2.308  -0.882  1.00 0.00 ? 138 LEU A CG   5  
ATOM 5658  C CD1  . LEU A 1 54 ? -3.812  -1.832  -1.150  1.00 0.00 ? 138 LEU A CD1  5  
ATOM 5659  C CD2  . LEU A 1 54 ? -5.556  -3.518  -1.745  1.00 0.00 ? 138 LEU A CD2  5  
ATOM 5660  H H    . LEU A 1 54 ? -7.714  -1.265  0.603   1.00 0.00 ? 138 LEU A H    5  
ATOM 5661  H HA   . LEU A 1 54 ? -6.976  -4.105  0.561   1.00 0.00 ? 138 LEU A HA   5  
ATOM 5662  H HB2  . LEU A 1 54 ? -5.200  -1.746  1.177   1.00 0.00 ? 138 LEU A HB2  5  
ATOM 5663  H HB3  . LEU A 1 54 ? -4.698  -3.397  0.872   1.00 0.00 ? 138 LEU A HB3  5  
ATOM 5664  H HG   . LEU A 1 54 ? -5.906  -1.510  -1.155  1.00 0.00 ? 138 LEU A HG   5  
ATOM 5665  H HD11 . LEU A 1 54 ? -3.710  -1.578  -2.195  1.00 0.00 ? 138 LEU A HD11 5  
ATOM 5666  H HD12 . LEU A 1 54 ? -3.116  -2.619  -0.901  1.00 0.00 ? 138 LEU A HD12 5  
ATOM 5667  H HD13 . LEU A 1 54 ? -3.604  -0.960  -0.546  1.00 0.00 ? 138 LEU A HD13 5  
ATOM 5668  H HD21 . LEU A 1 54 ? -5.430  -3.263  -2.786  1.00 0.00 ? 138 LEU A HD21 5  
ATOM 5669  H HD22 . LEU A 1 54 ? -6.575  -3.823  -1.567  1.00 0.00 ? 138 LEU A HD22 5  
ATOM 5670  H HD23 . LEU A 1 54 ? -4.888  -4.329  -1.490  1.00 0.00 ? 138 LEU A HD23 5  
ATOM 5671  N N    . GLU A 1 55 ? -7.554  -4.321  2.992   1.00 0.00 ? 139 GLU A N    5  
ATOM 5672  C CA   . GLU A 1 55 ? -7.572  -4.621  4.418   1.00 0.00 ? 139 GLU A CA   5  
ATOM 5673  C C    . GLU A 1 55 ? -6.160  -4.943  4.896   1.00 0.00 ? 139 GLU A C    5  
ATOM 5674  O O    . GLU A 1 55 ? -5.443  -5.714  4.257   1.00 0.00 ? 139 GLU A O    5  
ATOM 5675  C CB   . GLU A 1 55 ? -8.507  -5.791  4.740   1.00 0.00 ? 139 GLU A CB   5  
ATOM 5676  C CG   . GLU A 1 55 ? -9.977  -5.514  4.465   1.00 0.00 ? 139 GLU A CG   5  
ATOM 5677  C CD   . GLU A 1 55 ? -10.418 -5.968  3.090   1.00 0.00 ? 139 GLU A CD   5  
ATOM 5678  O OE1  . GLU A 1 55 ? -10.007 -5.351  2.089   1.00 0.00 ? 139 GLU A OE1  5  
ATOM 5679  O OE2  . GLU A 1 55 ? -11.181 -6.952  3.001   1.00 0.00 ? 139 GLU A OE2  5  
ATOM 5680  H H    . GLU A 1 55 ? -8.049  -4.898  2.370   1.00 0.00 ? 139 GLU A H    5  
ATOM 5681  H HA   . GLU A 1 55 ? -7.920  -3.738  4.935   1.00 0.00 ? 139 GLU A HA   5  
ATOM 5682  H HB2  . GLU A 1 55 ? -8.210  -6.645  4.149   1.00 0.00 ? 139 GLU A HB2  5  
ATOM 5683  H HB3  . GLU A 1 55 ? -8.400  -6.039  5.787   1.00 0.00 ? 139 GLU A HB3  5  
ATOM 5684  H HG2  . GLU A 1 55 ? -10.571 -6.032  5.201   1.00 0.00 ? 139 GLU A HG2  5  
ATOM 5685  H HG3  . GLU A 1 55 ? -10.149 -4.450  4.549   1.00 0.00 ? 139 GLU A HG3  5  
ATOM 5686  N N    . ASP A 1 56 ? -5.776  -4.363  6.028   1.00 0.00 ? 140 ASP A N    5  
ATOM 5687  C CA   . ASP A 1 56 ? -4.414  -4.489  6.541   1.00 0.00 ? 140 ASP A CA   5  
ATOM 5688  C C    . ASP A 1 56 ? -4.081  -5.925  6.939   1.00 0.00 ? 140 ASP A C    5  
ATOM 5689  O O    . ASP A 1 56 ? -2.913  -6.309  6.978   1.00 0.00 ? 140 ASP A O    5  
ATOM 5690  C CB   . ASP A 1 56 ? -4.197  -3.558  7.734   1.00 0.00 ? 140 ASP A CB   5  
ATOM 5691  C CG   . ASP A 1 56 ? -5.060  -3.910  8.933   1.00 0.00 ? 140 ASP A CG   5  
ATOM 5692  O OD1  . ASP A 1 56 ? -6.227  -3.469  8.974   1.00 0.00 ? 140 ASP A OD1  5  
ATOM 5693  O OD2  . ASP A 1 56 ? -4.576  -4.621  9.839   1.00 0.00 ? 140 ASP A OD2  5  
ATOM 5694  H H    . ASP A 1 56 ? -6.428  -3.837  6.536   1.00 0.00 ? 140 ASP A H    5  
ATOM 5695  H HA   . ASP A 1 56 ? -3.745  -4.189  5.756   1.00 0.00 ? 140 ASP A HA   5  
ATOM 5696  H HB2  . ASP A 1 56 ? -3.162  -3.612  8.033   1.00 0.00 ? 140 ASP A HB2  5  
ATOM 5697  H HB3  . ASP A 1 56 ? -4.423  -2.546  7.434   1.00 0.00 ? 140 ASP A HB3  5  
ATOM 5698  N N    . GLN A 1 57 ? -5.109  -6.715  7.212   1.00 0.00 ? 141 GLN A N    5  
ATOM 5699  C CA   . GLN A 1 57 ? -4.920  -8.087  7.663   1.00 0.00 ? 141 GLN A CA   5  
ATOM 5700  C C    . GLN A 1 57 ? -4.664  -9.028  6.482   1.00 0.00 ? 141 GLN A C    5  
ATOM 5701  O O    . GLN A 1 57 ? -4.287  -10.183 6.667   1.00 0.00 ? 141 GLN A O    5  
ATOM 5702  C CB   . GLN A 1 57 ? -6.155  -8.544  8.444   1.00 0.00 ? 141 GLN A CB   5  
ATOM 5703  C CG   . GLN A 1 57 ? -5.959  -9.849  9.202   1.00 0.00 ? 141 GLN A CG   5  
ATOM 5704  C CD   . GLN A 1 57 ? -7.211  -10.299 9.928   1.00 0.00 ? 141 GLN A CD   5  
ATOM 5705  O OE1  . GLN A 1 57 ? -7.137  -10.914 10.990  1.00 0.00 ? 141 GLN A OE1  5  
ATOM 5706  N NE2  . GLN A 1 57 ? -8.372  -10.017 9.353   1.00 0.00 ? 141 GLN A NE2  5  
ATOM 5707  H H    . GLN A 1 57 ? -6.020  -6.362  7.119   1.00 0.00 ? 141 GLN A H    5  
ATOM 5708  H HA   . GLN A 1 57 ? -4.062  -8.109  8.317   1.00 0.00 ? 141 GLN A HA   5  
ATOM 5709  H HB2  . GLN A 1 57 ? -6.419  -7.777  9.156   1.00 0.00 ? 141 GLN A HB2  5  
ATOM 5710  H HB3  . GLN A 1 57 ? -6.973  -8.678  7.751   1.00 0.00 ? 141 GLN A HB3  5  
ATOM 5711  H HG2  . GLN A 1 57 ? -5.672  -10.619 8.500   1.00 0.00 ? 141 GLN A HG2  5  
ATOM 5712  H HG3  . GLN A 1 57 ? -5.170  -9.714  9.928   1.00 0.00 ? 141 GLN A HG3  5  
ATOM 5713  H HE21 . GLN A 1 57 ? -8.362  -9.541  8.497   1.00 0.00 ? 141 GLN A HE21 5  
ATOM 5714  H HE22 . GLN A 1 57 ? -9.188  -10.299 9.805   1.00 0.00 ? 141 GLN A HE22 5  
ATOM 5715  N N    . LEU A 1 58 ? -4.862  -8.526  5.274   1.00 0.00 ? 142 LEU A N    5  
ATOM 5716  C CA   . LEU A 1 58 ? -4.716  -9.347  4.080   1.00 0.00 ? 142 LEU A CA   5  
ATOM 5717  C C    . LEU A 1 58 ? -3.287  -9.287  3.547   1.00 0.00 ? 142 LEU A C    5  
ATOM 5718  O O    . LEU A 1 58 ? -2.554  -8.341  3.832   1.00 0.00 ? 142 LEU A O    5  
ATOM 5719  C CB   . LEU A 1 58 ? -5.703  -8.894  2.999   1.00 0.00 ? 142 LEU A CB   5  
ATOM 5720  C CG   . LEU A 1 58 ? -7.181  -9.042  3.365   1.00 0.00 ? 142 LEU A CG   5  
ATOM 5721  C CD1  . LEU A 1 58 ? -8.055  -8.623  2.196   1.00 0.00 ? 142 LEU A CD1  5  
ATOM 5722  C CD2  . LEU A 1 58 ? -7.493  -10.473 3.784   1.00 0.00 ? 142 LEU A CD2  5  
ATOM 5723  H H    . LEU A 1 58 ? -5.091  -7.575  5.177   1.00 0.00 ? 142 LEU A H    5  
ATOM 5724  H HA   . LEU A 1 58 ? -4.942  -10.367 4.354   1.00 0.00 ? 142 LEU A HA   5  
ATOM 5725  H HB2  . LEU A 1 58 ? -5.510  -7.854  2.778   1.00 0.00 ? 142 LEU A HB2  5  
ATOM 5726  H HB3  . LEU A 1 58 ? -5.516  -9.473  2.109   1.00 0.00 ? 142 LEU A HB3  5  
ATOM 5727  H HG   . LEU A 1 58 ? -7.406  -8.392  4.199   1.00 0.00 ? 142 LEU A HG   5  
ATOM 5728  H HD11 . LEU A 1 58 ? -7.841  -9.250  1.343   1.00 0.00 ? 142 LEU A HD11 5  
ATOM 5729  H HD12 . LEU A 1 58 ? -7.851  -7.592  1.945   1.00 0.00 ? 142 LEU A HD12 5  
ATOM 5730  H HD13 . LEU A 1 58 ? -9.097  -8.728  2.466   1.00 0.00 ? 142 LEU A HD13 5  
ATOM 5731  H HD21 . LEU A 1 58 ? -6.873  -10.743 4.626   1.00 0.00 ? 142 LEU A HD21 5  
ATOM 5732  H HD22 . LEU A 1 58 ? -7.292  -11.140 2.960   1.00 0.00 ? 142 LEU A HD22 5  
ATOM 5733  H HD23 . LEU A 1 58 ? -8.533  -10.550 4.063   1.00 0.00 ? 142 LEU A HD23 5  
ATOM 5734  N N    . PRO A 1 59 ? -2.870  -10.306 2.779   1.00 0.00 ? 143 PRO A N    5  
ATOM 5735  C CA   . PRO A 1 59 ? -1.543  -10.351 2.169   1.00 0.00 ? 143 PRO A CA   5  
ATOM 5736  C C    . PRO A 1 59 ? -1.441  -9.412  0.972   1.00 0.00 ? 143 PRO A C    5  
ATOM 5737  O O    . PRO A 1 59 ? -2.276  -9.448  0.065   1.00 0.00 ? 143 PRO A O    5  
ATOM 5738  C CB   . PRO A 1 59 ? -1.386  -11.811 1.716   1.00 0.00 ? 143 PRO A CB   5  
ATOM 5739  C CG   . PRO A 1 59 ? -2.581  -12.537 2.243   1.00 0.00 ? 143 PRO A CG   5  
ATOM 5740  C CD   . PRO A 1 59 ? -3.648  -11.500 2.439   1.00 0.00 ? 143 PRO A CD   5  
ATOM 5741  H HA   . PRO A 1 59 ? -0.769  -10.107 2.882   1.00 0.00 ? 143 PRO A HA   5  
ATOM 5742  H HB2  . PRO A 1 59 ? -1.345  -11.852 0.637   1.00 0.00 ? 143 PRO A HB2  5  
ATOM 5743  H HB3  . PRO A 1 59 ? -0.473  -12.216 2.127   1.00 0.00 ? 143 PRO A HB3  5  
ATOM 5744  H HG2  . PRO A 1 59 ? -2.906  -13.277 1.525   1.00 0.00 ? 143 PRO A HG2  5  
ATOM 5745  H HG3  . PRO A 1 59 ? -2.337  -13.008 3.182   1.00 0.00 ? 143 PRO A HG3  5  
ATOM 5746  H HD2  . PRO A 1 59 ? -4.208  -11.351 1.528   1.00 0.00 ? 143 PRO A HD2  5  
ATOM 5747  H HD3  . PRO A 1 59 ? -4.305  -11.778 3.250   1.00 0.00 ? 143 PRO A HD3  5  
ATOM 5748  N N    . LEU A 1 60 ? -0.413  -8.577  0.975   1.00 0.00 ? 144 LEU A N    5  
ATOM 5749  C CA   . LEU A 1 60 ? -0.222  -7.582  -0.075  1.00 0.00 ? 144 LEU A CA   5  
ATOM 5750  C C    . LEU A 1 60 ? -0.019  -8.242  -1.434  1.00 0.00 ? 144 LEU A C    5  
ATOM 5751  O O    . LEU A 1 60 ? -0.502  -7.743  -2.453  1.00 0.00 ? 144 LEU A O    5  
ATOM 5752  C CB   . LEU A 1 60 ? 0.981   -6.702  0.272   1.00 0.00 ? 144 LEU A CB   5  
ATOM 5753  C CG   . LEU A 1 60 ? 1.029   -5.326  -0.409  1.00 0.00 ? 144 LEU A CG   5  
ATOM 5754  C CD1  . LEU A 1 60 ? 1.933   -4.394  0.371   1.00 0.00 ? 144 LEU A CD1  5  
ATOM 5755  C CD2  . LEU A 1 60 ? 1.530   -5.430  -1.840  1.00 0.00 ? 144 LEU A CD2  5  
ATOM 5756  H H    . LEU A 1 60 ? 0.232   -8.619  1.718   1.00 0.00 ? 144 LEU A H    5  
ATOM 5757  H HA   . LEU A 1 60 ? -1.106  -6.966  -0.116  1.00 0.00 ? 144 LEU A HA   5  
ATOM 5758  H HB2  . LEU A 1 60 ? 0.990   -6.552  1.340   1.00 0.00 ? 144 LEU A HB2  5  
ATOM 5759  H HB3  . LEU A 1 60 ? 1.877   -7.241  -0.002  1.00 0.00 ? 144 LEU A HB3  5  
ATOM 5760  H HG   . LEU A 1 60 ? 0.038   -4.898  -0.426  1.00 0.00 ? 144 LEU A HG   5  
ATOM 5761  H HD11 . LEU A 1 60 ? 1.919   -3.415  -0.085  1.00 0.00 ? 144 LEU A HD11 5  
ATOM 5762  H HD12 . LEU A 1 60 ? 2.941   -4.781  0.361   1.00 0.00 ? 144 LEU A HD12 5  
ATOM 5763  H HD13 . LEU A 1 60 ? 1.584   -4.322  1.390   1.00 0.00 ? 144 LEU A HD13 5  
ATOM 5764  H HD21 . LEU A 1 60 ? 1.540   -4.448  -2.288  1.00 0.00 ? 144 LEU A HD21 5  
ATOM 5765  H HD22 . LEU A 1 60 ? 0.877   -6.078  -2.406  1.00 0.00 ? 144 LEU A HD22 5  
ATOM 5766  H HD23 . LEU A 1 60 ? 2.530   -5.836  -1.842  1.00 0.00 ? 144 LEU A HD23 5  
ATOM 5767  N N    . GLY A 1 61 ? 0.679   -9.374  -1.437  1.00 0.00 ? 145 GLY A N    5  
ATOM 5768  C CA   . GLY A 1 61 ? 1.011   -10.068 -2.670  1.00 0.00 ? 145 GLY A CA   5  
ATOM 5769  C C    . GLY A 1 61 ? -0.177  -10.340 -3.576  1.00 0.00 ? 145 GLY A C    5  
ATOM 5770  O O    . GLY A 1 61 ? -0.021  -10.400 -4.794  1.00 0.00 ? 145 GLY A O    5  
ATOM 5771  H H    . GLY A 1 61 ? 0.994   -9.737  -0.582  1.00 0.00 ? 145 GLY A H    5  
ATOM 5772  H HA2  . GLY A 1 61 ? 1.725   -9.472  -3.216  1.00 0.00 ? 145 GLY A HA2  5  
ATOM 5773  H HA3  . GLY A 1 61 ? 1.473   -11.010 -2.417  1.00 0.00 ? 145 GLY A HA3  5  
ATOM 5774  N N    . GLU A 1 62 ? -1.361  -10.492 -2.994  1.00 0.00 ? 146 GLU A N    5  
ATOM 5775  C CA   . GLU A 1 62 ? -2.559  -10.783 -3.777  1.00 0.00 ? 146 GLU A CA   5  
ATOM 5776  C C    . GLU A 1 62 ? -2.846  -9.647  -4.757  1.00 0.00 ? 146 GLU A C    5  
ATOM 5777  O O    . GLU A 1 62 ? -3.255  -9.876  -5.896  1.00 0.00 ? 146 GLU A O    5  
ATOM 5778  C CB   . GLU A 1 62 ? -3.763  -10.997 -2.855  1.00 0.00 ? 146 GLU A CB   5  
ATOM 5779  C CG   . GLU A 1 62 ? -4.992  -11.538 -3.572  1.00 0.00 ? 146 GLU A CG   5  
ATOM 5780  C CD   . GLU A 1 62 ? -6.188  -11.697 -2.658  1.00 0.00 ? 146 GLU A CD   5  
ATOM 5781  O OE1  . GLU A 1 62 ? -6.223  -12.679 -1.883  1.00 0.00 ? 146 GLU A OE1  5  
ATOM 5782  O OE2  . GLU A 1 62 ? -7.105  -10.856 -2.724  1.00 0.00 ? 146 GLU A OE2  5  
ATOM 5783  H H    . GLU A 1 62 ? -1.435  -10.402 -2.020  1.00 0.00 ? 146 GLU A H    5  
ATOM 5784  H HA   . GLU A 1 62 ? -2.377  -11.690 -4.335  1.00 0.00 ? 146 GLU A HA   5  
ATOM 5785  H HB2  . GLU A 1 62 ? -3.489  -11.695 -2.079  1.00 0.00 ? 146 GLU A HB2  5  
ATOM 5786  H HB3  . GLU A 1 62 ? -4.026  -10.053 -2.401  1.00 0.00 ? 146 GLU A HB3  5  
ATOM 5787  H HG2  . GLU A 1 62 ? -5.258  -10.857 -4.367  1.00 0.00 ? 146 GLU A HG2  5  
ATOM 5788  H HG3  . GLU A 1 62 ? -4.749  -12.502 -3.992  1.00 0.00 ? 146 GLU A HG3  5  
ATOM 5789  N N    . TYR A 1 63 ? -2.612  -8.421  -4.308  1.00 0.00 ? 147 TYR A N    5  
ATOM 5790  C CA   . TYR A 1 63 ? -2.880  -7.237  -5.117  1.00 0.00 ? 147 TYR A CA   5  
ATOM 5791  C C    . TYR A 1 63 ? -1.596  -6.694  -5.742  1.00 0.00 ? 147 TYR A C    5  
ATOM 5792  O O    . TYR A 1 63 ? -1.601  -6.162  -6.855  1.00 0.00 ? 147 TYR A O    5  
ATOM 5793  C CB   . TYR A 1 63 ? -3.532  -6.153  -4.253  1.00 0.00 ? 147 TYR A CB   5  
ATOM 5794  C CG   . TYR A 1 63 ? -4.706  -6.646  -3.439  1.00 0.00 ? 147 TYR A CG   5  
ATOM 5795  C CD1  . TYR A 1 63 ? -5.952  -6.838  -4.021  1.00 0.00 ? 147 TYR A CD1  5  
ATOM 5796  C CD2  . TYR A 1 63 ? -4.564  -6.922  -2.083  1.00 0.00 ? 147 TYR A CD2  5  
ATOM 5797  C CE1  . TYR A 1 63 ? -7.024  -7.289  -3.275  1.00 0.00 ? 147 TYR A CE1  5  
ATOM 5798  C CE2  . TYR A 1 63 ? -5.630  -7.372  -1.333  1.00 0.00 ? 147 TYR A CE2  5  
ATOM 5799  C CZ   . TYR A 1 63 ? -6.858  -7.552  -1.932  1.00 0.00 ? 147 TYR A CZ   5  
ATOM 5800  O OH   . TYR A 1 63 ? -7.922  -8.002  -1.186  1.00 0.00 ? 147 TYR A OH   5  
ATOM 5801  H H    . TYR A 1 63 ? -2.241  -8.308  -3.407  1.00 0.00 ? 147 TYR A H    5  
ATOM 5802  H HA   . TYR A 1 63 ? -3.563  -7.516  -5.906  1.00 0.00 ? 147 TYR A HA   5  
ATOM 5803  H HB2  . TYR A 1 63 ? -2.796  -5.760  -3.566  1.00 0.00 ? 147 TYR A HB2  5  
ATOM 5804  H HB3  . TYR A 1 63 ? -3.881  -5.354  -4.892  1.00 0.00 ? 147 TYR A HB3  5  
ATOM 5805  H HD1  . TYR A 1 63 ? -6.078  -6.629  -5.075  1.00 0.00 ? 147 TYR A HD1  5  
ATOM 5806  H HD2  . TYR A 1 63 ? -3.601  -6.776  -1.617  1.00 0.00 ? 147 TYR A HD2  5  
ATOM 5807  H HE1  . TYR A 1 63 ? -7.986  -7.429  -3.746  1.00 0.00 ? 147 TYR A HE1  5  
ATOM 5808  H HE2  . TYR A 1 63 ? -5.500  -7.583  -0.282  1.00 0.00 ? 147 TYR A HE2  5  
ATOM 5809  H HH   . TYR A 1 63 ? -8.259  -8.825  -1.573  1.00 0.00 ? 147 TYR A HH   5  
ATOM 5810  N N    . GLY A 1 64 ? -0.496  -6.843  -5.020  1.00 0.00 ? 148 GLY A N    5  
ATOM 5811  C CA   . GLY A 1 64 ? 0.756   -6.232  -5.419  1.00 0.00 ? 148 GLY A CA   5  
ATOM 5812  C C    . GLY A 1 64 ? 1.678   -7.167  -6.175  1.00 0.00 ? 148 GLY A C    5  
ATOM 5813  O O    . GLY A 1 64 ? 2.815   -6.808  -6.445  1.00 0.00 ? 148 GLY A O    5  
ATOM 5814  H H    . GLY A 1 64 ? -0.535  -7.375  -4.196  1.00 0.00 ? 148 GLY A H    5  
ATOM 5815  H HA2  . GLY A 1 64 ? 0.540   -5.381  -6.047  1.00 0.00 ? 148 GLY A HA2  5  
ATOM 5816  H HA3  . GLY A 1 64 ? 1.267   -5.887  -4.532  1.00 0.00 ? 148 GLY A HA3  5  
ATOM 5817  N N    . LEU A 1 65 ? 1.195   -8.372  -6.493  1.00 0.00 ? 149 LEU A N    5  
ATOM 5818  C CA   . LEU A 1 65 ? 1.998   -9.401  -7.179  1.00 0.00 ? 149 LEU A CA   5  
ATOM 5819  C C    . LEU A 1 65 ? 2.775   -8.858  -8.390  1.00 0.00 ? 149 LEU A C    5  
ATOM 5820  O O    . LEU A 1 65 ? 3.810   -9.412  -8.770  1.00 0.00 ? 149 LEU A O    5  
ATOM 5821  C CB   . LEU A 1 65 ? 1.109   -10.568 -7.635  1.00 0.00 ? 149 LEU A CB   5  
ATOM 5822  C CG   . LEU A 1 65 ? 0.157   -10.281 -8.808  1.00 0.00 ? 149 LEU A CG   5  
ATOM 5823  C CD1  . LEU A 1 65 ? -0.431  -11.578 -9.334  1.00 0.00 ? 149 LEU A CD1  5  
ATOM 5824  C CD2  . LEU A 1 65 ? -0.964  -9.338  -8.396  1.00 0.00 ? 149 LEU A CD2  5  
ATOM 5825  H H    . LEU A 1 65 ? 0.273   -8.592  -6.240  1.00 0.00 ? 149 LEU A H    5  
ATOM 5826  H HA   . LEU A 1 65 ? 2.711   -9.778  -6.462  1.00 0.00 ? 149 LEU A HA   5  
ATOM 5827  H HB2  . LEU A 1 65 ? 1.754   -11.389 -7.919  1.00 0.00 ? 149 LEU A HB2  5  
ATOM 5828  H HB3  . LEU A 1 65 ? 0.514   -10.882 -6.792  1.00 0.00 ? 149 LEU A HB3  5  
ATOM 5829  H HG   . LEU A 1 65 ? 0.712   -9.815  -9.611  1.00 0.00 ? 149 LEU A HG   5  
ATOM 5830  H HD11 . LEU A 1 65 ? -1.088  -11.364 -10.166 1.00 0.00 ? 149 LEU A HD11 5  
ATOM 5831  H HD12 . LEU A 1 65 ? -0.991  -12.064 -8.549  1.00 0.00 ? 149 LEU A HD12 5  
ATOM 5832  H HD13 . LEU A 1 65 ? 0.366   -12.228 -9.665  1.00 0.00 ? 149 LEU A HD13 5  
ATOM 5833  H HD21 . LEU A 1 65 ? -1.571  -9.809  -7.638  1.00 0.00 ? 149 LEU A HD21 5  
ATOM 5834  H HD22 . LEU A 1 65 ? -1.576  -9.112  -9.257  1.00 0.00 ? 149 LEU A HD22 5  
ATOM 5835  H HD23 . LEU A 1 65 ? -0.542  -8.424  -8.006  1.00 0.00 ? 149 LEU A HD23 5  
ATOM 5836  N N    . LYS A 1 66 ? 2.280   -7.788  -8.993  1.00 0.00 ? 150 LYS A N    5  
ATOM 5837  C CA   . LYS A 1 66 ? 2.931   -7.202  -10.155 1.00 0.00 ? 150 LYS A CA   5  
ATOM 5838  C C    . LYS A 1 66 ? 3.816   -6.033  -9.734  1.00 0.00 ? 150 LYS A C    5  
ATOM 5839  O O    . LYS A 1 66 ? 3.389   -5.175  -8.964  1.00 0.00 ? 150 LYS A O    5  
ATOM 5840  C CB   . LYS A 1 66 ? 1.886   -6.713  -11.162 1.00 0.00 ? 150 LYS A CB   5  
ATOM 5841  C CG   . LYS A 1 66 ? 0.940   -7.799  -11.647 1.00 0.00 ? 150 LYS A CG   5  
ATOM 5842  C CD   . LYS A 1 66 ? -0.117  -7.228  -12.575 1.00 0.00 ? 150 LYS A CD   5  
ATOM 5843  C CE   . LYS A 1 66 ? -1.058  -8.304  -13.092 1.00 0.00 ? 150 LYS A CE   5  
ATOM 5844  N NZ   . LYS A 1 66 ? -0.345  -9.327  -13.901 1.00 0.00 ? 150 LYS A NZ   5  
ATOM 5845  H H    . LYS A 1 66 ? 1.474   -7.363  -8.635  1.00 0.00 ? 150 LYS A H    5  
ATOM 5846  H HA   . LYS A 1 66 ? 3.543   -7.959  -10.617 1.00 0.00 ? 150 LYS A HA   5  
ATOM 5847  H HB2  . LYS A 1 66 ? 1.295   -5.934  -10.700 1.00 0.00 ? 150 LYS A HB2  5  
ATOM 5848  H HB3  . LYS A 1 66 ? 2.397   -6.301  -12.021 1.00 0.00 ? 150 LYS A HB3  5  
ATOM 5849  H HG2  . LYS A 1 66 ? 1.505   -8.549  -12.177 1.00 0.00 ? 150 LYS A HG2  5  
ATOM 5850  H HG3  . LYS A 1 66 ? 0.453   -8.246  -10.793 1.00 0.00 ? 150 LYS A HG3  5  
ATOM 5851  H HD2  . LYS A 1 66 ? -0.694  -6.492  -12.038 1.00 0.00 ? 150 LYS A HD2  5  
ATOM 5852  H HD3  . LYS A 1 66 ? 0.375   -6.759  -13.416 1.00 0.00 ? 150 LYS A HD3  5  
ATOM 5853  H HE2  . LYS A 1 66 ? -1.526  -8.791  -12.249 1.00 0.00 ? 150 LYS A HE2  5  
ATOM 5854  H HE3  . LYS A 1 66 ? -1.817  -7.839  -13.704 1.00 0.00 ? 150 LYS A HE3  5  
ATOM 5855  H HZ1  . LYS A 1 66 ? 0.227   -8.867  -14.643 1.00 0.00 ? 150 LYS A HZ1  5  
ATOM 5856  H HZ2  . LYS A 1 66 ? -1.031  -9.969  -14.357 1.00 0.00 ? 150 LYS A HZ2  5  
ATOM 5857  H HZ3  . LYS A 1 66 ? 0.289   -9.894  -13.294 1.00 0.00 ? 150 LYS A HZ3  5  
ATOM 5858  N N    . PRO A 1 67 ? 5.057   -5.968  -10.247 1.00 0.00 ? 151 PRO A N    5  
ATOM 5859  C CA   . PRO A 1 67 ? 5.975   -4.849  -9.981  1.00 0.00 ? 151 PRO A CA   5  
ATOM 5860  C C    . PRO A 1 67 ? 5.490   -3.548  -10.625 1.00 0.00 ? 151 PRO A C    5  
ATOM 5861  O O    . PRO A 1 67 ? 6.148   -2.511  -10.555 1.00 0.00 ? 151 PRO A O    5  
ATOM 5862  C CB   . PRO A 1 67 ? 7.300   -5.302  -10.615 1.00 0.00 ? 151 PRO A CB   5  
ATOM 5863  C CG   . PRO A 1 67 ? 7.138   -6.763  -10.876 1.00 0.00 ? 151 PRO A CG   5  
ATOM 5864  C CD   . PRO A 1 67 ? 5.675   -6.979  -11.114 1.00 0.00 ? 151 PRO A CD   5  
ATOM 5865  H HA   . PRO A 1 67 ? 6.112   -4.693  -8.922  1.00 0.00 ? 151 PRO A HA   5  
ATOM 5866  H HB2  . PRO A 1 67 ? 7.466   -4.755  -11.529 1.00 0.00 ? 151 PRO A HB2  5  
ATOM 5867  H HB3  . PRO A 1 67 ? 8.111   -5.112  -9.927  1.00 0.00 ? 151 PRO A HB3  5  
ATOM 5868  H HG2  . PRO A 1 67 ? 7.705   -7.043  -11.752 1.00 0.00 ? 151 PRO A HG2  5  
ATOM 5869  H HG3  . PRO A 1 67 ? 7.468   -7.332  -10.018 1.00 0.00 ? 151 PRO A HG3  5  
ATOM 5870  H HD2  . PRO A 1 67 ? 5.431   -6.803  -12.152 1.00 0.00 ? 151 PRO A HD2  5  
ATOM 5871  H HD3  . PRO A 1 67 ? 5.384   -7.975  -10.816 1.00 0.00 ? 151 PRO A HD3  5  
ATOM 5872  N N    . LEU A 1 68 ? 4.326   -3.624  -11.255 1.00 0.00 ? 152 LEU A N    5  
ATOM 5873  C CA   . LEU A 1 68 ? 3.721   -2.482  -11.910 1.00 0.00 ? 152 LEU A CA   5  
ATOM 5874  C C    . LEU A 1 68 ? 2.313   -2.255  -11.370 1.00 0.00 ? 152 LEU A C    5  
ATOM 5875  O O    . LEU A 1 68 ? 1.544   -1.470  -11.931 1.00 0.00 ? 152 LEU A O    5  
ATOM 5876  C CB   . LEU A 1 68 ? 3.676   -2.680  -13.436 1.00 0.00 ? 152 LEU A CB   5  
ATOM 5877  C CG   . LEU A 1 68 ? 2.894   -3.903  -13.937 1.00 0.00 ? 152 LEU A CG   5  
ATOM 5878  C CD1  . LEU A 1 68 ? 2.424   -3.679  -15.365 1.00 0.00 ? 152 LEU A CD1  5  
ATOM 5879  C CD2  . LEU A 1 68 ? 3.748   -5.163  -13.868 1.00 0.00 ? 152 LEU A CD2  5  
ATOM 5880  H H    . LEU A 1 68 ? 3.854   -4.479  -11.266 1.00 0.00 ? 152 LEU A H    5  
ATOM 5881  H HA   . LEU A 1 68 ? 4.322   -1.613  -11.686 1.00 0.00 ? 152 LEU A HA   5  
ATOM 5882  H HB2  . LEU A 1 68 ? 3.231   -1.797  -13.873 1.00 0.00 ? 152 LEU A HB2  5  
ATOM 5883  H HB3  . LEU A 1 68 ? 4.691   -2.760  -13.794 1.00 0.00 ? 152 LEU A HB3  5  
ATOM 5884  H HG   . LEU A 1 68 ? 2.024   -4.051  -13.312 1.00 0.00 ? 152 LEU A HG   5  
ATOM 5885  H HD11 . LEU A 1 68 ? 3.279   -3.517  -16.004 1.00 0.00 ? 152 LEU A HD11 5  
ATOM 5886  H HD12 . LEU A 1 68 ? 1.781   -2.811  -15.401 1.00 0.00 ? 152 LEU A HD12 5  
ATOM 5887  H HD13 . LEU A 1 68 ? 1.876   -4.545  -15.706 1.00 0.00 ? 152 LEU A HD13 5  
ATOM 5888  H HD21 . LEU A 1 68 ? 4.644   -5.023  -14.453 1.00 0.00 ? 152 LEU A HD21 5  
ATOM 5889  H HD22 . LEU A 1 68 ? 3.188   -5.998  -14.263 1.00 0.00 ? 152 LEU A HD22 5  
ATOM 5890  H HD23 . LEU A 1 68 ? 4.014   -5.364  -12.840 1.00 0.00 ? 152 LEU A HD23 5  
ATOM 5891  N N    . SER A 1 69 ? 1.978   -2.945  -10.278 1.00 0.00 ? 153 SER A N    5  
ATOM 5892  C CA   . SER A 1 69 ? 0.681   -2.767  -9.639  1.00 0.00 ? 153 SER A CA   5  
ATOM 5893  C C    . SER A 1 69 ? 0.513   -1.326  -9.179  1.00 0.00 ? 153 SER A C    5  
ATOM 5894  O O    . SER A 1 69 ? 1.191   -0.873  -8.255  1.00 0.00 ? 153 SER A O    5  
ATOM 5895  C CB   . SER A 1 69 ? 0.522   -3.721  -8.449  1.00 0.00 ? 153 SER A CB   5  
ATOM 5896  O OG   . SER A 1 69 ? 0.376   -5.067  -8.878  1.00 0.00 ? 153 SER A OG   5  
ATOM 5897  H H    . SER A 1 69 ? 2.622   -3.580  -9.890  1.00 0.00 ? 153 SER A H    5  
ATOM 5898  H HA   . SER A 1 69 ? -0.080  -2.989  -10.371 1.00 0.00 ? 153 SER A HA   5  
ATOM 5899  H HB2  . SER A 1 69 ? 1.393   -3.652  -7.814  1.00 0.00 ? 153 SER A HB2  5  
ATOM 5900  H HB3  . SER A 1 69 ? -0.355  -3.441  -7.884  1.00 0.00 ? 153 SER A HB3  5  
ATOM 5901  H HG   . SER A 1 69 ? -0.361  -5.473  -8.401  1.00 0.00 ? 153 SER A HG   5  
ATOM 5902  N N    . THR A 1 70 ? -0.374  -0.603  -9.843  1.00 0.00 ? 154 THR A N    5  
ATOM 5903  C CA   . THR A 1 70 ? -0.587  0.793   -9.532  1.00 0.00 ? 154 THR A CA   5  
ATOM 5904  C C    . THR A 1 70 ? -1.567  0.937   -8.375  1.00 0.00 ? 154 THR A C    5  
ATOM 5905  O O    . THR A 1 70 ? -2.779  0.799   -8.546  1.00 0.00 ? 154 THR A O    5  
ATOM 5906  C CB   . THR A 1 70 ? -1.106  1.559   -10.760 1.00 0.00 ? 154 THR A CB   5  
ATOM 5907  O OG1  . THR A 1 70 ? -0.274  1.267   -11.895 1.00 0.00 ? 154 THR A OG1  5  
ATOM 5908  C CG2  . THR A 1 70 ? -1.106  3.057   -10.508 1.00 0.00 ? 154 THR A CG2  5  
ATOM 5909  H H    . THR A 1 70 ? -0.906  -1.025  -10.556 1.00 0.00 ? 154 THR A H    5  
ATOM 5910  H HA   . THR A 1 70 ? 0.363   1.218   -9.240  1.00 0.00 ? 154 THR A HA   5  
ATOM 5911  H HB   . THR A 1 70 ? -2.117  1.241   -10.966 1.00 0.00 ? 154 THR A HB   5  
ATOM 5912  H HG1  . THR A 1 70 ? 0.224   0.457   -11.726 1.00 0.00 ? 154 THR A HG1  5  
ATOM 5913  H HG21 . THR A 1 70 ? -0.107  3.380   -10.253 1.00 0.00 ? 154 THR A HG21 5  
ATOM 5914  H HG22 . THR A 1 70 ? -1.777  3.285   -9.694  1.00 0.00 ? 154 THR A HG22 5  
ATOM 5915  H HG23 . THR A 1 70 ? -1.433  3.572   -11.399 1.00 0.00 ? 154 THR A HG23 5  
ATOM 5916  N N    . VAL A 1 71 ? -1.030  1.191   -7.195  1.00 0.00 ? 155 VAL A N    5  
ATOM 5917  C CA   . VAL A 1 71 ? -1.852  1.374   -6.016  1.00 0.00 ? 155 VAL A CA   5  
ATOM 5918  C C    . VAL A 1 71 ? -2.263  2.832   -5.902  1.00 0.00 ? 155 VAL A C    5  
ATOM 5919  O O    . VAL A 1 71 ? -1.423  3.717   -5.731  1.00 0.00 ? 155 VAL A O    5  
ATOM 5920  C CB   . VAL A 1 71 ? -1.116  0.939   -4.730  1.00 0.00 ? 155 VAL A CB   5  
ATOM 5921  C CG1  . VAL A 1 71 ? -2.012  1.094   -3.509  1.00 0.00 ? 155 VAL A CG1  5  
ATOM 5922  C CG2  . VAL A 1 71 ? -0.629  -0.497  -4.859  1.00 0.00 ? 155 VAL A CG2  5  
ATOM 5923  H H    . VAL A 1 71 ? -0.052  1.274   -7.118  1.00 0.00 ? 155 VAL A H    5  
ATOM 5924  H HA   . VAL A 1 71 ? -2.737  0.766   -6.128  1.00 0.00 ? 155 VAL A HA   5  
ATOM 5925  H HB   . VAL A 1 71 ? -0.256  1.576   -4.601  1.00 0.00 ? 155 VAL A HB   5  
ATOM 5926  H HG11 . VAL A 1 71 ? -2.299  2.129   -3.403  1.00 0.00 ? 155 VAL A HG11 5  
ATOM 5927  H HG12 . VAL A 1 71 ? -1.476  0.777   -2.627  1.00 0.00 ? 155 VAL A HG12 5  
ATOM 5928  H HG13 . VAL A 1 71 ? -2.896  0.485   -3.631  1.00 0.00 ? 155 VAL A HG13 5  
ATOM 5929  H HG21 . VAL A 1 71 ? -0.106  -0.781  -3.959  1.00 0.00 ? 155 VAL A HG21 5  
ATOM 5930  H HG22 . VAL A 1 71 ? 0.037   -0.576  -5.705  1.00 0.00 ? 155 VAL A HG22 5  
ATOM 5931  H HG23 . VAL A 1 71 ? -1.475  -1.151  -5.006  1.00 0.00 ? 155 VAL A HG23 5  
ATOM 5932  N N    . PHE A 1 72 ? -3.555  3.079   -6.020  1.00 0.00 ? 156 PHE A N    5  
ATOM 5933  C CA   . PHE A 1 72 ? -4.076  4.431   -5.963  1.00 0.00 ? 156 PHE A CA   5  
ATOM 5934  C C    . PHE A 1 72 ? -4.373  4.833   -4.529  1.00 0.00 ? 156 PHE A C    5  
ATOM 5935  O O    . PHE A 1 72 ? -5.369  4.407   -3.936  1.00 0.00 ? 156 PHE A O    5  
ATOM 5936  C CB   . PHE A 1 72 ? -5.330  4.572   -6.830  1.00 0.00 ? 156 PHE A CB   5  
ATOM 5937  C CG   . PHE A 1 72 ? -5.041  4.526   -8.305  1.00 0.00 ? 156 PHE A CG   5  
ATOM 5938  C CD1  . PHE A 1 72 ? -4.578  5.654   -8.965  1.00 0.00 ? 156 PHE A CD1  5  
ATOM 5939  C CD2  . PHE A 1 72 ? -5.223  3.359   -9.030  1.00 0.00 ? 156 PHE A CD2  5  
ATOM 5940  C CE1  . PHE A 1 72 ? -4.304  5.620   -10.317 1.00 0.00 ? 156 PHE A CE1  5  
ATOM 5941  C CE2  . PHE A 1 72 ? -4.948  3.319   -10.384 1.00 0.00 ? 156 PHE A CE2  5  
ATOM 5942  C CZ   . PHE A 1 72 ? -4.488  4.453   -11.028 1.00 0.00 ? 156 PHE A CZ   5  
ATOM 5943  H H    . PHE A 1 72 ? -4.181  2.329   -6.132  1.00 0.00 ? 156 PHE A H    5  
ATOM 5944  H HA   . PHE A 1 72 ? -3.313  5.090   -6.347  1.00 0.00 ? 156 PHE A HA   5  
ATOM 5945  H HB2  . PHE A 1 72 ? -6.013  3.769   -6.598  1.00 0.00 ? 156 PHE A HB2  5  
ATOM 5946  H HB3  . PHE A 1 72 ? -5.805  5.518   -6.612  1.00 0.00 ? 156 PHE A HB3  5  
ATOM 5947  H HD1  . PHE A 1 72 ? -4.435  6.570   -8.410  1.00 0.00 ? 156 PHE A HD1  5  
ATOM 5948  H HD2  . PHE A 1 72 ? -5.584  2.473   -8.527  1.00 0.00 ? 156 PHE A HD2  5  
ATOM 5949  H HE1  . PHE A 1 72 ? -3.943  6.506   -10.818 1.00 0.00 ? 156 PHE A HE1  5  
ATOM 5950  H HE2  . PHE A 1 72 ? -5.093  2.403   -10.939 1.00 0.00 ? 156 PHE A HE2  5  
ATOM 5951  H HZ   . PHE A 1 72 ? -4.272  4.424   -12.086 1.00 0.00 ? 156 PHE A HZ   5  
ATOM 5952  N N    . MET A 1 73 ? -3.485  5.638   -3.977  1.00 0.00 ? 157 MET A N    5  
ATOM 5953  C CA   . MET A 1 73 ? -3.655  6.183   -2.645  1.00 0.00 ? 157 MET A CA   5  
ATOM 5954  C C    . MET A 1 73 ? -4.660  7.321   -2.705  1.00 0.00 ? 157 MET A C    5  
ATOM 5955  O O    . MET A 1 73 ? -4.300  8.485   -2.905  1.00 0.00 ? 157 MET A O    5  
ATOM 5956  C CB   . MET A 1 73 ? -2.308  6.667   -2.098  1.00 0.00 ? 157 MET A CB   5  
ATOM 5957  C CG   . MET A 1 73 ? -2.366  7.232   -0.688  1.00 0.00 ? 157 MET A CG   5  
ATOM 5958  S SD   . MET A 1 73 ? -0.764  7.865   -0.145  1.00 0.00 ? 157 MET A SD   5  
ATOM 5959  C CE   . MET A 1 73 ? -1.203  8.637   1.411   1.00 0.00 ? 157 MET A CE   5  
ATOM 5960  H H    . MET A 1 73 ? -2.688  5.890   -4.496  1.00 0.00 ? 157 MET A H    5  
ATOM 5961  H HA   . MET A 1 73 ? -4.043  5.403   -2.008  1.00 0.00 ? 157 MET A HA   5  
ATOM 5962  H HB2  . MET A 1 73 ? -1.618  5.836   -2.101  1.00 0.00 ? 157 MET A HB2  5  
ATOM 5963  H HB3  . MET A 1 73 ? -1.926  7.439   -2.751  1.00 0.00 ? 157 MET A HB3  5  
ATOM 5964  H HG2  . MET A 1 73 ? -3.088  8.035   -0.662  1.00 0.00 ? 157 MET A HG2  5  
ATOM 5965  H HG3  . MET A 1 73 ? -2.674  6.447   -0.012  1.00 0.00 ? 157 MET A HG3  5  
ATOM 5966  H HE1  . MET A 1 73 ? -1.619  7.895   2.077   1.00 0.00 ? 157 MET A HE1  5  
ATOM 5967  H HE2  . MET A 1 73 ? -1.934  9.414   1.238   1.00 0.00 ? 157 MET A HE2  5  
ATOM 5968  H HE3  . MET A 1 73 ? -0.320  9.065   1.860   1.00 0.00 ? 157 MET A HE3  5  
ATOM 5969  N N    . ASN A 1 74 ? -5.928  6.972   -2.583  1.00 0.00 ? 158 ASN A N    5  
ATOM 5970  C CA   . ASN A 1 74 ? -6.998  7.937   -2.746  1.00 0.00 ? 158 ASN A CA   5  
ATOM 5971  C C    . ASN A 1 74 ? -7.153  8.807   -1.511  1.00 0.00 ? 158 ASN A C    5  
ATOM 5972  O O    . ASN A 1 74 ? -7.905  8.484   -0.593  1.00 0.00 ? 158 ASN A O    5  
ATOM 5973  C CB   . ASN A 1 74 ? -8.316  7.233   -3.075  1.00 0.00 ? 158 ASN A CB   5  
ATOM 5974  C CG   . ASN A 1 74 ? -8.468  6.921   -4.552  1.00 0.00 ? 158 ASN A CG   5  
ATOM 5975  O OD1  . ASN A 1 74 ? -8.981  7.732   -5.323  1.00 0.00 ? 158 ASN A OD1  5  
ATOM 5976  N ND2  . ASN A 1 74 ? -8.026  5.738   -4.957  1.00 0.00 ? 158 ASN A ND2  5  
ATOM 5977  H H    . ASN A 1 74 ? -6.154  6.039   -2.373  1.00 0.00 ? 158 ASN A H    5  
ATOM 5978  H HA   . ASN A 1 74 ? -6.730  8.572   -3.576  1.00 0.00 ? 158 ASN A HA   5  
ATOM 5979  H HB2  . ASN A 1 74 ? -8.362  6.304   -2.527  1.00 0.00 ? 158 ASN A HB2  5  
ATOM 5980  H HB3  . ASN A 1 74 ? -9.131  7.859   -2.770  1.00 0.00 ? 158 ASN A HB3  5  
ATOM 5981  H HD21 . ASN A 1 74 ? -7.629  5.139   -4.290  1.00 0.00 ? 158 ASN A HD21 5  
ATOM 5982  H HD22 . ASN A 1 74 ? -8.120  5.511   -5.904  1.00 0.00 ? 158 ASN A HD22 5  
ATOM 5983  N N    . LEU A 1 75 ? -6.406  9.898   -1.483  1.00 0.00 ? 159 LEU A N    5  
ATOM 5984  C CA   . LEU A 1 75 ? -6.562  10.900  -0.446  1.00 0.00 ? 159 LEU A CA   5  
ATOM 5985  C C    . LEU A 1 75 ? -7.826  11.698  -0.754  1.00 0.00 ? 159 LEU A C    5  
ATOM 5986  O O    . LEU A 1 75 ? -7.801  12.643  -1.545  1.00 0.00 ? 159 LEU A O    5  
ATOM 5987  C CB   . LEU A 1 75 ? -5.333  11.821  -0.408  1.00 0.00 ? 159 LEU A CB   5  
ATOM 5988  C CG   . LEU A 1 75 ? -4.933  12.355  0.972   1.00 0.00 ? 159 LEU A CG   5  
ATOM 5989  C CD1  . LEU A 1 75 ? -3.743  13.291  0.840   1.00 0.00 ? 159 LEU A CD1  5  
ATOM 5990  C CD2  . LEU A 1 75 ? -6.101  13.060  1.651   1.00 0.00 ? 159 LEU A CD2  5  
ATOM 5991  H H    . LEU A 1 75 ? -5.729  10.031  -2.178  1.00 0.00 ? 159 LEU A H    5  
ATOM 5992  H HA   . LEU A 1 75 ? -6.676  10.397  0.502   1.00 0.00 ? 159 LEU A HA   5  
ATOM 5993  H HB2  . LEU A 1 75 ? -4.494  11.276  -0.812  1.00 0.00 ? 159 LEU A HB2  5  
ATOM 5994  H HB3  . LEU A 1 75 ? -5.528  12.666  -1.048  1.00 0.00 ? 159 LEU A HB3  5  
ATOM 5995  H HG   . LEU A 1 75 ? -4.633  11.525  1.596   1.00 0.00 ? 159 LEU A HG   5  
ATOM 5996  H HD11 . LEU A 1 75 ? -3.486  13.690  1.810   1.00 0.00 ? 159 LEU A HD11 5  
ATOM 5997  H HD12 . LEU A 1 75 ? -3.995  14.101  0.171   1.00 0.00 ? 159 LEU A HD12 5  
ATOM 5998  H HD13 . LEU A 1 75 ? -2.902  12.745  0.441   1.00 0.00 ? 159 LEU A HD13 5  
ATOM 5999  H HD21 . LEU A 1 75 ? -6.921  12.364  1.769   1.00 0.00 ? 159 LEU A HD21 5  
ATOM 6000  H HD22 . LEU A 1 75 ? -6.422  13.894  1.044   1.00 0.00 ? 159 LEU A HD22 5  
ATOM 6001  H HD23 . LEU A 1 75 ? -5.793  13.417  2.622   1.00 0.00 ? 159 LEU A HD23 5  
ATOM 6002  N N    . ARG A 1 76 ? -8.934  11.287  -0.161  1.00 0.00 ? 160 ARG A N    5  
ATOM 6003  C CA   . ARG A 1 76 ? -10.230 11.844  -0.505  1.00 0.00 ? 160 ARG A CA   5  
ATOM 6004  C C    . ARG A 1 76 ? -10.816 12.657  0.633   1.00 0.00 ? 160 ARG A C    5  
ATOM 6005  O O    . ARG A 1 76 ? -10.349 12.574  1.769   1.00 0.00 ? 160 ARG A O    5  
ATOM 6006  C CB   . ARG A 1 76 ? -11.204 10.724  -0.885  1.00 0.00 ? 160 ARG A CB   5  
ATOM 6007  C CG   . ARG A 1 76 ? -10.855 10.020  -2.186  1.00 0.00 ? 160 ARG A CG   5  
ATOM 6008  C CD   . ARG A 1 76 ? -10.854 10.992  -3.353  1.00 0.00 ? 160 ARG A CD   5  
ATOM 6009  N NE   . ARG A 1 76 ? -10.610 10.322  -4.623  1.00 0.00 ? 160 ARG A NE   5  
ATOM 6010  C CZ   . ARG A 1 76 ? -10.146 10.931  -5.708  1.00 0.00 ? 160 ARG A CZ   5  
ATOM 6011  N NH1  . ARG A 1 76 ? -9.830  12.220  -5.674  1.00 0.00 ? 160 ARG A NH1  5  
ATOM 6012  N NH2  . ARG A 1 76 ? -9.985  10.242  -6.829  1.00 0.00 ? 160 ARG A NH2  5  
ATOM 6013  H H    . ARG A 1 76 ? -8.877  10.604  0.545   1.00 0.00 ? 160 ARG A H    5  
ATOM 6014  H HA   . ARG A 1 76 ? -10.096 12.491  -1.359  1.00 0.00 ? 160 ARG A HA   5  
ATOM 6015  H HB2  . ARG A 1 76 ? -11.211 9.989   -0.095  1.00 0.00 ? 160 ARG A HB2  5  
ATOM 6016  H HB3  . ARG A 1 76 ? -12.194 11.144  -0.984  1.00 0.00 ? 160 ARG A HB3  5  
ATOM 6017  H HG2  . ARG A 1 76 ? -9.873  9.576   -2.095  1.00 0.00 ? 160 ARG A HG2  5  
ATOM 6018  H HG3  . ARG A 1 76 ? -11.587 9.247   -2.372  1.00 0.00 ? 160 ARG A HG3  5  
ATOM 6019  H HD2  . ARG A 1 76 ? -11.813 11.484  -3.394  1.00 0.00 ? 160 ARG A HD2  5  
ATOM 6020  H HD3  . ARG A 1 76 ? -10.080 11.729  -3.189  1.00 0.00 ? 160 ARG A HD3  5  
ATOM 6021  H HE   . ARG A 1 76 ? -10.827 9.358   -4.676  1.00 0.00 ? 160 ARG A HE   5  
ATOM 6022  H HH11 . ARG A 1 76 ? -9.935  12.749  -4.822  1.00 0.00 ? 160 ARG A HH11 5  
ATOM 6023  H HH12 . ARG A 1 76 ? -9.493  12.677  -6.506  1.00 0.00 ? 160 ARG A HH12 5  
ATOM 6024  H HH21 . ARG A 1 76 ? -10.210 9.265   -6.855  1.00 0.00 ? 160 ARG A HH21 5  
ATOM 6025  H HH22 . ARG A 1 76 ? -9.639  10.696  -7.655  1.00 0.00 ? 160 ARG A HH22 5  
ATOM 6026  N N    . ASP A 1 2  ? 14.883  -12.754 0.373   1.00 0.00 ? 86  ASP A N    6  
ATOM 6027  C CA   . ASP A 1 2  ? 14.153  -11.538 0.710   1.00 0.00 ? 86  ASP A CA   6  
ATOM 6028  C C    . ASP A 1 2  ? 12.952  -11.403 -0.209  1.00 0.00 ? 86  ASP A C    6  
ATOM 6029  O O    . ASP A 1 2  ? 11.817  -11.296 0.250   1.00 0.00 ? 86  ASP A O    6  
ATOM 6030  C CB   . ASP A 1 2  ? 15.056  -10.307 0.594   1.00 0.00 ? 86  ASP A CB   6  
ATOM 6031  C CG   . ASP A 1 2  ? 14.391  -9.044  1.115   1.00 0.00 ? 86  ASP A CG   6  
ATOM 6032  O OD1  . ASP A 1 2  ? 14.210  -8.928  2.347   1.00 0.00 ? 86  ASP A OD1  6  
ATOM 6033  O OD2  . ASP A 1 2  ? 14.060  -8.158  0.304   1.00 0.00 ? 86  ASP A OD2  6  
ATOM 6034  H H    . ASP A 1 2  ? 15.811  -12.688 0.046   1.00 0.00 ? 86  ASP A H    6  
ATOM 6035  H HA   . ASP A 1 2  ? 13.803  -11.630 1.725   1.00 0.00 ? 86  ASP A HA   6  
ATOM 6036  H HB2  . ASP A 1 2  ? 15.956  -10.475 1.166   1.00 0.00 ? 86  ASP A HB2  6  
ATOM 6037  H HB3  . ASP A 1 2  ? 15.313  -10.154 -0.441  1.00 0.00 ? 86  ASP A HB3  6  
ATOM 6038  N N    . GLU A 1 3  ? 13.232  -11.439 -1.509  1.00 0.00 ? 87  GLU A N    6  
ATOM 6039  C CA   . GLU A 1 3  ? 12.202  -11.450 -2.548  1.00 0.00 ? 87  GLU A CA   6  
ATOM 6040  C C    . GLU A 1 3  ? 11.220  -10.288 -2.389  1.00 0.00 ? 87  GLU A C    6  
ATOM 6041  O O    . GLU A 1 3  ? 10.083  -10.464 -1.943  1.00 0.00 ? 87  GLU A O    6  
ATOM 6042  C CB   . GLU A 1 3  ? 11.477  -12.801 -2.547  1.00 0.00 ? 87  GLU A CB   6  
ATOM 6043  C CG   . GLU A 1 3  ? 12.388  -13.956 -2.935  1.00 0.00 ? 87  GLU A CG   6  
ATOM 6044  C CD   . GLU A 1 3  ? 11.785  -15.314 -2.653  1.00 0.00 ? 87  GLU A CD   6  
ATOM 6045  O OE1  . GLU A 1 3  ? 10.838  -15.710 -3.357  1.00 0.00 ? 87  GLU A OE1  6  
ATOM 6046  O OE2  . GLU A 1 3  ? 12.278  -16.007 -1.735  1.00 0.00 ? 87  GLU A OE2  6  
ATOM 6047  H H    . GLU A 1 3  ? 14.174  -11.449 -1.784  1.00 0.00 ? 87  GLU A H    6  
ATOM 6048  H HA   . GLU A 1 3  ? 12.706  -11.337 -3.496  1.00 0.00 ? 87  GLU A HA   6  
ATOM 6049  H HB2  . GLU A 1 3  ? 11.086  -12.991 -1.558  1.00 0.00 ? 87  GLU A HB2  6  
ATOM 6050  H HB3  . GLU A 1 3  ? 10.659  -12.763 -3.251  1.00 0.00 ? 87  GLU A HB3  6  
ATOM 6051  H HG2  . GLU A 1 3  ? 12.598  -13.891 -3.994  1.00 0.00 ? 87  GLU A HG2  6  
ATOM 6052  H HG3  . GLU A 1 3  ? 13.313  -13.867 -2.383  1.00 0.00 ? 87  GLU A HG3  6  
ATOM 6053  N N    . PRO A 1 4  ? 11.672  -9.074  -2.727  1.00 0.00 ? 88  PRO A N    6  
ATOM 6054  C CA   . PRO A 1 4  ? 10.865  -7.877  -2.632  1.00 0.00 ? 88  PRO A CA   6  
ATOM 6055  C C    . PRO A 1 4  ? 10.150  -7.541  -3.938  1.00 0.00 ? 88  PRO A C    6  
ATOM 6056  O O    . PRO A 1 4  ? 10.724  -7.631  -5.026  1.00 0.00 ? 88  PRO A O    6  
ATOM 6057  C CB   . PRO A 1 4  ? 11.902  -6.810  -2.285  1.00 0.00 ? 88  PRO A CB   6  
ATOM 6058  C CG   . PRO A 1 4  ? 13.208  -7.311  -2.832  1.00 0.00 ? 88  PRO A CG   6  
ATOM 6059  C CD   . PRO A 1 4  ? 13.021  -8.762  -3.213  1.00 0.00 ? 88  PRO A CD   6  
ATOM 6060  H HA   . PRO A 1 4  ? 10.142  -7.951  -1.834  1.00 0.00 ? 88  PRO A HA   6  
ATOM 6061  H HB2  . PRO A 1 4  ? 11.620  -5.872  -2.741  1.00 0.00 ? 88  PRO A HB2  6  
ATOM 6062  H HB3  . PRO A 1 4  ? 11.948  -6.690  -1.212  1.00 0.00 ? 88  PRO A HB3  6  
ATOM 6063  H HG2  . PRO A 1 4  ? 13.479  -6.733  -3.702  1.00 0.00 ? 88  PRO A HG2  6  
ATOM 6064  H HG3  . PRO A 1 4  ? 13.972  -7.222  -2.076  1.00 0.00 ? 88  PRO A HG3  6  
ATOM 6065  H HD2  . PRO A 1 4  ? 13.082  -8.881  -4.285  1.00 0.00 ? 88  PRO A HD2  6  
ATOM 6066  H HD3  . PRO A 1 4  ? 13.757  -9.379  -2.721  1.00 0.00 ? 88  PRO A HD3  6  
ATOM 6067  N N    . LEU A 1 5  ? 8.896   -7.163  -3.818  1.00 0.00 ? 89  LEU A N    6  
ATOM 6068  C CA   . LEU A 1 5  ? 8.101   -6.763  -4.960  1.00 0.00 ? 89  LEU A CA   6  
ATOM 6069  C C    . LEU A 1 5  ? 8.096   -5.238  -5.054  1.00 0.00 ? 89  LEU A C    6  
ATOM 6070  O O    . LEU A 1 5  ? 7.766   -4.548  -4.086  1.00 0.00 ? 89  LEU A O    6  
ATOM 6071  C CB   . LEU A 1 5  ? 6.667   -7.291  -4.803  1.00 0.00 ? 89  LEU A CB   6  
ATOM 6072  C CG   . LEU A 1 5  ? 5.903   -7.608  -6.097  1.00 0.00 ? 89  LEU A CG   6  
ATOM 6073  C CD1  . LEU A 1 5  ? 5.931   -6.438  -7.065  1.00 0.00 ? 89  LEU A CD1  6  
ATOM 6074  C CD2  . LEU A 1 5  ? 6.448   -8.862  -6.757  1.00 0.00 ? 89  LEU A CD2  6  
ATOM 6075  H H    . LEU A 1 5  ? 8.485   -7.144  -2.924  1.00 0.00 ? 89  LEU A H    6  
ATOM 6076  H HA   . LEU A 1 5  ? 8.549   -7.179  -5.850  1.00 0.00 ? 89  LEU A HA   6  
ATOM 6077  H HB2  . LEU A 1 5  ? 6.709   -8.197  -4.215  1.00 0.00 ? 89  LEU A HB2  6  
ATOM 6078  H HB3  . LEU A 1 5  ? 6.098   -6.557  -4.252  1.00 0.00 ? 89  LEU A HB3  6  
ATOM 6079  H HG   . LEU A 1 5  ? 4.868   -7.794  -5.847  1.00 0.00 ? 89  LEU A HG   6  
ATOM 6080  H HD11 . LEU A 1 5  ? 5.392   -6.700  -7.963  1.00 0.00 ? 89  LEU A HD11 6  
ATOM 6081  H HD12 . LEU A 1 5  ? 6.954   -6.201  -7.314  1.00 0.00 ? 89  LEU A HD12 6  
ATOM 6082  H HD13 . LEU A 1 5  ? 5.466   -5.580  -6.602  1.00 0.00 ? 89  LEU A HD13 6  
ATOM 6083  H HD21 . LEU A 1 5  ? 6.403   -9.683  -6.056  1.00 0.00 ? 89  LEU A HD21 6  
ATOM 6084  H HD22 . LEU A 1 5  ? 7.471   -8.698  -7.059  1.00 0.00 ? 89  LEU A HD22 6  
ATOM 6085  H HD23 . LEU A 1 5  ? 5.846   -9.098  -7.624  1.00 0.00 ? 89  LEU A HD23 6  
ATOM 6086  N N    . SER A 1 6  ? 8.475   -4.717  -6.206  1.00 0.00 ? 90  SER A N    6  
ATOM 6087  C CA   . SER A 1 6  ? 8.471   -3.285  -6.427  1.00 0.00 ? 90  SER A CA   6  
ATOM 6088  C C    . SER A 1 6  ? 7.115   -2.839  -6.965  1.00 0.00 ? 90  SER A C    6  
ATOM 6089  O O    . SER A 1 6  ? 6.822   -2.990  -8.154  1.00 0.00 ? 90  SER A O    6  
ATOM 6090  C CB   . SER A 1 6  ? 9.593   -2.908  -7.401  1.00 0.00 ? 90  SER A CB   6  
ATOM 6091  O OG   . SER A 1 6  ? 9.728   -1.504  -7.528  1.00 0.00 ? 90  SER A OG   6  
ATOM 6092  H H    . SER A 1 6  ? 8.761   -5.311  -6.930  1.00 0.00 ? 90  SER A H    6  
ATOM 6093  H HA   . SER A 1 6  ? 8.648   -2.802  -5.476  1.00 0.00 ? 90  SER A HA   6  
ATOM 6094  H HB2  . SER A 1 6  ? 10.527  -3.311  -7.042  1.00 0.00 ? 90  SER A HB2  6  
ATOM 6095  H HB3  . SER A 1 6  ? 9.376   -3.324  -8.374  1.00 0.00 ? 90  SER A HB3  6  
ATOM 6096  H HG   . SER A 1 6  ? 10.333  -1.180  -6.849  1.00 0.00 ? 90  SER A HG   6  
ATOM 6097  N N    . ILE A 1 7  ? 6.278   -2.320  -6.075  1.00 0.00 ? 91  ILE A N    6  
ATOM 6098  C CA   . ILE A 1 7  ? 4.949   -1.856  -6.452  1.00 0.00 ? 91  ILE A CA   6  
ATOM 6099  C C    . ILE A 1 7  ? 4.936   -0.339  -6.572  1.00 0.00 ? 91  ILE A C    6  
ATOM 6100  O O    . ILE A 1 7  ? 5.836   0.340   -6.073  1.00 0.00 ? 91  ILE A O    6  
ATOM 6101  C CB   . ILE A 1 7  ? 3.870   -2.287  -5.436  1.00 0.00 ? 91  ILE A CB   6  
ATOM 6102  C CG1  . ILE A 1 7  ? 4.194   -1.740  -4.042  1.00 0.00 ? 91  ILE A CG1  6  
ATOM 6103  C CG2  . ILE A 1 7  ? 3.745   -3.805  -5.405  1.00 0.00 ? 91  ILE A CG2  6  
ATOM 6104  C CD1  . ILE A 1 7  ? 3.099   -1.982  -3.025  1.00 0.00 ? 91  ILE A CD1  6  
ATOM 6105  H H    . ILE A 1 7  ? 6.571   -2.229  -5.140  1.00 0.00 ? 91  ILE A H    6  
ATOM 6106  H HA   . ILE A 1 7  ? 4.705   -2.285  -7.413  1.00 0.00 ? 91  ILE A HA   6  
ATOM 6107  H HB   . ILE A 1 7  ? 2.925   -1.884  -5.761  1.00 0.00 ? 91  ILE A HB   6  
ATOM 6108  H HG12 . ILE A 1 7  ? 5.093   -2.211  -3.679  1.00 0.00 ? 91  ILE A HG12 6  
ATOM 6109  H HG13 . ILE A 1 7  ? 4.355   -0.673  -4.112  1.00 0.00 ? 91  ILE A HG13 6  
ATOM 6110  H HG21 . ILE A 1 7  ? 3.496   -4.167  -6.392  1.00 0.00 ? 91  ILE A HG21 6  
ATOM 6111  H HG22 . ILE A 1 7  ? 2.966   -4.088  -4.710  1.00 0.00 ? 91  ILE A HG22 6  
ATOM 6112  H HG23 . ILE A 1 7  ? 4.682   -4.237  -5.089  1.00 0.00 ? 91  ILE A HG23 6  
ATOM 6113  H HD11 . ILE A 1 7  ? 2.186   -1.509  -3.360  1.00 0.00 ? 91  ILE A HD11 6  
ATOM 6114  H HD12 . ILE A 1 7  ? 3.393   -1.561  -2.075  1.00 0.00 ? 91  ILE A HD12 6  
ATOM 6115  H HD13 . ILE A 1 7  ? 2.936   -3.043  -2.916  1.00 0.00 ? 91  ILE A HD13 6  
ATOM 6116  N N    . LEU A 1 8  ? 3.913   0.193   -7.219  1.00 0.00 ? 92  LEU A N    6  
ATOM 6117  C CA   . LEU A 1 8  ? 3.818   1.626   -7.422  1.00 0.00 ? 92  LEU A CA   6  
ATOM 6118  C C    . LEU A 1 8  ? 2.561   2.178   -6.763  1.00 0.00 ? 92  LEU A C    6  
ATOM 6119  O O    . LEU A 1 8  ? 1.444   1.888   -7.194  1.00 0.00 ? 92  LEU A O    6  
ATOM 6120  C CB   . LEU A 1 8  ? 3.812   1.952   -8.916  1.00 0.00 ? 92  LEU A CB   6  
ATOM 6121  C CG   . LEU A 1 8  ? 4.007   3.430   -9.255  1.00 0.00 ? 92  LEU A CG   6  
ATOM 6122  C CD1  . LEU A 1 8  ? 5.385   3.899   -8.807  1.00 0.00 ? 92  LEU A CD1  6  
ATOM 6123  C CD2  . LEU A 1 8  ? 3.813   3.662   -10.747 1.00 0.00 ? 92  LEU A CD2  6  
ATOM 6124  H H    . LEU A 1 8  ? 3.199   -0.389  -7.561  1.00 0.00 ? 92  LEU A H    6  
ATOM 6125  H HA   . LEU A 1 8  ? 4.683   2.084   -6.965  1.00 0.00 ? 92  LEU A HA   6  
ATOM 6126  H HB2  . LEU A 1 8  ? 4.601   1.387   -9.390  1.00 0.00 ? 92  LEU A HB2  6  
ATOM 6127  H HB3  . LEU A 1 8  ? 2.866   1.635   -9.329  1.00 0.00 ? 92  LEU A HB3  6  
ATOM 6128  H HG   . LEU A 1 8  ? 3.270   4.013   -8.724  1.00 0.00 ? 92  LEU A HG   6  
ATOM 6129  H HD11 . LEU A 1 8  ? 6.143   3.306   -9.296  1.00 0.00 ? 92  LEU A HD11 6  
ATOM 6130  H HD12 . LEU A 1 8  ? 5.473   3.785   -7.736  1.00 0.00 ? 92  LEU A HD12 6  
ATOM 6131  H HD13 . LEU A 1 8  ? 5.517   4.938   -9.069  1.00 0.00 ? 92  LEU A HD13 6  
ATOM 6132  H HD21 . LEU A 1 8  ? 3.897   4.717   -10.962 1.00 0.00 ? 92  LEU A HD21 6  
ATOM 6133  H HD22 . LEU A 1 8  ? 2.833   3.312   -11.042 1.00 0.00 ? 92  LEU A HD22 6  
ATOM 6134  H HD23 . LEU A 1 8  ? 4.569   3.120   -11.296 1.00 0.00 ? 92  LEU A HD23 6  
ATOM 6135  N N    . VAL A 1 9  ? 2.738   2.956   -5.709  1.00 0.00 ? 93  VAL A N    6  
ATOM 6136  C CA   . VAL A 1 9  ? 1.617   3.599   -5.041  1.00 0.00 ? 93  VAL A CA   6  
ATOM 6137  C C    . VAL A 1 9  ? 1.667   5.099   -5.288  1.00 0.00 ? 93  VAL A C    6  
ATOM 6138  O O    . VAL A 1 9  ? 2.579   5.781   -4.831  1.00 0.00 ? 93  VAL A O    6  
ATOM 6139  C CB   . VAL A 1 9  ? 1.616   3.322   -3.520  1.00 0.00 ? 93  VAL A CB   6  
ATOM 6140  C CG1  . VAL A 1 9  ? 0.414   3.977   -2.851  1.00 0.00 ? 93  VAL A CG1  6  
ATOM 6141  C CG2  . VAL A 1 9  ? 1.630   1.826   -3.248  1.00 0.00 ? 93  VAL A CG2  6  
ATOM 6142  H H    . VAL A 1 9  ? 3.650   3.118   -5.374  1.00 0.00 ? 93  VAL A H    6  
ATOM 6143  H HA   . VAL A 1 9  ? 0.705   3.204   -5.465  1.00 0.00 ? 93  VAL A HA   6  
ATOM 6144  H HB   . VAL A 1 9  ? 2.512   3.752   -3.097  1.00 0.00 ? 93  VAL A HB   6  
ATOM 6145  H HG11 . VAL A 1 9  ? 0.427   3.761   -1.793  1.00 0.00 ? 93  VAL A HG11 6  
ATOM 6146  H HG12 . VAL A 1 9  ? -0.496  3.590   -3.286  1.00 0.00 ? 93  VAL A HG12 6  
ATOM 6147  H HG13 . VAL A 1 9  ? 0.456   5.045   -2.998  1.00 0.00 ? 93  VAL A HG13 6  
ATOM 6148  H HG21 . VAL A 1 9  ? 2.519   1.391   -3.681  1.00 0.00 ? 93  VAL A HG21 6  
ATOM 6149  H HG22 . VAL A 1 9  ? 0.756   1.369   -3.692  1.00 0.00 ? 93  VAL A HG22 6  
ATOM 6150  H HG23 . VAL A 1 9  ? 1.628   1.651   -2.183  1.00 0.00 ? 93  VAL A HG23 6  
ATOM 6151  N N    . ARG A 1 10 ? 0.704   5.607   -6.033  1.00 0.00 ? 94  ARG A N    6  
ATOM 6152  C CA   . ARG A 1 10 ? 0.690   7.018   -6.368  1.00 0.00 ? 94  ARG A CA   6  
ATOM 6153  C C    . ARG A 1 10 ? -0.080  7.812   -5.330  1.00 0.00 ? 94  ARG A C    6  
ATOM 6154  O O    . ARG A 1 10 ? -1.238  7.506   -5.027  1.00 0.00 ? 94  ARG A O    6  
ATOM 6155  C CB   . ARG A 1 10 ? 0.104   7.252   -7.761  1.00 0.00 ? 94  ARG A CB   6  
ATOM 6156  C CG   . ARG A 1 10 ? 1.067   6.896   -8.876  1.00 0.00 ? 94  ARG A CG   6  
ATOM 6157  C CD   . ARG A 1 10 ? 0.530   7.299   -10.235 1.00 0.00 ? 94  ARG A CD   6  
ATOM 6158  N NE   . ARG A 1 10 ? 1.569   7.237   -11.261 1.00 0.00 ? 94  ARG A NE   6  
ATOM 6159  C CZ   . ARG A 1 10 ? 1.334   7.225   -12.571 1.00 0.00 ? 94  ARG A CZ   6  
ATOM 6160  N NH1  . ARG A 1 10 ? 0.089   7.268   -13.029 1.00 0.00 ? 94  ARG A NH1  6  
ATOM 6161  N NH2  . ARG A 1 10 ? 2.350   7.178   -13.427 1.00 0.00 ? 94  ARG A NH2  6  
ATOM 6162  H H    . ARG A 1 10 ? -0.030  5.027   -6.339  1.00 0.00 ? 94  ARG A H    6  
ATOM 6163  H HA   . ARG A 1 10 ? 1.716   7.358   -6.365  1.00 0.00 ? 94  ARG A HA   6  
ATOM 6164  H HB2  . ARG A 1 10 ? -0.786  6.649   -7.872  1.00 0.00 ? 94  ARG A HB2  6  
ATOM 6165  H HB3  . ARG A 1 10 ? -0.160  8.295   -7.860  1.00 0.00 ? 94  ARG A HB3  6  
ATOM 6166  H HG2  . ARG A 1 10 ? 2.003   7.406   -8.704  1.00 0.00 ? 94  ARG A HG2  6  
ATOM 6167  H HG3  . ARG A 1 10 ? 1.232   5.828   -8.867  1.00 0.00 ? 94  ARG A HG3  6  
ATOM 6168  H HD2  . ARG A 1 10 ? -0.273  6.630   -10.505 1.00 0.00 ? 94  ARG A HD2  6  
ATOM 6169  H HD3  . ARG A 1 10 ? 0.155   8.309   -10.176 1.00 0.00 ? 94  ARG A HD3  6  
ATOM 6170  H HE   . ARG A 1 10 ? 2.507   7.217   -10.947 1.00 0.00 ? 94  ARG A HE   6  
ATOM 6171  H HH11 . ARG A 1 10 ? -0.680  7.311   -12.391 1.00 0.00 ? 94  ARG A HH11 6  
ATOM 6172  H HH12 . ARG A 1 10 ? -0.089  7.256   -14.025 1.00 0.00 ? 94  ARG A HH12 6  
ATOM 6173  H HH21 . ARG A 1 10 ? 3.302   7.148   -13.088 1.00 0.00 ? 94  ARG A HH21 6  
ATOM 6174  H HH22 . ARG A 1 10 ? 2.178   7.177   -14.422 1.00 0.00 ? 94  ARG A HH22 6  
ATOM 6175  N N    . ASN A 1 11 ? 0.582   8.820   -4.780  1.00 0.00 ? 95  ASN A N    6  
ATOM 6176  C CA   . ASN A 1 11 ? -0.043  9.716   -3.819  1.00 0.00 ? 95  ASN A CA   6  
ATOM 6177  C C    . ASN A 1 11 ? -1.119  10.521  -4.531  1.00 0.00 ? 95  ASN A C    6  
ATOM 6178  O O    . ASN A 1 11 ? -1.000  10.776  -5.733  1.00 0.00 ? 95  ASN A O    6  
ATOM 6179  C CB   . ASN A 1 11 ? 0.995   10.668  -3.203  1.00 0.00 ? 95  ASN A CB   6  
ATOM 6180  C CG   . ASN A 1 11 ? 2.271   9.964   -2.769  1.00 0.00 ? 95  ASN A CG   6  
ATOM 6181  O OD1  . ASN A 1 11 ? 2.270   8.782   -2.423  1.00 0.00 ? 95  ASN A OD1  6  
ATOM 6182  N ND2  . ASN A 1 11 ? 3.377   10.694  -2.772  1.00 0.00 ? 95  ASN A ND2  6  
ATOM 6183  H H    . ASN A 1 11 ? 1.522   8.967   -5.028  1.00 0.00 ? 95  ASN A H    6  
ATOM 6184  H HA   . ASN A 1 11 ? -0.496  9.121   -3.040  1.00 0.00 ? 95  ASN A HA   6  
ATOM 6185  H HB2  . ASN A 1 11 ? 1.255   11.422  -3.931  1.00 0.00 ? 95  ASN A HB2  6  
ATOM 6186  H HB3  . ASN A 1 11 ? 0.560   11.149  -2.339  1.00 0.00 ? 95  ASN A HB3  6  
ATOM 6187  H HD21 . ASN A 1 11 ? 3.310   11.639  -3.042  1.00 0.00 ? 95  ASN A HD21 6  
ATOM 6188  H HD22 . ASN A 1 11 ? 4.220   10.258  -2.526  1.00 0.00 ? 95  ASN A HD22 6  
ATOM 6189  N N    . ASN A 1 12 ? -2.160  10.916  -3.808  1.00 0.00 ? 96  ASN A N    6  
ATOM 6190  C CA   . ASN A 1 12 ? -3.279  11.627  -4.420  1.00 0.00 ? 96  ASN A CA   6  
ATOM 6191  C C    . ASN A 1 12 ? -2.809  12.940  -5.032  1.00 0.00 ? 96  ASN A C    6  
ATOM 6192  O O    . ASN A 1 12 ? -2.499  13.893  -4.314  1.00 0.00 ? 96  ASN A O    6  
ATOM 6193  C CB   . ASN A 1 12 ? -4.388  11.888  -3.402  1.00 0.00 ? 96  ASN A CB   6  
ATOM 6194  C CG   . ASN A 1 12 ? -5.632  12.463  -4.050  1.00 0.00 ? 96  ASN A CG   6  
ATOM 6195  O OD1  . ASN A 1 12 ? -5.809  13.679  -4.128  1.00 0.00 ? 96  ASN A OD1  6  
ATOM 6196  N ND2  . ASN A 1 12 ? -6.504  11.589  -4.525  1.00 0.00 ? 96  ASN A ND2  6  
ATOM 6197  H H    . ASN A 1 12 ? -2.174  10.731  -2.849  1.00 0.00 ? 96  ASN A H    6  
ATOM 6198  H HA   . ASN A 1 12 ? -3.669  11.003  -5.208  1.00 0.00 ? 96  ASN A HA   6  
ATOM 6199  H HB2  . ASN A 1 12 ? -4.652  10.959  -2.921  1.00 0.00 ? 96  ASN A HB2  6  
ATOM 6200  H HB3  . ASN A 1 12 ? -4.031  12.588  -2.662  1.00 0.00 ? 96  ASN A HB3  6  
ATOM 6201  H HD21 . ASN A 1 12 ? -6.298  10.631  -4.431  1.00 0.00 ? 96  ASN A HD21 6  
ATOM 6202  H HD22 . ASN A 1 12 ? -7.316  11.932  -4.959  1.00 0.00 ? 96  ASN A HD22 6  
ATOM 6203  N N    . LYS A 1 13 ? -2.738  12.958  -6.362  1.00 0.00 ? 97  LYS A N    6  
ATOM 6204  C CA   . LYS A 1 13 ? -2.267  14.116  -7.123  1.00 0.00 ? 97  LYS A CA   6  
ATOM 6205  C C    . LYS A 1 13 ? -0.824  14.458  -6.773  1.00 0.00 ? 97  LYS A C    6  
ATOM 6206  O O    . LYS A 1 13 ? -0.366  15.579  -7.009  1.00 0.00 ? 97  LYS A O    6  
ATOM 6207  C CB   . LYS A 1 13 ? -3.165  15.329  -6.874  1.00 0.00 ? 97  LYS A CB   6  
ATOM 6208  C CG   . LYS A 1 13 ? -4.632  15.072  -7.174  1.00 0.00 ? 97  LYS A CG   6  
ATOM 6209  C CD   . LYS A 1 13 ? -5.472  16.315  -6.960  1.00 0.00 ? 97  LYS A CD   6  
ATOM 6210  C CE   . LYS A 1 13 ? -5.287  16.889  -5.564  1.00 0.00 ? 97  LYS A CE   6  
ATOM 6211  N NZ   . LYS A 1 13 ? -6.141  18.085  -5.349  1.00 0.00 ? 97  LYS A NZ   6  
ATOM 6212  H H    . LYS A 1 13 ? -3.024  12.158  -6.856  1.00 0.00 ? 97  LYS A H    6  
ATOM 6213  H HA   . LYS A 1 13 ? -2.317  13.858  -8.170  1.00 0.00 ? 97  LYS A HA   6  
ATOM 6214  H HB2  . LYS A 1 13 ? -3.076  15.619  -5.836  1.00 0.00 ? 97  LYS A HB2  6  
ATOM 6215  H HB3  . LYS A 1 13 ? -2.828  16.144  -7.496  1.00 0.00 ? 97  LYS A HB3  6  
ATOM 6216  H HG2  . LYS A 1 13 ? -4.728  14.758  -8.202  1.00 0.00 ? 97  LYS A HG2  6  
ATOM 6217  H HG3  . LYS A 1 13 ? -4.991  14.289  -6.523  1.00 0.00 ? 97  LYS A HG3  6  
ATOM 6218  H HD2  . LYS A 1 13 ? -5.180  17.062  -7.684  1.00 0.00 ? 97  LYS A HD2  6  
ATOM 6219  H HD3  . LYS A 1 13 ? -6.513  16.062  -7.102  1.00 0.00 ? 97  LYS A HD3  6  
ATOM 6220  H HE2  . LYS A 1 13 ? -5.551  16.134  -4.839  1.00 0.00 ? 97  LYS A HE2  6  
ATOM 6221  H HE3  . LYS A 1 13 ? -4.251  17.167  -5.435  1.00 0.00 ? 97  LYS A HE3  6  
ATOM 6222  H HZ1  . LYS A 1 13 ? -6.117  18.697  -6.192  1.00 0.00 ? 97  LYS A HZ1  6  
ATOM 6223  H HZ2  . LYS A 1 13 ? -5.795  18.630  -4.531  1.00 0.00 ? 97  LYS A HZ2  6  
ATOM 6224  H HZ3  . LYS A 1 13 ? -7.125  17.795  -5.169  1.00 0.00 ? 97  LYS A HZ3  6  
ATOM 6225  N N    . GLY A 1 14 ? -0.107  13.487  -6.230  1.00 0.00 ? 98  GLY A N    6  
ATOM 6226  C CA   . GLY A 1 14 ? 1.267   13.707  -5.835  1.00 0.00 ? 98  GLY A CA   6  
ATOM 6227  C C    . GLY A 1 14 ? 2.236   12.916  -6.684  1.00 0.00 ? 98  GLY A C    6  
ATOM 6228  O O    . GLY A 1 14 ? 2.001   12.712  -7.877  1.00 0.00 ? 98  GLY A O    6  
ATOM 6229  H H    . GLY A 1 14 ? -0.515  12.599  -6.108  1.00 0.00 ? 98  GLY A H    6  
ATOM 6230  H HA2  . GLY A 1 14 ? 1.495   14.758  -5.933  1.00 0.00 ? 98  GLY A HA2  6  
ATOM 6231  H HA3  . GLY A 1 14 ? 1.386   13.414  -4.803  1.00 0.00 ? 98  GLY A HA3  6  
ATOM 6232  N N    . ARG A 1 15 ? 3.323   12.463  -6.074  1.00 0.00 ? 99  ARG A N    6  
ATOM 6233  C CA   . ARG A 1 15 ? 4.325   11.690  -6.797  1.00 0.00 ? 99  ARG A CA   6  
ATOM 6234  C C    . ARG A 1 15 ? 4.015   10.200  -6.745  1.00 0.00 ? 99  ARG A C    6  
ATOM 6235  O O    . ARG A 1 15 ? 3.247   9.737   -5.897  1.00 0.00 ? 99  ARG A O    6  
ATOM 6236  C CB   . ARG A 1 15 ? 5.734   11.938  -6.240  1.00 0.00 ? 99  ARG A CB   6  
ATOM 6237  C CG   . ARG A 1 15 ? 5.956   11.436  -4.820  1.00 0.00 ? 99  ARG A CG   6  
ATOM 6238  C CD   . ARG A 1 15 ? 7.435   11.442  -4.458  1.00 0.00 ? 99  ARG A CD   6  
ATOM 6239  N NE   . ARG A 1 15 ? 7.679   10.930  -3.107  1.00 0.00 ? 99  ARG A NE   6  
ATOM 6240  C CZ   . ARG A 1 15 ? 8.556   9.963   -2.819  1.00 0.00 ? 99  ARG A CZ   6  
ATOM 6241  N NH1  . ARG A 1 15 ? 9.258   9.380   -3.786  1.00 0.00 ? 99  ARG A NH1  6  
ATOM 6242  N NH2  . ARG A 1 15 ? 8.735   9.582   -1.561  1.00 0.00 ? 99  ARG A NH2  6  
ATOM 6243  H H    . ARG A 1 15 ? 3.454   12.654  -5.120  1.00 0.00 ? 99  ARG A H    6  
ATOM 6244  H HA   . ARG A 1 15 ? 4.298   12.009  -7.828  1.00 0.00 ? 99  ARG A HA   6  
ATOM 6245  H HB2  . ARG A 1 15 ? 6.447   11.442  -6.879  1.00 0.00 ? 99  ARG A HB2  6  
ATOM 6246  H HB3  . ARG A 1 15 ? 5.930   13.000  -6.257  1.00 0.00 ? 99  ARG A HB3  6  
ATOM 6247  H HG2  . ARG A 1 15 ? 5.424   12.076  -4.132  1.00 0.00 ? 99  ARG A HG2  6  
ATOM 6248  H HG3  . ARG A 1 15 ? 5.578   10.426  -4.741  1.00 0.00 ? 99  ARG A HG3  6  
ATOM 6249  H HD2  . ARG A 1 15 ? 7.966   10.825  -5.167  1.00 0.00 ? 99  ARG A HD2  6  
ATOM 6250  H HD3  . ARG A 1 15 ? 7.802   12.456  -4.521  1.00 0.00 ? 99  ARG A HD3  6  
ATOM 6251  H HE   . ARG A 1 15 ? 7.170   11.342  -2.373  1.00 0.00 ? 99  ARG A HE   6  
ATOM 6252  H HH11 . ARG A 1 15 ? 9.138   9.662   -4.738  1.00 0.00 ? 99  ARG A HH11 6  
ATOM 6253  H HH12 . ARG A 1 15 ? 9.922   8.651   -3.562  1.00 0.00 ? 99  ARG A HH12 6  
ATOM 6254  H HH21 . ARG A 1 15 ? 8.214   10.023  -0.820  1.00 0.00 ? 99  ARG A HH21 6  
ATOM 6255  H HH22 . ARG A 1 15 ? 9.390   8.844   -1.337  1.00 0.00 ? 99  ARG A HH22 6  
ATOM 6256  N N    . SER A 1 16 ? 4.602   9.455   -7.670  1.00 0.00 ? 100 SER A N    6  
ATOM 6257  C CA   . SER A 1 16 ? 4.479   8.009   -7.674  1.00 0.00 ? 100 SER A CA   6  
ATOM 6258  C C    . SER A 1 16 ? 5.479   7.401   -6.694  1.00 0.00 ? 100 SER A C    6  
ATOM 6259  O O    . SER A 1 16 ? 6.686   7.396   -6.944  1.00 0.00 ? 100 SER A O    6  
ATOM 6260  C CB   . SER A 1 16 ? 4.717   7.464   -9.083  1.00 0.00 ? 100 SER A CB   6  
ATOM 6261  O OG   . SER A 1 16 ? 3.941   8.171   -10.035 1.00 0.00 ? 100 SER A OG   6  
ATOM 6262  H H    . SER A 1 16 ? 5.127   9.892   -8.376  1.00 0.00 ? 100 SER A H    6  
ATOM 6263  H HA   . SER A 1 16 ? 3.478   7.757   -7.359  1.00 0.00 ? 100 SER A HA   6  
ATOM 6264  H HB2  . SER A 1 16 ? 5.762   7.569   -9.341  1.00 0.00 ? 100 SER A HB2  6  
ATOM 6265  H HB3  . SER A 1 16 ? 4.441   6.422   -9.114  1.00 0.00 ? 100 SER A HB3  6  
ATOM 6266  H HG   . SER A 1 16 ? 4.303   9.063   -10.146 1.00 0.00 ? 100 SER A HG   6  
ATOM 6267  N N    . SER A 1 17 ? 4.980   6.916   -5.571  1.00 0.00 ? 101 SER A N    6  
ATOM 6268  C CA   . SER A 1 17 ? 5.831   6.336   -4.551  1.00 0.00 ? 101 SER A CA   6  
ATOM 6269  C C    . SER A 1 17 ? 6.095   4.861   -4.850  1.00 0.00 ? 101 SER A C    6  
ATOM 6270  O O    . SER A 1 17 ? 5.222   4.007   -4.671  1.00 0.00 ? 101 SER A O    6  
ATOM 6271  C CB   . SER A 1 17 ? 5.179   6.502   -3.176  1.00 0.00 ? 101 SER A CB   6  
ATOM 6272  O OG   . SER A 1 17 ? 4.879   7.867   -2.919  1.00 0.00 ? 101 SER A OG   6  
ATOM 6273  H H    . SER A 1 17 ? 4.008   6.944   -5.421  1.00 0.00 ? 101 SER A H    6  
ATOM 6274  H HA   . SER A 1 17 ? 6.768   6.868   -4.560  1.00 0.00 ? 101 SER A HA   6  
ATOM 6275  H HB2  . SER A 1 17 ? 4.263   5.930   -3.142  1.00 0.00 ? 101 SER A HB2  6  
ATOM 6276  H HB3  . SER A 1 17 ? 5.856   6.144   -2.414  1.00 0.00 ? 101 SER A HB3  6  
ATOM 6277  H HG   . SER A 1 17 ? 3.923   7.961   -2.777  1.00 0.00 ? 101 SER A HG   6  
ATOM 6278  N N    . THR A 1 18 ? 7.289   4.579   -5.344  1.00 0.00 ? 102 THR A N    6  
ATOM 6279  C CA   . THR A 1 18 ? 7.698   3.217   -5.625  1.00 0.00 ? 102 THR A CA   6  
ATOM 6280  C C    . THR A 1 18 ? 8.078   2.507   -4.326  1.00 0.00 ? 102 THR A C    6  
ATOM 6281  O O    . THR A 1 18 ? 9.032   2.896   -3.653  1.00 0.00 ? 102 THR A O    6  
ATOM 6282  C CB   . THR A 1 18 ? 8.893   3.206   -6.596  1.00 0.00 ? 102 THR A CB   6  
ATOM 6283  O OG1  . THR A 1 18 ? 8.685   4.201   -7.613  1.00 0.00 ? 102 THR A OG1  6  
ATOM 6284  C CG2  . THR A 1 18 ? 9.059   1.835   -7.238  1.00 0.00 ? 102 THR A CG2  6  
ATOM 6285  H H    . THR A 1 18 ? 7.912   5.311   -5.538  1.00 0.00 ? 102 THR A H    6  
ATOM 6286  H HA   . THR A 1 18 ? 6.872   2.699   -6.088  1.00 0.00 ? 102 THR A HA   6  
ATOM 6287  H HB   . THR A 1 18 ? 9.791   3.444   -6.043  1.00 0.00 ? 102 THR A HB   6  
ATOM 6288  H HG1  . THR A 1 18 ? 8.735   3.787   -8.485  1.00 0.00 ? 102 THR A HG1  6  
ATOM 6289  H HG21 . THR A 1 18 ? 9.912   1.847   -7.901  1.00 0.00 ? 102 THR A HG21 6  
ATOM 6290  H HG22 . THR A 1 18 ? 8.170   1.590   -7.801  1.00 0.00 ? 102 THR A HG22 6  
ATOM 6291  H HG23 . THR A 1 18 ? 9.214   1.093   -6.469  1.00 0.00 ? 102 THR A HG23 6  
ATOM 6292  N N    . TYR A 1 19 ? 7.321   1.480   -3.969  1.00 0.00 ? 103 TYR A N    6  
ATOM 6293  C CA   . TYR A 1 19 ? 7.523   0.793   -2.704  1.00 0.00 ? 103 TYR A CA   6  
ATOM 6294  C C    . TYR A 1 19 ? 8.154   -0.577  -2.900  1.00 0.00 ? 103 TYR A C    6  
ATOM 6295  O O    . TYR A 1 19 ? 7.716   -1.364  -3.740  1.00 0.00 ? 103 TYR A O    6  
ATOM 6296  C CB   . TYR A 1 19 ? 6.201   0.644   -1.947  1.00 0.00 ? 103 TYR A CB   6  
ATOM 6297  C CG   . TYR A 1 19 ? 5.772   1.893   -1.214  1.00 0.00 ? 103 TYR A CG   6  
ATOM 6298  C CD1  . TYR A 1 19 ? 6.381   2.259   -0.021  1.00 0.00 ? 103 TYR A CD1  6  
ATOM 6299  C CD2  . TYR A 1 19 ? 4.753   2.696   -1.703  1.00 0.00 ? 103 TYR A CD2  6  
ATOM 6300  C CE1  . TYR A 1 19 ? 5.988   3.393   0.664   1.00 0.00 ? 103 TYR A CE1  6  
ATOM 6301  C CE2  . TYR A 1 19 ? 4.353   3.832   -1.024  1.00 0.00 ? 103 TYR A CE2  6  
ATOM 6302  C CZ   . TYR A 1 19 ? 4.972   4.176   0.157   1.00 0.00 ? 103 TYR A CZ   6  
ATOM 6303  O OH   . TYR A 1 19 ? 4.573   5.304   0.836   1.00 0.00 ? 103 TYR A OH   6  
ATOM 6304  H H    . TYR A 1 19 ? 6.620   1.161   -4.584  1.00 0.00 ? 103 TYR A H    6  
ATOM 6305  H HA   . TYR A 1 19 ? 8.193   1.395   -2.110  1.00 0.00 ? 103 TYR A HA   6  
ATOM 6306  H HB2  . TYR A 1 19 ? 5.421   0.387   -2.647  1.00 0.00 ? 103 TYR A HB2  6  
ATOM 6307  H HB3  . TYR A 1 19 ? 6.299   -0.149  -1.220  1.00 0.00 ? 103 TYR A HB3  6  
ATOM 6308  H HD1  . TYR A 1 19 ? 7.177   1.645   0.373   1.00 0.00 ? 103 TYR A HD1  6  
ATOM 6309  H HD2  . TYR A 1 19 ? 4.272   2.426   -2.629  1.00 0.00 ? 103 TYR A HD2  6  
ATOM 6310  H HE1  . TYR A 1 19 ? 6.475   3.662   1.588   1.00 0.00 ? 103 TYR A HE1  6  
ATOM 6311  H HE2  . TYR A 1 19 ? 3.556   4.445   -1.422  1.00 0.00 ? 103 TYR A HE2  6  
ATOM 6312  H HH   . TYR A 1 19 ? 5.343   5.820   1.084   1.00 0.00 ? 103 TYR A HH   6  
ATOM 6313  N N    . GLU A 1 20 ? 9.189   -0.845  -2.118  1.00 0.00 ? 104 GLU A N    6  
ATOM 6314  C CA   . GLU A 1 20 ? 9.818   -2.152  -2.089  1.00 0.00 ? 104 GLU A CA   6  
ATOM 6315  C C    . GLU A 1 20 ? 9.222   -2.962  -0.943  1.00 0.00 ? 104 GLU A C    6  
ATOM 6316  O O    . GLU A 1 20 ? 9.527   -2.715  0.227   1.00 0.00 ? 104 GLU A O    6  
ATOM 6317  C CB   . GLU A 1 20 ? 11.330  -2.002  -1.909  1.00 0.00 ? 104 GLU A CB   6  
ATOM 6318  C CG   . GLU A 1 20 ? 12.088  -3.316  -1.931  1.00 0.00 ? 104 GLU A CG   6  
ATOM 6319  C CD   . GLU A 1 20 ? 13.576  -3.125  -1.734  1.00 0.00 ? 104 GLU A CD   6  
ATOM 6320  O OE1  . GLU A 1 20 ? 14.264  -2.738  -2.707  1.00 0.00 ? 104 GLU A OE1  6  
ATOM 6321  O OE2  . GLU A 1 20 ? 14.067  -3.342  -0.608  1.00 0.00 ? 104 GLU A OE2  6  
ATOM 6322  H H    . GLU A 1 20 ? 9.538   -0.137  -1.534  1.00 0.00 ? 104 GLU A H    6  
ATOM 6323  H HA   . GLU A 1 20 ? 9.613   -2.652  -3.024  1.00 0.00 ? 104 GLU A HA   6  
ATOM 6324  H HB2  . GLU A 1 20 ? 11.712  -1.377  -2.702  1.00 0.00 ? 104 GLU A HB2  6  
ATOM 6325  H HB3  . GLU A 1 20 ? 11.519  -1.519  -0.963  1.00 0.00 ? 104 GLU A HB3  6  
ATOM 6326  H HG2  . GLU A 1 20 ? 11.714  -3.948  -1.140  1.00 0.00 ? 104 GLU A HG2  6  
ATOM 6327  H HG3  . GLU A 1 20 ? 11.925  -3.797  -2.884  1.00 0.00 ? 104 GLU A HG3  6  
ATOM 6328  N N    . VAL A 1 21 ? 8.337   -3.890  -1.274  1.00 0.00 ? 105 VAL A N    6  
ATOM 6329  C CA   . VAL A 1 21 ? 7.622   -4.652  -0.260  1.00 0.00 ? 105 VAL A CA   6  
ATOM 6330  C C    . VAL A 1 21 ? 7.714   -6.147  -0.530  1.00 0.00 ? 105 VAL A C    6  
ATOM 6331  O O    . VAL A 1 21 ? 7.593   -6.589  -1.664  1.00 0.00 ? 105 VAL A O    6  
ATOM 6332  C CB   . VAL A 1 21 ? 6.135   -4.236  -0.193  1.00 0.00 ? 105 VAL A CB   6  
ATOM 6333  C CG1  . VAL A 1 21 ? 6.010   -2.763  0.151   1.00 0.00 ? 105 VAL A CG1  6  
ATOM 6334  C CG2  . VAL A 1 21 ? 5.423   -4.530  -1.507  1.00 0.00 ? 105 VAL A CG2  6  
ATOM 6335  H H    . VAL A 1 21 ? 8.160   -4.073  -2.227  1.00 0.00 ? 105 VAL A H    6  
ATOM 6336  H HA   . VAL A 1 21 ? 8.077   -4.440  0.697   1.00 0.00 ? 105 VAL A HA   6  
ATOM 6337  H HB   . VAL A 1 21 ? 5.657   -4.807  0.588   1.00 0.00 ? 105 VAL A HB   6  
ATOM 6338  H HG11 . VAL A 1 21 ? 6.506   -2.175  -0.610  1.00 0.00 ? 105 VAL A HG11 6  
ATOM 6339  H HG12 . VAL A 1 21 ? 6.467   -2.574  1.110   1.00 0.00 ? 105 VAL A HG12 6  
ATOM 6340  H HG13 . VAL A 1 21 ? 4.965   -2.492  0.189   1.00 0.00 ? 105 VAL A HG13 6  
ATOM 6341  H HG21 . VAL A 1 21 ? 4.393   -4.214  -1.438  1.00 0.00 ? 105 VAL A HG21 6  
ATOM 6342  H HG22 . VAL A 1 21 ? 5.463   -5.592  -1.709  1.00 0.00 ? 105 VAL A HG22 6  
ATOM 6343  H HG23 . VAL A 1 21 ? 5.909   -3.994  -2.308  1.00 0.00 ? 105 VAL A HG23 6  
ATOM 6344  N N    . ARG A 1 22 ? 7.933   -6.928  0.510   1.00 0.00 ? 106 ARG A N    6  
ATOM 6345  C CA   . ARG A 1 22 ? 8.007   -8.370  0.357   1.00 0.00 ? 106 ARG A CA   6  
ATOM 6346  C C    . ARG A 1 22 ? 6.610   -8.977  0.354   1.00 0.00 ? 106 ARG A C    6  
ATOM 6347  O O    . ARG A 1 22 ? 5.693   -8.452  0.982   1.00 0.00 ? 106 ARG A O    6  
ATOM 6348  C CB   . ARG A 1 22 ? 8.853   -8.979  1.474   1.00 0.00 ? 106 ARG A CB   6  
ATOM 6349  C CG   . ARG A 1 22 ? 10.316  -8.588  1.390   1.00 0.00 ? 106 ARG A CG   6  
ATOM 6350  C CD   . ARG A 1 22 ? 11.106  -9.109  2.577   1.00 0.00 ? 106 ARG A CD   6  
ATOM 6351  N NE   . ARG A 1 22 ? 10.700  -8.471  3.826   1.00 0.00 ? 106 ARG A NE   6  
ATOM 6352  C CZ   . ARG A 1 22 ? 11.549  -7.888  4.671   1.00 0.00 ? 106 ARG A CZ   6  
ATOM 6353  N NH1  . ARG A 1 22 ? 12.844  -7.835  4.382   1.00 0.00 ? 106 ARG A NH1  6  
ATOM 6354  N NH2  . ARG A 1 22 ? 11.100  -7.344  5.793   1.00 0.00 ? 106 ARG A NH2  6  
ATOM 6355  H H    . ARG A 1 22 ? 8.037   -6.527  1.403   1.00 0.00 ? 106 ARG A H    6  
ATOM 6356  H HA   . ARG A 1 22 ? 8.478   -8.578  -0.592  1.00 0.00 ? 106 ARG A HA   6  
ATOM 6357  H HB2  . ARG A 1 22 ? 8.467   -8.650  2.425   1.00 0.00 ? 106 ARG A HB2  6  
ATOM 6358  H HB3  . ARG A 1 22 ? 8.785   -10.055 1.418   1.00 0.00 ? 106 ARG A HB3  6  
ATOM 6359  H HG2  . ARG A 1 22 ? 10.736  -8.999  0.483   1.00 0.00 ? 106 ARG A HG2  6  
ATOM 6360  H HG3  . ARG A 1 22 ? 10.386  -7.511  1.366   1.00 0.00 ? 106 ARG A HG3  6  
ATOM 6361  H HD2  . ARG A 1 22 ? 10.947  -10.175 2.662   1.00 0.00 ? 106 ARG A HD2  6  
ATOM 6362  H HD3  . ARG A 1 22 ? 12.156  -8.917  2.410   1.00 0.00 ? 106 ARG A HD3  6  
ATOM 6363  H HE   . ARG A 1 22 ? 9.745   -8.484  4.051   1.00 0.00 ? 106 ARG A HE   6  
ATOM 6364  H HH11 . ARG A 1 22 ? 13.191  -8.231  3.521   1.00 0.00 ? 106 ARG A HH11 6  
ATOM 6365  H HH12 . ARG A 1 22 ? 13.490  -7.402  5.025   1.00 0.00 ? 106 ARG A HH12 6  
ATOM 6366  H HH21 . ARG A 1 22 ? 10.115  -7.366  6.013   1.00 0.00 ? 106 ARG A HH21 6  
ATOM 6367  H HH22 . ARG A 1 22 ? 11.743  -6.903  6.439   1.00 0.00 ? 106 ARG A HH22 6  
ATOM 6368  N N    . LEU A 1 23 ? 6.453   -10.088 -0.357  1.00 0.00 ? 107 LEU A N    6  
ATOM 6369  C CA   . LEU A 1 23 ? 5.155   -10.748 -0.473  1.00 0.00 ? 107 LEU A CA   6  
ATOM 6370  C C    . LEU A 1 23 ? 4.736   -11.366 0.858   1.00 0.00 ? 107 LEU A C    6  
ATOM 6371  O O    . LEU A 1 23 ? 3.560   -11.660 1.077   1.00 0.00 ? 107 LEU A O    6  
ATOM 6372  C CB   . LEU A 1 23 ? 5.182   -11.827 -1.562  1.00 0.00 ? 107 LEU A CB   6  
ATOM 6373  C CG   . LEU A 1 23 ? 5.324   -11.321 -3.006  1.00 0.00 ? 107 LEU A CG   6  
ATOM 6374  C CD1  . LEU A 1 23 ? 6.726   -10.800 -3.280  1.00 0.00 ? 107 LEU A CD1  6  
ATOM 6375  C CD2  . LEU A 1 23 ? 4.969   -12.422 -3.989  1.00 0.00 ? 107 LEU A CD2  6  
ATOM 6376  H H    . LEU A 1 23 ? 7.228   -10.472 -0.823  1.00 0.00 ? 107 LEU A H    6  
ATOM 6377  H HA   . LEU A 1 23 ? 4.429   -9.994  -0.747  1.00 0.00 ? 107 LEU A HA   6  
ATOM 6378  H HB2  . LEU A 1 23 ? 6.007   -12.491 -1.356  1.00 0.00 ? 107 LEU A HB2  6  
ATOM 6379  H HB3  . LEU A 1 23 ? 4.264   -12.392 -1.496  1.00 0.00 ? 107 LEU A HB3  6  
ATOM 6380  H HG   . LEU A 1 23 ? 4.632   -10.503 -3.158  1.00 0.00 ? 107 LEU A HG   6  
ATOM 6381  H HD11 . LEU A 1 23 ? 7.439   -11.599 -3.141  1.00 0.00 ? 107 LEU A HD11 6  
ATOM 6382  H HD12 . LEU A 1 23 ? 6.951   -9.994  -2.597  1.00 0.00 ? 107 LEU A HD12 6  
ATOM 6383  H HD13 . LEU A 1 23 ? 6.783   -10.438 -4.296  1.00 0.00 ? 107 LEU A HD13 6  
ATOM 6384  H HD21 . LEU A 1 23 ? 3.948   -12.733 -3.828  1.00 0.00 ? 107 LEU A HD21 6  
ATOM 6385  H HD22 . LEU A 1 23 ? 5.631   -13.264 -3.841  1.00 0.00 ? 107 LEU A HD22 6  
ATOM 6386  H HD23 . LEU A 1 23 ? 5.077   -12.051 -4.998  1.00 0.00 ? 107 LEU A HD23 6  
ATOM 6387  N N    . THR A 1 24 ? 5.704   -11.552 1.743   1.00 0.00 ? 108 THR A N    6  
ATOM 6388  C CA   . THR A 1 24 ? 5.453   -12.125 3.057   1.00 0.00 ? 108 THR A CA   6  
ATOM 6389  C C    . THR A 1 24 ? 4.902   -11.060 4.020   1.00 0.00 ? 108 THR A C    6  
ATOM 6390  O O    . THR A 1 24 ? 4.638   -11.331 5.194   1.00 0.00 ? 108 THR A O    6  
ATOM 6391  C CB   . THR A 1 24 ? 6.755   -12.737 3.622   1.00 0.00 ? 108 THR A CB   6  
ATOM 6392  O OG1  . THR A 1 24 ? 7.399   -13.505 2.595   1.00 0.00 ? 108 THR A OG1  6  
ATOM 6393  C CG2  . THR A 1 24 ? 6.480   -13.637 4.819   1.00 0.00 ? 108 THR A CG2  6  
ATOM 6394  H H    . THR A 1 24 ? 6.622   -11.307 1.503   1.00 0.00 ? 108 THR A H    6  
ATOM 6395  H HA   . THR A 1 24 ? 4.725   -12.913 2.946   1.00 0.00 ? 108 THR A HA   6  
ATOM 6396  H HB   . THR A 1 24 ? 7.410   -11.935 3.929   1.00 0.00 ? 108 THR A HB   6  
ATOM 6397  H HG1  . THR A 1 24 ? 8.271   -13.123 2.403   1.00 0.00 ? 108 THR A HG1  6  
ATOM 6398  H HG21 . THR A 1 24 ? 7.414   -14.013 5.207   1.00 0.00 ? 108 THR A HG21 6  
ATOM 6399  H HG22 . THR A 1 24 ? 5.857   -14.463 4.512   1.00 0.00 ? 108 THR A HG22 6  
ATOM 6400  H HG23 . THR A 1 24 ? 5.973   -13.069 5.586   1.00 0.00 ? 108 THR A HG23 6  
ATOM 6401  N N    . GLN A 1 25 ? 4.729   -9.843  3.515   1.00 0.00 ? 109 GLN A N    6  
ATOM 6402  C CA   . GLN A 1 25 ? 4.169   -8.758  4.311   1.00 0.00 ? 109 GLN A CA   6  
ATOM 6403  C C    . GLN A 1 25 ? 2.663   -8.679  4.118   1.00 0.00 ? 109 GLN A C    6  
ATOM 6404  O O    . GLN A 1 25 ? 2.140   -9.066  3.074   1.00 0.00 ? 109 GLN A O    6  
ATOM 6405  C CB   . GLN A 1 25 ? 4.781   -7.411  3.919   1.00 0.00 ? 109 GLN A CB   6  
ATOM 6406  C CG   . GLN A 1 25 ? 6.291   -7.348  4.045   1.00 0.00 ? 109 GLN A CG   6  
ATOM 6407  C CD   . GLN A 1 25 ? 6.853   -6.009  3.601   1.00 0.00 ? 109 GLN A CD   6  
ATOM 6408  O OE1  . GLN A 1 25 ? 7.978   -5.927  3.109   1.00 0.00 ? 109 GLN A OE1  6  
ATOM 6409  N NE2  . GLN A 1 25 ? 6.072   -4.949  3.760   1.00 0.00 ? 109 GLN A NE2  6  
ATOM 6410  H H    . GLN A 1 25 ? 4.974   -9.674  2.581   1.00 0.00 ? 109 GLN A H    6  
ATOM 6411  H HA   . GLN A 1 25 ? 4.384   -8.957  5.351   1.00 0.00 ? 109 GLN A HA   6  
ATOM 6412  H HB2  . GLN A 1 25 ? 4.520   -7.195  2.895   1.00 0.00 ? 109 GLN A HB2  6  
ATOM 6413  H HB3  . GLN A 1 25 ? 4.357   -6.646  4.553   1.00 0.00 ? 109 GLN A HB3  6  
ATOM 6414  H HG2  . GLN A 1 25 ? 6.562   -7.509  5.078   1.00 0.00 ? 109 GLN A HG2  6  
ATOM 6415  H HG3  . GLN A 1 25 ? 6.725   -8.124  3.434   1.00 0.00 ? 109 GLN A HG3  6  
ATOM 6416  H HE21 . GLN A 1 25 ? 5.186   -5.081  4.151   1.00 0.00 ? 109 GLN A HE21 6  
ATOM 6417  H HE22 . GLN A 1 25 ? 6.416   -4.077  3.477   1.00 0.00 ? 109 GLN A HE22 6  
ATOM 6418  N N    . THR A 1 26 ? 1.975   -8.177  5.126   1.00 0.00 ? 110 THR A N    6  
ATOM 6419  C CA   . THR A 1 26 ? 0.555   -7.894  5.019   1.00 0.00 ? 110 THR A CA   6  
ATOM 6420  C C    . THR A 1 26 ? 0.346   -6.462  4.532   1.00 0.00 ? 110 THR A C    6  
ATOM 6421  O O    . THR A 1 26 ? 1.238   -5.619  4.670   1.00 0.00 ? 110 THR A O    6  
ATOM 6422  C CB   . THR A 1 26 ? -0.150  -8.107  6.374   1.00 0.00 ? 110 THR A CB   6  
ATOM 6423  O OG1  . THR A 1 26 ? 0.719   -7.714  7.446   1.00 0.00 ? 110 THR A OG1  6  
ATOM 6424  C CG2  . THR A 1 26 ? -0.552  -9.564  6.549   1.00 0.00 ? 110 THR A CG2  6  
ATOM 6425  H H    . THR A 1 26 ? 2.436   -7.988  5.975   1.00 0.00 ? 110 THR A H    6  
ATOM 6426  H HA   . THR A 1 26 ? 0.129   -8.577  4.301   1.00 0.00 ? 110 THR A HA   6  
ATOM 6427  H HB   . THR A 1 26 ? -1.041  -7.498  6.398   1.00 0.00 ? 110 THR A HB   6  
ATOM 6428  H HG1  . THR A 1 26 ? 0.507   -6.812  7.729   1.00 0.00 ? 110 THR A HG1  6  
ATOM 6429  H HG21 . THR A 1 26 ? 0.330   -10.189 6.526   1.00 0.00 ? 110 THR A HG21 6  
ATOM 6430  H HG22 . THR A 1 26 ? -1.217  -9.851  5.748   1.00 0.00 ? 110 THR A HG22 6  
ATOM 6431  H HG23 . THR A 1 26 ? -1.057  -9.689  7.496   1.00 0.00 ? 110 THR A HG23 6  
ATOM 6432  N N    . VAL A 1 27 ? -0.819  -6.189  3.950   1.00 0.00 ? 111 VAL A N    6  
ATOM 6433  C CA   . VAL A 1 27 ? -1.124  -4.850  3.446   1.00 0.00 ? 111 VAL A CA   6  
ATOM 6434  C C    . VAL A 1 27 ? -1.048  -3.815  4.569   1.00 0.00 ? 111 VAL A C    6  
ATOM 6435  O O    . VAL A 1 27 ? -0.684  -2.658  4.344   1.00 0.00 ? 111 VAL A O    6  
ATOM 6436  C CB   . VAL A 1 27 ? -2.519  -4.796  2.790   1.00 0.00 ? 111 VAL A CB   6  
ATOM 6437  C CG1  . VAL A 1 27 ? -2.802  -3.407  2.234   1.00 0.00 ? 111 VAL A CG1  6  
ATOM 6438  C CG2  . VAL A 1 27 ? -2.640  -5.848  1.695   1.00 0.00 ? 111 VAL A CG2  6  
ATOM 6439  H H    . VAL A 1 27 ? -1.485  -6.906  3.847   1.00 0.00 ? 111 VAL A H    6  
ATOM 6440  H HA   . VAL A 1 27 ? -0.388  -4.601  2.696   1.00 0.00 ? 111 VAL A HA   6  
ATOM 6441  H HB   . VAL A 1 27 ? -3.258  -5.009  3.547   1.00 0.00 ? 111 VAL A HB   6  
ATOM 6442  H HG11 . VAL A 1 27 ? -2.797  -2.687  3.041   1.00 0.00 ? 111 VAL A HG11 6  
ATOM 6443  H HG12 . VAL A 1 27 ? -3.765  -3.400  1.750   1.00 0.00 ? 111 VAL A HG12 6  
ATOM 6444  H HG13 . VAL A 1 27 ? -2.036  -3.145  1.518   1.00 0.00 ? 111 VAL A HG13 6  
ATOM 6445  H HG21 . VAL A 1 27 ? -2.497  -6.831  2.122   1.00 0.00 ? 111 VAL A HG21 6  
ATOM 6446  H HG22 . VAL A 1 27 ? -1.889  -5.671  0.940   1.00 0.00 ? 111 VAL A HG22 6  
ATOM 6447  H HG23 . VAL A 1 27 ? -3.621  -5.793  1.246   1.00 0.00 ? 111 VAL A HG23 6  
ATOM 6448  N N    . ALA A 1 28 ? -1.366  -4.255  5.782   1.00 0.00 ? 112 ALA A N    6  
ATOM 6449  C CA   . ALA A 1 28 ? -1.290  -3.404  6.961   1.00 0.00 ? 112 ALA A CA   6  
ATOM 6450  C C    . ALA A 1 28 ? 0.102   -2.795  7.120   1.00 0.00 ? 112 ALA A C    6  
ATOM 6451  O O    . ALA A 1 28 ? 0.241   -1.625  7.473   1.00 0.00 ? 112 ALA A O    6  
ATOM 6452  C CB   . ALA A 1 28 ? -1.653  -4.203  8.203   1.00 0.00 ? 112 ALA A CB   6  
ATOM 6453  H H    . ALA A 1 28 ? -1.674  -5.182  5.883   1.00 0.00 ? 112 ALA A H    6  
ATOM 6454  H HA   . ALA A 1 28 ? -2.013  -2.608  6.849   1.00 0.00 ? 112 ALA A HA   6  
ATOM 6455  H HB1  . ALA A 1 28 ? -1.658  -3.551  9.063   1.00 0.00 ? 112 ALA A HB1  6  
ATOM 6456  H HB2  . ALA A 1 28 ? -0.924  -4.988  8.349   1.00 0.00 ? 112 ALA A HB2  6  
ATOM 6457  H HB3  . ALA A 1 28 ? -2.630  -4.640  8.075   1.00 0.00 ? 112 ALA A HB3  6  
ATOM 6458  N N    . HIS A 1 29 ? 1.129   -3.593  6.835   1.00 0.00 ? 113 HIS A N    6  
ATOM 6459  C CA   . HIS A 1 29 ? 2.511   -3.149  6.981   1.00 0.00 ? 113 HIS A CA   6  
ATOM 6460  C C    . HIS A 1 29 ? 2.811   -2.033  5.988   1.00 0.00 ? 113 HIS A C    6  
ATOM 6461  O O    . HIS A 1 29 ? 3.528   -1.089  6.301   1.00 0.00 ? 113 HIS A O    6  
ATOM 6462  C CB   . HIS A 1 29 ? 3.479   -4.323  6.767   1.00 0.00 ? 113 HIS A CB   6  
ATOM 6463  C CG   . HIS A 1 29 ? 4.866   -4.080  7.303   1.00 0.00 ? 113 HIS A CG   6  
ATOM 6464  N ND1  . HIS A 1 29 ? 5.370   -4.734  8.408   1.00 0.00 ? 113 HIS A ND1  6  
ATOM 6465  C CD2  . HIS A 1 29 ? 5.858   -3.264  6.872   1.00 0.00 ? 113 HIS A CD2  6  
ATOM 6466  C CE1  . HIS A 1 29 ? 6.606   -4.329  8.633   1.00 0.00 ? 113 HIS A CE1  6  
ATOM 6467  N NE2  . HIS A 1 29 ? 6.927   -3.435  7.715   1.00 0.00 ? 113 HIS A NE2  6  
ATOM 6468  H H    . HIS A 1 29 ? 0.950   -4.505  6.525   1.00 0.00 ? 113 HIS A H    6  
ATOM 6469  H HA   . HIS A 1 29 ? 2.636   -2.767  7.984   1.00 0.00 ? 113 HIS A HA   6  
ATOM 6470  H HB2  . HIS A 1 29 ? 3.083   -5.198  7.259   1.00 0.00 ? 113 HIS A HB2  6  
ATOM 6471  H HB3  . HIS A 1 29 ? 3.561   -4.522  5.708   1.00 0.00 ? 113 HIS A HB3  6  
ATOM 6472  H HD1  . HIS A 1 29 ? 4.887   -5.394  8.960   1.00 0.00 ? 113 HIS A HD1  6  
ATOM 6473  H HD2  . HIS A 1 29 ? 5.814   -2.599  6.018   1.00 0.00 ? 113 HIS A HD2  6  
ATOM 6474  H HE1  . HIS A 1 29 ? 7.249   -4.674  9.431   1.00 0.00 ? 113 HIS A HE1  6  
ATOM 6475  H HE2  . HIS A 1 29 ? 7.723   -2.843  7.756   1.00 0.00 ? 113 HIS A HE2  6  
ATOM 6476  N N    . LEU A 1 30 ? 2.244   -2.149  4.794   1.00 0.00 ? 114 LEU A N    6  
ATOM 6477  C CA   . LEU A 1 30 ? 2.419   -1.140  3.756   1.00 0.00 ? 114 LEU A CA   6  
ATOM 6478  C C    . LEU A 1 30 ? 1.734   0.158   4.149   1.00 0.00 ? 114 LEU A C    6  
ATOM 6479  O O    . LEU A 1 30 ? 2.339   1.231   4.101   1.00 0.00 ? 114 LEU A O    6  
ATOM 6480  C CB   . LEU A 1 30 ? 1.848   -1.640  2.429   1.00 0.00 ? 114 LEU A CB   6  
ATOM 6481  C CG   . LEU A 1 30 ? 1.846   -0.614  1.291   1.00 0.00 ? 114 LEU A CG   6  
ATOM 6482  C CD1  . LEU A 1 30 ? 3.263   -0.275  0.861   1.00 0.00 ? 114 LEU A CD1  6  
ATOM 6483  C CD2  . LEU A 1 30 ? 1.034   -1.128  0.113   1.00 0.00 ? 114 LEU A CD2  6  
ATOM 6484  H H    . LEU A 1 30 ? 1.682   -2.932  4.608   1.00 0.00 ? 114 LEU A H    6  
ATOM 6485  H HA   . LEU A 1 30 ? 3.476   -0.958  3.639   1.00 0.00 ? 114 LEU A HA   6  
ATOM 6486  H HB2  . LEU A 1 30 ? 2.430   -2.495  2.115   1.00 0.00 ? 114 LEU A HB2  6  
ATOM 6487  H HB3  . LEU A 1 30 ? 0.831   -1.961  2.597   1.00 0.00 ? 114 LEU A HB3  6  
ATOM 6488  H HG   . LEU A 1 30 ? 1.383   0.299   1.641   1.00 0.00 ? 114 LEU A HG   6  
ATOM 6489  H HD11 . LEU A 1 30 ? 3.233   0.478   0.090   1.00 0.00 ? 114 LEU A HD11 6  
ATOM 6490  H HD12 . LEU A 1 30 ? 3.744   -1.163  0.479   1.00 0.00 ? 114 LEU A HD12 6  
ATOM 6491  H HD13 . LEU A 1 30 ? 3.817   0.097   1.710   1.00 0.00 ? 114 LEU A HD13 6  
ATOM 6492  H HD21 . LEU A 1 30 ? 1.446   -2.067  -0.227  1.00 0.00 ? 114 LEU A HD21 6  
ATOM 6493  H HD22 . LEU A 1 30 ? 1.070   -0.406  -0.691  1.00 0.00 ? 114 LEU A HD22 6  
ATOM 6494  H HD23 . LEU A 1 30 ? 0.009   -1.274  0.420   1.00 0.00 ? 114 LEU A HD23 6  
ATOM 6495  N N    . LYS A 1 31 ? 0.473   0.048   4.542   1.00 0.00 ? 115 LYS A N    6  
ATOM 6496  C CA   . LYS A 1 31 ? -0.315  1.215   4.907   1.00 0.00 ? 115 LYS A CA   6  
ATOM 6497  C C    . LYS A 1 31 ? 0.276   1.917   6.120   1.00 0.00 ? 115 LYS A C    6  
ATOM 6498  O O    . LYS A 1 31 ? 0.309   3.139   6.163   1.00 0.00 ? 115 LYS A O    6  
ATOM 6499  C CB   . LYS A 1 31 ? -1.773  0.821   5.160   1.00 0.00 ? 115 LYS A CB   6  
ATOM 6500  C CG   . LYS A 1 31 ? -2.654  1.982   5.599   1.00 0.00 ? 115 LYS A CG   6  
ATOM 6501  C CD   . LYS A 1 31 ? -4.123  1.662   5.416   1.00 0.00 ? 115 LYS A CD   6  
ATOM 6502  C CE   . LYS A 1 31 ? -5.018  2.731   6.022   1.00 0.00 ? 115 LYS A CE   6  
ATOM 6503  N NZ   . LYS A 1 31 ? -4.909  2.780   7.505   1.00 0.00 ? 115 LYS A NZ   6  
ATOM 6504  H H    . LYS A 1 31 ? 0.059   -0.844  4.586   1.00 0.00 ? 115 LYS A H    6  
ATOM 6505  H HA   . LYS A 1 31 ? -0.286  1.903   4.073   1.00 0.00 ? 115 LYS A HA   6  
ATOM 6506  H HB2  . LYS A 1 31 ? -2.184  0.410   4.250   1.00 0.00 ? 115 LYS A HB2  6  
ATOM 6507  H HB3  . LYS A 1 31 ? -1.802  0.064   5.931   1.00 0.00 ? 115 LYS A HB3  6  
ATOM 6508  H HG2  . LYS A 1 31 ? -2.469  2.189   6.642   1.00 0.00 ? 115 LYS A HG2  6  
ATOM 6509  H HG3  . LYS A 1 31 ? -2.407  2.852   5.008   1.00 0.00 ? 115 LYS A HG3  6  
ATOM 6510  H HD2  . LYS A 1 31 ? -4.335  1.594   4.361   1.00 0.00 ? 115 LYS A HD2  6  
ATOM 6511  H HD3  . LYS A 1 31 ? -4.336  0.716   5.890   1.00 0.00 ? 115 LYS A HD3  6  
ATOM 6512  H HE2  . LYS A 1 31 ? -4.732  3.691   5.621   1.00 0.00 ? 115 LYS A HE2  6  
ATOM 6513  H HE3  . LYS A 1 31 ? -6.044  2.519   5.753   1.00 0.00 ? 115 LYS A HE3  6  
ATOM 6514  H HZ1  . LYS A 1 31 ? -5.857  2.868   7.932   1.00 0.00 ? 115 LYS A HZ1  6  
ATOM 6515  H HZ2  . LYS A 1 31 ? -4.334  3.602   7.798   1.00 0.00 ? 115 LYS A HZ2  6  
ATOM 6516  H HZ3  . LYS A 1 31 ? -4.458  1.908   7.864   1.00 0.00 ? 115 LYS A HZ3  6  
ATOM 6517  N N    . GLN A 1 32 ? 0.770   1.154   7.086   1.00 0.00 ? 116 GLN A N    6  
ATOM 6518  C CA   . GLN A 1 32 ? 1.348   1.744   8.288   1.00 0.00 ? 116 GLN A CA   6  
ATOM 6519  C C    . GLN A 1 32 ? 2.633   2.512   7.962   1.00 0.00 ? 116 GLN A C    6  
ATOM 6520  O O    . GLN A 1 32 ? 2.962   3.481   8.642   1.00 0.00 ? 116 GLN A O    6  
ATOM 6521  C CB   . GLN A 1 32 ? 1.607   0.668   9.348   1.00 0.00 ? 116 GLN A CB   6  
ATOM 6522  C CG   . GLN A 1 32 ? 2.043   1.217   10.706  1.00 0.00 ? 116 GLN A CG   6  
ATOM 6523  C CD   . GLN A 1 32 ? 0.936   1.945   11.468  1.00 0.00 ? 116 GLN A CD   6  
ATOM 6524  O OE1  . GLN A 1 32 ? 0.916   1.945   12.701  1.00 0.00 ? 116 GLN A OE1  6  
ATOM 6525  N NE2  . GLN A 1 32 ? 0.010   2.573   10.757  1.00 0.00 ? 116 GLN A NE2  6  
ATOM 6526  H H    . GLN A 1 32 ? 0.737   0.176   6.994   1.00 0.00 ? 116 GLN A H    6  
ATOM 6527  H HA   . GLN A 1 32 ? 0.626   2.449   8.680   1.00 0.00 ? 116 GLN A HA   6  
ATOM 6528  H HB2  . GLN A 1 32 ? 0.702   0.099   9.491   1.00 0.00 ? 116 GLN A HB2  6  
ATOM 6529  H HB3  . GLN A 1 32 ? 2.382   0.007   8.988   1.00 0.00 ? 116 GLN A HB3  6  
ATOM 6530  H HG2  . GLN A 1 32 ? 2.384   0.393   11.315  1.00 0.00 ? 116 GLN A HG2  6  
ATOM 6531  H HG3  . GLN A 1 32 ? 2.861   1.905   10.551  1.00 0.00 ? 116 GLN A HG3  6  
ATOM 6532  H HE21 . GLN A 1 32 ? 0.070   2.541   9.782   1.00 0.00 ? 116 GLN A HE21 6  
ATOM 6533  H HE22 . GLN A 1 32 ? -0.701  3.054   11.242  1.00 0.00 ? 116 GLN A HE22 6  
ATOM 6534  N N    . GLN A 1 33 ? 3.349   2.089   6.920   1.00 0.00 ? 117 GLN A N    6  
ATOM 6535  C CA   . GLN A 1 33 ? 4.501   2.848   6.442   1.00 0.00 ? 117 GLN A CA   6  
ATOM 6536  C C    . GLN A 1 33 ? 4.034   4.209   5.942   1.00 0.00 ? 117 GLN A C    6  
ATOM 6537  O O    . GLN A 1 33 ? 4.571   5.254   6.324   1.00 0.00 ? 117 GLN A O    6  
ATOM 6538  C CB   . GLN A 1 33 ? 5.234   2.111   5.313   1.00 0.00 ? 117 GLN A CB   6  
ATOM 6539  C CG   . GLN A 1 33 ? 5.864   0.791   5.728   1.00 0.00 ? 117 GLN A CG   6  
ATOM 6540  C CD   . GLN A 1 33 ? 6.648   0.137   4.601   1.00 0.00 ? 117 GLN A CD   6  
ATOM 6541  O OE1  . GLN A 1 33 ? 7.616   -0.589  4.837   1.00 0.00 ? 117 GLN A OE1  6  
ATOM 6542  N NE2  . GLN A 1 33 ? 6.244   0.387   3.363   1.00 0.00 ? 117 GLN A NE2  6  
ATOM 6543  H H    . GLN A 1 33 ? 3.097   1.255   6.467   1.00 0.00 ? 117 GLN A H    6  
ATOM 6544  H HA   . GLN A 1 33 ? 5.176   2.991   7.273   1.00 0.00 ? 117 GLN A HA   6  
ATOM 6545  H HB2  . GLN A 1 33 ? 4.529   1.910   4.519   1.00 0.00 ? 117 GLN A HB2  6  
ATOM 6546  H HB3  . GLN A 1 33 ? 6.015   2.753   4.931   1.00 0.00 ? 117 GLN A HB3  6  
ATOM 6547  H HG2  . GLN A 1 33 ? 6.535   0.973   6.555   1.00 0.00 ? 117 GLN A HG2  6  
ATOM 6548  H HG3  . GLN A 1 33 ? 5.082   0.116   6.043   1.00 0.00 ? 117 GLN A HG3  6  
ATOM 6549  H HE21 . GLN A 1 33 ? 5.466   0.975   3.241   1.00 0.00 ? 117 GLN A HE21 6  
ATOM 6550  H HE22 . GLN A 1 33 ? 6.748   -0.012  2.618   1.00 0.00 ? 117 GLN A HE22 6  
ATOM 6551  N N    . VAL A 1 34 ? 3.010   4.184   5.099   1.00 0.00 ? 118 VAL A N    6  
ATOM 6552  C CA   . VAL A 1 34 ? 2.403   5.403   4.598   1.00 0.00 ? 118 VAL A CA   6  
ATOM 6553  C C    . VAL A 1 34 ? 1.872   6.232   5.762   1.00 0.00 ? 118 VAL A C    6  
ATOM 6554  O O    . VAL A 1 34 ? 2.167   7.418   5.869   1.00 0.00 ? 118 VAL A O    6  
ATOM 6555  C CB   . VAL A 1 34 ? 1.248   5.103   3.621   1.00 0.00 ? 118 VAL A CB   6  
ATOM 6556  C CG1  . VAL A 1 34 ? 0.634   6.394   3.101   1.00 0.00 ? 118 VAL A CG1  6  
ATOM 6557  C CG2  . VAL A 1 34 ? 1.732   4.233   2.468   1.00 0.00 ? 118 VAL A CG2  6  
ATOM 6558  H H    . VAL A 1 34 ? 2.650   3.317   4.809   1.00 0.00 ? 118 VAL A H    6  
ATOM 6559  H HA   . VAL A 1 34 ? 3.160   5.970   4.075   1.00 0.00 ? 118 VAL A HA   6  
ATOM 6560  H HB   . VAL A 1 34 ? 0.485   4.559   4.154   1.00 0.00 ? 118 VAL A HB   6  
ATOM 6561  H HG11 . VAL A 1 34 ? 1.374   6.945   2.541   1.00 0.00 ? 118 VAL A HG11 6  
ATOM 6562  H HG12 . VAL A 1 34 ? 0.296   6.993   3.934   1.00 0.00 ? 118 VAL A HG12 6  
ATOM 6563  H HG13 . VAL A 1 34 ? -0.205  6.163   2.461   1.00 0.00 ? 118 VAL A HG13 6  
ATOM 6564  H HG21 . VAL A 1 34 ? 0.910   4.038   1.795   1.00 0.00 ? 118 VAL A HG21 6  
ATOM 6565  H HG22 . VAL A 1 34 ? 2.110   3.297   2.855   1.00 0.00 ? 118 VAL A HG22 6  
ATOM 6566  H HG23 . VAL A 1 34 ? 2.520   4.745   1.937   1.00 0.00 ? 118 VAL A HG23 6  
ATOM 6567  N N    . SER A 1 35 ? 1.122   5.577   6.642   1.00 0.00 ? 119 SER A N    6  
ATOM 6568  C CA   . SER A 1 35 ? 0.557   6.207   7.830   1.00 0.00 ? 119 SER A CA   6  
ATOM 6569  C C    . SER A 1 35 ? 1.646   6.782   8.740   1.00 0.00 ? 119 SER A C    6  
ATOM 6570  O O    . SER A 1 35 ? 1.379   7.656   9.568   1.00 0.00 ? 119 SER A O    6  
ATOM 6571  C CB   . SER A 1 35 ? -0.302  5.192   8.590   1.00 0.00 ? 119 SER A CB   6  
ATOM 6572  O OG   . SER A 1 35 ? -1.408  4.772   7.807   1.00 0.00 ? 119 SER A OG   6  
ATOM 6573  H H    . SER A 1 35 ? 0.925   4.626   6.478   1.00 0.00 ? 119 SER A H    6  
ATOM 6574  H HA   . SER A 1 35 ? -0.077  7.015   7.500   1.00 0.00 ? 119 SER A HA   6  
ATOM 6575  H HB2  . SER A 1 35 ? 0.297   4.329   8.827   1.00 0.00 ? 119 SER A HB2  6  
ATOM 6576  H HB3  . SER A 1 35 ? -0.666  5.635   9.502   1.00 0.00 ? 119 SER A HB3  6  
ATOM 6577  H HG   . SER A 1 35 ? -2.234  5.039   8.240   1.00 0.00 ? 119 SER A HG   6  
ATOM 6578  N N    . GLY A 1 36 ? 2.867   6.297   8.581   1.00 0.00 ? 120 GLY A N    6  
ATOM 6579  C CA   . GLY A 1 36 ? 3.978   6.834   9.338   1.00 0.00 ? 120 GLY A CA   6  
ATOM 6580  C C    . GLY A 1 36 ? 4.491   8.136   8.753   1.00 0.00 ? 120 GLY A C    6  
ATOM 6581  O O    . GLY A 1 36 ? 4.885   9.042   9.486   1.00 0.00 ? 120 GLY A O    6  
ATOM 6582  H H    . GLY A 1 36 ? 3.015   5.563   7.948   1.00 0.00 ? 120 GLY A H    6  
ATOM 6583  H HA2  . GLY A 1 36 ? 3.661   7.006   10.356  1.00 0.00 ? 120 GLY A HA2  6  
ATOM 6584  H HA3  . GLY A 1 36 ? 4.781   6.111   9.339   1.00 0.00 ? 120 GLY A HA3  6  
ATOM 6585  N N    . LEU A 1 37 ? 4.481   8.230   7.431   1.00 0.00 ? 121 LEU A N    6  
ATOM 6586  C CA   . LEU A 1 37 ? 5.004   9.410   6.744   1.00 0.00 ? 121 LEU A CA   6  
ATOM 6587  C C    . LEU A 1 37 ? 3.895   10.403  6.378   1.00 0.00 ? 121 LEU A C    6  
ATOM 6588  O O    . LEU A 1 37 ? 3.805   11.489  6.945   1.00 0.00 ? 121 LEU A O    6  
ATOM 6589  C CB   . LEU A 1 37 ? 5.760   8.985   5.481   1.00 0.00 ? 121 LEU A CB   6  
ATOM 6590  C CG   . LEU A 1 37 ? 6.919   8.013   5.715   1.00 0.00 ? 121 LEU A CG   6  
ATOM 6591  C CD1  . LEU A 1 37 ? 7.584   7.647   4.396   1.00 0.00 ? 121 LEU A CD1  6  
ATOM 6592  C CD2  . LEU A 1 37 ? 7.932   8.615   6.676   1.00 0.00 ? 121 LEU A CD2  6  
ATOM 6593  H H    . LEU A 1 37 ? 4.125   7.479   6.901   1.00 0.00 ? 121 LEU A H    6  
ATOM 6594  H HA   . LEU A 1 37 ? 5.697   9.896   7.414   1.00 0.00 ? 121 LEU A HA   6  
ATOM 6595  H HB2  . LEU A 1 37 ? 5.058   8.516   4.807   1.00 0.00 ? 121 LEU A HB2  6  
ATOM 6596  H HB3  . LEU A 1 37 ? 6.154   9.870   5.008   1.00 0.00 ? 121 LEU A HB3  6  
ATOM 6597  H HG   . LEU A 1 37 ? 6.536   7.106   6.157   1.00 0.00 ? 121 LEU A HG   6  
ATOM 6598  H HD11 . LEU A 1 37 ? 6.853   7.200   3.738   1.00 0.00 ? 121 LEU A HD11 6  
ATOM 6599  H HD12 . LEU A 1 37 ? 8.383   6.945   4.577   1.00 0.00 ? 121 LEU A HD12 6  
ATOM 6600  H HD13 . LEU A 1 37 ? 7.985   8.538   3.935   1.00 0.00 ? 121 LEU A HD13 6  
ATOM 6601  H HD21 . LEU A 1 37 ? 8.749   7.926   6.820   1.00 0.00 ? 121 LEU A HD21 6  
ATOM 6602  H HD22 . LEU A 1 37 ? 7.453   8.810   7.625   1.00 0.00 ? 121 LEU A HD22 6  
ATOM 6603  H HD23 . LEU A 1 37 ? 8.308   9.542   6.267   1.00 0.00 ? 121 LEU A HD23 6  
ATOM 6604  N N    . GLU A 1 38 ? 3.053   10.009  5.433   1.00 0.00 ? 122 GLU A N    6  
ATOM 6605  C CA   . GLU A 1 38 ? 1.980   10.860  4.916   1.00 0.00 ? 122 GLU A CA   6  
ATOM 6606  C C    . GLU A 1 38 ? 0.668   10.528  5.616   1.00 0.00 ? 122 GLU A C    6  
ATOM 6607  O O    . GLU A 1 38 ? -0.397  11.015  5.243   1.00 0.00 ? 122 GLU A O    6  
ATOM 6608  C CB   . GLU A 1 38 ? 1.826   10.654  3.408   1.00 0.00 ? 122 GLU A CB   6  
ATOM 6609  C CG   . GLU A 1 38 ? 3.094   10.924  2.614   1.00 0.00 ? 122 GLU A CG   6  
ATOM 6610  C CD   . GLU A 1 38 ? 3.524   12.374  2.672   1.00 0.00 ? 122 GLU A CD   6  
ATOM 6611  O OE1  . GLU A 1 38 ? 2.807   13.230  2.112   1.00 0.00 ? 122 GLU A OE1  6  
ATOM 6612  O OE2  . GLU A 1 38 ? 4.576   12.672  3.274   1.00 0.00 ? 122 GLU A OE2  6  
ATOM 6613  H H    . GLU A 1 38 ? 3.142   9.102   5.072   1.00 0.00 ? 122 GLU A H    6  
ATOM 6614  H HA   . GLU A 1 38 ? 2.236   11.891  5.112   1.00 0.00 ? 122 GLU A HA   6  
ATOM 6615  H HB2  . GLU A 1 38 ? 1.525   9.633   3.231   1.00 0.00 ? 122 GLU A HB2  6  
ATOM 6616  H HB3  . GLU A 1 38 ? 1.050   11.314  3.045   1.00 0.00 ? 122 GLU A HB3  6  
ATOM 6617  H HG2  . GLU A 1 38 ? 3.890   10.312  3.014   1.00 0.00 ? 122 GLU A HG2  6  
ATOM 6618  H HG3  . GLU A 1 38 ? 2.921   10.656  1.581   1.00 0.00 ? 122 GLU A HG3  6  
ATOM 6619  N N    . GLY A 1 39 ? 0.783   9.675   6.623   1.00 0.00 ? 123 GLY A N    6  
ATOM 6620  C CA   . GLY A 1 39 ? -0.353  9.067   7.296   1.00 0.00 ? 123 GLY A CA   6  
ATOM 6621  C C    . GLY A 1 39 ? -1.301  10.014  8.003   1.00 0.00 ? 123 GLY A C    6  
ATOM 6622  O O    . GLY A 1 39 ? -2.163  9.542   8.736   1.00 0.00 ? 123 GLY A O    6  
ATOM 6623  H H    . GLY A 1 39 ? 1.685   9.438   6.921   1.00 0.00 ? 123 GLY A H    6  
ATOM 6624  H HA2  . GLY A 1 39 ? -0.921  8.516   6.564   1.00 0.00 ? 123 GLY A HA2  6  
ATOM 6625  H HA3  . GLY A 1 39 ? 0.026   8.362   8.024   1.00 0.00 ? 123 GLY A HA3  6  
ATOM 6626  N N    . VAL A 1 40 ? -1.103  11.318  7.829   1.00 0.00 ? 124 VAL A N    6  
ATOM 6627  C CA   . VAL A 1 40 ? -1.964  12.362  8.403   1.00 0.00 ? 124 VAL A CA   6  
ATOM 6628  C C    . VAL A 1 40 ? -3.421  11.913  8.544   1.00 0.00 ? 124 VAL A C    6  
ATOM 6629  O O    . VAL A 1 40 ? -4.205  12.049  7.607   1.00 0.00 ? 124 VAL A O    6  
ATOM 6630  C CB   . VAL A 1 40 ? -1.945  13.614  7.512   1.00 0.00 ? 124 VAL A CB   6  
ATOM 6631  C CG1  . VAL A 1 40 ? -2.827  14.711  8.096   1.00 0.00 ? 124 VAL A CG1  6  
ATOM 6632  C CG2  . VAL A 1 40 ? -0.519  14.100  7.305   1.00 0.00 ? 124 VAL A CG2  6  
ATOM 6633  H H    . VAL A 1 40 ? -0.348  11.598  7.271   1.00 0.00 ? 124 VAL A H    6  
ATOM 6634  H HA   . VAL A 1 40 ? -1.574  12.629  9.375   1.00 0.00 ? 124 VAL A HA   6  
ATOM 6635  H HB   . VAL A 1 40 ? -2.348  13.334  6.547   1.00 0.00 ? 124 VAL A HB   6  
ATOM 6636  H HG11 . VAL A 1 40 ? -3.835  14.329  8.216   1.00 0.00 ? 124 VAL A HG11 6  
ATOM 6637  H HG12 . VAL A 1 40 ? -2.840  15.559  7.429   1.00 0.00 ? 124 VAL A HG12 6  
ATOM 6638  H HG13 . VAL A 1 40 ? -2.439  15.012  9.058   1.00 0.00 ? 124 VAL A HG13 6  
ATOM 6639  H HG21 . VAL A 1 40 ? -0.077  14.337  8.260   1.00 0.00 ? 124 VAL A HG21 6  
ATOM 6640  H HG22 . VAL A 1 40 ? -0.524  14.983  6.681   1.00 0.00 ? 124 VAL A HG22 6  
ATOM 6641  H HG23 . VAL A 1 40 ? 0.059   13.322  6.823   1.00 0.00 ? 124 VAL A HG23 6  
ATOM 6642  N N    . GLN A 1 41 ? -3.757  11.393  9.727   1.00 0.00 ? 125 GLN A N    6  
ATOM 6643  C CA   . GLN A 1 41 ? -5.082  10.842  10.014  1.00 0.00 ? 125 GLN A CA   6  
ATOM 6644  C C    . GLN A 1 41 ? -5.512  9.785   8.993   1.00 0.00 ? 125 GLN A C    6  
ATOM 6645  O O    . GLN A 1 41 ? -5.818  10.092  7.840   1.00 0.00 ? 125 GLN A O    6  
ATOM 6646  C CB   . GLN A 1 41 ? -6.138  11.946  10.094  1.00 0.00 ? 125 GLN A CB   6  
ATOM 6647  C CG   . GLN A 1 41 ? -5.974  12.862  11.294  1.00 0.00 ? 125 GLN A CG   6  
ATOM 6648  C CD   . GLN A 1 41 ? -7.150  13.800  11.478  1.00 0.00 ? 125 GLN A CD   6  
ATOM 6649  O OE1  . GLN A 1 41 ? -7.002  14.911  11.985  1.00 0.00 ? 125 GLN A OE1  6  
ATOM 6650  N NE2  . GLN A 1 41 ? -8.332  13.358  11.075  1.00 0.00 ? 125 GLN A NE2  6  
ATOM 6651  H H    . GLN A 1 41 ? -3.081  11.371  10.435  1.00 0.00 ? 125 GLN A H    6  
ATOM 6652  H HA   . GLN A 1 41 ? -5.022  10.365  10.981  1.00 0.00 ? 125 GLN A HA   6  
ATOM 6653  H HB2  . GLN A 1 41 ? -6.082  12.546  9.198   1.00 0.00 ? 125 GLN A HB2  6  
ATOM 6654  H HB3  . GLN A 1 41 ? -7.115  11.489  10.148  1.00 0.00 ? 125 GLN A HB3  6  
ATOM 6655  H HG2  . GLN A 1 41 ? -5.878  12.255  12.182  1.00 0.00 ? 125 GLN A HG2  6  
ATOM 6656  H HG3  . GLN A 1 41 ? -5.077  13.449  11.163  1.00 0.00 ? 125 GLN A HG3  6  
ATOM 6657  H HE21 . GLN A 1 41 ? -8.383  12.462  10.687  1.00 0.00 ? 125 GLN A HE21 6  
ATOM 6658  H HE22 . GLN A 1 41 ? -9.109  13.947  11.186  1.00 0.00 ? 125 GLN A HE22 6  
ATOM 6659  N N    . ASP A 1 42 ? -5.594  8.538   9.446   1.00 0.00 ? 126 ASP A N    6  
ATOM 6660  C CA   . ASP A 1 42 ? -6.049  7.433   8.599   1.00 0.00 ? 126 ASP A CA   6  
ATOM 6661  C C    . ASP A 1 42 ? -7.500  7.646   8.165   1.00 0.00 ? 126 ASP A C    6  
ATOM 6662  O O    . ASP A 1 42 ? -8.056  6.863   7.397   1.00 0.00 ? 126 ASP A O    6  
ATOM 6663  C CB   . ASP A 1 42 ? -5.931  6.095   9.335   1.00 0.00 ? 126 ASP A CB   6  
ATOM 6664  C CG   . ASP A 1 42 ? -4.497  5.677   9.594   1.00 0.00 ? 126 ASP A CG   6  
ATOM 6665  O OD1  . ASP A 1 42 ? -3.934  6.076   10.636  1.00 0.00 ? 126 ASP A OD1  6  
ATOM 6666  O OD2  . ASP A 1 42 ? -3.931  4.927   8.766   1.00 0.00 ? 126 ASP A OD2  6  
ATOM 6667  H H    . ASP A 1 42 ? -5.336  8.353   10.379  1.00 0.00 ? 126 ASP A H    6  
ATOM 6668  H HA   . ASP A 1 42 ? -5.422  7.408   7.719   1.00 0.00 ? 126 ASP A HA   6  
ATOM 6669  H HB2  . ASP A 1 42 ? -6.437  6.172   10.288  1.00 0.00 ? 126 ASP A HB2  6  
ATOM 6670  H HB3  . ASP A 1 42 ? -6.409  5.328   8.744   1.00 0.00 ? 126 ASP A HB3  6  
ATOM 6671  N N    . ASP A 1 43 ? -8.108  8.705   8.682   1.00 0.00 ? 127 ASP A N    6  
ATOM 6672  C CA   . ASP A 1 43 ? -9.470  9.068   8.330   1.00 0.00 ? 127 ASP A CA   6  
ATOM 6673  C C    . ASP A 1 43 ? -9.496  9.969   7.100   1.00 0.00 ? 127 ASP A C    6  
ATOM 6674  O O    . ASP A 1 43 ? -10.498 10.027  6.392   1.00 0.00 ? 127 ASP A O    6  
ATOM 6675  C CB   . ASP A 1 43 ? -10.153 9.796   9.492   1.00 0.00 ? 127 ASP A CB   6  
ATOM 6676  C CG   . ASP A 1 43 ? -10.197 8.967   10.757  1.00 0.00 ? 127 ASP A CG   6  
ATOM 6677  O OD1  . ASP A 1 43 ? -11.140 8.166   10.917  1.00 0.00 ? 127 ASP A OD1  6  
ATOM 6678  O OD2  . ASP A 1 43 ? -9.293  9.121   11.604  1.00 0.00 ? 127 ASP A OD2  6  
ATOM 6679  H H    . ASP A 1 43 ? -7.623  9.256   9.329   1.00 0.00 ? 127 ASP A H    6  
ATOM 6680  H HA   . ASP A 1 43 ? -10.014 8.163   8.113   1.00 0.00 ? 127 ASP A HA   6  
ATOM 6681  H HB2  . ASP A 1 43 ? -9.616  10.708  9.702   1.00 0.00 ? 127 ASP A HB2  6  
ATOM 6682  H HB3  . ASP A 1 43 ? -11.166 10.038  9.207   1.00 0.00 ? 127 ASP A HB3  6  
ATOM 6683  N N    . LEU A 1 44 ? -8.397  10.681  6.852   1.00 0.00 ? 128 LEU A N    6  
ATOM 6684  C CA   . LEU A 1 44 ? -8.349  11.637  5.754   1.00 0.00 ? 128 LEU A CA   6  
ATOM 6685  C C    . LEU A 1 44 ? -7.970  10.958  4.445   1.00 0.00 ? 128 LEU A C    6  
ATOM 6686  O O    . LEU A 1 44 ? -8.555  11.244  3.399   1.00 0.00 ? 128 LEU A O    6  
ATOM 6687  C CB   . LEU A 1 44 ? -7.363  12.766  6.069   1.00 0.00 ? 128 LEU A CB   6  
ATOM 6688  C CG   . LEU A 1 44 ? -7.725  13.623  7.285   1.00 0.00 ? 128 LEU A CG   6  
ATOM 6689  C CD1  . LEU A 1 44 ? -6.670  14.692  7.519   1.00 0.00 ? 128 LEU A CD1  6  
ATOM 6690  C CD2  . LEU A 1 44 ? -9.093  14.263  7.101   1.00 0.00 ? 128 LEU A CD2  6  
ATOM 6691  H H    . LEU A 1 44 ? -7.595  10.553  7.411   1.00 0.00 ? 128 LEU A H    6  
ATOM 6692  H HA   . LEU A 1 44 ? -9.336  12.061  5.646   1.00 0.00 ? 128 LEU A HA   6  
ATOM 6693  H HB2  . LEU A 1 44 ? -6.389  12.329  6.240   1.00 0.00 ? 128 LEU A HB2  6  
ATOM 6694  H HB3  . LEU A 1 44 ? -7.299  13.413  5.206   1.00 0.00 ? 128 LEU A HB3  6  
ATOM 6695  H HG   . LEU A 1 44 ? -7.764  12.993  8.163   1.00 0.00 ? 128 LEU A HG   6  
ATOM 6696  H HD11 . LEU A 1 44 ? -5.718  14.220  7.712   1.00 0.00 ? 128 LEU A HD11 6  
ATOM 6697  H HD12 . LEU A 1 44 ? -6.952  15.295  8.368   1.00 0.00 ? 128 LEU A HD12 6  
ATOM 6698  H HD13 . LEU A 1 44 ? -6.591  15.316  6.642   1.00 0.00 ? 128 LEU A HD13 6  
ATOM 6699  H HD21 . LEU A 1 44 ? -9.330  14.859  7.968   1.00 0.00 ? 128 LEU A HD21 6  
ATOM 6700  H HD22 . LEU A 1 44 ? -9.840  13.492  6.978   1.00 0.00 ? 128 LEU A HD22 6  
ATOM 6701  H HD23 . LEU A 1 44 ? -9.080  14.894  6.225   1.00 0.00 ? 128 LEU A HD23 6  
ATOM 6702  N N    . PHE A 1 45 ? -6.997  10.060  4.499   1.00 0.00 ? 129 PHE A N    6  
ATOM 6703  C CA   . PHE A 1 45 ? -6.546  9.374   3.298   1.00 0.00 ? 129 PHE A CA   6  
ATOM 6704  C C    . PHE A 1 45 ? -6.852  7.887   3.388   1.00 0.00 ? 129 PHE A C    6  
ATOM 6705  O O    . PHE A 1 45 ? -6.945  7.322   4.481   1.00 0.00 ? 129 PHE A O    6  
ATOM 6706  C CB   . PHE A 1 45 ? -5.036  9.572   3.084   1.00 0.00 ? 129 PHE A CB   6  
ATOM 6707  C CG   . PHE A 1 45 ? -4.178  8.641   3.901   1.00 0.00 ? 129 PHE A CG   6  
ATOM 6708  C CD1  . PHE A 1 45 ? -3.910  8.908   5.232   1.00 0.00 ? 129 PHE A CD1  6  
ATOM 6709  C CD2  . PHE A 1 45 ? -3.651  7.488   3.333   1.00 0.00 ? 129 PHE A CD2  6  
ATOM 6710  C CE1  . PHE A 1 45 ? -3.135  8.045   5.982   1.00 0.00 ? 129 PHE A CE1  6  
ATOM 6711  C CE2  . PHE A 1 45 ? -2.880  6.621   4.079   1.00 0.00 ? 129 PHE A CE2  6  
ATOM 6712  C CZ   . PHE A 1 45 ? -2.618  6.899   5.404   1.00 0.00 ? 129 PHE A CZ   6  
ATOM 6713  H H    . PHE A 1 45 ? -6.584  9.845   5.361   1.00 0.00 ? 129 PHE A H    6  
ATOM 6714  H HA   . PHE A 1 45 ? -7.078  9.788   2.456   1.00 0.00 ? 129 PHE A HA   6  
ATOM 6715  H HB2  . PHE A 1 45 ? -4.797  9.407   2.043   1.00 0.00 ? 129 PHE A HB2  6  
ATOM 6716  H HB3  . PHE A 1 45 ? -4.772  10.586  3.351   1.00 0.00 ? 129 PHE A HB3  6  
ATOM 6717  H HD1  . PHE A 1 45 ? -4.312  9.803   5.685   1.00 0.00 ? 129 PHE A HD1  6  
ATOM 6718  H HD2  . PHE A 1 45 ? -3.852  7.267   2.294   1.00 0.00 ? 129 PHE A HD2  6  
ATOM 6719  H HE1  . PHE A 1 45 ? -2.927  8.272   7.019   1.00 0.00 ? 129 PHE A HE1  6  
ATOM 6720  H HE2  . PHE A 1 45 ? -2.477  5.728   3.625   1.00 0.00 ? 129 PHE A HE2  6  
ATOM 6721  H HZ   . PHE A 1 45 ? -2.016  6.216   5.988   1.00 0.00 ? 129 PHE A HZ   6  
ATOM 6722  N N    . TRP A 1 46 ? -7.027  7.267   2.238   1.00 0.00 ? 130 TRP A N    6  
ATOM 6723  C CA   . TRP A 1 46 ? -7.094  5.822   2.143   1.00 0.00 ? 130 TRP A CA   6  
ATOM 6724  C C    . TRP A 1 46 ? -6.852  5.429   0.691   1.00 0.00 ? 130 TRP A C    6  
ATOM 6725  O O    . TRP A 1 46 ? -7.368  6.066   -0.222  1.00 0.00 ? 130 TRP A O    6  
ATOM 6726  C CB   . TRP A 1 46 ? -8.437  5.284   2.673   1.00 0.00 ? 130 TRP A CB   6  
ATOM 6727  C CG   . TRP A 1 46 ? -9.515  5.133   1.643   1.00 0.00 ? 130 TRP A CG   6  
ATOM 6728  C CD1  . TRP A 1 46 ? -9.882  3.977   1.024   1.00 0.00 ? 130 TRP A CD1  6  
ATOM 6729  C CD2  . TRP A 1 46 ? -10.370 6.158   1.120   1.00 0.00 ? 130 TRP A CD2  6  
ATOM 6730  N NE1  . TRP A 1 46 ? -10.904 4.214   0.144   1.00 0.00 ? 130 TRP A NE1  6  
ATOM 6731  C CE2  . TRP A 1 46 ? -11.225 5.545   0.183   1.00 0.00 ? 130 TRP A CE2  6  
ATOM 6732  C CE3  . TRP A 1 46 ? -10.496 7.532   1.347   1.00 0.00 ? 130 TRP A CE3  6  
ATOM 6733  C CZ2  . TRP A 1 46 ? -12.191 6.257   -0.522  1.00 0.00 ? 130 TRP A CZ2  6  
ATOM 6734  C CZ3  . TRP A 1 46 ? -11.457 8.236   0.647   1.00 0.00 ? 130 TRP A CZ3  6  
ATOM 6735  C CH2  . TRP A 1 46 ? -12.294 7.598   -0.279  1.00 0.00 ? 130 TRP A CH2  6  
ATOM 6736  H H    . TRP A 1 46 ? -7.124  7.802   1.416   1.00 0.00 ? 130 TRP A H    6  
ATOM 6737  H HA   . TRP A 1 46 ? -6.288  5.420   2.744   1.00 0.00 ? 130 TRP A HA   6  
ATOM 6738  H HB2  . TRP A 1 46 ? -8.273  4.313   3.118   1.00 0.00 ? 130 TRP A HB2  6  
ATOM 6739  H HB3  . TRP A 1 46 ? -8.802  5.958   3.438   1.00 0.00 ? 130 TRP A HB3  6  
ATOM 6740  H HD1  . TRP A 1 46 ? -9.422  3.016   1.209   1.00 0.00 ? 130 TRP A HD1  6  
ATOM 6741  H HE1  . TRP A 1 46 ? -11.338 3.538   -0.419  1.00 0.00 ? 130 TRP A HE1  6  
ATOM 6742  H HE3  . TRP A 1 46 ? -9.860  8.041   2.055   1.00 0.00 ? 130 TRP A HE3  6  
ATOM 6743  H HZ2  . TRP A 1 46 ? -12.843 5.779   -1.240  1.00 0.00 ? 130 TRP A HZ2  6  
ATOM 6744  H HZ3  . TRP A 1 46 ? -11.572 9.298   0.811   1.00 0.00 ? 130 TRP A HZ3  6  
ATOM 6745  H HH2  . TRP A 1 46 ? -13.028 8.188   -0.803  1.00 0.00 ? 130 TRP A HH2  6  
ATOM 6746  N N    . LEU A 1 47 ? -6.036  4.417   0.468   1.00 0.00 ? 131 LEU A N    6  
ATOM 6747  C CA   . LEU A 1 47 ? -5.648  4.068   -0.888  1.00 0.00 ? 131 LEU A CA   6  
ATOM 6748  C C    . LEU A 1 47 ? -6.483  2.915   -1.434  1.00 0.00 ? 131 LEU A C    6  
ATOM 6749  O O    . LEU A 1 47 ? -6.882  2.010   -0.700  1.00 0.00 ? 131 LEU A O    6  
ATOM 6750  C CB   . LEU A 1 47 ? -4.139  3.772   -0.959  1.00 0.00 ? 131 LEU A CB   6  
ATOM 6751  C CG   . LEU A 1 47 ? -3.561  2.907   0.168   1.00 0.00 ? 131 LEU A CG   6  
ATOM 6752  C CD1  . LEU A 1 47 ? -3.859  1.437   -0.060  1.00 0.00 ? 131 LEU A CD1  6  
ATOM 6753  C CD2  . LEU A 1 47 ? -2.062  3.133   0.292   1.00 0.00 ? 131 LEU A CD2  6  
ATOM 6754  H H    . LEU A 1 47 ? -5.702  3.888   1.220   1.00 0.00 ? 131 LEU A H    6  
ATOM 6755  H HA   . LEU A 1 47 ? -5.854  4.937   -1.500  1.00 0.00 ? 131 LEU A HA   6  
ATOM 6756  H HB2  . LEU A 1 47 ? -3.942  3.274   -1.897  1.00 0.00 ? 131 LEU A HB2  6  
ATOM 6757  H HB3  . LEU A 1 47 ? -3.615  4.715   -0.959  1.00 0.00 ? 131 LEU A HB3  6  
ATOM 6758  H HG   . LEU A 1 47 ? -4.020  3.199   1.102   1.00 0.00 ? 131 LEU A HG   6  
ATOM 6759  H HD11 . LEU A 1 47 ? -3.404  1.120   -0.986  1.00 0.00 ? 131 LEU A HD11 6  
ATOM 6760  H HD12 . LEU A 1 47 ? -4.927  1.292   -0.114  1.00 0.00 ? 131 LEU A HD12 6  
ATOM 6761  H HD13 . LEU A 1 47 ? -3.457  0.857   0.757   1.00 0.00 ? 131 LEU A HD13 6  
ATOM 6762  H HD21 . LEU A 1 47 ? -1.872  4.167   0.538   1.00 0.00 ? 131 LEU A HD21 6  
ATOM 6763  H HD22 . LEU A 1 47 ? -1.583  2.891   -0.645  1.00 0.00 ? 131 LEU A HD22 6  
ATOM 6764  H HD23 . LEU A 1 47 ? -1.669  2.498   1.072   1.00 0.00 ? 131 LEU A HD23 6  
ATOM 6765  N N    . THR A 1 48 ? -6.757  2.981   -2.723  1.00 0.00 ? 132 THR A N    6  
ATOM 6766  C CA   . THR A 1 48 ? -7.592  2.001   -3.387  1.00 0.00 ? 132 THR A CA   6  
ATOM 6767  C C    . THR A 1 48 ? -6.821  1.301   -4.500  1.00 0.00 ? 132 THR A C    6  
ATOM 6768  O O    . THR A 1 48 ? -5.902  1.881   -5.086  1.00 0.00 ? 132 THR A O    6  
ATOM 6769  C CB   . THR A 1 48 ? -8.839  2.680   -3.989  1.00 0.00 ? 132 THR A CB   6  
ATOM 6770  O OG1  . THR A 1 48 ? -8.439  3.814   -4.771  1.00 0.00 ? 132 THR A OG1  6  
ATOM 6771  C CG2  . THR A 1 48 ? -9.803  3.128   -2.900  1.00 0.00 ? 132 THR A CG2  6  
ATOM 6772  H H    . THR A 1 48 ? -6.384  3.723   -3.252  1.00 0.00 ? 132 THR A H    6  
ATOM 6773  H HA   . THR A 1 48 ? -7.909  1.271   -2.657  1.00 0.00 ? 132 THR A HA   6  
ATOM 6774  H HB   . THR A 1 48 ? -9.342  1.969   -4.627  1.00 0.00 ? 132 THR A HB   6  
ATOM 6775  H HG1  . THR A 1 48 ? -7.514  3.718   -5.027  1.00 0.00 ? 132 THR A HG1  6  
ATOM 6776  H HG21 . THR A 1 48 ? -9.303  3.816   -2.234  1.00 0.00 ? 132 THR A HG21 6  
ATOM 6777  H HG22 . THR A 1 48 ? -10.141 2.267   -2.344  1.00 0.00 ? 132 THR A HG22 6  
ATOM 6778  H HG23 . THR A 1 48 ? -10.653 3.620   -3.353  1.00 0.00 ? 132 THR A HG23 6  
ATOM 6779  N N    . PHE A 1 49 ? -7.199  0.063   -4.797  1.00 0.00 ? 133 PHE A N    6  
ATOM 6780  C CA   . PHE A 1 49 ? -6.555  -0.683  -5.877  1.00 0.00 ? 133 PHE A CA   6  
ATOM 6781  C C    . PHE A 1 49 ? -7.586  -1.422  -6.711  1.00 0.00 ? 133 PHE A C    6  
ATOM 6782  O O    . PHE A 1 49 ? -7.720  -1.183  -7.910  1.00 0.00 ? 133 PHE A O    6  
ATOM 6783  C CB   . PHE A 1 49 ? -5.517  -1.675  -5.333  1.00 0.00 ? 133 PHE A CB   6  
ATOM 6784  C CG   . PHE A 1 49 ? -5.207  -2.778  -6.308  1.00 0.00 ? 133 PHE A CG   6  
ATOM 6785  C CD1  . PHE A 1 49 ? -4.560  -2.505  -7.500  1.00 0.00 ? 133 PHE A CD1  6  
ATOM 6786  C CD2  . PHE A 1 49 ? -5.606  -4.081  -6.046  1.00 0.00 ? 133 PHE A CD2  6  
ATOM 6787  C CE1  . PHE A 1 49 ? -4.311  -3.509  -8.411  1.00 0.00 ? 133 PHE A CE1  6  
ATOM 6788  C CE2  . PHE A 1 49 ? -5.367  -5.088  -6.957  1.00 0.00 ? 133 PHE A CE2  6  
ATOM 6789  C CZ   . PHE A 1 49 ? -4.718  -4.801  -8.139  1.00 0.00 ? 133 PHE A CZ   6  
ATOM 6790  H H    . PHE A 1 49 ? -7.945  -0.352  -4.291  1.00 0.00 ? 133 PHE A H    6  
ATOM 6791  H HA   . PHE A 1 49 ? -6.056  0.028   -6.509  1.00 0.00 ? 133 PHE A HA   6  
ATOM 6792  H HB2  . PHE A 1 49 ? -4.598  -1.149  -5.122  1.00 0.00 ? 133 PHE A HB2  6  
ATOM 6793  H HB3  . PHE A 1 49 ? -5.890  -2.123  -4.427  1.00 0.00 ? 133 PHE A HB3  6  
ATOM 6794  H HD1  . PHE A 1 49 ? -4.241  -1.494  -7.712  1.00 0.00 ? 133 PHE A HD1  6  
ATOM 6795  H HD2  . PHE A 1 49 ? -6.112  -4.308  -5.121  1.00 0.00 ? 133 PHE A HD2  6  
ATOM 6796  H HE1  . PHE A 1 49 ? -3.804  -3.285  -9.340  1.00 0.00 ? 133 PHE A HE1  6  
ATOM 6797  H HE2  . PHE A 1 49 ? -5.678  -6.100  -6.742  1.00 0.00 ? 133 PHE A HE2  6  
ATOM 6798  H HZ   . PHE A 1 49 ? -4.542  -5.584  -8.854  1.00 0.00 ? 133 PHE A HZ   6  
ATOM 6799  N N    . GLU A 1 50 ? -8.317  -2.312  -6.069  1.00 0.00 ? 134 GLU A N    6  
ATOM 6800  C CA   . GLU A 1 50 ? -9.340  -3.100  -6.742  1.00 0.00 ? 134 GLU A CA   6  
ATOM 6801  C C    . GLU A 1 50 ? -10.612 -2.251  -6.849  1.00 0.00 ? 134 GLU A C    6  
ATOM 6802  O O    . GLU A 1 50 ? -11.726 -2.743  -6.728  1.00 0.00 ? 134 GLU A O    6  
ATOM 6803  C CB   . GLU A 1 50 ? -9.592  -4.382  -5.929  1.00 0.00 ? 134 GLU A CB   6  
ATOM 6804  C CG   . GLU A 1 50 ? -10.026 -5.594  -6.749  1.00 0.00 ? 134 GLU A CG   6  
ATOM 6805  C CD   . GLU A 1 50 ? -11.468 -5.529  -7.212  1.00 0.00 ? 134 GLU A CD   6  
ATOM 6806  O OE1  . GLU A 1 50 ? -12.378 -5.674  -6.367  1.00 0.00 ? 134 GLU A OE1  6  
ATOM 6807  O OE2  . GLU A 1 50 ? -11.701 -5.353  -8.421  1.00 0.00 ? 134 GLU A OE2  6  
ATOM 6808  H H    . GLU A 1 50 ? -8.166  -2.447  -5.113  1.00 0.00 ? 134 GLU A H    6  
ATOM 6809  H HA   . GLU A 1 50 ? -8.976  -3.360  -7.731  1.00 0.00 ? 134 GLU A HA   6  
ATOM 6810  H HB2  . GLU A 1 50 ? -8.684  -4.641  -5.407  1.00 0.00 ? 134 GLU A HB2  6  
ATOM 6811  H HB3  . GLU A 1 50 ? -10.362 -4.180  -5.199  1.00 0.00 ? 134 GLU A HB3  6  
ATOM 6812  H HG2  . GLU A 1 50 ? -9.394  -5.664  -7.621  1.00 0.00 ? 134 GLU A HG2  6  
ATOM 6813  H HG3  . GLU A 1 50 ? -9.900  -6.480  -6.145  1.00 0.00 ? 134 GLU A HG3  6  
ATOM 6814  N N    . GLY A 1 51 ? -10.428 -0.949  -7.054  1.00 0.00 ? 135 GLY A N    6  
ATOM 6815  C CA   . GLY A 1 51 ? -11.535 -0.019  -6.977  1.00 0.00 ? 135 GLY A CA   6  
ATOM 6816  C C    . GLY A 1 51 ? -11.826 0.352   -5.537  1.00 0.00 ? 135 GLY A C    6  
ATOM 6817  O O    . GLY A 1 51 ? -12.295 1.451   -5.240  1.00 0.00 ? 135 GLY A O    6  
ATOM 6818  H H    . GLY A 1 51 ? -9.530  -0.622  -7.275  1.00 0.00 ? 135 GLY A H    6  
ATOM 6819  H HA2  . GLY A 1 51 ? -11.289 0.875   -7.534  1.00 0.00 ? 135 GLY A HA2  6  
ATOM 6820  H HA3  . GLY A 1 51 ? -12.413 -0.476  -7.409  1.00 0.00 ? 135 GLY A HA3  6  
ATOM 6821  N N    . LYS A 1 52 ? -11.535 -0.584  -4.648  1.00 0.00 ? 136 LYS A N    6  
ATOM 6822  C CA   . LYS A 1 52 ? -11.711 -0.391  -3.226  1.00 0.00 ? 136 LYS A CA   6  
ATOM 6823  C C    . LYS A 1 52 ? -10.365 -0.498  -2.519  1.00 0.00 ? 136 LYS A C    6  
ATOM 6824  O O    . LYS A 1 52 ? -9.355  -0.824  -3.157  1.00 0.00 ? 136 LYS A O    6  
ATOM 6825  C CB   . LYS A 1 52 ? -12.675 -1.445  -2.679  1.00 0.00 ? 136 LYS A CB   6  
ATOM 6826  C CG   . LYS A 1 52 ? -12.160 -2.875  -2.764  1.00 0.00 ? 136 LYS A CG   6  
ATOM 6827  C CD   . LYS A 1 52 ? -13.164 -3.855  -2.174  1.00 0.00 ? 136 LYS A CD   6  
ATOM 6828  C CE   . LYS A 1 52 ? -12.635 -5.281  -2.183  1.00 0.00 ? 136 LYS A CE   6  
ATOM 6829  N NZ   . LYS A 1 52 ? -11.492 -5.462  -1.248  1.00 0.00 ? 136 LYS A NZ   6  
ATOM 6830  H H    . LYS A 1 52 ? -11.197 -1.445  -4.968  1.00 0.00 ? 136 LYS A H    6  
ATOM 6831  H HA   . LYS A 1 52 ? -12.122 0.592   -3.064  1.00 0.00 ? 136 LYS A HA   6  
ATOM 6832  H HB2  . LYS A 1 52 ? -12.867 -1.220  -1.644  1.00 0.00 ? 136 LYS A HB2  6  
ATOM 6833  H HB3  . LYS A 1 52 ? -13.597 -1.384  -3.230  1.00 0.00 ? 136 LYS A HB3  6  
ATOM 6834  H HG2  . LYS A 1 52 ? -11.992 -3.126  -3.800  1.00 0.00 ? 136 LYS A HG2  6  
ATOM 6835  H HG3  . LYS A 1 52 ? -11.230 -2.948  -2.216  1.00 0.00 ? 136 LYS A HG3  6  
ATOM 6836  H HD2  . LYS A 1 52 ? -13.376 -3.567  -1.156  1.00 0.00 ? 136 LYS A HD2  6  
ATOM 6837  H HD3  . LYS A 1 52 ? -14.073 -3.814  -2.758  1.00 0.00 ? 136 LYS A HD3  6  
ATOM 6838  H HE2  . LYS A 1 52 ? -13.432 -5.947  -1.891  1.00 0.00 ? 136 LYS A HE2  6  
ATOM 6839  H HE3  . LYS A 1 52 ? -12.313 -5.523  -3.185  1.00 0.00 ? 136 LYS A HE3  6  
ATOM 6840  H HZ1  . LYS A 1 52 ? -10.748 -4.762  -1.444  1.00 0.00 ? 136 LYS A HZ1  6  
ATOM 6841  H HZ2  . LYS A 1 52 ? -11.091 -6.413  -1.356  1.00 0.00 ? 136 LYS A HZ2  6  
ATOM 6842  H HZ3  . LYS A 1 52 ? -11.811 -5.344  -0.261  1.00 0.00 ? 136 LYS A HZ3  6  
ATOM 6843  N N    . PRO A 1 53 ? -10.325 -0.215  -1.205  1.00 0.00 ? 137 PRO A N    6  
ATOM 6844  C CA   . PRO A 1 53 ? -9.110  -0.382  -0.403  1.00 0.00 ? 137 PRO A CA   6  
ATOM 6845  C C    . PRO A 1 53 ? -8.652  -1.839  -0.359  1.00 0.00 ? 137 PRO A C    6  
ATOM 6846  O O    . PRO A 1 53 ? -9.357  -2.745  -0.816  1.00 0.00 ? 137 PRO A O    6  
ATOM 6847  C CB   . PRO A 1 53 ? -9.519  0.092   0.997   1.00 0.00 ? 137 PRO A CB   6  
ATOM 6848  C CG   . PRO A 1 53 ? -10.763 0.883   0.804   1.00 0.00 ? 137 PRO A CG   6  
ATOM 6849  C CD   . PRO A 1 53 ? -11.442 0.311   -0.401  1.00 0.00 ? 137 PRO A CD   6  
ATOM 6850  H HA   . PRO A 1 53 ? -8.302  0.235   -0.775  1.00 0.00 ? 137 PRO A HA   6  
ATOM 6851  H HB2  . PRO A 1 53 ? -9.695  -0.760  1.630   1.00 0.00 ? 137 PRO A HB2  6  
ATOM 6852  H HB3  . PRO A 1 53 ? -8.730  0.699   1.417   1.00 0.00 ? 137 PRO A HB3  6  
ATOM 6853  H HG2  . PRO A 1 53 ? -11.397 0.786   1.673   1.00 0.00 ? 137 PRO A HG2  6  
ATOM 6854  H HG3  . PRO A 1 53 ? -10.512 1.919   0.635   1.00 0.00 ? 137 PRO A HG3  6  
ATOM 6855  H HD2  . PRO A 1 53 ? -12.117 -0.482  -0.113  1.00 0.00 ? 137 PRO A HD2  6  
ATOM 6856  H HD3  . PRO A 1 53 ? -11.972 1.084   -0.939  1.00 0.00 ? 137 PRO A HD3  6  
ATOM 6857  N N    . LEU A 1 54 ? -7.473  -2.065  0.198   1.00 0.00 ? 138 LEU A N    6  
ATOM 6858  C CA   . LEU A 1 54 ? -6.912  -3.402  0.279   1.00 0.00 ? 138 LEU A CA   6  
ATOM 6859  C C    . LEU A 1 54 ? -7.088  -3.968  1.680   1.00 0.00 ? 138 LEU A C    6  
ATOM 6860  O O    . LEU A 1 54 ? -7.061  -3.225  2.661   1.00 0.00 ? 138 LEU A O    6  
ATOM 6861  C CB   . LEU A 1 54 ? -5.435  -3.367  -0.110  1.00 0.00 ? 138 LEU A CB   6  
ATOM 6862  C CG   . LEU A 1 54 ? -5.170  -2.937  -1.552  1.00 0.00 ? 138 LEU A CG   6  
ATOM 6863  C CD1  . LEU A 1 54 ? -3.684  -2.750  -1.790  1.00 0.00 ? 138 LEU A CD1  6  
ATOM 6864  C CD2  . LEU A 1 54 ? -5.745  -3.962  -2.515  1.00 0.00 ? 138 LEU A CD2  6  
ATOM 6865  H H    . LEU A 1 54 ? -6.968  -1.312  0.574   1.00 0.00 ? 138 LEU A H    6  
ATOM 6866  H HA   . LEU A 1 54 ? -7.446  -4.030  -0.420  1.00 0.00 ? 138 LEU A HA   6  
ATOM 6867  H HB2  . LEU A 1 54 ? -4.924  -2.680  0.551   1.00 0.00 ? 138 LEU A HB2  6  
ATOM 6868  H HB3  . LEU A 1 54 ? -5.020  -4.353  0.030   1.00 0.00 ? 138 LEU A HB3  6  
ATOM 6869  H HG   . LEU A 1 54 ? -5.662  -1.993  -1.737  1.00 0.00 ? 138 LEU A HG   6  
ATOM 6870  H HD11 . LEU A 1 54 ? -3.305  -2.000  -1.112  1.00 0.00 ? 138 LEU A HD11 6  
ATOM 6871  H HD12 . LEU A 1 54 ? -3.522  -2.426  -2.809  1.00 0.00 ? 138 LEU A HD12 6  
ATOM 6872  H HD13 . LEU A 1 54 ? -3.170  -3.683  -1.622  1.00 0.00 ? 138 LEU A HD13 6  
ATOM 6873  H HD21 . LEU A 1 54 ? -6.813  -4.025  -2.380  1.00 0.00 ? 138 LEU A HD21 6  
ATOM 6874  H HD22 . LEU A 1 54 ? -5.301  -4.927  -2.321  1.00 0.00 ? 138 LEU A HD22 6  
ATOM 6875  H HD23 . LEU A 1 54 ? -5.527  -3.664  -3.529  1.00 0.00 ? 138 LEU A HD23 6  
ATOM 6876  N N    . GLU A 1 55 ? -7.293  -5.275  1.769   1.00 0.00 ? 139 GLU A N    6  
ATOM 6877  C CA   . GLU A 1 55 ? -7.516  -5.919  3.053   1.00 0.00 ? 139 GLU A CA   6  
ATOM 6878  C C    . GLU A 1 55 ? -6.203  -6.009  3.821   1.00 0.00 ? 139 GLU A C    6  
ATOM 6879  O O    . GLU A 1 55 ? -5.297  -6.744  3.429   1.00 0.00 ? 139 GLU A O    6  
ATOM 6880  C CB   . GLU A 1 55 ? -8.107  -7.320  2.864   1.00 0.00 ? 139 GLU A CB   6  
ATOM 6881  C CG   . GLU A 1 55 ? -9.157  -7.416  1.764   1.00 0.00 ? 139 GLU A CG   6  
ATOM 6882  C CD   . GLU A 1 55 ? -10.280 -6.407  1.905   1.00 0.00 ? 139 GLU A CD   6  
ATOM 6883  O OE1  . GLU A 1 55 ? -11.171 -6.608  2.752   1.00 0.00 ? 139 GLU A OE1  6  
ATOM 6884  O OE2  . GLU A 1 55 ? -10.287 -5.413  1.149   1.00 0.00 ? 139 GLU A OE2  6  
ATOM 6885  H H    . GLU A 1 55 ? -7.295  -5.819  0.953   1.00 0.00 ? 139 GLU A H    6  
ATOM 6886  H HA   . GLU A 1 55 ? -8.209  -5.313  3.616   1.00 0.00 ? 139 GLU A HA   6  
ATOM 6887  H HB2  . GLU A 1 55 ? -7.306  -8.004  2.625   1.00 0.00 ? 139 GLU A HB2  6  
ATOM 6888  H HB3  . GLU A 1 55 ? -8.563  -7.630  3.793   1.00 0.00 ? 139 GLU A HB3  6  
ATOM 6889  H HG2  . GLU A 1 55 ? -8.675  -7.253  0.813   1.00 0.00 ? 139 GLU A HG2  6  
ATOM 6890  H HG3  . GLU A 1 55 ? -9.582  -8.409  1.780   1.00 0.00 ? 139 GLU A HG3  6  
ATOM 6891  N N    . ASP A 1 56 ? -6.113  -5.264  4.917   1.00 0.00 ? 140 ASP A N    6  
ATOM 6892  C CA   . ASP A 1 56 ? -4.874  -5.155  5.690   1.00 0.00 ? 140 ASP A CA   6  
ATOM 6893  C C    . ASP A 1 56 ? -4.425  -6.508  6.236   1.00 0.00 ? 140 ASP A C    6  
ATOM 6894  O O    . ASP A 1 56 ? -3.235  -6.736  6.446   1.00 0.00 ? 140 ASP A O    6  
ATOM 6895  C CB   . ASP A 1 56 ? -5.046  -4.168  6.846   1.00 0.00 ? 140 ASP A CB   6  
ATOM 6896  C CG   . ASP A 1 56 ? -5.912  -4.720  7.967   1.00 0.00 ? 140 ASP A CG   6  
ATOM 6897  O OD1  . ASP A 1 56 ? -7.148  -4.749  7.803   1.00 0.00 ? 140 ASP A OD1  6  
ATOM 6898  O OD2  . ASP A 1 56 ? -5.358  -5.143  9.006   1.00 0.00 ? 140 ASP A OD2  6  
ATOM 6899  H H    . ASP A 1 56 ? -6.905  -4.764  5.216   1.00 0.00 ? 140 ASP A H    6  
ATOM 6900  H HA   . ASP A 1 56 ? -4.112  -4.782  5.032   1.00 0.00 ? 140 ASP A HA   6  
ATOM 6901  H HB2  . ASP A 1 56 ? -4.073  -3.928  7.248   1.00 0.00 ? 140 ASP A HB2  6  
ATOM 6902  H HB3  . ASP A 1 56 ? -5.505  -3.265  6.472   1.00 0.00 ? 140 ASP A HB3  6  
ATOM 6903  N N    . GLN A 1 57 ? -5.384  -7.398  6.437   1.00 0.00 ? 141 GLN A N    6  
ATOM 6904  C CA   . GLN A 1 57 ? -5.124  -8.693  7.051   1.00 0.00 ? 141 GLN A CA   6  
ATOM 6905  C C    . GLN A 1 57 ? -4.488  -9.663  6.057   1.00 0.00 ? 141 GLN A C    6  
ATOM 6906  O O    . GLN A 1 57 ? -3.870  -10.648 6.454   1.00 0.00 ? 141 GLN A O    6  
ATOM 6907  C CB   . GLN A 1 57 ? -6.435  -9.281  7.570   1.00 0.00 ? 141 GLN A CB   6  
ATOM 6908  C CG   . GLN A 1 57 ? -7.231  -8.304  8.420   1.00 0.00 ? 141 GLN A CG   6  
ATOM 6909  C CD   . GLN A 1 57 ? -8.622  -8.796  8.775   1.00 0.00 ? 141 GLN A CD   6  
ATOM 6910  O OE1  . GLN A 1 57 ? -9.164  -8.434  9.818   1.00 0.00 ? 141 GLN A OE1  6  
ATOM 6911  N NE2  . GLN A 1 57 ? -9.215  -9.606  7.911   1.00 0.00 ? 141 GLN A NE2  6  
ATOM 6912  H H    . GLN A 1 57 ? -6.298  -7.176  6.168   1.00 0.00 ? 141 GLN A H    6  
ATOM 6913  H HA   . GLN A 1 57 ? -4.450  -8.544  7.881   1.00 0.00 ? 141 GLN A HA   6  
ATOM 6914  H HB2  . GLN A 1 57 ? -7.039  -9.572  6.724   1.00 0.00 ? 141 GLN A HB2  6  
ATOM 6915  H HB3  . GLN A 1 57 ? -6.217  -10.154 8.166   1.00 0.00 ? 141 GLN A HB3  6  
ATOM 6916  H HG2  . GLN A 1 57 ? -6.690  -8.126  9.338   1.00 0.00 ? 141 GLN A HG2  6  
ATOM 6917  H HG3  . GLN A 1 57 ? -7.325  -7.375  7.876   1.00 0.00 ? 141 GLN A HG3  6  
ATOM 6918  H HE21 . GLN A 1 57 ? -8.736  -9.848  7.098   1.00 0.00 ? 141 GLN A HE21 6  
ATOM 6919  H HE22 . GLN A 1 57 ? -10.121 -9.929  8.123   1.00 0.00 ? 141 GLN A HE22 6  
ATOM 6920  N N    . LEU A 1 58 ? -4.636  -9.376  4.771   1.00 0.00 ? 142 LEU A N    6  
ATOM 6921  C CA   . LEU A 1 58 ? -4.171  -10.287 3.736   1.00 0.00 ? 142 LEU A CA   6  
ATOM 6922  C C    . LEU A 1 58 ? -2.757  -9.931  3.291   1.00 0.00 ? 142 LEU A C    6  
ATOM 6923  O O    . LEU A 1 58 ? -2.312  -8.789  3.454   1.00 0.00 ? 142 LEU A O    6  
ATOM 6924  C CB   . LEU A 1 58 ? -5.128  -10.271 2.537   1.00 0.00 ? 142 LEU A CB   6  
ATOM 6925  C CG   . LEU A 1 58 ? -6.559  -10.724 2.836   1.00 0.00 ? 142 LEU A CG   6  
ATOM 6926  C CD1  . LEU A 1 58 ? -7.370  -10.792 1.552   1.00 0.00 ? 142 LEU A CD1  6  
ATOM 6927  C CD2  . LEU A 1 58 ? -6.563  -12.072 3.540   1.00 0.00 ? 142 LEU A CD2  6  
ATOM 6928  H H    . LEU A 1 58 ? -5.043  -8.523  4.509   1.00 0.00 ? 142 LEU A H    6  
ATOM 6929  H HA   . LEU A 1 58 ? -4.159  -11.280 4.158   1.00 0.00 ? 142 LEU A HA   6  
ATOM 6930  H HB2  . LEU A 1 58 ? -5.166  -9.265  2.149   1.00 0.00 ? 142 LEU A HB2  6  
ATOM 6931  H HB3  . LEU A 1 58 ? -4.723  -10.918 1.773   1.00 0.00 ? 142 LEU A HB3  6  
ATOM 6932  H HG   . LEU A 1 58 ? -7.027  -10.002 3.489   1.00 0.00 ? 142 LEU A HG   6  
ATOM 6933  H HD11 . LEU A 1 58 ? -6.892  -11.470 0.861   1.00 0.00 ? 142 LEU A HD11 6  
ATOM 6934  H HD12 . LEU A 1 58 ? -7.429  -9.808  1.112   1.00 0.00 ? 142 LEU A HD12 6  
ATOM 6935  H HD13 . LEU A 1 58 ? -8.365  -11.150 1.775   1.00 0.00 ? 142 LEU A HD13 6  
ATOM 6936  H HD21 . LEU A 1 58 ? -7.580  -12.367 3.754   1.00 0.00 ? 142 LEU A HD21 6  
ATOM 6937  H HD22 . LEU A 1 58 ? -6.008  -11.997 4.463   1.00 0.00 ? 142 LEU A HD22 6  
ATOM 6938  H HD23 . LEU A 1 58 ? -6.102  -12.811 2.902   1.00 0.00 ? 142 LEU A HD23 6  
ATOM 6939  N N    . PRO A 1 59 ? -2.026  -10.915 2.739   1.00 0.00 ? 143 PRO A N    6  
ATOM 6940  C CA   . PRO A 1 59 ? -0.671  -10.707 2.227   1.00 0.00 ? 143 PRO A CA   6  
ATOM 6941  C C    . PRO A 1 59 ? -0.639  -9.724  1.062   1.00 0.00 ? 143 PRO A C    6  
ATOM 6942  O O    . PRO A 1 59 ? -1.466  -9.788  0.149   1.00 0.00 ? 143 PRO A O    6  
ATOM 6943  C CB   . PRO A 1 59 ? -0.233  -12.102 1.762   1.00 0.00 ? 143 PRO A CB   6  
ATOM 6944  C CG   . PRO A 1 59 ? -1.500  -12.852 1.555   1.00 0.00 ? 143 PRO A CG   6  
ATOM 6945  C CD   . PRO A 1 59 ? -2.466  -12.314 2.571   1.00 0.00 ? 143 PRO A CD   6  
ATOM 6946  H HA   . PRO A 1 59 ? -0.005  -10.360 3.006   1.00 0.00 ? 143 PRO A HA   6  
ATOM 6947  H HB2  . PRO A 1 59 ? 0.328   -12.016 0.843   1.00 0.00 ? 143 PRO A HB2  6  
ATOM 6948  H HB3  . PRO A 1 59 ? 0.378   -12.566 2.521   1.00 0.00 ? 143 PRO A HB3  6  
ATOM 6949  H HG2  . PRO A 1 59 ? -1.871  -12.676 0.556   1.00 0.00 ? 143 PRO A HG2  6  
ATOM 6950  H HG3  . PRO A 1 59 ? -1.334  -13.908 1.715   1.00 0.00 ? 143 PRO A HG3  6  
ATOM 6951  H HD2  . PRO A 1 59 ? -3.476  -12.358 2.193   1.00 0.00 ? 143 PRO A HD2  6  
ATOM 6952  H HD3  . PRO A 1 59 ? -2.383  -12.858 3.501   1.00 0.00 ? 143 PRO A HD3  6  
ATOM 6953  N N    . LEU A 1 60 ? 0.332   -8.824  1.100   1.00 0.00 ? 144 LEU A N    6  
ATOM 6954  C CA   . LEU A 1 60 ? 0.482   -7.802  0.078   1.00 0.00 ? 144 LEU A CA   6  
ATOM 6955  C C    . LEU A 1 60 ? 0.784   -8.455  -1.266  1.00 0.00 ? 144 LEU A C    6  
ATOM 6956  O O    . LEU A 1 60 ? 0.309   -8.005  -2.309  1.00 0.00 ? 144 LEU A O    6  
ATOM 6957  C CB   . LEU A 1 60 ? 1.608   -6.842  0.480   1.00 0.00 ? 144 LEU A CB   6  
ATOM 6958  C CG   . LEU A 1 60 ? 1.500   -5.407  -0.050  1.00 0.00 ? 144 LEU A CG   6  
ATOM 6959  C CD1  . LEU A 1 60 ? 2.512   -4.520  0.650   1.00 0.00 ? 144 LEU A CD1  6  
ATOM 6960  C CD2  . LEU A 1 60 ? 1.716   -5.351  -1.555  1.00 0.00 ? 144 LEU A CD2  6  
ATOM 6961  H H    . LEU A 1 60 ? 0.975   -8.851  1.847   1.00 0.00 ? 144 LEU A H    6  
ATOM 6962  H HA   . LEU A 1 60 ? -0.448  -7.256  0.006   1.00 0.00 ? 144 LEU A HA   6  
ATOM 6963  H HB2  . LEU A 1 60 ? 1.645   -6.801  1.558   1.00 0.00 ? 144 LEU A HB2  6  
ATOM 6964  H HB3  . LEU A 1 60 ? 2.542   -7.258  0.128   1.00 0.00 ? 144 LEU A HB3  6  
ATOM 6965  H HG   . LEU A 1 60 ? 0.514   -5.024  0.164   1.00 0.00 ? 144 LEU A HG   6  
ATOM 6966  H HD11 . LEU A 1 60 ? 3.510   -4.884  0.451   1.00 0.00 ? 144 LEU A HD11 6  
ATOM 6967  H HD12 . LEU A 1 60 ? 2.330   -4.533  1.715   1.00 0.00 ? 144 LEU A HD12 6  
ATOM 6968  H HD13 . LEU A 1 60 ? 2.420   -3.509  0.281   1.00 0.00 ? 144 LEU A HD13 6  
ATOM 6969  H HD21 . LEU A 1 60 ? 2.691   -5.751  -1.794  1.00 0.00 ? 144 LEU A HD21 6  
ATOM 6970  H HD22 . LEU A 1 60 ? 1.656   -4.326  -1.889  1.00 0.00 ? 144 LEU A HD22 6  
ATOM 6971  H HD23 . LEU A 1 60 ? 0.956   -5.938  -2.050  1.00 0.00 ? 144 LEU A HD23 6  
ATOM 6972  N N    . GLY A 1 61 ? 1.549   -9.546  -1.223  1.00 0.00 ? 145 GLY A N    6  
ATOM 6973  C CA   . GLY A 1 61 ? 1.951   -10.236 -2.434  1.00 0.00 ? 145 GLY A CA   6  
ATOM 6974  C C    . GLY A 1 61 ? 0.777   -10.724 -3.260  1.00 0.00 ? 145 GLY A C    6  
ATOM 6975  O O    . GLY A 1 61 ? 0.900   -10.900 -4.467  1.00 0.00 ? 145 GLY A O    6  
ATOM 6976  H H    . GLY A 1 61 ? 1.844   -9.887  -0.353  1.00 0.00 ? 145 GLY A H    6  
ATOM 6977  H HA2  . GLY A 1 61 ? 2.543   -9.563  -3.036  1.00 0.00 ? 145 GLY A HA2  6  
ATOM 6978  H HA3  . GLY A 1 61 ? 2.561   -11.085 -2.161  1.00 0.00 ? 145 GLY A HA3  6  
ATOM 6979  N N    . GLU A 1 62 ? -0.369  -10.923 -2.620  1.00 0.00 ? 146 GLU A N    6  
ATOM 6980  C CA   . GLU A 1 62 ? -1.547  -11.418 -3.321  1.00 0.00 ? 146 GLU A CA   6  
ATOM 6981  C C    . GLU A 1 62 ? -2.084  -10.359 -4.285  1.00 0.00 ? 146 GLU A C    6  
ATOM 6982  O O    . GLU A 1 62 ? -2.643  -10.684 -5.332  1.00 0.00 ? 146 GLU A O    6  
ATOM 6983  C CB   . GLU A 1 62 ? -2.628  -11.823 -2.320  1.00 0.00 ? 146 GLU A CB   6  
ATOM 6984  C CG   . GLU A 1 62 ? -3.783  -12.578 -2.951  1.00 0.00 ? 146 GLU A CG   6  
ATOM 6985  C CD   . GLU A 1 62 ? -4.798  -13.052 -1.938  1.00 0.00 ? 146 GLU A CD   6  
ATOM 6986  O OE1  . GLU A 1 62 ? -4.487  -13.989 -1.169  1.00 0.00 ? 146 GLU A OE1  6  
ATOM 6987  O OE2  . GLU A 1 62 ? -5.920  -12.506 -1.916  1.00 0.00 ? 146 GLU A OE2  6  
ATOM 6988  H H    . GLU A 1 62 ? -0.422  -10.739 -1.657  1.00 0.00 ? 146 GLU A H    6  
ATOM 6989  H HA   . GLU A 1 62 ? -1.250  -12.287 -3.889  1.00 0.00 ? 146 GLU A HA   6  
ATOM 6990  H HB2  . GLU A 1 62 ? -2.187  -12.452 -1.560  1.00 0.00 ? 146 GLU A HB2  6  
ATOM 6991  H HB3  . GLU A 1 62 ? -3.021  -10.933 -1.855  1.00 0.00 ? 146 GLU A HB3  6  
ATOM 6992  H HG2  . GLU A 1 62 ? -4.278  -11.927 -3.655  1.00 0.00 ? 146 GLU A HG2  6  
ATOM 6993  H HG3  . GLU A 1 62 ? -3.391  -13.438 -3.475  1.00 0.00 ? 146 GLU A HG3  6  
ATOM 6994  N N    . TYR A 1 63 ? -1.897  -9.095  -3.930  1.00 0.00 ? 147 TYR A N    6  
ATOM 6995  C CA   . TYR A 1 63 ? -2.350  -7.990  -4.770  1.00 0.00 ? 147 TYR A CA   6  
ATOM 6996  C C    . TYR A 1 63 ? -1.193  -7.410  -5.578  1.00 0.00 ? 147 TYR A C    6  
ATOM 6997  O O    . TYR A 1 63 ? -1.383  -6.884  -6.676  1.00 0.00 ? 147 TYR A O    6  
ATOM 6998  C CB   . TYR A 1 63 ? -2.971  -6.885  -3.913  1.00 0.00 ? 147 TYR A CB   6  
ATOM 6999  C CG   . TYR A 1 63 ? -4.176  -7.320  -3.109  1.00 0.00 ? 147 TYR A CG   6  
ATOM 7000  C CD1  . TYR A 1 63 ? -5.395  -7.573  -3.725  1.00 0.00 ? 147 TYR A CD1  6  
ATOM 7001  C CD2  . TYR A 1 63 ? -4.097  -7.464  -1.728  1.00 0.00 ? 147 TYR A CD2  6  
ATOM 7002  C CE1  . TYR A 1 63 ? -6.497  -7.961  -2.991  1.00 0.00 ? 147 TYR A CE1  6  
ATOM 7003  C CE2  . TYR A 1 63 ? -5.196  -7.849  -0.988  1.00 0.00 ? 147 TYR A CE2  6  
ATOM 7004  C CZ   . TYR A 1 63 ? -6.392  -8.094  -1.623  1.00 0.00 ? 147 TYR A CZ   6  
ATOM 7005  O OH   . TYR A 1 63 ? -7.489  -8.475  -0.891  1.00 0.00 ? 147 TYR A OH   6  
ATOM 7006  H H    . TYR A 1 63 ? -1.439  -8.895  -3.083  1.00 0.00 ? 147 TYR A H    6  
ATOM 7007  H HA   . TYR A 1 63 ? -3.096  -8.372  -5.450  1.00 0.00 ? 147 TYR A HA   6  
ATOM 7008  H HB2  . TYR A 1 63 ? -2.228  -6.523  -3.219  1.00 0.00 ? 147 TYR A HB2  6  
ATOM 7009  H HB3  . TYR A 1 63 ? -3.277  -6.071  -4.557  1.00 0.00 ? 147 TYR A HB3  6  
ATOM 7010  H HD1  . TYR A 1 63 ? -5.473  -7.469  -4.796  1.00 0.00 ? 147 TYR A HD1  6  
ATOM 7011  H HD2  . TYR A 1 63 ? -3.157  -7.270  -1.234  1.00 0.00 ? 147 TYR A HD2  6  
ATOM 7012  H HE1  . TYR A 1 63 ? -7.437  -8.153  -3.486  1.00 0.00 ? 147 TYR A HE1  6  
ATOM 7013  H HE2  . TYR A 1 63 ? -5.114  -7.957  0.084   1.00 0.00 ? 147 TYR A HE2  6  
ATOM 7014  H HH   . TYR A 1 63 ? -7.869  -9.271  -1.276  1.00 0.00 ? 147 TYR A HH   6  
ATOM 7015  N N    . GLY A 1 64 ? 0.008   -7.507  -5.023  1.00 0.00 ? 148 GLY A N    6  
ATOM 7016  C CA   . GLY A 1 64 ? 1.164   -6.887  -5.638  1.00 0.00 ? 148 GLY A CA   6  
ATOM 7017  C C    . GLY A 1 64 ? 2.027   -7.856  -6.422  1.00 0.00 ? 148 GLY A C    6  
ATOM 7018  O O    . GLY A 1 64 ? 3.081   -7.473  -6.900  1.00 0.00 ? 148 GLY A O    6  
ATOM 7019  H H    . GLY A 1 64 ? 0.108   -7.997  -4.178  1.00 0.00 ? 148 GLY A H    6  
ATOM 7020  H HA2  . GLY A 1 64 ? 0.826   -6.110  -6.308  1.00 0.00 ? 148 GLY A HA2  6  
ATOM 7021  H HA3  . GLY A 1 64 ? 1.766   -6.438  -4.863  1.00 0.00 ? 148 GLY A HA3  6  
ATOM 7022  N N    . LEU A 1 65 ? 1.575   -9.104  -6.550  1.00 0.00 ? 149 LEU A N    6  
ATOM 7023  C CA   . LEU A 1 65 ? 2.337   -10.167 -7.231  1.00 0.00 ? 149 LEU A CA   6  
ATOM 7024  C C    . LEU A 1 65 ? 2.931   -9.714  -8.570  1.00 0.00 ? 149 LEU A C    6  
ATOM 7025  O O    . LEU A 1 65 ? 3.999   -10.175 -8.970  1.00 0.00 ? 149 LEU A O    6  
ATOM 7026  C CB   . LEU A 1 65 ? 1.457   -11.412 -7.455  1.00 0.00 ? 149 LEU A CB   6  
ATOM 7027  C CG   . LEU A 1 65 ? 0.360   -11.291 -8.527  1.00 0.00 ? 149 LEU A CG   6  
ATOM 7028  C CD1  . LEU A 1 65 ? -0.307  -12.639 -8.745  1.00 0.00 ? 149 LEU A CD1  6  
ATOM 7029  C CD2  . LEU A 1 65 ? -0.679  -10.246 -8.134  1.00 0.00 ? 149 LEU A CD2  6  
ATOM 7030  H H    . LEU A 1 65 ? 0.707   -9.330  -6.156  1.00 0.00 ? 149 LEU A H    6  
ATOM 7031  H HA   . LEU A 1 65 ? 3.152   -10.442 -6.578  1.00 0.00 ? 149 LEU A HA   6  
ATOM 7032  H HB2  . LEU A 1 65 ? 2.103   -12.233 -7.729  1.00 0.00 ? 149 LEU A HB2  6  
ATOM 7033  H HB3  . LEU A 1 65 ? 0.981   -11.658 -6.517  1.00 0.00 ? 149 LEU A HB3  6  
ATOM 7034  H HG   . LEU A 1 65 ? 0.809   -10.987 -9.462  1.00 0.00 ? 149 LEU A HG   6  
ATOM 7035  H HD11 . LEU A 1 65 ? 0.427   -13.354 -9.086  1.00 0.00 ? 149 LEU A HD11 6  
ATOM 7036  H HD12 . LEU A 1 65 ? -1.087  -12.541 -9.486  1.00 0.00 ? 149 LEU A HD12 6  
ATOM 7037  H HD13 . LEU A 1 65 ? -0.737  -12.981 -7.815  1.00 0.00 ? 149 LEU A HD13 6  
ATOM 7038  H HD21 . LEU A 1 65 ? -1.160  -10.544 -7.214  1.00 0.00 ? 149 LEU A HD21 6  
ATOM 7039  H HD22 . LEU A 1 65 ? -1.418  -10.156 -8.916  1.00 0.00 ? 149 LEU A HD22 6  
ATOM 7040  H HD23 . LEU A 1 65 ? -0.187  -9.293  -7.988  1.00 0.00 ? 149 LEU A HD23 6  
ATOM 7041  N N    . LYS A 1 66 ? 2.240   -8.822  -9.262  1.00 0.00 ? 150 LYS A N    6  
ATOM 7042  C CA   . LYS A 1 66 ? 2.730   -8.313  -10.531 1.00 0.00 ? 150 LYS A CA   6  
ATOM 7043  C C    . LYS A 1 66 ? 3.429   -6.976  -10.329 1.00 0.00 ? 150 LYS A C    6  
ATOM 7044  O O    . LYS A 1 66 ? 2.799   -6.000  -9.909  1.00 0.00 ? 150 LYS A O    6  
ATOM 7045  C CB   . LYS A 1 66 ? 1.574   -8.159  -11.521 1.00 0.00 ? 150 LYS A CB   6  
ATOM 7046  C CG   . LYS A 1 66 ? 2.017   -7.799  -12.932 1.00 0.00 ? 150 LYS A CG   6  
ATOM 7047  C CD   . LYS A 1 66 ? 2.949   -8.851  -13.507 1.00 0.00 ? 150 LYS A CD   6  
ATOM 7048  C CE   . LYS A 1 66 ? 3.396   -8.497  -14.917 1.00 0.00 ? 150 LYS A CE   6  
ATOM 7049  N NZ   . LYS A 1 66 ? 2.258   -8.483  -15.875 1.00 0.00 ? 150 LYS A NZ   6  
ATOM 7050  H H    . LYS A 1 66 ? 1.392   -8.491  -8.906  1.00 0.00 ? 150 LYS A H    6  
ATOM 7051  H HA   . LYS A 1 66 ? 3.441   -9.026  -10.925 1.00 0.00 ? 150 LYS A HA   6  
ATOM 7052  H HB2  . LYS A 1 66 ? 1.029   -9.090  -11.565 1.00 0.00 ? 150 LYS A HB2  6  
ATOM 7053  H HB3  . LYS A 1 66 ? 0.913   -7.382  -11.166 1.00 0.00 ? 150 LYS A HB3  6  
ATOM 7054  H HG2  . LYS A 1 66 ? 1.145   -7.724  -13.563 1.00 0.00 ? 150 LYS A HG2  6  
ATOM 7055  H HG3  . LYS A 1 66 ? 2.530   -6.849  -12.907 1.00 0.00 ? 150 LYS A HG3  6  
ATOM 7056  H HD2  . LYS A 1 66 ? 3.821   -8.933  -12.873 1.00 0.00 ? 150 LYS A HD2  6  
ATOM 7057  H HD3  . LYS A 1 66 ? 2.432   -9.798  -13.532 1.00 0.00 ? 150 LYS A HD3  6  
ATOM 7058  H HE2  . LYS A 1 66 ? 3.853   -7.518  -14.900 1.00 0.00 ? 150 LYS A HE2  6  
ATOM 7059  H HE3  . LYS A 1 66 ? 4.123   -9.226  -15.244 1.00 0.00 ? 150 LYS A HE3  6  
ATOM 7060  H HZ1  . LYS A 1 66 ? 1.601   -7.704  -15.648 1.00 0.00 ? 150 LYS A HZ1  6  
ATOM 7061  H HZ2  . LYS A 1 66 ? 1.735   -9.383  -15.825 1.00 0.00 ? 150 LYS A HZ2  6  
ATOM 7062  H HZ3  . LYS A 1 66 ? 2.609   -8.351  -16.850 1.00 0.00 ? 150 LYS A HZ3  6  
ATOM 7063  N N    . PRO A 1 67 ? 4.743   -6.913  -10.619 1.00 0.00 ? 151 PRO A N    6  
ATOM 7064  C CA   . PRO A 1 67 ? 5.531   -5.683  -10.505 1.00 0.00 ? 151 PRO A CA   6  
ATOM 7065  C C    . PRO A 1 67 ? 5.083   -4.629  -11.509 1.00 0.00 ? 151 PRO A C    6  
ATOM 7066  O O    . PRO A 1 67 ? 5.706   -4.440  -12.556 1.00 0.00 ? 151 PRO A O    6  
ATOM 7067  C CB   . PRO A 1 67 ? 6.973   -6.129  -10.791 1.00 0.00 ? 151 PRO A CB   6  
ATOM 7068  C CG   . PRO A 1 67 ? 6.955   -7.617  -10.692 1.00 0.00 ? 151 PRO A CG   6  
ATOM 7069  C CD   . PRO A 1 67 ? 5.568   -8.042  -11.074 1.00 0.00 ? 151 PRO A CD   6  
ATOM 7070  H HA   . PRO A 1 67 ? 5.470   -5.270  -9.508  1.00 0.00 ? 151 PRO A HA   6  
ATOM 7071  H HB2  . PRO A 1 67 ? 7.259   -5.805  -11.780 1.00 0.00 ? 151 PRO A HB2  6  
ATOM 7072  H HB3  . PRO A 1 67 ? 7.637   -5.694  -10.059 1.00 0.00 ? 151 PRO A HB3  6  
ATOM 7073  H HG2  . PRO A 1 67 ? 7.679   -8.038  -11.374 1.00 0.00 ? 151 PRO A HG2  6  
ATOM 7074  H HG3  . PRO A 1 67 ? 7.175   -7.921  -9.679  1.00 0.00 ? 151 PRO A HG3  6  
ATOM 7075  H HD2  . PRO A 1 67 ? 5.493   -8.172  -12.144 1.00 0.00 ? 151 PRO A HD2  6  
ATOM 7076  H HD3  . PRO A 1 67 ? 5.295   -8.953  -10.559 1.00 0.00 ? 151 PRO A HD3  6  
ATOM 7077  N N    . LEU A 1 68 ? 3.996   -3.955  -11.164 1.00 0.00 ? 152 LEU A N    6  
ATOM 7078  C CA   . LEU A 1 68 ? 3.331   -2.995  -12.038 1.00 0.00 ? 152 LEU A CA   6  
ATOM 7079  C C    . LEU A 1 68 ? 2.026   -2.549  -11.388 1.00 0.00 ? 152 LEU A C    6  
ATOM 7080  O O    . LEU A 1 68 ? 1.514   -1.466  -11.674 1.00 0.00 ? 152 LEU A O    6  
ATOM 7081  C CB   . LEU A 1 68 ? 3.036   -3.607  -13.416 1.00 0.00 ? 152 LEU A CB   6  
ATOM 7082  C CG   . LEU A 1 68 ? 2.440   -2.645  -14.447 1.00 0.00 ? 152 LEU A CG   6  
ATOM 7083  C CD1  . LEU A 1 68 ? 3.413   -1.512  -14.742 1.00 0.00 ? 152 LEU A CD1  6  
ATOM 7084  C CD2  . LEU A 1 68 ? 2.089   -3.388  -15.725 1.00 0.00 ? 152 LEU A CD2  6  
ATOM 7085  H H    . LEU A 1 68 ? 3.631   -4.101  -10.267 1.00 0.00 ? 152 LEU A H    6  
ATOM 7086  H HA   . LEU A 1 68 ? 3.979   -2.139  -12.155 1.00 0.00 ? 152 LEU A HA   6  
ATOM 7087  H HB2  . LEU A 1 68 ? 3.961   -3.998  -13.816 1.00 0.00 ? 152 LEU A HB2  6  
ATOM 7088  H HB3  . LEU A 1 68 ? 2.347   -4.428  -13.282 1.00 0.00 ? 152 LEU A HB3  6  
ATOM 7089  H HG   . LEU A 1 68 ? 1.533   -2.214  -14.047 1.00 0.00 ? 152 LEU A HG   6  
ATOM 7090  H HD11 . LEU A 1 68 ? 3.600   -0.951  -13.835 1.00 0.00 ? 152 LEU A HD11 6  
ATOM 7091  H HD12 . LEU A 1 68 ? 2.988   -0.856  -15.487 1.00 0.00 ? 152 LEU A HD12 6  
ATOM 7092  H HD13 . LEU A 1 68 ? 4.341   -1.922  -15.109 1.00 0.00 ? 152 LEU A HD13 6  
ATOM 7093  H HD21 . LEU A 1 68 ? 2.986   -3.817  -16.150 1.00 0.00 ? 152 LEU A HD21 6  
ATOM 7094  H HD22 . LEU A 1 68 ? 1.648   -2.702  -16.432 1.00 0.00 ? 152 LEU A HD22 6  
ATOM 7095  H HD23 . LEU A 1 68 ? 1.385   -4.178  -15.502 1.00 0.00 ? 152 LEU A HD23 6  
ATOM 7096  N N    . SER A 1 69 ? 1.487   -3.411  -10.520 1.00 0.00 ? 153 SER A N    6  
ATOM 7097  C CA   . SER A 1 69 ? 0.288   -3.101  -9.748  1.00 0.00 ? 153 SER A CA   6  
ATOM 7098  C C    . SER A 1 69 ? 0.383   -1.702  -9.140  1.00 0.00 ? 153 SER A C    6  
ATOM 7099  O O    . SER A 1 69 ? 1.284   -1.411  -8.343  1.00 0.00 ? 153 SER A O    6  
ATOM 7100  C CB   . SER A 1 69 ? 0.105   -4.154  -8.649  1.00 0.00 ? 153 SER A CB   6  
ATOM 7101  O OG   . SER A 1 69 ? -1.154  -4.025  -8.014  1.00 0.00 ? 153 SER A OG   6  
ATOM 7102  H H    . SER A 1 69 ? 1.897   -4.296  -10.413 1.00 0.00 ? 153 SER A H    6  
ATOM 7103  H HA   . SER A 1 69 ? -0.558  -3.137  -10.417 1.00 0.00 ? 153 SER A HA   6  
ATOM 7104  H HB2  . SER A 1 69 ? 0.175   -5.140  -9.085  1.00 0.00 ? 153 SER A HB2  6  
ATOM 7105  H HB3  . SER A 1 69 ? 0.881   -4.035  -7.909  1.00 0.00 ? 153 SER A HB3  6  
ATOM 7106  H HG   . SER A 1 69 ? -1.385  -4.859  -7.589  1.00 0.00 ? 153 SER A HG   6  
ATOM 7107  N N    . THR A 1 70 ? -0.531  -0.831  -9.549  1.00 0.00 ? 154 THR A N    6  
ATOM 7108  C CA   . THR A 1 70 ? -0.504  0.556   -9.129  1.00 0.00 ? 154 THR A CA   6  
ATOM 7109  C C    . THR A 1 70 ? -1.662  0.867   -8.183  1.00 0.00 ? 154 THR A C    6  
ATOM 7110  O O    . THR A 1 70 ? -2.834  0.707   -8.535  1.00 0.00 ? 154 THR A O    6  
ATOM 7111  C CB   . THR A 1 70 ? -0.566  1.498   -10.346 1.00 0.00 ? 154 THR A CB   6  
ATOM 7112  O OG1  . THR A 1 70 ? 0.429   1.116   -11.307 1.00 0.00 ? 154 THR A OG1  6  
ATOM 7113  C CG2  . THR A 1 70 ? -0.331  2.945   -9.930  1.00 0.00 ? 154 THR A CG2  6  
ATOM 7114  H H    . THR A 1 70 ? -1.249  -1.134  -10.140 1.00 0.00 ? 154 THR A H    6  
ATOM 7115  H HA   . THR A 1 70 ? 0.428   0.730   -8.611  1.00 0.00 ? 154 THR A HA   6  
ATOM 7116  H HB   . THR A 1 70 ? -1.544  1.422   -10.798 1.00 0.00 ? 154 THR A HB   6  
ATOM 7117  H HG1  . THR A 1 70 ? 0.676   0.193   -11.167 1.00 0.00 ? 154 THR A HG1  6  
ATOM 7118  H HG21 . THR A 1 70 ? -0.391  3.583   -10.800 1.00 0.00 ? 154 THR A HG21 6  
ATOM 7119  H HG22 . THR A 1 70 ? 0.648   3.035   -9.485  1.00 0.00 ? 154 THR A HG22 6  
ATOM 7120  H HG23 . THR A 1 70 ? -1.082  3.240   -9.214  1.00 0.00 ? 154 THR A HG23 6  
ATOM 7121  N N    . VAL A 1 71 ? -1.324  1.300   -6.982  1.00 0.00 ? 155 VAL A N    6  
ATOM 7122  C CA   . VAL A 1 71 ? -2.318  1.680   -5.996  1.00 0.00 ? 155 VAL A CA   6  
ATOM 7123  C C    . VAL A 1 71 ? -2.494  3.195   -6.004  1.00 0.00 ? 155 VAL A C    6  
ATOM 7124  O O    . VAL A 1 71 ? -1.512  3.937   -6.073  1.00 0.00 ? 155 VAL A O    6  
ATOM 7125  C CB   . VAL A 1 71 ? -1.911  1.212   -4.580  1.00 0.00 ? 155 VAL A CB   6  
ATOM 7126  C CG1  . VAL A 1 71 ? -3.002  1.520   -3.568  1.00 0.00 ? 155 VAL A CG1  6  
ATOM 7127  C CG2  . VAL A 1 71 ? -1.581  -0.277  -4.577  1.00 0.00 ? 155 VAL A CG2  6  
ATOM 7128  H H    . VAL A 1 71 ? -0.369  1.379   -6.757  1.00 0.00 ? 155 VAL A H    6  
ATOM 7129  H HA   . VAL A 1 71 ? -3.257  1.213   -6.259  1.00 0.00 ? 155 VAL A HA   6  
ATOM 7130  H HB   . VAL A 1 71 ? -1.023  1.753   -4.289  1.00 0.00 ? 155 VAL A HB   6  
ATOM 7131  H HG11 . VAL A 1 71 ? -3.188  2.583   -3.552  1.00 0.00 ? 155 VAL A HG11 6  
ATOM 7132  H HG12 . VAL A 1 71 ? -2.685  1.193   -2.588  1.00 0.00 ? 155 VAL A HG12 6  
ATOM 7133  H HG13 . VAL A 1 71 ? -3.908  1.001   -3.844  1.00 0.00 ? 155 VAL A HG13 6  
ATOM 7134  H HG21 . VAL A 1 71 ? -1.281  -0.576  -3.584  1.00 0.00 ? 155 VAL A HG21 6  
ATOM 7135  H HG22 . VAL A 1 71 ? -0.774  -0.467  -5.268  1.00 0.00 ? 155 VAL A HG22 6  
ATOM 7136  H HG23 . VAL A 1 71 ? -2.451  -0.840  -4.876  1.00 0.00 ? 155 VAL A HG23 6  
ATOM 7137  N N    . PHE A 1 72 ? -3.737  3.650   -5.961  1.00 0.00 ? 156 PHE A N    6  
ATOM 7138  C CA   . PHE A 1 72 ? -4.023  5.077   -5.974  1.00 0.00 ? 156 PHE A CA   6  
ATOM 7139  C C    . PHE A 1 72 ? -4.596  5.525   -4.640  1.00 0.00 ? 156 PHE A C    6  
ATOM 7140  O O    . PHE A 1 72 ? -5.592  4.977   -4.165  1.00 0.00 ? 156 PHE A O    6  
ATOM 7141  C CB   . PHE A 1 72 ? -4.996  5.423   -7.102  1.00 0.00 ? 156 PHE A CB   6  
ATOM 7142  C CG   . PHE A 1 72 ? -4.409  5.276   -8.476  1.00 0.00 ? 156 PHE A CG   6  
ATOM 7143  C CD1  . PHE A 1 72 ? -3.754  6.340   -9.077  1.00 0.00 ? 156 PHE A CD1  6  
ATOM 7144  C CD2  . PHE A 1 72 ? -4.507  4.077   -9.168  1.00 0.00 ? 156 PHE A CD2  6  
ATOM 7145  C CE1  . PHE A 1 72 ? -3.209  6.211   -10.341 1.00 0.00 ? 156 PHE A CE1  6  
ATOM 7146  C CE2  . PHE A 1 72 ? -3.964  3.945   -10.431 1.00 0.00 ? 156 PHE A CE2  6  
ATOM 7147  C CZ   . PHE A 1 72 ? -3.314  5.013   -11.018 1.00 0.00 ? 156 PHE A CZ   6  
ATOM 7148  H H    . PHE A 1 72 ? -4.482  3.011   -5.905  1.00 0.00 ? 156 PHE A H    6  
ATOM 7149  H HA   . PHE A 1 72 ? -3.091  5.597   -6.145  1.00 0.00 ? 156 PHE A HA   6  
ATOM 7150  H HB2  . PHE A 1 72 ? -5.855  4.772   -7.037  1.00 0.00 ? 156 PHE A HB2  6  
ATOM 7151  H HB3  . PHE A 1 72 ? -5.319  6.447   -6.984  1.00 0.00 ? 156 PHE A HB3  6  
ATOM 7152  H HD1  . PHE A 1 72 ? -3.671  7.278   -8.548  1.00 0.00 ? 156 PHE A HD1  6  
ATOM 7153  H HD2  . PHE A 1 72 ? -5.016  3.244   -8.711  1.00 0.00 ? 156 PHE A HD2  6  
ATOM 7154  H HE1  . PHE A 1 72 ? -2.702  7.048   -10.799 1.00 0.00 ? 156 PHE A HE1  6  
ATOM 7155  H HE2  . PHE A 1 72 ? -4.047  3.006   -10.957 1.00 0.00 ? 156 PHE A HE2  6  
ATOM 7156  H HZ   . PHE A 1 72 ? -2.888  4.912   -12.005 1.00 0.00 ? 156 PHE A HZ   6  
ATOM 7157  N N    . MET A 1 73 ? -3.959  6.517   -4.036  1.00 0.00 ? 157 MET A N    6  
ATOM 7158  C CA   . MET A 1 73 ? -4.433  7.075   -2.777  1.00 0.00 ? 157 MET A CA   6  
ATOM 7159  C C    . MET A 1 73 ? -5.648  7.964   -3.005  1.00 0.00 ? 157 MET A C    6  
ATOM 7160  O O    . MET A 1 73 ? -5.615  8.884   -3.822  1.00 0.00 ? 157 MET A O    6  
ATOM 7161  C CB   . MET A 1 73 ? -3.335  7.883   -2.087  1.00 0.00 ? 157 MET A CB   6  
ATOM 7162  C CG   . MET A 1 73 ? -2.229  7.037   -1.481  1.00 0.00 ? 157 MET A CG   6  
ATOM 7163  S SD   . MET A 1 73 ? -0.895  8.054   -0.826  1.00 0.00 ? 157 MET A SD   6  
ATOM 7164  C CE   . MET A 1 73 ? 0.274   6.800   -0.314  1.00 0.00 ? 157 MET A CE   6  
ATOM 7165  H H    . MET A 1 73 ? -3.147  6.888   -4.451  1.00 0.00 ? 157 MET A H    6  
ATOM 7166  H HA   . MET A 1 73 ? -4.719  6.255   -2.139  1.00 0.00 ? 157 MET A HA   6  
ATOM 7167  H HB2  . MET A 1 73 ? -2.890  8.554   -2.806  1.00 0.00 ? 157 MET A HB2  6  
ATOM 7168  H HB3  . MET A 1 73 ? -3.781  8.466   -1.295  1.00 0.00 ? 157 MET A HB3  6  
ATOM 7169  H HG2  . MET A 1 73 ? -2.646  6.453   -0.675  1.00 0.00 ? 157 MET A HG2  6  
ATOM 7170  H HG3  . MET A 1 73 ? -1.832  6.375   -2.236  1.00 0.00 ? 157 MET A HG3  6  
ATOM 7171  H HE1  . MET A 1 73 ? 1.149   7.274   0.103   1.00 0.00 ? 157 MET A HE1  6  
ATOM 7172  H HE2  . MET A 1 73 ? 0.557   6.202   -1.168  1.00 0.00 ? 157 MET A HE2  6  
ATOM 7173  H HE3  . MET A 1 73 ? -0.183  6.168   0.433   1.00 0.00 ? 157 MET A HE3  6  
ATOM 7174  N N    . ASN A 1 74 ? -6.713  7.682   -2.280  1.00 0.00 ? 158 ASN A N    6  
ATOM 7175  C CA   . ASN A 1 74 ? -7.919  8.487   -2.346  1.00 0.00 ? 158 ASN A CA   6  
ATOM 7176  C C    . ASN A 1 74 ? -8.039  9.354   -1.101  1.00 0.00 ? 158 ASN A C    6  
ATOM 7177  O O    . ASN A 1 74 ? -7.526  9.002   -0.036  1.00 0.00 ? 158 ASN A O    6  
ATOM 7178  C CB   . ASN A 1 74 ? -9.153  7.591   -2.485  1.00 0.00 ? 158 ASN A CB   6  
ATOM 7179  C CG   . ASN A 1 74 ? -9.733  7.617   -3.887  1.00 0.00 ? 158 ASN A CG   6  
ATOM 7180  O OD1  . ASN A 1 74 ? -10.534 8.487   -4.225  1.00 0.00 ? 158 ASN A OD1  6  
ATOM 7181  N ND2  . ASN A 1 74 ? -9.351  6.648   -4.705  1.00 0.00 ? 158 ASN A ND2  6  
ATOM 7182  H H    . ASN A 1 74 ? -6.690  6.914   -1.668  1.00 0.00 ? 158 ASN A H    6  
ATOM 7183  H HA   . ASN A 1 74 ? -7.846  9.126   -3.213  1.00 0.00 ? 158 ASN A HA   6  
ATOM 7184  H HB2  . ASN A 1 74 ? -8.878  6.574   -2.250  1.00 0.00 ? 158 ASN A HB2  6  
ATOM 7185  H HB3  . ASN A 1 74 ? -9.908  7.919   -1.792  1.00 0.00 ? 158 ASN A HB3  6  
ATOM 7186  H HD21 . ASN A 1 74 ? -8.725  5.973   -4.367  1.00 0.00 ? 158 ASN A HD21 6  
ATOM 7187  H HD22 . ASN A 1 74 ? -9.710  6.644   -5.620  1.00 0.00 ? 158 ASN A HD22 6  
ATOM 7188  N N    . LEU A 1 75 ? -8.700  10.491  -1.240  1.00 0.00 ? 159 LEU A N    6  
ATOM 7189  C CA   . LEU A 1 75 ? -8.893  11.399  -0.121  1.00 0.00 ? 159 LEU A CA   6  
ATOM 7190  C C    . LEU A 1 75 ? -10.372 11.518  0.217   1.00 0.00 ? 159 LEU A C    6  
ATOM 7191  O O    . LEU A 1 75 ? -11.228 11.474  -0.669  1.00 0.00 ? 159 LEU A O    6  
ATOM 7192  C CB   . LEU A 1 75 ? -8.317  12.784  -0.434  1.00 0.00 ? 159 LEU A CB   6  
ATOM 7193  C CG   . LEU A 1 75 ? -6.795  12.845  -0.601  1.00 0.00 ? 159 LEU A CG   6  
ATOM 7194  C CD1  . LEU A 1 75 ? -6.349  14.270  -0.892  1.00 0.00 ? 159 LEU A CD1  6  
ATOM 7195  C CD2  . LEU A 1 75 ? -6.101  12.314  0.644   1.00 0.00 ? 159 LEU A CD2  6  
ATOM 7196  H H    . LEU A 1 75 ? -9.083  10.723  -2.111  1.00 0.00 ? 159 LEU A H    6  
ATOM 7197  H HA   . LEU A 1 75 ? -8.376  10.988  0.734   1.00 0.00 ? 159 LEU A HA   6  
ATOM 7198  H HB2  . LEU A 1 75 ? -8.772  13.139  -1.348  1.00 0.00 ? 159 LEU A HB2  6  
ATOM 7199  H HB3  . LEU A 1 75 ? -8.593  13.454  0.368   1.00 0.00 ? 159 LEU A HB3  6  
ATOM 7200  H HG   . LEU A 1 75 ? -6.505  12.225  -1.439  1.00 0.00 ? 159 LEU A HG   6  
ATOM 7201  H HD11 . LEU A 1 75 ? -6.659  14.917  -0.084  1.00 0.00 ? 159 LEU A HD11 6  
ATOM 7202  H HD12 . LEU A 1 75 ? -6.796  14.607  -1.816  1.00 0.00 ? 159 LEU A HD12 6  
ATOM 7203  H HD13 . LEU A 1 75 ? -5.273  14.299  -0.982  1.00 0.00 ? 159 LEU A HD13 6  
ATOM 7204  H HD21 . LEU A 1 75 ? -5.031  12.377  0.514   1.00 0.00 ? 159 LEU A HD21 6  
ATOM 7205  H HD22 . LEU A 1 75 ? -6.385  11.283  0.802   1.00 0.00 ? 159 LEU A HD22 6  
ATOM 7206  H HD23 . LEU A 1 75 ? -6.395  12.904  1.500   1.00 0.00 ? 159 LEU A HD23 6  
ATOM 7207  N N    . ARG A 1 76 ? -10.658 11.659  1.499   1.00 0.00 ? 160 ARG A N    6  
ATOM 7208  C CA   . ARG A 1 76 ? -12.025 11.784  1.980   1.00 0.00 ? 160 ARG A CA   6  
ATOM 7209  C C    . ARG A 1 76 ? -12.550 13.197  1.728   1.00 0.00 ? 160 ARG A C    6  
ATOM 7210  O O    . ARG A 1 76 ? -11.767 14.138  1.584   1.00 0.00 ? 160 ARG A O    6  
ATOM 7211  C CB   . ARG A 1 76 ? -12.065 11.454  3.475   1.00 0.00 ? 160 ARG A CB   6  
ATOM 7212  C CG   . ARG A 1 76 ? -13.456 11.464  4.083   1.00 0.00 ? 160 ARG A CG   6  
ATOM 7213  C CD   . ARG A 1 76 ? -13.413 11.128  5.559   1.00 0.00 ? 160 ARG A CD   6  
ATOM 7214  N NE   . ARG A 1 76 ? -14.739 11.175  6.169   1.00 0.00 ? 160 ARG A NE   6  
ATOM 7215  C CZ   . ARG A 1 76 ? -15.199 10.257  7.014   1.00 0.00 ? 160 ARG A CZ   6  
ATOM 7216  N NH1  . ARG A 1 76 ? -14.454 9.201   7.319   1.00 0.00 ? 160 ARG A NH1  6  
ATOM 7217  N NH2  . ARG A 1 76 ? -16.413 10.383  7.540   1.00 0.00 ? 160 ARG A NH2  6  
ATOM 7218  H H    . ARG A 1 76 ? -9.921  11.680  2.150   1.00 0.00 ? 160 ARG A H    6  
ATOM 7219  H HA   . ARG A 1 76 ? -12.638 11.078  1.441   1.00 0.00 ? 160 ARG A HA   6  
ATOM 7220  H HB2  . ARG A 1 76 ? -11.644 10.471  3.620   1.00 0.00 ? 160 ARG A HB2  6  
ATOM 7221  H HB3  . ARG A 1 76 ? -11.460 12.175  4.005   1.00 0.00 ? 160 ARG A HB3  6  
ATOM 7222  H HG2  . ARG A 1 76 ? -13.890 12.445  3.958   1.00 0.00 ? 160 ARG A HG2  6  
ATOM 7223  H HG3  . ARG A 1 76 ? -14.064 10.730  3.572   1.00 0.00 ? 160 ARG A HG3  6  
ATOM 7224  H HD2  . ARG A 1 76 ? -13.007 10.136  5.679   1.00 0.00 ? 160 ARG A HD2  6  
ATOM 7225  H HD3  . ARG A 1 76 ? -12.772 11.841  6.059   1.00 0.00 ? 160 ARG A HD3  6  
ATOM 7226  H HE   . ARG A 1 76 ? -15.315 11.945  5.935   1.00 0.00 ? 160 ARG A HE   6  
ATOM 7227  H HH11 . ARG A 1 76 ? -13.544 9.091   6.914   1.00 0.00 ? 160 ARG A HH11 6  
ATOM 7228  H HH12 . ARG A 1 76 ? -14.803 8.503   7.961   1.00 0.00 ? 160 ARG A HH12 6  
ATOM 7229  H HH21 . ARG A 1 76 ? -16.990 11.176  7.302   1.00 0.00 ? 160 ARG A HH21 6  
ATOM 7230  H HH22 . ARG A 1 76 ? -16.758 9.690   8.178   1.00 0.00 ? 160 ARG A HH22 6  
ATOM 7231  N N    . ASP A 1 2  ? 15.748  -11.898 -0.836  1.00 0.00 ? 86  ASP A N    7  
ATOM 7232  C CA   . ASP A 1 2  ? 14.901  -11.030 -0.029  1.00 0.00 ? 86  ASP A CA   7  
ATOM 7233  C C    . ASP A 1 2  ? 13.538  -10.878 -0.686  1.00 0.00 ? 86  ASP A C    7  
ATOM 7234  O O    . ASP A 1 2  ? 12.610  -10.345 -0.085  1.00 0.00 ? 86  ASP A O    7  
ATOM 7235  C CB   . ASP A 1 2  ? 15.554  -9.654  0.149   1.00 0.00 ? 86  ASP A CB   7  
ATOM 7236  C CG   . ASP A 1 2  ? 16.931  -9.738  0.777   1.00 0.00 ? 86  ASP A CG   7  
ATOM 7237  O OD1  . ASP A 1 2  ? 17.022  -9.809  2.022   1.00 0.00 ? 86  ASP A OD1  7  
ATOM 7238  O OD2  . ASP A 1 2  ? 17.930  -9.749  0.027   1.00 0.00 ? 86  ASP A OD2  7  
ATOM 7239  H H    . ASP A 1 2  ? 16.209  -11.519 -1.619  1.00 0.00 ? 86  ASP A H    7  
ATOM 7240  H HA   . ASP A 1 2  ? 14.774  -11.492 0.940   1.00 0.00 ? 86  ASP A HA   7  
ATOM 7241  H HB2  . ASP A 1 2  ? 15.650  -9.183  -0.817  1.00 0.00 ? 86  ASP A HB2  7  
ATOM 7242  H HB3  . ASP A 1 2  ? 14.927  -9.045  0.782   1.00 0.00 ? 86  ASP A HB3  7  
ATOM 7243  N N    . GLU A 1 3  ? 13.457  -11.355 -1.934  1.00 0.00 ? 87  GLU A N    7  
ATOM 7244  C CA   . GLU A 1 3  ? 12.230  -11.354 -2.748  1.00 0.00 ? 87  GLU A CA   7  
ATOM 7245  C C    . GLU A 1 3  ? 11.319  -10.140 -2.497  1.00 0.00 ? 87  GLU A C    7  
ATOM 7246  O O    . GLU A 1 3  ? 10.208  -10.276 -1.976  1.00 0.00 ? 87  GLU A O    7  
ATOM 7247  C CB   . GLU A 1 3  ? 11.451  -12.669 -2.565  1.00 0.00 ? 87  GLU A CB   7  
ATOM 7248  C CG   . GLU A 1 3  ? 11.044  -12.982 -1.132  1.00 0.00 ? 87  GLU A CG   7  
ATOM 7249  C CD   . GLU A 1 3  ? 10.273  -14.280 -1.025  1.00 0.00 ? 87  GLU A CD   7  
ATOM 7250  O OE1  . GLU A 1 3  ? 9.074   -14.299 -1.377  1.00 0.00 ? 87  GLU A OE1  7  
ATOM 7251  O OE2  . GLU A 1 3  ? 10.868  -15.294 -0.602  1.00 0.00 ? 87  GLU A OE2  7  
ATOM 7252  H H    . GLU A 1 3  ? 14.269  -11.729 -2.334  1.00 0.00 ? 87  GLU A H    7  
ATOM 7253  H HA   . GLU A 1 3  ? 12.551  -11.305 -3.778  1.00 0.00 ? 87  GLU A HA   7  
ATOM 7254  H HB2  . GLU A 1 3  ? 10.554  -12.620 -3.163  1.00 0.00 ? 87  GLU A HB2  7  
ATOM 7255  H HB3  . GLU A 1 3  ? 12.064  -13.482 -2.926  1.00 0.00 ? 87  GLU A HB3  7  
ATOM 7256  H HG2  . GLU A 1 3  ? 11.934  -13.058 -0.525  1.00 0.00 ? 87  GLU A HG2  7  
ATOM 7257  H HG3  . GLU A 1 3  ? 10.423  -12.179 -0.762  1.00 0.00 ? 87  GLU A HG3  7  
ATOM 7258  N N    . PRO A 1 4  ? 11.776  -8.932  -2.857  1.00 0.00 ? 88  PRO A N    7  
ATOM 7259  C CA   . PRO A 1 4  ? 10.964  -7.733  -2.726  1.00 0.00 ? 88  PRO A CA   7  
ATOM 7260  C C    . PRO A 1 4  ? 10.041  -7.535  -3.928  1.00 0.00 ? 88  PRO A C    7  
ATOM 7261  O O    . PRO A 1 4  ? 10.364  -7.925  -5.052  1.00 0.00 ? 88  PRO A O    7  
ATOM 7262  C CB   . PRO A 1 4  ? 12.010  -6.624  -2.649  1.00 0.00 ? 88  PRO A CB   7  
ATOM 7263  C CG   . PRO A 1 4  ? 13.146  -7.122  -3.477  1.00 0.00 ? 88  PRO A CG   7  
ATOM 7264  C CD   . PRO A 1 4  ? 13.111  -8.630  -3.404  1.00 0.00 ? 88  PRO A CD   7  
ATOM 7265  H HA   . PRO A 1 4  ? 10.377  -7.751  -1.813  1.00 0.00 ? 88  PRO A HA   7  
ATOM 7266  H HB2  . PRO A 1 4  ? 11.596  -5.709  -3.049  1.00 0.00 ? 88  PRO A HB2  7  
ATOM 7267  H HB3  . PRO A 1 4  ? 12.307  -6.473  -1.621  1.00 0.00 ? 88  PRO A HB3  7  
ATOM 7268  H HG2  . PRO A 1 4  ? 13.022  -6.797  -4.501  1.00 0.00 ? 88  PRO A HG2  7  
ATOM 7269  H HG3  . PRO A 1 4  ? 14.079  -6.751  -3.078  1.00 0.00 ? 88  PRO A HG3  7  
ATOM 7270  H HD2  . PRO A 1 4  ? 13.226  -9.057  -4.390  1.00 0.00 ? 88  PRO A HD2  7  
ATOM 7271  H HD3  . PRO A 1 4  ? 13.886  -8.990  -2.744  1.00 0.00 ? 88  PRO A HD3  7  
ATOM 7272  N N    . LEU A 1 5  ? 8.899   -6.933  -3.672  1.00 0.00 ? 89  LEU A N    7  
ATOM 7273  C CA   . LEU A 1 5  ? 7.904   -6.674  -4.691  1.00 0.00 ? 89  LEU A CA   7  
ATOM 7274  C C    . LEU A 1 5  ? 7.819   -5.183  -4.962  1.00 0.00 ? 89  LEU A C    7  
ATOM 7275  O O    . LEU A 1 5  ? 7.599   -4.384  -4.050  1.00 0.00 ? 89  LEU A O    7  
ATOM 7276  C CB   . LEU A 1 5  ? 6.544   -7.193  -4.235  1.00 0.00 ? 89  LEU A CB   7  
ATOM 7277  C CG   . LEU A 1 5  ? 5.385   -6.879  -5.176  1.00 0.00 ? 89  LEU A CG   7  
ATOM 7278  C CD1  . LEU A 1 5  ? 5.514   -7.665  -6.474  1.00 0.00 ? 89  LEU A CD1  7  
ATOM 7279  C CD2  . LEU A 1 5  ? 4.066   -7.171  -4.487  1.00 0.00 ? 89  LEU A CD2  7  
ATOM 7280  H H    . LEU A 1 5  ? 8.717   -6.633  -2.750  1.00 0.00 ? 89  LEU A H    7  
ATOM 7281  H HA   . LEU A 1 5  ? 8.198   -7.183  -5.594  1.00 0.00 ? 89  LEU A HA   7  
ATOM 7282  H HB2  . LEU A 1 5  ? 6.610   -8.267  -4.125  1.00 0.00 ? 89  LEU A HB2  7  
ATOM 7283  H HB3  . LEU A 1 5  ? 6.322   -6.762  -3.271  1.00 0.00 ? 89  LEU A HB3  7  
ATOM 7284  H HG   . LEU A 1 5  ? 5.408   -5.827  -5.421  1.00 0.00 ? 89  LEU A HG   7  
ATOM 7285  H HD11 . LEU A 1 5  ? 6.432   -7.392  -6.971  1.00 0.00 ? 89  LEU A HD11 7  
ATOM 7286  H HD12 . LEU A 1 5  ? 4.674   -7.439  -7.117  1.00 0.00 ? 89  LEU A HD12 7  
ATOM 7287  H HD13 . LEU A 1 5  ? 5.524   -8.723  -6.256  1.00 0.00 ? 89  LEU A HD13 7  
ATOM 7288  H HD21 . LEU A 1 5  ? 4.034   -8.211  -4.198  1.00 0.00 ? 89  LEU A HD21 7  
ATOM 7289  H HD22 . LEU A 1 5  ? 3.253   -6.961  -5.168  1.00 0.00 ? 89  LEU A HD22 7  
ATOM 7290  H HD23 . LEU A 1 5  ? 3.973   -6.550  -3.610  1.00 0.00 ? 89  LEU A HD23 7  
ATOM 7291  N N    . SER A 1 6  ? 8.012   -4.816  -6.208  1.00 0.00 ? 90  SER A N    7  
ATOM 7292  C CA   . SER A 1 6  ? 7.975   -3.431  -6.608  1.00 0.00 ? 90  SER A CA   7  
ATOM 7293  C C    . SER A 1 6  ? 6.567   -3.019  -7.021  1.00 0.00 ? 90  SER A C    7  
ATOM 7294  O O    . SER A 1 6  ? 6.133   -3.311  -8.135  1.00 0.00 ? 90  SER A O    7  
ATOM 7295  C CB   . SER A 1 6  ? 8.934   -3.241  -7.771  1.00 0.00 ? 90  SER A CB   7  
ATOM 7296  O OG   . SER A 1 6  ? 10.148  -3.931  -7.535  1.00 0.00 ? 90  SER A OG   7  
ATOM 7297  H H    . SER A 1 6  ? 8.210   -5.492  -6.884  1.00 0.00 ? 90  SER A H    7  
ATOM 7298  H HA   . SER A 1 6  ? 8.296   -2.824  -5.774  1.00 0.00 ? 90  SER A HA   7  
ATOM 7299  H HB2  . SER A 1 6  ? 8.483   -3.625  -8.673  1.00 0.00 ? 90  SER A HB2  7  
ATOM 7300  H HB3  . SER A 1 6  ? 9.146   -2.197  -7.890  1.00 0.00 ? 90  SER A HB3  7  
ATOM 7301  H HG   . SER A 1 6  ? 10.883  -3.301  -7.561  1.00 0.00 ? 90  SER A HG   7  
ATOM 7302  N N    . ILE A 1 7  ? 5.854   -2.364  -6.120  1.00 0.00 ? 91  ILE A N    7  
ATOM 7303  C CA   . ILE A 1 7  ? 4.530   -1.847  -6.442  1.00 0.00 ? 91  ILE A CA   7  
ATOM 7304  C C    . ILE A 1 7  ? 4.612   -0.360  -6.736  1.00 0.00 ? 91  ILE A C    7  
ATOM 7305  O O    . ILE A 1 7  ? 5.418   0.361   -6.140  1.00 0.00 ? 91  ILE A O    7  
ATOM 7306  C CB   . ILE A 1 7  ? 3.505   -2.094  -5.316  1.00 0.00 ? 91  ILE A CB   7  
ATOM 7307  C CG1  . ILE A 1 7  ? 3.981   -1.482  -3.993  1.00 0.00 ? 91  ILE A CG1  7  
ATOM 7308  C CG2  . ILE A 1 7  ? 3.246   -3.586  -5.160  1.00 0.00 ? 91  ILE A CG2  7  
ATOM 7309  C CD1  . ILE A 1 7  ? 2.980   -1.619  -2.866  1.00 0.00 ? 91  ILE A CD1  7  
ATOM 7310  H H    . ILE A 1 7  ? 6.225   -2.219  -5.222  1.00 0.00 ? 91  ILE A H    7  
ATOM 7311  H HA   . ILE A 1 7  ? 4.184   -2.356  -7.332  1.00 0.00 ? 91  ILE A HA   7  
ATOM 7312  H HB   . ILE A 1 7  ? 2.576   -1.625  -5.604  1.00 0.00 ? 91  ILE A HB   7  
ATOM 7313  H HG12 . ILE A 1 7  ? 4.894   -1.969  -3.686  1.00 0.00 ? 91  ILE A HG12 7  
ATOM 7314  H HG13 . ILE A 1 7  ? 4.173   -0.429  -4.138  1.00 0.00 ? 91  ILE A HG13 7  
ATOM 7315  H HG21 . ILE A 1 7  ? 4.167   -4.084  -4.894  1.00 0.00 ? 91  ILE A HG21 7  
ATOM 7316  H HG22 . ILE A 1 7  ? 2.875   -3.985  -6.093  1.00 0.00 ? 91  ILE A HG22 7  
ATOM 7317  H HG23 . ILE A 1 7  ? 2.512   -3.746  -4.383  1.00 0.00 ? 91  ILE A HG23 7  
ATOM 7318  H HD11 . ILE A 1 7  ? 2.065   -1.111  -3.131  1.00 0.00 ? 91  ILE A HD11 7  
ATOM 7319  H HD12 . ILE A 1 7  ? 3.388   -1.183  -1.966  1.00 0.00 ? 91  ILE A HD12 7  
ATOM 7320  H HD13 . ILE A 1 7  ? 2.773   -2.666  -2.696  1.00 0.00 ? 91  ILE A HD13 7  
ATOM 7321  N N    . LEU A 1 8  ? 3.788   0.103   -7.657  1.00 0.00 ? 92  LEU A N    7  
ATOM 7322  C CA   . LEU A 1 8  ? 3.833   1.492   -8.068  1.00 0.00 ? 92  LEU A CA   7  
ATOM 7323  C C    . LEU A 1 8  ? 2.642   2.248   -7.500  1.00 0.00 ? 92  LEU A C    7  
ATOM 7324  O O    . LEU A 1 8  ? 1.509   2.082   -7.954  1.00 0.00 ? 92  LEU A O    7  
ATOM 7325  C CB   . LEU A 1 8  ? 3.859   1.597   -9.592  1.00 0.00 ? 92  LEU A CB   7  
ATOM 7326  C CG   . LEU A 1 8  ? 4.187   2.983   -10.140 1.00 0.00 ? 92  LEU A CG   7  
ATOM 7327  C CD1  . LEU A 1 8  ? 5.550   3.438   -9.646  1.00 0.00 ? 92  LEU A CD1  7  
ATOM 7328  C CD2  . LEU A 1 8  ? 4.150   2.968   -11.655 1.00 0.00 ? 92  LEU A CD2  7  
ATOM 7329  H H    . LEU A 1 8  ? 3.124   -0.496  -8.061  1.00 0.00 ? 92  LEU A H    7  
ATOM 7330  H HA   . LEU A 1 8  ? 4.739   1.924   -7.670  1.00 0.00 ? 92  LEU A HA   7  
ATOM 7331  H HB2  . LEU A 1 8  ? 4.593   0.901   -9.968  1.00 0.00 ? 92  LEU A HB2  7  
ATOM 7332  H HB3  . LEU A 1 8  ? 2.889   1.309   -9.969  1.00 0.00 ? 92  LEU A HB3  7  
ATOM 7333  H HG   . LEU A 1 8  ? 3.450   3.689   -9.789  1.00 0.00 ? 92  LEU A HG   7  
ATOM 7334  H HD11 . LEU A 1 8  ? 5.767   4.419   -10.041 1.00 0.00 ? 92  LEU A HD11 7  
ATOM 7335  H HD12 . LEU A 1 8  ? 6.305   2.739   -9.979  1.00 0.00 ? 92  LEU A HD12 7  
ATOM 7336  H HD13 . LEU A 1 8  ? 5.548   3.477   -8.567  1.00 0.00 ? 92  LEU A HD13 7  
ATOM 7337  H HD21 . LEU A 1 8  ? 3.182   2.627   -11.989 1.00 0.00 ? 92  LEU A HD21 7  
ATOM 7338  H HD22 . LEU A 1 8  ? 4.915   2.299   -12.025 1.00 0.00 ? 92  LEU A HD22 7  
ATOM 7339  H HD23 . LEU A 1 8  ? 4.331   3.964   -12.030 1.00 0.00 ? 92  LEU A HD23 7  
ATOM 7340  N N    . VAL A 1 9  ? 2.906   3.065   -6.496  1.00 0.00 ? 93  VAL A N    7  
ATOM 7341  C CA   . VAL A 1 9  ? 1.867   3.840   -5.842  1.00 0.00 ? 93  VAL A CA   7  
ATOM 7342  C C    . VAL A 1 9  ? 1.872   5.269   -6.369  1.00 0.00 ? 93  VAL A C    7  
ATOM 7343  O O    . VAL A 1 9  ? 2.915   5.919   -6.408  1.00 0.00 ? 93  VAL A O    7  
ATOM 7344  C CB   . VAL A 1 9  ? 2.052   3.856   -4.306  1.00 0.00 ? 93  VAL A CB   7  
ATOM 7345  C CG1  . VAL A 1 9  ? 0.955   4.668   -3.634  1.00 0.00 ? 93  VAL A CG1  7  
ATOM 7346  C CG2  . VAL A 1 9  ? 2.082   2.436   -3.756  1.00 0.00 ? 93  VAL A CG2  7  
ATOM 7347  H H    . VAL A 1 9  ? 3.836   3.162   -6.191  1.00 0.00 ? 93  VAL A H    7  
ATOM 7348  H HA   . VAL A 1 9  ? 0.913   3.385   -6.067  1.00 0.00 ? 93  VAL A HA   7  
ATOM 7349  H HB   . VAL A 1 9  ? 3.000   4.323   -4.084  1.00 0.00 ? 93  VAL A HB   7  
ATOM 7350  H HG11 . VAL A 1 9  ? -0.006  4.219   -3.842  1.00 0.00 ? 93  VAL A HG11 7  
ATOM 7351  H HG12 . VAL A 1 9  ? 0.970   5.677   -4.016  1.00 0.00 ? 93  VAL A HG12 7  
ATOM 7352  H HG13 . VAL A 1 9  ? 1.120   4.683   -2.566  1.00 0.00 ? 93  VAL A HG13 7  
ATOM 7353  H HG21 . VAL A 1 9  ? 1.148   1.941   -3.980  1.00 0.00 ? 93  VAL A HG21 7  
ATOM 7354  H HG22 . VAL A 1 9  ? 2.224   2.468   -2.686  1.00 0.00 ? 93  VAL A HG22 7  
ATOM 7355  H HG23 . VAL A 1 9  ? 2.896   1.891   -4.211  1.00 0.00 ? 93  VAL A HG23 7  
ATOM 7356  N N    . ARG A 1 10 ? 0.712   5.745   -6.789  1.00 0.00 ? 94  ARG A N    7  
ATOM 7357  C CA   . ARG A 1 10 ? 0.596   7.102   -7.285  1.00 0.00 ? 94  ARG A CA   7  
ATOM 7358  C C    . ARG A 1 10 ? 0.020   8.018   -6.223  1.00 0.00 ? 94  ARG A C    7  
ATOM 7359  O O    . ARG A 1 10 ? -1.064  7.771   -5.685  1.00 0.00 ? 94  ARG A O    7  
ATOM 7360  C CB   . ARG A 1 10 ? -0.251  7.157   -8.553  1.00 0.00 ? 94  ARG A CB   7  
ATOM 7361  C CG   . ARG A 1 10 ? 0.464   6.610   -9.776  1.00 0.00 ? 94  ARG A CG   7  
ATOM 7362  C CD   . ARG A 1 10 ? -0.367  6.792   -11.033 1.00 0.00 ? 94  ARG A CD   7  
ATOM 7363  N NE   . ARG A 1 10 ? 0.333   6.326   -12.230 1.00 0.00 ? 94  ARG A NE   7  
ATOM 7364  C CZ   . ARG A 1 10 ? -0.280  5.755   -13.264 1.00 0.00 ? 94  ARG A CZ   7  
ATOM 7365  N NH1  . ARG A 1 10 ? -1.600  5.614   -13.260 1.00 0.00 ? 94  ARG A NH1  7  
ATOM 7366  N NH2  . ARG A 1 10 ? 0.418   5.341   -14.308 1.00 0.00 ? 94  ARG A NH2  7  
ATOM 7367  H H    . ARG A 1 10 ? -0.086  5.174   -6.753  1.00 0.00 ? 94  ARG A H    7  
ATOM 7368  H HA   . ARG A 1 10 ? 1.592   7.446   -7.525  1.00 0.00 ? 94  ARG A HA   7  
ATOM 7369  H HB2  . ARG A 1 10 ? -1.150  6.578   -8.397  1.00 0.00 ? 94  ARG A HB2  7  
ATOM 7370  H HB3  . ARG A 1 10 ? -0.523  8.183   -8.749  1.00 0.00 ? 94  ARG A HB3  7  
ATOM 7371  H HG2  . ARG A 1 10 ? 1.400   7.132   -9.897  1.00 0.00 ? 94  ARG A HG2  7  
ATOM 7372  H HG3  . ARG A 1 10 ? 0.652   5.556   -9.629  1.00 0.00 ? 94  ARG A HG3  7  
ATOM 7373  H HD2  . ARG A 1 10 ? -1.285  6.232   -10.927 1.00 0.00 ? 94  ARG A HD2  7  
ATOM 7374  H HD3  . ARG A 1 10 ? -0.599  7.841   -11.148 1.00 0.00 ? 94  ARG A HD3  7  
ATOM 7375  H HE   . ARG A 1 10 ? 1.312   6.443   -12.257 1.00 0.00 ? 94  ARG A HE   7  
ATOM 7376  H HH11 . ARG A 1 10 ? -2.139  5.936   -12.482 1.00 0.00 ? 94  ARG A HH11 7  
ATOM 7377  H HH12 . ARG A 1 10 ? -2.063  5.171   -14.037 1.00 0.00 ? 94  ARG A HH12 7  
ATOM 7378  H HH21 . ARG A 1 10 ? 1.418   5.454   -14.328 1.00 0.00 ? 94  ARG A HH21 7  
ATOM 7379  H HH22 . ARG A 1 10 ? -0.050  4.903   -15.088 1.00 0.00 ? 94  ARG A HH22 7  
ATOM 7380  N N    . ASN A 1 11 ? 0.774   9.063   -5.915  1.00 0.00 ? 95  ASN A N    7  
ATOM 7381  C CA   . ASN A 1 11 ? 0.368   10.063  -4.938  1.00 0.00 ? 95  ASN A CA   7  
ATOM 7382  C C    . ASN A 1 11 ? -0.824  10.869  -5.445  1.00 0.00 ? 95  ASN A C    7  
ATOM 7383  O O    . ASN A 1 11 ? -1.177  10.802  -6.623  1.00 0.00 ? 95  ASN A O    7  
ATOM 7384  C CB   . ASN A 1 11 ? 1.533   11.015  -4.620  1.00 0.00 ? 95  ASN A CB   7  
ATOM 7385  C CG   . ASN A 1 11 ? 2.737   10.315  -4.008  1.00 0.00 ? 95  ASN A CG   7  
ATOM 7386  O OD1  . ASN A 1 11 ? 2.997   9.147   -4.271  1.00 0.00 ? 95  ASN A OD1  7  
ATOM 7387  N ND2  . ASN A 1 11 ? 3.494   11.038  -3.197  1.00 0.00 ? 95  ASN A ND2  7  
ATOM 7388  H H    . ASN A 1 11 ? 1.653   9.149   -6.345  1.00 0.00 ? 95  ASN A H    7  
ATOM 7389  H HA   . ASN A 1 11 ? 0.080   9.548   -4.034  1.00 0.00 ? 95  ASN A HA   7  
ATOM 7390  H HB2  . ASN A 1 11 ? 1.852   11.497  -5.534  1.00 0.00 ? 95  ASN A HB2  7  
ATOM 7391  H HB3  . ASN A 1 11 ? 1.191   11.769  -3.927  1.00 0.00 ? 95  ASN A HB3  7  
ATOM 7392  H HD21 . ASN A 1 11 ? 3.246   11.972  -3.035  1.00 0.00 ? 95  ASN A HD21 7  
ATOM 7393  H HD22 . ASN A 1 11 ? 4.280   10.610  -2.796  1.00 0.00 ? 95  ASN A HD22 7  
ATOM 7394  N N    . ASN A 1 12 ? -1.402  11.657  -4.544  1.00 0.00 ? 96  ASN A N    7  
ATOM 7395  C CA   . ASN A 1 12 ? -2.596  12.460  -4.822  1.00 0.00 ? 96  ASN A CA   7  
ATOM 7396  C C    . ASN A 1 12 ? -2.444  13.327  -6.075  1.00 0.00 ? 96  ASN A C    7  
ATOM 7397  O O    . ASN A 1 12 ? -3.354  13.402  -6.897  1.00 0.00 ? 96  ASN A O    7  
ATOM 7398  C CB   . ASN A 1 12 ? -2.925  13.353  -3.614  1.00 0.00 ? 96  ASN A CB   7  
ATOM 7399  C CG   . ASN A 1 12 ? -1.778  14.276  -3.217  1.00 0.00 ? 96  ASN A CG   7  
ATOM 7400  O OD1  . ASN A 1 12 ? -0.602  13.950  -3.397  1.00 0.00 ? 96  ASN A OD1  7  
ATOM 7401  N ND2  . ASN A 1 12 ? -2.112  15.438  -2.679  1.00 0.00 ? 96  ASN A ND2  7  
ATOM 7402  H H    . ASN A 1 12 ? -1.009  11.705  -3.649  1.00 0.00 ? 96  ASN A H    7  
ATOM 7403  H HA   . ASN A 1 12 ? -3.418  11.778  -4.977  1.00 0.00 ? 96  ASN A HA   7  
ATOM 7404  H HB2  . ASN A 1 12 ? -3.782  13.965  -3.853  1.00 0.00 ? 96  ASN A HB2  7  
ATOM 7405  H HB3  . ASN A 1 12 ? -3.167  12.725  -2.771  1.00 0.00 ? 96  ASN A HB3  7  
ATOM 7406  H HD21 . ASN A 1 12 ? -3.065  15.641  -2.568  1.00 0.00 ? 96  ASN A HD21 7  
ATOM 7407  H HD22 . ASN A 1 12 ? -1.390  16.049  -2.411  1.00 0.00 ? 96  ASN A HD22 7  
ATOM 7408  N N    . LYS A 1 13 ? -1.298  13.979  -6.219  1.00 0.00 ? 97  LYS A N    7  
ATOM 7409  C CA   . LYS A 1 13 ? -1.070  14.867  -7.353  1.00 0.00 ? 97  LYS A CA   7  
ATOM 7410  C C    . LYS A 1 13 ? -0.789  14.081  -8.627  1.00 0.00 ? 97  LYS A C    7  
ATOM 7411  O O    . LYS A 1 13 ? -1.241  14.454  -9.709  1.00 0.00 ? 97  LYS A O    7  
ATOM 7412  C CB   . LYS A 1 13 ? 0.084   15.828  -7.062  1.00 0.00 ? 97  LYS A CB   7  
ATOM 7413  C CG   . LYS A 1 13 ? -0.219  16.822  -5.953  1.00 0.00 ? 97  LYS A CG   7  
ATOM 7414  C CD   . LYS A 1 13 ? 0.894   17.845  -5.808  1.00 0.00 ? 97  LYS A CD   7  
ATOM 7415  C CE   . LYS A 1 13 ? 0.533   18.921  -4.798  1.00 0.00 ? 97  LYS A CE   7  
ATOM 7416  N NZ   . LYS A 1 13 ? 1.591   19.961  -4.693  1.00 0.00 ? 97  LYS A NZ   7  
ATOM 7417  H H    . LYS A 1 13 ? -0.600  13.874  -5.539  1.00 0.00 ? 97  LYS A H    7  
ATOM 7418  H HA   . LYS A 1 13 ? -1.971  15.445  -7.500  1.00 0.00 ? 97  LYS A HA   7  
ATOM 7419  H HB2  . LYS A 1 13 ? 0.949   15.251  -6.774  1.00 0.00 ? 97  LYS A HB2  7  
ATOM 7420  H HB3  . LYS A 1 13 ? 0.312   16.380  -7.960  1.00 0.00 ? 97  LYS A HB3  7  
ATOM 7421  H HG2  . LYS A 1 13 ? -1.140  17.337  -6.184  1.00 0.00 ? 97  LYS A HG2  7  
ATOM 7422  H HG3  . LYS A 1 13 ? -0.328  16.286  -5.022  1.00 0.00 ? 97  LYS A HG3  7  
ATOM 7423  H HD2  . LYS A 1 13 ? 1.791   17.342  -5.478  1.00 0.00 ? 97  LYS A HD2  7  
ATOM 7424  H HD3  . LYS A 1 13 ? 1.071   18.308  -6.768  1.00 0.00 ? 97  LYS A HD3  7  
ATOM 7425  H HE2  . LYS A 1 13 ? -0.390  19.387  -5.105  1.00 0.00 ? 97  LYS A HE2  7  
ATOM 7426  H HE3  . LYS A 1 13 ? 0.399   18.457  -3.831  1.00 0.00 ? 97  LYS A HE3  7  
ATOM 7427  H HZ1  . LYS A 1 13 ? 1.293   20.711  -4.031  1.00 0.00 ? 97  LYS A HZ1  7  
ATOM 7428  H HZ2  . LYS A 1 13 ? 1.766   20.390  -5.628  1.00 0.00 ? 97  LYS A HZ2  7  
ATOM 7429  H HZ3  . LYS A 1 13 ? 2.478   19.540  -4.348  1.00 0.00 ? 97  LYS A HZ3  7  
ATOM 7430  N N    . GLY A 1 14 ? -0.056  12.987  -8.497  1.00 0.00 ? 98  GLY A N    7  
ATOM 7431  C CA   . GLY A 1 14 ? 0.285   12.192  -9.660  1.00 0.00 ? 98  GLY A CA   7  
ATOM 7432  C C    . GLY A 1 14 ? 1.750   11.815  -9.702  1.00 0.00 ? 98  GLY A C    7  
ATOM 7433  O O    . GLY A 1 14 ? 2.399   11.926  -10.743 1.00 0.00 ? 98  GLY A O    7  
ATOM 7434  H H    . GLY A 1 14 ? 0.237   12.708  -7.607  1.00 0.00 ? 98  GLY A H    7  
ATOM 7435  H HA2  . GLY A 1 14 ? -0.306  11.287  -9.650  1.00 0.00 ? 98  GLY A HA2  7  
ATOM 7436  H HA3  . GLY A 1 14 ? 0.044   12.754  -10.548 1.00 0.00 ? 98  GLY A HA3  7  
ATOM 7437  N N    . ARG A 1 15 ? 2.279   11.382  -8.569  1.00 0.00 ? 99  ARG A N    7  
ATOM 7438  C CA   . ARG A 1 15 ? 3.652   10.904  -8.507  1.00 0.00 ? 99  ARG A CA   7  
ATOM 7439  C C    . ARG A 1 15 ? 3.659   9.383   -8.435  1.00 0.00 ? 99  ARG A C    7  
ATOM 7440  O O    . ARG A 1 15 ? 3.031   8.806   -7.554  1.00 0.00 ? 99  ARG A O    7  
ATOM 7441  C CB   . ARG A 1 15 ? 4.382   11.478  -7.288  1.00 0.00 ? 99  ARG A CB   7  
ATOM 7442  C CG   . ARG A 1 15 ? 5.763   10.873  -7.086  1.00 0.00 ? 99  ARG A CG   7  
ATOM 7443  C CD   . ARG A 1 15 ? 6.382   11.283  -5.760  1.00 0.00 ? 99  ARG A CD   7  
ATOM 7444  N NE   . ARG A 1 15 ? 6.948   12.632  -5.794  1.00 0.00 ? 99  ARG A NE   7  
ATOM 7445  C CZ   . ARG A 1 15 ? 8.138   12.937  -5.282  1.00 0.00 ? 99  ARG A CZ   7  
ATOM 7446  N NH1  . ARG A 1 15 ? 8.895   11.981  -4.760  1.00 0.00 ? 99  ARG A NH1  7  
ATOM 7447  N NH2  . ARG A 1 15 ? 8.574   14.188  -5.310  1.00 0.00 ? 99  ARG A NH2  7  
ATOM 7448  H H    . ARG A 1 15 ? 1.730   11.366  -7.760  1.00 0.00 ? 99  ARG A H    7  
ATOM 7449  H HA   . ARG A 1 15 ? 4.158   11.219  -9.407  1.00 0.00 ? 99  ARG A HA   7  
ATOM 7450  H HB2  . ARG A 1 15 ? 4.493   12.544  -7.413  1.00 0.00 ? 99  ARG A HB2  7  
ATOM 7451  H HB3  . ARG A 1 15 ? 3.796   11.285  -6.403  1.00 0.00 ? 99  ARG A HB3  7  
ATOM 7452  H HG2  . ARG A 1 15 ? 5.679   9.797   -7.112  1.00 0.00 ? 99  ARG A HG2  7  
ATOM 7453  H HG3  . ARG A 1 15 ? 6.407   11.201  -7.889  1.00 0.00 ? 99  ARG A HG3  7  
ATOM 7454  H HD2  . ARG A 1 15 ? 5.619   11.245  -4.997  1.00 0.00 ? 99  ARG A HD2  7  
ATOM 7455  H HD3  . ARG A 1 15 ? 7.166   10.580  -5.515  1.00 0.00 ? 99  ARG A HD3  7  
ATOM 7456  H HE   . ARG A 1 15 ? 6.406   13.348  -6.203  1.00 0.00 ? 99  ARG A HE   7  
ATOM 7457  H HH11 . ARG A 1 15 ? 8.573   11.033  -4.749  1.00 0.00 ? 99  ARG A HH11 7  
ATOM 7458  H HH12 . ARG A 1 15 ? 9.801   12.202  -4.380  1.00 0.00 ? 99  ARG A HH12 7  
ATOM 7459  H HH21 . ARG A 1 15 ? 8.009   14.910  -5.718  1.00 0.00 ? 99  ARG A HH21 7  
ATOM 7460  H HH22 . ARG A 1 15 ? 9.474   14.424  -4.910  1.00 0.00 ? 99  ARG A HH22 7  
ATOM 7461  N N    . SER A 1 16 ? 4.347   8.744   -9.366  1.00 0.00 ? 100 SER A N    7  
ATOM 7462  C CA   . SER A 1 16 ? 4.455   7.295   -9.360  1.00 0.00 ? 100 SER A CA   7  
ATOM 7463  C C    . SER A 1 16 ? 5.667   6.861   -8.538  1.00 0.00 ? 100 SER A C    7  
ATOM 7464  O O    . SER A 1 16 ? 6.792   6.824   -9.039  1.00 0.00 ? 100 SER A O    7  
ATOM 7465  C CB   . SER A 1 16 ? 4.562   6.762   -10.794 1.00 0.00 ? 100 SER A CB   7  
ATOM 7466  O OG   . SER A 1 16 ? 3.449   7.166   -11.580 1.00 0.00 ? 100 SER A OG   7  
ATOM 7467  H H    . SER A 1 16 ? 4.798   9.257   -10.075 1.00 0.00 ? 100 SER A H    7  
ATOM 7468  H HA   . SER A 1 16 ? 3.563   6.894   -8.900  1.00 0.00 ? 100 SER A HA   7  
ATOM 7469  H HB2  . SER A 1 16 ? 5.464   7.143   -11.250 1.00 0.00 ? 100 SER A HB2  7  
ATOM 7470  H HB3  . SER A 1 16 ? 4.598   5.684   -10.773 1.00 0.00 ? 100 SER A HB3  7  
ATOM 7471  H HG   . SER A 1 16 ? 3.734   7.293   -12.493 1.00 0.00 ? 100 SER A HG   7  
ATOM 7472  N N    . SER A 1 17 ? 5.436   6.566   -7.272  1.00 0.00 ? 101 SER A N    7  
ATOM 7473  C CA   . SER A 1 17 ? 6.502   6.146   -6.380  1.00 0.00 ? 101 SER A CA   7  
ATOM 7474  C C    . SER A 1 17 ? 6.518   4.631   -6.240  1.00 0.00 ? 101 SER A C    7  
ATOM 7475  O O    . SER A 1 17 ? 5.495   4.008   -5.953  1.00 0.00 ? 101 SER A O    7  
ATOM 7476  C CB   . SER A 1 17 ? 6.331   6.803   -5.011  1.00 0.00 ? 101 SER A CB   7  
ATOM 7477  O OG   . SER A 1 17 ? 6.432   8.212   -5.112  1.00 0.00 ? 101 SER A OG   7  
ATOM 7478  H H    . SER A 1 17 ? 4.514   6.624   -6.924  1.00 0.00 ? 101 SER A H    7  
ATOM 7479  H HA   . SER A 1 17 ? 7.437   6.469   -6.810  1.00 0.00 ? 101 SER A HA   7  
ATOM 7480  H HB2  . SER A 1 17 ? 5.362   6.550   -4.610  1.00 0.00 ? 101 SER A HB2  7  
ATOM 7481  H HB3  . SER A 1 17 ? 7.103   6.445   -4.346  1.00 0.00 ? 101 SER A HB3  7  
ATOM 7482  H HG   . SER A 1 17 ? 7.109   8.438   -5.765  1.00 0.00 ? 101 SER A HG   7  
ATOM 7483  N N    . THR A 1 18 ? 7.679   4.038   -6.461  1.00 0.00 ? 102 THR A N    7  
ATOM 7484  C CA   . THR A 1 18 ? 7.822   2.597   -6.374  1.00 0.00 ? 102 THR A CA   7  
ATOM 7485  C C    . THR A 1 18 ? 8.160   2.177   -4.945  1.00 0.00 ? 102 THR A C    7  
ATOM 7486  O O    . THR A 1 18 ? 9.257   2.440   -4.453  1.00 0.00 ? 102 THR A O    7  
ATOM 7487  C CB   . THR A 1 18 ? 8.924   2.096   -7.328  1.00 0.00 ? 102 THR A CB   7  
ATOM 7488  O OG1  . THR A 1 18 ? 8.723   2.663   -8.630  1.00 0.00 ? 102 THR A OG1  7  
ATOM 7489  C CG2  . THR A 1 18 ? 8.907   0.577   -7.428  1.00 0.00 ? 102 THR A CG2  7  
ATOM 7490  H H    . THR A 1 18 ? 8.460   4.584   -6.688  1.00 0.00 ? 102 THR A H    7  
ATOM 7491  H HA   . THR A 1 18 ? 6.883   2.146   -6.669  1.00 0.00 ? 102 THR A HA   7  
ATOM 7492  H HB   . THR A 1 18 ? 9.884   2.409   -6.947  1.00 0.00 ? 102 THR A HB   7  
ATOM 7493  H HG1  . THR A 1 18 ? 7.803   2.548   -8.887  1.00 0.00 ? 102 THR A HG1  7  
ATOM 7494  H HG21 . THR A 1 18 ? 9.684   0.252   -8.105  1.00 0.00 ? 102 THR A HG21 7  
ATOM 7495  H HG22 . THR A 1 18 ? 7.946   0.251   -7.800  1.00 0.00 ? 102 THR A HG22 7  
ATOM 7496  H HG23 . THR A 1 18 ? 9.078   0.151   -6.452  1.00 0.00 ? 102 THR A HG23 7  
ATOM 7497  N N    . TYR A 1 19 ? 7.208   1.544   -4.278  1.00 0.00 ? 103 TYR A N    7  
ATOM 7498  C CA   . TYR A 1 19 ? 7.421   1.056   -2.926  1.00 0.00 ? 103 TYR A CA   7  
ATOM 7499  C C    . TYR A 1 19 ? 7.868   -0.394  -2.965  1.00 0.00 ? 103 TYR A C    7  
ATOM 7500  O O    . TYR A 1 19 ? 7.171   -1.253  -3.510  1.00 0.00 ? 103 TYR A O    7  
ATOM 7501  C CB   . TYR A 1 19 ? 6.148   1.187   -2.082  1.00 0.00 ? 103 TYR A CB   7  
ATOM 7502  C CG   . TYR A 1 19 ? 5.872   2.593   -1.589  1.00 0.00 ? 103 TYR A CG   7  
ATOM 7503  C CD1  . TYR A 1 19 ? 5.384   3.573   -2.445  1.00 0.00 ? 103 TYR A CD1  7  
ATOM 7504  C CD2  . TYR A 1 19 ? 6.102   2.937   -0.260  1.00 0.00 ? 103 TYR A CD2  7  
ATOM 7505  C CE1  . TYR A 1 19 ? 5.129   4.854   -1.991  1.00 0.00 ? 103 TYR A CE1  7  
ATOM 7506  C CE2  . TYR A 1 19 ? 5.848   4.215   0.199   1.00 0.00 ? 103 TYR A CE2  7  
ATOM 7507  C CZ   . TYR A 1 19 ? 5.365   5.170   -0.670  1.00 0.00 ? 103 TYR A CZ   7  
ATOM 7508  O OH   . TYR A 1 19 ? 5.113   6.442   -0.213  1.00 0.00 ? 103 TYR A OH   7  
ATOM 7509  H H    . TYR A 1 19 ? 6.343   1.380   -4.718  1.00 0.00 ? 103 TYR A H    7  
ATOM 7510  H HA   . TYR A 1 19 ? 8.203   1.650   -2.479  1.00 0.00 ? 103 TYR A HA   7  
ATOM 7511  H HB2  . TYR A 1 19 ? 5.299   0.876   -2.673  1.00 0.00 ? 103 TYR A HB2  7  
ATOM 7512  H HB3  . TYR A 1 19 ? 6.231   0.543   -1.217  1.00 0.00 ? 103 TYR A HB3  7  
ATOM 7513  H HD1  . TYR A 1 19 ? 5.202   3.323   -3.479  1.00 0.00 ? 103 TYR A HD1  7  
ATOM 7514  H HD2  . TYR A 1 19 ? 6.481   2.187   0.421   1.00 0.00 ? 103 TYR A HD2  7  
ATOM 7515  H HE1  . TYR A 1 19 ? 4.750   5.601   -2.672  1.00 0.00 ? 103 TYR A HE1  7  
ATOM 7516  H HE2  . TYR A 1 19 ? 6.030   4.461   1.235   1.00 0.00 ? 103 TYR A HE2  7  
ATOM 7517  H HH   . TYR A 1 19 ? 5.864   6.751   0.297   1.00 0.00 ? 103 TYR A HH   7  
ATOM 7518  N N    . GLU A 1 20 ? 9.039   -0.661  -2.410  1.00 0.00 ? 104 GLU A N    7  
ATOM 7519  C CA   . GLU A 1 20 ? 9.551   -2.017  -2.361  1.00 0.00 ? 104 GLU A CA   7  
ATOM 7520  C C    . GLU A 1 20 ? 9.019   -2.725  -1.127  1.00 0.00 ? 104 GLU A C    7  
ATOM 7521  O O    . GLU A 1 20 ? 9.468   -2.497  -0.004  1.00 0.00 ? 104 GLU A O    7  
ATOM 7522  C CB   . GLU A 1 20 ? 11.076  -2.022  -2.394  1.00 0.00 ? 104 GLU A CB   7  
ATOM 7523  C CG   . GLU A 1 20 ? 11.635  -1.411  -3.667  1.00 0.00 ? 104 GLU A CG   7  
ATOM 7524  C CD   . GLU A 1 20 ? 13.146  -1.389  -3.699  1.00 0.00 ? 104 GLU A CD   7  
ATOM 7525  O OE1  . GLU A 1 20 ? 13.747  -0.529  -3.023  1.00 0.00 ? 104 GLU A OE1  7  
ATOM 7526  O OE2  . GLU A 1 20 ? 13.744  -2.226  -4.407  1.00 0.00 ? 104 GLU A OE2  7  
ATOM 7527  H H    . GLU A 1 20 ? 9.568   0.068   -2.022  1.00 0.00 ? 104 GLU A H    7  
ATOM 7528  H HA   . GLU A 1 20 ? 9.182   -2.532  -3.237  1.00 0.00 ? 104 GLU A HA   7  
ATOM 7529  H HB2  . GLU A 1 20 ? 11.449  -1.459  -1.550  1.00 0.00 ? 104 GLU A HB2  7  
ATOM 7530  H HB3  . GLU A 1 20 ? 11.426  -3.041  -2.325  1.00 0.00 ? 104 GLU A HB3  7  
ATOM 7531  H HG2  . GLU A 1 20 ? 11.284  -1.988  -4.511  1.00 0.00 ? 104 GLU A HG2  7  
ATOM 7532  H HG3  . GLU A 1 20 ? 11.269  -0.400  -3.751  1.00 0.00 ? 104 GLU A HG3  7  
ATOM 7533  N N    . VAL A 1 21 ? 8.023   -3.556  -1.357  1.00 0.00 ? 105 VAL A N    7  
ATOM 7534  C CA   . VAL A 1 21 ? 7.349   -4.289  -0.296  1.00 0.00 ? 105 VAL A CA   7  
ATOM 7535  C C    . VAL A 1 21 ? 7.657   -5.773  -0.425  1.00 0.00 ? 105 VAL A C    7  
ATOM 7536  O O    . VAL A 1 21 ? 8.438   -6.166  -1.278  1.00 0.00 ? 105 VAL A O    7  
ATOM 7537  C CB   . VAL A 1 21 ? 5.823   -4.063  -0.333  1.00 0.00 ? 105 VAL A CB   7  
ATOM 7538  C CG1  . VAL A 1 21 ? 5.506   -2.582  -0.206  1.00 0.00 ? 105 VAL A CG1  7  
ATOM 7539  C CG2  . VAL A 1 21 ? 5.217   -4.631  -1.606  1.00 0.00 ? 105 VAL A CG2  7  
ATOM 7540  H H    . VAL A 1 21 ? 7.734   -3.693  -2.288  1.00 0.00 ? 105 VAL A H    7  
ATOM 7541  H HA   . VAL A 1 21 ? 7.728   -3.931  0.651   1.00 0.00 ? 105 VAL A HA   7  
ATOM 7542  H HB   . VAL A 1 21 ? 5.382   -4.575  0.512   1.00 0.00 ? 105 VAL A HB   7  
ATOM 7543  H HG11 . VAL A 1 21 ? 5.925   -2.052  -1.050  1.00 0.00 ? 105 VAL A HG11 7  
ATOM 7544  H HG12 . VAL A 1 21 ? 5.934   -2.198  0.706   1.00 0.00 ? 105 VAL A HG12 7  
ATOM 7545  H HG13 . VAL A 1 21 ? 4.434   -2.441  -0.189  1.00 0.00 ? 105 VAL A HG13 7  
ATOM 7546  H HG21 . VAL A 1 21 ? 5.420   -5.690  -1.662  1.00 0.00 ? 105 VAL A HG21 7  
ATOM 7547  H HG22 . VAL A 1 21 ? 5.651   -4.136  -2.463  1.00 0.00 ? 105 VAL A HG22 7  
ATOM 7548  H HG23 . VAL A 1 21 ? 4.149   -4.469  -1.601  1.00 0.00 ? 105 VAL A HG23 7  
ATOM 7549  N N    . ARG A 1 22 ? 7.089   -6.591  0.437   1.00 0.00 ? 106 ARG A N    7  
ATOM 7550  C CA   . ARG A 1 22 ? 7.285   -8.029  0.345   1.00 0.00 ? 106 ARG A CA   7  
ATOM 7551  C C    . ARG A 1 22 ? 5.943   -8.742  0.481   1.00 0.00 ? 106 ARG A C    7  
ATOM 7552  O O    . ARG A 1 22 ? 5.022   -8.216  1.093   1.00 0.00 ? 106 ARG A O    7  
ATOM 7553  C CB   . ARG A 1 22 ? 8.269   -8.499  1.422   1.00 0.00 ? 106 ARG A CB   7  
ATOM 7554  C CG   . ARG A 1 22 ? 8.657   -9.963  1.303   1.00 0.00 ? 106 ARG A CG   7  
ATOM 7555  C CD   . ARG A 1 22 ? 9.710   -10.345 2.327   1.00 0.00 ? 106 ARG A CD   7  
ATOM 7556  N NE   . ARG A 1 22 ? 11.009  -9.774  1.996   1.00 0.00 ? 106 ARG A NE   7  
ATOM 7557  C CZ   . ARG A 1 22 ? 11.790  -9.128  2.857   1.00 0.00 ? 106 ARG A CZ   7  
ATOM 7558  N NH1  . ARG A 1 22 ? 11.425  -8.985  4.127   1.00 0.00 ? 106 ARG A NH1  7  
ATOM 7559  N NH2  . ARG A 1 22 ? 12.952  -8.637  2.446   1.00 0.00 ? 106 ARG A NH2  7  
ATOM 7560  H H    . ARG A 1 22 ? 6.509   -6.228  1.137   1.00 0.00 ? 106 ARG A H    7  
ATOM 7561  H HA   . ARG A 1 22 ? 7.699   -8.246  -0.628  1.00 0.00 ? 106 ARG A HA   7  
ATOM 7562  H HB2  . ARG A 1 22 ? 9.170   -7.908  1.352   1.00 0.00 ? 106 ARG A HB2  7  
ATOM 7563  H HB3  . ARG A 1 22 ? 7.822   -8.345  2.392   1.00 0.00 ? 106 ARG A HB3  7  
ATOM 7564  H HG2  . ARG A 1 22 ? 7.781   -10.570 1.452   1.00 0.00 ? 106 ARG A HG2  7  
ATOM 7565  H HG3  . ARG A 1 22 ? 9.052   -10.139 0.311   1.00 0.00 ? 106 ARG A HG3  7  
ATOM 7566  H HD2  . ARG A 1 22 ? 9.399   -9.984  3.296   1.00 0.00 ? 106 ARG A HD2  7  
ATOM 7567  H HD3  . ARG A 1 22 ? 9.795   -11.422 2.353   1.00 0.00 ? 106 ARG A HD3  7  
ATOM 7568  H HE   . ARG A 1 22 ? 11.320  -9.879  1.065   1.00 0.00 ? 106 ARG A HE   7  
ATOM 7569  H HH11 . ARG A 1 22 ? 10.551  -9.365  4.451   1.00 0.00 ? 106 ARG A HH11 7  
ATOM 7570  H HH12 . ARG A 1 22 ? 12.017  -8.493  4.768   1.00 0.00 ? 106 ARG A HH12 7  
ATOM 7571  H HH21 . ARG A 1 22 ? 13.235  -8.754  1.493   1.00 0.00 ? 106 ARG A HH21 7  
ATOM 7572  H HH22 . ARG A 1 22 ? 13.546  -8.132  3.087   1.00 0.00 ? 106 ARG A HH22 7  
ATOM 7573  N N    . LEU A 1 23 ? 5.827   -9.936  -0.088  1.00 0.00 ? 107 LEU A N    7  
ATOM 7574  C CA   . LEU A 1 23 ? 4.562   -10.671 -0.058  1.00 0.00 ? 107 LEU A CA   7  
ATOM 7575  C C    . LEU A 1 23 ? 4.328   -11.278 1.320   1.00 0.00 ? 107 LEU A C    7  
ATOM 7576  O O    . LEU A 1 23 ? 3.255   -11.806 1.606   1.00 0.00 ? 107 LEU A O    7  
ATOM 7577  C CB   . LEU A 1 23 ? 4.560   -11.791 -1.105  1.00 0.00 ? 107 LEU A CB   7  
ATOM 7578  C CG   . LEU A 1 23 ? 5.142   -11.426 -2.473  1.00 0.00 ? 107 LEU A CG   7  
ATOM 7579  C CD1  . LEU A 1 23 ? 5.097   -12.628 -3.400  1.00 0.00 ? 107 LEU A CD1  7  
ATOM 7580  C CD2  . LEU A 1 23 ? 4.388   -10.263 -3.089  1.00 0.00 ? 107 LEU A CD2  7  
ATOM 7581  H H    . LEU A 1 23 ? 6.601   -10.336 -0.536  1.00 0.00 ? 107 LEU A H    7  
ATOM 7582  H HA   . LEU A 1 23 ? 3.763   -9.979  -0.279  1.00 0.00 ? 107 LEU A HA   7  
ATOM 7583  H HB2  . LEU A 1 23 ? 5.120   -12.618 -0.707  1.00 0.00 ? 107 LEU A HB2  7  
ATOM 7584  H HB3  . LEU A 1 23 ? 3.540   -12.113 -1.251  1.00 0.00 ? 107 LEU A HB3  7  
ATOM 7585  H HG   . LEU A 1 23 ? 6.175   -11.134 -2.352  1.00 0.00 ? 107 LEU A HG   7  
ATOM 7586  H HD11 . LEU A 1 23 ? 5.485   -12.349 -4.367  1.00 0.00 ? 107 LEU A HD11 7  
ATOM 7587  H HD12 . LEU A 1 23 ? 4.075   -12.963 -3.503  1.00 0.00 ? 107 LEU A HD12 7  
ATOM 7588  H HD13 . LEU A 1 23 ? 5.698   -13.425 -2.986  1.00 0.00 ? 107 LEU A HD13 7  
ATOM 7589  H HD21 . LEU A 1 23 ? 3.354   -10.538 -3.228  1.00 0.00 ? 107 LEU A HD21 7  
ATOM 7590  H HD22 . LEU A 1 23 ? 4.827   -10.015 -4.046  1.00 0.00 ? 107 LEU A HD22 7  
ATOM 7591  H HD23 . LEU A 1 23 ? 4.447   -9.407  -2.433  1.00 0.00 ? 107 LEU A HD23 7  
ATOM 7592  N N    . THR A 1 24 ? 5.348   -11.210 2.163   1.00 0.00 ? 108 THR A N    7  
ATOM 7593  C CA   . THR A 1 24 ? 5.288   -11.796 3.491   1.00 0.00 ? 108 THR A CA   7  
ATOM 7594  C C    . THR A 1 24 ? 4.789   -10.784 4.523   1.00 0.00 ? 108 THR A C    7  
ATOM 7595  O O    . THR A 1 24 ? 4.765   -11.064 5.721   1.00 0.00 ? 108 THR A O    7  
ATOM 7596  C CB   . THR A 1 24 ? 6.678   -12.307 3.911   1.00 0.00 ? 108 THR A CB   7  
ATOM 7597  O OG1  . THR A 1 24 ? 7.475   -12.532 2.739   1.00 0.00 ? 108 THR A OG1  7  
ATOM 7598  C CG2  . THR A 1 24 ? 6.573   -13.598 4.711   1.00 0.00 ? 108 THR A CG2  7  
ATOM 7599  H H    . THR A 1 24 ? 6.173   -10.768 1.880   1.00 0.00 ? 108 THR A H    7  
ATOM 7600  H HA   . THR A 1 24 ? 4.607   -12.636 3.460   1.00 0.00 ? 108 THR A HA   7  
ATOM 7601  H HB   . THR A 1 24 ? 7.152   -11.555 4.523   1.00 0.00 ? 108 THR A HB   7  
ATOM 7602  H HG1  . THR A 1 24 ? 7.243   -13.384 2.342   1.00 0.00 ? 108 THR A HG1  7  
ATOM 7603  H HG21 . THR A 1 24 ? 6.082   -14.354 4.117   1.00 0.00 ? 108 THR A HG21 7  
ATOM 7604  H HG22 . THR A 1 24 ? 6.000   -13.418 5.611   1.00 0.00 ? 108 THR A HG22 7  
ATOM 7605  H HG23 . THR A 1 24 ? 7.563   -13.937 4.979   1.00 0.00 ? 108 THR A HG23 7  
ATOM 7606  N N    . GLN A 1 25 ? 4.395   -9.604  4.060   1.00 0.00 ? 109 GLN A N    7  
ATOM 7607  C CA   . GLN A 1 25 ? 3.864   -8.591  4.955   1.00 0.00 ? 109 GLN A CA   7  
ATOM 7608  C C    . GLN A 1 25 ? 2.466   -8.178  4.521   1.00 0.00 ? 109 GLN A C    7  
ATOM 7609  O O    . GLN A 1 25 ? 2.052   -8.440  3.387   1.00 0.00 ? 109 GLN A O    7  
ATOM 7610  C CB   . GLN A 1 25 ? 4.812   -7.381  5.062   1.00 0.00 ? 109 GLN A CB   7  
ATOM 7611  C CG   . GLN A 1 25 ? 5.276   -6.795  3.732   1.00 0.00 ? 109 GLN A CG   7  
ATOM 7612  C CD   . GLN A 1 25 ? 4.304   -5.800  3.126   1.00 0.00 ? 109 GLN A CD   7  
ATOM 7613  O OE1  . GLN A 1 25 ? 3.412   -6.165  2.370   1.00 0.00 ? 109 GLN A OE1  7  
ATOM 7614  N NE2  . GLN A 1 25 ? 4.491   -4.526  3.433   1.00 0.00 ? 109 GLN A NE2  7  
ATOM 7615  H H    . GLN A 1 25 ? 4.443   -9.421  3.098   1.00 0.00 ? 109 GLN A H    7  
ATOM 7616  H HA   . GLN A 1 25 ? 3.785   -9.047  5.931   1.00 0.00 ? 109 GLN A HA   7  
ATOM 7617  H HB2  . GLN A 1 25 ? 4.309   -6.600  5.610   1.00 0.00 ? 109 GLN A HB2  7  
ATOM 7618  H HB3  . GLN A 1 25 ? 5.687   -7.680  5.620   1.00 0.00 ? 109 GLN A HB3  7  
ATOM 7619  H HG2  . GLN A 1 25 ? 6.219   -6.294  3.889   1.00 0.00 ? 109 GLN A HG2  7  
ATOM 7620  H HG3  . GLN A 1 25 ? 5.417   -7.607  3.032   1.00 0.00 ? 109 GLN A HG3  7  
ATOM 7621  H HE21 . GLN A 1 25 ? 5.237   -4.296  4.022   1.00 0.00 ? 109 GLN A HE21 7  
ATOM 7622  H HE22 . GLN A 1 25 ? 3.870   -3.867  3.060   1.00 0.00 ? 109 GLN A HE22 7  
ATOM 7623  N N    . THR A 1 26 ? 1.741   -7.563  5.437   1.00 0.00 ? 110 THR A N    7  
ATOM 7624  C CA   . THR A 1 26 ? 0.373   -7.151  5.188   1.00 0.00 ? 110 THR A CA   7  
ATOM 7625  C C    . THR A 1 26 ? 0.328   -5.739  4.617   1.00 0.00 ? 110 THR A C    7  
ATOM 7626  O O    . THR A 1 26 ? 1.330   -5.015  4.641   1.00 0.00 ? 110 THR A O    7  
ATOM 7627  C CB   . THR A 1 26 ? -0.437  -7.189  6.497   1.00 0.00 ? 110 THR A CB   7  
ATOM 7628  O OG1  . THR A 1 26 ? 0.265   -6.451  7.510   1.00 0.00 ? 110 THR A OG1  7  
ATOM 7629  C CG2  . THR A 1 26 ? -0.663  -8.623  6.962   1.00 0.00 ? 110 THR A CG2  7  
ATOM 7630  H H    . THR A 1 26 ? 2.137   -7.374  6.309   1.00 0.00 ? 110 THR A H    7  
ATOM 7631  H HA   . THR A 1 26 ? -0.072  -7.839  4.486   1.00 0.00 ? 110 THR A HA   7  
ATOM 7632  H HB   . THR A 1 26 ? -1.399  -6.724  6.323   1.00 0.00 ? 110 THR A HB   7  
ATOM 7633  H HG1  . THR A 1 26 ? -0.028  -6.738  8.390   1.00 0.00 ? 110 THR A HG1  7  
ATOM 7634  H HG21 . THR A 1 26 ? 0.289   -9.112  7.097   1.00 0.00 ? 110 THR A HG21 7  
ATOM 7635  H HG22 . THR A 1 26 ? -1.241  -9.155  6.220   1.00 0.00 ? 110 THR A HG22 7  
ATOM 7636  H HG23 . THR A 1 26 ? -1.201  -8.616  7.899   1.00 0.00 ? 110 THR A HG23 7  
ATOM 7637  N N    . VAL A 1 27 ? -0.837  -5.347  4.111   1.00 0.00 ? 111 VAL A N    7  
ATOM 7638  C CA   . VAL A 1 27 ? -1.045  -3.984  3.640   1.00 0.00 ? 111 VAL A CA   7  
ATOM 7639  C C    . VAL A 1 27 ? -0.821  -2.997  4.780   1.00 0.00 ? 111 VAL A C    7  
ATOM 7640  O O    . VAL A 1 27 ? -0.357  -1.878  4.564   1.00 0.00 ? 111 VAL A O    7  
ATOM 7641  C CB   . VAL A 1 27 ? -2.462  -3.782  3.067   1.00 0.00 ? 111 VAL A CB   7  
ATOM 7642  C CG1  . VAL A 1 27 ? -2.640  -2.359  2.558   1.00 0.00 ? 111 VAL A CG1  7  
ATOM 7643  C CG2  . VAL A 1 27 ? -2.740  -4.786  1.959   1.00 0.00 ? 111 VAL A CG2  7  
ATOM 7644  H H    . VAL A 1 27 ? -1.573  -5.998  4.044   1.00 0.00 ? 111 VAL A H    7  
ATOM 7645  H HA   . VAL A 1 27 ? -0.326  -3.787  2.857   1.00 0.00 ? 111 VAL A HA   7  
ATOM 7646  H HB   . VAL A 1 27 ? -3.175  -3.945  3.863   1.00 0.00 ? 111 VAL A HB   7  
ATOM 7647  H HG11 . VAL A 1 27 ? -3.639  -2.238  2.163   1.00 0.00 ? 111 VAL A HG11 7  
ATOM 7648  H HG12 . VAL A 1 27 ? -1.919  -2.163  1.778   1.00 0.00 ? 111 VAL A HG12 7  
ATOM 7649  H HG13 . VAL A 1 27 ? -2.488  -1.663  3.371   1.00 0.00 ? 111 VAL A HG13 7  
ATOM 7650  H HG21 . VAL A 1 27 ? -3.725  -4.608  1.551   1.00 0.00 ? 111 VAL A HG21 7  
ATOM 7651  H HG22 . VAL A 1 27 ? -2.692  -5.787  2.360   1.00 0.00 ? 111 VAL A HG22 7  
ATOM 7652  H HG23 . VAL A 1 27 ? -2.003  -4.674  1.179   1.00 0.00 ? 111 VAL A HG23 7  
ATOM 7653  N N    . ALA A 1 28 ? -1.129  -3.437  5.999   1.00 0.00 ? 112 ALA A N    7  
ATOM 7654  C CA   . ALA A 1 28 ? -0.933  -2.617  7.187   1.00 0.00 ? 112 ALA A CA   7  
ATOM 7655  C C    . ALA A 1 28 ? 0.520   -2.184  7.318   1.00 0.00 ? 112 ALA A C    7  
ATOM 7656  O O    . ALA A 1 28 ? 0.806   -1.068  7.735   1.00 0.00 ? 112 ALA A O    7  
ATOM 7657  C CB   . ALA A 1 28 ? -1.368  -3.378  8.432   1.00 0.00 ? 112 ALA A CB   7  
ATOM 7658  H H    . ALA A 1 28 ? -1.497  -4.341  6.099   1.00 0.00 ? 112 ALA A H    7  
ATOM 7659  H HA   . ALA A 1 28 ? -1.554  -1.739  7.095   1.00 0.00 ? 112 ALA A HA   7  
ATOM 7660  H HB1  . ALA A 1 28 ? -0.756  -4.261  8.546   1.00 0.00 ? 112 ALA A HB1  7  
ATOM 7661  H HB2  . ALA A 1 28 ? -2.404  -3.667  8.333   1.00 0.00 ? 112 ALA A HB2  7  
ATOM 7662  H HB3  . ALA A 1 28 ? -1.251  -2.746  9.298   1.00 0.00 ? 112 ALA A HB3  7  
ATOM 7663  N N    . HIS A 1 29 ? 1.434   -3.057  6.919   1.00 0.00 ? 113 HIS A N    7  
ATOM 7664  C CA   . HIS A 1 29 ? 2.861   -2.772  7.028   1.00 0.00 ? 113 HIS A CA   7  
ATOM 7665  C C    . HIS A 1 29 ? 3.263   -1.656  6.059   1.00 0.00 ? 113 HIS A C    7  
ATOM 7666  O O    . HIS A 1 29 ? 4.317   -1.044  6.198   1.00 0.00 ? 113 HIS A O    7  
ATOM 7667  C CB   . HIS A 1 29 ? 3.671   -4.042  6.750   1.00 0.00 ? 113 HIS A CB   7  
ATOM 7668  C CG   . HIS A 1 29 ? 5.074   -4.003  7.282   1.00 0.00 ? 113 HIS A CG   7  
ATOM 7669  N ND1  . HIS A 1 29 ? 5.467   -4.694  8.405   1.00 0.00 ? 113 HIS A ND1  7  
ATOM 7670  C CD2  . HIS A 1 29 ? 6.181   -3.366  6.831   1.00 0.00 ? 113 HIS A CD2  7  
ATOM 7671  C CE1  . HIS A 1 29 ? 6.752   -4.483  8.623   1.00 0.00 ? 113 HIS A CE1  7  
ATOM 7672  N NE2  . HIS A 1 29 ? 7.212   -3.681  7.680   1.00 0.00 ? 113 HIS A NE2  7  
ATOM 7673  H H    . HIS A 1 29 ? 1.144   -3.917  6.541   1.00 0.00 ? 113 HIS A H    7  
ATOM 7674  H HA   . HIS A 1 29 ? 3.058   -2.443  8.038   1.00 0.00 ? 113 HIS A HA   7  
ATOM 7675  H HB2  . HIS A 1 29 ? 3.170   -4.884  7.204   1.00 0.00 ? 113 HIS A HB2  7  
ATOM 7676  H HB3  . HIS A 1 29 ? 3.723   -4.197  5.682   1.00 0.00 ? 113 HIS A HB3  7  
ATOM 7677  H HD1  . HIS A 1 29 ? 4.879   -5.257  8.973   1.00 0.00 ? 113 HIS A HD1  7  
ATOM 7678  H HD2  . HIS A 1 29 ? 6.242   -2.724  5.963   1.00 0.00 ? 113 HIS A HD2  7  
ATOM 7679  H HE1  . HIS A 1 29 ? 7.330   -4.897  9.437   1.00 0.00 ? 113 HIS A HE1  7  
ATOM 7680  H HE2  . HIS A 1 29 ? 8.067   -3.183  7.736   1.00 0.00 ? 113 HIS A HE2  7  
ATOM 7681  N N    . LEU A 1 30 ? 2.417   -1.398  5.071   1.00 0.00 ? 114 LEU A N    7  
ATOM 7682  C CA   . LEU A 1 30 ? 2.651   -0.311  4.129   1.00 0.00 ? 114 LEU A CA   7  
ATOM 7683  C C    . LEU A 1 30 ? 1.814   0.907   4.502   1.00 0.00 ? 114 LEU A C    7  
ATOM 7684  O O    . LEU A 1 30 ? 2.315   2.029   4.567   1.00 0.00 ? 114 LEU A O    7  
ATOM 7685  C CB   . LEU A 1 30 ? 2.308   -0.750  2.703   1.00 0.00 ? 114 LEU A CB   7  
ATOM 7686  C CG   . LEU A 1 30 ? 2.498   0.327   1.632   1.00 0.00 ? 114 LEU A CG   7  
ATOM 7687  C CD1  . LEU A 1 30 ? 3.974   0.639   1.444   1.00 0.00 ? 114 LEU A CD1  7  
ATOM 7688  C CD2  . LEU A 1 30 ? 1.863   -0.104  0.321   1.00 0.00 ? 114 LEU A CD2  7  
ATOM 7689  H H    . LEU A 1 30 ? 1.609   -1.950  4.977   1.00 0.00 ? 114 LEU A H    7  
ATOM 7690  H HA   . LEU A 1 30 ? 3.696   -0.048  4.178   1.00 0.00 ? 114 LEU A HA   7  
ATOM 7691  H HB2  . LEU A 1 30 ? 2.931   -1.595  2.449   1.00 0.00 ? 114 LEU A HB2  7  
ATOM 7692  H HB3  . LEU A 1 30 ? 1.276   -1.067  2.683   1.00 0.00 ? 114 LEU A HB3  7  
ATOM 7693  H HG   . LEU A 1 30 ? 2.007   1.233   1.957   1.00 0.00 ? 114 LEU A HG   7  
ATOM 7694  H HD11 . LEU A 1 30 ? 4.392   0.988   2.376   1.00 0.00 ? 114 LEU A HD11 7  
ATOM 7695  H HD12 . LEU A 1 30 ? 4.086   1.404   0.690   1.00 0.00 ? 114 LEU A HD12 7  
ATOM 7696  H HD13 . LEU A 1 30 ? 4.493   -0.254  1.129   1.00 0.00 ? 114 LEU A HD13 7  
ATOM 7697  H HD21 . LEU A 1 30 ? 0.799   -0.237  0.461   1.00 0.00 ? 114 LEU A HD21 7  
ATOM 7698  H HD22 . LEU A 1 30 ? 2.300   -1.038  -0.002  1.00 0.00 ? 114 LEU A HD22 7  
ATOM 7699  H HD23 . LEU A 1 30 ? 2.038   0.651   -0.431  1.00 0.00 ? 114 LEU A HD23 7  
ATOM 7700  N N    . LYS A 1 31 ? 0.535   0.665   4.753   1.00 0.00 ? 115 LYS A N    7  
ATOM 7701  C CA   . LYS A 1 31 ? -0.416  1.718   5.072   1.00 0.00 ? 115 LYS A CA   7  
ATOM 7702  C C    . LYS A 1 31 ? -0.043  2.422   6.373   1.00 0.00 ? 115 LYS A C    7  
ATOM 7703  O O    . LYS A 1 31 ? -0.102  3.648   6.457   1.00 0.00 ? 115 LYS A O    7  
ATOM 7704  C CB   . LYS A 1 31 ? -1.827  1.118   5.145   1.00 0.00 ? 115 LYS A CB   7  
ATOM 7705  C CG   . LYS A 1 31 ? -2.928  2.096   5.530   1.00 0.00 ? 115 LYS A CG   7  
ATOM 7706  C CD   . LYS A 1 31 ? -4.258  1.668   4.923   1.00 0.00 ? 115 LYS A CD   7  
ATOM 7707  C CE   . LYS A 1 31 ? -5.447  2.347   5.584   1.00 0.00 ? 115 LYS A CE   7  
ATOM 7708  N NZ   . LYS A 1 31 ? -5.731  1.783   6.928   1.00 0.00 ? 115 LYS A NZ   7  
ATOM 7709  H H    . LYS A 1 31 ? 0.214   -0.265  4.713   1.00 0.00 ? 115 LYS A H    7  
ATOM 7710  H HA   . LYS A 1 31 ? -0.386  2.441   4.272   1.00 0.00 ? 115 LYS A HA   7  
ATOM 7711  H HB2  . LYS A 1 31 ? -2.074  0.705   4.178   1.00 0.00 ? 115 LYS A HB2  7  
ATOM 7712  H HB3  . LYS A 1 31 ? -1.821  0.317   5.870   1.00 0.00 ? 115 LYS A HB3  7  
ATOM 7713  H HG2  . LYS A 1 31 ? -3.024  2.118   6.606   1.00 0.00 ? 115 LYS A HG2  7  
ATOM 7714  H HG3  . LYS A 1 31 ? -2.672  3.080   5.165   1.00 0.00 ? 115 LYS A HG3  7  
ATOM 7715  H HD2  . LYS A 1 31 ? -4.256  1.923   3.874   1.00 0.00 ? 115 LYS A HD2  7  
ATOM 7716  H HD3  . LYS A 1 31 ? -4.360  0.597   5.031   1.00 0.00 ? 115 LYS A HD3  7  
ATOM 7717  H HE2  . LYS A 1 31 ? -5.234  3.399   5.684   1.00 0.00 ? 115 LYS A HE2  7  
ATOM 7718  H HE3  . LYS A 1 31 ? -6.316  2.215   4.957   1.00 0.00 ? 115 LYS A HE3  7  
ATOM 7719  H HZ1  . LYS A 1 31 ? -6.702  2.032   7.223   1.00 0.00 ? 115 LYS A HZ1  7  
ATOM 7720  H HZ2  . LYS A 1 31 ? -5.068  2.168   7.633   1.00 0.00 ? 115 LYS A HZ2  7  
ATOM 7721  H HZ3  . LYS A 1 31 ? -5.640  0.741   6.913   1.00 0.00 ? 115 LYS A HZ3  7  
ATOM 7722  N N    . GLN A 1 32 ? 0.374   1.646   7.367   1.00 0.00 ? 116 GLN A N    7  
ATOM 7723  C CA   . GLN A 1 32 ? 0.763   2.200   8.659   1.00 0.00 ? 116 GLN A CA   7  
ATOM 7724  C C    . GLN A 1 32 ? 2.181   2.769   8.591   1.00 0.00 ? 116 GLN A C    7  
ATOM 7725  O O    . GLN A 1 32 ? 2.588   3.565   9.439   1.00 0.00 ? 116 GLN A O    7  
ATOM 7726  C CB   . GLN A 1 32 ? 0.658   1.127   9.745   1.00 0.00 ? 116 GLN A CB   7  
ATOM 7727  C CG   . GLN A 1 32 ? 0.876   1.643   11.157  1.00 0.00 ? 116 GLN A CG   7  
ATOM 7728  C CD   . GLN A 1 32 ? 0.713   0.554   12.195  1.00 0.00 ? 116 GLN A CD   7  
ATOM 7729  O OE1  . GLN A 1 32 ? 0.984   -0.620  11.930  1.00 0.00 ? 116 GLN A OE1  7  
ATOM 7730  N NE2  . GLN A 1 32 ? 0.262   0.928   13.381  1.00 0.00 ? 116 GLN A NE2  7  
ATOM 7731  H H    . GLN A 1 32 ? 0.421   0.675   7.233   1.00 0.00 ? 116 GLN A H    7  
ATOM 7732  H HA   . GLN A 1 32 ? 0.078   3.015   8.892   1.00 0.00 ? 116 GLN A HA   7  
ATOM 7733  H HB2  . GLN A 1 32 ? -0.325  0.685   9.699   1.00 0.00 ? 116 GLN A HB2  7  
ATOM 7734  H HB3  . GLN A 1 32 ? 1.395   0.361   9.549   1.00 0.00 ? 116 GLN A HB3  7  
ATOM 7735  H HG2  . GLN A 1 32 ? 1.877   2.047   11.231  1.00 0.00 ? 116 GLN A HG2  7  
ATOM 7736  H HG3  . GLN A 1 32 ? 0.159   2.425   11.358  1.00 0.00 ? 116 GLN A HG3  7  
ATOM 7737  H HE21 . GLN A 1 32 ? 0.059   1.882   13.524  1.00 0.00 ? 116 GLN A HE21 7  
ATOM 7738  H HE22 . GLN A 1 32 ? 0.146   0.236   14.072  1.00 0.00 ? 116 GLN A HE22 7  
ATOM 7739  N N    . GLN A 1 33 ? 2.931   2.360   7.576   1.00 0.00 ? 117 GLN A N    7  
ATOM 7740  C CA   . GLN A 1 33 ? 4.236   2.948   7.319   1.00 0.00 ? 117 GLN A CA   7  
ATOM 7741  C C    . GLN A 1 33 ? 4.048   4.392   6.875   1.00 0.00 ? 117 GLN A C    7  
ATOM 7742  O O    . GLN A 1 33 ? 4.616   5.324   7.458   1.00 0.00 ? 117 GLN A O    7  
ATOM 7743  C CB   . GLN A 1 33 ? 4.982   2.153   6.243   1.00 0.00 ? 117 GLN A CB   7  
ATOM 7744  C CG   . GLN A 1 33 ? 6.387   2.665   5.961   1.00 0.00 ? 117 GLN A CG   7  
ATOM 7745  C CD   . GLN A 1 33 ? 7.116   1.844   4.910   1.00 0.00 ? 117 GLN A CD   7  
ATOM 7746  O OE1  . GLN A 1 33 ? 8.341   1.727   4.936   1.00 0.00 ? 117 GLN A OE1  7  
ATOM 7747  N NE2  . GLN A 1 33 ? 6.371   1.276   3.972   1.00 0.00 ? 117 GLN A NE2  7  
ATOM 7748  H H    . GLN A 1 33 ? 2.598   1.654   6.986   1.00 0.00 ? 117 GLN A H    7  
ATOM 7749  H HA   . GLN A 1 33 ? 4.804   2.930   8.238   1.00 0.00 ? 117 GLN A HA   7  
ATOM 7750  H HB2  . GLN A 1 33 ? 5.054   1.124   6.559   1.00 0.00 ? 117 GLN A HB2  7  
ATOM 7751  H HB3  . GLN A 1 33 ? 4.417   2.197   5.321   1.00 0.00 ? 117 GLN A HB3  7  
ATOM 7752  H HG2  . GLN A 1 33 ? 6.320   3.686   5.614   1.00 0.00 ? 117 GLN A HG2  7  
ATOM 7753  H HG3  . GLN A 1 33 ? 6.957   2.634   6.878   1.00 0.00 ? 117 GLN A HG3  7  
ATOM 7754  H HE21 . GLN A 1 33 ? 5.403   1.412   4.005   1.00 0.00 ? 117 GLN A HE21 7  
ATOM 7755  H HE22 . GLN A 1 33 ? 6.823   0.740   3.277   1.00 0.00 ? 117 GLN A HE22 7  
ATOM 7756  N N    . VAL A 1 34 ? 3.209   4.574   5.862   1.00 0.00 ? 118 VAL A N    7  
ATOM 7757  C CA   . VAL A 1 34 ? 2.894   5.901   5.366   1.00 0.00 ? 118 VAL A CA   7  
ATOM 7758  C C    . VAL A 1 34 ? 2.166   6.707   6.436   1.00 0.00 ? 118 VAL A C    7  
ATOM 7759  O O    . VAL A 1 34 ? 2.471   7.877   6.645   1.00 0.00 ? 118 VAL A O    7  
ATOM 7760  C CB   . VAL A 1 34 ? 2.030   5.852   4.088   1.00 0.00 ? 118 VAL A CB   7  
ATOM 7761  C CG1  . VAL A 1 34 ? 1.765   7.257   3.562   1.00 0.00 ? 118 VAL A CG1  7  
ATOM 7762  C CG2  . VAL A 1 34 ? 2.698   4.993   3.021   1.00 0.00 ? 118 VAL A CG2  7  
ATOM 7763  H H    . VAL A 1 34 ? 2.793   3.789   5.439   1.00 0.00 ? 118 VAL A H    7  
ATOM 7764  H HA   . VAL A 1 34 ? 3.825   6.396   5.128   1.00 0.00 ? 118 VAL A HA   7  
ATOM 7765  H HB   . VAL A 1 34 ? 1.081   5.400   4.338   1.00 0.00 ? 118 VAL A HB   7  
ATOM 7766  H HG11 . VAL A 1 34 ? 2.700   7.718   3.276   1.00 0.00 ? 118 VAL A HG11 7  
ATOM 7767  H HG12 . VAL A 1 34 ? 1.295   7.850   4.335   1.00 0.00 ? 118 VAL A HG12 7  
ATOM 7768  H HG13 . VAL A 1 34 ? 1.112   7.203   2.703   1.00 0.00 ? 118 VAL A HG13 7  
ATOM 7769  H HG21 . VAL A 1 34 ? 2.096   4.998   2.125   1.00 0.00 ? 118 VAL A HG21 7  
ATOM 7770  H HG22 . VAL A 1 34 ? 2.796   3.979   3.383   1.00 0.00 ? 118 VAL A HG22 7  
ATOM 7771  H HG23 . VAL A 1 34 ? 3.678   5.391   2.798   1.00 0.00 ? 118 VAL A HG23 7  
ATOM 7772  N N    . SER A 1 35 ? 1.226   6.065   7.128   1.00 0.00 ? 119 SER A N    7  
ATOM 7773  C CA   . SER A 1 35 ? 0.451   6.726   8.176   1.00 0.00 ? 119 SER A CA   7  
ATOM 7774  C C    . SER A 1 35 ? 1.360   7.174   9.314   1.00 0.00 ? 119 SER A C    7  
ATOM 7775  O O    . SER A 1 35 ? 1.105   8.187   9.968   1.00 0.00 ? 119 SER A O    7  
ATOM 7776  C CB   . SER A 1 35 ? -0.650  5.800   8.711   1.00 0.00 ? 119 SER A CB   7  
ATOM 7777  O OG   . SER A 1 35 ? -0.109  4.697   9.395   1.00 0.00 ? 119 SER A OG   7  
ATOM 7778  H H    . SER A 1 35 ? 1.045   5.120   6.925   1.00 0.00 ? 119 SER A H    7  
ATOM 7779  H HA   . SER A 1 35 ? -0.010  7.600   7.738   1.00 0.00 ? 119 SER A HA   7  
ATOM 7780  H HB2  . SER A 1 35 ? -1.276  6.339   9.391   1.00 0.00 ? 119 SER A HB2  7  
ATOM 7781  H HB3  . SER A 1 35 ? -1.248  5.437   7.888   1.00 0.00 ? 119 SER A HB3  7  
ATOM 7782  H HG   . SER A 1 35 ? -0.018  4.913   10.333  1.00 0.00 ? 119 SER A HG   7  
ATOM 7783  N N    . GLY A 1 36 ? 2.419   6.409   9.545   1.00 0.00 ? 120 GLY A N    7  
ATOM 7784  C CA   . GLY A 1 36 ? 3.390   6.769   10.554  1.00 0.00 ? 120 GLY A CA   7  
ATOM 7785  C C    . GLY A 1 36 ? 4.199   7.982   10.150  1.00 0.00 ? 120 GLY A C    7  
ATOM 7786  O O    . GLY A 1 36 ? 4.660   8.738   11.007  1.00 0.00 ? 120 GLY A O    7  
ATOM 7787  H H    . GLY A 1 36 ? 2.533   5.580   9.032   1.00 0.00 ? 120 GLY A H    7  
ATOM 7788  H HA2  . GLY A 1 36 ? 2.875   6.983   11.478  1.00 0.00 ? 120 GLY A HA2  7  
ATOM 7789  H HA3  . GLY A 1 36 ? 4.060   5.936   10.712  1.00 0.00 ? 120 GLY A HA3  7  
ATOM 7790  N N    . LEU A 1 37 ? 4.381   8.167   8.846   1.00 0.00 ? 121 LEU A N    7  
ATOM 7791  C CA   . LEU A 1 37 ? 5.121   9.321   8.350   1.00 0.00 ? 121 LEU A CA   7  
ATOM 7792  C C    . LEU A 1 37 ? 4.193   10.506  8.057   1.00 0.00 ? 121 LEU A C    7  
ATOM 7793  O O    . LEU A 1 37 ? 4.129   11.460  8.835   1.00 0.00 ? 121 LEU A O    7  
ATOM 7794  C CB   . LEU A 1 37 ? 5.898   8.947   7.081   1.00 0.00 ? 121 LEU A CB   7  
ATOM 7795  C CG   . LEU A 1 37 ? 6.872   7.776   7.227   1.00 0.00 ? 121 LEU A CG   7  
ATOM 7796  C CD1  . LEU A 1 37 ? 7.566   7.499   5.903   1.00 0.00 ? 121 LEU A CD1  7  
ATOM 7797  C CD2  . LEU A 1 37 ? 7.893   8.067   8.313   1.00 0.00 ? 121 LEU A CD2  7  
ATOM 7798  H H    . LEU A 1 37 ? 4.028   7.500   8.209   1.00 0.00 ? 121 LEU A H    7  
ATOM 7799  H HA   . LEU A 1 37 ? 5.827   9.612   9.113   1.00 0.00 ? 121 LEU A HA   7  
ATOM 7800  H HB2  . LEU A 1 37 ? 5.183   8.696   6.310   1.00 0.00 ? 121 LEU A HB2  7  
ATOM 7801  H HB3  . LEU A 1 37 ? 6.458   9.811   6.760   1.00 0.00 ? 121 LEU A HB3  7  
ATOM 7802  H HG   . LEU A 1 37 ? 6.323   6.888   7.509   1.00 0.00 ? 121 LEU A HG   7  
ATOM 7803  H HD11 . LEU A 1 37 ? 8.230   6.654   6.011   1.00 0.00 ? 121 LEU A HD11 7  
ATOM 7804  H HD12 . LEU A 1 37 ? 8.133   8.369   5.606   1.00 0.00 ? 121 LEU A HD12 7  
ATOM 7805  H HD13 . LEU A 1 37 ? 6.824   7.279   5.147   1.00 0.00 ? 121 LEU A HD13 7  
ATOM 7806  H HD21 . LEU A 1 37 ? 8.546   7.215   8.434   1.00 0.00 ? 121 LEU A HD21 7  
ATOM 7807  H HD22 . LEU A 1 37 ? 7.384   8.264   9.245   1.00 0.00 ? 121 LEU A HD22 7  
ATOM 7808  H HD23 . LEU A 1 37 ? 8.478   8.933   8.034   1.00 0.00 ? 121 LEU A HD23 7  
ATOM 7809  N N    . GLU A 1 38 ? 3.482   10.447  6.936   1.00 0.00 ? 122 GLU A N    7  
ATOM 7810  C CA   . GLU A 1 38 ? 2.622   11.549  6.506   1.00 0.00 ? 122 GLU A CA   7  
ATOM 7811  C C    . GLU A 1 38 ? 1.152   11.267  6.768   1.00 0.00 ? 122 GLU A C    7  
ATOM 7812  O O    . GLU A 1 38 ? 0.329   12.177  6.714   1.00 0.00 ? 122 GLU A O    7  
ATOM 7813  C CB   . GLU A 1 38 ? 2.790   11.809  5.017   1.00 0.00 ? 122 GLU A CB   7  
ATOM 7814  C CG   . GLU A 1 38 ? 4.235   11.919  4.570   1.00 0.00 ? 122 GLU A CG   7  
ATOM 7815  C CD   . GLU A 1 38 ? 4.355   12.437  3.157   1.00 0.00 ? 122 GLU A CD   7  
ATOM 7816  O OE1  . GLU A 1 38 ? 4.104   13.640  2.944   1.00 0.00 ? 122 GLU A OE1  7  
ATOM 7817  O OE2  . GLU A 1 38 ? 4.702   11.651  2.254   1.00 0.00 ? 122 GLU A OE2  7  
ATOM 7818  H H    . GLU A 1 38 ? 3.517   9.631   6.392   1.00 0.00 ? 122 GLU A H    7  
ATOM 7819  H HA   . GLU A 1 38 ? 2.914   12.435  7.048   1.00 0.00 ? 122 GLU A HA   7  
ATOM 7820  H HB2  . GLU A 1 38 ? 2.321   11.001  4.475   1.00 0.00 ? 122 GLU A HB2  7  
ATOM 7821  H HB3  . GLU A 1 38 ? 2.288   12.731  4.769   1.00 0.00 ? 122 GLU A HB3  7  
ATOM 7822  H HG2  . GLU A 1 38 ? 4.756   12.590  5.232   1.00 0.00 ? 122 GLU A HG2  7  
ATOM 7823  H HG3  . GLU A 1 38 ? 4.690   10.939  4.620   1.00 0.00 ? 122 GLU A HG3  7  
ATOM 7824  N N    . GLY A 1 39 ? 0.846   10.001  7.018   1.00 0.00 ? 123 GLY A N    7  
ATOM 7825  C CA   . GLY A 1 39 ? -0.520  9.500   6.976   1.00 0.00 ? 123 GLY A CA   7  
ATOM 7826  C C    . GLY A 1 39 ? -1.561  10.399  7.605   1.00 0.00 ? 123 GLY A C    7  
ATOM 7827  O O    . GLY A 1 39 ? -2.526  10.772  6.942   1.00 0.00 ? 123 GLY A O    7  
ATOM 7828  H H    . GLY A 1 39 ? 1.575   9.378   7.241   1.00 0.00 ? 123 GLY A H    7  
ATOM 7829  H HA2  . GLY A 1 39 ? -0.792  9.344   5.944   1.00 0.00 ? 123 GLY A HA2  7  
ATOM 7830  H HA3  . GLY A 1 39 ? -0.544  8.544   7.481   1.00 0.00 ? 123 GLY A HA3  7  
ATOM 7831  N N    . VAL A 1 40 ? -1.351  10.765  8.863   1.00 0.00 ? 124 VAL A N    7  
ATOM 7832  C CA   . VAL A 1 40 ? -2.359  11.502  9.623   1.00 0.00 ? 124 VAL A CA   7  
ATOM 7833  C C    . VAL A 1 40 ? -3.651  10.688  9.727   1.00 0.00 ? 124 VAL A C    7  
ATOM 7834  O O    . VAL A 1 40 ? -4.589  10.886  8.953   1.00 0.00 ? 124 VAL A O    7  
ATOM 7835  C CB   . VAL A 1 40 ? -2.655  12.880  8.987   1.00 0.00 ? 124 VAL A CB   7  
ATOM 7836  C CG1  . VAL A 1 40 ? -3.793  13.582  9.712   1.00 0.00 ? 124 VAL A CG1  7  
ATOM 7837  C CG2  . VAL A 1 40 ? -1.398  13.743  8.971   1.00 0.00 ? 124 VAL A CG2  7  
ATOM 7838  H H    . VAL A 1 40 ? -0.482  10.566  9.280   1.00 0.00 ? 124 VAL A H    7  
ATOM 7839  H HA   . VAL A 1 40 ? -1.969  11.664  10.617  1.00 0.00 ? 124 VAL A HA   7  
ATOM 7840  H HB   . VAL A 1 40 ? -2.962  12.715  7.964   1.00 0.00 ? 124 VAL A HB   7  
ATOM 7841  H HG11 . VAL A 1 40 ? -3.960  14.553  9.273   1.00 0.00 ? 124 VAL A HG11 7  
ATOM 7842  H HG12 . VAL A 1 40 ? -3.544  13.693  10.757  1.00 0.00 ? 124 VAL A HG12 7  
ATOM 7843  H HG13 . VAL A 1 40 ? -4.695  12.982  9.615   1.00 0.00 ? 124 VAL A HG13 7  
ATOM 7844  H HG21 . VAL A 1 40 ? -1.636  14.717  8.575   1.00 0.00 ? 124 VAL A HG21 7  
ATOM 7845  H HG22 . VAL A 1 40 ? -0.648  13.273  8.344   1.00 0.00 ? 124 VAL A HG22 7  
ATOM 7846  H HG23 . VAL A 1 40 ? -1.015  13.843  9.976   1.00 0.00 ? 124 VAL A HG23 7  
ATOM 7847  N N    . GLN A 1 41 ? -3.679  9.762   10.687  1.00 0.00 ? 125 GLN A N    7  
ATOM 7848  C CA   . GLN A 1 41 ? -4.800  8.830   10.854  1.00 0.00 ? 125 GLN A CA   7  
ATOM 7849  C C    . GLN A 1 41 ? -5.020  8.000   9.589   1.00 0.00 ? 125 GLN A C    7  
ATOM 7850  O O    . GLN A 1 41 ? -5.471  8.509   8.566   1.00 0.00 ? 125 GLN A O    7  
ATOM 7851  C CB   . GLN A 1 41 ? -6.094  9.566   11.221  1.00 0.00 ? 125 GLN A CB   7  
ATOM 7852  C CG   . GLN A 1 41 ? -6.084  10.170  12.617  1.00 0.00 ? 125 GLN A CG   7  
ATOM 7853  C CD   . GLN A 1 41 ? -7.407  10.809  12.998  1.00 0.00 ? 125 GLN A CD   7  
ATOM 7854  O OE1  . GLN A 1 41 ? -7.792  10.819  14.168  1.00 0.00 ? 125 GLN A OE1  7  
ATOM 7855  N NE2  . GLN A 1 41 ? -8.111  11.356  12.018  1.00 0.00 ? 125 GLN A NE2  7  
ATOM 7856  H H    . GLN A 1 41 ? -2.924  9.706   11.309  1.00 0.00 ? 125 GLN A H    7  
ATOM 7857  H HA   . GLN A 1 41 ? -4.544  8.158   11.660  1.00 0.00 ? 125 GLN A HA   7  
ATOM 7858  H HB2  . GLN A 1 41 ? -6.252  10.363  10.510  1.00 0.00 ? 125 GLN A HB2  7  
ATOM 7859  H HB3  . GLN A 1 41 ? -6.919  8.871   11.158  1.00 0.00 ? 125 GLN A HB3  7  
ATOM 7860  H HG2  . GLN A 1 41 ? -5.862  9.389   13.328  1.00 0.00 ? 125 GLN A HG2  7  
ATOM 7861  H HG3  . GLN A 1 41 ? -5.311  10.924  12.659  1.00 0.00 ? 125 GLN A HG3  7  
ATOM 7862  H HE21 . GLN A 1 41 ? -7.746  11.323  11.110  1.00 0.00 ? 125 GLN A HE21 7  
ATOM 7863  H HE22 . GLN A 1 41 ? -8.976  11.770  12.244  1.00 0.00 ? 125 GLN A HE22 7  
ATOM 7864  N N    . ASP A 1 42 ? -4.753  6.703   9.678   1.00 0.00 ? 126 ASP A N    7  
ATOM 7865  C CA   . ASP A 1 42 ? -4.843  5.818   8.516   1.00 0.00 ? 126 ASP A CA   7  
ATOM 7866  C C    . ASP A 1 42 ? -6.302  5.558   8.119   1.00 0.00 ? 126 ASP A C    7  
ATOM 7867  O O    . ASP A 1 42 ? -6.605  4.603   7.405   1.00 0.00 ? 126 ASP A O    7  
ATOM 7868  C CB   . ASP A 1 42 ? -4.114  4.495   8.797   1.00 0.00 ? 126 ASP A CB   7  
ATOM 7869  C CG   . ASP A 1 42 ? -4.846  3.605   9.782   1.00 0.00 ? 126 ASP A CG   7  
ATOM 7870  O OD1  . ASP A 1 42 ? -5.138  4.063   10.907  1.00 0.00 ? 126 ASP A OD1  7  
ATOM 7871  O OD2  . ASP A 1 42 ? -5.140  2.443   9.429   1.00 0.00 ? 126 ASP A OD2  7  
ATOM 7872  H H    . ASP A 1 42 ? -4.499  6.324   10.546  1.00 0.00 ? 126 ASP A H    7  
ATOM 7873  H HA   . ASP A 1 42 ? -4.350  6.314   7.692   1.00 0.00 ? 126 ASP A HA   7  
ATOM 7874  H HB2  . ASP A 1 42 ? -4.005  3.951   7.870   1.00 0.00 ? 126 ASP A HB2  7  
ATOM 7875  H HB3  . ASP A 1 42 ? -3.134  4.713   9.195   1.00 0.00 ? 126 ASP A HB3  7  
ATOM 7876  N N    . ASP A 1 43 ? -7.193  6.429   8.574   1.00 0.00 ? 127 ASP A N    7  
ATOM 7877  C CA   . ASP A 1 43 ? -8.599  6.365   8.213   1.00 0.00 ? 127 ASP A CA   7  
ATOM 7878  C C    . ASP A 1 43 ? -8.953  7.504   7.261   1.00 0.00 ? 127 ASP A C    7  
ATOM 7879  O O    . ASP A 1 43 ? -9.886  7.392   6.468   1.00 0.00 ? 127 ASP A O    7  
ATOM 7880  C CB   . ASP A 1 43 ? -9.478  6.436   9.464   1.00 0.00 ? 127 ASP A CB   7  
ATOM 7881  C CG   . ASP A 1 43 ? -10.960 6.390   9.140   1.00 0.00 ? 127 ASP A CG   7  
ATOM 7882  O OD1  . ASP A 1 43 ? -11.476 5.290   8.847   1.00 0.00 ? 127 ASP A OD1  7  
ATOM 7883  O OD2  . ASP A 1 43 ? -11.616 7.452   9.177   1.00 0.00 ? 127 ASP A OD2  7  
ATOM 7884  H H    . ASP A 1 43 ? -6.888  7.144   9.164   1.00 0.00 ? 127 ASP A H    7  
ATOM 7885  H HA   . ASP A 1 43 ? -8.771  5.424   7.713   1.00 0.00 ? 127 ASP A HA   7  
ATOM 7886  H HB2  . ASP A 1 43 ? -9.242  5.601   10.109  1.00 0.00 ? 127 ASP A HB2  7  
ATOM 7887  H HB3  . ASP A 1 43 ? -9.270  7.358   9.988   1.00 0.00 ? 127 ASP A HB3  7  
ATOM 7888  N N    . LEU A 1 44 ? -8.184  8.596   7.319   1.00 0.00 ? 128 LEU A N    7  
ATOM 7889  C CA   . LEU A 1 44 ? -8.440  9.747   6.457   1.00 0.00 ? 128 LEU A CA   7  
ATOM 7890  C C    . LEU A 1 44 ? -7.970  9.471   5.035   1.00 0.00 ? 128 LEU A C    7  
ATOM 7891  O O    . LEU A 1 44 ? -8.275  10.222  4.107   1.00 0.00 ? 128 LEU A O    7  
ATOM 7892  C CB   . LEU A 1 44 ? -7.739  10.991  7.004   1.00 0.00 ? 128 LEU A CB   7  
ATOM 7893  C CG   . LEU A 1 44 ? -8.217  11.454  8.380   1.00 0.00 ? 128 LEU A CG   7  
ATOM 7894  C CD1  . LEU A 1 44 ? -7.415  12.659  8.839   1.00 0.00 ? 128 LEU A CD1  7  
ATOM 7895  C CD2  . LEU A 1 44 ? -9.702  11.785  8.350   1.00 0.00 ? 128 LEU A CD2  7  
ATOM 7896  H H    . LEU A 1 44 ? -7.425  8.629   7.947   1.00 0.00 ? 128 LEU A H    7  
ATOM 7897  H HA   . LEU A 1 44 ? -9.506  9.921   6.445   1.00 0.00 ? 128 LEU A HA   7  
ATOM 7898  H HB2  . LEU A 1 44 ? -6.681  10.784  7.065   1.00 0.00 ? 128 LEU A HB2  7  
ATOM 7899  H HB3  . LEU A 1 44 ? -7.891  11.800  6.306   1.00 0.00 ? 128 LEU A HB3  7  
ATOM 7900  H HG   . LEU A 1 44 ? -8.064  10.656  9.093   1.00 0.00 ? 128 LEU A HG   7  
ATOM 7901  H HD11 . LEU A 1 44 ? -7.562  13.474  8.146   1.00 0.00 ? 128 LEU A HD11 7  
ATOM 7902  H HD12 . LEU A 1 44 ? -6.367  12.400  8.875   1.00 0.00 ? 128 LEU A HD12 7  
ATOM 7903  H HD13 . LEU A 1 44 ? -7.748  12.959  9.822   1.00 0.00 ? 128 LEU A HD13 7  
ATOM 7904  H HD21 . LEU A 1 44 ? -9.874  12.599  7.659   1.00 0.00 ? 128 LEU A HD21 7  
ATOM 7905  H HD22 . LEU A 1 44 ? -10.025 12.079  9.338   1.00 0.00 ? 128 LEU A HD22 7  
ATOM 7906  H HD23 . LEU A 1 44 ? -10.260 10.919  8.030   1.00 0.00 ? 128 LEU A HD23 7  
ATOM 7907  N N    . PHE A 1 45 ? -7.222  8.391   4.874   1.00 0.00 ? 129 PHE A N    7  
ATOM 7908  C CA   . PHE A 1 45 ? -6.733  7.987   3.570   1.00 0.00 ? 129 PHE A CA   7  
ATOM 7909  C C    . PHE A 1 45 ? -6.748  6.470   3.452   1.00 0.00 ? 129 PHE A C    7  
ATOM 7910  O O    . PHE A 1 45 ? -6.570  5.759   4.441   1.00 0.00 ? 129 PHE A O    7  
ATOM 7911  C CB   . PHE A 1 45 ? -5.310  8.512   3.344   1.00 0.00 ? 129 PHE A CB   7  
ATOM 7912  C CG   . PHE A 1 45 ? -4.254  7.793   4.140   1.00 0.00 ? 129 PHE A CG   7  
ATOM 7913  C CD1  . PHE A 1 45 ? -3.999  8.131   5.460   1.00 0.00 ? 129 PHE A CD1  7  
ATOM 7914  C CD2  . PHE A 1 45 ? -3.518  6.769   3.561   1.00 0.00 ? 129 PHE A CD2  7  
ATOM 7915  C CE1  . PHE A 1 45 ? -3.033  7.461   6.184   1.00 0.00 ? 129 PHE A CE1  7  
ATOM 7916  C CE2  . PHE A 1 45 ? -2.553  6.095   4.281   1.00 0.00 ? 129 PHE A CE2  7  
ATOM 7917  C CZ   . PHE A 1 45 ? -2.308  6.440   5.593   1.00 0.00 ? 129 PHE A CZ   7  
ATOM 7918  H H    . PHE A 1 45 ? -6.996  7.850   5.657   1.00 0.00 ? 129 PHE A H    7  
ATOM 7919  H HA   . PHE A 1 45 ? -7.389  8.406   2.821   1.00 0.00 ? 129 PHE A HA   7  
ATOM 7920  H HB2  . PHE A 1 45 ? -5.062  8.410   2.297   1.00 0.00 ? 129 PHE A HB2  7  
ATOM 7921  H HB3  . PHE A 1 45 ? -5.277  9.556   3.615   1.00 0.00 ? 129 PHE A HB3  7  
ATOM 7922  H HD1  . PHE A 1 45 ? -4.563  8.930   5.924   1.00 0.00 ? 129 PHE A HD1  7  
ATOM 7923  H HD2  . PHE A 1 45 ? -3.709  6.499   2.533   1.00 0.00 ? 129 PHE A HD2  7  
ATOM 7924  H HE1  . PHE A 1 45 ? -2.843  7.731   7.212   1.00 0.00 ? 129 PHE A HE1  7  
ATOM 7925  H HE2  . PHE A 1 45 ? -1.987  5.300   3.816   1.00 0.00 ? 129 PHE A HE2  7  
ATOM 7926  H HZ   . PHE A 1 45 ? -1.554  5.913   6.159   1.00 0.00 ? 129 PHE A HZ   7  
ATOM 7927  N N    . TRP A 1 46 ? -6.964  5.974   2.247   1.00 0.00 ? 130 TRP A N    7  
ATOM 7928  C CA   . TRP A 1 46 ? -6.857  4.551   1.983   1.00 0.00 ? 130 TRP A CA   7  
ATOM 7929  C C    . TRP A 1 46 ? -6.421  4.353   0.540   1.00 0.00 ? 130 TRP A C    7  
ATOM 7930  O O    . TRP A 1 46 ? -6.608  5.232   -0.292  1.00 0.00 ? 130 TRP A O    7  
ATOM 7931  C CB   . TRP A 1 46 ? -8.185  3.827   2.271   1.00 0.00 ? 130 TRP A CB   7  
ATOM 7932  C CG   . TRP A 1 46 ? -9.165  3.825   1.137   1.00 0.00 ? 130 TRP A CG   7  
ATOM 7933  C CD1  . TRP A 1 46 ? -9.540  2.741   0.396   1.00 0.00 ? 130 TRP A CD1  7  
ATOM 7934  C CD2  . TRP A 1 46 ? -9.894  4.942   0.609   1.00 0.00 ? 130 TRP A CD2  7  
ATOM 7935  N NE1  . TRP A 1 46 ? -10.455 3.114   -0.552  1.00 0.00 ? 130 TRP A NE1  7  
ATOM 7936  C CE2  . TRP A 1 46 ? -10.684 4.456   -0.448  1.00 0.00 ? 130 TRP A CE2  7  
ATOM 7937  C CE3  . TRP A 1 46 ? -9.952  6.301   0.923   1.00 0.00 ? 130 TRP A CE3  7  
ATOM 7938  C CZ2  . TRP A 1 46 ? -11.523 5.277   -1.190  1.00 0.00 ? 130 TRP A CZ2  7  
ATOM 7939  C CZ3  . TRP A 1 46 ? -10.784 7.119   0.183   1.00 0.00 ? 130 TRP A CZ3  7  
ATOM 7940  C CH2  . TRP A 1 46 ? -11.559 6.602   -0.865  1.00 0.00 ? 130 TRP A CH2  7  
ATOM 7941  H H    . TRP A 1 46 ? -7.195  6.583   1.511   1.00 0.00 ? 130 TRP A H    7  
ATOM 7942  H HA   . TRP A 1 46 ? -6.091  4.155   2.633   1.00 0.00 ? 130 TRP A HA   7  
ATOM 7943  H HB2  . TRP A 1 46 ? -7.972  2.799   2.516   1.00 0.00 ? 130 TRP A HB2  7  
ATOM 7944  H HB3  . TRP A 1 46 ? -8.660  4.298   3.120   1.00 0.00 ? 130 TRP A HB3  7  
ATOM 7945  H HD1  . TRP A 1 46 ? -9.165  1.741   0.550   1.00 0.00 ? 130 TRP A HD1  7  
ATOM 7946  H HE1  . TRP A 1 46 ? -10.872 2.514   -1.209  1.00 0.00 ? 130 TRP A HE1  7  
ATOM 7947  H HE3  . TRP A 1 46 ? -9.362  6.716   1.727   1.00 0.00 ? 130 TRP A HE3  7  
ATOM 7948  H HZ2  . TRP A 1 46 ? -12.128 4.895   -1.999  1.00 0.00 ? 130 TRP A HZ2  7  
ATOM 7949  H HZ3  . TRP A 1 46 ? -10.842 8.174   0.407   1.00 0.00 ? 130 TRP A HZ3  7  
ATOM 7950  H HH2  . TRP A 1 46 ? -12.192 7.274   -1.419  1.00 0.00 ? 130 TRP A HH2  7  
ATOM 7951  N N    . LEU A 1 47 ? -5.819  3.220   0.243   1.00 0.00 ? 131 LEU A N    7  
ATOM 7952  C CA   . LEU A 1 47 ? -5.310  2.982   -1.097  1.00 0.00 ? 131 LEU A CA   7  
ATOM 7953  C C    . LEU A 1 47 ? -6.100  1.877   -1.780  1.00 0.00 ? 131 LEU A C    7  
ATOM 7954  O O    . LEU A 1 47 ? -6.615  0.967   -1.121  1.00 0.00 ? 131 LEU A O    7  
ATOM 7955  C CB   . LEU A 1 47 ? -3.815  2.625   -1.064  1.00 0.00 ? 131 LEU A CB   7  
ATOM 7956  C CG   . LEU A 1 47 ? -2.853  3.766   -0.701  1.00 0.00 ? 131 LEU A CG   7  
ATOM 7957  C CD1  . LEU A 1 47 ? -2.943  4.118   0.775   1.00 0.00 ? 131 LEU A CD1  7  
ATOM 7958  C CD2  . LEU A 1 47 ? -1.426  3.392   -1.065  1.00 0.00 ? 131 LEU A CD2  7  
ATOM 7959  H H    . LEU A 1 47 ? -5.722  2.525   0.927   1.00 0.00 ? 131 LEU A H    7  
ATOM 7960  H HA   . LEU A 1 47 ? -5.443  3.897   -1.661  1.00 0.00 ? 131 LEU A HA   7  
ATOM 7961  H HB2  . LEU A 1 47 ? -3.680  1.836   -0.343  1.00 0.00 ? 131 LEU A HB2  7  
ATOM 7962  H HB3  . LEU A 1 47 ? -3.539  2.250   -2.038  1.00 0.00 ? 131 LEU A HB3  7  
ATOM 7963  H HG   . LEU A 1 47 ? -3.121  4.648   -1.266  1.00 0.00 ? 131 LEU A HG   7  
ATOM 7964  H HD11 . LEU A 1 47 ? -3.955  4.413   1.013   1.00 0.00 ? 131 LEU A HD11 7  
ATOM 7965  H HD12 . LEU A 1 47 ? -2.269  4.932   0.993   1.00 0.00 ? 131 LEU A HD12 7  
ATOM 7966  H HD13 . LEU A 1 47 ? -2.672  3.256   1.368   1.00 0.00 ? 131 LEU A HD13 7  
ATOM 7967  H HD21 . LEU A 1 47 ? -1.140  2.497   -0.532  1.00 0.00 ? 131 LEU A HD21 7  
ATOM 7968  H HD22 . LEU A 1 47 ? -0.762  4.199   -0.792  1.00 0.00 ? 131 LEU A HD22 7  
ATOM 7969  H HD23 . LEU A 1 47 ? -1.360  3.214   -2.128  1.00 0.00 ? 131 LEU A HD23 7  
ATOM 7970  N N    . THR A 1 48 ? -6.202  1.966   -3.096  1.00 0.00 ? 132 THR A N    7  
ATOM 7971  C CA   . THR A 1 48 ? -6.963  0.999   -3.875  1.00 0.00 ? 132 THR A CA   7  
ATOM 7972  C C    . THR A 1 48 ? -6.156  0.505   -5.069  1.00 0.00 ? 132 THR A C    7  
ATOM 7973  O O    . THR A 1 48 ? -5.252  1.197   -5.551  1.00 0.00 ? 132 THR A O    7  
ATOM 7974  C CB   . THR A 1 48 ? -8.284  1.606   -4.396  1.00 0.00 ? 132 THR A CB   7  
ATOM 7975  O OG1  . THR A 1 48 ? -8.010  2.798   -5.146  1.00 0.00 ? 132 THR A OG1  7  
ATOM 7976  C CG2  . THR A 1 48 ? -9.237  1.934   -3.256  1.00 0.00 ? 132 THR A CG2  7  
ATOM 7977  H H    . THR A 1 48 ? -5.747  2.699   -3.565  1.00 0.00 ? 132 THR A H    7  
ATOM 7978  H HA   . THR A 1 48 ? -7.200  0.161   -3.236  1.00 0.00 ? 132 THR A HA   7  
ATOM 7979  H HB   . THR A 1 48 ? -8.761  0.886   -5.046  1.00 0.00 ? 132 THR A HB   7  
ATOM 7980  H HG1  . THR A 1 48 ? -8.106  2.604   -6.090  1.00 0.00 ? 132 THR A HG1  7  
ATOM 7981  H HG21 . THR A 1 48 ? -8.791  2.681   -2.615  1.00 0.00 ? 132 THR A HG21 7  
ATOM 7982  H HG22 . THR A 1 48 ? -9.435  1.041   -2.683  1.00 0.00 ? 132 THR A HG22 7  
ATOM 7983  H HG23 . THR A 1 48 ? -10.164 2.315   -3.659  1.00 0.00 ? 132 THR A HG23 7  
ATOM 7984  N N    . PHE A 1 49 ? -6.474  -0.691  -5.529  1.00 0.00 ? 133 PHE A N    7  
ATOM 7985  C CA   . PHE A 1 49 ? -5.909  -1.209  -6.759  1.00 0.00 ? 133 PHE A CA   7  
ATOM 7986  C C    . PHE A 1 49 ? -6.975  -1.937  -7.564  1.00 0.00 ? 133 PHE A C    7  
ATOM 7987  O O    . PHE A 1 49 ? -7.714  -2.761  -7.021  1.00 0.00 ? 133 PHE A O    7  
ATOM 7988  C CB   . PHE A 1 49 ? -4.737  -2.164  -6.497  1.00 0.00 ? 133 PHE A CB   7  
ATOM 7989  C CG   . PHE A 1 49 ? -4.339  -2.910  -7.740  1.00 0.00 ? 133 PHE A CG   7  
ATOM 7990  C CD1  . PHE A 1 49 ? -3.737  -2.243  -8.797  1.00 0.00 ? 133 PHE A CD1  7  
ATOM 7991  C CD2  . PHE A 1 49 ? -4.619  -4.261  -7.877  1.00 0.00 ? 133 PHE A CD2  7  
ATOM 7992  C CE1  . PHE A 1 49 ? -3.416  -2.911  -9.962  1.00 0.00 ? 133 PHE A CE1  7  
ATOM 7993  C CE2  . PHE A 1 49 ? -4.309  -4.931  -9.045  1.00 0.00 ? 133 PHE A CE2  7  
ATOM 7994  C CZ   . PHE A 1 49 ? -3.704  -4.253  -10.088 1.00 0.00 ? 133 PHE A CZ   7  
ATOM 7995  H H    . PHE A 1 49 ? -7.121  -1.243  -5.030  1.00 0.00 ? 133 PHE A H    7  
ATOM 7996  H HA   . PHE A 1 49 ? -5.553  -0.369  -7.336  1.00 0.00 ? 133 PHE A HA   7  
ATOM 7997  H HB2  . PHE A 1 49 ? -3.884  -1.597  -6.152  1.00 0.00 ? 133 PHE A HB2  7  
ATOM 7998  H HB3  . PHE A 1 49 ? -5.021  -2.885  -5.748  1.00 0.00 ? 133 PHE A HB3  7  
ATOM 7999  H HD1  . PHE A 1 49 ? -3.511  -1.192  -8.699  1.00 0.00 ? 133 PHE A HD1  7  
ATOM 8000  H HD2  . PHE A 1 49 ? -5.087  -4.793  -7.061  1.00 0.00 ? 133 PHE A HD2  7  
ATOM 8001  H HE1  . PHE A 1 49 ? -2.944  -2.380  -10.775 1.00 0.00 ? 133 PHE A HE1  7  
ATOM 8002  H HE2  . PHE A 1 49 ? -4.534  -5.983  -9.141  1.00 0.00 ? 133 PHE A HE2  7  
ATOM 8003  H HZ   . PHE A 1 49 ? -3.471  -4.770  -11.004 1.00 0.00 ? 133 PHE A HZ   7  
ATOM 8004  N N    . GLU A 1 50 ? -7.065  -1.596  -8.850  1.00 0.00 ? 134 GLU A N    7  
ATOM 8005  C CA   . GLU A 1 50 ? -7.924  -2.300  -9.807  1.00 0.00 ? 134 GLU A CA   7  
ATOM 8006  C C    . GLU A 1 50 ? -9.408  -2.017  -9.528  1.00 0.00 ? 134 GLU A C    7  
ATOM 8007  O O    . GLU A 1 50 ? -10.289 -2.494  -10.241 1.00 0.00 ? 134 GLU A O    7  
ATOM 8008  C CB   . GLU A 1 50 ? -7.660  -3.812  -9.757  1.00 0.00 ? 134 GLU A CB   7  
ATOM 8009  C CG   . GLU A 1 50 ? -8.157  -4.568  -10.978 1.00 0.00 ? 134 GLU A CG   7  
ATOM 8010  C CD   . GLU A 1 50 ? -8.895  -5.834  -10.607 1.00 0.00 ? 134 GLU A CD   7  
ATOM 8011  O OE1  . GLU A 1 50 ? -8.247  -6.799  -10.158 1.00 0.00 ? 134 GLU A OE1  7  
ATOM 8012  O OE2  . GLU A 1 50 ? -10.136 -5.858  -10.731 1.00 0.00 ? 134 GLU A OE2  7  
ATOM 8013  H H    . GLU A 1 50 ? -6.547  -0.822  -9.168  1.00 0.00 ? 134 GLU A H    7  
ATOM 8014  H HA   . GLU A 1 50 ? -7.673  -1.940  -10.794 1.00 0.00 ? 134 GLU A HA   7  
ATOM 8015  H HB2  . GLU A 1 50 ? -6.596  -3.976  -9.668  1.00 0.00 ? 134 GLU A HB2  7  
ATOM 8016  H HB3  . GLU A 1 50 ? -8.152  -4.217  -8.885  1.00 0.00 ? 134 GLU A HB3  7  
ATOM 8017  H HG2  . GLU A 1 50 ? -8.824  -3.931  -11.536 1.00 0.00 ? 134 GLU A HG2  7  
ATOM 8018  H HG3  . GLU A 1 50 ? -7.310  -4.831  -11.597 1.00 0.00 ? 134 GLU A HG3  7  
ATOM 8019  N N    . GLY A 1 51 ? -9.677  -1.229  -8.496  1.00 0.00 ? 135 GLY A N    7  
ATOM 8020  C CA   . GLY A 1 51 ? -11.042 -0.986  -8.082  1.00 0.00 ? 135 GLY A CA   7  
ATOM 8021  C C    . GLY A 1 51 ? -11.343 -1.616  -6.737  1.00 0.00 ? 135 GLY A C    7  
ATOM 8022  O O    . GLY A 1 51 ? -12.435 -1.454  -6.193  1.00 0.00 ? 135 GLY A O    7  
ATOM 8023  H H    . GLY A 1 51 ? -8.936  -0.802  -8.013  1.00 0.00 ? 135 GLY A H    7  
ATOM 8024  H HA2  . GLY A 1 51 ? -11.208 0.080   -8.017  1.00 0.00 ? 135 GLY A HA2  7  
ATOM 8025  H HA3  . GLY A 1 51 ? -11.713 -1.401  -8.819  1.00 0.00 ? 135 GLY A HA3  7  
ATOM 8026  N N    . LYS A 1 52 ? -10.372 -2.348  -6.202  1.00 0.00 ? 136 LYS A N    7  
ATOM 8027  C CA   . LYS A 1 52 ? -10.508 -2.974  -4.892  1.00 0.00 ? 136 LYS A CA   7  
ATOM 8028  C C    . LYS A 1 52 ? -9.664  -2.241  -3.857  1.00 0.00 ? 136 LYS A C    7  
ATOM 8029  O O    . LYS A 1 52 ? -8.512  -1.896  -4.118  1.00 0.00 ? 136 LYS A O    7  
ATOM 8030  C CB   . LYS A 1 52 ? -10.079 -4.444  -4.938  1.00 0.00 ? 136 LYS A CB   7  
ATOM 8031  C CG   . LYS A 1 52 ? -11.077 -5.360  -5.629  1.00 0.00 ? 136 LYS A CG   7  
ATOM 8032  C CD   . LYS A 1 52 ? -10.629 -6.814  -5.570  1.00 0.00 ? 136 LYS A CD   7  
ATOM 8033  C CE   . LYS A 1 52 ? -9.406  -7.063  -6.440  1.00 0.00 ? 136 LYS A CE   7  
ATOM 8034  N NZ   . LYS A 1 52 ? -9.731  -6.983  -7.889  1.00 0.00 ? 136 LYS A NZ   7  
ATOM 8035  H H    . LYS A 1 52 ? -9.531  -2.464  -6.700  1.00 0.00 ? 136 LYS A H    7  
ATOM 8036  H HA   . LYS A 1 52 ? -11.547 -2.918  -4.603  1.00 0.00 ? 136 LYS A HA   7  
ATOM 8037  H HB2  . LYS A 1 52 ? -9.137  -4.517  -5.460  1.00 0.00 ? 136 LYS A HB2  7  
ATOM 8038  H HB3  . LYS A 1 52 ? -9.945  -4.797  -3.925  1.00 0.00 ? 136 LYS A HB3  7  
ATOM 8039  H HG2  . LYS A 1 52 ? -12.036 -5.267  -5.143  1.00 0.00 ? 136 LYS A HG2  7  
ATOM 8040  H HG3  . LYS A 1 52 ? -11.165 -5.062  -6.664  1.00 0.00 ? 136 LYS A HG3  7  
ATOM 8041  H HD2  . LYS A 1 52 ? -10.384 -7.063  -4.547  1.00 0.00 ? 136 LYS A HD2  7  
ATOM 8042  H HD3  . LYS A 1 52 ? -11.439 -7.443  -5.911  1.00 0.00 ? 136 LYS A HD3  7  
ATOM 8043  H HE2  . LYS A 1 52 ? -8.660  -6.317  -6.207  1.00 0.00 ? 136 LYS A HE2  7  
ATOM 8044  H HE3  . LYS A 1 52 ? -9.013  -8.045  -6.220  1.00 0.00 ? 136 LYS A HE3  7  
ATOM 8045  H HZ1  . LYS A 1 52 ? -10.355 -7.773  -8.161  1.00 0.00 ? 136 LYS A HZ1  7  
ATOM 8046  H HZ2  . LYS A 1 52 ? -8.858  -7.035  -8.462  1.00 0.00 ? 136 LYS A HZ2  7  
ATOM 8047  H HZ3  . LYS A 1 52 ? -10.218 -6.087  -8.102  1.00 0.00 ? 136 LYS A HZ3  7  
ATOM 8048  N N    . PRO A 1 53 ? -10.233 -1.976  -2.675  1.00 0.00 ? 137 PRO A N    7  
ATOM 8049  C CA   . PRO A 1 53 ? -9.499  -1.376  -1.564  1.00 0.00 ? 137 PRO A CA   7  
ATOM 8050  C C    . PRO A 1 53 ? -8.528  -2.370  -0.943  1.00 0.00 ? 137 PRO A C    7  
ATOM 8051  O O    . PRO A 1 53 ? -8.787  -3.576  -0.924  1.00 0.00 ? 137 PRO A O    7  
ATOM 8052  C CB   . PRO A 1 53 ? -10.591 -0.991  -0.554  1.00 0.00 ? 137 PRO A CB   7  
ATOM 8053  C CG   . PRO A 1 53 ? -11.892 -1.202  -1.260  1.00 0.00 ? 137 PRO A CG   7  
ATOM 8054  C CD   . PRO A 1 53 ? -11.630 -2.231  -2.322  1.00 0.00 ? 137 PRO A CD   7  
ATOM 8055  H HA   . PRO A 1 53 ? -8.960  -0.495  -1.876  1.00 0.00 ? 137 PRO A HA   7  
ATOM 8056  H HB2  . PRO A 1 53 ? -10.512 -1.623  0.319   1.00 0.00 ? 137 PRO A HB2  7  
ATOM 8057  H HB3  . PRO A 1 53 ? -10.463 0.042   -0.266  1.00 0.00 ? 137 PRO A HB3  7  
ATOM 8058  H HG2  . PRO A 1 53 ? -12.632 -1.564  -0.564  1.00 0.00 ? 137 PRO A HG2  7  
ATOM 8059  H HG3  . PRO A 1 53 ? -12.219 -0.275  -1.708  1.00 0.00 ? 137 PRO A HG3  7  
ATOM 8060  H HD2  . PRO A 1 53 ? -11.756 -3.227  -1.926  1.00 0.00 ? 137 PRO A HD2  7  
ATOM 8061  H HD3  . PRO A 1 53 ? -12.279 -2.075  -3.173  1.00 0.00 ? 137 PRO A HD3  7  
ATOM 8062  N N    . LEU A 1 54 ? -7.411  -1.867  -0.448  1.00 0.00 ? 138 LEU A N    7  
ATOM 8063  C CA   . LEU A 1 54 ? -6.403  -2.719  0.160   1.00 0.00 ? 138 LEU A CA   7  
ATOM 8064  C C    . LEU A 1 54 ? -6.718  -2.943  1.634   1.00 0.00 ? 138 LEU A C    7  
ATOM 8065  O O    . LEU A 1 54 ? -6.642  -2.012  2.438   1.00 0.00 ? 138 LEU A O    7  
ATOM 8066  C CB   . LEU A 1 54 ? -5.014  -2.089  0.019   1.00 0.00 ? 138 LEU A CB   7  
ATOM 8067  C CG   . LEU A 1 54 ? -4.635  -1.621  -1.390  1.00 0.00 ? 138 LEU A CG   7  
ATOM 8068  C CD1  . LEU A 1 54 ? -3.222  -1.065  -1.401  1.00 0.00 ? 138 LEU A CD1  7  
ATOM 8069  C CD2  . LEU A 1 54 ? -4.769  -2.752  -2.395  1.00 0.00 ? 138 LEU A CD2  7  
ATOM 8070  H H    . LEU A 1 54 ? -7.256  -0.898  -0.494  1.00 0.00 ? 138 LEU A H    7  
ATOM 8071  H HA   . LEU A 1 54 ? -6.416  -3.669  -0.350  1.00 0.00 ? 138 LEU A HA   7  
ATOM 8072  H HB2  . LEU A 1 54 ? -4.963  -1.238  0.682   1.00 0.00 ? 138 LEU A HB2  7  
ATOM 8073  H HB3  . LEU A 1 54 ? -4.281  -2.816  0.341   1.00 0.00 ? 138 LEU A HB3  7  
ATOM 8074  H HG   . LEU A 1 54 ? -5.304  -0.829  -1.689  1.00 0.00 ? 138 LEU A HG   7  
ATOM 8075  H HD11 . LEU A 1 54 ? -2.529  -1.833  -1.088  1.00 0.00 ? 138 LEU A HD11 7  
ATOM 8076  H HD12 . LEU A 1 54 ? -3.161  -0.226  -0.725  1.00 0.00 ? 138 LEU A HD12 7  
ATOM 8077  H HD13 . LEU A 1 54 ? -2.973  -0.742  -2.400  1.00 0.00 ? 138 LEU A HD13 7  
ATOM 8078  H HD21 . LEU A 1 54 ? -4.444  -2.409  -3.365  1.00 0.00 ? 138 LEU A HD21 7  
ATOM 8079  H HD22 . LEU A 1 54 ? -5.802  -3.062  -2.449  1.00 0.00 ? 138 LEU A HD22 7  
ATOM 8080  H HD23 . LEU A 1 54 ? -4.158  -3.586  -2.084  1.00 0.00 ? 138 LEU A HD23 7  
ATOM 8081  N N    . GLU A 1 55 ? -7.085  -4.168  1.987   1.00 0.00 ? 139 GLU A N    7  
ATOM 8082  C CA   . GLU A 1 55 ? -7.378  -4.493  3.374   1.00 0.00 ? 139 GLU A CA   7  
ATOM 8083  C C    . GLU A 1 55 ? -6.088  -4.729  4.140   1.00 0.00 ? 139 GLU A C    7  
ATOM 8084  O O    . GLU A 1 55 ? -5.267  -5.556  3.744   1.00 0.00 ? 139 GLU A O    7  
ATOM 8085  C CB   . GLU A 1 55 ? -8.267  -5.730  3.482   1.00 0.00 ? 139 GLU A CB   7  
ATOM 8086  C CG   . GLU A 1 55 ? -9.588  -5.600  2.747   1.00 0.00 ? 139 GLU A CG   7  
ATOM 8087  C CD   . GLU A 1 55 ? -10.610 -6.611  3.215   1.00 0.00 ? 139 GLU A CD   7  
ATOM 8088  O OE1  . GLU A 1 55 ? -10.284 -7.813  3.288   1.00 0.00 ? 139 GLU A OE1  7  
ATOM 8089  O OE2  . GLU A 1 55 ? -11.746 -6.203  3.529   1.00 0.00 ? 139 GLU A OE2  7  
ATOM 8090  H H    . GLU A 1 55 ? -7.154  -4.869  1.301   1.00 0.00 ? 139 GLU A H    7  
ATOM 8091  H HA   . GLU A 1 55 ? -7.893  -3.651  3.808   1.00 0.00 ? 139 GLU A HA   7  
ATOM 8092  H HB2  . GLU A 1 55 ? -7.737  -6.576  3.072   1.00 0.00 ? 139 GLU A HB2  7  
ATOM 8093  H HB3  . GLU A 1 55 ? -8.478  -5.918  4.524   1.00 0.00 ? 139 GLU A HB3  7  
ATOM 8094  H HG2  . GLU A 1 55 ? -9.981  -4.609  2.912   1.00 0.00 ? 139 GLU A HG2  7  
ATOM 8095  H HG3  . GLU A 1 55 ? -9.413  -5.748  1.692   1.00 0.00 ? 139 GLU A HG3  7  
ATOM 8096  N N    . ASP A 1 56 ? -5.921  -4.014  5.248   1.00 0.00 ? 140 ASP A N    7  
ATOM 8097  C CA   . ASP A 1 56 ? -4.702  -4.105  6.052   1.00 0.00 ? 140 ASP A CA   7  
ATOM 8098  C C    . ASP A 1 56 ? -4.502  -5.517  6.583   1.00 0.00 ? 140 ASP A C    7  
ATOM 8099  O O    . ASP A 1 56 ? -3.380  -5.936  6.864   1.00 0.00 ? 140 ASP A O    7  
ATOM 8100  C CB   . ASP A 1 56 ? -4.744  -3.146  7.242   1.00 0.00 ? 140 ASP A CB   7  
ATOM 8101  C CG   . ASP A 1 56 ? -5.622  -1.929  7.025   1.00 0.00 ? 140 ASP A CG   7  
ATOM 8102  O OD1  . ASP A 1 56 ? -6.861  -2.091  6.935   1.00 0.00 ? 140 ASP A OD1  7  
ATOM 8103  O OD2  . ASP A 1 56 ? -5.088  -0.801  6.991   1.00 0.00 ? 140 ASP A OD2  7  
ATOM 8104  H H    . ASP A 1 56 ? -6.634  -3.395  5.532   1.00 0.00 ? 140 ASP A H    7  
ATOM 8105  H HA   . ASP A 1 56 ? -3.868  -3.845  5.427   1.00 0.00 ? 140 ASP A HA   7  
ATOM 8106  H HB2  . ASP A 1 56 ? -5.103  -3.676  8.108   1.00 0.00 ? 140 ASP A HB2  7  
ATOM 8107  H HB3  . ASP A 1 56 ? -3.736  -2.805  7.428   1.00 0.00 ? 140 ASP A HB3  7  
ATOM 8108  N N    . GLN A 1 57 ? -5.605  -6.242  6.707   1.00 0.00 ? 141 GLN A N    7  
ATOM 8109  C CA   . GLN A 1 57 ? -5.611  -7.582  7.288   1.00 0.00 ? 141 GLN A CA   7  
ATOM 8110  C C    . GLN A 1 57 ? -5.119  -8.642  6.305   1.00 0.00 ? 141 GLN A C    7  
ATOM 8111  O O    . GLN A 1 57 ? -5.061  -9.829  6.640   1.00 0.00 ? 141 GLN A O    7  
ATOM 8112  C CB   . GLN A 1 57 ? -7.027  -7.927  7.749   1.00 0.00 ? 141 GLN A CB   7  
ATOM 8113  C CG   . GLN A 1 57 ? -8.081  -7.717  6.670   1.00 0.00 ? 141 GLN A CG   7  
ATOM 8114  C CD   . GLN A 1 57 ? -9.483  -8.019  7.152   1.00 0.00 ? 141 GLN A CD   7  
ATOM 8115  O OE1  . GLN A 1 57 ? -9.777  -7.901  8.341   1.00 0.00 ? 141 GLN A OE1  7  
ATOM 8116  N NE2  . GLN A 1 57 ? -10.366 -8.378  6.235   1.00 0.00 ? 141 GLN A NE2  7  
ATOM 8117  H H    . GLN A 1 57 ? -6.450  -5.860  6.397   1.00 0.00 ? 141 GLN A H    7  
ATOM 8118  H HA   . GLN A 1 57 ? -4.958  -7.573  8.148   1.00 0.00 ? 141 GLN A HA   7  
ATOM 8119  H HB2  . GLN A 1 57 ? -7.053  -8.963  8.052   1.00 0.00 ? 141 GLN A HB2  7  
ATOM 8120  H HB3  . GLN A 1 57 ? -7.281  -7.307  8.595   1.00 0.00 ? 141 GLN A HB3  7  
ATOM 8121  H HG2  . GLN A 1 57 ? -8.045  -6.688  6.344   1.00 0.00 ? 141 GLN A HG2  7  
ATOM 8122  H HG3  . GLN A 1 57 ? -7.855  -8.364  5.834   1.00 0.00 ? 141 GLN A HG3  7  
ATOM 8123  H HE21 . GLN A 1 57 ? -10.073 -8.430  5.296   1.00 0.00 ? 141 GLN A HE21 7  
ATOM 8124  H HE22 . GLN A 1 57 ? -11.284 -8.573  6.527   1.00 0.00 ? 141 GLN A HE22 7  
ATOM 8125  N N    . LEU A 1 58 ? -4.774  -8.222  5.099   1.00 0.00 ? 142 LEU A N    7  
ATOM 8126  C CA   . LEU A 1 58 ? -4.336  -9.150  4.069   1.00 0.00 ? 142 LEU A CA   7  
ATOM 8127  C C    . LEU A 1 58 ? -2.926  -8.808  3.601   1.00 0.00 ? 142 LEU A C    7  
ATOM 8128  O O    . LEU A 1 58 ? -2.505  -7.650  3.679   1.00 0.00 ? 142 LEU A O    7  
ATOM 8129  C CB   . LEU A 1 58 ? -5.312  -9.127  2.887   1.00 0.00 ? 142 LEU A CB   7  
ATOM 8130  C CG   . LEU A 1 58 ? -6.740  -9.579  3.214   1.00 0.00 ? 142 LEU A CG   7  
ATOM 8131  C CD1  . LEU A 1 58 ? -7.629  -9.472  1.985   1.00 0.00 ? 142 LEU A CD1  7  
ATOM 8132  C CD2  . LEU A 1 58 ? -6.740  -11.006 3.746   1.00 0.00 ? 142 LEU A CD2  7  
ATOM 8133  H H    . LEU A 1 58 ? -4.803  -7.262  4.897   1.00 0.00 ? 142 LEU A H    7  
ATOM 8134  H HA   . LEU A 1 58 ? -4.328  -10.141 4.499   1.00 0.00 ? 142 LEU A HA   7  
ATOM 8135  H HB2  . LEU A 1 58 ? -5.354  -8.120  2.500   1.00 0.00 ? 142 LEU A HB2  7  
ATOM 8136  H HB3  . LEU A 1 58 ? -4.924  -9.774  2.113   1.00 0.00 ? 142 LEU A HB3  7  
ATOM 8137  H HG   . LEU A 1 58 ? -7.149  -8.936  3.980   1.00 0.00 ? 142 LEU A HG   7  
ATOM 8138  H HD11 . LEU A 1 58 ? -7.233  -10.095 1.197   1.00 0.00 ? 142 LEU A HD11 7  
ATOM 8139  H HD12 . LEU A 1 58 ? -7.659  -8.445  1.651   1.00 0.00 ? 142 LEU A HD12 7  
ATOM 8140  H HD13 . LEU A 1 58 ? -8.628  -9.798  2.234   1.00 0.00 ? 142 LEU A HD13 7  
ATOM 8141  H HD21 . LEU A 1 58 ? -6.160  -11.051 4.658   1.00 0.00 ? 142 LEU A HD21 7  
ATOM 8142  H HD22 . LEU A 1 58 ? -6.305  -11.665 3.011   1.00 0.00 ? 142 LEU A HD22 7  
ATOM 8143  H HD23 . LEU A 1 58 ? -7.754  -11.313 3.951   1.00 0.00 ? 142 LEU A HD23 7  
ATOM 8144  N N    . PRO A 1 59 ? -2.168  -9.817  3.135   1.00 0.00 ? 143 PRO A N    7  
ATOM 8145  C CA   . PRO A 1 59 ? -0.823  -9.612  2.592   1.00 0.00 ? 143 PRO A CA   7  
ATOM 8146  C C    . PRO A 1 59 ? -0.860  -8.830  1.283   1.00 0.00 ? 143 PRO A C    7  
ATOM 8147  O O    . PRO A 1 59 ? -1.767  -9.010  0.466   1.00 0.00 ? 143 PRO A O    7  
ATOM 8148  C CB   . PRO A 1 59 ? -0.302  -11.032 2.357   1.00 0.00 ? 143 PRO A CB   7  
ATOM 8149  C CG   . PRO A 1 59 ? -1.526  -11.865 2.210   1.00 0.00 ? 143 PRO A CG   7  
ATOM 8150  C CD   . PRO A 1 59 ? -2.562  -11.238 3.103   1.00 0.00 ? 143 PRO A CD   7  
ATOM 8151  H HA   . PRO A 1 59 ? -0.183  -9.101  3.300   1.00 0.00 ? 143 PRO A HA   7  
ATOM 8152  H HB2  . PRO A 1 59 ? 0.301   -11.054 1.462   1.00 0.00 ? 143 PRO A HB2  7  
ATOM 8153  H HB3  . PRO A 1 59 ? 0.288   -11.348 3.206   1.00 0.00 ? 143 PRO A HB3  7  
ATOM 8154  H HG2  . PRO A 1 59 ? -1.860  -11.852 1.182   1.00 0.00 ? 143 PRO A HG2  7  
ATOM 8155  H HG3  . PRO A 1 59 ? -1.322  -12.877 2.527   1.00 0.00 ? 143 PRO A HG3  7  
ATOM 8156  H HD2  . PRO A 1 59 ? -3.548  -11.354 2.681   1.00 0.00 ? 143 PRO A HD2  7  
ATOM 8157  H HD3  . PRO A 1 59 ? -2.519  -11.671 4.091   1.00 0.00 ? 143 PRO A HD3  7  
ATOM 8158  N N    . LEU A 1 60 ? 0.133   -7.977  1.078   1.00 0.00 ? 144 LEU A N    7  
ATOM 8159  C CA   . LEU A 1 60 ? 0.152   -7.084  -0.074  1.00 0.00 ? 144 LEU A CA   7  
ATOM 8160  C C    . LEU A 1 60 ? 0.284   -7.856  -1.387  1.00 0.00 ? 144 LEU A C    7  
ATOM 8161  O O    . LEU A 1 60 ? -0.180  -7.393  -2.429  1.00 0.00 ? 144 LEU A O    7  
ATOM 8162  C CB   . LEU A 1 60 ? 1.291   -6.077  0.062   1.00 0.00 ? 144 LEU A CB   7  
ATOM 8163  C CG   . LEU A 1 60 ? 0.874   -4.608  -0.040  1.00 0.00 ? 144 LEU A CG   7  
ATOM 8164  C CD1  . LEU A 1 60 ? 2.042   -3.709  0.313   1.00 0.00 ? 144 LEU A CD1  7  
ATOM 8165  C CD2  . LEU A 1 60 ? 0.364   -4.291  -1.440  1.00 0.00 ? 144 LEU A CD2  7  
ATOM 8166  H H    . LEU A 1 60 ? 0.874   -7.940  1.727   1.00 0.00 ? 144 LEU A H    7  
ATOM 8167  H HA   . LEU A 1 60 ? -0.784  -6.547  -0.086  1.00 0.00 ? 144 LEU A HA   7  
ATOM 8168  H HB2  . LEU A 1 60 ? 1.763   -6.230  1.022   1.00 0.00 ? 144 LEU A HB2  7  
ATOM 8169  H HB3  . LEU A 1 60 ? 2.014   -6.277  -0.713  1.00 0.00 ? 144 LEU A HB3  7  
ATOM 8170  H HG   . LEU A 1 60 ? 0.076   -4.415  0.664   1.00 0.00 ? 144 LEU A HG   7  
ATOM 8171  H HD11 . LEU A 1 60 ? 2.367   -3.918  1.322   1.00 0.00 ? 144 LEU A HD11 7  
ATOM 8172  H HD12 . LEU A 1 60 ? 1.734   -2.676  0.243   1.00 0.00 ? 144 LEU A HD12 7  
ATOM 8173  H HD13 . LEU A 1 60 ? 2.855   -3.890  -0.373  1.00 0.00 ? 144 LEU A HD13 7  
ATOM 8174  H HD21 . LEU A 1 60 ? 0.091   -3.248  -1.498  1.00 0.00 ? 144 LEU A HD21 7  
ATOM 8175  H HD22 . LEU A 1 60 ? -0.500  -4.903  -1.656  1.00 0.00 ? 144 LEU A HD22 7  
ATOM 8176  H HD23 . LEU A 1 60 ? 1.140   -4.499  -2.161  1.00 0.00 ? 144 LEU A HD23 7  
ATOM 8177  N N    . GLY A 1 61 ? 0.901   -9.037  -1.333  1.00 0.00 ? 145 GLY A N    7  
ATOM 8178  C CA   . GLY A 1 61 ? 1.064   -9.847  -2.528  1.00 0.00 ? 145 GLY A CA   7  
ATOM 8179  C C    . GLY A 1 61 ? -0.251  -10.166 -3.216  1.00 0.00 ? 145 GLY A C    7  
ATOM 8180  O O    . GLY A 1 61 ? -0.289  -10.343 -4.432  1.00 0.00 ? 145 GLY A O    7  
ATOM 8181  H H    . GLY A 1 61 ? 1.256   -9.358  -0.476  1.00 0.00 ? 145 GLY A H    7  
ATOM 8182  H HA2  . GLY A 1 61 ? 1.695   -9.311  -3.221  1.00 0.00 ? 145 GLY A HA2  7  
ATOM 8183  H HA3  . GLY A 1 61 ? 1.550   -10.772 -2.258  1.00 0.00 ? 145 GLY A HA3  7  
ATOM 8184  N N    . GLU A 1 62 ? -1.328  -10.214 -2.438  1.00 0.00 ? 146 GLU A N    7  
ATOM 8185  C CA   . GLU A 1 62 ? -2.656  -10.515 -2.966  1.00 0.00 ? 146 GLU A CA   7  
ATOM 8186  C C    . GLU A 1 62 ? -3.057  -9.507  -4.047  1.00 0.00 ? 146 GLU A C    7  
ATOM 8187  O O    . GLU A 1 62 ? -3.644  -9.871  -5.068  1.00 0.00 ? 146 GLU A O    7  
ATOM 8188  C CB   . GLU A 1 62 ? -3.676  -10.502 -1.823  1.00 0.00 ? 146 GLU A CB   7  
ATOM 8189  C CG   . GLU A 1 62 ? -5.091  -10.869 -2.241  1.00 0.00 ? 146 GLU A CG   7  
ATOM 8190  C CD   . GLU A 1 62 ? -5.185  -12.258 -2.835  1.00 0.00 ? 146 GLU A CD   7  
ATOM 8191  O OE1  . GLU A 1 62 ? -5.085  -13.245 -2.078  1.00 0.00 ? 146 GLU A OE1  7  
ATOM 8192  O OE2  . GLU A 1 62 ? -5.357  -12.370 -4.065  1.00 0.00 ? 146 GLU A OE2  7  
ATOM 8193  H H    . GLU A 1 62 ? -1.231  -10.027 -1.480  1.00 0.00 ? 146 GLU A H    7  
ATOM 8194  H HA   . GLU A 1 62 ? -2.624  -11.502 -3.401  1.00 0.00 ? 146 GLU A HA   7  
ATOM 8195  H HB2  . GLU A 1 62 ? -3.357  -11.205 -1.066  1.00 0.00 ? 146 GLU A HB2  7  
ATOM 8196  H HB3  . GLU A 1 62 ? -3.699  -9.512  -1.391  1.00 0.00 ? 146 GLU A HB3  7  
ATOM 8197  H HG2  . GLU A 1 62 ? -5.734  -10.822 -1.376  1.00 0.00 ? 146 GLU A HG2  7  
ATOM 8198  H HG3  . GLU A 1 62 ? -5.431  -10.155 -2.979  1.00 0.00 ? 146 GLU A HG3  7  
ATOM 8199  N N    . TYR A 1 63 ? -2.714  -8.244  -3.824  1.00 0.00 ? 147 TYR A N    7  
ATOM 8200  C CA   . TYR A 1 63 ? -3.088  -7.175  -4.744  1.00 0.00 ? 147 TYR A CA   7  
ATOM 8201  C C    . TYR A 1 63 ? -1.925  -6.805  -5.656  1.00 0.00 ? 147 TYR A C    7  
ATOM 8202  O O    . TYR A 1 63 ? -2.107  -6.535  -6.841  1.00 0.00 ? 147 TYR A O    7  
ATOM 8203  C CB   . TYR A 1 63 ? -3.510  -5.927  -3.966  1.00 0.00 ? 147 TYR A CB   7  
ATOM 8204  C CG   . TYR A 1 63 ? -4.535  -6.167  -2.880  1.00 0.00 ? 147 TYR A CG   7  
ATOM 8205  C CD1  . TYR A 1 63 ? -5.892  -6.215  -3.171  1.00 0.00 ? 147 TYR A CD1  7  
ATOM 8206  C CD2  . TYR A 1 63 ? -4.141  -6.316  -1.553  1.00 0.00 ? 147 TYR A CD2  7  
ATOM 8207  C CE1  . TYR A 1 63 ? -6.828  -6.403  -2.172  1.00 0.00 ? 147 TYR A CE1  7  
ATOM 8208  C CE2  . TYR A 1 63 ? -5.071  -6.511  -0.552  1.00 0.00 ? 147 TYR A CE2  7  
ATOM 8209  C CZ   . TYR A 1 63 ? -6.412  -6.552  -0.866  1.00 0.00 ? 147 TYR A CZ   7  
ATOM 8210  O OH   . TYR A 1 63 ? -7.340  -6.729  0.133   1.00 0.00 ? 147 TYR A OH   7  
ATOM 8211  H H    . TYR A 1 63 ? -2.190  -8.026  -3.027  1.00 0.00 ? 147 TYR A H    7  
ATOM 8212  H HA   . TYR A 1 63 ? -3.917  -7.518  -5.342  1.00 0.00 ? 147 TYR A HA   7  
ATOM 8213  H HB2  . TYR A 1 63 ? -2.636  -5.497  -3.500  1.00 0.00 ? 147 TYR A HB2  7  
ATOM 8214  H HB3  . TYR A 1 63 ? -3.926  -5.209  -4.660  1.00 0.00 ? 147 TYR A HB3  7  
ATOM 8215  H HD1  . TYR A 1 63 ? -6.212  -6.102  -4.196  1.00 0.00 ? 147 TYR A HD1  7  
ATOM 8216  H HD2  . TYR A 1 63 ? -3.087  -6.281  -1.310  1.00 0.00 ? 147 TYR A HD2  7  
ATOM 8217  H HE1  . TYR A 1 63 ? -7.880  -6.437  -2.418  1.00 0.00 ? 147 TYR A HE1  7  
ATOM 8218  H HE2  . TYR A 1 63 ? -4.744  -6.628  0.471   1.00 0.00 ? 147 TYR A HE2  7  
ATOM 8219  H HH   . TYR A 1 63 ? -7.989  -7.384  -0.145  1.00 0.00 ? 147 TYR A HH   7  
ATOM 8220  N N    . GLY A 1 64 ? -0.728  -6.805  -5.088  1.00 0.00 ? 148 GLY A N    7  
ATOM 8221  C CA   . GLY A 1 64 ? 0.430   -6.271  -5.774  1.00 0.00 ? 148 GLY A CA   7  
ATOM 8222  C C    . GLY A 1 64 ? 1.265   -7.313  -6.489  1.00 0.00 ? 148 GLY A C    7  
ATOM 8223  O O    . GLY A 1 64 ? 2.338   -6.985  -6.981  1.00 0.00 ? 148 GLY A O    7  
ATOM 8224  H H    . GLY A 1 64 ? -0.628  -7.171  -4.183  1.00 0.00 ? 148 GLY A H    7  
ATOM 8225  H HA2  . GLY A 1 64 ? 0.094   -5.550  -6.504  1.00 0.00 ? 148 GLY A HA2  7  
ATOM 8226  H HA3  . GLY A 1 64 ? 1.055   -5.762  -5.054  1.00 0.00 ? 148 GLY A HA3  7  
ATOM 8227  N N    . LEU A 1 65 ? 0.781   -8.561  -6.525  1.00 0.00 ? 149 LEU A N    7  
ATOM 8228  C CA   . LEU A 1 65 ? 1.517   -9.698  -7.117  1.00 0.00 ? 149 LEU A CA   7  
ATOM 8229  C C    . LEU A 1 65 ? 2.269   -9.341  -8.410  1.00 0.00 ? 149 LEU A C    7  
ATOM 8230  O O    . LEU A 1 65 ? 3.318   -9.920  -8.704  1.00 0.00 ? 149 LEU A O    7  
ATOM 8231  C CB   . LEU A 1 65 ? 0.568   -10.876 -7.396  1.00 0.00 ? 149 LEU A CB   7  
ATOM 8232  C CG   . LEU A 1 65 ? -0.452  -10.671 -8.528  1.00 0.00 ? 149 LEU A CG   7  
ATOM 8233  C CD1  . LEU A 1 65 ? -1.047  -12.003 -8.949  1.00 0.00 ? 149 LEU A CD1  7  
ATOM 8234  C CD2  . LEU A 1 65 ? -1.566  -9.720  -8.104  1.00 0.00 ? 149 LEU A CD2  7  
ATOM 8235  H H    . LEU A 1 65 ? -0.098  -8.734  -6.119  1.00 0.00 ? 149 LEU A H    7  
ATOM 8236  H HA   . LEU A 1 65 ? 2.243   -10.019 -6.386  1.00 0.00 ? 149 LEU A HA   7  
ATOM 8237  H HB2  . LEU A 1 65 ? 1.170   -11.739 -7.640  1.00 0.00 ? 149 LEU A HB2  7  
ATOM 8238  H HB3  . LEU A 1 65 ? 0.024   -11.088 -6.488  1.00 0.00 ? 149 LEU A HB3  7  
ATOM 8239  H HG   . LEU A 1 65 ? 0.048   -10.242 -9.384  1.00 0.00 ? 149 LEU A HG   7  
ATOM 8240  H HD11 . LEU A 1 65 ? -1.757  -11.845 -9.746  1.00 0.00 ? 149 LEU A HD11 7  
ATOM 8241  H HD12 . LEU A 1 65 ? -1.548  -12.457 -8.106  1.00 0.00 ? 149 LEU A HD12 7  
ATOM 8242  H HD13 . LEU A 1 65 ? -0.259  -12.656 -9.293  1.00 0.00 ? 149 LEU A HD13 7  
ATOM 8243  H HD21 . LEU A 1 65 ? -1.143  -8.757  -7.853  1.00 0.00 ? 149 LEU A HD21 7  
ATOM 8244  H HD22 . LEU A 1 65 ? -2.075  -10.124 -7.242  1.00 0.00 ? 149 LEU A HD22 7  
ATOM 8245  H HD23 . LEU A 1 65 ? -2.269  -9.605  -8.914  1.00 0.00 ? 149 LEU A HD23 7  
ATOM 8246  N N    . LYS A 1 66 ? 1.735   -8.407  -9.184  1.00 0.00 ? 150 LYS A N    7  
ATOM 8247  C CA   . LYS A 1 66 ? 2.416   -7.939  -10.380 1.00 0.00 ? 150 LYS A CA   7  
ATOM 8248  C C    . LYS A 1 66 ? 3.194   -6.660  -10.082 1.00 0.00 ? 150 LYS A C    7  
ATOM 8249  O O    . LYS A 1 66 ? 2.625   -5.682  -9.601  1.00 0.00 ? 150 LYS A O    7  
ATOM 8250  C CB   . LYS A 1 66 ? 1.420   -7.700  -11.518 1.00 0.00 ? 150 LYS A CB   7  
ATOM 8251  C CG   . LYS A 1 66 ? 2.063   -7.143  -12.782 1.00 0.00 ? 150 LYS A CG   7  
ATOM 8252  C CD   . LYS A 1 66 ? 1.152   -7.279  -13.990 1.00 0.00 ? 150 LYS A CD   7  
ATOM 8253  C CE   . LYS A 1 66 ? -0.207  -6.645  -13.753 1.00 0.00 ? 150 LYS A CE   7  
ATOM 8254  N NZ   . LYS A 1 66 ? -1.131  -6.877  -14.895 1.00 0.00 ? 150 LYS A NZ   7  
ATOM 8255  H H    . LYS A 1 66 ? 0.879   -8.011  -8.929  1.00 0.00 ? 150 LYS A H    7  
ATOM 8256  H HA   . LYS A 1 66 ? 3.116   -8.707  -10.680 1.00 0.00 ? 150 LYS A HA   7  
ATOM 8257  H HB2  . LYS A 1 66 ? 0.942   -8.631  -11.765 1.00 0.00 ? 150 LYS A HB2  7  
ATOM 8258  H HB3  . LYS A 1 66 ? 0.671   -7.000  -11.183 1.00 0.00 ? 150 LYS A HB3  7  
ATOM 8259  H HG2  . LYS A 1 66 ? 2.285   -6.099  -12.628 1.00 0.00 ? 150 LYS A HG2  7  
ATOM 8260  H HG3  . LYS A 1 66 ? 2.981   -7.682  -12.972 1.00 0.00 ? 150 LYS A HG3  7  
ATOM 8261  H HD2  . LYS A 1 66 ? 1.620   -6.794  -14.835 1.00 0.00 ? 150 LYS A HD2  7  
ATOM 8262  H HD3  . LYS A 1 66 ? 1.016   -8.329  -14.208 1.00 0.00 ? 150 LYS A HD3  7  
ATOM 8263  H HE2  . LYS A 1 66 ? -0.640  -7.072  -12.859 1.00 0.00 ? 150 LYS A HE2  7  
ATOM 8264  H HE3  . LYS A 1 66 ? -0.077  -5.582  -13.615 1.00 0.00 ? 150 LYS A HE3  7  
ATOM 8265  H HZ1  . LYS A 1 66 ? -0.780  -6.386  -15.747 1.00 0.00 ? 150 LYS A HZ1  7  
ATOM 8266  H HZ2  . LYS A 1 66 ? -2.082  -6.517  -14.667 1.00 0.00 ? 150 LYS A HZ2  7  
ATOM 8267  H HZ3  . LYS A 1 66 ? -1.197  -7.897  -15.100 1.00 0.00 ? 150 LYS A HZ3  7  
ATOM 8268  N N    . PRO A 1 67 ? 4.510   -6.656  -10.371 1.00 0.00 ? 151 PRO A N    7  
ATOM 8269  C CA   . PRO A 1 67 ? 5.392   -5.490  -10.159 1.00 0.00 ? 151 PRO A CA   7  
ATOM 8270  C C    . PRO A 1 67 ? 5.077   -4.313  -11.092 1.00 0.00 ? 151 PRO A C    7  
ATOM 8271  O O    . PRO A 1 67 ? 5.935   -3.474  -11.370 1.00 0.00 ? 151 PRO A O    7  
ATOM 8272  C CB   . PRO A 1 67 ? 6.798   -6.034  -10.460 1.00 0.00 ? 151 PRO A CB   7  
ATOM 8273  C CG   . PRO A 1 67 ? 6.660   -7.519  -10.447 1.00 0.00 ? 151 PRO A CG   7  
ATOM 8274  C CD   . PRO A 1 67 ? 5.257   -7.805  -10.894 1.00 0.00 ? 151 PRO A CD   7  
ATOM 8275  H HA   . PRO A 1 67 ? 5.352   -5.147  -9.135  1.00 0.00 ? 151 PRO A HA   7  
ATOM 8276  H HB2  . PRO A 1 67 ? 7.123   -5.680  -11.428 1.00 0.00 ? 151 PRO A HB2  7  
ATOM 8277  H HB3  . PRO A 1 67 ? 7.487   -5.697  -9.699  1.00 0.00 ? 151 PRO A HB3  7  
ATOM 8278  H HG2  . PRO A 1 67 ? 7.371   -7.959  -11.131 1.00 0.00 ? 151 PRO A HG2  7  
ATOM 8279  H HG3  . PRO A 1 67 ? 6.818   -7.892  -9.447  1.00 0.00 ? 151 PRO A HG3  7  
ATOM 8280  H HD2  . PRO A 1 67 ? 5.200   -7.847  -11.971 1.00 0.00 ? 151 PRO A HD2  7  
ATOM 8281  H HD3  . PRO A 1 67 ? 4.900   -8.726  -10.456 1.00 0.00 ? 151 PRO A HD3  7  
ATOM 8282  N N    . LEU A 1 68 ? 3.844   -4.264  -11.567 1.00 0.00 ? 152 LEU A N    7  
ATOM 8283  C CA   . LEU A 1 68 ? 3.370   -3.173  -12.404 1.00 0.00 ? 152 LEU A CA   7  
ATOM 8284  C C    . LEU A 1 68 ? 2.005   -2.712  -11.898 1.00 0.00 ? 152 LEU A C    7  
ATOM 8285  O O    . LEU A 1 68 ? 1.341   -1.877  -12.513 1.00 0.00 ? 152 LEU A O    7  
ATOM 8286  C CB   . LEU A 1 68 ? 3.286   -3.625  -13.869 1.00 0.00 ? 152 LEU A CB   7  
ATOM 8287  C CG   . LEU A 1 68 ? 2.991   -2.518  -14.885 1.00 0.00 ? 152 LEU A CG   7  
ATOM 8288  C CD1  . LEU A 1 68 ? 4.105   -1.479  -14.888 1.00 0.00 ? 152 LEU A CD1  7  
ATOM 8289  C CD2  . LEU A 1 68 ? 2.808   -3.107  -16.276 1.00 0.00 ? 152 LEU A CD2  7  
ATOM 8290  H H    . LEU A 1 68 ? 3.226   -4.988  -11.341 1.00 0.00 ? 152 LEU A H    7  
ATOM 8291  H HA   . LEU A 1 68 ? 4.071   -2.354  -12.320 1.00 0.00 ? 152 LEU A HA   7  
ATOM 8292  H HB2  . LEU A 1 68 ? 4.228   -4.084  -14.133 1.00 0.00 ? 152 LEU A HB2  7  
ATOM 8293  H HB3  . LEU A 1 68 ? 2.509   -4.372  -13.949 1.00 0.00 ? 152 LEU A HB3  7  
ATOM 8294  H HG   . LEU A 1 68 ? 2.072   -2.021  -14.609 1.00 0.00 ? 152 LEU A HG   7  
ATOM 8295  H HD11 . LEU A 1 68 ? 5.034   -1.948  -15.179 1.00 0.00 ? 152 LEU A HD11 7  
ATOM 8296  H HD12 . LEU A 1 68 ? 4.208   -1.059  -13.899 1.00 0.00 ? 152 LEU A HD12 7  
ATOM 8297  H HD13 . LEU A 1 68 ? 3.863   -0.694  -15.590 1.00 0.00 ? 152 LEU A HD13 7  
ATOM 8298  H HD21 . LEU A 1 68 ? 2.589   -2.313  -16.975 1.00 0.00 ? 152 LEU A HD21 7  
ATOM 8299  H HD22 . LEU A 1 68 ? 1.988   -3.810  -16.262 1.00 0.00 ? 152 LEU A HD22 7  
ATOM 8300  H HD23 . LEU A 1 68 ? 3.713   -3.613  -16.575 1.00 0.00 ? 152 LEU A HD23 7  
ATOM 8301  N N    . SER A 1 69 ? 1.595   -3.277  -10.767 1.00 0.00 ? 153 SER A N    7  
ATOM 8302  C CA   . SER A 1 69 ? 0.336   -2.919  -10.137 1.00 0.00 ? 153 SER A CA   7  
ATOM 8303  C C    . SER A 1 69 ? 0.321   -1.438  -9.767  1.00 0.00 ? 153 SER A C    7  
ATOM 8304  O O    . SER A 1 69 ? 1.169   -0.963  -9.009  1.00 0.00 ? 153 SER A O    7  
ATOM 8305  C CB   . SER A 1 69 ? 0.104   -3.792  -8.898  1.00 0.00 ? 153 SER A CB   7  
ATOM 8306  O OG   . SER A 1 69 ? 1.264   -3.841  -8.085  1.00 0.00 ? 153 SER A OG   7  
ATOM 8307  H H    . SER A 1 69 ? 2.162   -3.955  -10.336 1.00 0.00 ? 153 SER A H    7  
ATOM 8308  H HA   . SER A 1 69 ? -0.455  -3.105  -10.850 1.00 0.00 ? 153 SER A HA   7  
ATOM 8309  H HB2  . SER A 1 69 ? -0.710  -3.383  -8.319  1.00 0.00 ? 153 SER A HB2  7  
ATOM 8310  H HB3  . SER A 1 69 ? -0.144  -4.795  -9.210  1.00 0.00 ? 153 SER A HB3  7  
ATOM 8311  H HG   . SER A 1 69 ? 1.786   -4.621  -8.316  1.00 0.00 ? 153 SER A HG   7  
ATOM 8312  N N    . THR A 1 70 ? -0.626  -0.709  -10.333 1.00 0.00 ? 154 THR A N    7  
ATOM 8313  C CA   . THR A 1 70 ? -0.745  0.711   -10.073 1.00 0.00 ? 154 THR A CA   7  
ATOM 8314  C C    . THR A 1 70 ? -1.706  0.971   -8.916  1.00 0.00 ? 154 THR A C    7  
ATOM 8315  O O    . THR A 1 70 ? -2.927  0.948   -9.085  1.00 0.00 ? 154 THR A O    7  
ATOM 8316  C CB   . THR A 1 70 ? -1.222  1.465   -11.326 1.00 0.00 ? 154 THR A CB   7  
ATOM 8317  O OG1  . THR A 1 70 ? -0.429  1.072   -12.458 1.00 0.00 ? 154 THR A OG1  7  
ATOM 8318  C CG2  . THR A 1 70 ? -1.114  2.968   -11.124 1.00 0.00 ? 154 THR A CG2  7  
ATOM 8319  H H    . THR A 1 70 ? -1.260  -1.139  -10.943 1.00 0.00 ? 154 THR A H    7  
ATOM 8320  H HA   . THR A 1 70 ? 0.233   1.082   -9.804  1.00 0.00 ? 154 THR A HA   7  
ATOM 8321  H HB   . THR A 1 70 ? -2.256  1.212   -11.513 1.00 0.00 ? 154 THR A HB   7  
ATOM 8322  H HG1  . THR A 1 70 ? 0.129   0.324   -12.210 1.00 0.00 ? 154 THR A HG1  7  
ATOM 8323  H HG21 . THR A 1 70 ? -1.442  3.474   -12.021 1.00 0.00 ? 154 THR A HG21 7  
ATOM 8324  H HG22 . THR A 1 70 ? -0.087  3.229   -10.918 1.00 0.00 ? 154 THR A HG22 7  
ATOM 8325  H HG23 . THR A 1 70 ? -1.736  3.267   -10.295 1.00 0.00 ? 154 THR A HG23 7  
ATOM 8326  N N    . VAL A 1 71 ? -1.141  1.198   -7.743  1.00 0.00 ? 155 VAL A N    7  
ATOM 8327  C CA   . VAL A 1 71 ? -1.926  1.466   -6.551  1.00 0.00 ? 155 VAL A CA   7  
ATOM 8328  C C    . VAL A 1 71 ? -2.116  2.968   -6.388  1.00 0.00 ? 155 VAL A C    7  
ATOM 8329  O O    . VAL A 1 71 ? -1.164  3.737   -6.515  1.00 0.00 ? 155 VAL A O    7  
ATOM 8330  C CB   . VAL A 1 71 ? -1.245  0.892   -5.290  1.00 0.00 ? 155 VAL A CB   7  
ATOM 8331  C CG1  . VAL A 1 71 ? -2.103  1.123   -4.056  1.00 0.00 ? 155 VAL A CG1  7  
ATOM 8332  C CG2  . VAL A 1 71 ? -0.954  -0.589  -5.468  1.00 0.00 ? 155 VAL A CG2  7  
ATOM 8333  H H    . VAL A 1 71 ? -0.159  1.204   -7.680  1.00 0.00 ? 155 VAL A H    7  
ATOM 8334  H HA   . VAL A 1 71 ? -2.893  0.996   -6.668  1.00 0.00 ? 155 VAL A HA   7  
ATOM 8335  H HB   . VAL A 1 71 ? -0.306  1.405   -5.147  1.00 0.00 ? 155 VAL A HB   7  
ATOM 8336  H HG11 . VAL A 1 71 ? -1.580  0.762   -3.180  1.00 0.00 ? 155 VAL A HG11 7  
ATOM 8337  H HG12 . VAL A 1 71 ? -3.037  0.590   -4.161  1.00 0.00 ? 155 VAL A HG12 7  
ATOM 8338  H HG13 . VAL A 1 71 ? -2.302  2.177   -3.946  1.00 0.00 ? 155 VAL A HG13 7  
ATOM 8339  H HG21 . VAL A 1 71 ? -0.293  -0.727  -6.310  1.00 0.00 ? 155 VAL A HG21 7  
ATOM 8340  H HG22 . VAL A 1 71 ? -1.877  -1.121  -5.643  1.00 0.00 ? 155 VAL A HG22 7  
ATOM 8341  H HG23 . VAL A 1 71 ? -0.483  -0.973  -4.575  1.00 0.00 ? 155 VAL A HG23 7  
ATOM 8342  N N    . PHE A 1 72 ? -3.341  3.390   -6.129  1.00 0.00 ? 156 PHE A N    7  
ATOM 8343  C CA   . PHE A 1 72 ? -3.636  4.805   -5.969  1.00 0.00 ? 156 PHE A CA   7  
ATOM 8344  C C    . PHE A 1 72 ? -3.808  5.157   -4.498  1.00 0.00 ? 156 PHE A C    7  
ATOM 8345  O O    . PHE A 1 72 ? -4.541  4.482   -3.771  1.00 0.00 ? 156 PHE A O    7  
ATOM 8346  C CB   . PHE A 1 72 ? -4.897  5.183   -6.749  1.00 0.00 ? 156 PHE A CB   7  
ATOM 8347  C CG   . PHE A 1 72 ? -4.751  5.039   -8.239  1.00 0.00 ? 156 PHE A CG   7  
ATOM 8348  C CD1  . PHE A 1 72 ? -4.175  6.051   -8.990  1.00 0.00 ? 156 PHE A CD1  7  
ATOM 8349  C CD2  . PHE A 1 72 ? -5.191  3.895   -8.888  1.00 0.00 ? 156 PHE A CD2  7  
ATOM 8350  C CE1  . PHE A 1 72 ? -4.038  5.923   -10.359 1.00 0.00 ? 156 PHE A CE1  7  
ATOM 8351  C CE2  . PHE A 1 72 ? -5.056  3.765   -10.257 1.00 0.00 ? 156 PHE A CE2  7  
ATOM 8352  C CZ   . PHE A 1 72 ? -4.480  4.780   -10.993 1.00 0.00 ? 156 PHE A CZ   7  
ATOM 8353  H H    . PHE A 1 72 ? -4.068  2.732   -6.037  1.00 0.00 ? 156 PHE A H    7  
ATOM 8354  H HA   . PHE A 1 72 ? -2.800  5.364   -6.362  1.00 0.00 ? 156 PHE A HA   7  
ATOM 8355  H HB2  . PHE A 1 72 ? -5.711  4.546   -6.433  1.00 0.00 ? 156 PHE A HB2  7  
ATOM 8356  H HB3  . PHE A 1 72 ? -5.147  6.210   -6.535  1.00 0.00 ? 156 PHE A HB3  7  
ATOM 8357  H HD1  . PHE A 1 72 ? -3.828  6.946   -8.495  1.00 0.00 ? 156 PHE A HD1  7  
ATOM 8358  H HD2  . PHE A 1 72 ? -5.642  3.101   -8.314  1.00 0.00 ? 156 PHE A HD2  7  
ATOM 8359  H HE1  . PHE A 1 72 ? -3.585  6.719   -10.934 1.00 0.00 ? 156 PHE A HE1  7  
ATOM 8360  H HE2  . PHE A 1 72 ? -5.400  2.868   -10.751 1.00 0.00 ? 156 PHE A HE2  7  
ATOM 8361  H HZ   . PHE A 1 72 ? -4.373  4.680   -12.064 1.00 0.00 ? 156 PHE A HZ   7  
ATOM 8362  N N    . MET A 1 73 ? -3.120  6.202   -4.056  1.00 0.00 ? 157 MET A N    7  
ATOM 8363  C CA   . MET A 1 73 ? -3.272  6.681   -2.691  1.00 0.00 ? 157 MET A CA   7  
ATOM 8364  C C    . MET A 1 73 ? -4.460  7.628   -2.620  1.00 0.00 ? 157 MET A C    7  
ATOM 8365  O O    . MET A 1 73 ? -4.357  8.806   -2.963  1.00 0.00 ? 157 MET A O    7  
ATOM 8366  C CB   . MET A 1 73 ? -2.001  7.380   -2.203  1.00 0.00 ? 157 MET A CB   7  
ATOM 8367  C CG   . MET A 1 73 ? -2.049  7.743   -0.728  1.00 0.00 ? 157 MET A CG   7  
ATOM 8368  S SD   . MET A 1 73 ? -0.579  8.633   -0.183  1.00 0.00 ? 157 MET A SD   7  
ATOM 8369  C CE   . MET A 1 73 ? -0.962  8.916   1.544   1.00 0.00 ? 157 MET A CE   7  
ATOM 8370  H H    . MET A 1 73 ? -2.499  6.666   -4.664  1.00 0.00 ? 157 MET A H    7  
ATOM 8371  H HA   . MET A 1 73 ? -3.470  5.825   -2.061  1.00 0.00 ? 157 MET A HA   7  
ATOM 8372  H HB2  . MET A 1 73 ? -1.156  6.727   -2.365  1.00 0.00 ? 157 MET A HB2  7  
ATOM 8373  H HB3  . MET A 1 73 ? -1.859  8.286   -2.770  1.00 0.00 ? 157 MET A HB3  7  
ATOM 8374  H HG2  . MET A 1 73 ? -2.915  8.363   -0.553  1.00 0.00 ? 157 MET A HG2  7  
ATOM 8375  H HG3  . MET A 1 73 ? -2.138  6.830   -0.153  1.00 0.00 ? 157 MET A HG3  7  
ATOM 8376  H HE1  . MET A 1 73 ? -0.140  9.442   2.012   1.00 0.00 ? 157 MET A HE1  7  
ATOM 8377  H HE2  . MET A 1 73 ? -1.113  7.970   2.039   1.00 0.00 ? 157 MET A HE2  7  
ATOM 8378  H HE3  . MET A 1 73 ? -1.858  9.512   1.620   1.00 0.00 ? 157 MET A HE3  7  
ATOM 8379  N N    . ASN A 1 74 ? -5.593  7.103   -2.193  1.00 0.00 ? 158 ASN A N    7  
ATOM 8380  C CA   . ASN A 1 74 ? -6.832  7.860   -2.205  1.00 0.00 ? 158 ASN A CA   7  
ATOM 8381  C C    . ASN A 1 74 ? -6.937  8.763   -0.982  1.00 0.00 ? 158 ASN A C    7  
ATOM 8382  O O    . ASN A 1 74 ? -7.424  8.348   0.071   1.00 0.00 ? 158 ASN A O    7  
ATOM 8383  C CB   . ASN A 1 74 ? -8.041  6.919   -2.261  1.00 0.00 ? 158 ASN A CB   7  
ATOM 8384  C CG   . ASN A 1 74 ? -8.037  6.009   -3.475  1.00 0.00 ? 158 ASN A CG   7  
ATOM 8385  O OD1  . ASN A 1 74 ? -8.528  6.370   -4.544  1.00 0.00 ? 158 ASN A OD1  7  
ATOM 8386  N ND2  . ASN A 1 74 ? -7.513  4.811   -3.303  1.00 0.00 ? 158 ASN A ND2  7  
ATOM 8387  H H    . ASN A 1 74 ? -5.598  6.184   -1.852  1.00 0.00 ? 158 ASN A H    7  
ATOM 8388  H HA   . ASN A 1 74 ? -6.831  8.477   -3.090  1.00 0.00 ? 158 ASN A HA   7  
ATOM 8389  H HB2  . ASN A 1 74 ? -8.041  6.298   -1.380  1.00 0.00 ? 158 ASN A HB2  7  
ATOM 8390  H HB3  . ASN A 1 74 ? -8.943  7.502   -2.277  1.00 0.00 ? 158 ASN A HB3  7  
ATOM 8391  H HD21 . ASN A 1 74 ? -7.160  4.584   -2.418  1.00 0.00 ? 158 ASN A HD21 7  
ATOM 8392  H HD22 . ASN A 1 74 ? -7.506  4.188   -4.069  1.00 0.00 ? 158 ASN A HD22 7  
ATOM 8393  N N    . LEU A 1 75 ? -6.448  9.986   -1.118  1.00 0.00 ? 159 LEU A N    7  
ATOM 8394  C CA   . LEU A 1 75 ? -6.597  10.986  -0.072  1.00 0.00 ? 159 LEU A CA   7  
ATOM 8395  C C    . LEU A 1 75 ? -7.950  11.676  -0.194  1.00 0.00 ? 159 LEU A C    7  
ATOM 8396  O O    . LEU A 1 75 ? -8.080  12.710  -0.849  1.00 0.00 ? 159 LEU A O    7  
ATOM 8397  C CB   . LEU A 1 75 ? -5.462  12.015  -0.141  1.00 0.00 ? 159 LEU A CB   7  
ATOM 8398  C CG   . LEU A 1 75 ? -4.118  11.544  0.422   1.00 0.00 ? 159 LEU A CG   7  
ATOM 8399  C CD1  . LEU A 1 75 ? -3.015  12.531  0.071   1.00 0.00 ? 159 LEU A CD1  7  
ATOM 8400  C CD2  . LEU A 1 75 ? -4.212  11.368  1.928   1.00 0.00 ? 159 LEU A CD2  7  
ATOM 8401  H H    . LEU A 1 75 ? -5.966  10.220  -1.940  1.00 0.00 ? 159 LEU A H    7  
ATOM 8402  H HA   . LEU A 1 75 ? -6.551  10.478  0.879   1.00 0.00 ? 159 LEU A HA   7  
ATOM 8403  H HB2  . LEU A 1 75 ? -5.319  12.292  -1.174  1.00 0.00 ? 159 LEU A HB2  7  
ATOM 8404  H HB3  . LEU A 1 75 ? -5.768  12.892  0.411   1.00 0.00 ? 159 LEU A HB3  7  
ATOM 8405  H HG   . LEU A 1 75 ? -3.866  10.588  -0.013  1.00 0.00 ? 159 LEU A HG   7  
ATOM 8406  H HD11 . LEU A 1 75 ? -2.919  12.593  -1.002  1.00 0.00 ? 159 LEU A HD11 7  
ATOM 8407  H HD12 . LEU A 1 75 ? -2.082  12.195  0.495   1.00 0.00 ? 159 LEU A HD12 7  
ATOM 8408  H HD13 . LEU A 1 75 ? -3.262  13.505  0.467   1.00 0.00 ? 159 LEU A HD13 7  
ATOM 8409  H HD21 . LEU A 1 75 ? -3.245  11.082  2.321   1.00 0.00 ? 159 LEU A HD21 7  
ATOM 8410  H HD22 . LEU A 1 75 ? -4.934  10.598  2.154   1.00 0.00 ? 159 LEU A HD22 7  
ATOM 8411  H HD23 . LEU A 1 75 ? -4.523  12.298  2.381   1.00 0.00 ? 159 LEU A HD23 7  
ATOM 8412  N N    . ARG A 1 76 ? -8.969  11.059  0.389   1.00 0.00 ? 160 ARG A N    7  
ATOM 8413  C CA   . ARG A 1 76 ? -10.314 11.624  0.387   1.00 0.00 ? 160 ARG A CA   7  
ATOM 8414  C C    . ARG A 1 76 ? -10.913 11.558  1.781   1.00 0.00 ? 160 ARG A C    7  
ATOM 8415  O O    . ARG A 1 76 ? -10.856 10.521  2.442   1.00 0.00 ? 160 ARG A O    7  
ATOM 8416  C CB   . ARG A 1 76 ? -11.243 10.891  -0.596  1.00 0.00 ? 160 ARG A CB   7  
ATOM 8417  C CG   . ARG A 1 76 ? -10.998 11.205  -2.067  1.00 0.00 ? 160 ARG A CG   7  
ATOM 8418  C CD   . ARG A 1 76 ? -9.846  10.399  -2.639  1.00 0.00 ? 160 ARG A CD   7  
ATOM 8419  N NE   . ARG A 1 76 ? -9.628  10.684  -4.059  1.00 0.00 ? 160 ARG A NE   7  
ATOM 8420  C CZ   . ARG A 1 76 ? -9.830  9.798   -5.037  1.00 0.00 ? 160 ARG A CZ   7  
ATOM 8421  N NH1  . ARG A 1 76 ? -10.317 8.596   -4.757  1.00 0.00 ? 160 ARG A NH1  7  
ATOM 8422  N NH2  . ARG A 1 76 ? -9.567  10.116  -6.298  1.00 0.00 ? 160 ARG A NH2  7  
ATOM 8423  H H    . ARG A 1 76 ? -8.813  10.204  0.849   1.00 0.00 ? 160 ARG A H    7  
ATOM 8424  H HA   . ARG A 1 76 ? -10.237 12.659  0.092   1.00 0.00 ? 160 ARG A HA   7  
ATOM 8425  H HB2  . ARG A 1 76 ? -11.115 9.829   -0.458  1.00 0.00 ? 160 ARG A HB2  7  
ATOM 8426  H HB3  . ARG A 1 76 ? -12.265 11.150  -0.362  1.00 0.00 ? 160 ARG A HB3  7  
ATOM 8427  H HG2  . ARG A 1 76 ? -11.893 10.975  -2.626  1.00 0.00 ? 160 ARG A HG2  7  
ATOM 8428  H HG3  . ARG A 1 76 ? -10.774 12.257  -2.166  1.00 0.00 ? 160 ARG A HG3  7  
ATOM 8429  H HD2  . ARG A 1 76 ? -8.948  10.640  -2.092  1.00 0.00 ? 160 ARG A HD2  7  
ATOM 8430  H HD3  . ARG A 1 76 ? -10.066 9.347   -2.524  1.00 0.00 ? 160 ARG A HD3  7  
ATOM 8431  H HE   . ARG A 1 76 ? -9.295  11.579  -4.290  1.00 0.00 ? 160 ARG A HE   7  
ATOM 8432  H HH11 . ARG A 1 76 ? -10.533 8.343   -3.817  1.00 0.00 ? 160 ARG A HH11 7  
ATOM 8433  H HH12 . ARG A 1 76 ? -10.469 7.929   -5.502  1.00 0.00 ? 160 ARG A HH12 7  
ATOM 8434  H HH21 . ARG A 1 76 ? -9.212  11.023  -6.531  1.00 0.00 ? 160 ARG A HH21 7  
ATOM 8435  H HH22 . ARG A 1 76 ? -9.718  9.437   -7.028  1.00 0.00 ? 160 ARG A HH22 7  
ATOM 8436  N N    . ASP A 1 2  ? 16.111  -12.285 -1.336  1.00 0.00 ? 86  ASP A N    8  
ATOM 8437  C CA   . ASP A 1 2  ? 14.728  -12.346 -0.882  1.00 0.00 ? 86  ASP A CA   8  
ATOM 8438  C C    . ASP A 1 2  ? 13.828  -11.653 -1.891  1.00 0.00 ? 86  ASP A C    8  
ATOM 8439  O O    . ASP A 1 2  ? 14.280  -11.292 -2.978  1.00 0.00 ? 86  ASP A O    8  
ATOM 8440  C CB   . ASP A 1 2  ? 14.577  -11.702 0.501   1.00 0.00 ? 86  ASP A CB   8  
ATOM 8441  C CG   . ASP A 1 2  ? 15.244  -12.515 1.597   1.00 0.00 ? 86  ASP A CG   8  
ATOM 8442  O OD1  . ASP A 1 2  ? 16.443  -12.293 1.865   1.00 0.00 ? 86  ASP A OD1  8  
ATOM 8443  O OD2  . ASP A 1 2  ? 14.571  -13.383 2.195   1.00 0.00 ? 86  ASP A OD2  8  
ATOM 8444  H H    . ASP A 1 2  ? 16.510  -11.406 -1.532  1.00 0.00 ? 86  ASP A H    8  
ATOM 8445  H HA   . ASP A 1 2  ? 14.442  -13.385 -0.822  1.00 0.00 ? 86  ASP A HA   8  
ATOM 8446  H HB2  . ASP A 1 2  ? 15.023  -10.718 0.488   1.00 0.00 ? 86  ASP A HB2  8  
ATOM 8447  H HB3  . ASP A 1 2  ? 13.527  -11.611 0.734   1.00 0.00 ? 86  ASP A HB3  8  
ATOM 8448  N N    . GLU A 1 3  ? 12.569  -11.458 -1.527  1.00 0.00 ? 87  GLU A N    8  
ATOM 8449  C CA   . GLU A 1 3  ? 11.583  -10.867 -2.427  1.00 0.00 ? 87  GLU A CA   8  
ATOM 8450  C C    . GLU A 1 3  ? 11.470  -9.351  -2.225  1.00 0.00 ? 87  GLU A C    8  
ATOM 8451  O O    . GLU A 1 3  ? 10.891  -8.885  -1.248  1.00 0.00 ? 87  GLU A O    8  
ATOM 8452  C CB   . GLU A 1 3  ? 10.224  -11.537 -2.212  1.00 0.00 ? 87  GLU A CB   8  
ATOM 8453  C CG   . GLU A 1 3  ? 9.847   -11.682 -0.744  1.00 0.00 ? 87  GLU A CG   8  
ATOM 8454  C CD   . GLU A 1 3  ? 8.497   -12.328 -0.540  1.00 0.00 ? 87  GLU A CD   8  
ATOM 8455  O OE1  . GLU A 1 3  ? 8.343   -13.516 -0.887  1.00 0.00 ? 87  GLU A OE1  8  
ATOM 8456  O OE2  . GLU A 1 3  ? 7.591   -11.657 -0.010  1.00 0.00 ? 87  GLU A OE2  8  
ATOM 8457  H H    . GLU A 1 3  ? 12.290  -11.716 -0.624  1.00 0.00 ? 87  GLU A H    8  
ATOM 8458  H HA   . GLU A 1 3  ? 11.908  -11.057 -3.439  1.00 0.00 ? 87  GLU A HA   8  
ATOM 8459  H HB2  . GLU A 1 3  ? 9.462   -10.947 -2.700  1.00 0.00 ? 87  GLU A HB2  8  
ATOM 8460  H HB3  . GLU A 1 3  ? 10.245  -12.523 -2.655  1.00 0.00 ? 87  GLU A HB3  8  
ATOM 8461  H HG2  . GLU A 1 3  ? 10.595  -12.285 -0.252  1.00 0.00 ? 87  GLU A HG2  8  
ATOM 8462  H HG3  . GLU A 1 3  ? 9.830   -10.697 -0.296  1.00 0.00 ? 87  GLU A HG3  8  
ATOM 8463  N N    . PRO A 1 4  ? 12.048  -8.560  -3.140  1.00 0.00 ? 88  PRO A N    8  
ATOM 8464  C CA   . PRO A 1 4  ? 11.966  -7.114  -3.112  1.00 0.00 ? 88  PRO A CA   8  
ATOM 8465  C C    . PRO A 1 4  ? 10.902  -6.591  -4.075  1.00 0.00 ? 88  PRO A C    8  
ATOM 8466  O O    . PRO A 1 4  ? 11.218  -6.069  -5.147  1.00 0.00 ? 88  PRO A O    8  
ATOM 8467  C CB   . PRO A 1 4  ? 13.365  -6.709  -3.578  1.00 0.00 ? 88  PRO A CB   8  
ATOM 8468  C CG   . PRO A 1 4  ? 13.857  -7.855  -4.424  1.00 0.00 ? 88  PRO A CG   8  
ATOM 8469  C CD   . PRO A 1 4  ? 12.871  -8.993  -4.268  1.00 0.00 ? 88  PRO A CD   8  
ATOM 8470  H HA   . PRO A 1 4  ? 11.783  -6.738  -2.115  1.00 0.00 ? 88  PRO A HA   8  
ATOM 8471  H HB2  . PRO A 1 4  ? 13.302  -5.795  -4.152  1.00 0.00 ? 88  PRO A HB2  8  
ATOM 8472  H HB3  . PRO A 1 4  ? 14.002  -6.555  -2.720  1.00 0.00 ? 88  PRO A HB3  8  
ATOM 8473  H HG2  . PRO A 1 4  ? 13.903  -7.547  -5.459  1.00 0.00 ? 88  PRO A HG2  8  
ATOM 8474  H HG3  . PRO A 1 4  ? 14.835  -8.162  -4.085  1.00 0.00 ? 88  PRO A HG3  8  
ATOM 8475  H HD2  . PRO A 1 4  ? 12.273  -9.103  -5.163  1.00 0.00 ? 88  PRO A HD2  8  
ATOM 8476  H HD3  . PRO A 1 4  ? 13.388  -9.912  -4.041  1.00 0.00 ? 88  PRO A HD3  8  
ATOM 8477  N N    . LEU A 1 5  ? 9.643   -6.741  -3.697  1.00 0.00 ? 89  LEU A N    8  
ATOM 8478  C CA   . LEU A 1 5  ? 8.535   -6.349  -4.558  1.00 0.00 ? 89  LEU A CA   8  
ATOM 8479  C C    . LEU A 1 5  ? 8.450   -4.829  -4.662  1.00 0.00 ? 89  LEU A C    8  
ATOM 8480  O O    . LEU A 1 5  ? 8.005   -4.151  -3.737  1.00 0.00 ? 89  LEU A O    8  
ATOM 8481  C CB   . LEU A 1 5  ? 7.222   -6.933  -4.030  1.00 0.00 ? 89  LEU A CB   8  
ATOM 8482  C CG   . LEU A 1 5  ? 5.970   -6.617  -4.854  1.00 0.00 ? 89  LEU A CG   8  
ATOM 8483  C CD1  . LEU A 1 5  ? 6.124   -7.112  -6.286  1.00 0.00 ? 89  LEU A CD1  8  
ATOM 8484  C CD2  . LEU A 1 5  ? 4.743   -7.239  -4.204  1.00 0.00 ? 89  LEU A CD2  8  
ATOM 8485  H H    . LEU A 1 5  ? 9.450   -7.112  -2.805  1.00 0.00 ? 89  LEU A H    8  
ATOM 8486  H HA   . LEU A 1 5  ? 8.727   -6.751  -5.543  1.00 0.00 ? 89  LEU A HA   8  
ATOM 8487  H HB2  . LEU A 1 5  ? 7.328   -8.006  -3.980  1.00 0.00 ? 89  LEU A HB2  8  
ATOM 8488  H HB3  . LEU A 1 5  ? 7.065   -6.559  -3.028  1.00 0.00 ? 89  LEU A HB3  8  
ATOM 8489  H HG   . LEU A 1 5  ? 5.828   -5.548  -4.884  1.00 0.00 ? 89  LEU A HG   8  
ATOM 8490  H HD11 . LEU A 1 5  ? 5.249   -6.838  -6.859  1.00 0.00 ? 89  LEU A HD11 8  
ATOM 8491  H HD12 . LEU A 1 5  ? 6.230   -8.187  -6.285  1.00 0.00 ? 89  LEU A HD12 8  
ATOM 8492  H HD13 . LEU A 1 5  ? 7.001   -6.663  -6.728  1.00 0.00 ? 89  LEU A HD13 8  
ATOM 8493  H HD21 . LEU A 1 5  ? 4.850   -8.315  -4.189  1.00 0.00 ? 89  LEU A HD21 8  
ATOM 8494  H HD22 . LEU A 1 5  ? 3.861   -6.972  -4.768  1.00 0.00 ? 89  LEU A HD22 8  
ATOM 8495  H HD23 . LEU A 1 5  ? 4.648   -6.875  -3.191  1.00 0.00 ? 89  LEU A HD23 8  
ATOM 8496  N N    . SER A 1 6  ? 8.919   -4.301  -5.780  1.00 0.00 ? 90  SER A N    8  
ATOM 8497  C CA   . SER A 1 6  ? 8.919   -2.878  -6.009  1.00 0.00 ? 90  SER A CA   8  
ATOM 8498  C C    . SER A 1 6  ? 7.686   -2.456  -6.806  1.00 0.00 ? 90  SER A C    8  
ATOM 8499  O O    . SER A 1 6  ? 7.666   -2.539  -8.036  1.00 0.00 ? 90  SER A O    8  
ATOM 8500  C CB   . SER A 1 6  ? 10.195  -2.504  -6.751  1.00 0.00 ? 90  SER A CB   8  
ATOM 8501  O OG   . SER A 1 6  ? 11.342  -2.978  -6.055  1.00 0.00 ? 90  SER A OG   8  
ATOM 8502  H H    . SER A 1 6  ? 9.287   -4.884  -6.469  1.00 0.00 ? 90  SER A H    8  
ATOM 8503  H HA   . SER A 1 6  ? 8.909   -2.382  -5.051  1.00 0.00 ? 90  SER A HA   8  
ATOM 8504  H HB2  . SER A 1 6  ? 10.178  -2.948  -7.736  1.00 0.00 ? 90  SER A HB2  8  
ATOM 8505  H HB3  . SER A 1 6  ? 10.255  -1.439  -6.838  1.00 0.00 ? 90  SER A HB3  8  
ATOM 8506  H HG   . SER A 1 6  ? 11.110  -3.782  -5.570  1.00 0.00 ? 90  SER A HG   8  
ATOM 8507  N N    . ILE A 1 7  ? 6.655   -2.025  -6.099  1.00 0.00 ? 91  ILE A N    8  
ATOM 8508  C CA   . ILE A 1 7  ? 5.414   -1.604  -6.732  1.00 0.00 ? 91  ILE A CA   8  
ATOM 8509  C C    . ILE A 1 7  ? 5.322   -0.084  -6.762  1.00 0.00 ? 91  ILE A C    8  
ATOM 8510  O O    . ILE A 1 7  ? 5.961   0.600   -5.961  1.00 0.00 ? 91  ILE A O    8  
ATOM 8511  C CB   . ILE A 1 7  ? 4.178   -2.173  -6.004  1.00 0.00 ? 91  ILE A CB   8  
ATOM 8512  C CG1  . ILE A 1 7  ? 4.209   -1.803  -4.515  1.00 0.00 ? 91  ILE A CG1  8  
ATOM 8513  C CG2  . ILE A 1 7  ? 4.108   -3.683  -6.187  1.00 0.00 ? 91  ILE A CG2  8  
ATOM 8514  C CD1  . ILE A 1 7  ? 2.989   -2.264  -3.744  1.00 0.00 ? 91  ILE A CD1  8  
ATOM 8515  H H    . ILE A 1 7  ? 6.735   -1.973  -5.122  1.00 0.00 ? 91  ILE A H    8  
ATOM 8516  H HA   . ILE A 1 7  ? 5.412   -1.978  -7.750  1.00 0.00 ? 91  ILE A HA   8  
ATOM 8517  H HB   . ILE A 1 7  ? 3.296   -1.745  -6.453  1.00 0.00 ? 91  ILE A HB   8  
ATOM 8518  H HG12 . ILE A 1 7  ? 5.077   -2.251  -4.056  1.00 0.00 ? 91  ILE A HG12 8  
ATOM 8519  H HG13 . ILE A 1 7  ? 4.275   -0.727  -4.422  1.00 0.00 ? 91  ILE A HG13 8  
ATOM 8520  H HG21 . ILE A 1 7  ? 3.217   -4.062  -5.712  1.00 0.00 ? 91  ILE A HG21 8  
ATOM 8521  H HG22 . ILE A 1 7  ? 4.977   -4.141  -5.738  1.00 0.00 ? 91  ILE A HG22 8  
ATOM 8522  H HG23 . ILE A 1 7  ? 4.082   -3.917  -7.242  1.00 0.00 ? 91  ILE A HG23 8  
ATOM 8523  H HD11 . ILE A 1 7  ? 3.093   -1.989  -2.705  1.00 0.00 ? 91  ILE A HD11 8  
ATOM 8524  H HD12 . ILE A 1 7  ? 2.897   -3.338  -3.826  1.00 0.00 ? 91  ILE A HD12 8  
ATOM 8525  H HD13 . ILE A 1 7  ? 2.107   -1.795  -4.153  1.00 0.00 ? 91  ILE A HD13 8  
ATOM 8526  N N    . LEU A 1 8  ? 4.535   0.444   -7.683  1.00 0.00 ? 92  LEU A N    8  
ATOM 8527  C CA   . LEU A 1 8  ? 4.383   1.883   -7.810  1.00 0.00 ? 92  LEU A CA   8  
ATOM 8528  C C    . LEU A 1 8  ? 3.140   2.358   -7.069  1.00 0.00 ? 92  LEU A C    8  
ATOM 8529  O O    . LEU A 1 8  ? 2.010   2.108   -7.496  1.00 0.00 ? 92  LEU A O    8  
ATOM 8530  C CB   . LEU A 1 8  ? 4.314   2.284   -9.287  1.00 0.00 ? 92  LEU A CB   8  
ATOM 8531  C CG   . LEU A 1 8  ? 4.214   3.784   -9.558  1.00 0.00 ? 92  LEU A CG   8  
ATOM 8532  C CD1  . LEU A 1 8  ? 5.427   4.511   -9.008  1.00 0.00 ? 92  LEU A CD1  8  
ATOM 8533  C CD2  . LEU A 1 8  ? 4.076   4.040   -11.048 1.00 0.00 ? 92  LEU A CD2  8  
ATOM 8534  H H    . LEU A 1 8  ? 4.038   -0.148  -8.287  1.00 0.00 ? 92  LEU A H    8  
ATOM 8535  H HA   . LEU A 1 8  ? 5.250   2.346   -7.362  1.00 0.00 ? 92  LEU A HA   8  
ATOM 8536  H HB2  . LEU A 1 8  ? 5.203   1.913   -9.775  1.00 0.00 ? 92  LEU A HB2  8  
ATOM 8537  H HB3  . LEU A 1 8  ? 3.456   1.803   -9.728  1.00 0.00 ? 92  LEU A HB3  8  
ATOM 8538  H HG   . LEU A 1 8  ? 3.338   4.178   -9.067  1.00 0.00 ? 92  LEU A HG   8  
ATOM 8539  H HD11 . LEU A 1 8  ? 6.321   4.129   -9.481  1.00 0.00 ? 92  LEU A HD11 8  
ATOM 8540  H HD12 . LEU A 1 8  ? 5.489   4.352   -7.941  1.00 0.00 ? 92  LEU A HD12 8  
ATOM 8541  H HD13 . LEU A 1 8  ? 5.336   5.567   -9.211  1.00 0.00 ? 92  LEU A HD13 8  
ATOM 8542  H HD21 . LEU A 1 8  ? 4.019   5.104   -11.227 1.00 0.00 ? 92  LEU A HD21 8  
ATOM 8543  H HD22 . LEU A 1 8  ? 3.178   3.566   -11.414 1.00 0.00 ? 92  LEU A HD22 8  
ATOM 8544  H HD23 . LEU A 1 8  ? 4.935   3.635   -11.564 1.00 0.00 ? 92  LEU A HD23 8  
ATOM 8545  N N    . VAL A 1 9  ? 3.355   3.032   -5.952  1.00 0.00 ? 93  VAL A N    8  
ATOM 8546  C CA   . VAL A 1 9  ? 2.261   3.556   -5.158  1.00 0.00 ? 93  VAL A CA   8  
ATOM 8547  C C    . VAL A 1 9  ? 2.081   5.042   -5.439  1.00 0.00 ? 93  VAL A C    8  
ATOM 8548  O O    . VAL A 1 9  ? 2.982   5.849   -5.209  1.00 0.00 ? 93  VAL A O    8  
ATOM 8549  C CB   . VAL A 1 9  ? 2.492   3.331   -3.649  1.00 0.00 ? 93  VAL A CB   8  
ATOM 8550  C CG1  . VAL A 1 9  ? 1.328   3.878   -2.833  1.00 0.00 ? 93  VAL A CG1  8  
ATOM 8551  C CG2  . VAL A 1 9  ? 2.702   1.851   -3.352  1.00 0.00 ? 93  VAL A CG2  8  
ATOM 8552  H H    . VAL A 1 9  ? 4.280   3.199   -5.662  1.00 0.00 ? 93  VAL A H    8  
ATOM 8553  H HA   . VAL A 1 9  ? 1.359   3.033   -5.448  1.00 0.00 ? 93  VAL A HA   8  
ATOM 8554  H HB   . VAL A 1 9  ? 3.387   3.864   -3.358  1.00 0.00 ? 93  VAL A HB   8  
ATOM 8555  H HG11 . VAL A 1 9  ? 1.498   3.679   -1.785  1.00 0.00 ? 93  VAL A HG11 8  
ATOM 8556  H HG12 . VAL A 1 9  ? 0.413   3.399   -3.148  1.00 0.00 ? 93  VAL A HG12 8  
ATOM 8557  H HG13 . VAL A 1 9  ? 1.249   4.943   -2.991  1.00 0.00 ? 93  VAL A HG13 8  
ATOM 8558  H HG21 . VAL A 1 9  ? 1.811   1.300   -3.617  1.00 0.00 ? 93  VAL A HG21 8  
ATOM 8559  H HG22 . VAL A 1 9  ? 2.909   1.722   -2.301  1.00 0.00 ? 93  VAL A HG22 8  
ATOM 8560  H HG23 . VAL A 1 9  ? 3.537   1.485   -3.931  1.00 0.00 ? 93  VAL A HG23 8  
ATOM 8561  N N    . ARG A 1 10 ? 0.919   5.391   -5.955  1.00 0.00 ? 94  ARG A N    8  
ATOM 8562  C CA   . ARG A 1 10 ? 0.615   6.767   -6.293  1.00 0.00 ? 94  ARG A CA   8  
ATOM 8563  C C    . ARG A 1 10 ? -0.329  7.347   -5.254  1.00 0.00 ? 94  ARG A C    8  
ATOM 8564  O O    . ARG A 1 10 ? -1.496  6.960   -5.182  1.00 0.00 ? 94  ARG A O    8  
ATOM 8565  C CB   . ARG A 1 10 ? -0.002  6.837   -7.691  1.00 0.00 ? 94  ARG A CB   8  
ATOM 8566  C CG   . ARG A 1 10 ? -0.194  8.251   -8.206  1.00 0.00 ? 94  ARG A CG   8  
ATOM 8567  C CD   . ARG A 1 10 ? -0.573  8.254   -9.676  1.00 0.00 ? 94  ARG A CD   8  
ATOM 8568  N NE   . ARG A 1 10 ? -0.635  9.605   -10.222 1.00 0.00 ? 94  ARG A NE   8  
ATOM 8569  C CZ   . ARG A 1 10 ? 0.157   10.058  -11.192 1.00 0.00 ? 94  ARG A CZ   8  
ATOM 8570  N NH1  . ARG A 1 10 ? 1.084   9.274   -11.731 1.00 0.00 ? 94  ARG A NH1  8  
ATOM 8571  N NH2  . ARG A 1 10 ? 0.022   11.300  -11.629 1.00 0.00 ? 94  ARG A NH2  8  
ATOM 8572  H H    . ARG A 1 10 ? 0.231   4.702   -6.090  1.00 0.00 ? 94  ARG A H    8  
ATOM 8573  H HA   . ARG A 1 10 ? 1.538   7.327   -6.282  1.00 0.00 ? 94  ARG A HA   8  
ATOM 8574  H HB2  . ARG A 1 10 ? 0.642   6.311   -8.383  1.00 0.00 ? 94  ARG A HB2  8  
ATOM 8575  H HB3  . ARG A 1 10 ? -0.965  6.351   -7.669  1.00 0.00 ? 94  ARG A HB3  8  
ATOM 8576  H HG2  . ARG A 1 10 ? -0.980  8.728   -7.640  1.00 0.00 ? 94  ARG A HG2  8  
ATOM 8577  H HG3  . ARG A 1 10 ? 0.729   8.800   -8.080  1.00 0.00 ? 94  ARG A HG3  8  
ATOM 8578  H HD2  . ARG A 1 10 ? 0.162   7.686   -10.226 1.00 0.00 ? 94  ARG A HD2  8  
ATOM 8579  H HD3  . ARG A 1 10 ? -1.541  7.788   -9.786  1.00 0.00 ? 94  ARG A HD3  8  
ATOM 8580  H HE   . ARG A 1 10 ? -1.306  10.213  -9.840  1.00 0.00 ? 94  ARG A HE   8  
ATOM 8581  H HH11 . ARG A 1 10 ? 1.199   8.331   -11.411 1.00 0.00 ? 94  ARG A HH11 8  
ATOM 8582  H HH12 . ARG A 1 10 ? 1.687   9.630   -12.450 1.00 0.00 ? 94  ARG A HH12 8  
ATOM 8583  H HH21 . ARG A 1 10 ? -0.669  11.904  -11.226 1.00 0.00 ? 94  ARG A HH21 8  
ATOM 8584  H HH22 . ARG A 1 10 ? 0.616   11.644  -12.363 1.00 0.00 ? 94  ARG A HH22 8  
ATOM 8585  N N    . ASN A 1 11 ? 0.183   8.245   -4.429  1.00 0.00 ? 95  ASN A N    8  
ATOM 8586  C CA   . ASN A 1 11 ? -0.607  8.813   -3.351  1.00 0.00 ? 95  ASN A CA   8  
ATOM 8587  C C    . ASN A 1 11 ? -1.337  10.079  -3.793  1.00 0.00 ? 95  ASN A C    8  
ATOM 8588  O O    . ASN A 1 11 ? -0.732  11.117  -4.076  1.00 0.00 ? 95  ASN A O    8  
ATOM 8589  C CB   . ASN A 1 11 ? 0.243   9.051   -2.088  1.00 0.00 ? 95  ASN A CB   8  
ATOM 8590  C CG   . ASN A 1 11 ? 1.511   9.854   -2.324  1.00 0.00 ? 95  ASN A CG   8  
ATOM 8591  O OD1  . ASN A 1 11 ? 2.547   9.303   -2.697  1.00 0.00 ? 95  ASN A OD1  8  
ATOM 8592  N ND2  . ASN A 1 11 ? 1.459   11.148  -2.055  1.00 0.00 ? 95  ASN A ND2  8  
ATOM 8593  H H    . ASN A 1 11 ? 1.115   8.541   -4.555  1.00 0.00 ? 95  ASN A H    8  
ATOM 8594  H HA   . ASN A 1 11 ? -1.361  8.079   -3.109  1.00 0.00 ? 95  ASN A HA   8  
ATOM 8595  H HB2  . ASN A 1 11 ? -0.355  9.582   -1.364  1.00 0.00 ? 95  ASN A HB2  8  
ATOM 8596  H HB3  . ASN A 1 11 ? 0.523   8.093   -1.673  1.00 0.00 ? 95  ASN A HB3  8  
ATOM 8597  H HD21 . ASN A 1 11 ? 0.615   11.521  -1.718  1.00 0.00 ? 95  ASN A HD21 8  
ATOM 8598  H HD22 . ASN A 1 11 ? 2.265   11.683  -2.197  1.00 0.00 ? 95  ASN A HD22 8  
ATOM 8599  N N    . ASN A 1 12 ? -2.656  9.940   -3.866  1.00 0.00 ? 96  ASN A N    8  
ATOM 8600  C CA   . ASN A 1 12 ? -3.591  11.010  -4.211  1.00 0.00 ? 96  ASN A CA   8  
ATOM 8601  C C    . ASN A 1 12 ? -3.488  11.433  -5.674  1.00 0.00 ? 96  ASN A C    8  
ATOM 8602  O O    . ASN A 1 12 ? -4.226  10.924  -6.517  1.00 0.00 ? 96  ASN A O    8  
ATOM 8603  C CB   . ASN A 1 12 ? -3.437  12.227  -3.299  1.00 0.00 ? 96  ASN A CB   8  
ATOM 8604  C CG   . ASN A 1 12 ? -4.691  13.086  -3.292  1.00 0.00 ? 96  ASN A CG   8  
ATOM 8605  O OD1  . ASN A 1 12 ? -5.803  12.578  -3.441  1.00 0.00 ? 96  ASN A OD1  8  
ATOM 8606  N ND2  . ASN A 1 12 ? -4.531  14.385  -3.118  1.00 0.00 ? 96  ASN A ND2  8  
ATOM 8607  H H    . ASN A 1 12 ? -3.033  9.052   -3.673  1.00 0.00 ? 96  ASN A H    8  
ATOM 8608  H HA   . ASN A 1 12 ? -4.583  10.609  -4.061  1.00 0.00 ? 96  ASN A HA   8  
ATOM 8609  H HB2  . ASN A 1 12 ? -3.238  11.895  -2.292  1.00 0.00 ? 96  ASN A HB2  8  
ATOM 8610  H HB3  . ASN A 1 12 ? -2.611  12.830  -3.648  1.00 0.00 ? 96  ASN A HB3  8  
ATOM 8611  H HD21 . ASN A 1 12 ? -3.612  14.735  -3.007  1.00 0.00 ? 96  ASN A HD21 8  
ATOM 8612  H HD22 . ASN A 1 12 ? -5.328  14.952  -3.104  1.00 0.00 ? 96  ASN A HD22 8  
ATOM 8613  N N    . LYS A 1 13 ? -2.586  12.361  -5.983  1.00 0.00 ? 97  LYS A N    8  
ATOM 8614  C CA   . LYS A 1 13 ? -2.543  12.939  -7.321  1.00 0.00 ? 97  LYS A CA   8  
ATOM 8615  C C    . LYS A 1 13 ? -1.150  12.919  -7.938  1.00 0.00 ? 97  LYS A C    8  
ATOM 8616  O O    . LYS A 1 13 ? -0.885  12.142  -8.855  1.00 0.00 ? 97  LYS A O    8  
ATOM 8617  C CB   . LYS A 1 13 ? -3.065  14.377  -7.300  1.00 0.00 ? 97  LYS A CB   8  
ATOM 8618  C CG   . LYS A 1 13 ? -4.544  14.487  -6.980  1.00 0.00 ? 97  LYS A CG   8  
ATOM 8619  C CD   . LYS A 1 13 ? -5.384  13.725  -7.989  1.00 0.00 ? 97  LYS A CD   8  
ATOM 8620  C CE   . LYS A 1 13 ? -6.861  13.841  -7.678  1.00 0.00 ? 97  LYS A CE   8  
ATOM 8621  N NZ   . LYS A 1 13 ? -7.685  12.988  -8.575  1.00 0.00 ? 97  LYS A NZ   8  
ATOM 8622  H H    . LYS A 1 13 ? -1.942  12.657  -5.304  1.00 0.00 ? 97  LYS A H    8  
ATOM 8623  H HA   . LYS A 1 13 ? -3.199  12.351  -7.944  1.00 0.00 ? 97  LYS A HA   8  
ATOM 8624  H HB2  . LYS A 1 13 ? -2.516  14.935  -6.555  1.00 0.00 ? 97  LYS A HB2  8  
ATOM 8625  H HB3  . LYS A 1 13 ? -2.894  14.823  -8.268  1.00 0.00 ? 97  LYS A HB3  8  
ATOM 8626  H HG2  . LYS A 1 13 ? -4.722  14.079  -5.997  1.00 0.00 ? 97  LYS A HG2  8  
ATOM 8627  H HG3  . LYS A 1 13 ? -4.831  15.528  -7.000  1.00 0.00 ? 97  LYS A HG3  8  
ATOM 8628  H HD2  . LYS A 1 13 ? -5.201  14.127  -8.974  1.00 0.00 ? 97  LYS A HD2  8  
ATOM 8629  H HD3  . LYS A 1 13 ? -5.100  12.682  -7.965  1.00 0.00 ? 97  LYS A HD3  8  
ATOM 8630  H HE2  . LYS A 1 13 ? -7.022  13.534  -6.654  1.00 0.00 ? 97  LYS A HE2  8  
ATOM 8631  H HE3  . LYS A 1 13 ? -7.161  14.872  -7.796  1.00 0.00 ? 97  LYS A HE3  8  
ATOM 8632  H HZ1  . LYS A 1 13 ? -8.686  13.288  -8.537  1.00 0.00 ? 97  LYS A HZ1  8  
ATOM 8633  H HZ2  . LYS A 1 13 ? -7.620  11.990  -8.278  1.00 0.00 ? 97  LYS A HZ2  8  
ATOM 8634  H HZ3  . LYS A 1 13 ? -7.349  13.062  -9.556  1.00 0.00 ? 97  LYS A HZ3  8  
ATOM 8635  N N    . GLY A 1 14 ? -0.265  13.768  -7.436  1.00 0.00 ? 98  GLY A N    8  
ATOM 8636  C CA   . GLY A 1 14 ? 0.982   14.026  -8.139  1.00 0.00 ? 98  GLY A CA   8  
ATOM 8637  C C    . GLY A 1 14 ? 2.193   13.391  -7.491  1.00 0.00 ? 98  GLY A C    8  
ATOM 8638  O O    . GLY A 1 14 ? 3.313   13.872  -7.663  1.00 0.00 ? 98  GLY A O    8  
ATOM 8639  H H    . GLY A 1 14 ? -0.447  14.212  -6.576  1.00 0.00 ? 98  GLY A H    8  
ATOM 8640  H HA2  . GLY A 1 14 ? 0.893   13.645  -9.143  1.00 0.00 ? 98  GLY A HA2  8  
ATOM 8641  H HA3  . GLY A 1 14 ? 1.135   15.095  -8.186  1.00 0.00 ? 98  GLY A HA3  8  
ATOM 8642  N N    . ARG A 1 15 ? 1.986   12.316  -6.753  1.00 0.00 ? 99  ARG A N    8  
ATOM 8643  C CA   . ARG A 1 15 ? 3.094   11.619  -6.126  1.00 0.00 ? 99  ARG A CA   8  
ATOM 8644  C C    . ARG A 1 15 ? 3.007   10.119  -6.348  1.00 0.00 ? 99  ARG A C    8  
ATOM 8645  O O    . ARG A 1 15 ? 2.294   9.411   -5.644  1.00 0.00 ? 99  ARG A O    8  
ATOM 8646  C CB   . ARG A 1 15 ? 3.160   11.935  -4.631  1.00 0.00 ? 99  ARG A CB   8  
ATOM 8647  C CG   . ARG A 1 15 ? 3.871   13.241  -4.308  1.00 0.00 ? 99  ARG A CG   8  
ATOM 8648  C CD   . ARG A 1 15 ? 5.325   13.201  -4.762  1.00 0.00 ? 99  ARG A CD   8  
ATOM 8649  N NE   . ARG A 1 15 ? 6.026   12.039  -4.218  1.00 0.00 ? 99  ARG A NE   8  
ATOM 8650  C CZ   . ARG A 1 15 ? 7.166   11.553  -4.705  1.00 0.00 ? 99  ARG A CZ   8  
ATOM 8651  N NH1  . ARG A 1 15 ? 7.774   12.149  -5.726  1.00 0.00 ? 99  ARG A NH1  8  
ATOM 8652  N NH2  . ARG A 1 15 ? 7.704   10.475  -4.151  1.00 0.00 ? 99  ARG A NH2  8  
ATOM 8653  H H    . ARG A 1 15 ? 1.071   11.981  -6.631  1.00 0.00 ? 99  ARG A H    8  
ATOM 8654  H HA   . ARG A 1 15 ? 4.002   11.977  -6.589  1.00 0.00 ? 99  ARG A HA   8  
ATOM 8655  H HB2  . ARG A 1 15 ? 2.152   11.993  -4.242  1.00 0.00 ? 99  ARG A HB2  8  
ATOM 8656  H HB3  . ARG A 1 15 ? 3.682   11.134  -4.131  1.00 0.00 ? 99  ARG A HB3  8  
ATOM 8657  H HG2  . ARG A 1 15 ? 3.368   14.053  -4.814  1.00 0.00 ? 99  ARG A HG2  8  
ATOM 8658  H HG3  . ARG A 1 15 ? 3.840   13.404  -3.241  1.00 0.00 ? 99  ARG A HG3  8  
ATOM 8659  H HD2  . ARG A 1 15 ? 5.353   13.157  -5.841  1.00 0.00 ? 99  ARG A HD2  8  
ATOM 8660  H HD3  . ARG A 1 15 ? 5.821   14.101  -4.425  1.00 0.00 ? 99  ARG A HD3  8  
ATOM 8661  H HE   . ARG A 1 15 ? 5.615   11.583  -3.441  1.00 0.00 ? 99  ARG A HE   8  
ATOM 8662  H HH11 . ARG A 1 15 ? 7.380   12.972  -6.137  1.00 0.00 ? 99  ARG A HH11 8  
ATOM 8663  H HH12 . ARG A 1 15 ? 8.633   11.776  -6.087  1.00 0.00 ? 99  ARG A HH12 8  
ATOM 8664  H HH21 . ARG A 1 15 ? 7.248   10.032  -3.372  1.00 0.00 ? 99  ARG A HH21 8  
ATOM 8665  H HH22 . ARG A 1 15 ? 8.568   10.092  -4.508  1.00 0.00 ? 99  ARG A HH22 8  
ATOM 8666  N N    . SER A 1 16 ? 3.707   9.650   -7.364  1.00 0.00 ? 100 SER A N    8  
ATOM 8667  C CA   . SER A 1 16 ? 3.845   8.226   -7.609  1.00 0.00 ? 100 SER A CA   8  
ATOM 8668  C C    . SER A 1 16 ? 5.257   7.777   -7.259  1.00 0.00 ? 100 SER A C    8  
ATOM 8669  O O    . SER A 1 16 ? 6.219   8.100   -7.958  1.00 0.00 ? 100 SER A O    8  
ATOM 8670  C CB   . SER A 1 16 ? 3.506   7.907   -9.068  1.00 0.00 ? 100 SER A CB   8  
ATOM 8671  O OG   . SER A 1 16 ? 3.987   8.923   -9.941  1.00 0.00 ? 100 SER A OG   8  
ATOM 8672  H H    . SER A 1 16 ? 4.141   10.279  -7.978  1.00 0.00 ? 100 SER A H    8  
ATOM 8673  H HA   . SER A 1 16 ? 3.149   7.712   -6.965  1.00 0.00 ? 100 SER A HA   8  
ATOM 8674  H HB2  . SER A 1 16 ? 3.963   6.966   -9.344  1.00 0.00 ? 100 SER A HB2  8  
ATOM 8675  H HB3  . SER A 1 16 ? 2.435   7.834   -9.178  1.00 0.00 ? 100 SER A HB3  8  
ATOM 8676  H HG   . SER A 1 16 ? 4.703   8.564   -10.486 1.00 0.00 ? 100 SER A HG   8  
ATOM 8677  N N    . SER A 1 17 ? 5.386   7.051   -6.162  1.00 0.00 ? 101 SER A N    8  
ATOM 8678  C CA   . SER A 1 17 ? 6.688   6.614   -5.696  1.00 0.00 ? 101 SER A CA   8  
ATOM 8679  C C    . SER A 1 17 ? 6.777   5.095   -5.722  1.00 0.00 ? 101 SER A C    8  
ATOM 8680  O O    . SER A 1 17 ? 5.819   4.400   -5.374  1.00 0.00 ? 101 SER A O    8  
ATOM 8681  C CB   . SER A 1 17 ? 6.948   7.146   -4.283  1.00 0.00 ? 101 SER A CB   8  
ATOM 8682  O OG   . SER A 1 17 ? 8.252   6.814   -3.829  1.00 0.00 ? 101 SER A OG   8  
ATOM 8683  H H    . SER A 1 17 ? 4.582   6.788   -5.657  1.00 0.00 ? 101 SER A H    8  
ATOM 8684  H HA   . SER A 1 17 ? 7.432   7.018   -6.367  1.00 0.00 ? 101 SER A HA   8  
ATOM 8685  H HB2  . SER A 1 17 ? 6.848   8.221   -4.284  1.00 0.00 ? 101 SER A HB2  8  
ATOM 8686  H HB3  . SER A 1 17 ? 6.224   6.721   -3.603  1.00 0.00 ? 101 SER A HB3  8  
ATOM 8687  H HG   . SER A 1 17 ? 8.279   6.860   -2.860  1.00 0.00 ? 101 SER A HG   8  
ATOM 8688  N N    . THR A 1 18 ? 7.911   4.586   -6.164  1.00 0.00 ? 102 THR A N    8  
ATOM 8689  C CA   . THR A 1 18 ? 8.150   3.158   -6.158  1.00 0.00 ? 102 THR A CA   8  
ATOM 8690  C C    . THR A 1 18 ? 8.473   2.695   -4.734  1.00 0.00 ? 102 THR A C    8  
ATOM 8691  O O    . THR A 1 18 ? 9.467   3.127   -4.145  1.00 0.00 ? 102 THR A O    8  
ATOM 8692  C CB   . THR A 1 18 ? 9.312   2.792   -7.101  1.00 0.00 ? 102 THR A CB   8  
ATOM 8693  O OG1  . THR A 1 18 ? 9.126   3.425   -8.378  1.00 0.00 ? 102 THR A OG1  8  
ATOM 8694  C CG2  . THR A 1 18 ? 9.401   1.283   -7.290  1.00 0.00 ? 102 THR A CG2  8  
ATOM 8695  H H    . THR A 1 18 ? 8.605   5.188   -6.512  1.00 0.00 ? 102 THR A H    8  
ATOM 8696  H HA   . THR A 1 18 ? 7.252   2.663   -6.503  1.00 0.00 ? 102 THR A HA   8  
ATOM 8697  H HB   . THR A 1 18 ? 10.236  3.142   -6.663  1.00 0.00 ? 102 THR A HB   8  
ATOM 8698  H HG1  . THR A 1 18 ? 9.937   3.326   -8.904  1.00 0.00 ? 102 THR A HG1  8  
ATOM 8699  H HG21 . THR A 1 18 ? 8.500   0.927   -7.768  1.00 0.00 ? 102 THR A HG21 8  
ATOM 8700  H HG22 . THR A 1 18 ? 9.511   0.807   -6.328  1.00 0.00 ? 102 THR A HG22 8  
ATOM 8701  H HG23 . THR A 1 18 ? 10.254  1.051   -7.908  1.00 0.00 ? 102 THR A HG23 8  
ATOM 8702  N N    . TYR A 1 19 ? 7.624   1.843   -4.177  1.00 0.00 ? 103 TYR A N    8  
ATOM 8703  C CA   . TYR A 1 19 ? 7.807   1.369   -2.812  1.00 0.00 ? 103 TYR A CA   8  
ATOM 8704  C C    . TYR A 1 19 ? 8.335   -0.058  -2.792  1.00 0.00 ? 103 TYR A C    8  
ATOM 8705  O O    . TYR A 1 19 ? 8.038   -0.856  -3.681  1.00 0.00 ? 103 TYR A O    8  
ATOM 8706  C CB   . TYR A 1 19 ? 6.494   1.450   -2.025  1.00 0.00 ? 103 TYR A CB   8  
ATOM 8707  C CG   . TYR A 1 19 ? 6.159   2.844   -1.536  1.00 0.00 ? 103 TYR A CG   8  
ATOM 8708  C CD1  . TYR A 1 19 ? 5.593   3.780   -2.390  1.00 0.00 ? 103 TYR A CD1  8  
ATOM 8709  C CD2  . TYR A 1 19 ? 6.411   3.219   -0.223  1.00 0.00 ? 103 TYR A CD2  8  
ATOM 8710  C CE1  . TYR A 1 19 ? 5.289   5.053   -1.952  1.00 0.00 ? 103 TYR A CE1  8  
ATOM 8711  C CE2  . TYR A 1 19 ? 6.108   4.491   0.224   1.00 0.00 ? 103 TYR A CE2  8  
ATOM 8712  C CZ   . TYR A 1 19 ? 5.547   5.405   -0.644  1.00 0.00 ? 103 TYR A CZ   8  
ATOM 8713  O OH   . TYR A 1 19 ? 5.247   6.673   -0.208  1.00 0.00 ? 103 TYR A OH   8  
ATOM 8714  H H    . TYR A 1 19 ? 6.861   1.507   -4.704  1.00 0.00 ? 103 TYR A H    8  
ATOM 8715  H HA   . TYR A 1 19 ? 8.536   2.009   -2.339  1.00 0.00 ? 103 TYR A HA   8  
ATOM 8716  H HB2  . TYR A 1 19 ? 5.684   1.120   -2.659  1.00 0.00 ? 103 TYR A HB2  8  
ATOM 8717  H HB3  . TYR A 1 19 ? 6.558   0.800   -1.163  1.00 0.00 ? 103 TYR A HB3  8  
ATOM 8718  H HD1  . TYR A 1 19 ? 5.392   3.501   -3.412  1.00 0.00 ? 103 TYR A HD1  8  
ATOM 8719  H HD2  . TYR A 1 19 ? 6.851   2.501   0.452   1.00 0.00 ? 103 TYR A HD2  8  
ATOM 8720  H HE1  . TYR A 1 19 ? 4.849   5.766   -2.632  1.00 0.00 ? 103 TYR A HE1  8  
ATOM 8721  H HE2  . TYR A 1 19 ? 6.312   4.766   1.248   1.00 0.00 ? 103 TYR A HE2  8  
ATOM 8722  H HH   . TYR A 1 19 ? 4.390   6.937   -0.556  1.00 0.00 ? 103 TYR A HH   8  
ATOM 8723  N N    . GLU A 1 20 ? 9.119   -0.363  -1.771  1.00 0.00 ? 104 GLU A N    8  
ATOM 8724  C CA   . GLU A 1 20 ? 9.699   -1.683  -1.607  1.00 0.00 ? 104 GLU A CA   8  
ATOM 8725  C C    . GLU A 1 20 ? 8.927   -2.464  -0.553  1.00 0.00 ? 104 GLU A C    8  
ATOM 8726  O O    . GLU A 1 20 ? 8.968   -2.131  0.636   1.00 0.00 ? 104 GLU A O    8  
ATOM 8727  C CB   . GLU A 1 20 ? 11.168  -1.550  -1.209  1.00 0.00 ? 104 GLU A CB   8  
ATOM 8728  C CG   . GLU A 1 20 ? 11.853  -2.869  -0.897  1.00 0.00 ? 104 GLU A CG   8  
ATOM 8729  C CD   . GLU A 1 20 ? 13.290  -2.675  -0.460  1.00 0.00 ? 104 GLU A CD   8  
ATOM 8730  O OE1  . GLU A 1 20 ? 13.516  -2.222  0.685   1.00 0.00 ? 104 GLU A OE1  8  
ATOM 8731  O OE2  . GLU A 1 20 ? 14.203  -2.966  -1.262  1.00 0.00 ? 104 GLU A OE2  8  
ATOM 8732  H H    . GLU A 1 20 ? 9.306   0.321   -1.094  1.00 0.00 ? 104 GLU A H    8  
ATOM 8733  H HA   . GLU A 1 20 ? 9.630   -2.202  -2.552  1.00 0.00 ? 104 GLU A HA   8  
ATOM 8734  H HB2  . GLU A 1 20 ? 11.705  -1.076  -2.016  1.00 0.00 ? 104 GLU A HB2  8  
ATOM 8735  H HB3  . GLU A 1 20 ? 11.233  -0.923  -0.331  1.00 0.00 ? 104 GLU A HB3  8  
ATOM 8736  H HG2  . GLU A 1 20 ? 11.315  -3.364  -0.103  1.00 0.00 ? 104 GLU A HG2  8  
ATOM 8737  H HG3  . GLU A 1 20 ? 11.840  -3.488  -1.781  1.00 0.00 ? 104 GLU A HG3  8  
ATOM 8738  N N    . VAL A 1 21 ? 8.205   -3.481  -0.995  1.00 0.00 ? 105 VAL A N    8  
ATOM 8739  C CA   . VAL A 1 21 ? 7.411   -4.301  -0.097  1.00 0.00 ? 105 VAL A CA   8  
ATOM 8740  C C    . VAL A 1 21 ? 7.678   -5.783  -0.331  1.00 0.00 ? 105 VAL A C    8  
ATOM 8741  O O    . VAL A 1 21 ? 8.484   -6.153  -1.182  1.00 0.00 ? 105 VAL A O    8  
ATOM 8742  C CB   . VAL A 1 21 ? 5.897   -4.030  -0.254  1.00 0.00 ? 105 VAL A CB   8  
ATOM 8743  C CG1  . VAL A 1 21 ? 5.563   -2.595  0.112   1.00 0.00 ? 105 VAL A CG1  8  
ATOM 8744  C CG2  . VAL A 1 21 ? 5.428   -4.341  -1.669  1.00 0.00 ? 105 VAL A CG2  8  
ATOM 8745  H H    . VAL A 1 21 ? 8.209   -3.693  -1.956  1.00 0.00 ? 105 VAL A H    8  
ATOM 8746  H HA   . VAL A 1 21 ? 7.693   -4.051  0.917   1.00 0.00 ? 105 VAL A HA   8  
ATOM 8747  H HB   . VAL A 1 21 ? 5.365   -4.681  0.424   1.00 0.00 ? 105 VAL A HB   8  
ATOM 8748  H HG11 . VAL A 1 21 ? 6.071   -1.924  -0.564  1.00 0.00 ? 105 VAL A HG11 8  
ATOM 8749  H HG12 . VAL A 1 21 ? 5.886   -2.398  1.123   1.00 0.00 ? 105 VAL A HG12 8  
ATOM 8750  H HG13 . VAL A 1 21 ? 4.497   -2.443  0.039   1.00 0.00 ? 105 VAL A HG13 8  
ATOM 8751  H HG21 . VAL A 1 21 ? 5.618   -5.382  -1.891  1.00 0.00 ? 105 VAL A HG21 8  
ATOM 8752  H HG22 . VAL A 1 21 ? 5.963   -3.719  -2.372  1.00 0.00 ? 105 VAL A HG22 8  
ATOM 8753  H HG23 . VAL A 1 21 ? 4.369   -4.145  -1.748  1.00 0.00 ? 105 VAL A HG23 8  
ATOM 8754  N N    . ARG A 1 22 ? 7.002   -6.620  0.436   1.00 0.00 ? 106 ARG A N    8  
ATOM 8755  C CA   . ARG A 1 22 ? 7.112   -8.062  0.302   1.00 0.00 ? 106 ARG A CA   8  
ATOM 8756  C C    . ARG A 1 22 ? 5.724   -8.674  0.179   1.00 0.00 ? 106 ARG A C    8  
ATOM 8757  O O    . ARG A 1 22 ? 4.730   -8.058  0.572   1.00 0.00 ? 106 ARG A O    8  
ATOM 8758  C CB   . ARG A 1 22 ? 7.858   -8.650  1.504   1.00 0.00 ? 106 ARG A CB   8  
ATOM 8759  C CG   . ARG A 1 22 ? 9.357   -8.393  1.476   1.00 0.00 ? 106 ARG A CG   8  
ATOM 8760  C CD   . ARG A 1 22 ? 10.001  -8.637  2.831   1.00 0.00 ? 106 ARG A CD   8  
ATOM 8761  N NE   . ARG A 1 22 ? 9.679   -7.573  3.783   1.00 0.00 ? 106 ARG A NE   8  
ATOM 8762  C CZ   . ARG A 1 22 ? 10.038  -7.572  5.067   1.00 0.00 ? 106 ARG A CZ   8  
ATOM 8763  N NH1  . ARG A 1 22 ? 10.634  -8.633  5.602   1.00 0.00 ? 106 ARG A NH1  8  
ATOM 8764  N NH2  . ARG A 1 22 ? 9.776   -6.507  5.815   1.00 0.00 ? 106 ARG A NH2  8  
ATOM 8765  H H    . ARG A 1 22 ? 6.401   -6.257  1.118   1.00 0.00 ? 106 ARG A H    8  
ATOM 8766  H HA   . ARG A 1 22 ? 7.668   -8.271  -0.600  1.00 0.00 ? 106 ARG A HA   8  
ATOM 8767  H HB2  . ARG A 1 22 ? 7.457   -8.217  2.408   1.00 0.00 ? 106 ARG A HB2  8  
ATOM 8768  H HB3  . ARG A 1 22 ? 7.699   -9.719  1.526   1.00 0.00 ? 106 ARG A HB3  8  
ATOM 8769  H HG2  . ARG A 1 22 ? 9.812   -9.053  0.752   1.00 0.00 ? 106 ARG A HG2  8  
ATOM 8770  H HG3  . ARG A 1 22 ? 9.528   -7.366  1.185   1.00 0.00 ? 106 ARG A HG3  8  
ATOM 8771  H HD2  . ARG A 1 22 ? 9.646   -9.580  3.222   1.00 0.00 ? 106 ARG A HD2  8  
ATOM 8772  H HD3  . ARG A 1 22 ? 11.072  -8.679  2.701   1.00 0.00 ? 106 ARG A HD3  8  
ATOM 8773  H HE   . ARG A 1 22 ? 9.184   -6.794  3.432   1.00 0.00 ? 106 ARG A HE   8  
ATOM 8774  H HH11 . ARG A 1 22 ? 10.810  -9.444  5.046   1.00 0.00 ? 106 ARG A HH11 8  
ATOM 8775  H HH12 . ARG A 1 22 ? 10.914  -8.623  6.572   1.00 0.00 ? 106 ARG A HH12 8  
ATOM 8776  H HH21 . ARG A 1 22 ? 9.314   -5.710  5.411   1.00 0.00 ? 106 ARG A HH21 8  
ATOM 8777  H HH22 . ARG A 1 22 ? 10.036  -6.489  6.788   1.00 0.00 ? 106 ARG A HH22 8  
ATOM 8778  N N    . LEU A 1 23 ? 5.654   -9.886  -0.351  1.00 0.00 ? 107 LEU A N    8  
ATOM 8779  C CA   . LEU A 1 23 ? 4.378   -10.543 -0.588  1.00 0.00 ? 107 LEU A CA   8  
ATOM 8780  C C    . LEU A 1 23 ? 3.868   -11.174 0.697   1.00 0.00 ? 107 LEU A C    8  
ATOM 8781  O O    . LEU A 1 23 ? 2.663   -11.317 0.899   1.00 0.00 ? 107 LEU A O    8  
ATOM 8782  C CB   . LEU A 1 23 ? 4.497   -11.610 -1.686  1.00 0.00 ? 107 LEU A CB   8  
ATOM 8783  C CG   . LEU A 1 23 ? 4.772   -11.087 -3.103  1.00 0.00 ? 107 LEU A CG   8  
ATOM 8784  C CD1  . LEU A 1 23 ? 6.216   -10.634 -3.256  1.00 0.00 ? 107 LEU A CD1  8  
ATOM 8785  C CD2  . LEU A 1 23 ? 4.438   -12.156 -4.132  1.00 0.00 ? 107 LEU A CD2  8  
ATOM 8786  H H    . LEU A 1 23 ? 6.489   -10.368 -0.566  1.00 0.00 ? 107 LEU A H    8  
ATOM 8787  H HA   . LEU A 1 23 ? 3.672   -9.790  -0.906  1.00 0.00 ? 107 LEU A HA   8  
ATOM 8788  H HB2  . LEU A 1 23 ? 5.299   -12.281 -1.416  1.00 0.00 ? 107 LEU A HB2  8  
ATOM 8789  H HB3  . LEU A 1 23 ? 3.575   -12.173 -1.711  1.00 0.00 ? 107 LEU A HB3  8  
ATOM 8790  H HG   . LEU A 1 23 ? 4.135   -10.235 -3.289  1.00 0.00 ? 107 LEU A HG   8  
ATOM 8791  H HD11 . LEU A 1 23 ? 6.878   -11.463 -3.054  1.00 0.00 ? 107 LEU A HD11 8  
ATOM 8792  H HD12 . LEU A 1 23 ? 6.418   -9.835  -2.558  1.00 0.00 ? 107 LEU A HD12 8  
ATOM 8793  H HD13 . LEU A 1 23 ? 6.378   -10.282 -4.264  1.00 0.00 ? 107 LEU A HD13 8  
ATOM 8794  H HD21 . LEU A 1 23 ? 4.668   -11.789 -5.121  1.00 0.00 ? 107 LEU A HD21 8  
ATOM 8795  H HD22 . LEU A 1 23 ? 3.386   -12.395 -4.072  1.00 0.00 ? 107 LEU A HD22 8  
ATOM 8796  H HD23 . LEU A 1 23 ? 5.021   -13.044 -3.932  1.00 0.00 ? 107 LEU A HD23 8  
ATOM 8797  N N    . THR A 1 24 ? 4.800   -11.532 1.573   1.00 0.00 ? 108 THR A N    8  
ATOM 8798  C CA   . THR A 1 24 ? 4.462   -12.138 2.852   1.00 0.00 ? 108 THR A CA   8  
ATOM 8799  C C    . THR A 1 24 ? 4.145   -11.061 3.901   1.00 0.00 ? 108 THR A C    8  
ATOM 8800  O O    . THR A 1 24 ? 4.017   -11.341 5.093   1.00 0.00 ? 108 THR A O    8  
ATOM 8801  C CB   . THR A 1 24 ? 5.613   -13.047 3.329   1.00 0.00 ? 108 THR A CB   8  
ATOM 8802  O OG1  . THR A 1 24 ? 6.067   -13.838 2.225   1.00 0.00 ? 108 THR A OG1  8  
ATOM 8803  C CG2  . THR A 1 24 ? 5.159   -13.980 4.444   1.00 0.00 ? 108 THR A CG2  8  
ATOM 8804  H H    . THR A 1 24 ? 5.748   -11.399 1.342   1.00 0.00 ? 108 THR A H    8  
ATOM 8805  H HA   . THR A 1 24 ? 3.585   -12.751 2.707   1.00 0.00 ? 108 THR A HA   8  
ATOM 8806  H HB   . THR A 1 24 ? 6.424   -12.432 3.691   1.00 0.00 ? 108 THR A HB   8  
ATOM 8807  H HG1  . THR A 1 24 ? 5.296   -14.151 1.724   1.00 0.00 ? 108 THR A HG1  8  
ATOM 8808  H HG21 . THR A 1 24 ? 4.769   -13.397 5.267   1.00 0.00 ? 108 THR A HG21 8  
ATOM 8809  H HG22 . THR A 1 24 ? 5.999   -14.565 4.787   1.00 0.00 ? 108 THR A HG22 8  
ATOM 8810  H HG23 . THR A 1 24 ? 4.390   -14.639 4.070   1.00 0.00 ? 108 THR A HG23 8  
ATOM 8811  N N    . GLN A 1 25 ? 4.022   -9.823  3.442   1.00 0.00 ? 109 GLN A N    8  
ATOM 8812  C CA   . GLN A 1 25 ? 3.572   -8.739  4.296   1.00 0.00 ? 109 GLN A CA   8  
ATOM 8813  C C    . GLN A 1 25 ? 2.075   -8.548  4.132   1.00 0.00 ? 109 GLN A C    8  
ATOM 8814  O O    . GLN A 1 25 ? 1.547   -8.689  3.030   1.00 0.00 ? 109 GLN A O    8  
ATOM 8815  C CB   . GLN A 1 25 ? 4.262   -7.422  3.944   1.00 0.00 ? 109 GLN A CB   8  
ATOM 8816  C CG   . GLN A 1 25 ? 5.760   -7.395  4.185   1.00 0.00 ? 109 GLN A CG   8  
ATOM 8817  C CD   . GLN A 1 25 ? 6.377   -6.057  3.810   1.00 0.00 ? 109 GLN A CD   8  
ATOM 8818  O OE1  . GLN A 1 25 ? 7.529   -5.986  3.396   1.00 0.00 ? 109 GLN A OE1  8  
ATOM 8819  N NE2  . GLN A 1 25 ? 5.614   -4.982  3.950   1.00 0.00 ? 109 GLN A NE2  8  
ATOM 8820  H H    . GLN A 1 25 ? 4.230   -9.639  2.502   1.00 0.00 ? 109 GLN A H    8  
ATOM 8821  H HA   . GLN A 1 25 ? 3.791   -8.998  5.323   1.00 0.00 ? 109 GLN A HA   8  
ATOM 8822  H HB2  . GLN A 1 25 ? 4.088   -7.211  2.898   1.00 0.00 ? 109 GLN A HB2  8  
ATOM 8823  H HB3  . GLN A 1 25 ? 3.813   -6.638  4.532   1.00 0.00 ? 109 GLN A HB3  8  
ATOM 8824  H HG2  . GLN A 1 25 ? 5.947   -7.580  5.231   1.00 0.00 ? 109 GLN A HG2  8  
ATOM 8825  H HG3  . GLN A 1 25 ? 6.226   -8.169  3.592   1.00 0.00 ? 109 GLN A HG3  8  
ATOM 8826  H HE21 . GLN A 1 25 ? 4.702   -5.098  4.281   1.00 0.00 ? 109 GLN A HE21 8  
ATOM 8827  H HE22 . GLN A 1 25 ? 6.003   -4.111  3.728   1.00 0.00 ? 109 GLN A HE22 8  
ATOM 8828  N N    . THR A 1 26 ? 1.395   -8.227  5.214   1.00 0.00 ? 110 THR A N    8  
ATOM 8829  C CA   . THR A 1 26 ? 0.004   -7.832  5.122   1.00 0.00 ? 110 THR A CA   8  
ATOM 8830  C C    . THR A 1 26 ? -0.072  -6.379  4.681   1.00 0.00 ? 110 THR A C    8  
ATOM 8831  O O    . THR A 1 26 ? 0.892   -5.623  4.859   1.00 0.00 ? 110 THR A O    8  
ATOM 8832  C CB   . THR A 1 26 ? -0.729  -8.006  6.465   1.00 0.00 ? 110 THR A CB   8  
ATOM 8833  O OG1  . THR A 1 26 ? 0.023   -7.386  7.518   1.00 0.00 ? 110 THR A OG1  8  
ATOM 8834  C CG2  . THR A 1 26 ? -0.943  -9.479  6.777   1.00 0.00 ? 110 THR A CG2  8  
ATOM 8835  H H    . THR A 1 26 ? 1.834   -8.249  6.088   1.00 0.00 ? 110 THR A H    8  
ATOM 8836  H HA   . THR A 1 26 ? -0.477  -8.454  4.379   1.00 0.00 ? 110 THR A HA   8  
ATOM 8837  H HB   . THR A 1 26 ? -1.694  -7.526  6.394   1.00 0.00 ? 110 THR A HB   8  
ATOM 8838  H HG1  . THR A 1 26 ? 0.580   -8.052  7.952   1.00 0.00 ? 110 THR A HG1  8  
ATOM 8839  H HG21 . THR A 1 26 ? -1.566  -9.923  6.012   1.00 0.00 ? 110 THR A HG21 8  
ATOM 8840  H HG22 . THR A 1 26 ? -1.427  -9.579  7.738   1.00 0.00 ? 110 THR A HG22 8  
ATOM 8841  H HG23 . THR A 1 26 ? 0.011   -9.983  6.800   1.00 0.00 ? 110 THR A HG23 8  
ATOM 8842  N N    . VAL A 1 27 ? -1.195  -5.985  4.094   1.00 0.00 ? 111 VAL A N    8  
ATOM 8843  C CA   . VAL A 1 27 ? -1.375  -4.610  3.647   1.00 0.00 ? 111 VAL A CA   8  
ATOM 8844  C C    . VAL A 1 27 ? -1.244  -3.645  4.826   1.00 0.00 ? 111 VAL A C    8  
ATOM 8845  O O    . VAL A 1 27 ? -0.832  -2.496  4.659   1.00 0.00 ? 111 VAL A O    8  
ATOM 8846  C CB   . VAL A 1 27 ? -2.734  -4.415  2.937   1.00 0.00 ? 111 VAL A CB   8  
ATOM 8847  C CG1  . VAL A 1 27 ? -2.930  -2.967  2.505   1.00 0.00 ? 111 VAL A CG1  8  
ATOM 8848  C CG2  . VAL A 1 27 ? -2.844  -5.345  1.738   1.00 0.00 ? 111 VAL A CG2  8  
ATOM 8849  H H    . VAL A 1 27 ? -1.919  -6.638  3.953   1.00 0.00 ? 111 VAL A H    8  
ATOM 8850  H HA   . VAL A 1 27 ? -0.588  -4.393  2.940   1.00 0.00 ? 111 VAL A HA   8  
ATOM 8851  H HB   . VAL A 1 27 ? -3.519  -4.667  3.628   1.00 0.00 ? 111 VAL A HB   8  
ATOM 8852  H HG11 . VAL A 1 27 ? -3.892  -2.861  2.027   1.00 0.00 ? 111 VAL A HG11 8  
ATOM 8853  H HG12 . VAL A 1 27 ? -2.149  -2.688  1.813   1.00 0.00 ? 111 VAL A HG12 8  
ATOM 8854  H HG13 . VAL A 1 27 ? -2.887  -2.325  3.373   1.00 0.00 ? 111 VAL A HG13 8  
ATOM 8855  H HG21 . VAL A 1 27 ? -2.048  -5.133  1.041   1.00 0.00 ? 111 VAL A HG21 8  
ATOM 8856  H HG22 . VAL A 1 27 ? -3.798  -5.194  1.253   1.00 0.00 ? 111 VAL A HG22 8  
ATOM 8857  H HG23 . VAL A 1 27 ? -2.770  -6.370  2.070   1.00 0.00 ? 111 VAL A HG23 8  
ATOM 8858  N N    . ALA A 1 28 ? -1.550  -4.140  6.025   1.00 0.00 ? 112 ALA A N    8  
ATOM 8859  C CA   . ALA A 1 28 ? -1.434  -3.348  7.245   1.00 0.00 ? 112 ALA A CA   8  
ATOM 8860  C C    . ALA A 1 28 ? -0.013  -2.833  7.448   1.00 0.00 ? 112 ALA A C    8  
ATOM 8861  O O    . ALA A 1 28 ? 0.188   -1.734  7.961   1.00 0.00 ? 112 ALA A O    8  
ATOM 8862  C CB   . ALA A 1 28 ? -1.863  -4.175  8.446   1.00 0.00 ? 112 ALA A CB   8  
ATOM 8863  H H    . ALA A 1 28 ? -1.867  -5.065  6.090   1.00 0.00 ? 112 ALA A H    8  
ATOM 8864  H HA   . ALA A 1 28 ? -2.104  -2.506  7.161   1.00 0.00 ? 112 ALA A HA   8  
ATOM 8865  H HB1  . ALA A 1 28 ? -1.868  -3.553  9.329   1.00 0.00 ? 112 ALA A HB1  8  
ATOM 8866  H HB2  . ALA A 1 28 ? -1.170  -4.993  8.587   1.00 0.00 ? 112 ALA A HB2  8  
ATOM 8867  H HB3  . ALA A 1 28 ? -2.854  -4.570  8.277   1.00 0.00 ? 112 ALA A HB3  8  
ATOM 8868  N N    . HIS A 1 29 ? 0.973   -3.618  7.027   1.00 0.00 ? 113 HIS A N    8  
ATOM 8869  C CA   . HIS A 1 29 ? 2.365   -3.251  7.239   1.00 0.00 ? 113 HIS A CA   8  
ATOM 8870  C C    . HIS A 1 29 ? 2.748   -2.073  6.348   1.00 0.00 ? 113 HIS A C    8  
ATOM 8871  O O    . HIS A 1 29 ? 3.410   -1.143  6.794   1.00 0.00 ? 113 HIS A O    8  
ATOM 8872  C CB   . HIS A 1 29 ? 3.288   -4.442  6.974   1.00 0.00 ? 113 HIS A CB   8  
ATOM 8873  C CG   . HIS A 1 29 ? 4.511   -4.452  7.842   1.00 0.00 ? 113 HIS A CG   8  
ATOM 8874  N ND1  . HIS A 1 29 ? 5.111   -5.610  8.282   1.00 0.00 ? 113 HIS A ND1  8  
ATOM 8875  C CD2  . HIS A 1 29 ? 5.243   -3.436  8.360   1.00 0.00 ? 113 HIS A CD2  8  
ATOM 8876  C CE1  . HIS A 1 29 ? 6.154   -5.308  9.032   1.00 0.00 ? 113 HIS A CE1  8  
ATOM 8877  N NE2  . HIS A 1 29 ? 6.257   -3.993  9.095   1.00 0.00 ? 113 HIS A NE2  8  
ATOM 8878  H H    . HIS A 1 29 ? 0.759   -4.458  6.562   1.00 0.00 ? 113 HIS A H    8  
ATOM 8879  H HA   . HIS A 1 29 ? 2.469   -2.951  8.273   1.00 0.00 ? 113 HIS A HA   8  
ATOM 8880  H HB2  . HIS A 1 29 ? 2.743   -5.357  7.155   1.00 0.00 ? 113 HIS A HB2  8  
ATOM 8881  H HB3  . HIS A 1 29 ? 3.609   -4.417  5.944   1.00 0.00 ? 113 HIS A HB3  8  
ATOM 8882  H HD1  . HIS A 1 29 ? 4.803   -6.530  8.085   1.00 0.00 ? 113 HIS A HD1  8  
ATOM 8883  H HD2  . HIS A 1 29 ? 5.058   -2.379  8.222   1.00 0.00 ? 113 HIS A HD2  8  
ATOM 8884  H HE1  . HIS A 1 29 ? 6.812   -6.015  9.513   1.00 0.00 ? 113 HIS A HE1  8  
ATOM 8885  H HE2  . HIS A 1 29 ? 6.816   -3.505  9.745   1.00 0.00 ? 113 HIS A HE2  8  
ATOM 8886  N N    . LEU A 1 30 ? 2.318   -2.111  5.088   1.00 0.00 ? 114 LEU A N    8  
ATOM 8887  C CA   . LEU A 1 30 ? 2.567   -0.998  4.175   1.00 0.00 ? 114 LEU A CA   8  
ATOM 8888  C C    . LEU A 1 30 ? 1.736   0.200   4.595   1.00 0.00 ? 114 LEU A C    8  
ATOM 8889  O O    . LEU A 1 30 ? 2.183   1.342   4.510   1.00 0.00 ? 114 LEU A O    8  
ATOM 8890  C CB   . LEU A 1 30 ? 2.236   -1.384  2.732   1.00 0.00 ? 114 LEU A CB   8  
ATOM 8891  C CG   . LEU A 1 30 ? 2.421   -0.264  1.700   1.00 0.00 ? 114 LEU A CG   8  
ATOM 8892  C CD1  . LEU A 1 30 ? 3.867   0.209   1.663   1.00 0.00 ? 114 LEU A CD1  8  
ATOM 8893  C CD2  . LEU A 1 30 ? 1.977   -0.731  0.322   1.00 0.00 ? 114 LEU A CD2  8  
ATOM 8894  H H    . LEU A 1 30 ? 1.813   -2.890  4.774   1.00 0.00 ? 114 LEU A H    8  
ATOM 8895  H HA   . LEU A 1 30 ? 3.614   -0.739  4.242   1.00 0.00 ? 114 LEU A HA   8  
ATOM 8896  H HB2  . LEU A 1 30 ? 2.866   -2.216  2.451   1.00 0.00 ? 114 LEU A HB2  8  
ATOM 8897  H HB3  . LEU A 1 30 ? 1.206   -1.708  2.695   1.00 0.00 ? 114 LEU A HB3  8  
ATOM 8898  H HG   . LEU A 1 30 ? 1.804   0.578   1.980   1.00 0.00 ? 114 LEU A HG   8  
ATOM 8899  H HD11 . LEU A 1 30 ? 3.975   0.983   0.919   1.00 0.00 ? 114 LEU A HD11 8  
ATOM 8900  H HD12 . LEU A 1 30 ? 4.512   -0.622  1.413   1.00 0.00 ? 114 LEU A HD12 8  
ATOM 8901  H HD13 . LEU A 1 30 ? 4.143   0.599   2.632   1.00 0.00 ? 114 LEU A HD13 8  
ATOM 8902  H HD21 . LEU A 1 30 ? 2.089   0.077   -0.384  1.00 0.00 ? 114 LEU A HD21 8  
ATOM 8903  H HD22 . LEU A 1 30 ? 0.941   -1.034  0.362   1.00 0.00 ? 114 LEU A HD22 8  
ATOM 8904  H HD23 . LEU A 1 30 ? 2.586   -1.568  0.013   1.00 0.00 ? 114 LEU A HD23 8  
ATOM 8905  N N    . LYS A 1 31 ? 0.525   -0.086  5.053   1.00 0.00 ? 115 LYS A N    8  
ATOM 8906  C CA   . LYS A 1 31 ? -0.384  0.923   5.577   1.00 0.00 ? 115 LYS A CA   8  
ATOM 8907  C C    . LYS A 1 31 ? 0.319   1.805   6.605   1.00 0.00 ? 115 LYS A C    8  
ATOM 8908  O O    . LYS A 1 31 ? 0.309   3.022   6.481   1.00 0.00 ? 115 LYS A O    8  
ATOM 8909  C CB   . LYS A 1 31 ? -1.599  0.221   6.197   1.00 0.00 ? 115 LYS A CB   8  
ATOM 8910  C CG   . LYS A 1 31 ? -2.583  1.133   6.908   1.00 0.00 ? 115 LYS A CG   8  
ATOM 8911  C CD   . LYS A 1 31 ? -3.192  2.170   5.980   1.00 0.00 ? 115 LYS A CD   8  
ATOM 8912  C CE   . LYS A 1 31 ? -4.524  2.661   6.517   1.00 0.00 ? 115 LYS A CE   8  
ATOM 8913  N NZ   . LYS A 1 31 ? -4.480  2.895   7.983   1.00 0.00 ? 115 LYS A NZ   8  
ATOM 8914  H H    . LYS A 1 31 ? 0.222   -1.022  5.031   1.00 0.00 ? 115 LYS A H    8  
ATOM 8915  H HA   . LYS A 1 31 ? -0.715  1.540   4.755   1.00 0.00 ? 115 LYS A HA   8  
ATOM 8916  H HB2  . LYS A 1 31 ? -2.132  -0.292  5.411   1.00 0.00 ? 115 LYS A HB2  8  
ATOM 8917  H HB3  . LYS A 1 31 ? -1.245  -0.511  6.908   1.00 0.00 ? 115 LYS A HB3  8  
ATOM 8918  H HG2  . LYS A 1 31 ? -3.377  0.531   7.325   1.00 0.00 ? 115 LYS A HG2  8  
ATOM 8919  H HG3  . LYS A 1 31 ? -2.066  1.643   7.708   1.00 0.00 ? 115 LYS A HG3  8  
ATOM 8920  H HD2  . LYS A 1 31 ? -2.518  3.009   5.896   1.00 0.00 ? 115 LYS A HD2  8  
ATOM 8921  H HD3  . LYS A 1 31 ? -3.345  1.725   5.008   1.00 0.00 ? 115 LYS A HD3  8  
ATOM 8922  H HE2  . LYS A 1 31 ? -4.779  3.586   6.020   1.00 0.00 ? 115 LYS A HE2  8  
ATOM 8923  H HE3  . LYS A 1 31 ? -5.279  1.919   6.302   1.00 0.00 ? 115 LYS A HE3  8  
ATOM 8924  H HZ1  . LYS A 1 31 ? -4.131  2.042   8.476   1.00 0.00 ? 115 LYS A HZ1  8  
ATOM 8925  H HZ2  . LYS A 1 31 ? -5.432  3.114   8.339   1.00 0.00 ? 115 LYS A HZ2  8  
ATOM 8926  H HZ3  . LYS A 1 31 ? -3.847  3.696   8.213   1.00 0.00 ? 115 LYS A HZ3  8  
ATOM 8927  N N    . GLN A 1 32 ? 0.961   1.181   7.587   1.00 0.00 ? 116 GLN A N    8  
ATOM 8928  C CA   . GLN A 1 32 ? 1.646   1.918   8.647   1.00 0.00 ? 116 GLN A CA   8  
ATOM 8929  C C    . GLN A 1 32 ? 2.828   2.725   8.101   1.00 0.00 ? 116 GLN A C    8  
ATOM 8930  O O    . GLN A 1 32 ? 3.119   3.811   8.602   1.00 0.00 ? 116 GLN A O    8  
ATOM 8931  C CB   . GLN A 1 32 ? 2.114   0.957   9.741   1.00 0.00 ? 116 GLN A CB   8  
ATOM 8932  C CG   . GLN A 1 32 ? 0.973   0.212   10.413  1.00 0.00 ? 116 GLN A CG   8  
ATOM 8933  C CD   . GLN A 1 32 ? 1.451   -0.784  11.449  1.00 0.00 ? 116 GLN A CD   8  
ATOM 8934  O OE1  . GLN A 1 32 ? 1.719   -1.944  11.136  1.00 0.00 ? 116 GLN A OE1  8  
ATOM 8935  N NE2  . GLN A 1 32 ? 1.547   -0.345  12.694  1.00 0.00 ? 116 GLN A NE2  8  
ATOM 8936  H H    . GLN A 1 32 ? 0.971   0.199   7.603   1.00 0.00 ? 116 GLN A H    8  
ATOM 8937  H HA   . GLN A 1 32 ? 0.931   2.612   9.077   1.00 0.00 ? 116 GLN A HA   8  
ATOM 8938  H HB2  . GLN A 1 32 ? 2.784   0.229   9.305   1.00 0.00 ? 116 GLN A HB2  8  
ATOM 8939  H HB3  . GLN A 1 32 ? 2.644   1.517   10.495  1.00 0.00 ? 116 GLN A HB3  8  
ATOM 8940  H HG2  . GLN A 1 32 ? 0.331   0.931   10.899  1.00 0.00 ? 116 GLN A HG2  8  
ATOM 8941  H HG3  . GLN A 1 32 ? 0.412   -0.316  9.657   1.00 0.00 ? 116 GLN A HG3  8  
ATOM 8942  H HE21 . GLN A 1 32 ? 1.305   0.587   12.876  1.00 0.00 ? 116 GLN A HE21 8  
ATOM 8943  H HE22 . GLN A 1 32 ? 1.859   -0.972  13.387  1.00 0.00 ? 116 GLN A HE22 8  
ATOM 8944  N N    . GLN A 1 33 ? 3.505   2.211   7.074   1.00 0.00 ? 117 GLN A N    8  
ATOM 8945  C CA   . GLN A 1 33 ? 4.575   2.975   6.426   1.00 0.00 ? 117 GLN A CA   8  
ATOM 8946  C C    . GLN A 1 33 ? 3.997   4.196   5.723   1.00 0.00 ? 117 GLN A C    8  
ATOM 8947  O O    . GLN A 1 33 ? 4.543   5.302   5.813   1.00 0.00 ? 117 GLN A O    8  
ATOM 8948  C CB   . GLN A 1 33 ? 5.367   2.129   5.425   1.00 0.00 ? 117 GLN A CB   8  
ATOM 8949  C CG   . GLN A 1 33 ? 6.594   1.460   6.024   1.00 0.00 ? 117 GLN A CG   8  
ATOM 8950  C CD   . GLN A 1 33 ? 6.287   0.151   6.717   1.00 0.00 ? 117 GLN A CD   8  
ATOM 8951  O OE1  . GLN A 1 33 ? 5.974   0.115   7.906   1.00 0.00 ? 117 GLN A OE1  8  
ATOM 8952  N NE2  . GLN A 1 33 ? 6.389   -0.935  5.972   1.00 0.00 ? 117 GLN A NE2  8  
ATOM 8953  H H    . GLN A 1 33 ? 3.285   1.312   6.751   1.00 0.00 ? 117 GLN A H    8  
ATOM 8954  H HA   . GLN A 1 33 ? 5.246   3.313   7.203   1.00 0.00 ? 117 GLN A HA   8  
ATOM 8955  H HB2  . GLN A 1 33 ? 4.721   1.360   5.030   1.00 0.00 ? 117 GLN A HB2  8  
ATOM 8956  H HB3  . GLN A 1 33 ? 5.690   2.768   4.614   1.00 0.00 ? 117 GLN A HB3  8  
ATOM 8957  H HG2  . GLN A 1 33 ? 7.304   1.270   5.234   1.00 0.00 ? 117 GLN A HG2  8  
ATOM 8958  H HG3  . GLN A 1 33 ? 7.034   2.134   6.745   1.00 0.00 ? 117 GLN A HG3  8  
ATOM 8959  H HE21 . GLN A 1 33 ? 6.650   -0.829  5.035   1.00 0.00 ? 117 GLN A HE21 8  
ATOM 8960  H HE22 . GLN A 1 33 ? 6.212   -1.803  6.389   1.00 0.00 ? 117 GLN A HE22 8  
ATOM 8961  N N    . VAL A 1 34 ? 2.882   3.996   5.031   1.00 0.00 ? 118 VAL A N    8  
ATOM 8962  C CA   . VAL A 1 34 ? 2.169   5.097   4.407   1.00 0.00 ? 118 VAL A CA   8  
ATOM 8963  C C    . VAL A 1 34 ? 1.712   6.074   5.481   1.00 0.00 ? 118 VAL A C    8  
ATOM 8964  O O    . VAL A 1 34 ? 1.854   7.283   5.328   1.00 0.00 ? 118 VAL A O    8  
ATOM 8965  C CB   . VAL A 1 34 ? 0.949   4.613   3.587   1.00 0.00 ? 118 VAL A CB   8  
ATOM 8966  C CG1  . VAL A 1 34 ? 0.202   5.792   2.976   1.00 0.00 ? 118 VAL A CG1  8  
ATOM 8967  C CG2  . VAL A 1 34 ? 1.383   3.642   2.500   1.00 0.00 ? 118 VAL A CG2  8  
ATOM 8968  H H    . VAL A 1 34 ? 2.529   3.081   4.942   1.00 0.00 ? 118 VAL A H    8  
ATOM 8969  H HA   . VAL A 1 34 ? 2.853   5.603   3.740   1.00 0.00 ? 118 VAL A HA   8  
ATOM 8970  H HB   . VAL A 1 34 ? 0.276   4.095   4.254   1.00 0.00 ? 118 VAL A HB   8  
ATOM 8971  H HG11 . VAL A 1 34 ? 0.868   6.349   2.335   1.00 0.00 ? 118 VAL A HG11 8  
ATOM 8972  H HG12 . VAL A 1 34 ? -0.161  6.436   3.764   1.00 0.00 ? 118 VAL A HG12 8  
ATOM 8973  H HG13 . VAL A 1 34 ? -0.633  5.427   2.396   1.00 0.00 ? 118 VAL A HG13 8  
ATOM 8974  H HG21 . VAL A 1 34 ? 0.517   3.308   1.947   1.00 0.00 ? 118 VAL A HG21 8  
ATOM 8975  H HG22 . VAL A 1 34 ? 1.873   2.790   2.952   1.00 0.00 ? 118 VAL A HG22 8  
ATOM 8976  H HG23 . VAL A 1 34 ? 2.069   4.136   1.828   1.00 0.00 ? 118 VAL A HG23 8  
ATOM 8977  N N    . SER A 1 35 ? 1.208   5.526   6.583   1.00 0.00 ? 119 SER A N    8  
ATOM 8978  C CA   . SER A 1 35 ? 0.784   6.312   7.734   1.00 0.00 ? 119 SER A CA   8  
ATOM 8979  C C    . SER A 1 35 ? 1.950   7.114   8.324   1.00 0.00 ? 119 SER A C    8  
ATOM 8980  O O    . SER A 1 35 ? 1.744   8.108   9.022   1.00 0.00 ? 119 SER A O    8  
ATOM 8981  C CB   . SER A 1 35 ? 0.176   5.385   8.796   1.00 0.00 ? 119 SER A CB   8  
ATOM 8982  O OG   . SER A 1 35 ? -0.952  4.693   8.284   1.00 0.00 ? 119 SER A OG   8  
ATOM 8983  H H    . SER A 1 35 ? 1.093   4.548   6.618   1.00 0.00 ? 119 SER A H    8  
ATOM 8984  H HA   . SER A 1 35 ? 0.025   7.003   7.397   1.00 0.00 ? 119 SER A HA   8  
ATOM 8985  H HB2  . SER A 1 35 ? 0.916   4.659   9.100   1.00 0.00 ? 119 SER A HB2  8  
ATOM 8986  H HB3  . SER A 1 35 ? -0.130  5.962   9.653   1.00 0.00 ? 119 SER A HB3  8  
ATOM 8987  H HG   . SER A 1 35 ? -1.704  4.789   8.894   1.00 0.00 ? 119 SER A HG   8  
ATOM 8988  N N    . GLY A 1 36 ? 3.170   6.682   8.036   1.00 0.00 ? 120 GLY A N    8  
ATOM 8989  C CA   . GLY A 1 36 ? 4.340   7.402   8.493   1.00 0.00 ? 120 GLY A CA   8  
ATOM 8990  C C    . GLY A 1 36 ? 4.740   8.528   7.552   1.00 0.00 ? 120 GLY A C    8  
ATOM 8991  O O    . GLY A 1 36 ? 5.350   9.512   7.976   1.00 0.00 ? 120 GLY A O    8  
ATOM 8992  H H    . GLY A 1 36 ? 3.279   5.852   7.522   1.00 0.00 ? 120 GLY A H    8  
ATOM 8993  H HA2  . GLY A 1 36 ? 4.136   7.821   9.466   1.00 0.00 ? 120 GLY A HA2  8  
ATOM 8994  H HA3  . GLY A 1 36 ? 5.164   6.709   8.575   1.00 0.00 ? 120 GLY A HA3  8  
ATOM 8995  N N    . LEU A 1 37 ? 4.408   8.387   6.273   1.00 0.00 ? 121 LEU A N    8  
ATOM 8996  C CA   . LEU A 1 37 ? 4.753   9.404   5.278   1.00 0.00 ? 121 LEU A CA   8  
ATOM 8997  C C    . LEU A 1 37 ? 3.567   10.319  4.955   1.00 0.00 ? 121 LEU A C    8  
ATOM 8998  O O    . LEU A 1 37 ? 3.583   11.512  5.257   1.00 0.00 ? 121 LEU A O    8  
ATOM 8999  C CB   . LEU A 1 37 ? 5.259   8.734   3.998   1.00 0.00 ? 121 LEU A CB   8  
ATOM 9000  C CG   . LEU A 1 37 ? 6.568   7.957   4.145   1.00 0.00 ? 121 LEU A CG   8  
ATOM 9001  C CD1  . LEU A 1 37 ? 6.920   7.257   2.843   1.00 0.00 ? 121 LEU A CD1  8  
ATOM 9002  C CD2  . LEU A 1 37 ? 7.693   8.891   4.566   1.00 0.00 ? 121 LEU A CD2  8  
ATOM 9003  H H    . LEU A 1 37 ? 3.935   7.571   5.987   1.00 0.00 ? 121 LEU A H    8  
ATOM 9004  H HA   . LEU A 1 37 ? 5.551   10.006  5.690   1.00 0.00 ? 121 LEU A HA   8  
ATOM 9005  H HB2  . LEU A 1 37 ? 4.496   8.054   3.650   1.00 0.00 ? 121 LEU A HB2  8  
ATOM 9006  H HB3  . LEU A 1 37 ? 5.403   9.500   3.250   1.00 0.00 ? 121 LEU A HB3  8  
ATOM 9007  H HG   . LEU A 1 37 ? 6.452   7.201   4.910   1.00 0.00 ? 121 LEU A HG   8  
ATOM 9008  H HD11 . LEU A 1 37 ? 6.119   6.586   2.566   1.00 0.00 ? 121 LEU A HD11 8  
ATOM 9009  H HD12 . LEU A 1 37 ? 7.832   6.695   2.971   1.00 0.00 ? 121 LEU A HD12 8  
ATOM 9010  H HD13 . LEU A 1 37 ? 7.057   7.994   2.065   1.00 0.00 ? 121 LEU A HD13 8  
ATOM 9011  H HD21 . LEU A 1 37 ? 7.838   9.646   3.806   1.00 0.00 ? 121 LEU A HD21 8  
ATOM 9012  H HD22 . LEU A 1 37 ? 8.606   8.326   4.689   1.00 0.00 ? 121 LEU A HD22 8  
ATOM 9013  H HD23 . LEU A 1 37 ? 7.435   9.368   5.500   1.00 0.00 ? 121 LEU A HD23 8  
ATOM 9014  N N    . GLU A 1 38 ? 2.545   9.745   4.342   1.00 0.00 ? 122 GLU A N    8  
ATOM 9015  C CA   . GLU A 1 38 ? 1.359   10.487  3.908   1.00 0.00 ? 122 GLU A CA   8  
ATOM 9016  C C    . GLU A 1 38 ? 0.228   10.280  4.912   1.00 0.00 ? 122 GLU A C    8  
ATOM 9017  O O    . GLU A 1 38 ? -0.915  10.655  4.670   1.00 0.00 ? 122 GLU A O    8  
ATOM 9018  C CB   . GLU A 1 38 ? 0.929   10.028  2.510   1.00 0.00 ? 122 GLU A CB   8  
ATOM 9019  C CG   . GLU A 1 38 ? -0.039  10.975  1.810   1.00 0.00 ? 122 GLU A CG   8  
ATOM 9020  C CD   . GLU A 1 38 ? 0.606   12.285  1.389   1.00 0.00 ? 122 GLU A CD   8  
ATOM 9021  O OE1  . GLU A 1 38 ? 1.098   13.025  2.266   1.00 0.00 ? 122 GLU A OE1  8  
ATOM 9022  O OE2  . GLU A 1 38 ? 0.624   12.582  0.177   1.00 0.00 ? 122 GLU A OE2  8  
ATOM 9023  H H    . GLU A 1 38 ? 2.572   8.775   4.188   1.00 0.00 ? 122 GLU A H    8  
ATOM 9024  H HA   . GLU A 1 38 ? 1.612   11.536  3.878   1.00 0.00 ? 122 GLU A HA   8  
ATOM 9025  H HB2  . GLU A 1 38 ? 1.808   9.938   1.895   1.00 0.00 ? 122 GLU A HB2  8  
ATOM 9026  H HB3  . GLU A 1 38 ? 0.457   9.059   2.594   1.00 0.00 ? 122 GLU A HB3  8  
ATOM 9027  H HG2  . GLU A 1 38 ? -0.427  10.487  0.929   1.00 0.00 ? 122 GLU A HG2  8  
ATOM 9028  H HG3  . GLU A 1 38 ? -0.856  11.195  2.485   1.00 0.00 ? 122 GLU A HG3  8  
ATOM 9029  N N    . GLY A 1 39 ? 0.589   9.637   6.021   1.00 0.00 ? 123 GLY A N    8  
ATOM 9030  C CA   . GLY A 1 39 ? -0.341  9.186   7.055   1.00 0.00 ? 123 GLY A CA   8  
ATOM 9031  C C    . GLY A 1 39 ? -1.273  10.230  7.656   1.00 0.00 ? 123 GLY A C    8  
ATOM 9032  O O    . GLY A 1 39 ? -1.908  9.939   8.665   1.00 0.00 ? 123 GLY A O    8  
ATOM 9033  H H    . GLY A 1 39 ? 1.541   9.449   6.144   1.00 0.00 ? 123 GLY A H    8  
ATOM 9034  H HA2  . GLY A 1 39 ? -0.954  8.406   6.634   1.00 0.00 ? 123 GLY A HA2  8  
ATOM 9035  H HA3  . GLY A 1 39 ? 0.240   8.752   7.860   1.00 0.00 ? 123 GLY A HA3  8  
ATOM 9036  N N    . VAL A 1 40 ? -1.288  11.437  7.094   1.00 0.00 ? 124 VAL A N    8  
ATOM 9037  C CA   . VAL A 1 40 ? -2.222  12.506  7.475   1.00 0.00 ? 124 VAL A CA   8  
ATOM 9038  C C    . VAL A 1 40 ? -3.567  11.958  7.954   1.00 0.00 ? 124 VAL A C    8  
ATOM 9039  O O    . VAL A 1 40 ? -4.448  11.679  7.140   1.00 0.00 ? 124 VAL A O    8  
ATOM 9040  C CB   . VAL A 1 40 ? -2.496  13.429  6.275   1.00 0.00 ? 124 VAL A CB   8  
ATOM 9041  C CG1  . VAL A 1 40 ? -3.542  14.476  6.632   1.00 0.00 ? 124 VAL A CG1  8  
ATOM 9042  C CG2  . VAL A 1 40 ? -1.209  14.071  5.779   1.00 0.00 ? 124 VAL A CG2  8  
ATOM 9043  H H    . VAL A 1 40 ? -0.658  11.613  6.365   1.00 0.00 ? 124 VAL A H    8  
ATOM 9044  H HA   . VAL A 1 40 ? -1.771  13.090  8.263   1.00 0.00 ? 124 VAL A HA   8  
ATOM 9045  H HB   . VAL A 1 40 ? -2.897  12.819  5.477   1.00 0.00 ? 124 VAL A HB   8  
ATOM 9046  H HG11 . VAL A 1 40 ? -3.730  15.105  5.777   1.00 0.00 ? 124 VAL A HG11 8  
ATOM 9047  H HG12 . VAL A 1 40 ? -3.186  15.078  7.454   1.00 0.00 ? 124 VAL A HG12 8  
ATOM 9048  H HG13 . VAL A 1 40 ? -4.462  13.972  6.921   1.00 0.00 ? 124 VAL A HG13 8  
ATOM 9049  H HG21 . VAL A 1 40 ? -0.524  13.297  5.456   1.00 0.00 ? 124 VAL A HG21 8  
ATOM 9050  H HG22 . VAL A 1 40 ? -0.758  14.641  6.576   1.00 0.00 ? 124 VAL A HG22 8  
ATOM 9051  H HG23 . VAL A 1 40 ? -1.429  14.725  4.947   1.00 0.00 ? 124 VAL A HG23 8  
ATOM 9052  N N    . GLN A 1 41 ? -3.705  11.828  9.276   1.00 0.00 ? 125 GLN A N    8  
ATOM 9053  C CA   . GLN A 1 41 ? -4.874  11.206  9.895   1.00 0.00 ? 125 GLN A CA   8  
ATOM 9054  C C    . GLN A 1 41 ? -5.146  9.832   9.285   1.00 0.00 ? 125 GLN A C    8  
ATOM 9055  O O    . GLN A 1 41 ? -5.697  9.713   8.191   1.00 0.00 ? 125 GLN A O    8  
ATOM 9056  C CB   . GLN A 1 41 ? -6.104  12.108  9.791   1.00 0.00 ? 125 GLN A CB   8  
ATOM 9057  C CG   . GLN A 1 41 ? -5.950  13.417  10.547  1.00 0.00 ? 125 GLN A CG   8  
ATOM 9058  C CD   . GLN A 1 41 ? -7.239  14.201  10.628  1.00 0.00 ? 125 GLN A CD   8  
ATOM 9059  O OE1  . GLN A 1 41 ? -8.330  13.630  10.656  1.00 0.00 ? 125 GLN A OE1  8  
ATOM 9060  N NE2  . GLN A 1 41 ? -7.125  15.518  10.657  1.00 0.00 ? 125 GLN A NE2  8  
ATOM 9061  H H    . GLN A 1 41 ? -2.984  12.148  9.854   1.00 0.00 ? 125 GLN A H    8  
ATOM 9062  H HA   . GLN A 1 41 ? -4.642  11.065  10.940  1.00 0.00 ? 125 GLN A HA   8  
ATOM 9063  H HB2  . GLN A 1 41 ? -6.286  12.335  8.749   1.00 0.00 ? 125 GLN A HB2  8  
ATOM 9064  H HB3  . GLN A 1 41 ? -6.959  11.583  10.191  1.00 0.00 ? 125 GLN A HB3  8  
ATOM 9065  H HG2  . GLN A 1 41 ? -5.619  13.202  11.550  1.00 0.00 ? 125 GLN A HG2  8  
ATOM 9066  H HG3  . GLN A 1 41 ? -5.207  14.022  10.044  1.00 0.00 ? 125 GLN A HG3  8  
ATOM 9067  H HE21 . GLN A 1 41 ? -6.225  15.904  10.626  1.00 0.00 ? 125 GLN A HE21 8  
ATOM 9068  H HE22 . GLN A 1 41 ? -7.948  16.058  10.705  1.00 0.00 ? 125 GLN A HE22 8  
ATOM 9069  N N    . ASP A 1 42 ? -4.784  8.797   10.033  1.00 0.00 ? 126 ASP A N    8  
ATOM 9070  C CA   . ASP A 1 42 ? -4.778  7.418   9.538   1.00 0.00 ? 126 ASP A CA   8  
ATOM 9071  C C    . ASP A 1 42 ? -6.148  6.972   9.007   1.00 0.00 ? 126 ASP A C    8  
ATOM 9072  O O    . ASP A 1 42 ? -6.261  5.948   8.330   1.00 0.00 ? 126 ASP A O    8  
ATOM 9073  C CB   . ASP A 1 42 ? -4.310  6.484   10.658  1.00 0.00 ? 126 ASP A CB   8  
ATOM 9074  C CG   . ASP A 1 42 ? -4.249  5.034   10.233  1.00 0.00 ? 126 ASP A CG   8  
ATOM 9075  O OD1  . ASP A 1 42 ? -3.313  4.665   9.498   1.00 0.00 ? 126 ASP A OD1  8  
ATOM 9076  O OD2  . ASP A 1 42 ? -5.145  4.255   10.634  1.00 0.00 ? 126 ASP A OD2  8  
ATOM 9077  H H    . ASP A 1 42 ? -4.518  8.964   10.964  1.00 0.00 ? 126 ASP A H    8  
ATOM 9078  H HA   . ASP A 1 42 ? -4.063  7.367   8.729   1.00 0.00 ? 126 ASP A HA   8  
ATOM 9079  H HB2  . ASP A 1 42 ? -3.324  6.783   10.980  1.00 0.00 ? 126 ASP A HB2  8  
ATOM 9080  H HB3  . ASP A 1 42 ? -4.992  6.564   11.491  1.00 0.00 ? 126 ASP A HB3  8  
ATOM 9081  N N    . ASP A 1 43 ? -7.186  7.741   9.295   1.00 0.00 ? 127 ASP A N    8  
ATOM 9082  C CA   . ASP A 1 43 ? -8.530  7.383   8.869   1.00 0.00 ? 127 ASP A CA   8  
ATOM 9083  C C    . ASP A 1 43 ? -8.964  8.145   7.610   1.00 0.00 ? 127 ASP A C    8  
ATOM 9084  O O    . ASP A 1 43 ? -9.916  7.738   6.942   1.00 0.00 ? 127 ASP A O    8  
ATOM 9085  C CB   . ASP A 1 43 ? -9.525  7.633   10.006  1.00 0.00 ? 127 ASP A CB   8  
ATOM 9086  C CG   . ASP A 1 43 ? -10.912 7.116   9.686   1.00 0.00 ? 127 ASP A CG   8  
ATOM 9087  O OD1  . ASP A 1 43 ? -11.111 5.878   9.708   1.00 0.00 ? 127 ASP A OD1  8  
ATOM 9088  O OD2  . ASP A 1 43 ? -11.815 7.939   9.438   1.00 0.00 ? 127 ASP A OD2  8  
ATOM 9089  H H    . ASP A 1 43 ? -7.046  8.568   9.809   1.00 0.00 ? 127 ASP A H    8  
ATOM 9090  H HA   . ASP A 1 43 ? -8.527  6.327   8.644   1.00 0.00 ? 127 ASP A HA   8  
ATOM 9091  H HB2  . ASP A 1 43 ? -9.175  7.134   10.898  1.00 0.00 ? 127 ASP A HB2  8  
ATOM 9092  H HB3  . ASP A 1 43 ? -9.592  8.694   10.196  1.00 0.00 ? 127 ASP A HB3  8  
ATOM 9093  N N    . LEU A 1 44 ? -8.265  9.231   7.259   1.00 0.00 ? 128 LEU A N    8  
ATOM 9094  C CA   . LEU A 1 44 ? -8.682  10.055  6.124   1.00 0.00 ? 128 LEU A CA   8  
ATOM 9095  C C    . LEU A 1 44 ? -8.241  9.460   4.794   1.00 0.00 ? 128 LEU A C    8  
ATOM 9096  O O    . LEU A 1 44 ? -8.696  9.889   3.732   1.00 0.00 ? 128 LEU A O    8  
ATOM 9097  C CB   . LEU A 1 44 ? -8.127  11.469  6.242   1.00 0.00 ? 128 LEU A CB   8  
ATOM 9098  C CG   . LEU A 1 44 ? -8.715  12.314  7.364   1.00 0.00 ? 128 LEU A CG   8  
ATOM 9099  C CD1  . LEU A 1 44 ? -8.110  13.701  7.326   1.00 0.00 ? 128 LEU A CD1  8  
ATOM 9100  C CD2  . LEU A 1 44 ? -10.230 12.390  7.251   1.00 0.00 ? 128 LEU A CD2  8  
ATOM 9101  H H    . LEU A 1 44 ? -7.447  9.480   7.762   1.00 0.00 ? 128 LEU A H    8  
ATOM 9102  H HA   . LEU A 1 44 ? -9.759  10.104  6.135   1.00 0.00 ? 128 LEU A HA   8  
ATOM 9103  H HB2  . LEU A 1 44 ? -7.060  11.402  6.392   1.00 0.00 ? 128 LEU A HB2  8  
ATOM 9104  H HB3  . LEU A 1 44 ? -8.307  11.981  5.308   1.00 0.00 ? 128 LEU A HB3  8  
ATOM 9105  H HG   . LEU A 1 44 ? -8.469  11.865  8.315   1.00 0.00 ? 128 LEU A HG   8  
ATOM 9106  H HD11 . LEU A 1 44 ? -8.383  14.188  6.402   1.00 0.00 ? 128 LEU A HD11 8  
ATOM 9107  H HD12 . LEU A 1 44 ? -7.034  13.617  7.385   1.00 0.00 ? 128 LEU A HD12 8  
ATOM 9108  H HD13 . LEU A 1 44 ? -8.474  14.278  8.163   1.00 0.00 ? 128 LEU A HD13 8  
ATOM 9109  H HD21 . LEU A 1 44 ? -10.645 11.396  7.312   1.00 0.00 ? 128 LEU A HD21 8  
ATOM 9110  H HD22 . LEU A 1 44 ? -10.498 12.835  6.303   1.00 0.00 ? 128 LEU A HD22 8  
ATOM 9111  H HD23 . LEU A 1 44 ? -10.622 12.995  8.056   1.00 0.00 ? 128 LEU A HD23 8  
ATOM 9112  N N    . PHE A 1 45 ? -7.342  8.495   4.843   1.00 0.00 ? 129 PHE A N    8  
ATOM 9113  C CA   . PHE A 1 45 ? -6.853  7.872   3.625   1.00 0.00 ? 129 PHE A CA   8  
ATOM 9114  C C    . PHE A 1 45 ? -7.060  6.364   3.635   1.00 0.00 ? 129 PHE A C    8  
ATOM 9115  O O    . PHE A 1 45 ? -7.087  5.728   4.691   1.00 0.00 ? 129 PHE A O    8  
ATOM 9116  C CB   . PHE A 1 45 ? -5.372  8.199   3.409   1.00 0.00 ? 129 PHE A CB   8  
ATOM 9117  C CG   . PHE A 1 45 ? -4.435  7.553   4.388   1.00 0.00 ? 129 PHE A CG   8  
ATOM 9118  C CD1  . PHE A 1 45 ? -4.105  8.188   5.573   1.00 0.00 ? 129 PHE A CD1  8  
ATOM 9119  C CD2  . PHE A 1 45 ? -3.870  6.316   4.117   1.00 0.00 ? 129 PHE A CD2  8  
ATOM 9120  C CE1  . PHE A 1 45 ? -3.236  7.601   6.468   1.00 0.00 ? 129 PHE A CE1  8  
ATOM 9121  C CE2  . PHE A 1 45 ? -3.001  5.723   5.008   1.00 0.00 ? 129 PHE A CE2  8  
ATOM 9122  C CZ   . PHE A 1 45 ? -2.682  6.367   6.184   1.00 0.00 ? 129 PHE A CZ   8  
ATOM 9123  H H    . PHE A 1 45 ? -6.994  8.209   5.711   1.00 0.00 ? 129 PHE A H    8  
ATOM 9124  H HA   . PHE A 1 45 ? -7.417  8.286   2.803   1.00 0.00 ? 129 PHE A HA   8  
ATOM 9125  H HB2  . PHE A 1 45 ? -5.082  7.881   2.420   1.00 0.00 ? 129 PHE A HB2  8  
ATOM 9126  H HB3  . PHE A 1 45 ? -5.241  9.266   3.487   1.00 0.00 ? 129 PHE A HB3  8  
ATOM 9127  H HD1  . PHE A 1 45 ? -4.538  9.151   5.796   1.00 0.00 ? 129 PHE A HD1  8  
ATOM 9128  H HD2  . PHE A 1 45 ? -4.121  5.812   3.195   1.00 0.00 ? 129 PHE A HD2  8  
ATOM 9129  H HE1  . PHE A 1 45 ? -2.986  8.111   7.385   1.00 0.00 ? 129 PHE A HE1  8  
ATOM 9130  H HE2  . PHE A 1 45 ? -2.568  4.759   4.784   1.00 0.00 ? 129 PHE A HE2  8  
ATOM 9131  H HZ   . PHE A 1 45 ? -1.999  5.905   6.884   1.00 0.00 ? 129 PHE A HZ   8  
ATOM 9132  N N    . TRP A 1 46 ? -7.217  5.808   2.446   1.00 0.00 ? 130 TRP A N    8  
ATOM 9133  C CA   . TRP A 1 46 ? -7.266  4.367   2.258   1.00 0.00 ? 130 TRP A CA   8  
ATOM 9134  C C    . TRP A 1 46 ? -6.699  4.048   0.880   1.00 0.00 ? 130 TRP A C    8  
ATOM 9135  O O    . TRP A 1 46 ? -6.658  4.915   0.013   1.00 0.00 ? 130 TRP A O    8  
ATOM 9136  C CB   . TRP A 1 46 ? -8.698  3.830   2.414   1.00 0.00 ? 130 TRP A CB   8  
ATOM 9137  C CG   . TRP A 1 46 ? -9.568  3.979   1.197   1.00 0.00 ? 130 TRP A CG   8  
ATOM 9138  C CD1  . TRP A 1 46 ? -9.946  2.981   0.352   1.00 0.00 ? 130 TRP A CD1  8  
ATOM 9139  C CD2  . TRP A 1 46 ? -10.167 5.179   0.688   1.00 0.00 ? 130 TRP A CD2  8  
ATOM 9140  N NE1  . TRP A 1 46 ? -10.747 3.478   -0.644  1.00 0.00 ? 130 TRP A NE1  8  
ATOM 9141  C CE2  . TRP A 1 46 ? -10.894 4.825   -0.464  1.00 0.00 ? 130 TRP A CE2  8  
ATOM 9142  C CE3  . TRP A 1 46 ? -10.161 6.516   1.093   1.00 0.00 ? 130 TRP A CE3  8  
ATOM 9143  C CZ2  . TRP A 1 46 ? -11.604 5.755   -1.214  1.00 0.00 ? 130 TRP A CZ2  8  
ATOM 9144  C CZ3  . TRP A 1 46 ? -10.865 7.439   0.344   1.00 0.00 ? 130 TRP A CZ3  8  
ATOM 9145  C CH2  . TRP A 1 46 ? -11.579 7.053   -0.797  1.00 0.00 ? 130 TRP A CH2  8  
ATOM 9146  H H    . TRP A 1 46 ? -7.296  6.392   1.657   1.00 0.00 ? 130 TRP A H    8  
ATOM 9147  H HA   . TRP A 1 46 ? -6.631  3.917   3.007   1.00 0.00 ? 130 TRP A HA   8  
ATOM 9148  H HB2  . TRP A 1 46 ? -8.651  2.778   2.653   1.00 0.00 ? 130 TRP A HB2  8  
ATOM 9149  H HB3  . TRP A 1 46 ? -9.176  4.352   3.230   1.00 0.00 ? 130 TRP A HB3  8  
ATOM 9150  H HD1  . TRP A 1 46 ? -9.654  1.949   0.466   1.00 0.00 ? 130 TRP A HD1  8  
ATOM 9151  H HE1  . TRP A 1 46 ? -11.146 2.954   -1.370  1.00 0.00 ? 130 TRP A HE1  8  
ATOM 9152  H HE3  . TRP A 1 46 ? -9.616  6.832   1.970   1.00 0.00 ? 130 TRP A HE3  8  
ATOM 9153  H HZ2  . TRP A 1 46 ? -12.160 5.473   -2.097  1.00 0.00 ? 130 TRP A HZ2  8  
ATOM 9154  H HZ3  . TRP A 1 46 ? -10.871 8.477   0.640   1.00 0.00 ? 130 TRP A HZ3  8  
ATOM 9155  H HH2  . TRP A 1 46 ? -12.113 7.809   -1.353  1.00 0.00 ? 130 TRP A HH2  8  
ATOM 9156  N N    . LEU A 1 47 ? -6.243  2.827   0.670   1.00 0.00 ? 131 LEU A N    8  
ATOM 9157  C CA   . LEU A 1 47 ? -5.568  2.500   -0.578  1.00 0.00 ? 131 LEU A CA   8  
ATOM 9158  C C    . LEU A 1 47 ? -6.463  1.664   -1.485  1.00 0.00 ? 131 LEU A C    8  
ATOM 9159  O O    . LEU A 1 47 ? -7.116  0.724   -1.032  1.00 0.00 ? 131 LEU A O    8  
ATOM 9160  C CB   . LEU A 1 47 ? -4.249  1.753   -0.319  1.00 0.00 ? 131 LEU A CB   8  
ATOM 9161  C CG   . LEU A 1 47 ? -3.163  2.532   0.439   1.00 0.00 ? 131 LEU A CG   8  
ATOM 9162  C CD1  . LEU A 1 47 ? -3.489  2.642   1.923   1.00 0.00 ? 131 LEU A CD1  8  
ATOM 9163  C CD2  . LEU A 1 47 ? -1.808  1.870   0.245   1.00 0.00 ? 131 LEU A CD2  8  
ATOM 9164  H H    . LEU A 1 47 ? -6.370  2.135   1.350   1.00 0.00 ? 131 LEU A H    8  
ATOM 9165  H HA   . LEU A 1 47 ? -5.352  3.436   -1.080  1.00 0.00 ? 131 LEU A HA   8  
ATOM 9166  H HB2  . LEU A 1 47 ? -4.477  0.861   0.248   1.00 0.00 ? 131 LEU A HB2  8  
ATOM 9167  H HB3  . LEU A 1 47 ? -3.842  1.452   -1.273  1.00 0.00 ? 131 LEU A HB3  8  
ATOM 9168  H HG   . LEU A 1 47 ? -3.103  3.533   0.036   1.00 0.00 ? 131 LEU A HG   8  
ATOM 9169  H HD11 . LEU A 1 47 ? -3.530  1.652   2.357   1.00 0.00 ? 131 LEU A HD11 8  
ATOM 9170  H HD12 . LEU A 1 47 ? -4.445  3.127   2.048   1.00 0.00 ? 131 LEU A HD12 8  
ATOM 9171  H HD13 . LEU A 1 47 ? -2.724  3.221   2.420   1.00 0.00 ? 131 LEU A HD13 8  
ATOM 9172  H HD21 . LEU A 1 47 ? -1.056  2.424   0.788   1.00 0.00 ? 131 LEU A HD21 8  
ATOM 9173  H HD22 . LEU A 1 47 ? -1.557  1.858   -0.805  1.00 0.00 ? 131 LEU A HD22 8  
ATOM 9174  H HD23 . LEU A 1 47 ? -1.848  0.856   0.615   1.00 0.00 ? 131 LEU A HD23 8  
ATOM 9175  N N    . THR A 1 48 ? -6.489  2.019   -2.763  1.00 0.00 ? 132 THR A N    8  
ATOM 9176  C CA   . THR A 1 48 ? -7.271  1.289   -3.748  1.00 0.00 ? 132 THR A CA   8  
ATOM 9177  C C    . THR A 1 48 ? -6.393  0.804   -4.897  1.00 0.00 ? 132 THR A C    8  
ATOM 9178  O O    . THR A 1 48 ? -5.706  1.598   -5.535  1.00 0.00 ? 132 THR A O    8  
ATOM 9179  C CB   . THR A 1 48 ? -8.395  2.173   -4.325  1.00 0.00 ? 132 THR A CB   8  
ATOM 9180  O OG1  . THR A 1 48 ? -7.863  3.443   -4.720  1.00 0.00 ? 132 THR A OG1  8  
ATOM 9181  C CG2  . THR A 1 48 ? -9.507  2.376   -3.311  1.00 0.00 ? 132 THR A CG2  8  
ATOM 9182  H H    . THR A 1 48 ? -5.977  2.808   -3.054  1.00 0.00 ? 132 THR A H    8  
ATOM 9183  H HA   . THR A 1 48 ? -7.721  0.439   -3.259  1.00 0.00 ? 132 THR A HA   8  
ATOM 9184  H HB   . THR A 1 48 ? -8.807  1.678   -5.193  1.00 0.00 ? 132 THR A HB   8  
ATOM 9185  H HG1  . THR A 1 48 ? -6.981  3.319   -5.091  1.00 0.00 ? 132 THR A HG1  8  
ATOM 9186  H HG21 . THR A 1 48 ? -9.104  2.840   -2.423  1.00 0.00 ? 132 THR A HG21 8  
ATOM 9187  H HG22 . THR A 1 48 ? -9.939  1.421   -3.054  1.00 0.00 ? 132 THR A HG22 8  
ATOM 9188  H HG23 . THR A 1 48 ? -10.269 3.015   -3.734  1.00 0.00 ? 132 THR A HG23 8  
ATOM 9189  N N    . PHE A 1 49 ? -6.401  -0.498  -5.146  1.00 0.00 ? 133 PHE A N    8  
ATOM 9190  C CA   . PHE A 1 49 ? -5.725  -1.040  -6.317  1.00 0.00 ? 133 PHE A CA   8  
ATOM 9191  C C    . PHE A 1 49 ? -6.721  -1.248  -7.454  1.00 0.00 ? 133 PHE A C    8  
ATOM 9192  O O    . PHE A 1 49 ? -6.693  -0.536  -8.457  1.00 0.00 ? 133 PHE A O    8  
ATOM 9193  C CB   . PHE A 1 49 ? -4.998  -2.355  -5.988  1.00 0.00 ? 133 PHE A CB   8  
ATOM 9194  C CG   . PHE A 1 49 ? -4.659  -3.159  -7.216  1.00 0.00 ? 133 PHE A CG   8  
ATOM 9195  C CD1  . PHE A 1 49 ? -3.833  -2.639  -8.201  1.00 0.00 ? 133 PHE A CD1  8  
ATOM 9196  C CD2  . PHE A 1 49 ? -5.198  -4.422  -7.396  1.00 0.00 ? 133 PHE A CD2  8  
ATOM 9197  C CE1  . PHE A 1 49 ? -3.560  -3.361  -9.344  1.00 0.00 ? 133 PHE A CE1  8  
ATOM 9198  C CE2  . PHE A 1 49 ? -4.920  -5.151  -8.534  1.00 0.00 ? 133 PHE A CE2  8  
ATOM 9199  C CZ   . PHE A 1 49 ? -4.104  -4.619  -9.511  1.00 0.00 ? 133 PHE A CZ   8  
ATOM 9200  H H    . PHE A 1 49 ? -6.868  -1.104  -4.533  1.00 0.00 ? 133 PHE A H    8  
ATOM 9201  H HA   . PHE A 1 49 ? -4.997  -0.312  -6.636  1.00 0.00 ? 133 PHE A HA   8  
ATOM 9202  H HB2  . PHE A 1 49 ? -4.079  -2.131  -5.469  1.00 0.00 ? 133 PHE A HB2  8  
ATOM 9203  H HB3  . PHE A 1 49 ? -5.629  -2.959  -5.354  1.00 0.00 ? 133 PHE A HB3  8  
ATOM 9204  H HD1  . PHE A 1 49 ? -3.407  -1.655  -8.071  1.00 0.00 ? 133 PHE A HD1  8  
ATOM 9205  H HD2  . PHE A 1 49 ? -5.839  -4.838  -6.632  1.00 0.00 ? 133 PHE A HD2  8  
ATOM 9206  H HE1  . PHE A 1 49 ? -2.918  -2.946  -10.106 1.00 0.00 ? 133 PHE A HE1  8  
ATOM 9207  H HE2  . PHE A 1 49 ? -5.346  -6.135  -8.663  1.00 0.00 ? 133 PHE A HE2  8  
ATOM 9208  H HZ   . PHE A 1 49 ? -3.901  -5.181  -10.405 1.00 0.00 ? 133 PHE A HZ   8  
ATOM 9209  N N    . GLU A 1 50 ? -7.604  -2.220  -7.281  1.00 0.00 ? 134 GLU A N    8  
ATOM 9210  C CA   . GLU A 1 50 ? -8.623  -2.518  -8.281  1.00 0.00 ? 134 GLU A CA   8  
ATOM 9211  C C    . GLU A 1 50 ? -9.655  -1.399  -8.334  1.00 0.00 ? 134 GLU A C    8  
ATOM 9212  O O    . GLU A 1 50 ? -10.229 -1.097  -9.380  1.00 0.00 ? 134 GLU A O    8  
ATOM 9213  C CB   . GLU A 1 50 ? -9.350  -3.816  -7.937  1.00 0.00 ? 134 GLU A CB   8  
ATOM 9214  C CG   . GLU A 1 50 ? -8.485  -5.056  -7.970  1.00 0.00 ? 134 GLU A CG   8  
ATOM 9215  C CD   . GLU A 1 50 ? -9.297  -6.301  -7.705  1.00 0.00 ? 134 GLU A CD   8  
ATOM 9216  O OE1  . GLU A 1 50 ? -10.047 -6.721  -8.612  1.00 0.00 ? 134 GLU A OE1  8  
ATOM 9217  O OE2  . GLU A 1 50 ? -9.202  -6.853  -6.593  1.00 0.00 ? 134 GLU A OE2  8  
ATOM 9218  H H    . GLU A 1 50 ? -7.564  -2.755  -6.465  1.00 0.00 ? 134 GLU A H    8  
ATOM 9219  H HA   . GLU A 1 50 ? -8.135  -2.621  -9.244  1.00 0.00 ? 134 GLU A HA   8  
ATOM 9220  H HB2  . GLU A 1 50 ? -9.761  -3.726  -6.943  1.00 0.00 ? 134 GLU A HB2  8  
ATOM 9221  H HB3  . GLU A 1 50 ? -10.160 -3.954  -8.638  1.00 0.00 ? 134 GLU A HB3  8  
ATOM 9222  H HG2  . GLU A 1 50 ? -8.027  -5.138  -8.945  1.00 0.00 ? 134 GLU A HG2  8  
ATOM 9223  H HG3  . GLU A 1 50 ? -7.718  -4.973  -7.214  1.00 0.00 ? 134 GLU A HG3  8  
ATOM 9224  N N    . GLY A 1 51 ? -9.862  -0.792  -7.177  1.00 0.00 ? 135 GLY A N    8  
ATOM 9225  C CA   . GLY A 1 51 ? -10.946 0.141   -6.985  1.00 0.00 ? 135 GLY A CA   8  
ATOM 9226  C C    . GLY A 1 51 ? -11.562 -0.086  -5.626  1.00 0.00 ? 135 GLY A C    8  
ATOM 9227  O O    . GLY A 1 51 ? -12.168 0.806   -5.034  1.00 0.00 ? 135 GLY A O    8  
ATOM 9228  H H    . GLY A 1 51 ? -9.256  -0.981  -6.433  1.00 0.00 ? 135 GLY A H    8  
ATOM 9229  H HA2  . GLY A 1 51 ? -10.567 1.151   -7.050  1.00 0.00 ? 135 GLY A HA2  8  
ATOM 9230  H HA3  . GLY A 1 51 ? -11.696 -0.016  -7.745  1.00 0.00 ? 135 GLY A HA3  8  
ATOM 9231  N N    . LYS A 1 52 ? -11.389 -1.310  -5.141  1.00 0.00 ? 136 LYS A N    8  
ATOM 9232  C CA   . LYS A 1 52 ? -11.765 -1.678  -3.787  1.00 0.00 ? 136 LYS A CA   8  
ATOM 9233  C C    . LYS A 1 52 ? -10.638 -1.326  -2.821  1.00 0.00 ? 136 LYS A C    8  
ATOM 9234  O O    . LYS A 1 52 ? -9.467  -1.296  -3.215  1.00 0.00 ? 136 LYS A O    8  
ATOM 9235  C CB   . LYS A 1 52 ? -12.057 -3.179  -3.707  1.00 0.00 ? 136 LYS A CB   8  
ATOM 9236  C CG   . LYS A 1 52 ? -13.340 -3.601  -4.404  1.00 0.00 ? 136 LYS A CG   8  
ATOM 9237  C CD   . LYS A 1 52 ? -13.460 -5.117  -4.465  1.00 0.00 ? 136 LYS A CD   8  
ATOM 9238  C CE   . LYS A 1 52 ? -13.323 -5.753  -3.087  1.00 0.00 ? 136 LYS A CE   8  
ATOM 9239  N NZ   . LYS A 1 52 ? -13.327 -7.238  -3.162  1.00 0.00 ? 136 LYS A NZ   8  
ATOM 9240  H H    . LYS A 1 52 ? -10.997 -1.995  -5.722  1.00 0.00 ? 136 LYS A H    8  
ATOM 9241  H HA   . LYS A 1 52 ? -12.653 -1.126  -3.518  1.00 0.00 ? 136 LYS A HA   8  
ATOM 9242  H HB2  . LYS A 1 52 ? -11.238 -3.719  -4.159  1.00 0.00 ? 136 LYS A HB2  8  
ATOM 9243  H HB3  . LYS A 1 52 ? -12.130 -3.463  -2.666  1.00 0.00 ? 136 LYS A HB3  8  
ATOM 9244  H HG2  . LYS A 1 52 ? -14.183 -3.203  -3.859  1.00 0.00 ? 136 LYS A HG2  8  
ATOM 9245  H HG3  . LYS A 1 52 ? -13.338 -3.207  -5.410  1.00 0.00 ? 136 LYS A HG3  8  
ATOM 9246  H HD2  . LYS A 1 52 ? -14.427 -5.376  -4.871  1.00 0.00 ? 136 LYS A HD2  8  
ATOM 9247  H HD3  . LYS A 1 52 ? -12.685 -5.506  -5.110  1.00 0.00 ? 136 LYS A HD3  8  
ATOM 9248  H HE2  . LYS A 1 52 ? -12.394 -5.428  -2.644  1.00 0.00 ? 136 LYS A HE2  8  
ATOM 9249  H HE3  . LYS A 1 52 ? -14.149 -5.430  -2.472  1.00 0.00 ? 136 LYS A HE3  8  
ATOM 9250  H HZ1  . LYS A 1 52 ? -14.296 -7.586  -3.330  1.00 0.00 ? 136 LYS A HZ1  8  
ATOM 9251  H HZ2  . LYS A 1 52 ? -12.969 -7.645  -2.272  1.00 0.00 ? 136 LYS A HZ2  8  
ATOM 9252  H HZ3  . LYS A 1 52 ? -12.720 -7.556  -3.949  1.00 0.00 ? 136 LYS A HZ3  8  
ATOM 9253  N N    . PRO A 1 53 ? -10.980 -1.042  -1.556  1.00 0.00 ? 137 PRO A N    8  
ATOM 9254  C CA   . PRO A 1 53 ? -9.992  -0.768  -0.508  1.00 0.00 ? 137 PRO A CA   8  
ATOM 9255  C C    . PRO A 1 53 ? -9.159  -2.002  -0.174  1.00 0.00 ? 137 PRO A C    8  
ATOM 9256  O O    . PRO A 1 53 ? -9.698  -3.096  -0.002  1.00 0.00 ? 137 PRO A O    8  
ATOM 9257  C CB   . PRO A 1 53 ? -10.845 -0.367  0.705   1.00 0.00 ? 137 PRO A CB   8  
ATOM 9258  C CG   . PRO A 1 53 ? -12.200 -0.070  0.158   1.00 0.00 ? 137 PRO A CG   8  
ATOM 9259  C CD   . PRO A 1 53 ? -12.355 -0.953  -1.045  1.00 0.00 ? 137 PRO A CD   8  
ATOM 9260  H HA   . PRO A 1 53 ? -9.338  0.048   -0.782  1.00 0.00 ? 137 PRO A HA   8  
ATOM 9261  H HB2  . PRO A 1 53 ? -10.876 -1.188  1.408   1.00 0.00 ? 137 PRO A HB2  8  
ATOM 9262  H HB3  . PRO A 1 53 ? -10.413 0.500   1.182   1.00 0.00 ? 137 PRO A HB3  8  
ATOM 9263  H HG2  . PRO A 1 53 ? -12.953 -0.304  0.895   1.00 0.00 ? 137 PRO A HG2  8  
ATOM 9264  H HG3  . PRO A 1 53 ? -12.261 0.968   -0.129  1.00 0.00 ? 137 PRO A HG3  8  
ATOM 9265  H HD2  . PRO A 1 53 ? -12.728 -1.926  -0.758  1.00 0.00 ? 137 PRO A HD2  8  
ATOM 9266  H HD3  . PRO A 1 53 ? -13.007 -0.492  -1.772  1.00 0.00 ? 137 PRO A HD3  8  
ATOM 9267  N N    . LEU A 1 54 ? -7.847  -1.821  -0.092  1.00 0.00 ? 138 LEU A N    8  
ATOM 9268  C CA   . LEU A 1 54 ? -6.954  -2.912  0.268   1.00 0.00 ? 138 LEU A CA   8  
ATOM 9269  C C    . LEU A 1 54 ? -7.189  -3.323  1.714   1.00 0.00 ? 138 LEU A C    8  
ATOM 9270  O O    . LEU A 1 54 ? -7.058  -2.507  2.628   1.00 0.00 ? 138 LEU A O    8  
ATOM 9271  C CB   . LEU A 1 54 ? -5.487  -2.509  0.090   1.00 0.00 ? 138 LEU A CB   8  
ATOM 9272  C CG   . LEU A 1 54 ? -5.082  -2.041  -1.310  1.00 0.00 ? 138 LEU A CG   8  
ATOM 9273  C CD1  . LEU A 1 54 ? -3.570  -1.888  -1.392  1.00 0.00 ? 138 LEU A CD1  8  
ATOM 9274  C CD2  . LEU A 1 54 ? -5.576  -3.010  -2.372  1.00 0.00 ? 138 LEU A CD2  8  
ATOM 9275  H H    . LEU A 1 54 ? -7.472  -0.932  -0.278  1.00 0.00 ? 138 LEU A H    8  
ATOM 9276  H HA   . LEU A 1 54 ? -7.172  -3.750  -0.376  1.00 0.00 ? 138 LEU A HA   8  
ATOM 9277  H HB2  . LEU A 1 54 ? -5.273  -1.710  0.785   1.00 0.00 ? 138 LEU A HB2  8  
ATOM 9278  H HB3  . LEU A 1 54 ? -4.873  -3.359  0.349   1.00 0.00 ? 138 LEU A HB3  8  
ATOM 9279  H HG   . LEU A 1 54 ? -5.525  -1.074  -1.504  1.00 0.00 ? 138 LEU A HG   8  
ATOM 9280  H HD11 . LEU A 1 54 ? -3.290  -1.583  -2.389  1.00 0.00 ? 138 LEU A HD11 8  
ATOM 9281  H HD12 . LEU A 1 54 ? -3.096  -2.834  -1.159  1.00 0.00 ? 138 LEU A HD12 8  
ATOM 9282  H HD13 . LEU A 1 54 ? -3.245  -1.142  -0.682  1.00 0.00 ? 138 LEU A HD13 8  
ATOM 9283  H HD21 . LEU A 1 54 ? -6.651  -3.089  -2.311  1.00 0.00 ? 138 LEU A HD21 8  
ATOM 9284  H HD22 . LEU A 1 54 ? -5.134  -3.982  -2.206  1.00 0.00 ? 138 LEU A HD22 8  
ATOM 9285  H HD23 . LEU A 1 54 ? -5.296  -2.649  -3.350  1.00 0.00 ? 138 LEU A HD23 8  
ATOM 9286  N N    . GLU A 1 55 ? -7.549  -4.580  1.914   1.00 0.00 ? 139 GLU A N    8  
ATOM 9287  C CA   . GLU A 1 55 ? -7.771  -5.097  3.253   1.00 0.00 ? 139 GLU A CA   8  
ATOM 9288  C C    . GLU A 1 55 ? -6.443  -5.298  3.971   1.00 0.00 ? 139 GLU A C    8  
ATOM 9289  O O    . GLU A 1 55 ? -5.589  -6.055  3.513   1.00 0.00 ? 139 GLU A O    8  
ATOM 9290  C CB   . GLU A 1 55 ? -8.543  -6.414  3.196   1.00 0.00 ? 139 GLU A CB   8  
ATOM 9291  C CG   . GLU A 1 55 ? -9.969  -6.255  2.695   1.00 0.00 ? 139 GLU A CG   8  
ATOM 9292  C CD   . GLU A 1 55 ? -10.684 -7.577  2.523   1.00 0.00 ? 139 GLU A CD   8  
ATOM 9293  O OE1  . GLU A 1 55 ? -10.743 -8.361  3.493   1.00 0.00 ? 139 GLU A OE1  8  
ATOM 9294  O OE2  . GLU A 1 55 ? -11.192 -7.843  1.412   1.00 0.00 ? 139 GLU A OE2  8  
ATOM 9295  H H    . GLU A 1 55 ? -7.667  -5.177  1.141   1.00 0.00 ? 139 GLU A H    8  
ATOM 9296  H HA   . GLU A 1 55 ? -8.355  -4.371  3.797   1.00 0.00 ? 139 GLU A HA   8  
ATOM 9297  H HB2  . GLU A 1 55 ? -8.025  -7.095  2.538   1.00 0.00 ? 139 GLU A HB2  8  
ATOM 9298  H HB3  . GLU A 1 55 ? -8.578  -6.840  4.188   1.00 0.00 ? 139 GLU A HB3  8  
ATOM 9299  H HG2  . GLU A 1 55 ? -10.522 -5.656  3.404   1.00 0.00 ? 139 GLU A HG2  8  
ATOM 9300  H HG3  . GLU A 1 55 ? -9.947  -5.748  1.740   1.00 0.00 ? 139 GLU A HG3  8  
ATOM 9301  N N    . ASP A 1 56 ? -6.281  -4.623  5.104   1.00 0.00 ? 140 ASP A N    8  
ATOM 9302  C CA   . ASP A 1 56 ? -5.045  -4.709  5.881   1.00 0.00 ? 140 ASP A CA   8  
ATOM 9303  C C    . ASP A 1 56 ? -4.893  -6.100  6.487   1.00 0.00 ? 140 ASP A C    8  
ATOM 9304  O O    . ASP A 1 56 ? -3.807  -6.499  6.907   1.00 0.00 ? 140 ASP A O    8  
ATOM 9305  C CB   . ASP A 1 56 ? -5.021  -3.645  6.982   1.00 0.00 ? 140 ASP A CB   8  
ATOM 9306  C CG   . ASP A 1 56 ? -5.891  -3.992  8.171   1.00 0.00 ? 140 ASP A CG   8  
ATOM 9307  O OD1  . ASP A 1 56 ? -7.123  -4.095  8.005   1.00 0.00 ? 140 ASP A OD1  8  
ATOM 9308  O OD2  . ASP A 1 56 ? -5.347  -4.159  9.282   1.00 0.00 ? 140 ASP A OD2  8  
ATOM 9309  H H    . ASP A 1 56 ? -7.009  -4.050  5.427   1.00 0.00 ? 140 ASP A H    8  
ATOM 9310  H HA   . ASP A 1 56 ? -4.221  -4.533  5.214   1.00 0.00 ? 140 ASP A HA   8  
ATOM 9311  H HB2  . ASP A 1 56 ? -4.006  -3.528  7.330   1.00 0.00 ? 140 ASP A HB2  8  
ATOM 9312  H HB3  . ASP A 1 56 ? -5.364  -2.707  6.571   1.00 0.00 ? 140 ASP A HB3  8  
ATOM 9313  N N    . GLN A 1 57 ? -5.996  -6.833  6.501   1.00 0.00 ? 141 GLN A N    8  
ATOM 9314  C CA   . GLN A 1 57 ? -6.022  -8.201  7.000   1.00 0.00 ? 141 GLN A CA   8  
ATOM 9315  C C    . GLN A 1 57 ? -5.586  -9.196  5.926   1.00 0.00 ? 141 GLN A C    8  
ATOM 9316  O O    . GLN A 1 57 ? -5.472  -10.394 6.188   1.00 0.00 ? 141 GLN A O    8  
ATOM 9317  C CB   . GLN A 1 57 ? -7.427  -8.542  7.502   1.00 0.00 ? 141 GLN A CB   8  
ATOM 9318  C CG   . GLN A 1 57 ? -8.539  -8.140  6.544   1.00 0.00 ? 141 GLN A CG   8  
ATOM 9319  C CD   . GLN A 1 57 ? -9.918  -8.475  7.077   1.00 0.00 ? 141 GLN A CD   8  
ATOM 9320  O OE1  . GLN A 1 57 ? -10.133 -8.526  8.287   1.00 0.00 ? 141 GLN A OE1  8  
ATOM 9321  N NE2  . GLN A 1 57 ? -10.865 -8.680  6.179   1.00 0.00 ? 141 GLN A NE2  8  
ATOM 9322  H H    . GLN A 1 57 ? -6.826  -6.435  6.169   1.00 0.00 ? 141 GLN A H    8  
ATOM 9323  H HA   . GLN A 1 57 ? -5.332  -8.262  7.828   1.00 0.00 ? 141 GLN A HA   8  
ATOM 9324  H HB2  . GLN A 1 57 ? -7.488  -9.606  7.663   1.00 0.00 ? 141 GLN A HB2  8  
ATOM 9325  H HB3  . GLN A 1 57 ? -7.593  -8.034  8.440   1.00 0.00 ? 141 GLN A HB3  8  
ATOM 9326  H HG2  . GLN A 1 57 ? -8.487  -7.075  6.376   1.00 0.00 ? 141 GLN A HG2  8  
ATOM 9327  H HG3  . GLN A 1 57 ? -8.396  -8.659  5.607   1.00 0.00 ? 141 GLN A HG3  8  
ATOM 9328  H HE21 . GLN A 1 57 ? -10.628 -8.606  5.219   1.00 0.00 ? 141 GLN A HE21 8  
ATOM 9329  H HE22 . GLN A 1 57 ? -11.766 -8.891  6.498   1.00 0.00 ? 141 GLN A HE22 8  
ATOM 9330  N N    . LEU A 1 58 ? -5.342  -8.696  4.722   1.00 0.00 ? 142 LEU A N    8  
ATOM 9331  C CA   . LEU A 1 58 ? -4.888  -9.536  3.623   1.00 0.00 ? 142 LEU A CA   8  
ATOM 9332  C C    . LEU A 1 58 ? -3.452  -9.177  3.243   1.00 0.00 ? 142 LEU A C    8  
ATOM 9333  O O    . LEU A 1 58 ? -2.978  -8.082  3.554   1.00 0.00 ? 142 LEU A O    8  
ATOM 9334  C CB   . LEU A 1 58 ? -5.813  -9.382  2.410   1.00 0.00 ? 142 LEU A CB   8  
ATOM 9335  C CG   . LEU A 1 58 ? -7.250  -9.872  2.617   1.00 0.00 ? 142 LEU A CG   8  
ATOM 9336  C CD1  . LEU A 1 58 ? -8.047  -9.742  1.332   1.00 0.00 ? 142 LEU A CD1  8  
ATOM 9337  C CD2  . LEU A 1 58 ? -7.265  -11.313 3.104   1.00 0.00 ? 142 LEU A CD2  8  
ATOM 9338  H H    . LEU A 1 58 ? -5.458  -7.733  4.569   1.00 0.00 ? 142 LEU A H    8  
ATOM 9339  H HA   . LEU A 1 58 ? -4.914  -10.563 3.957   1.00 0.00 ? 142 LEU A HA   8  
ATOM 9340  H HB2  . LEU A 1 58 ? -5.847  -8.335  2.142   1.00 0.00 ? 142 LEU A HB2  8  
ATOM 9341  H HB3  . LEU A 1 58 ? -5.383  -9.932  1.586   1.00 0.00 ? 142 LEU A HB3  8  
ATOM 9342  H HG   . LEU A 1 58 ? -7.726  -9.258  3.370   1.00 0.00 ? 142 LEU A HG   8  
ATOM 9343  H HD11 . LEU A 1 58 ? -7.566  -10.309 0.548   1.00 0.00 ? 142 LEU A HD11 8  
ATOM 9344  H HD12 . LEU A 1 58 ? -8.100  -8.701  1.043   1.00 0.00 ? 142 LEU A HD12 8  
ATOM 9345  H HD13 . LEU A 1 58 ? -9.045  -10.122 1.490   1.00 0.00 ? 142 LEU A HD13 8  
ATOM 9346  H HD21 . LEU A 1 58 ? -6.803  -11.949 2.364   1.00 0.00 ? 142 LEU A HD21 8  
ATOM 9347  H HD22 . LEU A 1 58 ? -8.286  -11.628 3.263   1.00 0.00 ? 142 LEU A HD22 8  
ATOM 9348  H HD23 . LEU A 1 58 ? -6.718  -11.387 4.032   1.00 0.00 ? 142 LEU A HD23 8  
ATOM 9349  N N    . PRO A 1 59 ? -2.732  -10.102 2.589   1.00 0.00 ? 143 PRO A N    8  
ATOM 9350  C CA   . PRO A 1 59 ? -1.344  -9.877  2.179   1.00 0.00 ? 143 PRO A CA   8  
ATOM 9351  C C    . PRO A 1 59 ? -1.221  -8.900  1.010   1.00 0.00 ? 143 PRO A C    8  
ATOM 9352  O O    . PRO A 1 59 ? -2.092  -8.836  0.139   1.00 0.00 ? 143 PRO A O    8  
ATOM 9353  C CB   . PRO A 1 59 ? -0.866  -11.270 1.762   1.00 0.00 ? 143 PRO A CB   8  
ATOM 9354  C CG   . PRO A 1 59 ? -2.102  -11.988 1.348   1.00 0.00 ? 143 PRO A CG   8  
ATOM 9355  C CD   . PRO A 1 59 ? -3.205  -11.451 2.219   1.00 0.00 ? 143 PRO A CD   8  
ATOM 9356  H HA   . PRO A 1 59 ? -0.746  -9.524  3.007   1.00 0.00 ? 143 PRO A HA   8  
ATOM 9357  H HB2  . PRO A 1 59 ? -0.167  -11.180 0.941   1.00 0.00 ? 143 PRO A HB2  8  
ATOM 9358  H HB3  . PRO A 1 59 ? -0.387  -11.757 2.598   1.00 0.00 ? 143 PRO A HB3  8  
ATOM 9359  H HG2  . PRO A 1 59 ? -2.313  -11.785 0.309   1.00 0.00 ? 143 PRO A HG2  8  
ATOM 9360  H HG3  . PRO A 1 59 ? -1.982  -13.048 1.508   1.00 0.00 ? 143 PRO A HG3  8  
ATOM 9361  H HD2  . PRO A 1 59 ? -4.130  -11.395 1.664   1.00 0.00 ? 143 PRO A HD2  8  
ATOM 9362  H HD3  . PRO A 1 59 ? -3.328  -12.069 3.095   1.00 0.00 ? 143 PRO A HD3  8  
ATOM 9363  N N    . LEU A 1 60 ? -0.122  -8.156  0.996   1.00 0.00 ? 144 LEU A N    8  
ATOM 9364  C CA   . LEU A 1 60 ? 0.154   -7.196  -0.067  1.00 0.00 ? 144 LEU A CA   8  
ATOM 9365  C C    . LEU A 1 60 ? 0.379   -7.897  -1.395  1.00 0.00 ? 144 LEU A C    8  
ATOM 9366  O O    . LEU A 1 60 ? -0.043  -7.409  -2.439  1.00 0.00 ? 144 LEU A O    8  
ATOM 9367  C CB   . LEU A 1 60 ? 1.382   -6.355  0.282   1.00 0.00 ? 144 LEU A CB   8  
ATOM 9368  C CG   . LEU A 1 60 ? 1.122   -5.181  1.219   1.00 0.00 ? 144 LEU A CG   8  
ATOM 9369  C CD1  . LEU A 1 60 ? 2.430   -4.675  1.804   1.00 0.00 ? 144 LEU A CD1  8  
ATOM 9370  C CD2  . LEU A 1 60 ? 0.410   -4.064  0.472   1.00 0.00 ? 144 LEU A CD2  8  
ATOM 9371  H H    . LEU A 1 60 ? 0.530   -8.259  1.729   1.00 0.00 ? 144 LEU A H    8  
ATOM 9372  H HA   . LEU A 1 60 ? -0.702  -6.546  -0.157  1.00 0.00 ? 144 LEU A HA   8  
ATOM 9373  H HB2  . LEU A 1 60 ? 2.116   -7.002  0.744   1.00 0.00 ? 144 LEU A HB2  8  
ATOM 9374  H HB3  . LEU A 1 60 ? 1.797   -5.967  -0.635  1.00 0.00 ? 144 LEU A HB3  8  
ATOM 9375  H HG   . LEU A 1 60 ? 0.486   -5.500  2.029   1.00 0.00 ? 144 LEU A HG   8  
ATOM 9376  H HD11 . LEU A 1 60 ? 2.927   -5.479  2.327   1.00 0.00 ? 144 LEU A HD11 8  
ATOM 9377  H HD12 . LEU A 1 60 ? 2.227   -3.869  2.494   1.00 0.00 ? 144 LEU A HD12 8  
ATOM 9378  H HD13 . LEU A 1 60 ? 3.065   -4.315  1.008   1.00 0.00 ? 144 LEU A HD13 8  
ATOM 9379  H HD21 . LEU A 1 60 ? 1.008   -3.762  -0.374  1.00 0.00 ? 144 LEU A HD21 8  
ATOM 9380  H HD22 . LEU A 1 60 ? 0.269   -3.222  1.131   1.00 0.00 ? 144 LEU A HD22 8  
ATOM 9381  H HD23 . LEU A 1 60 ? -0.551  -4.417  0.127   1.00 0.00 ? 144 LEU A HD23 8  
ATOM 9382  N N    . GLY A 1 61 ? 1.033   -9.054  -1.344  1.00 0.00 ? 145 GLY A N    8  
ATOM 9383  C CA   . GLY A 1 61 ? 1.335   -9.797  -2.554  1.00 0.00 ? 145 GLY A CA   8  
ATOM 9384  C C    . GLY A 1 61 ? 0.093   -10.186 -3.329  1.00 0.00 ? 145 GLY A C    8  
ATOM 9385  O O    . GLY A 1 61 ? 0.151   -10.391 -4.536  1.00 0.00 ? 145 GLY A O    8  
ATOM 9386  H H    . GLY A 1 61 ? 1.317   -9.404  -0.474  1.00 0.00 ? 145 GLY A H    8  
ATOM 9387  H HA2  . GLY A 1 61 ? 1.965   -9.191  -3.187  1.00 0.00 ? 145 GLY A HA2  8  
ATOM 9388  H HA3  . GLY A 1 61 ? 1.872   -10.695 -2.285  1.00 0.00 ? 145 GLY A HA3  8  
ATOM 9389  N N    . GLU A 1 62 ? -1.036  -10.266 -2.643  1.00 0.00 ? 146 GLU A N    8  
ATOM 9390  C CA   . GLU A 1 62 ? -2.281  -10.668 -3.275  1.00 0.00 ? 146 GLU A CA   8  
ATOM 9391  C C    . GLU A 1 62 ? -2.771  -9.580  -4.232  1.00 0.00 ? 146 GLU A C    8  
ATOM 9392  O O    . GLU A 1 62 ? -3.429  -9.867  -5.230  1.00 0.00 ? 146 GLU A O    8  
ATOM 9393  C CB   . GLU A 1 62 ? -3.334  -10.974 -2.209  1.00 0.00 ? 146 GLU A CB   8  
ATOM 9394  C CG   . GLU A 1 62 ? -4.528  -11.753 -2.734  1.00 0.00 ? 146 GLU A CG   8  
ATOM 9395  C CD   . GLU A 1 62 ? -4.941  -12.865 -1.796  1.00 0.00 ? 146 GLU A CD   8  
ATOM 9396  O OE1  . GLU A 1 62 ? -4.277  -13.924 -1.801  1.00 0.00 ? 146 GLU A OE1  8  
ATOM 9397  O OE2  . GLU A 1 62 ? -5.926  -12.691 -1.051  1.00 0.00 ? 146 GLU A OE2  8  
ATOM 9398  H H    . GLU A 1 62 ? -1.033  -10.046 -1.688  1.00 0.00 ? 146 GLU A H    8  
ATOM 9399  H HA   . GLU A 1 62 ? -2.087  -11.564 -3.843  1.00 0.00 ? 146 GLU A HA   8  
ATOM 9400  H HB2  . GLU A 1 62 ? -2.874  -11.554 -1.422  1.00 0.00 ? 146 GLU A HB2  8  
ATOM 9401  H HB3  . GLU A 1 62 ? -3.693  -10.043 -1.797  1.00 0.00 ? 146 GLU A HB3  8  
ATOM 9402  H HG2  . GLU A 1 62 ? -5.361  -11.074 -2.853  1.00 0.00 ? 146 GLU A HG2  8  
ATOM 9403  H HG3  . GLU A 1 62 ? -4.272  -12.183 -3.690  1.00 0.00 ? 146 GLU A HG3  8  
ATOM 9404  N N    . TYR A 1 63 ? -2.438  -8.330  -3.922  1.00 0.00 ? 147 TYR A N    8  
ATOM 9405  C CA   . TYR A 1 63 ? -2.788  -7.202  -4.783  1.00 0.00 ? 147 TYR A CA   8  
ATOM 9406  C C    . TYR A 1 63 ? -1.586  -6.764  -5.621  1.00 0.00 ? 147 TYR A C    8  
ATOM 9407  O O    . TYR A 1 63 ? -1.717  -6.419  -6.796  1.00 0.00 ? 147 TYR A O    8  
ATOM 9408  C CB   . TYR A 1 63 ? -3.256  -6.011  -3.947  1.00 0.00 ? 147 TYR A CB   8  
ATOM 9409  C CG   . TYR A 1 63 ? -4.400  -6.305  -3.002  1.00 0.00 ? 147 TYR A CG   8  
ATOM 9410  C CD1  . TYR A 1 63 ? -5.704  -6.422  -3.468  1.00 0.00 ? 147 TYR A CD1  8  
ATOM 9411  C CD2  . TYR A 1 63 ? -4.177  -6.438  -1.637  1.00 0.00 ? 147 TYR A CD2  8  
ATOM 9412  C CE1  . TYR A 1 63 ? -6.753  -6.659  -2.600  1.00 0.00 ? 147 TYR A CE1  8  
ATOM 9413  C CE2  . TYR A 1 63 ? -5.218  -6.682  -0.763  1.00 0.00 ? 147 TYR A CE2  8  
ATOM 9414  C CZ   . TYR A 1 63 ? -6.505  -6.791  -1.250  1.00 0.00 ? 147 TYR A CZ   8  
ATOM 9415  O OH   . TYR A 1 63 ? -7.547  -7.012  -0.379  1.00 0.00 ? 147 TYR A OH   8  
ATOM 9416  H H    . TYR A 1 63 ? -1.935  -8.163  -3.097  1.00 0.00 ? 147 TYR A H    8  
ATOM 9417  H HA   . TYR A 1 63 ? -3.587  -7.514  -5.439  1.00 0.00 ? 147 TYR A HA   8  
ATOM 9418  H HB2  . TYR A 1 63 ? -2.429  -5.655  -3.355  1.00 0.00 ? 147 TYR A HB2  8  
ATOM 9419  H HB3  . TYR A 1 63 ? -3.576  -5.223  -4.614  1.00 0.00 ? 147 TYR A HB3  8  
ATOM 9420  H HD1  . TYR A 1 63 ? -5.894  -6.321  -4.527  1.00 0.00 ? 147 TYR A HD1  8  
ATOM 9421  H HD2  . TYR A 1 63 ? -3.168  -6.355  -1.260  1.00 0.00 ? 147 TYR A HD2  8  
ATOM 9422  H HE1  . TYR A 1 63 ? -7.760  -6.748  -2.980  1.00 0.00 ? 147 TYR A HE1  8  
ATOM 9423  H HE2  . TYR A 1 63 ? -5.023  -6.785  0.295   1.00 0.00 ? 147 TYR A HE2  8  
ATOM 9424  H HH   . TYR A 1 63 ? -8.091  -7.738  -0.699  1.00 0.00 ? 147 TYR A HH   8  
ATOM 9425  N N    . GLY A 1 64 ? -0.415  -6.789  -4.997  1.00 0.00 ? 148 GLY A N    8  
ATOM 9426  C CA   . GLY A 1 64 ? 0.781   -6.204  -5.580  1.00 0.00 ? 148 GLY A CA   8  
ATOM 9427  C C    . GLY A 1 64 ? 1.683   -7.210  -6.268  1.00 0.00 ? 148 GLY A C    8  
ATOM 9428  O O    . GLY A 1 64 ? 2.802   -6.864  -6.632  1.00 0.00 ? 148 GLY A O    8  
ATOM 9429  H H    . GLY A 1 64 ? -0.359  -7.205  -4.109  1.00 0.00 ? 148 GLY A H    8  
ATOM 9430  H HA2  . GLY A 1 64 ? 0.484   -5.462  -6.303  1.00 0.00 ? 148 GLY A HA2  8  
ATOM 9431  H HA3  . GLY A 1 64 ? 1.343   -5.714  -4.797  1.00 0.00 ? 148 GLY A HA3  8  
ATOM 9432  N N    . LEU A 1 65 ? 1.214   -8.456  -6.391  1.00 0.00 ? 149 LEU A N    8  
ATOM 9433  C CA   . LEU A 1 65 ? 1.997   -9.559  -6.976  1.00 0.00 ? 149 LEU A CA   8  
ATOM 9434  C C    . LEU A 1 65 ? 2.841   -9.127  -8.182  1.00 0.00 ? 149 LEU A C    8  
ATOM 9435  O O    . LEU A 1 65 ? 3.951   -9.623  -8.381  1.00 0.00 ? 149 LEU A O    8  
ATOM 9436  C CB   . LEU A 1 65 ? 1.083   -10.726 -7.387  1.00 0.00 ? 149 LEU A CB   8  
ATOM 9437  C CG   . LEU A 1 65 ? 0.126   -10.467 -8.561  1.00 0.00 ? 149 LEU A CG   8  
ATOM 9438  C CD1  . LEU A 1 65 ? -0.409  -11.784 -9.102  1.00 0.00 ? 149 LEU A CD1  8  
ATOM 9439  C CD2  . LEU A 1 65 ? -1.034  -9.575  -8.136  1.00 0.00 ? 149 LEU A CD2  8  
ATOM 9440  H H    . LEU A 1 65 ? 0.311   -8.650  -6.059  1.00 0.00 ? 149 LEU A H    8  
ATOM 9441  H HA   . LEU A 1 65 ? 2.669   -9.911  -6.210  1.00 0.00 ? 149 LEU A HA   8  
ATOM 9442  H HB2  . LEU A 1 65 ? 1.711   -11.565 -7.645  1.00 0.00 ? 149 LEU A HB2  8  
ATOM 9443  H HB3  . LEU A 1 65 ? 0.488   -11.003 -6.527  1.00 0.00 ? 149 LEU A HB3  8  
ATOM 9444  H HG   . LEU A 1 65 ? 0.661   -9.970  -9.357  1.00 0.00 ? 149 LEU A HG   8  
ATOM 9445  H HD11 . LEU A 1 65 ? -0.953  -12.300 -8.323  1.00 0.00 ? 149 LEU A HD11 8  
ATOM 9446  H HD12 . LEU A 1 65 ? 0.416   -12.400 -9.431  1.00 0.00 ? 149 LEU A HD12 8  
ATOM 9447  H HD13 . LEU A 1 65 ? -1.068  -11.592 -9.934  1.00 0.00 ? 149 LEU A HD13 8  
ATOM 9448  H HD21 . LEU A 1 65 ? -1.602  -10.067 -7.361  1.00 0.00 ? 149 LEU A HD21 8  
ATOM 9449  H HD22 . LEU A 1 65 ? -1.673  -9.387  -8.986  1.00 0.00 ? 149 LEU A HD22 8  
ATOM 9450  H HD23 . LEU A 1 65 ? -0.649  -8.638  -7.761  1.00 0.00 ? 149 LEU A HD23 8  
ATOM 9451  N N    . LYS A 1 66 ? 2.312   -8.218  -8.984  1.00 0.00 ? 150 LYS A N    8  
ATOM 9452  C CA   . LYS A 1 66 ? 3.061   -7.671  -10.102 1.00 0.00 ? 150 LYS A CA   8  
ATOM 9453  C C    . LYS A 1 66 ? 3.555   -6.268  -9.758  1.00 0.00 ? 150 LYS A C    8  
ATOM 9454  O O    . LYS A 1 66 ? 2.798   -5.445  -9.243  1.00 0.00 ? 150 LYS A O    8  
ATOM 9455  C CB   . LYS A 1 66 ? 2.201   -7.649  -11.372 1.00 0.00 ? 150 LYS A CB   8  
ATOM 9456  C CG   . LYS A 1 66 ? 0.893   -6.893  -11.219 1.00 0.00 ? 150 LYS A CG   8  
ATOM 9457  C CD   . LYS A 1 66 ? 0.039   -7.002  -12.466 1.00 0.00 ? 150 LYS A CD   8  
ATOM 9458  C CE   . LYS A 1 66 ? -1.314  -6.337  -12.278 1.00 0.00 ? 150 LYS A CE   8  
ATOM 9459  N NZ   . LYS A 1 66 ? -2.209  -6.580  -13.436 1.00 0.00 ? 150 LYS A NZ   8  
ATOM 9460  H H    . LYS A 1 66 ? 1.408   -7.893  -8.808  1.00 0.00 ? 150 LYS A H    8  
ATOM 9461  H HA   . LYS A 1 66 ? 3.919   -8.307  -10.268 1.00 0.00 ? 150 LYS A HA   8  
ATOM 9462  H HB2  . LYS A 1 66 ? 2.766   -7.187  -12.169 1.00 0.00 ? 150 LYS A HB2  8  
ATOM 9463  H HB3  . LYS A 1 66 ? 1.971   -8.665  -11.652 1.00 0.00 ? 150 LYS A HB3  8  
ATOM 9464  H HG2  . LYS A 1 66 ? 0.346   -7.301  -10.382 1.00 0.00 ? 150 LYS A HG2  8  
ATOM 9465  H HG3  . LYS A 1 66 ? 1.111   -5.851  -11.034 1.00 0.00 ? 150 LYS A HG3  8  
ATOM 9466  H HD2  . LYS A 1 66 ? 0.554   -6.521  -13.285 1.00 0.00 ? 150 LYS A HD2  8  
ATOM 9467  H HD3  . LYS A 1 66 ? -0.111  -8.046  -12.697 1.00 0.00 ? 150 LYS A HD3  8  
ATOM 9468  H HE2  . LYS A 1 66 ? -1.777  -6.735  -11.386 1.00 0.00 ? 150 LYS A HE2  8  
ATOM 9469  H HE3  . LYS A 1 66 ? -1.166  -5.273  -12.164 1.00 0.00 ? 150 LYS A HE3  8  
ATOM 9470  H HZ1  . LYS A 1 66 ? -2.288  -7.607  -13.614 1.00 0.00 ? 150 LYS A HZ1  8  
ATOM 9471  H HZ2  . LYS A 1 66 ? -1.828  -6.120  -14.291 1.00 0.00 ? 150 LYS A HZ2  8  
ATOM 9472  H HZ3  . LYS A 1 66 ? -3.161  -6.201  -13.245 1.00 0.00 ? 150 LYS A HZ3  8  
ATOM 9473  N N    . PRO A 1 67 ? 4.835   -5.976  -10.038 1.00 0.00 ? 151 PRO A N    8  
ATOM 9474  C CA   . PRO A 1 67 ? 5.441   -4.666  -9.739  1.00 0.00 ? 151 PRO A CA   8  
ATOM 9475  C C    . PRO A 1 67 ? 4.757   -3.522  -10.489 1.00 0.00 ? 151 PRO A C    8  
ATOM 9476  O O    . PRO A 1 67 ? 5.041   -2.346  -10.255 1.00 0.00 ? 151 PRO A O    8  
ATOM 9477  C CB   . PRO A 1 67 ? 6.891   -4.824  -10.213 1.00 0.00 ? 151 PRO A CB   8  
ATOM 9478  C CG   . PRO A 1 67 ? 7.125   -6.292  -10.273 1.00 0.00 ? 151 PRO A CG   8  
ATOM 9479  C CD   . PRO A 1 67 ? 5.805   -6.902  -10.643 1.00 0.00 ? 151 PRO A CD   8  
ATOM 9480  H HA   . PRO A 1 67 ? 5.426   -4.457  -8.679  1.00 0.00 ? 151 PRO A HA   8  
ATOM 9481  H HB2  . PRO A 1 67 ? 7.005   -4.365  -11.187 1.00 0.00 ? 151 PRO A HB2  8  
ATOM 9482  H HB3  . PRO A 1 67 ? 7.555   -4.348  -9.509  1.00 0.00 ? 151 PRO A HB3  8  
ATOM 9483  H HG2  . PRO A 1 67 ? 7.867   -6.518  -11.027 1.00 0.00 ? 151 PRO A HG2  8  
ATOM 9484  H HG3  . PRO A 1 67 ? 7.449   -6.653  -9.308  1.00 0.00 ? 151 PRO A HG3  8  
ATOM 9485  H HD2  . PRO A 1 67 ? 5.690   -6.933  -11.716 1.00 0.00 ? 151 PRO A HD2  8  
ATOM 9486  H HD3  . PRO A 1 67 ? 5.709   -7.891  -10.221 1.00 0.00 ? 151 PRO A HD3  8  
ATOM 9487  N N    . LEU A 1 68 ? 3.853   -3.879  -11.388 1.00 0.00 ? 152 LEU A N    8  
ATOM 9488  C CA   . LEU A 1 68 ? 3.124   -2.904  -12.179 1.00 0.00 ? 152 LEU A CA   8  
ATOM 9489  C C    . LEU A 1 68 ? 1.783   -2.569  -11.533 1.00 0.00 ? 152 LEU A C    8  
ATOM 9490  O O    . LEU A 1 68 ? 1.020   -1.756  -12.063 1.00 0.00 ? 152 LEU A O    8  
ATOM 9491  C CB   . LEU A 1 68 ? 2.910   -3.421  -13.605 1.00 0.00 ? 152 LEU A CB   8  
ATOM 9492  C CG   . LEU A 1 68 ? 4.186   -3.603  -14.428 1.00 0.00 ? 152 LEU A CG   8  
ATOM 9493  C CD1  . LEU A 1 68 ? 3.858   -4.165  -15.803 1.00 0.00 ? 152 LEU A CD1  8  
ATOM 9494  C CD2  . LEU A 1 68 ? 4.928   -2.282  -14.553 1.00 0.00 ? 152 LEU A CD2  8  
ATOM 9495  H H    . LEU A 1 68 ? 3.666   -4.830  -11.511 1.00 0.00 ? 152 LEU A H    8  
ATOM 9496  H HA   . LEU A 1 68 ? 3.720   -2.005  -12.219 1.00 0.00 ? 152 LEU A HA   8  
ATOM 9497  H HB2  . LEU A 1 68 ? 2.403   -4.372  -13.549 1.00 0.00 ? 152 LEU A HB2  8  
ATOM 9498  H HB3  . LEU A 1 68 ? 2.271   -2.723  -14.125 1.00 0.00 ? 152 LEU A HB3  8  
ATOM 9499  H HG   . LEU A 1 68 ? 4.833   -4.305  -13.925 1.00 0.00 ? 152 LEU A HG   8  
ATOM 9500  H HD11 . LEU A 1 68 ? 3.214   -3.476  -16.328 1.00 0.00 ? 152 LEU A HD11 8  
ATOM 9501  H HD12 . LEU A 1 68 ? 3.356   -5.115  -15.693 1.00 0.00 ? 152 LEU A HD12 8  
ATOM 9502  H HD13 . LEU A 1 68 ? 4.772   -4.301  -16.364 1.00 0.00 ? 152 LEU A HD13 8  
ATOM 9503  H HD21 . LEU A 1 68 ? 4.300   -1.562  -15.059 1.00 0.00 ? 152 LEU A HD21 8  
ATOM 9504  H HD22 . LEU A 1 68 ? 5.836   -2.429  -15.120 1.00 0.00 ? 152 LEU A HD22 8  
ATOM 9505  H HD23 . LEU A 1 68 ? 5.174   -1.913  -13.568 1.00 0.00 ? 152 LEU A HD23 8  
ATOM 9506  N N    . SER A 1 69 ? 1.488   -3.201  -10.400 1.00 0.00 ? 153 SER A N    8  
ATOM 9507  C CA   . SER A 1 69 ? 0.290   -2.872  -9.644  1.00 0.00 ? 153 SER A CA   8  
ATOM 9508  C C    . SER A 1 69 ? 0.382   -1.446  -9.111  1.00 0.00 ? 153 SER A C    8  
ATOM 9509  O O    . SER A 1 69 ? 1.128   -1.166  -8.172  1.00 0.00 ? 153 SER A O    8  
ATOM 9510  C CB   . SER A 1 69 ? 0.085   -3.853  -8.487  1.00 0.00 ? 153 SER A CB   8  
ATOM 9511  O OG   . SER A 1 69 ? -0.231  -5.151  -8.958  1.00 0.00 ? 153 SER A OG   8  
ATOM 9512  H H    . SER A 1 69 ? 2.092   -3.906  -10.063 1.00 0.00 ? 153 SER A H    8  
ATOM 9513  H HA   . SER A 1 69 ? -0.553  -2.937  -10.317 1.00 0.00 ? 153 SER A HA   8  
ATOM 9514  H HB2  . SER A 1 69 ? 0.992   -3.909  -7.901  1.00 0.00 ? 153 SER A HB2  8  
ATOM 9515  H HB3  . SER A 1 69 ? -0.726  -3.505  -7.862  1.00 0.00 ? 153 SER A HB3  8  
ATOM 9516  H HG   . SER A 1 69 ? -0.767  -5.610  -8.296  1.00 0.00 ? 153 SER A HG   8  
ATOM 9517  N N    . THR A 1 70 ? -0.360  -0.543  -9.736  1.00 0.00 ? 154 THR A N    8  
ATOM 9518  C CA   . THR A 1 70 ? -0.370  0.842   -9.320  1.00 0.00 ? 154 THR A CA   8  
ATOM 9519  C C    . THR A 1 70 ? -1.321  1.030   -8.149  1.00 0.00 ? 154 THR A C    8  
ATOM 9520  O O    . THR A 1 70 ? -2.540  1.065   -8.318  1.00 0.00 ? 154 THR A O    8  
ATOM 9521  C CB   . THR A 1 70 ? -0.781  1.767   -10.480 1.00 0.00 ? 154 THR A CB   8  
ATOM 9522  O OG1  . THR A 1 70 ? -0.026  1.431   -11.653 1.00 0.00 ? 154 THR A OG1  8  
ATOM 9523  C CG2  . THR A 1 70 ? -0.543  3.228   -10.123 1.00 0.00 ? 154 THR A CG2  8  
ATOM 9524  H H    . THR A 1 70 ? -0.918  -0.820  -10.492 1.00 0.00 ? 154 THR A H    8  
ATOM 9525  H HA   . THR A 1 70 ? 0.629   1.108   -9.010  1.00 0.00 ? 154 THR A HA   8  
ATOM 9526  H HB   . THR A 1 70 ? -1.832  1.624   -10.681 1.00 0.00 ? 154 THR A HB   8  
ATOM 9527  H HG1  . THR A 1 70 ? 0.652   0.788   -11.421 1.00 0.00 ? 154 THR A HG1  8  
ATOM 9528  H HG21 . THR A 1 70 ? -0.860  3.855   -10.944 1.00 0.00 ? 154 THR A HG21 8  
ATOM 9529  H HG22 . THR A 1 70 ? 0.509   3.385   -9.936  1.00 0.00 ? 154 THR A HG22 8  
ATOM 9530  H HG23 . THR A 1 70 ? -1.108  3.479   -9.238  1.00 0.00 ? 154 THR A HG23 8  
ATOM 9531  N N    . VAL A 1 71 ? -0.761  1.112   -6.957  1.00 0.00 ? 155 VAL A N    8  
ATOM 9532  C CA   . VAL A 1 71 ? -1.560  1.282   -5.763  1.00 0.00 ? 155 VAL A CA   8  
ATOM 9533  C C    . VAL A 1 71 ? -1.925  2.749   -5.583  1.00 0.00 ? 155 VAL A C    8  
ATOM 9534  O O    . VAL A 1 71 ? -1.079  3.575   -5.236  1.00 0.00 ? 155 VAL A O    8  
ATOM 9535  C CB   . VAL A 1 71 ? -0.820  0.767   -4.509  1.00 0.00 ? 155 VAL A CB   8  
ATOM 9536  C CG1  . VAL A 1 71 ? -1.700  0.898   -3.276  1.00 0.00 ? 155 VAL A CG1  8  
ATOM 9537  C CG2  . VAL A 1 71 ? -0.378  -0.678  -4.701  1.00 0.00 ? 155 VAL A CG2  8  
ATOM 9538  H H    . VAL A 1 71 ? 0.217   1.059   -6.882  1.00 0.00 ? 155 VAL A H    8  
ATOM 9539  H HA   . VAL A 1 71 ? -2.467  0.708   -5.883  1.00 0.00 ? 155 VAL A HA   8  
ATOM 9540  H HB   . VAL A 1 71 ? 0.062   1.374   -4.360  1.00 0.00 ? 155 VAL A HB   8  
ATOM 9541  H HG11 . VAL A 1 71 ? -1.941  1.937   -3.116  1.00 0.00 ? 155 VAL A HG11 8  
ATOM 9542  H HG12 . VAL A 1 71 ? -1.172  0.513   -2.414  1.00 0.00 ? 155 VAL A HG12 8  
ATOM 9543  H HG13 . VAL A 1 71 ? -2.610  0.335   -3.420  1.00 0.00 ? 155 VAL A HG13 8  
ATOM 9544  H HG21 . VAL A 1 71 ? -1.244  -1.301  -4.868  1.00 0.00 ? 155 VAL A HG21 8  
ATOM 9545  H HG22 . VAL A 1 71 ? 0.145   -1.016  -3.819  1.00 0.00 ? 155 VAL A HG22 8  
ATOM 9546  H HG23 . VAL A 1 71 ? 0.282   -0.741  -5.556  1.00 0.00 ? 155 VAL A HG23 8  
ATOM 9547  N N    . PHE A 1 72 ? -3.178  3.075   -5.848  1.00 0.00 ? 156 PHE A N    8  
ATOM 9548  C CA   . PHE A 1 72 ? -3.652  4.434   -5.685  1.00 0.00 ? 156 PHE A CA   8  
ATOM 9549  C C    . PHE A 1 72 ? -4.025  4.686   -4.234  1.00 0.00 ? 156 PHE A C    8  
ATOM 9550  O O    . PHE A 1 72 ? -5.064  4.229   -3.754  1.00 0.00 ? 156 PHE A O    8  
ATOM 9551  C CB   . PHE A 1 72 ? -4.848  4.709   -6.600  1.00 0.00 ? 156 PHE A CB   8  
ATOM 9552  C CG   . PHE A 1 72 ? -4.498  4.730   -8.059  1.00 0.00 ? 156 PHE A CG   8  
ATOM 9553  C CD1  . PHE A 1 72 ? -3.953  5.868   -8.636  1.00 0.00 ? 156 PHE A CD1  8  
ATOM 9554  C CD2  . PHE A 1 72 ? -4.716  3.619   -8.858  1.00 0.00 ? 156 PHE A CD2  8  
ATOM 9555  C CE1  . PHE A 1 72 ? -3.632  5.896   -9.978  1.00 0.00 ? 156 PHE A CE1  8  
ATOM 9556  C CE2  . PHE A 1 72 ? -4.397  3.642   -10.203 1.00 0.00 ? 156 PHE A CE2  8  
ATOM 9557  C CZ   . PHE A 1 72 ? -3.854  4.782   -10.764 1.00 0.00 ? 156 PHE A CZ   8  
ATOM 9558  H H    . PHE A 1 72 ? -3.803  2.382   -6.156  1.00 0.00 ? 156 PHE A H    8  
ATOM 9559  H HA   . PHE A 1 72 ? -2.843  5.098   -5.955  1.00 0.00 ? 156 PHE A HA   8  
ATOM 9560  H HB2  . PHE A 1 72 ? -5.589  3.939   -6.450  1.00 0.00 ? 156 PHE A HB2  8  
ATOM 9561  H HB3  . PHE A 1 72 ? -5.273  5.669   -6.345  1.00 0.00 ? 156 PHE A HB3  8  
ATOM 9562  H HD1  . PHE A 1 72 ? -3.781  6.741   -8.023  1.00 0.00 ? 156 PHE A HD1  8  
ATOM 9563  H HD2  . PHE A 1 72 ? -5.138  2.725   -8.422  1.00 0.00 ? 156 PHE A HD2  8  
ATOM 9564  H HE1  . PHE A 1 72 ? -3.205  6.787   -10.414 1.00 0.00 ? 156 PHE A HE1  8  
ATOM 9565  H HE2  . PHE A 1 72 ? -4.573  2.770   -10.815 1.00 0.00 ? 156 PHE A HE2  8  
ATOM 9566  H HZ   . PHE A 1 72 ? -3.604  4.802   -11.814 1.00 0.00 ? 156 PHE A HZ   8  
ATOM 9567  N N    . MET A 1 73 ? -3.152  5.385   -3.532  1.00 0.00 ? 157 MET A N    8  
ATOM 9568  C CA   . MET A 1 73 ? -3.405  5.752   -2.150  1.00 0.00 ? 157 MET A CA   8  
ATOM 9569  C C    . MET A 1 73 ? -4.352  6.944   -2.135  1.00 0.00 ? 157 MET A C    8  
ATOM 9570  O O    . MET A 1 73 ? -3.992  8.036   -2.566  1.00 0.00 ? 157 MET A O    8  
ATOM 9571  C CB   . MET A 1 73 ? -2.089  6.079   -1.437  1.00 0.00 ? 157 MET A CB   8  
ATOM 9572  C CG   . MET A 1 73 ? -2.153  5.964   0.079   1.00 0.00 ? 157 MET A CG   8  
ATOM 9573  S SD   . MET A 1 73 ? -3.227  7.189   0.844   1.00 0.00 ? 157 MET A SD   8  
ATOM 9574  C CE   . MET A 1 73 ? -2.359  8.697   0.432   1.00 0.00 ? 157 MET A CE   8  
ATOM 9575  H H    . MET A 1 73 ? -2.317  5.676   -3.962  1.00 0.00 ? 157 MET A H    8  
ATOM 9576  H HA   . MET A 1 73 ? -3.882  4.913   -1.663  1.00 0.00 ? 157 MET A HA   8  
ATOM 9577  H HB2  . MET A 1 73 ? -1.323  5.406   -1.793  1.00 0.00 ? 157 MET A HB2  8  
ATOM 9578  H HB3  . MET A 1 73 ? -1.804  7.090   -1.685  1.00 0.00 ? 157 MET A HB3  8  
ATOM 9579  H HG2  . MET A 1 73 ? -2.521  4.983   0.332   1.00 0.00 ? 157 MET A HG2  8  
ATOM 9580  H HG3  . MET A 1 73 ? -1.155  6.084   0.473   1.00 0.00 ? 157 MET A HG3  8  
ATOM 9581  H HE1  . MET A 1 73 ? -2.285  8.785   -0.641  1.00 0.00 ? 157 MET A HE1  8  
ATOM 9582  H HE2  . MET A 1 73 ? -1.368  8.673   0.861   1.00 0.00 ? 157 MET A HE2  8  
ATOM 9583  H HE3  . MET A 1 73 ? -2.900  9.544   0.827   1.00 0.00 ? 157 MET A HE3  8  
ATOM 9584  N N    . ASN A 1 74 ? -5.562  6.724   -1.655  1.00 0.00 ? 158 ASN A N    8  
ATOM 9585  C CA   . ASN A 1 74 ? -6.636  7.694   -1.798  1.00 0.00 ? 158 ASN A CA   8  
ATOM 9586  C C    . ASN A 1 74 ? -6.766  8.599   -0.577  1.00 0.00 ? 158 ASN A C    8  
ATOM 9587  O O    . ASN A 1 74 ? -7.117  8.143   0.510   1.00 0.00 ? 158 ASN A O    8  
ATOM 9588  C CB   . ASN A 1 74 ? -7.953  6.958   -2.045  1.00 0.00 ? 158 ASN A CB   8  
ATOM 9589  C CG   . ASN A 1 74 ? -8.520  7.222   -3.425  1.00 0.00 ? 158 ASN A CG   8  
ATOM 9590  O OD1  . ASN A 1 74 ? -9.238  8.197   -3.640  1.00 0.00 ? 158 ASN A OD1  8  
ATOM 9591  N ND2  . ASN A 1 74 ? -8.219  6.340   -4.365  1.00 0.00 ? 158 ASN A ND2  8  
ATOM 9592  H H    . ASN A 1 74 ? -5.744  5.886   -1.173  1.00 0.00 ? 158 ASN A H    8  
ATOM 9593  H HA   . ASN A 1 74 ? -6.418  8.305   -2.659  1.00 0.00 ? 158 ASN A HA   8  
ATOM 9594  H HB2  . ASN A 1 74 ? -7.782  5.896   -1.948  1.00 0.00 ? 158 ASN A HB2  8  
ATOM 9595  H HB3  . ASN A 1 74 ? -8.675  7.264   -1.308  1.00 0.00 ? 158 ASN A HB3  8  
ATOM 9596  H HD21 . ASN A 1 74 ? -7.656  5.573   -4.121  1.00 0.00 ? 158 ASN A HD21 8  
ATOM 9597  H HD22 . ASN A 1 74 ? -8.574  6.481   -5.267  1.00 0.00 ? 158 ASN A HD22 8  
ATOM 9598  N N    . LEU A 1 75 ? -6.473  9.882   -0.768  1.00 0.00 ? 159 LEU A N    8  
ATOM 9599  C CA   . LEU A 1 75 ? -6.661  10.886  0.278   1.00 0.00 ? 159 LEU A CA   8  
ATOM 9600  C C    . LEU A 1 75 ? -8.032  11.533  0.149   1.00 0.00 ? 159 LEU A C    8  
ATOM 9601  O O    . LEU A 1 75 ? -8.161  12.611  -0.436  1.00 0.00 ? 159 LEU A O    8  
ATOM 9602  C CB   . LEU A 1 75 ? -5.582  11.974  0.196   1.00 0.00 ? 159 LEU A CB   8  
ATOM 9603  C CG   . LEU A 1 75 ? -4.200  11.577  0.710   1.00 0.00 ? 159 LEU A CG   8  
ATOM 9604  C CD1  . LEU A 1 75 ? -3.169  12.632  0.345   1.00 0.00 ? 159 LEU A CD1  8  
ATOM 9605  C CD2  . LEU A 1 75 ? -4.232  11.386  2.218   1.00 0.00 ? 159 LEU A CD2  8  
ATOM 9606  H H    . LEU A 1 75 ? -6.123  10.162  -1.638  1.00 0.00 ? 159 LEU A H    8  
ATOM 9607  H HA   . LEU A 1 75 ? -6.594  10.390  1.234   1.00 0.00 ? 159 LEU A HA   8  
ATOM 9608  H HB2  . LEU A 1 75 ? -5.484  12.272  -0.839  1.00 0.00 ? 159 LEU A HB2  8  
ATOM 9609  H HB3  . LEU A 1 75 ? -5.923  12.826  0.765   1.00 0.00 ? 159 LEU A HB3  8  
ATOM 9610  H HG   . LEU A 1 75 ? -3.902  10.645  0.256   1.00 0.00 ? 159 LEU A HG   8  
ATOM 9611  H HD11 . LEU A 1 75 ? -2.188  12.297  0.653   1.00 0.00 ? 159 LEU A HD11 8  
ATOM 9612  H HD12 . LEU A 1 75 ? -3.407  13.559  0.846   1.00 0.00 ? 159 LEU A HD12 8  
ATOM 9613  H HD13 . LEU A 1 75 ? -3.176  12.787  -0.723  1.00 0.00 ? 159 LEU A HD13 8  
ATOM 9614  H HD21 . LEU A 1 75 ? -5.039  10.722  2.474   1.00 0.00 ? 159 LEU A HD21 8  
ATOM 9615  H HD22 . LEU A 1 75 ? -4.380  12.340  2.703   1.00 0.00 ? 159 LEU A HD22 8  
ATOM 9616  H HD23 . LEU A 1 75 ? -3.296  10.958  2.546   1.00 0.00 ? 159 LEU A HD23 8  
ATOM 9617  N N    . ARG A 1 76 ? -9.058  10.866  0.662   1.00 0.00 ? 160 ARG A N    8  
ATOM 9618  C CA   . ARG A 1 76 ? -10.427 11.365  0.564   1.00 0.00 ? 160 ARG A CA   8  
ATOM 9619  C C    . ARG A 1 76 ? -11.249 10.935  1.770   1.00 0.00 ? 160 ARG A C    8  
ATOM 9620  O O    . ARG A 1 76 ? -11.176 9.791   2.209   1.00 0.00 ? 160 ARG A O    8  
ATOM 9621  C CB   . ARG A 1 76 ? -11.111 10.864  -0.714  1.00 0.00 ? 160 ARG A CB   8  
ATOM 9622  C CG   . ARG A 1 76 ? -10.470 11.366  -1.994  1.00 0.00 ? 160 ARG A CG   8  
ATOM 9623  C CD   . ARG A 1 76 ? -11.179 10.841  -3.226  1.00 0.00 ? 160 ARG A CD   8  
ATOM 9624  N NE   . ARG A 1 76 ? -10.484 11.234  -4.449  1.00 0.00 ? 160 ARG A NE   8  
ATOM 9625  C CZ   . ARG A 1 76 ? -10.809 10.817  -5.670  1.00 0.00 ? 160 ARG A CZ   8  
ATOM 9626  N NH1  . ARG A 1 76 ? -11.855 10.019  -5.855  1.00 0.00 ? 160 ARG A NH1  8  
ATOM 9627  N NH2  . ARG A 1 76 ? -10.084 11.206  -6.710  1.00 0.00 ? 160 ARG A NH2  8  
ATOM 9628  H H    . ARG A 1 76 ? -8.893  10.019  1.134   1.00 0.00 ? 160 ARG A H    8  
ATOM 9629  H HA   . ARG A 1 76 ? -10.386 12.444  0.540   1.00 0.00 ? 160 ARG A HA   8  
ATOM 9630  H HB2  . ARG A 1 76 ? -11.081 9.786   -0.721  1.00 0.00 ? 160 ARG A HB2  8  
ATOM 9631  H HB3  . ARG A 1 76 ? -12.143 11.186  -0.703  1.00 0.00 ? 160 ARG A HB3  8  
ATOM 9632  H HG2  . ARG A 1 76 ? -10.509 12.444  -2.004  1.00 0.00 ? 160 ARG A HG2  8  
ATOM 9633  H HG3  . ARG A 1 76 ? -9.440  11.043  -2.018  1.00 0.00 ? 160 ARG A HG3  8  
ATOM 9634  H HD2  . ARG A 1 76 ? -11.221 9.763   -3.172  1.00 0.00 ? 160 ARG A HD2  8  
ATOM 9635  H HD3  . ARG A 1 76 ? -12.182 11.241  -3.248  1.00 0.00 ? 160 ARG A HD3  8  
ATOM 9636  H HE   . ARG A 1 76 ? -9.707  11.840  -4.349  1.00 0.00 ? 160 ARG A HE   8  
ATOM 9637  H HH11 . ARG A 1 76 ? -12.403 9.721   -5.076  1.00 0.00 ? 160 ARG A HH11 8  
ATOM 9638  H HH12 . ARG A 1 76 ? -12.097 9.714   -6.788  1.00 0.00 ? 160 ARG A HH12 8  
ATOM 9639  H HH21 . ARG A 1 76 ? -9.296  11.807  -6.572  1.00 0.00 ? 160 ARG A HH21 8  
ATOM 9640  H HH22 . ARG A 1 76 ? -10.319 10.897  -7.640  1.00 0.00 ? 160 ARG A HH22 8  
ATOM 9641  N N    . ASP A 1 2  ? 12.692  -14.345 -1.850  1.00 0.00 ? 86  ASP A N    9  
ATOM 9642  C CA   . ASP A 1 2  ? 12.114  -13.499 -0.812  1.00 0.00 ? 86  ASP A CA   9  
ATOM 9643  C C    . ASP A 1 2  ? 11.086  -12.595 -1.457  1.00 0.00 ? 86  ASP A C    9  
ATOM 9644  O O    . ASP A 1 2  ? 10.042  -12.293 -0.879  1.00 0.00 ? 86  ASP A O    9  
ATOM 9645  C CB   . ASP A 1 2  ? 13.193  -12.640 -0.141  1.00 0.00 ? 86  ASP A CB   9  
ATOM 9646  C CG   . ASP A 1 2  ? 14.265  -13.460 0.544   1.00 0.00 ? 86  ASP A CG   9  
ATOM 9647  O OD1  . ASP A 1 2  ? 15.256  -13.832 -0.118  1.00 0.00 ? 86  ASP A OD1  9  
ATOM 9648  O OD2  . ASP A 1 2  ? 14.127  -13.742 1.750   1.00 0.00 ? 86  ASP A OD2  9  
ATOM 9649  H H    . ASP A 1 2  ? 12.924  -13.936 -2.708  1.00 0.00 ? 86  ASP A H    9  
ATOM 9650  H HA   . ASP A 1 2  ? 11.636  -14.129 -0.077  1.00 0.00 ? 86  ASP A HA   9  
ATOM 9651  H HB2  . ASP A 1 2  ? 13.667  -12.023 -0.890  1.00 0.00 ? 86  ASP A HB2  9  
ATOM 9652  H HB3  . ASP A 1 2  ? 12.727  -12.004 0.596   1.00 0.00 ? 86  ASP A HB3  9  
ATOM 9653  N N    . GLU A 1 3  ? 11.418  -12.175 -2.672  1.00 0.00 ? 87  GLU A N    9  
ATOM 9654  C CA   . GLU A 1 3  ? 10.543  -11.372 -3.511  1.00 0.00 ? 87  GLU A CA   9  
ATOM 9655  C C    . GLU A 1 3  ? 10.233  -10.015 -2.890  1.00 0.00 ? 87  GLU A C    9  
ATOM 9656  O O    . GLU A 1 3  ? 9.175   -9.808  -2.290  1.00 0.00 ? 87  GLU A O    9  
ATOM 9657  C CB   . GLU A 1 3  ? 9.256   -12.135 -3.855  1.00 0.00 ? 87  GLU A CB   9  
ATOM 9658  C CG   . GLU A 1 3  ? 9.438   -13.177 -4.952  1.00 0.00 ? 87  GLU A CG   9  
ATOM 9659  C CD   . GLU A 1 3  ? 10.537  -14.180 -4.652  1.00 0.00 ? 87  GLU A CD   9  
ATOM 9660  O OE1  . GLU A 1 3  ? 10.257  -15.198 -3.992  1.00 0.00 ? 87  GLU A OE1  9  
ATOM 9661  O OE2  . GLU A 1 3  ? 11.693  -13.955 -5.078  1.00 0.00 ? 87  GLU A OE2  9  
ATOM 9662  H H    . GLU A 1 3  ? 12.297  -12.412 -3.022  1.00 0.00 ? 87  GLU A H    9  
ATOM 9663  H HA   . GLU A 1 3  ? 11.078  -11.192 -4.431  1.00 0.00 ? 87  GLU A HA   9  
ATOM 9664  H HB2  . GLU A 1 3  ? 8.900   -12.636 -2.966  1.00 0.00 ? 87  GLU A HB2  9  
ATOM 9665  H HB3  . GLU A 1 3  ? 8.510   -11.425 -4.181  1.00 0.00 ? 87  GLU A HB3  9  
ATOM 9666  H HG2  . GLU A 1 3  ? 8.509   -13.715 -5.075  1.00 0.00 ? 87  GLU A HG2  9  
ATOM 9667  H HG3  . GLU A 1 3  ? 9.678   -12.668 -5.874  1.00 0.00 ? 87  GLU A HG3  9  
ATOM 9668  N N    . PRO A 1 4  ? 11.185  -9.080  -2.999  1.00 0.00 ? 88  PRO A N    9  
ATOM 9669  C CA   . PRO A 1 4  ? 10.960  -7.696  -2.632  1.00 0.00 ? 88  PRO A CA   9  
ATOM 9670  C C    . PRO A 1 4  ? 10.257  -6.962  -3.765  1.00 0.00 ? 88  PRO A C    9  
ATOM 9671  O O    . PRO A 1 4  ? 10.896  -6.455  -4.690  1.00 0.00 ? 88  PRO A O    9  
ATOM 9672  C CB   . PRO A 1 4  ? 12.370  -7.152  -2.409  1.00 0.00 ? 88  PRO A CB   9  
ATOM 9673  C CG   . PRO A 1 4  ? 13.252  -7.986  -3.281  1.00 0.00 ? 88  PRO A CG   9  
ATOM 9674  C CD   . PRO A 1 4  ? 12.558  -9.307  -3.488  1.00 0.00 ? 88  PRO A CD   9  
ATOM 9675  H HA   . PRO A 1 4  ? 10.380  -7.610  -1.724  1.00 0.00 ? 88  PRO A HA   9  
ATOM 9676  H HB2  . PRO A 1 4  ? 12.404  -6.111  -2.695  1.00 0.00 ? 88  PRO A HB2  9  
ATOM 9677  H HB3  . PRO A 1 4  ? 12.637  -7.254  -1.369  1.00 0.00 ? 88  PRO A HB3  9  
ATOM 9678  H HG2  . PRO A 1 4  ? 13.393  -7.491  -4.230  1.00 0.00 ? 88  PRO A HG2  9  
ATOM 9679  H HG3  . PRO A 1 4  ? 14.206  -8.138  -2.795  1.00 0.00 ? 88  PRO A HG3  9  
ATOM 9680  H HD2  . PRO A 1 4  ? 12.549  -9.566  -4.534  1.00 0.00 ? 88  PRO A HD2  9  
ATOM 9681  H HD3  . PRO A 1 4  ? 13.046  -10.083 -2.915  1.00 0.00 ? 88  PRO A HD3  9  
ATOM 9682  N N    . LEU A 1 5  ? 8.939   -6.951  -3.705  1.00 0.00 ? 89  LEU A N    9  
ATOM 9683  C CA   . LEU A 1 5  ? 8.127   -6.416  -4.781  1.00 0.00 ? 89  LEU A CA   9  
ATOM 9684  C C    . LEU A 1 5  ? 8.162   -4.891  -4.763  1.00 0.00 ? 89  LEU A C    9  
ATOM 9685  O O    . LEU A 1 5  ? 7.697   -4.256  -3.816  1.00 0.00 ? 89  LEU A O    9  
ATOM 9686  C CB   . LEU A 1 5  ? 6.682   -6.915  -4.641  1.00 0.00 ? 89  LEU A CB   9  
ATOM 9687  C CG   . LEU A 1 5  ? 5.939   -7.194  -5.950  1.00 0.00 ? 89  LEU A CG   9  
ATOM 9688  C CD1  . LEU A 1 5  ? 6.007   -6.001  -6.886  1.00 0.00 ? 89  LEU A CD1  9  
ATOM 9689  C CD2  . LEU A 1 5  ? 6.489   -8.440  -6.625  1.00 0.00 ? 89  LEU A CD2  9  
ATOM 9690  H H    . LEU A 1 5  ? 8.495   -7.297  -2.902  1.00 0.00 ? 89  LEU A H    9  
ATOM 9691  H HA   . LEU A 1 5  ? 8.537   -6.765  -5.717  1.00 0.00 ? 89  LEU A HA   9  
ATOM 9692  H HB2  . LEU A 1 5  ? 6.697   -7.827  -4.063  1.00 0.00 ? 89  LEU A HB2  9  
ATOM 9693  H HB3  . LEU A 1 5  ? 6.123   -6.171  -4.091  1.00 0.00 ? 89  LEU A HB3  9  
ATOM 9694  H HG   . LEU A 1 5  ? 4.898   -7.374  -5.725  1.00 0.00 ? 89  LEU A HG   9  
ATOM 9695  H HD11 . LEU A 1 5  ? 7.038   -5.806  -7.146  1.00 0.00 ? 89  LEU A HD11 9  
ATOM 9696  H HD12 . LEU A 1 5  ? 5.590   -5.135  -6.396  1.00 0.00 ? 89  LEU A HD12 9  
ATOM 9697  H HD13 . LEU A 1 5  ? 5.444   -6.214  -7.783  1.00 0.00 ? 89  LEU A HD13 9  
ATOM 9698  H HD21 . LEU A 1 5  ? 5.907   -8.654  -7.510  1.00 0.00 ? 89  LEU A HD21 9  
ATOM 9699  H HD22 . LEU A 1 5  ? 6.427   -9.276  -5.942  1.00 0.00 ? 89  LEU A HD22 9  
ATOM 9700  H HD23 . LEU A 1 5  ? 7.520   -8.276  -6.902  1.00 0.00 ? 89  LEU A HD23 9  
ATOM 9701  N N    . SER A 1 6  ? 8.733   -4.312  -5.802  1.00 0.00 ? 90  SER A N    9  
ATOM 9702  C CA   . SER A 1 6  ? 8.744   -2.873  -5.950  1.00 0.00 ? 90  SER A CA   9  
ATOM 9703  C C    . SER A 1 6  ? 7.416   -2.417  -6.552  1.00 0.00 ? 90  SER A C    9  
ATOM 9704  O O    . SER A 1 6  ? 7.215   -2.461  -7.768  1.00 0.00 ? 90  SER A O    9  
ATOM 9705  C CB   . SER A 1 6  ? 9.925   -2.453  -6.830  1.00 0.00 ? 90  SER A CB   9  
ATOM 9706  O OG   . SER A 1 6  ? 10.058  -1.045  -6.903  1.00 0.00 ? 90  SER A OG   9  
ATOM 9707  H H    . SER A 1 6  ? 9.162   -4.868  -6.491  1.00 0.00 ? 90  SER A H    9  
ATOM 9708  H HA   . SER A 1 6  ? 8.854   -2.436  -4.966  1.00 0.00 ? 90  SER A HA   9  
ATOM 9709  H HB2  . SER A 1 6  ? 10.835  -2.862  -6.420  1.00 0.00 ? 90  SER A HB2  9  
ATOM 9710  H HB3  . SER A 1 6  ? 9.778   -2.841  -7.829  1.00 0.00 ? 90  SER A HB3  9  
ATOM 9711  H HG   . SER A 1 6  ? 10.989  -0.805  -6.790  1.00 0.00 ? 90  SER A HG   9  
ATOM 9712  N N    . ILE A 1 7  ? 6.496   -2.022  -5.683  1.00 0.00 ? 91  ILE A N    9  
ATOM 9713  C CA   . ILE A 1 7  ? 5.170   -1.612  -6.105  1.00 0.00 ? 91  ILE A CA   9  
ATOM 9714  C C    . ILE A 1 7  ? 5.106   -0.101  -6.260  1.00 0.00 ? 91  ILE A C    9  
ATOM 9715  O O    . ILE A 1 7  ? 5.863   0.632   -5.622  1.00 0.00 ? 91  ILE A O    9  
ATOM 9716  C CB   . ILE A 1 7  ? 4.079   -2.062  -5.104  1.00 0.00 ? 91  ILE A CB   9  
ATOM 9717  C CG1  . ILE A 1 7  ? 4.327   -1.445  -3.720  1.00 0.00 ? 91  ILE A CG1  9  
ATOM 9718  C CG2  . ILE A 1 7  ? 4.033   -3.582  -5.016  1.00 0.00 ? 91  ILE A CG2  9  
ATOM 9719  C CD1  . ILE A 1 7  ? 3.215   -1.710  -2.726  1.00 0.00 ? 91  ILE A CD1  9  
ATOM 9720  H H    . ILE A 1 7  ? 6.726   -1.989  -4.727  1.00 0.00 ? 91  ILE A H    9  
ATOM 9721  H HA   . ILE A 1 7  ? 4.964   -2.072  -7.060  1.00 0.00 ? 91  ILE A HA   9  
ATOM 9722  H HB   . ILE A 1 7  ? 3.124   -1.722  -5.474  1.00 0.00 ? 91  ILE A HB   9  
ATOM 9723  H HG12 . ILE A 1 7  ? 5.241   -1.851  -3.312  1.00 0.00 ? 91  ILE A HG12 9  
ATOM 9724  H HG13 . ILE A 1 7  ? 4.431   -0.375  -3.826  1.00 0.00 ? 91  ILE A HG13 9  
ATOM 9725  H HG21 . ILE A 1 7  ? 3.283   -3.879  -4.297  1.00 0.00 ? 91  ILE A HG21 9  
ATOM 9726  H HG22 . ILE A 1 7  ? 4.997   -3.956  -4.703  1.00 0.00 ? 91  ILE A HG22 9  
ATOM 9727  H HG23 . ILE A 1 7  ? 3.786   -3.992  -5.983  1.00 0.00 ? 91  ILE A HG23 9  
ATOM 9728  H HD11 . ILE A 1 7  ? 3.467   -1.262  -1.777  1.00 0.00 ? 91  ILE A HD11 9  
ATOM 9729  H HD12 . ILE A 1 7  ? 3.087   -2.776  -2.601  1.00 0.00 ? 91  ILE A HD12 9  
ATOM 9730  H HD13 . ILE A 1 7  ? 2.295   -1.280  -3.093  1.00 0.00 ? 91  ILE A HD13 9  
ATOM 9731  N N    . LEU A 1 8  ? 4.198   0.364   -7.100  1.00 0.00 ? 92  LEU A N    9  
ATOM 9732  C CA   . LEU A 1 8  ? 4.046   1.786   -7.325  1.00 0.00 ? 92  LEU A CA   9  
ATOM 9733  C C    . LEU A 1 8  ? 2.776   2.285   -6.652  1.00 0.00 ? 92  LEU A C    9  
ATOM 9734  O O    . LEU A 1 8  ? 1.670   1.893   -7.021  1.00 0.00 ? 92  LEU A O    9  
ATOM 9735  C CB   . LEU A 1 8  ? 4.012   2.093   -8.822  1.00 0.00 ? 92  LEU A CB   9  
ATOM 9736  C CG   . LEU A 1 8  ? 4.014   3.578   -9.182  1.00 0.00 ? 92  LEU A CG   9  
ATOM 9737  C CD1  . LEU A 1 8  ? 5.255   4.260   -8.632  1.00 0.00 ? 92  LEU A CD1  9  
ATOM 9738  C CD2  . LEU A 1 8  ? 3.936   3.755   -10.687 1.00 0.00 ? 92  LEU A CD2  9  
ATOM 9739  H H    . LEU A 1 8  ? 3.611   -0.264  -7.571  1.00 0.00 ? 92  LEU A H    9  
ATOM 9740  H HA   . LEU A 1 8  ? 4.896   2.284   -6.881  1.00 0.00 ? 92  LEU A HA   9  
ATOM 9741  H HB2  . LEU A 1 8  ? 4.875   1.630   -9.283  1.00 0.00 ? 92  LEU A HB2  9  
ATOM 9742  H HB3  . LEU A 1 8  ? 3.121   1.647   -9.240  1.00 0.00 ? 92  LEU A HB3  9  
ATOM 9743  H HG   . LEU A 1 8  ? 3.148   4.052   -8.741  1.00 0.00 ? 92  LEU A HG   9  
ATOM 9744  H HD11 . LEU A 1 8  ? 6.136   3.776   -9.026  1.00 0.00 ? 92  LEU A HD11 9  
ATOM 9745  H HD12 . LEU A 1 8  ? 5.254   4.188   -7.554  1.00 0.00 ? 92  LEU A HD12 9  
ATOM 9746  H HD13 . LEU A 1 8  ? 5.252   5.299   -8.924  1.00 0.00 ? 92  LEU A HD13 9  
ATOM 9747  H HD21 . LEU A 1 8  ? 4.798   3.292   -11.147 1.00 0.00 ? 92  LEU A HD21 9  
ATOM 9748  H HD22 . LEU A 1 8  ? 3.923   4.808   -10.925 1.00 0.00 ? 92  LEU A HD22 9  
ATOM 9749  H HD23 . LEU A 1 8  ? 3.037   3.288   -11.057 1.00 0.00 ? 92  LEU A HD23 9  
ATOM 9750  N N    . VAL A 1 9  ? 2.938   3.132   -5.651  1.00 0.00 ? 93  VAL A N    9  
ATOM 9751  C CA   . VAL A 1 9  ? 1.805   3.698   -4.942  1.00 0.00 ? 93  VAL A CA   9  
ATOM 9752  C C    . VAL A 1 9  ? 1.669   5.177   -5.279  1.00 0.00 ? 93  VAL A C    9  
ATOM 9753  O O    . VAL A 1 9  ? 2.576   5.968   -5.035  1.00 0.00 ? 93  VAL A O    9  
ATOM 9754  C CB   . VAL A 1 9  ? 1.944   3.527   -3.412  1.00 0.00 ? 93  VAL A CB   9  
ATOM 9755  C CG1  . VAL A 1 9  ? 0.729   4.092   -2.687  1.00 0.00 ? 93  VAL A CG1  9  
ATOM 9756  C CG2  . VAL A 1 9  ? 2.149   2.065   -3.051  1.00 0.00 ? 93  VAL A CG2  9  
ATOM 9757  H H    . VAL A 1 9  ? 3.849   3.393   -5.384  1.00 0.00 ? 93  VAL A H    9  
ATOM 9758  H HA   . VAL A 1 9  ? 0.913   3.180   -5.265  1.00 0.00 ? 93  VAL A HA   9  
ATOM 9759  H HB   . VAL A 1 9  ? 2.814   4.078   -3.088  1.00 0.00 ? 93  VAL A HB   9  
ATOM 9760  H HG11 . VAL A 1 9  ? 0.631   5.143   -2.911  1.00 0.00 ? 93  VAL A HG11 9  
ATOM 9761  H HG12 . VAL A 1 9  ? 0.850   3.961   -1.623  1.00 0.00 ? 93  VAL A HG12 9  
ATOM 9762  H HG13 . VAL A 1 9  ? -0.159  3.570   -3.013  1.00 0.00 ? 93  VAL A HG13 9  
ATOM 9763  H HG21 . VAL A 1 9  ? 1.307   1.485   -3.399  1.00 0.00 ? 93  VAL A HG21 9  
ATOM 9764  H HG22 . VAL A 1 9  ? 2.232   1.971   -1.979  1.00 0.00 ? 93  VAL A HG22 9  
ATOM 9765  H HG23 . VAL A 1 9  ? 3.054   1.701   -3.517  1.00 0.00 ? 93  VAL A HG23 9  
ATOM 9766  N N    . ARG A 1 10 ? 0.543   5.543   -5.864  1.00 0.00 ? 94  ARG A N    9  
ATOM 9767  C CA   . ARG A 1 10 ? 0.303   6.925   -6.233  1.00 0.00 ? 94  ARG A CA   9  
ATOM 9768  C C    . ARG A 1 10 ? -0.377  7.664   -5.091  1.00 0.00 ? 94  ARG A C    9  
ATOM 9769  O O    . ARG A 1 10 ? -1.345  7.172   -4.508  1.00 0.00 ? 94  ARG A O    9  
ATOM 9770  C CB   . ARG A 1 10 ? -0.522  7.008   -7.519  1.00 0.00 ? 94  ARG A CB   9  
ATOM 9771  C CG   . ARG A 1 10 ? 0.273   6.604   -8.750  1.00 0.00 ? 94  ARG A CG   9  
ATOM 9772  C CD   . ARG A 1 10 ? -0.537  6.728   -10.028 1.00 0.00 ? 94  ARG A CD   9  
ATOM 9773  N NE   . ARG A 1 10 ? 0.302   6.540   -11.214 1.00 0.00 ? 94  ARG A NE   9  
ATOM 9774  C CZ   . ARG A 1 10 ? 0.014   5.707   -12.215 1.00 0.00 ? 94  ARG A CZ   9  
ATOM 9775  N NH1  . ARG A 1 10 ? -1.089  4.972   -12.182 1.00 0.00 ? 94  ARG A NH1  9  
ATOM 9776  N NH2  . ARG A 1 10 ? 0.831   5.610   -13.254 1.00 0.00 ? 94  ARG A NH2  9  
ATOM 9777  H H    . ARG A 1 10 ? -0.155  4.870   -6.029  1.00 0.00 ? 94  ARG A H    9  
ATOM 9778  H HA   . ARG A 1 10 ? 1.264   7.385   -6.409  1.00 0.00 ? 94  ARG A HA   9  
ATOM 9779  H HB2  . ARG A 1 10 ? -1.375  6.353   -7.433  1.00 0.00 ? 94  ARG A HB2  9  
ATOM 9780  H HB3  . ARG A 1 10 ? -0.865  8.024   -7.654  1.00 0.00 ? 94  ARG A HB3  9  
ATOM 9781  H HG2  . ARG A 1 10 ? 1.138   7.242   -8.828  1.00 0.00 ? 94  ARG A HG2  9  
ATOM 9782  H HG3  . ARG A 1 10 ? 0.593   5.578   -8.638  1.00 0.00 ? 94  ARG A HG3  9  
ATOM 9783  H HD2  . ARG A 1 10 ? -1.315  5.977   -10.023 1.00 0.00 ? 94  ARG A HD2  9  
ATOM 9784  H HD3  . ARG A 1 10 ? -0.983  7.710   -10.065 1.00 0.00 ? 94  ARG A HD3  9  
ATOM 9785  H HE   . ARG A 1 10 ? 1.134   7.074   -11.267 1.00 0.00 ? 94  ARG A HE   9  
ATOM 9786  H HH11 . ARG A 1 10 ? -1.716  5.036   -11.408 1.00 0.00 ? 94  ARG A HH11 9  
ATOM 9787  H HH12 . ARG A 1 10 ? -1.294  4.339   -12.944 1.00 0.00 ? 94  ARG A HH12 9  
ATOM 9788  H HH21 . ARG A 1 10 ? 1.673   6.169   -13.298 1.00 0.00 ? 94  ARG A HH21 9  
ATOM 9789  H HH22 . ARG A 1 10 ? 0.623   4.970   -14.000 1.00 0.00 ? 94  ARG A HH22 9  
ATOM 9790  N N    . ASN A 1 11 ? 0.144   8.847   -4.781  1.00 0.00 ? 95  ASN A N    9  
ATOM 9791  C CA   . ASN A 1 11 ? -0.321  9.646   -3.644  1.00 0.00 ? 95  ASN A CA   9  
ATOM 9792  C C    . ASN A 1 11 ? -1.778  10.056  -3.825  1.00 0.00 ? 95  ASN A C    9  
ATOM 9793  O O    . ASN A 1 11 ? -2.440  10.472  -2.878  1.00 0.00 ? 95  ASN A O    9  
ATOM 9794  C CB   . ASN A 1 11 ? 0.541   10.907  -3.477  1.00 0.00 ? 95  ASN A CB   9  
ATOM 9795  C CG   . ASN A 1 11 ? 2.028   10.623  -3.311  1.00 0.00 ? 95  ASN A CG   9  
ATOM 9796  O OD1  . ASN A 1 11 ? 2.576   9.687   -3.892  1.00 0.00 ? 95  ASN A OD1  9  
ATOM 9797  N ND2  . ASN A 1 11 ? 2.695   11.441  -2.517  1.00 0.00 ? 95  ASN A ND2  9  
ATOM 9798  H H    . ASN A 1 11 ? 0.882   9.195   -5.331  1.00 0.00 ? 95  ASN A H    9  
ATOM 9799  H HA   . ASN A 1 11 ? -0.237  9.042   -2.753  1.00 0.00 ? 95  ASN A HA   9  
ATOM 9800  H HB2  . ASN A 1 11 ? 0.416   11.529  -4.350  1.00 0.00 ? 95  ASN A HB2  9  
ATOM 9801  H HB3  . ASN A 1 11 ? 0.199   11.449  -2.608  1.00 0.00 ? 95  ASN A HB3  9  
ATOM 9802  H HD21 . ASN A 1 11 ? 2.204   12.175  -2.085  1.00 0.00 ? 95  ASN A HD21 9  
ATOM 9803  H HD22 . ASN A 1 11 ? 3.648   11.280  -2.383  1.00 0.00 ? 95  ASN A HD22 9  
ATOM 9804  N N    . ASN A 1 12 ? -2.251  9.962   -5.059  1.00 0.00 ? 96  ASN A N    9  
ATOM 9805  C CA   . ASN A 1 12 ? -3.637  10.258  -5.398  1.00 0.00 ? 96  ASN A CA   9  
ATOM 9806  C C    . ASN A 1 12 ? -3.905  9.802   -6.824  1.00 0.00 ? 96  ASN A C    9  
ATOM 9807  O O    . ASN A 1 12 ? -4.752  8.944   -7.071  1.00 0.00 ? 96  ASN A O    9  
ATOM 9808  C CB   . ASN A 1 12 ? -3.956  11.760  -5.235  1.00 0.00 ? 96  ASN A CB   9  
ATOM 9809  C CG   . ASN A 1 12 ? -2.908  12.682  -5.847  1.00 0.00 ? 96  ASN A CG   9  
ATOM 9810  O OD1  . ASN A 1 12 ? -2.951  13.004  -7.035  1.00 0.00 ? 96  ASN A OD1  9  
ATOM 9811  N ND2  . ASN A 1 12 ? -1.969  13.124  -5.028  1.00 0.00 ? 96  ASN A ND2  9  
ATOM 9812  H H    . ASN A 1 12 ? -1.650  9.659   -5.769  1.00 0.00 ? 96  ASN A H    9  
ATOM 9813  H HA   . ASN A 1 12 ? -4.266  9.690   -4.729  1.00 0.00 ? 96  ASN A HA   9  
ATOM 9814  H HB2  . ASN A 1 12 ? -4.902  11.970  -5.710  1.00 0.00 ? 96  ASN A HB2  9  
ATOM 9815  H HB3  . ASN A 1 12 ? -4.033  11.987  -4.181  1.00 0.00 ? 96  ASN A HB3  9  
ATOM 9816  H HD21 . ASN A 1 12 ? -2.005  12.839  -4.091  1.00 0.00 ? 96  ASN A HD21 9  
ATOM 9817  H HD22 . ASN A 1 12 ? -1.270  13.717  -5.391  1.00 0.00 ? 96  ASN A HD22 9  
ATOM 9818  N N    . LYS A 1 13 ? -3.149  10.368  -7.751  1.00 0.00 ? 97  LYS A N    9  
ATOM 9819  C CA   . LYS A 1 13 ? -3.231  10.014  -9.157  1.00 0.00 ? 97  LYS A CA   9  
ATOM 9820  C C    . LYS A 1 13 ? -2.064  10.633  -9.917  1.00 0.00 ? 97  LYS A C    9  
ATOM 9821  O O    . LYS A 1 13 ? -1.554  10.049  -10.873 1.00 0.00 ? 97  LYS A O    9  
ATOM 9822  C CB   . LYS A 1 13 ? -4.570  10.477  -9.740  1.00 0.00 ? 97  LYS A CB   9  
ATOM 9823  C CG   . LYS A 1 13 ? -4.834  11.970  -9.575  1.00 0.00 ? 97  LYS A CG   9  
ATOM 9824  C CD   . LYS A 1 13 ? -6.303  12.297  -9.757  1.00 0.00 ? 97  LYS A CD   9  
ATOM 9825  C CE   . LYS A 1 13 ? -6.821  11.782  -11.084 1.00 0.00 ? 97  LYS A CE   9  
ATOM 9826  N NZ   . LYS A 1 13 ? -8.290  11.943  -11.197 1.00 0.00 ? 97  LYS A NZ   9  
ATOM 9827  H H    . LYS A 1 13 ? -2.529  11.068  -7.481  1.00 0.00 ? 97  LYS A H    9  
ATOM 9828  H HA   . LYS A 1 13 ? -3.165  8.939   -9.232  1.00 0.00 ? 97  LYS A HA   9  
ATOM 9829  H HB2  . LYS A 1 13 ? -4.587  10.245  -10.795 1.00 0.00 ? 97  LYS A HB2  9  
ATOM 9830  H HB3  . LYS A 1 13 ? -5.366  9.939   -9.250  1.00 0.00 ? 97  LYS A HB3  9  
ATOM 9831  H HG2  . LYS A 1 13 ? -4.528  12.273  -8.584  1.00 0.00 ? 97  LYS A HG2  9  
ATOM 9832  H HG3  . LYS A 1 13 ? -4.260  12.512  -10.311 1.00 0.00 ? 97  LYS A HG3  9  
ATOM 9833  H HD2  . LYS A 1 13 ? -6.869  11.838  -8.959  1.00 0.00 ? 97  LYS A HD2  9  
ATOM 9834  H HD3  . LYS A 1 13 ? -6.432  13.369  -9.723  1.00 0.00 ? 97  LYS A HD3  9  
ATOM 9835  H HE2  . LYS A 1 13 ? -6.342  12.331  -11.879 1.00 0.00 ? 97  LYS A HE2  9  
ATOM 9836  H HE3  . LYS A 1 13 ? -6.571  10.733  -11.165 1.00 0.00 ? 97  LYS A HE3  9  
ATOM 9837  H HZ1  . LYS A 1 13 ? -8.551  12.947  -11.088 1.00 0.00 ? 97  LYS A HZ1  9  
ATOM 9838  H HZ2  . LYS A 1 13 ? -8.769  11.385  -10.454 1.00 0.00 ? 97  LYS A HZ2  9  
ATOM 9839  H HZ3  . LYS A 1 13 ? -8.620  11.607  -12.128 1.00 0.00 ? 97  LYS A HZ3  9  
ATOM 9840  N N    . GLY A 1 14 ? -1.636  11.814  -9.475  1.00 0.00 ? 98  GLY A N    9  
ATOM 9841  C CA   . GLY A 1 14 ? -0.507  12.478  -10.093 1.00 0.00 ? 98  GLY A CA   9  
ATOM 9842  C C    . GLY A 1 14 ? 0.826   11.895  -9.660  1.00 0.00 ? 98  GLY A C    9  
ATOM 9843  O O    . GLY A 1 14 ? 1.450   11.141  -10.404 1.00 0.00 ? 98  GLY A O    9  
ATOM 9844  H H    . GLY A 1 14 ? -2.109  12.249  -8.734  1.00 0.00 ? 98  GLY A H    9  
ATOM 9845  H HA2  . GLY A 1 14 ? -0.595  12.381  -11.166 1.00 0.00 ? 98  GLY A HA2  9  
ATOM 9846  H HA3  . GLY A 1 14 ? -0.533  13.525  -9.833  1.00 0.00 ? 98  GLY A HA3  9  
ATOM 9847  N N    . ARG A 1 15 ? 1.260   12.229  -8.448  1.00 0.00 ? 99  ARG A N    9  
ATOM 9848  C CA   . ARG A 1 15 ? 2.561   11.783  -7.964  1.00 0.00 ? 99  ARG A CA   9  
ATOM 9849  C C    . ARG A 1 15 ? 2.556   10.282  -7.707  1.00 0.00 ? 99  ARG A C    9  
ATOM 9850  O O    . ARG A 1 15 ? 1.622   9.746   -7.110  1.00 0.00 ? 99  ARG A O    9  
ATOM 9851  C CB   . ARG A 1 15 ? 2.955   12.526  -6.684  1.00 0.00 ? 99  ARG A CB   9  
ATOM 9852  C CG   . ARG A 1 15 ? 4.454   12.506  -6.432  1.00 0.00 ? 99  ARG A CG   9  
ATOM 9853  C CD   . ARG A 1 15 ? 4.829   13.186  -5.126  1.00 0.00 ? 99  ARG A CD   9  
ATOM 9854  N NE   . ARG A 1 15 ? 6.252   13.510  -5.086  1.00 0.00 ? 99  ARG A NE   9  
ATOM 9855  C CZ   . ARG A 1 15 ? 7.168   12.816  -4.413  1.00 0.00 ? 99  ARG A CZ   9  
ATOM 9856  N NH1  . ARG A 1 15 ? 6.811   11.766  -3.680  1.00 0.00 ? 99  ARG A NH1  9  
ATOM 9857  N NH2  . ARG A 1 15 ? 8.442   13.175  -4.479  1.00 0.00 ? 99  ARG A NH2  9  
ATOM 9858  H H    . ARG A 1 15 ? 0.697   12.784  -7.868  1.00 0.00 ? 99  ARG A H    9  
ATOM 9859  H HA   . ARG A 1 15 ? 3.290   12.000  -8.732  1.00 0.00 ? 99  ARG A HA   9  
ATOM 9860  H HB2  . ARG A 1 15 ? 2.634   13.551  -6.759  1.00 0.00 ? 99  ARG A HB2  9  
ATOM 9861  H HB3  . ARG A 1 15 ? 2.463   12.060  -5.844  1.00 0.00 ? 99  ARG A HB3  9  
ATOM 9862  H HG2  . ARG A 1 15 ? 4.786   11.480  -6.397  1.00 0.00 ? 99  ARG A HG2  9  
ATOM 9863  H HG3  . ARG A 1 15 ? 4.949   13.015  -7.248  1.00 0.00 ? 99  ARG A HG3  9  
ATOM 9864  H HD2  . ARG A 1 15 ? 4.255   14.095  -5.027  1.00 0.00 ? 99  ARG A HD2  9  
ATOM 9865  H HD3  . ARG A 1 15 ? 4.596   12.521  -4.308  1.00 0.00 ? 99  ARG A HD3  9  
ATOM 9866  H HE   . ARG A 1 15 ? 6.545   14.294  -5.604  1.00 0.00 ? 99  ARG A HE   9  
ATOM 9867  H HH11 . ARG A 1 15 ? 5.853   11.493  -3.631  1.00 0.00 ? 99  ARG A HH11 9  
ATOM 9868  H HH12 . ARG A 1 15 ? 7.507   11.240  -3.168  1.00 0.00 ? 99  ARG A HH12 9  
ATOM 9869  H HH21 . ARG A 1 15 ? 8.713   13.970  -5.036  1.00 0.00 ? 99  ARG A HH21 9  
ATOM 9870  H HH22 . ARG A 1 15 ? 9.146   12.657  -3.981  1.00 0.00 ? 99  ARG A HH22 9  
ATOM 9871  N N    . SER A 1 16 ? 3.598   9.614   -8.169  1.00 0.00 ? 100 SER A N    9  
ATOM 9872  C CA   . SER A 1 16 ? 3.726   8.181   -8.000  1.00 0.00 ? 100 SER A CA   9  
ATOM 9873  C C    . SER A 1 16 ? 4.973   7.865   -7.182  1.00 0.00 ? 100 SER A C    9  
ATOM 9874  O O    . SER A 1 16 ? 6.078   8.261   -7.556  1.00 0.00 ? 100 SER A O    9  
ATOM 9875  C CB   . SER A 1 16 ? 3.796   7.516   -9.375  1.00 0.00 ? 100 SER A CB   9  
ATOM 9876  O OG   . SER A 1 16 ? 2.729   7.952   -10.207 1.00 0.00 ? 100 SER A OG   9  
ATOM 9877  H H    . SER A 1 16 ? 4.312   10.099  -8.630  1.00 0.00 ? 100 SER A H    9  
ATOM 9878  H HA   . SER A 1 16 ? 2.852   7.822   -7.472  1.00 0.00 ? 100 SER A HA   9  
ATOM 9879  H HB2  . SER A 1 16 ? 4.733   7.770   -9.845  1.00 0.00 ? 100 SER A HB2  9  
ATOM 9880  H HB3  . SER A 1 16 ? 3.731   6.443   -9.257  1.00 0.00 ? 100 SER A HB3  9  
ATOM 9881  H HG   . SER A 1 16 ? 2.568   8.890   -10.056 1.00 0.00 ? 100 SER A HG   9  
ATOM 9882  N N    . SER A 1 17 ? 4.794   7.181   -6.061  1.00 0.00 ? 101 SER A N    9  
ATOM 9883  C CA   . SER A 1 17 ? 5.903   6.853   -5.180  1.00 0.00 ? 101 SER A CA   9  
ATOM 9884  C C    . SER A 1 17 ? 6.108   5.338   -5.143  1.00 0.00 ? 101 SER A C    9  
ATOM 9885  O O    . SER A 1 17 ? 5.176   4.575   -4.882  1.00 0.00 ? 101 SER A O    9  
ATOM 9886  C CB   . SER A 1 17 ? 5.626   7.401   -3.777  1.00 0.00 ? 101 SER A CB   9  
ATOM 9887  O OG   . SER A 1 17 ? 6.781   7.361   -2.959  1.00 0.00 ? 101 SER A OG   9  
ATOM 9888  H H    . SER A 1 17 ? 3.889   6.883   -5.816  1.00 0.00 ? 101 SER A H    9  
ATOM 9889  H HA   . SER A 1 17 ? 6.793   7.319   -5.574  1.00 0.00 ? 101 SER A HA   9  
ATOM 9890  H HB2  . SER A 1 17 ? 5.294   8.425   -3.854  1.00 0.00 ? 101 SER A HB2  9  
ATOM 9891  H HB3  . SER A 1 17 ? 4.850   6.809   -3.310  1.00 0.00 ? 101 SER A HB3  9  
ATOM 9892  H HG   . SER A 1 17 ? 6.519   7.154   -2.052  1.00 0.00 ? 101 SER A HG   9  
ATOM 9893  N N    . THR A 1 18 ? 7.326   4.904   -5.426  1.00 0.00 ? 102 THR A N    9  
ATOM 9894  C CA   . THR A 1 18 ? 7.632   3.483   -5.489  1.00 0.00 ? 102 THR A CA   9  
ATOM 9895  C C    . THR A 1 18 ? 8.077   2.957   -4.122  1.00 0.00 ? 102 THR A C    9  
ATOM 9896  O O    . THR A 1 18 ? 8.894   3.584   -3.444  1.00 0.00 ? 102 THR A O    9  
ATOM 9897  C CB   . THR A 1 18 ? 8.743   3.218   -6.521  1.00 0.00 ? 102 THR A CB   9  
ATOM 9898  O OG1  . THR A 1 18 ? 8.547   4.055   -7.669  1.00 0.00 ? 102 THR A OG1  9  
ATOM 9899  C CG2  . THR A 1 18 ? 8.741   1.763   -6.955  1.00 0.00 ? 102 THR A CG2  9  
ATOM 9900  H H    . THR A 1 18 ? 8.041   5.555   -5.594  1.00 0.00 ? 102 THR A H    9  
ATOM 9901  H HA   . THR A 1 18 ? 6.740   2.960   -5.803  1.00 0.00 ? 102 THR A HA   9  
ATOM 9902  H HB   . THR A 1 18 ? 9.698   3.447   -6.072  1.00 0.00 ? 102 THR A HB   9  
ATOM 9903  H HG1  . THR A 1 18 ? 8.752   4.975   -7.433  1.00 0.00 ? 102 THR A HG1  9  
ATOM 9904  H HG21 . THR A 1 18 ? 9.561   1.588   -7.634  1.00 0.00 ? 102 THR A HG21 9  
ATOM 9905  H HG22 . THR A 1 18 ? 7.809   1.535   -7.452  1.00 0.00 ? 102 THR A HG22 9  
ATOM 9906  H HG23 . THR A 1 18 ? 8.852   1.129   -6.088  1.00 0.00 ? 102 THR A HG23 9  
ATOM 9907  N N    . TYR A 1 19 ? 7.538   1.809   -3.724  1.00 0.00 ? 103 TYR A N    9  
ATOM 9908  C CA   . TYR A 1 19 ? 7.882   1.204   -2.442  1.00 0.00 ? 103 TYR A CA   9  
ATOM 9909  C C    . TYR A 1 19 ? 8.189   -0.275  -2.616  1.00 0.00 ? 103 TYR A C    9  
ATOM 9910  O O    . TYR A 1 19 ? 7.505   -0.973  -3.361  1.00 0.00 ? 103 TYR A O    9  
ATOM 9911  C CB   . TYR A 1 19 ? 6.739   1.374   -1.436  1.00 0.00 ? 103 TYR A CB   9  
ATOM 9912  C CG   . TYR A 1 19 ? 6.421   2.815   -1.117  1.00 0.00 ? 103 TYR A CG   9  
ATOM 9913  C CD1  . TYR A 1 19 ? 7.249   3.561   -0.291  1.00 0.00 ? 103 TYR A CD1  9  
ATOM 9914  C CD2  . TYR A 1 19 ? 5.297   3.432   -1.650  1.00 0.00 ? 103 TYR A CD2  9  
ATOM 9915  C CE1  . TYR A 1 19 ? 6.967   4.883   -0.004  1.00 0.00 ? 103 TYR A CE1  9  
ATOM 9916  C CE2  . TYR A 1 19 ? 5.008   4.753   -1.372  1.00 0.00 ? 103 TYR A CE2  9  
ATOM 9917  C CZ   . TYR A 1 19 ? 5.844   5.474   -0.547  1.00 0.00 ? 103 TYR A CZ   9  
ATOM 9918  O OH   . TYR A 1 19 ? 5.564   6.793   -0.275  1.00 0.00 ? 103 TYR A OH   9  
ATOM 9919  H H    . TYR A 1 19 ? 6.898   1.348   -4.315  1.00 0.00 ? 103 TYR A H    9  
ATOM 9920  H HA   . TYR A 1 19 ? 8.762   1.703   -2.063  1.00 0.00 ? 103 TYR A HA   9  
ATOM 9921  H HB2  . TYR A 1 19 ? 5.846   0.917   -1.835  1.00 0.00 ? 103 TYR A HB2  9  
ATOM 9922  H HB3  . TYR A 1 19 ? 7.009   0.881   -0.513  1.00 0.00 ? 103 TYR A HB3  9  
ATOM 9923  H HD1  . TYR A 1 19 ? 8.128   3.096   0.130   1.00 0.00 ? 103 TYR A HD1  9  
ATOM 9924  H HD2  . TYR A 1 19 ? 4.640   2.863   -2.293  1.00 0.00 ? 103 TYR A HD2  9  
ATOM 9925  H HE1  . TYR A 1 19 ? 7.625   5.449   0.644   1.00 0.00 ? 103 TYR A HE1  9  
ATOM 9926  H HE2  . TYR A 1 19 ? 4.128   5.215   -1.798  1.00 0.00 ? 103 TYR A HE2  9  
ATOM 9927  H HH   . TYR A 1 19 ? 4.633   6.882   -0.049  1.00 0.00 ? 103 TYR A HH   9  
ATOM 9928  N N    . GLU A 1 20 ? 9.212   -0.751  -1.924  1.00 0.00 ? 104 GLU A N    9  
ATOM 9929  C CA   . GLU A 1 20 ? 9.602   -2.152  -2.008  1.00 0.00 ? 104 GLU A CA   9  
ATOM 9930  C C    . GLU A 1 20 ? 9.060   -2.936  -0.819  1.00 0.00 ? 104 GLU A C    9  
ATOM 9931  O O    . GLU A 1 20 ? 9.536   -2.788  0.308   1.00 0.00 ? 104 GLU A O    9  
ATOM 9932  C CB   . GLU A 1 20 ? 11.120  -2.281  -2.083  1.00 0.00 ? 104 GLU A CB   9  
ATOM 9933  C CG   . GLU A 1 20 ? 11.706  -1.691  -3.351  1.00 0.00 ? 104 GLU A CG   9  
ATOM 9934  C CD   . GLU A 1 20 ? 13.217  -1.687  -3.347  1.00 0.00 ? 104 GLU A CD   9  
ATOM 9935  O OE1  . GLU A 1 20 ? 13.821  -2.759  -3.561  1.00 0.00 ? 104 GLU A OE1  9  
ATOM 9936  O OE2  . GLU A 1 20 ? 13.812  -0.609  -3.139  1.00 0.00 ? 104 GLU A OE2  9  
ATOM 9937  H H    . GLU A 1 20 ? 9.713   -0.149  -1.336  1.00 0.00 ? 104 GLU A H    9  
ATOM 9938  H HA   . GLU A 1 20 ? 9.172   -2.560  -2.912  1.00 0.00 ? 104 GLU A HA   9  
ATOM 9939  H HB2  . GLU A 1 20 ? 11.558  -1.772  -1.237  1.00 0.00 ? 104 GLU A HB2  9  
ATOM 9940  H HB3  . GLU A 1 20 ? 11.384  -3.327  -2.043  1.00 0.00 ? 104 GLU A HB3  9  
ATOM 9941  H HG2  . GLU A 1 20 ? 11.367  -2.274  -4.193  1.00 0.00 ? 104 GLU A HG2  9  
ATOM 9942  H HG3  . GLU A 1 20 ? 11.355  -0.674  -3.454  1.00 0.00 ? 104 GLU A HG3  9  
ATOM 9943  N N    . VAL A 1 21 ? 8.058   -3.758  -1.075  1.00 0.00 ? 105 VAL A N    9  
ATOM 9944  C CA   . VAL A 1 21 ? 7.424   -4.541  -0.027  1.00 0.00 ? 105 VAL A CA   9  
ATOM 9945  C C    . VAL A 1 21 ? 7.429   -6.018  -0.401  1.00 0.00 ? 105 VAL A C    9  
ATOM 9946  O O    . VAL A 1 21 ? 7.362   -6.366  -1.575  1.00 0.00 ? 105 VAL A O    9  
ATOM 9947  C CB   . VAL A 1 21 ? 5.970   -4.070  0.224   1.00 0.00 ? 105 VAL A CB   9  
ATOM 9948  C CG1  . VAL A 1 21 ? 5.942   -2.587  0.571   1.00 0.00 ? 105 VAL A CG1  9  
ATOM 9949  C CG2  . VAL A 1 21 ? 5.093   -4.351  -0.987  1.00 0.00 ? 105 VAL A CG2  9  
ATOM 9950  H H    . VAL A 1 21 ? 7.743   -3.854  -2.004  1.00 0.00 ? 105 VAL A H    9  
ATOM 9951  H HA   . VAL A 1 21 ? 7.990   -4.409  0.882   1.00 0.00 ? 105 VAL A HA   9  
ATOM 9952  H HB   . VAL A 1 21 ? 5.573   -4.623  1.065   1.00 0.00 ? 105 VAL A HB   9  
ATOM 9953  H HG11 . VAL A 1 21 ? 6.362   -2.020  -0.250  1.00 0.00 ? 105 VAL A HG11 9  
ATOM 9954  H HG12 . VAL A 1 21 ? 6.526   -2.412  1.463   1.00 0.00 ? 105 VAL A HG12 9  
ATOM 9955  H HG13 . VAL A 1 21 ? 4.921   -2.276  0.740   1.00 0.00 ? 105 VAL A HG13 9  
ATOM 9956  H HG21 . VAL A 1 21 ? 5.070   -5.414  -1.178  1.00 0.00 ? 105 VAL A HG21 9  
ATOM 9957  H HG22 . VAL A 1 21 ? 5.499   -3.841  -1.848  1.00 0.00 ? 105 VAL A HG22 9  
ATOM 9958  H HG23 . VAL A 1 21 ? 4.091   -3.997  -0.798  1.00 0.00 ? 105 VAL A HG23 9  
ATOM 9959  N N    . ARG A 1 22 ? 7.527   -6.887  0.584   1.00 0.00 ? 106 ARG A N    9  
ATOM 9960  C CA   . ARG A 1 22 ? 7.547   -8.312  0.310   1.00 0.00 ? 106 ARG A CA   9  
ATOM 9961  C C    . ARG A 1 22 ? 6.145   -8.893  0.406   1.00 0.00 ? 106 ARG A C    9  
ATOM 9962  O O    . ARG A 1 22 ? 5.272   -8.332  1.066   1.00 0.00 ? 106 ARG A O    9  
ATOM 9963  C CB   . ARG A 1 22 ? 8.510   -9.029  1.253   1.00 0.00 ? 106 ARG A CB   9  
ATOM 9964  C CG   . ARG A 1 22 ? 9.942   -8.573  1.060   1.00 0.00 ? 106 ARG A CG   9  
ATOM 9965  C CD   . ARG A 1 22 ? 10.913  -9.309  1.959   1.00 0.00 ? 106 ARG A CD   9  
ATOM 9966  N NE   . ARG A 1 22 ? 12.276  -8.815  1.773   1.00 0.00 ? 106 ARG A NE   9  
ATOM 9967  C CZ   . ARG A 1 22 ? 13.374  -9.469  2.147   1.00 0.00 ? 106 ARG A CZ   9  
ATOM 9968  N NH1  . ARG A 1 22 ? 13.283  -10.635 2.776   1.00 0.00 ? 106 ARG A NH1  9  
ATOM 9969  N NH2  . ARG A 1 22 ? 14.566  -8.947  1.896   1.00 0.00 ? 106 ARG A NH2  9  
ATOM 9970  H H    . ARG A 1 22 ? 7.583   -6.567  1.513   1.00 0.00 ? 106 ARG A H    9  
ATOM 9971  H HA   . ARG A 1 22 ? 7.898   -8.442  -0.704  1.00 0.00 ? 106 ARG A HA   9  
ATOM 9972  H HB2  . ARG A 1 22 ? 8.220   -8.829  2.276   1.00 0.00 ? 106 ARG A HB2  9  
ATOM 9973  H HB3  . ARG A 1 22 ? 8.464   -10.092 1.072   1.00 0.00 ? 106 ARG A HB3  9  
ATOM 9974  H HG2  . ARG A 1 22 ? 10.223  -8.743  0.032   1.00 0.00 ? 106 ARG A HG2  9  
ATOM 9975  H HG3  . ARG A 1 22 ? 9.999   -7.515  1.275   1.00 0.00 ? 106 ARG A HG3  9  
ATOM 9976  H HD2  . ARG A 1 22 ? 10.620  -9.162  2.989   1.00 0.00 ? 106 ARG A HD2  9  
ATOM 9977  H HD3  . ARG A 1 22 ? 10.882  -10.363 1.721   1.00 0.00 ? 106 ARG A HD3  9  
ATOM 9978  H HE   . ARG A 1 22 ? 12.373  -7.936  1.328   1.00 0.00 ? 106 ARG A HE   9  
ATOM 9979  H HH11 . ARG A 1 22 ? 12.386  -11.034 2.972   1.00 0.00 ? 106 ARG A HH11 9  
ATOM 9980  H HH12 . ARG A 1 22 ? 14.116  -11.121 3.065   1.00 0.00 ? 106 ARG A HH12 9  
ATOM 9981  H HH21 . ARG A 1 22 ? 14.640  -8.058  1.422   1.00 0.00 ? 106 ARG A HH21 9  
ATOM 9982  H HH22 . ARG A 1 22 ? 15.402  -9.433  2.164   1.00 0.00 ? 106 ARG A HH22 9  
ATOM 9983  N N    . LEU A 1 23 ? 5.937   -10.019 -0.261  1.00 0.00 ? 107 LEU A N    9  
ATOM 9984  C CA   . LEU A 1 23 ? 4.619   -10.644 -0.349  1.00 0.00 ? 107 LEU A CA   9  
ATOM 9985  C C    . LEU A 1 23 ? 4.126   -11.134 1.011   1.00 0.00 ? 107 LEU A C    9  
ATOM 9986  O O    . LEU A 1 23 ? 2.947   -11.443 1.175   1.00 0.00 ? 107 LEU A O    9  
ATOM 9987  C CB   . LEU A 1 23 ? 4.640   -11.814 -1.346  1.00 0.00 ? 107 LEU A CB   9  
ATOM 9988  C CG   . LEU A 1 23 ? 4.670   -11.427 -2.834  1.00 0.00 ? 107 LEU A CG   9  
ATOM 9989  C CD1  . LEU A 1 23 ? 5.983   -10.758 -3.220  1.00 0.00 ? 107 LEU A CD1  9  
ATOM 9990  C CD2  . LEU A 1 23 ? 4.422   -12.648 -3.705  1.00 0.00 ? 107 LEU A CD2  9  
ATOM 9991  H H    . LEU A 1 23 ? 6.694   -10.440 -0.727  1.00 0.00 ? 107 LEU A H    9  
ATOM 9992  H HA   . LEU A 1 23 ? 3.930   -9.898  -0.713  1.00 0.00 ? 107 LEU A HA   9  
ATOM 9993  H HB2  . LEU A 1 23 ? 5.512   -12.418 -1.136  1.00 0.00 ? 107 LEU A HB2  9  
ATOM 9994  H HB3  . LEU A 1 23 ? 3.761   -12.416 -1.174  1.00 0.00 ? 107 LEU A HB3  9  
ATOM 9995  H HG   . LEU A 1 23 ? 3.876   -10.722 -3.024  1.00 0.00 ? 107 LEU A HG   9  
ATOM 9996  H HD11 . LEU A 1 23 ? 6.123   -9.869  -2.624  1.00 0.00 ? 107 LEU A HD11 9  
ATOM 9997  H HD12 . LEU A 1 23 ? 5.954   -10.488 -4.266  1.00 0.00 ? 107 LEU A HD12 9  
ATOM 9998  H HD13 . LEU A 1 23 ? 6.802   -11.440 -3.048  1.00 0.00 ? 107 LEU A HD13 9  
ATOM 9999  H HD21 . LEU A 1 23 ? 3.458   -13.072 -3.466  1.00 0.00 ? 107 LEU A HD21 9  
ATOM 10000 H HD22 . LEU A 1 23 ? 5.193   -13.383 -3.527  1.00 0.00 ? 107 LEU A HD22 9  
ATOM 10001 H HD23 . LEU A 1 23 ? 4.438   -12.355 -4.744  1.00 0.00 ? 107 LEU A HD23 9  
ATOM 10002 N N    . THR A 1 24 ? 5.026   -11.187 1.981   1.00 0.00 ? 108 THR A N    9  
ATOM 10003 C CA   . THR A 1 24 ? 4.689   -11.662 3.314   1.00 0.00 ? 108 THR A CA   9  
ATOM 10004 C C    . THR A 1 24 ? 4.187   -10.521 4.202   1.00 0.00 ? 108 THR A C    9  
ATOM 10005 O O    . THR A 1 24 ? 3.913   -10.717 5.388   1.00 0.00 ? 108 THR A O    9  
ATOM 10006 C CB   . THR A 1 24 ? 5.909   -12.344 3.978   1.00 0.00 ? 108 THR A CB   9  
ATOM 10007 O OG1  . THR A 1 24 ? 5.558   -12.855 5.269   1.00 0.00 ? 108 THR A OG1  9  
ATOM 10008 C CG2  . THR A 1 24 ? 7.077   -11.373 4.115   1.00 0.00 ? 108 THR A CG2  9  
ATOM 10009 H H    . THR A 1 24 ? 5.941   -10.896 1.799   1.00 0.00 ? 108 THR A H    9  
ATOM 10010 H HA   . THR A 1 24 ? 3.904   -12.398 3.215   1.00 0.00 ? 108 THR A HA   9  
ATOM 10011 H HB   . THR A 1 24 ? 6.222   -13.168 3.352   1.00 0.00 ? 108 THR A HB   9  
ATOM 10012 H HG1  . THR A 1 24 ? 4.954   -12.234 5.708   1.00 0.00 ? 108 THR A HG1  9  
ATOM 10013 H HG21 . THR A 1 24 ? 7.909   -11.874 4.585   1.00 0.00 ? 108 THR A HG21 9  
ATOM 10014 H HG22 . THR A 1 24 ? 6.776   -10.532 4.723   1.00 0.00 ? 108 THR A HG22 9  
ATOM 10015 H HG23 . THR A 1 24 ? 7.371   -11.023 3.137   1.00 0.00 ? 108 THR A HG23 9  
ATOM 10016 N N    . GLN A 1 25 ? 4.061   -9.331  3.633   1.00 0.00 ? 109 GLN A N    9  
ATOM 10017 C CA   . GLN A 1 25 ? 3.589   -8.184  4.392   1.00 0.00 ? 109 GLN A CA   9  
ATOM 10018 C C    . GLN A 1 25 ? 2.084   -8.020  4.253   1.00 0.00 ? 109 GLN A C    9  
ATOM 10019 O O    . GLN A 1 25 ? 1.500   -8.345  3.216   1.00 0.00 ? 109 GLN A O    9  
ATOM 10020 C CB   . GLN A 1 25 ? 4.283   -6.900  3.939   1.00 0.00 ? 109 GLN A CB   9  
ATOM 10021 C CG   . GLN A 1 25 ? 5.790   -6.926  4.106   1.00 0.00 ? 109 GLN A CG   9  
ATOM 10022 C CD   . GLN A 1 25 ? 6.455   -5.633  3.673   1.00 0.00 ? 109 GLN A CD   9  
ATOM 10023 O OE1  . GLN A 1 25 ? 7.587   -5.640  3.197   1.00 0.00 ? 109 GLN A OE1  9  
ATOM 10024 N NE2  . GLN A 1 25 ? 5.760   -4.512  3.835   1.00 0.00 ? 109 GLN A NE2  9  
ATOM 10025 H H    . GLN A 1 25 ? 4.285   -9.223  2.684   1.00 0.00 ? 109 GLN A H    9  
ATOM 10026 H HA   . GLN A 1 25 ? 3.824   -8.359  5.432   1.00 0.00 ? 109 GLN A HA   9  
ATOM 10027 H HB2  . GLN A 1 25 ? 4.060   -6.734  2.897   1.00 0.00 ? 109 GLN A HB2  9  
ATOM 10028 H HB3  . GLN A 1 25 ? 3.892   -6.075  4.515   1.00 0.00 ? 109 GLN A HB3  9  
ATOM 10029 H HG2  . GLN A 1 25 ? 6.023   -7.097  5.147   1.00 0.00 ? 109 GLN A HG2  9  
ATOM 10030 H HG3  . GLN A 1 25 ? 6.189   -7.734  3.513   1.00 0.00 ? 109 GLN A HG3  9  
ATOM 10031 H HE21 . GLN A 1 25 ? 4.863   -4.573  4.219   1.00 0.00 ? 109 GLN A HE21 9  
ATOM 10032 H HE22 . GLN A 1 25 ? 6.180   -3.662  3.569   1.00 0.00 ? 109 GLN A HE22 9  
ATOM 10033 N N    . THR A 1 26 ? 1.466   -7.510  5.303   1.00 0.00 ? 110 THR A N    9  
ATOM 10034 C CA   . THR A 1 26 ? 0.045   -7.216  5.298   1.00 0.00 ? 110 THR A CA   9  
ATOM 10035 C C    . THR A 1 26 ? -0.199  -5.832  4.703   1.00 0.00 ? 110 THR A C    9  
ATOM 10036 O O    . THR A 1 26 ? 0.715   -5.001  4.653   1.00 0.00 ? 110 THR A O    9  
ATOM 10037 C CB   . THR A 1 26 ? -0.514  -7.253  6.729   1.00 0.00 ? 110 THR A CB   9  
ATOM 10038 O OG1  . THR A 1 26 ? 0.237   -6.351  7.557   1.00 0.00 ? 110 THR A OG1  9  
ATOM 10039 C CG2  . THR A 1 26 ? -0.451  -8.663  7.306   1.00 0.00 ? 110 THR A CG2  9  
ATOM 10040 H H    . THR A 1 26 ? 1.980   -7.323  6.114   1.00 0.00 ? 110 THR A H    9  
ATOM 10041 H HA   . THR A 1 26 ? -0.464  -7.960  4.707   1.00 0.00 ? 110 THR A HA   9  
ATOM 10042 H HB   . THR A 1 26 ? -1.547  -6.936  6.707   1.00 0.00 ? 110 THR A HB   9  
ATOM 10043 H HG1  . THR A 1 26 ? 0.543   -6.818  8.348   1.00 0.00 ? 110 THR A HG1  9  
ATOM 10044 H HG21 . THR A 1 26 ? -1.039  -9.331  6.694   1.00 0.00 ? 110 THR A HG21 9  
ATOM 10045 H HG22 . THR A 1 26 ? -0.844  -8.659  8.313   1.00 0.00 ? 110 THR A HG22 9  
ATOM 10046 H HG23 . THR A 1 26 ? 0.576   -9.000  7.324   1.00 0.00 ? 110 THR A HG23 9  
ATOM 10047 N N    . VAL A 1 27 ? -1.426  -5.579  4.252   1.00 0.00 ? 111 VAL A N    9  
ATOM 10048 C CA   . VAL A 1 27 ? -1.790  -4.259  3.746   1.00 0.00 ? 111 VAL A CA   9  
ATOM 10049 C C    . VAL A 1 27 ? -1.655  -3.219  4.861   1.00 0.00 ? 111 VAL A C    9  
ATOM 10050 O O    . VAL A 1 27 ? -1.277  -2.071  4.621   1.00 0.00 ? 111 VAL A O    9  
ATOM 10051 C CB   . VAL A 1 27 ? -3.232  -4.241  3.187   1.00 0.00 ? 111 VAL A CB   9  
ATOM 10052 C CG1  . VAL A 1 27 ? -3.579  -2.874  2.620   1.00 0.00 ? 111 VAL A CG1  9  
ATOM 10053 C CG2  . VAL A 1 27 ? -3.410  -5.318  2.127   1.00 0.00 ? 111 VAL A CG2  9  
ATOM 10054 H H    . VAL A 1 27 ? -2.095  -6.297  4.249   1.00 0.00 ? 111 VAL A H    9  
ATOM 10055 H HA   . VAL A 1 27 ? -1.108  -4.006  2.946   1.00 0.00 ? 111 VAL A HA   9  
ATOM 10056 H HB   . VAL A 1 27 ? -3.912  -4.450  3.999   1.00 0.00 ? 111 VAL A HB   9  
ATOM 10057 H HG11 . VAL A 1 27 ? -4.591  -2.891  2.238   1.00 0.00 ? 111 VAL A HG11 9  
ATOM 10058 H HG12 . VAL A 1 27 ? -2.895  -2.634  1.819   1.00 0.00 ? 111 VAL A HG12 9  
ATOM 10059 H HG13 . VAL A 1 27 ? -3.499  -2.130  3.399   1.00 0.00 ? 111 VAL A HG13 9  
ATOM 10060 H HG21 . VAL A 1 27 ? -2.715  -5.145  1.318   1.00 0.00 ? 111 VAL A HG21 9  
ATOM 10061 H HG22 . VAL A 1 27 ? -4.419  -5.283  1.746   1.00 0.00 ? 111 VAL A HG22 9  
ATOM 10062 H HG23 . VAL A 1 27 ? -3.222  -6.289  2.561   1.00 0.00 ? 111 VAL A HG23 9  
ATOM 10063 N N    . ALA A 1 28 ? -1.930  -3.648  6.092   1.00 0.00 ? 112 ALA A N    9  
ATOM 10064 C CA   . ALA A 1 28 ? -1.808  -2.783  7.257   1.00 0.00 ? 112 ALA A CA   9  
ATOM 10065 C C    . ALA A 1 28 ? -0.360  -2.367  7.473   1.00 0.00 ? 112 ALA A C    9  
ATOM 10066 O O    . ALA A 1 28 ? -0.084  -1.253  7.917   1.00 0.00 ? 112 ALA A O    9  
ATOM 10067 C CB   . ALA A 1 28 ? -2.334  -3.485  8.496   1.00 0.00 ? 112 ALA A CB   9  
ATOM 10068 H H    . ALA A 1 28 ? -2.220  -4.576  6.217   1.00 0.00 ? 112 ALA A H    9  
ATOM 10069 H HA   . ALA A 1 28 ? -2.407  -1.900  7.084   1.00 0.00 ? 112 ALA A HA   9  
ATOM 10070 H HB1  . ALA A 1 28 ? -3.385  -3.701  8.371   1.00 0.00 ? 112 ALA A HB1  9  
ATOM 10071 H HB2  . ALA A 1 28 ? -2.199  -2.847  9.358   1.00 0.00 ? 112 ALA A HB2  9  
ATOM 10072 H HB3  . ALA A 1 28 ? -1.793  -4.409  8.642   1.00 0.00 ? 112 ALA A HB3  9  
ATOM 10073 N N    . HIS A 1 29 ? 0.565   -3.266  7.153   1.00 0.00 ? 113 HIS A N    9  
ATOM 10074 C CA   . HIS A 1 29 ? 1.982   -2.986  7.322   1.00 0.00 ? 113 HIS A CA   9  
ATOM 10075 C C    . HIS A 1 29 ? 2.419   -1.904  6.342   1.00 0.00 ? 113 HIS A C    9  
ATOM 10076 O O    . HIS A 1 29 ? 3.169   -0.999  6.701   1.00 0.00 ? 113 HIS A O    9  
ATOM 10077 C CB   . HIS A 1 29 ? 2.816   -4.254  7.129   1.00 0.00 ? 113 HIS A CB   9  
ATOM 10078 C CG   . HIS A 1 29 ? 3.949   -4.368  8.098   1.00 0.00 ? 113 HIS A CG   9  
ATOM 10079 N ND1  . HIS A 1 29 ? 3.860   -5.085  9.272   1.00 0.00 ? 113 HIS A ND1  9  
ATOM 10080 C CD2  . HIS A 1 29 ? 5.198   -3.852  8.069   1.00 0.00 ? 113 HIS A CD2  9  
ATOM 10081 C CE1  . HIS A 1 29 ? 5.003   -5.002  9.922   1.00 0.00 ? 113 HIS A CE1  9  
ATOM 10082 N NE2  . HIS A 1 29 ? 5.835   -4.261  9.214   1.00 0.00 ? 113 HIS A NE2  9  
ATOM 10083 H H    . HIS A 1 29 ? 0.285   -4.142  6.803   1.00 0.00 ? 113 HIS A H    9  
ATOM 10084 H HA   . HIS A 1 29 ? 2.127   -2.621  8.329   1.00 0.00 ? 113 HIS A HA   9  
ATOM 10085 H HB2  . HIS A 1 29 ? 2.181   -5.119  7.252   1.00 0.00 ? 113 HIS A HB2  9  
ATOM 10086 H HB3  . HIS A 1 29 ? 3.229   -4.257  6.132   1.00 0.00 ? 113 HIS A HB3  9  
ATOM 10087 H HD1  . HIS A 1 29 ? 3.067   -5.584  9.588   1.00 0.00 ? 113 HIS A HD1  9  
ATOM 10088 H HD2  . HIS A 1 29 ? 5.616   -3.232  7.289   1.00 0.00 ? 113 HIS A HD2  9  
ATOM 10089 H HE1  . HIS A 1 29 ? 5.221   -5.463  10.876  1.00 0.00 ? 113 HIS A HE1  9  
ATOM 10090 H HE2  . HIS A 1 29 ? 6.812   -4.221  9.364   1.00 0.00 ? 113 HIS A HE2  9  
ATOM 10091 N N    . LEU A 1 30 ? 1.932   -2.000  5.106   1.00 0.00 ? 114 LEU A N    9  
ATOM 10092 C CA   . LEU A 1 30 ? 2.164   -0.963  4.106   1.00 0.00 ? 114 LEU A CA   9  
ATOM 10093 C C    . LEU A 1 30 ? 1.547   0.349   4.561   1.00 0.00 ? 114 LEU A C    9  
ATOM 10094 O O    . LEU A 1 30 ? 2.174   1.407   4.479   1.00 0.00 ? 114 LEU A O    9  
ATOM 10095 C CB   . LEU A 1 30 ? 1.565   -1.368  2.757   1.00 0.00 ? 114 LEU A CB   9  
ATOM 10096 C CG   . LEU A 1 30 ? 1.692   -0.319  1.645   1.00 0.00 ? 114 LEU A CG   9  
ATOM 10097 C CD1  . LEU A 1 30 ? 3.150   -0.092  1.281   1.00 0.00 ? 114 LEU A CD1  9  
ATOM 10098 C CD2  . LEU A 1 30 ? 0.895   -0.738  0.419   1.00 0.00 ? 114 LEU A CD2  9  
ATOM 10099 H H    . LEU A 1 30 ? 1.403   -2.791  4.863   1.00 0.00 ? 114 LEU A H    9  
ATOM 10100 H HA   . LEU A 1 30 ? 3.230   -0.832  3.997   1.00 0.00 ? 114 LEU A HA   9  
ATOM 10101 H HB2  . LEU A 1 30 ? 2.055   -2.272  2.426   1.00 0.00 ? 114 LEU A HB2  9  
ATOM 10102 H HB3  . LEU A 1 30 ? 0.516   -1.577  2.903   1.00 0.00 ? 114 LEU A HB3  9  
ATOM 10103 H HG   . LEU A 1 30 ? 1.292   0.618   1.998   1.00 0.00 ? 114 LEU A HG   9  
ATOM 10104 H HD11 . LEU A 1 30 ? 3.581   -1.015  0.923   1.00 0.00 ? 114 LEU A HD11 9  
ATOM 10105 H HD12 . LEU A 1 30 ? 3.690   0.244   2.154   1.00 0.00 ? 114 LEU A HD12 9  
ATOM 10106 H HD13 . LEU A 1 30 ? 3.215   0.660   0.506   1.00 0.00 ? 114 LEU A HD13 9  
ATOM 10107 H HD21 . LEU A 1 30 ? 1.280   -1.675  0.042   1.00 0.00 ? 114 LEU A HD21 9  
ATOM 10108 H HD22 . LEU A 1 30 ? 0.982   0.021   -0.345  1.00 0.00 ? 114 LEU A HD22 9  
ATOM 10109 H HD23 . LEU A 1 30 ? -0.143  -0.859  0.690   1.00 0.00 ? 114 LEU A HD23 9  
ATOM 10110 N N    . LYS A 1 31 ? 0.311   0.264   5.046   1.00 0.00 ? 115 LYS A N    9  
ATOM 10111 C CA   . LYS A 1 31 ? -0.403  1.427   5.565   1.00 0.00 ? 115 LYS A CA   9  
ATOM 10112 C C    . LYS A 1 31 ? 0.405   2.123   6.656   1.00 0.00 ? 115 LYS A C    9  
ATOM 10113 O O    . LYS A 1 31 ? 0.420   3.345   6.731   1.00 0.00 ? 115 LYS A O    9  
ATOM 10114 C CB   . LYS A 1 31 ? -1.772  1.006   6.110   1.00 0.00 ? 115 LYS A CB   9  
ATOM 10115 C CG   . LYS A 1 31 ? -2.480  2.092   6.908   1.00 0.00 ? 115 LYS A CG   9  
ATOM 10116 C CD   . LYS A 1 31 ? -3.815  1.602   7.436   1.00 0.00 ? 115 LYS A CD   9  
ATOM 10117 C CE   . LYS A 1 31 ? -4.374  2.534   8.498   1.00 0.00 ? 115 LYS A CE   9  
ATOM 10118 N NZ   . LYS A 1 31 ? -5.672  2.045   9.033   1.00 0.00 ? 115 LYS A NZ   9  
ATOM 10119 H H    . LYS A 1 31 ? -0.137  -0.611  5.049   1.00 0.00 ? 115 LYS A H    9  
ATOM 10120 H HA   . LYS A 1 31 ? -0.548  2.118   4.746   1.00 0.00 ? 115 LYS A HA   9  
ATOM 10121 H HB2  . LYS A 1 31 ? -2.407  0.729   5.282   1.00 0.00 ? 115 LYS A HB2  9  
ATOM 10122 H HB3  . LYS A 1 31 ? -1.642  0.147   6.753   1.00 0.00 ? 115 LYS A HB3  9  
ATOM 10123 H HG2  . LYS A 1 31 ? -1.856  2.377   7.742   1.00 0.00 ? 115 LYS A HG2  9  
ATOM 10124 H HG3  . LYS A 1 31 ? -2.646  2.948   6.269   1.00 0.00 ? 115 LYS A HG3  9  
ATOM 10125 H HD2  . LYS A 1 31 ? -4.516  1.550   6.617   1.00 0.00 ? 115 LYS A HD2  9  
ATOM 10126 H HD3  . LYS A 1 31 ? -3.684  0.620   7.864   1.00 0.00 ? 115 LYS A HD3  9  
ATOM 10127 H HE2  . LYS A 1 31 ? -3.665  2.606   9.309   1.00 0.00 ? 115 LYS A HE2  9  
ATOM 10128 H HE3  . LYS A 1 31 ? -4.522  3.511   8.062   1.00 0.00 ? 115 LYS A HE3  9  
ATOM 10129 H HZ1  . LYS A 1 31 ? -5.589  1.046   9.325   1.00 0.00 ? 115 LYS A HZ1  9  
ATOM 10130 H HZ2  . LYS A 1 31 ? -6.413  2.122   8.304   1.00 0.00 ? 115 LYS A HZ2  9  
ATOM 10131 H HZ3  . LYS A 1 31 ? -5.956  2.612   9.861   1.00 0.00 ? 115 LYS A HZ3  9  
ATOM 10132 N N    . GLN A 1 32 ? 1.085   1.342   7.486   1.00 0.00 ? 116 GLN A N    9  
ATOM 10133 C CA   . GLN A 1 32 ? 1.901   1.892   8.562   1.00 0.00 ? 116 GLN A CA   9  
ATOM 10134 C C    . GLN A 1 32 ? 3.121   2.623   8.004   1.00 0.00 ? 116 GLN A C    9  
ATOM 10135 O O    . GLN A 1 32 ? 3.547   3.642   8.547   1.00 0.00 ? 116 GLN A O    9  
ATOM 10136 C CB   . GLN A 1 32 ? 2.333   0.785   9.527   1.00 0.00 ? 116 GLN A CB   9  
ATOM 10137 C CG   . GLN A 1 32 ? 3.074   1.305   10.747  1.00 0.00 ? 116 GLN A CG   9  
ATOM 10138 C CD   . GLN A 1 32 ? 3.422   0.219   11.742  1.00 0.00 ? 116 GLN A CD   9  
ATOM 10139 O OE1  . GLN A 1 32 ? 4.430   0.308   12.443  1.00 0.00 ? 116 GLN A OE1  9  
ATOM 10140 N NE2  . GLN A 1 32 ? 2.595   -0.811  11.815  1.00 0.00 ? 116 GLN A NE2  9  
ATOM 10141 H H    . GLN A 1 32 ? 1.028   0.367   7.379   1.00 0.00 ? 116 GLN A H    9  
ATOM 10142 H HA   . GLN A 1 32 ? 1.295   2.607   9.102   1.00 0.00 ? 116 GLN A HA   9  
ATOM 10143 H HB2  . GLN A 1 32 ? 1.455   0.253   9.864   1.00 0.00 ? 116 GLN A HB2  9  
ATOM 10144 H HB3  . GLN A 1 32 ? 2.982   0.098   9.003   1.00 0.00 ? 116 GLN A HB3  9  
ATOM 10145 H HG2  . GLN A 1 32 ? 3.988   1.777   10.423  1.00 0.00 ? 116 GLN A HG2  9  
ATOM 10146 H HG3  . GLN A 1 32 ? 2.451   2.036   11.244  1.00 0.00 ? 116 GLN A HG3  9  
ATOM 10147 H HE21 . GLN A 1 32 ? 1.808   -0.817  11.230  1.00 0.00 ? 116 GLN A HE21 9  
ATOM 10148 H HE22 . GLN A 1 32 ? 2.796   -1.525  12.466  1.00 0.00 ? 116 GLN A HE22 9  
ATOM 10149 N N    . GLN A 1 33 ? 3.673   2.109   6.911   1.00 0.00 ? 117 GLN A N    9  
ATOM 10150 C CA   . GLN A 1 33 ? 4.786   2.775   6.242   1.00 0.00 ? 117 GLN A CA   9  
ATOM 10151 C C    . GLN A 1 33 ? 4.301   4.099   5.648   1.00 0.00 ? 117 GLN A C    9  
ATOM 10152 O O    . GLN A 1 33 ? 4.938   5.149   5.803   1.00 0.00 ? 117 GLN A O    9  
ATOM 10153 C CB   . GLN A 1 33 ? 5.370   1.880   5.141   1.00 0.00 ? 117 GLN A CB   9  
ATOM 10154 C CG   . GLN A 1 33 ? 5.762   0.493   5.628   1.00 0.00 ? 117 GLN A CG   9  
ATOM 10155 C CD   . GLN A 1 33 ? 6.397   -0.370  4.546   1.00 0.00 ? 117 GLN A CD   9  
ATOM 10156 O OE1  . GLN A 1 33 ? 6.244   -1.593  4.544   1.00 0.00 ? 117 GLN A OE1  9  
ATOM 10157 N NE2  . GLN A 1 33 ? 7.129   0.254   3.631   1.00 0.00 ? 117 GLN A NE2  9  
ATOM 10158 H H    . GLN A 1 33 ? 3.327   1.267   6.544   1.00 0.00 ? 117 GLN A H    9  
ATOM 10159 H HA   . GLN A 1 33 ? 5.548   2.978   6.980   1.00 0.00 ? 117 GLN A HA   9  
ATOM 10160 H HB2  . GLN A 1 33 ? 4.635   1.767   4.359   1.00 0.00 ? 117 GLN A HB2  9  
ATOM 10161 H HB3  . GLN A 1 33 ? 6.248   2.358   4.732   1.00 0.00 ? 117 GLN A HB3  9  
ATOM 10162 H HG2  . GLN A 1 33 ? 6.467   0.598   6.440   1.00 0.00 ? 117 GLN A HG2  9  
ATOM 10163 H HG3  . GLN A 1 33 ? 4.876   -0.009  5.989   1.00 0.00 ? 117 GLN A HG3  9  
ATOM 10164 H HE21 . GLN A 1 33 ? 7.223   1.224   3.692   1.00 0.00 ? 117 GLN A HE21 9  
ATOM 10165 H HE22 . GLN A 1 33 ? 7.569   -0.292  2.936   1.00 0.00 ? 117 GLN A HE22 9  
ATOM 10166 N N    . VAL A 1 34 ? 3.150   4.046   4.992   1.00 0.00 ? 118 VAL A N    9  
ATOM 10167 C CA   . VAL A 1 34 ? 2.510   5.248   4.487   1.00 0.00 ? 118 VAL A CA   9  
ATOM 10168 C C    . VAL A 1 34 ? 2.180   6.181   5.651   1.00 0.00 ? 118 VAL A C    9  
ATOM 10169 O O    . VAL A 1 34 ? 2.312   7.394   5.538   1.00 0.00 ? 118 VAL A O    9  
ATOM 10170 C CB   . VAL A 1 34 ? 1.224   4.927   3.695   1.00 0.00 ? 118 VAL A CB   9  
ATOM 10171 C CG1  . VAL A 1 34 ? 0.600   6.196   3.135   1.00 0.00 ? 118 VAL A CG1  9  
ATOM 10172 C CG2  . VAL A 1 34 ? 1.520   3.943   2.570   1.00 0.00 ? 118 VAL A CG2  9  
ATOM 10173 H H    . VAL A 1 34 ? 2.722   3.171   4.841   1.00 0.00 ? 118 VAL A H    9  
ATOM 10174 H HA   . VAL A 1 34 ? 3.208   5.743   3.826   1.00 0.00 ? 118 VAL A HA   9  
ATOM 10175 H HB   . VAL A 1 34 ? 0.515   4.470   4.369   1.00 0.00 ? 118 VAL A HB   9  
ATOM 10176 H HG11 . VAL A 1 34 ? 1.296   6.673   2.459   1.00 0.00 ? 118 VAL A HG11 9  
ATOM 10177 H HG12 . VAL A 1 34 ? 0.365   6.872   3.944   1.00 0.00 ? 118 VAL A HG12 9  
ATOM 10178 H HG13 . VAL A 1 34 ? -0.307  5.948   2.600   1.00 0.00 ? 118 VAL A HG13 9  
ATOM 10179 H HG21 . VAL A 1 34 ? 1.909   3.027   2.985   1.00 0.00 ? 118 VAL A HG21 9  
ATOM 10180 H HG22 . VAL A 1 34 ? 2.248   4.373   1.897   1.00 0.00 ? 118 VAL A HG22 9  
ATOM 10181 H HG23 . VAL A 1 34 ? 0.608   3.734   2.025   1.00 0.00 ? 118 VAL A HG23 9  
ATOM 10182 N N    . SER A 1 35 ? 1.788   5.592   6.778   1.00 0.00 ? 119 SER A N    9  
ATOM 10183 C CA   . SER A 1 35 ? 1.520   6.341   7.998   1.00 0.00 ? 119 SER A CA   9  
ATOM 10184 C C    . SER A 1 35 ? 2.805   6.961   8.556   1.00 0.00 ? 119 SER A C    9  
ATOM 10185 O O    . SER A 1 35 ? 2.762   7.866   9.391   1.00 0.00 ? 119 SER A O    9  
ATOM 10186 C CB   . SER A 1 35 ? 0.858   5.440   9.048   1.00 0.00 ? 119 SER A CB   9  
ATOM 10187 O OG   . SER A 1 35 ? -0.437  5.038   8.631   1.00 0.00 ? 119 SER A OG   9  
ATOM 10188 H H    . SER A 1 35 ? 1.657   4.618   6.784   1.00 0.00 ? 119 SER A H    9  
ATOM 10189 H HA   . SER A 1 35 ? 0.836   7.138   7.746   1.00 0.00 ? 119 SER A HA   9  
ATOM 10190 H HB2  . SER A 1 35 ? 1.462   4.558   9.188   1.00 0.00 ? 119 SER A HB2  9  
ATOM 10191 H HB3  . SER A 1 35 ? 0.777   5.974   9.982   1.00 0.00 ? 119 SER A HB3  9  
ATOM 10192 H HG   . SER A 1 35 ? -0.357  4.437   7.880   1.00 0.00 ? 119 SER A HG   9  
ATOM 10193 N N    . GLY A 1 36 ? 3.943   6.467   8.091   1.00 0.00 ? 120 GLY A N    9  
ATOM 10194 C CA   . GLY A 1 36 ? 5.213   7.059   8.453   1.00 0.00 ? 120 GLY A CA   9  
ATOM 10195 C C    . GLY A 1 36 ? 5.480   8.329   7.673   1.00 0.00 ? 120 GLY A C    9  
ATOM 10196 O O    . GLY A 1 36 ? 6.064   9.278   8.192   1.00 0.00 ? 120 GLY A O    9  
ATOM 10197 H H    . GLY A 1 36 ? 3.921   5.682   7.498   1.00 0.00 ? 120 GLY A H    9  
ATOM 10198 H HA2  . GLY A 1 36 ? 5.207   7.288   9.510   1.00 0.00 ? 120 GLY A HA2  9  
ATOM 10199 H HA3  . GLY A 1 36 ? 6.003   6.349   8.250   1.00 0.00 ? 120 GLY A HA3  9  
ATOM 10200 N N    . LEU A 1 37 ? 5.053   8.346   6.415   1.00 0.00 ? 121 LEU A N    9  
ATOM 10201 C CA   . LEU A 1 37 ? 5.215   9.536   5.574   1.00 0.00 ? 121 LEU A CA   9  
ATOM 10202 C C    . LEU A 1 37 ? 3.955   10.411  5.558   1.00 0.00 ? 121 LEU A C    9  
ATOM 10203 O O    . LEU A 1 37 ? 3.927   11.487  6.152   1.00 0.00 ? 121 LEU A O    9  
ATOM 10204 C CB   . LEU A 1 37 ? 5.589   9.149   4.135   1.00 0.00 ? 121 LEU A CB   9  
ATOM 10205 C CG   . LEU A 1 37 ? 7.023   8.641   3.931   1.00 0.00 ? 121 LEU A CG   9  
ATOM 10206 C CD1  . LEU A 1 37 ? 7.211   7.256   4.526   1.00 0.00 ? 121 LEU A CD1  9  
ATOM 10207 C CD2  . LEU A 1 37 ? 7.377   8.634   2.451   1.00 0.00 ? 121 LEU A CD2  9  
ATOM 10208 H H    . LEU A 1 37 ? 4.639   7.532   6.037   1.00 0.00 ? 121 LEU A H    9  
ATOM 10209 H HA   . LEU A 1 37 ? 6.024   10.117  5.989   1.00 0.00 ? 121 LEU A HA   9  
ATOM 10210 H HB2  . LEU A 1 37 ? 4.908   8.379   3.803   1.00 0.00 ? 121 LEU A HB2  9  
ATOM 10211 H HB3  . LEU A 1 37 ? 5.451   10.019  3.509   1.00 0.00 ? 121 LEU A HB3  9  
ATOM 10212 H HG   . LEU A 1 37 ? 7.708   9.311   4.432   1.00 0.00 ? 121 LEU A HG   9  
ATOM 10213 H HD11 . LEU A 1 37 ? 8.228   6.930   4.365   1.00 0.00 ? 121 LEU A HD11 9  
ATOM 10214 H HD12 . LEU A 1 37 ? 6.533   6.566   4.046   1.00 0.00 ? 121 LEU A HD12 9  
ATOM 10215 H HD13 . LEU A 1 37 ? 7.005   7.286   5.585   1.00 0.00 ? 121 LEU A HD13 9  
ATOM 10216 H HD21 . LEU A 1 37 ? 7.252   9.626   2.046   1.00 0.00 ? 121 LEU A HD21 9  
ATOM 10217 H HD22 . LEU A 1 37 ? 6.727   7.945   1.932   1.00 0.00 ? 121 LEU A HD22 9  
ATOM 10218 H HD23 . LEU A 1 37 ? 8.403   8.321   2.329   1.00 0.00 ? 121 LEU A HD23 9  
ATOM 10219 N N    . GLU A 1 38 ? 2.915   9.926   4.894   1.00 0.00 ? 122 GLU A N    9  
ATOM 10220 C CA   . GLU A 1 38 ? 1.682   10.688  4.668   1.00 0.00 ? 122 GLU A CA   9  
ATOM 10221 C C    . GLU A 1 38 ? 0.642   10.388  5.751   1.00 0.00 ? 122 GLU A C    9  
ATOM 10222 O O    . GLU A 1 38 ? -0.521  10.762  5.617   1.00 0.00 ? 122 GLU A O    9  
ATOM 10223 C CB   . GLU A 1 38 ? 1.091   10.359  3.297   1.00 0.00 ? 122 GLU A CB   9  
ATOM 10224 C CG   . GLU A 1 38 ? 2.091   10.431  2.149   1.00 0.00 ? 122 GLU A CG   9  
ATOM 10225 C CD   . GLU A 1 38 ? 2.689   11.814  1.969   1.00 0.00 ? 122 GLU A CD   9  
ATOM 10226 O OE1  . GLU A 1 38 ? 1.945   12.750  1.606   1.00 0.00 ? 122 GLU A OE1  9  
ATOM 10227 O OE2  . GLU A 1 38 ? 3.911   11.970  2.167   1.00 0.00 ? 122 GLU A OE2  9  
ATOM 10228 H H    . GLU A 1 38 ? 2.967   9.009   4.548   1.00 0.00 ? 122 GLU A H    9  
ATOM 10229 H HA   . GLU A 1 38 ? 1.929   11.736  4.703   1.00 0.00 ? 122 GLU A HA   9  
ATOM 10230 H HB2  . GLU A 1 38 ? 0.680   9.365   3.331   1.00 0.00 ? 122 GLU A HB2  9  
ATOM 10231 H HB3  . GLU A 1 38 ? 0.294   11.058  3.091   1.00 0.00 ? 122 GLU A HB3  9  
ATOM 10232 H HG2  . GLU A 1 38 ? 2.890   9.733   2.344   1.00 0.00 ? 122 GLU A HG2  9  
ATOM 10233 H HG3  . GLU A 1 38 ? 1.585   10.153  1.237   1.00 0.00 ? 122 GLU A HG3  9  
ATOM 10234 N N    . GLY A 1 39 ? 1.086   9.662   6.777   1.00 0.00 ? 123 GLY A N    9  
ATOM 10235 C CA   . GLY A 1 39 ? 0.233   9.091   7.831   1.00 0.00 ? 123 GLY A CA   9  
ATOM 10236 C C    . GLY A 1 39 ? -0.749  10.017  8.540   1.00 0.00 ? 123 GLY A C    9  
ATOM 10237 O O    . GLY A 1 39 ? -1.319  9.616   9.555   1.00 0.00 ? 123 GLY A O    9  
ATOM 10238 H H    . GLY A 1 39 ? 2.050   9.500   6.828   1.00 0.00 ? 123 GLY A H    9  
ATOM 10239 H HA2  . GLY A 1 39 ? -0.339  8.291   7.392   1.00 0.00 ? 123 GLY A HA2  9  
ATOM 10240 H HA3  . GLY A 1 39 ? 0.885   8.654   8.578   1.00 0.00 ? 123 GLY A HA3  9  
ATOM 10241 N N    . VAL A 1 40 ? -0.901  11.245  8.069   1.00 0.00 ? 124 VAL A N    9  
ATOM 10242 C CA   . VAL A 1 40 ? -1.853  12.203  8.633   1.00 0.00 ? 124 VAL A CA   9  
ATOM 10243 C C    . VAL A 1 40 ? -3.282  11.644  8.680   1.00 0.00 ? 124 VAL A C    9  
ATOM 10244 O O    . VAL A 1 40 ? -4.081  11.911  7.783   1.00 0.00 ? 124 VAL A O    9  
ATOM 10245 C CB   . VAL A 1 40 ? -1.872  13.502  7.803   1.00 0.00 ? 124 VAL A CB   9  
ATOM 10246 C CG1  . VAL A 1 40 ? -2.740  14.556  8.471   1.00 0.00 ? 124 VAL A CG1  9  
ATOM 10247 C CG2  . VAL A 1 40 ? -0.455  14.007  7.567   1.00 0.00 ? 124 VAL A CG2  9  
ATOM 10248 H H    . VAL A 1 40 ? -0.367  11.515  7.294   1.00 0.00 ? 124 VAL A H    9  
ATOM 10249 H HA   . VAL A 1 40 ? -1.535  12.446  9.636   1.00 0.00 ? 124 VAL A HA   9  
ATOM 10250 H HB   . VAL A 1 40 ? -2.308  13.277  6.841   1.00 0.00 ? 124 VAL A HB   9  
ATOM 10251 H HG11 . VAL A 1 40 ? -3.757  14.185  8.545   1.00 0.00 ? 124 VAL A HG11 9  
ATOM 10252 H HG12 . VAL A 1 40 ? -2.728  15.461  7.881   1.00 0.00 ? 124 VAL A HG12 9  
ATOM 10253 H HG13 . VAL A 1 40 ? -2.361  14.764  9.460   1.00 0.00 ? 124 VAL A HG13 9  
ATOM 10254 H HG21 . VAL A 1 40 ? 0.093   13.278  6.979   1.00 0.00 ? 124 VAL A HG21 9  
ATOM 10255 H HG22 . VAL A 1 40 ? 0.040   14.151  8.514   1.00 0.00 ? 124 VAL A HG22 9  
ATOM 10256 H HG23 . VAL A 1 40 ? -0.491  14.945  7.031   1.00 0.00 ? 124 VAL A HG23 9  
ATOM 10257 N N    . GLN A 1 41 ? -3.571  10.866  9.724   1.00 0.00 ? 125 GLN A N    9  
ATOM 10258 C CA   . GLN A 1 41 ? -4.899  10.292  9.985   1.00 0.00 ? 125 GLN A CA   9  
ATOM 10259 C C    . GLN A 1 41 ? -5.427  9.479   8.796   1.00 0.00 ? 125 GLN A C    9  
ATOM 10260 O O    . GLN A 1 41 ? -5.761  10.025  7.745   1.00 0.00 ? 125 GLN A O    9  
ATOM 10261 C CB   . GLN A 1 41 ? -5.884  11.394  10.390  1.00 0.00 ? 125 GLN A CB   9  
ATOM 10262 C CG   . GLN A 1 41 ? -6.749  11.013  11.583  1.00 0.00 ? 125 GLN A CG   9  
ATOM 10263 C CD   . GLN A 1 41 ? -8.014  10.276  11.188  1.00 0.00 ? 125 GLN A CD   9  
ATOM 10264 O OE1  . GLN A 1 41 ? -8.012  9.060   11.004  1.00 0.00 ? 125 GLN A OE1  9  
ATOM 10265 N NE2  . GLN A 1 41 ? -9.115  11.005  11.095  1.00 0.00 ? 125 GLN A NE2  9  
ATOM 10266 H H    . GLN A 1 41 ? -2.846  10.652  10.347  1.00 0.00 ? 125 GLN A H    9  
ATOM 10267 H HA   . GLN A 1 41 ? -4.787  9.617   10.822  1.00 0.00 ? 125 GLN A HA   9  
ATOM 10268 H HB2  . GLN A 1 41 ? -5.329  12.284  10.641  1.00 0.00 ? 125 GLN A HB2  9  
ATOM 10269 H HB3  . GLN A 1 41 ? -6.534  11.608  9.553   1.00 0.00 ? 125 GLN A HB3  9  
ATOM 10270 H HG2  . GLN A 1 41 ? -6.174  10.375  12.239  1.00 0.00 ? 125 GLN A HG2  9  
ATOM 10271 H HG3  . GLN A 1 41 ? -7.025  11.913  12.111  1.00 0.00 ? 125 GLN A HG3  9  
ATOM 10272 H HE21 . GLN A 1 41 ? -9.052  11.972  11.285  1.00 0.00 ? 125 GLN A HE21 9  
ATOM 10273 H HE22 . GLN A 1 41 ? -9.951  10.557  10.847  1.00 0.00 ? 125 GLN A HE22 9  
ATOM 10274 N N    . ASP A 1 42 ? -5.551  8.166   8.990   1.00 0.00 ? 126 ASP A N    9  
ATOM 10275 C CA   . ASP A 1 42 ? -5.915  7.241   7.908   1.00 0.00 ? 126 ASP A CA   9  
ATOM 10276 C C    . ASP A 1 42 ? -7.258  7.588   7.268   1.00 0.00 ? 126 ASP A C    9  
ATOM 10277 O O    . ASP A 1 42 ? -7.597  7.065   6.209   1.00 0.00 ? 126 ASP A O    9  
ATOM 10278 C CB   . ASP A 1 42 ? -5.962  5.799   8.420   1.00 0.00 ? 126 ASP A CB   9  
ATOM 10279 C CG   . ASP A 1 42 ? -7.230  5.485   9.193   1.00 0.00 ? 126 ASP A CG   9  
ATOM 10280 O OD1  . ASP A 1 42 ? -7.273  5.746   10.411  1.00 0.00 ? 126 ASP A OD1  9  
ATOM 10281 O OD2  . ASP A 1 42 ? -8.189  4.958   8.585   1.00 0.00 ? 126 ASP A OD2  9  
ATOM 10282 H H    . ASP A 1 42 ? -5.388  7.802   9.888   1.00 0.00 ? 126 ASP A H    9  
ATOM 10283 H HA   . ASP A 1 42 ? -5.147  7.310   7.150   1.00 0.00 ? 126 ASP A HA   9  
ATOM 10284 H HB2  . ASP A 1 42 ? -5.905  5.124   7.579   1.00 0.00 ? 126 ASP A HB2  9  
ATOM 10285 H HB3  . ASP A 1 42 ? -5.115  5.627   9.070   1.00 0.00 ? 126 ASP A HB3  9  
ATOM 10286 N N    . ASP A 1 43 ? -8.019  8.462   7.908   1.00 0.00 ? 127 ASP A N    9  
ATOM 10287 C CA   . ASP A 1 43 ? -9.307  8.881   7.375   1.00 0.00 ? 127 ASP A CA   9  
ATOM 10288 C C    . ASP A 1 43 ? -9.112  9.802   6.175   1.00 0.00 ? 127 ASP A C    9  
ATOM 10289 O O    . ASP A 1 43 ? -9.945  9.840   5.266   1.00 0.00 ? 127 ASP A O    9  
ATOM 10290 C CB   . ASP A 1 43 ? -10.125 9.582   8.459   1.00 0.00 ? 127 ASP A CB   9  
ATOM 10291 C CG   . ASP A 1 43 ? -11.479 10.054  7.971   1.00 0.00 ? 127 ASP A CG   9  
ATOM 10292 O OD1  . ASP A 1 43 ? -12.162 9.291   7.256   1.00 0.00 ? 127 ASP A OD1  9  
ATOM 10293 O OD2  . ASP A 1 43 ? -11.877 11.183  8.324   1.00 0.00 ? 127 ASP A OD2  9  
ATOM 10294 H H    . ASP A 1 43 ? -7.703  8.842   8.757   1.00 0.00 ? 127 ASP A H    9  
ATOM 10295 H HA   . ASP A 1 43 ? -9.834  7.995   7.052   1.00 0.00 ? 127 ASP A HA   9  
ATOM 10296 H HB2  . ASP A 1 43 ? -10.280 8.900   9.282   1.00 0.00 ? 127 ASP A HB2  9  
ATOM 10297 H HB3  . ASP A 1 43 ? -9.575  10.442  8.813   1.00 0.00 ? 127 ASP A HB3  9  
ATOM 10298 N N    . LEU A 1 44 ? -8.004  10.537  6.166   1.00 0.00 ? 128 LEU A N    9  
ATOM 10299 C CA   . LEU A 1 44 ? -7.701  11.437  5.066   1.00 0.00 ? 128 LEU A CA   9  
ATOM 10300 C C    . LEU A 1 44 ? -7.112  10.673  3.884   1.00 0.00 ? 128 LEU A C    9  
ATOM 10301 O O    . LEU A 1 44 ? -7.441  10.950  2.731   1.00 0.00 ? 128 LEU A O    9  
ATOM 10302 C CB   . LEU A 1 44 ? -6.742  12.532  5.539   1.00 0.00 ? 128 LEU A CB   9  
ATOM 10303 C CG   . LEU A 1 44 ? -7.285  13.415  6.665   1.00 0.00 ? 128 LEU A CG   9  
ATOM 10304 C CD1  . LEU A 1 44 ? -6.198  14.337  7.186   1.00 0.00 ? 128 LEU A CD1  9  
ATOM 10305 C CD2  . LEU A 1 44 ? -8.481  14.220  6.180   1.00 0.00 ? 128 LEU A CD2  9  
ATOM 10306 H H    . LEU A 1 44 ? -7.369  10.475  6.923   1.00 0.00 ? 128 LEU A H    9  
ATOM 10307 H HA   . LEU A 1 44 ? -8.626  11.897  4.753   1.00 0.00 ? 128 LEU A HA   9  
ATOM 10308 H HB2  . LEU A 1 44 ? -5.828  12.062  5.882   1.00 0.00 ? 128 LEU A HB2  9  
ATOM 10309 H HB3  . LEU A 1 44 ? -6.505  13.165  4.697   1.00 0.00 ? 128 LEU A HB3  9  
ATOM 10310 H HG   . LEU A 1 44 ? -7.611  12.786  7.484   1.00 0.00 ? 128 LEU A HG   9  
ATOM 10311 H HD11 . LEU A 1 44 ? -6.604  14.964  7.966   1.00 0.00 ? 128 LEU A HD11 9  
ATOM 10312 H HD12 . LEU A 1 44 ? -5.831  14.955  6.380   1.00 0.00 ? 128 LEU A HD12 9  
ATOM 10313 H HD13 . LEU A 1 44 ? -5.387  13.742  7.584   1.00 0.00 ? 128 LEU A HD13 9  
ATOM 10314 H HD21 . LEU A 1 44 ? -8.185  14.836  5.342   1.00 0.00 ? 128 LEU A HD21 9  
ATOM 10315 H HD22 . LEU A 1 44 ? -8.839  14.850  6.980   1.00 0.00 ? 128 LEU A HD22 9  
ATOM 10316 H HD23 . LEU A 1 44 ? -9.268  13.548  5.872   1.00 0.00 ? 128 LEU A HD23 9  
ATOM 10317 N N    . PHE A 1 45 ? -6.256  9.696   4.166   1.00 0.00 ? 129 PHE A N    9  
ATOM 10318 C CA   . PHE A 1 45 ? -5.660  8.900   3.105   1.00 0.00 ? 129 PHE A CA   9  
ATOM 10319 C C    . PHE A 1 45 ? -6.215  7.475   3.115   1.00 0.00 ? 129 PHE A C    9  
ATOM 10320 O O    . PHE A 1 45 ? -5.888  6.655   3.972   1.00 0.00 ? 129 PHE A O    9  
ATOM 10321 C CB   . PHE A 1 45 ? -4.120  8.919   3.175   1.00 0.00 ? 129 PHE A CB   9  
ATOM 10322 C CG   . PHE A 1 45 ? -3.501  8.172   4.333   1.00 0.00 ? 129 PHE A CG   9  
ATOM 10323 C CD1  . PHE A 1 45 ? -3.490  8.711   5.609   1.00 0.00 ? 129 PHE A CD1  9  
ATOM 10324 C CD2  . PHE A 1 45 ? -2.918  6.926   4.131   1.00 0.00 ? 129 PHE A CD2  9  
ATOM 10325 C CE1  . PHE A 1 45 ? -2.914  8.021   6.662   1.00 0.00 ? 129 PHE A CE1  9  
ATOM 10326 C CE2  . PHE A 1 45 ? -2.340  6.236   5.182   1.00 0.00 ? 129 PHE A CE2  9  
ATOM 10327 C CZ   . PHE A 1 45 ? -2.340  6.782   6.446   1.00 0.00 ? 129 PHE A CZ   9  
ATOM 10328 H H    . PHE A 1 45 ? -6.034  9.502   5.101   1.00 0.00 ? 129 PHE A H    9  
ATOM 10329 H HA   . PHE A 1 45 ? -5.956  9.358   2.172   1.00 0.00 ? 129 PHE A HA   9  
ATOM 10330 H HB2  . PHE A 1 45 ? -3.731  8.485   2.266   1.00 0.00 ? 129 PHE A HB2  9  
ATOM 10331 H HB3  . PHE A 1 45 ? -3.793  9.946   3.234   1.00 0.00 ? 129 PHE A HB3  9  
ATOM 10332 H HD1  . PHE A 1 45 ? -3.939  9.679   5.782   1.00 0.00 ? 129 PHE A HD1  9  
ATOM 10333 H HD2  . PHE A 1 45 ? -2.920  6.496   3.140   1.00 0.00 ? 129 PHE A HD2  9  
ATOM 10334 H HE1  . PHE A 1 45 ? -2.913  8.449   7.654   1.00 0.00 ? 129 PHE A HE1  9  
ATOM 10335 H HE2  . PHE A 1 45 ? -1.889  5.268   5.013   1.00 0.00 ? 129 PHE A HE2  9  
ATOM 10336 H HZ   . PHE A 1 45 ? -1.891  6.241   7.267   1.00 0.00 ? 129 PHE A HZ   9  
ATOM 10337 N N    . TRP A 1 46 ? -7.083  7.202   2.161   1.00 0.00 ? 130 TRP A N    9  
ATOM 10338 C CA   . TRP A 1 46 ? -7.700  5.895   2.022   1.00 0.00 ? 130 TRP A CA   9  
ATOM 10339 C C    . TRP A 1 46 ? -7.347  5.305   0.660   1.00 0.00 ? 130 TRP A C    9  
ATOM 10340 O O    . TRP A 1 46 ? -7.780  5.798   -0.374  1.00 0.00 ? 130 TRP A O    9  
ATOM 10341 C CB   . TRP A 1 46 ? -9.219  6.031   2.230   1.00 0.00 ? 130 TRP A CB   9  
ATOM 10342 C CG   . TRP A 1 46 ? -10.059 5.068   1.449   1.00 0.00 ? 130 TRP A CG   9  
ATOM 10343 C CD1  . TRP A 1 46 ? -10.084 3.709   1.556   1.00 0.00 ? 130 TRP A CD1  9  
ATOM 10344 C CD2  . TRP A 1 46 ? -11.013 5.412   0.437   1.00 0.00 ? 130 TRP A CD2  9  
ATOM 10345 N NE1  . TRP A 1 46 ? -10.994 3.186   0.667   1.00 0.00 ? 130 TRP A NE1  9  
ATOM 10346 C CE2  . TRP A 1 46 ? -11.575 4.213   -0.031  1.00 0.00 ? 130 TRP A CE2  9  
ATOM 10347 C CE3  . TRP A 1 46 ? -11.442 6.621   -0.115  1.00 0.00 ? 130 TRP A CE3  9  
ATOM 10348 C CZ2  . TRP A 1 46 ? -12.547 4.188   -1.031  1.00 0.00 ? 130 TRP A CZ2  9  
ATOM 10349 C CZ3  . TRP A 1 46 ? -12.405 6.596   -1.108  1.00 0.00 ? 130 TRP A CZ3  9  
ATOM 10350 C CH2  . TRP A 1 46 ? -12.949 5.388   -1.556  1.00 0.00 ? 130 TRP A CH2  9  
ATOM 10351 H H    . TRP A 1 46 ? -7.321  7.908   1.521   1.00 0.00 ? 130 TRP A H    9  
ATOM 10352 H HA   . TRP A 1 46 ? -7.295  5.254   2.792   1.00 0.00 ? 130 TRP A HA   9  
ATOM 10353 H HB2  . TRP A 1 46 ? -9.439  5.882   3.275   1.00 0.00 ? 130 TRP A HB2  9  
ATOM 10354 H HB3  . TRP A 1 46 ? -9.516  7.033   1.951   1.00 0.00 ? 130 TRP A HB3  9  
ATOM 10355 H HD1  . TRP A 1 46 ? -9.472  3.140   2.241   1.00 0.00 ? 130 TRP A HD1  9  
ATOM 10356 H HE1  . TRP A 1 46 ? -11.191 2.233   0.550   1.00 0.00 ? 130 TRP A HE1  9  
ATOM 10357 H HE3  . TRP A 1 46 ? -11.034 7.565   0.218   1.00 0.00 ? 130 TRP A HE3  9  
ATOM 10358 H HZ2  . TRP A 1 46 ? -12.978 3.265   -1.388  1.00 0.00 ? 130 TRP A HZ2  9  
ATOM 10359 H HZ3  . TRP A 1 46 ? -12.748 7.521   -1.549  1.00 0.00 ? 130 TRP A HZ3  9  
ATOM 10360 H HH2  . TRP A 1 46 ? -13.697 5.416   -2.333  1.00 0.00 ? 130 TRP A HH2  9  
ATOM 10361 N N    . LEU A 1 47 ? -6.537  4.259   0.661   1.00 0.00 ? 131 LEU A N    9  
ATOM 10362 C CA   . LEU A 1 47 ? -6.009  3.721   -0.583  1.00 0.00 ? 131 LEU A CA   9  
ATOM 10363 C C    . LEU A 1 47 ? -6.891  2.605   -1.136  1.00 0.00 ? 131 LEU A C    9  
ATOM 10364 O O    . LEU A 1 47 ? -7.586  1.916   -0.390  1.00 0.00 ? 131 LEU A O    9  
ATOM 10365 C CB   . LEU A 1 47 ? -4.560  3.240   -0.389  1.00 0.00 ? 131 LEU A CB   9  
ATOM 10366 C CG   . LEU A 1 47 ? -4.327  2.202   0.720   1.00 0.00 ? 131 LEU A CG   9  
ATOM 10367 C CD1  . LEU A 1 47 ? -4.604  0.794   0.218   1.00 0.00 ? 131 LEU A CD1  9  
ATOM 10368 C CD2  . LEU A 1 47 ? -2.906  2.304   1.252   1.00 0.00 ? 131 LEU A CD2  9  
ATOM 10369 H H    . LEU A 1 47 ? -6.306  3.827   1.509   1.00 0.00 ? 131 LEU A H    9  
ATOM 10370 H HA   . LEU A 1 47 ? -6.009  4.532   -1.299  1.00 0.00 ? 131 LEU A HA   9  
ATOM 10371 H HB2  . LEU A 1 47 ? -4.223  2.812   -1.322  1.00 0.00 ? 131 LEU A HB2  9  
ATOM 10372 H HB3  . LEU A 1 47 ? -3.950  4.103   -0.173  1.00 0.00 ? 131 LEU A HB3  9  
ATOM 10373 H HG   . LEU A 1 47 ? -5.003  2.403   1.539   1.00 0.00 ? 131 LEU A HG   9  
ATOM 10374 H HD11 . LEU A 1 47 ? -4.460  0.088   1.023   1.00 0.00 ? 131 LEU A HD11 9  
ATOM 10375 H HD12 . LEU A 1 47 ? -3.924  0.560   -0.590  1.00 0.00 ? 131 LEU A HD12 9  
ATOM 10376 H HD13 . LEU A 1 47 ? -5.621  0.732   -0.140  1.00 0.00 ? 131 LEU A HD13 9  
ATOM 10377 H HD21 . LEU A 1 47 ? -2.758  1.569   2.029   1.00 0.00 ? 131 LEU A HD21 9  
ATOM 10378 H HD22 . LEU A 1 47 ? -2.741  3.293   1.656   1.00 0.00 ? 131 LEU A HD22 9  
ATOM 10379 H HD23 . LEU A 1 47 ? -2.207  2.123   0.449   1.00 0.00 ? 131 LEU A HD23 9  
ATOM 10380 N N    . THR A 1 48 ? -6.859  2.451   -2.450  1.00 0.00 ? 132 THR A N    9  
ATOM 10381 C CA   . THR A 1 48 ? -7.612  1.414   -3.132  1.00 0.00 ? 132 THR A CA   9  
ATOM 10382 C C    . THR A 1 48 ? -6.782  0.824   -4.269  1.00 0.00 ? 132 THR A C    9  
ATOM 10383 O O    . THR A 1 48 ? -5.868  1.474   -4.785  1.00 0.00 ? 132 THR A O    9  
ATOM 10384 C CB   . THR A 1 48 ? -8.936  1.967   -3.705  1.00 0.00 ? 132 THR A CB   9  
ATOM 10385 O OG1  . THR A 1 48 ? -8.700  3.211   -4.375  1.00 0.00 ? 132 THR A OG1  9  
ATOM 10386 C CG2  . THR A 1 48 ? -9.974  2.161   -2.611  1.00 0.00 ? 132 THR A CG2  9  
ATOM 10387 H H    . THR A 1 48 ? -6.309  3.066   -2.989  1.00 0.00 ? 132 THR A H    9  
ATOM 10388 H HA   . THR A 1 48 ? -7.843  0.637   -2.420  1.00 0.00 ? 132 THR A HA   9  
ATOM 10389 H HB   . THR A 1 48 ? -9.323  1.255   -4.422  1.00 0.00 ? 132 THR A HB   9  
ATOM 10390 H HG1  . THR A 1 48 ? -9.462  3.786   -4.261  1.00 0.00 ? 132 THR A HG1  9  
ATOM 10391 H HG21 . THR A 1 48 ? -10.178 1.213   -2.134  1.00 0.00 ? 132 THR A HG21 9  
ATOM 10392 H HG22 . THR A 1 48 ? -10.886 2.552   -3.041  1.00 0.00 ? 132 THR A HG22 9  
ATOM 10393 H HG23 . THR A 1 48 ? -9.595  2.858   -1.878  1.00 0.00 ? 132 THR A HG23 9  
ATOM 10394 N N    . PHE A 1 49 ? -7.077  -0.414  -4.639  1.00 0.00 ? 133 PHE A N    9  
ATOM 10395 C CA   . PHE A 1 49 ? -6.421  -1.039  -5.780  1.00 0.00 ? 133 PHE A CA   9  
ATOM 10396 C C    . PHE A 1 49 ? -7.447  -1.542  -6.787  1.00 0.00 ? 133 PHE A C    9  
ATOM 10397 O O    . PHE A 1 49 ? -7.552  -1.017  -7.891  1.00 0.00 ? 133 PHE A O    9  
ATOM 10398 C CB   . PHE A 1 49 ? -5.489  -2.179  -5.340  1.00 0.00 ? 133 PHE A CB   9  
ATOM 10399 C CG   . PHE A 1 49 ? -5.133  -3.105  -6.470  1.00 0.00 ? 133 PHE A CG   9  
ATOM 10400 C CD1  . PHE A 1 49 ? -4.526  -2.625  -7.623  1.00 0.00 ? 133 PHE A CD1  9  
ATOM 10401 C CD2  . PHE A 1 49 ? -5.446  -4.449  -6.393  1.00 0.00 ? 133 PHE A CD2  9  
ATOM 10402 C CE1  . PHE A 1 49 ? -4.253  -3.474  -8.677  1.00 0.00 ? 133 PHE A CE1  9  
ATOM 10403 C CE2  . PHE A 1 49 ? -5.164  -5.303  -7.439  1.00 0.00 ? 133 PHE A CE2  9  
ATOM 10404 C CZ   . PHE A 1 49 ? -4.572  -4.813  -8.583  1.00 0.00 ? 133 PHE A CZ   9  
ATOM 10405 H H    . PHE A 1 49 ? -7.744  -0.919  -4.130  1.00 0.00 ? 133 PHE A H    9  
ATOM 10406 H HA   . PHE A 1 49 ? -5.828  -0.282  -6.262  1.00 0.00 ? 133 PHE A HA   9  
ATOM 10407 H HB2  . PHE A 1 49 ? -4.575  -1.760  -4.949  1.00 0.00 ? 133 PHE A HB2  9  
ATOM 10408 H HB3  . PHE A 1 49 ? -5.978  -2.760  -4.571  1.00 0.00 ? 133 PHE A HB3  9  
ATOM 10409 H HD1  . PHE A 1 49 ? -4.271  -1.577  -7.697  1.00 0.00 ? 133 PHE A HD1  9  
ATOM 10410 H HD2  . PHE A 1 49 ? -5.909  -4.835  -5.497  1.00 0.00 ? 133 PHE A HD2  9  
ATOM 10411 H HE1  . PHE A 1 49 ? -3.781  -3.091  -9.571  1.00 0.00 ? 133 PHE A HE1  9  
ATOM 10412 H HE2  . PHE A 1 49 ? -5.414  -6.350  -7.366  1.00 0.00 ? 133 PHE A HE2  9  
ATOM 10413 H HZ   . PHE A 1 49 ? -4.371  -5.472  -9.409  1.00 0.00 ? 133 PHE A HZ   9  
ATOM 10414 N N    . GLU A 1 50 ? -8.212  -2.550  -6.393  1.00 0.00 ? 134 GLU A N    9  
ATOM 10415 C CA   . GLU A 1 50 ? -9.221  -3.139  -7.274  1.00 0.00 ? 134 GLU A CA   9  
ATOM 10416 C C    . GLU A 1 50 ? -10.462 -2.254  -7.334  1.00 0.00 ? 134 GLU A C    9  
ATOM 10417 O O    . GLU A 1 50 ? -11.460 -2.603  -7.959  1.00 0.00 ? 134 GLU A O    9  
ATOM 10418 C CB   . GLU A 1 50 ? -9.654  -4.512  -6.765  1.00 0.00 ? 134 GLU A CB   9  
ATOM 10419 C CG   . GLU A 1 50 ? -8.533  -5.516  -6.612  1.00 0.00 ? 134 GLU A CG   9  
ATOM 10420 C CD   . GLU A 1 50 ? -9.036  -6.845  -6.093  1.00 0.00 ? 134 GLU A CD   9  
ATOM 10421 O OE1  . GLU A 1 50 ? -9.364  -6.930  -4.893  1.00 0.00 ? 134 GLU A OE1  9  
ATOM 10422 O OE2  . GLU A 1 50 ? -9.139  -7.798  -6.890  1.00 0.00 ? 134 GLU A OE2  9  
ATOM 10423 H H    . GLU A 1 50 ? -8.090  -2.911  -5.495  1.00 0.00 ? 134 GLU A H    9  
ATOM 10424 H HA   . GLU A 1 50 ? -8.791  -3.242  -8.262  1.00 0.00 ? 134 GLU A HA   9  
ATOM 10425 H HB2  . GLU A 1 50 ? -10.128 -4.390  -5.802  1.00 0.00 ? 134 GLU A HB2  9  
ATOM 10426 H HB3  . GLU A 1 50 ? -10.377 -4.921  -7.456  1.00 0.00 ? 134 GLU A HB3  9  
ATOM 10427 H HG2  . GLU A 1 50 ? -8.069  -5.673  -7.576  1.00 0.00 ? 134 GLU A HG2  9  
ATOM 10428 H HG3  . GLU A 1 50 ? -7.804  -5.125  -5.918  1.00 0.00 ? 134 GLU A HG3  9  
ATOM 10429 N N    . GLY A 1 51 ? -10.389 -1.114  -6.667  1.00 0.00 ? 135 GLY A N    9  
ATOM 10430 C CA   . GLY A 1 51 ? -11.568 -0.311  -6.430  1.00 0.00 ? 135 GLY A CA   9  
ATOM 10431 C C    . GLY A 1 51 ? -11.995 -0.443  -4.986  1.00 0.00 ? 135 GLY A C    9  
ATOM 10432 O O    . GLY A 1 51 ? -12.647 0.436   -4.426  1.00 0.00 ? 135 GLY A O    9  
ATOM 10433 H H    . GLY A 1 51 ? -9.519  -0.805  -6.345  1.00 0.00 ? 135 GLY A H    9  
ATOM 10434 H HA2  . GLY A 1 51 ? -11.348 0.724   -6.648  1.00 0.00 ? 135 GLY A HA2  9  
ATOM 10435 H HA3  . GLY A 1 51 ? -12.370 -0.650  -7.069  1.00 0.00 ? 135 GLY A HA3  9  
ATOM 10436 N N    . LYS A 1 52 ? -11.598 -1.559  -4.386  1.00 0.00 ? 136 LYS A N    9  
ATOM 10437 C CA   . LYS A 1 52 ? -11.846 -1.819  -2.977  1.00 0.00 ? 136 LYS A CA   9  
ATOM 10438 C C    . LYS A 1 52 ? -10.649 -1.352  -2.153  1.00 0.00 ? 136 LYS A C    9  
ATOM 10439 O O    . LYS A 1 52 ? -9.543  -1.228  -2.686  1.00 0.00 ? 136 LYS A O    9  
ATOM 10440 C CB   . LYS A 1 52 ? -12.071 -3.316  -2.735  1.00 0.00 ? 136 LYS A CB   9  
ATOM 10441 C CG   . LYS A 1 52 ? -13.204 -3.925  -3.542  1.00 0.00 ? 136 LYS A CG   9  
ATOM 10442 C CD   . LYS A 1 52 ? -13.510 -5.342  -3.069  1.00 0.00 ? 136 LYS A CD   9  
ATOM 10443 C CE   . LYS A 1 52 ? -12.293 -6.253  -3.173  1.00 0.00 ? 136 LYS A CE   9  
ATOM 10444 N NZ   . LYS A 1 52 ? -12.014 -6.660  -4.575  1.00 0.00 ? 136 LYS A NZ   9  
ATOM 10445 H H    . LYS A 1 52 ? -11.117 -2.227  -4.911  1.00 0.00 ? 136 LYS A H    9  
ATOM 10446 H HA   . LYS A 1 52 ? -12.725 -1.269  -2.675  1.00 0.00 ? 136 LYS A HA   9  
ATOM 10447 H HB2  . LYS A 1 52 ? -11.162 -3.845  -2.982  1.00 0.00 ? 136 LYS A HB2  9  
ATOM 10448 H HB3  . LYS A 1 52 ? -12.286 -3.467  -1.687  1.00 0.00 ? 136 LYS A HB3  9  
ATOM 10449 H HG2  . LYS A 1 52 ? -14.088 -3.318  -3.426  1.00 0.00 ? 136 LYS A HG2  9  
ATOM 10450 H HG3  . LYS A 1 52 ? -12.917 -3.954  -4.584  1.00 0.00 ? 136 LYS A HG3  9  
ATOM 10451 H HD2  . LYS A 1 52 ? -13.827 -5.305  -2.039  1.00 0.00 ? 136 LYS A HD2  9  
ATOM 10452 H HD3  . LYS A 1 52 ? -14.306 -5.750  -3.677  1.00 0.00 ? 136 LYS A HD3  9  
ATOM 10453 H HE2  . LYS A 1 52 ? -11.433 -5.729  -2.784  1.00 0.00 ? 136 LYS A HE2  9  
ATOM 10454 H HE3  . LYS A 1 52 ? -12.472 -7.138  -2.580  1.00 0.00 ? 136 LYS A HE3  9  
ATOM 10455 H HZ1  . LYS A 1 52 ? -12.638 -7.448  -4.849  1.00 0.00 ? 136 LYS A HZ1  9  
ATOM 10456 H HZ2  . LYS A 1 52 ? -11.019 -6.971  -4.670  1.00 0.00 ? 136 LYS A HZ2  9  
ATOM 10457 H HZ3  . LYS A 1 52 ? -12.181 -5.861  -5.224  1.00 0.00 ? 136 LYS A HZ3  9  
ATOM 10458 N N    . PRO A 1 53 ? -10.851 -1.091  -0.849  1.00 0.00 ? 137 PRO A N    9  
ATOM 10459 C CA   . PRO A 1 53 ? -9.776  -0.675  0.061   1.00 0.00 ? 137 PRO A CA   9  
ATOM 10460 C C    . PRO A 1 53 ? -8.888  -1.847  0.473   1.00 0.00 ? 137 PRO A C    9  
ATOM 10461 O O    . PRO A 1 53 ? -7.919  -1.670  1.213   1.00 0.00 ? 137 PRO A O    9  
ATOM 10462 C CB   . PRO A 1 53 ? -10.519 -0.121  1.287   1.00 0.00 ? 137 PRO A CB   9  
ATOM 10463 C CG   . PRO A 1 53 ? -11.977 -0.148  0.942   1.00 0.00 ? 137 PRO A CG   9  
ATOM 10464 C CD   . PRO A 1 53 ? -12.136 -1.168  -0.148  1.00 0.00 ? 137 PRO A CD   9  
ATOM 10465 H HA   . PRO A 1 53 ? -9.166  0.102   -0.378  1.00 0.00 ? 137 PRO A HA   9  
ATOM 10466 H HB2  . PRO A 1 53 ? -10.310 -0.745  2.143   1.00 0.00 ? 137 PRO A HB2  9  
ATOM 10467 H HB3  . PRO A 1 53 ? -10.184 0.887   1.486   1.00 0.00 ? 137 PRO A HB3  9  
ATOM 10468 H HG2  . PRO A 1 53 ? -12.552 -0.436  1.808   1.00 0.00 ? 137 PRO A HG2  9  
ATOM 10469 H HG3  . PRO A 1 53 ? -12.288 0.823   0.593   1.00 0.00 ? 137 PRO A HG3  9  
ATOM 10470 H HD2  . PRO A 1 53 ? -12.291 -2.150  0.269   1.00 0.00 ? 137 PRO A HD2  9  
ATOM 10471 H HD3  . PRO A 1 53 ? -12.951 -0.898  -0.805  1.00 0.00 ? 137 PRO A HD3  9  
ATOM 10472 N N    . LEU A 1 54 ? -9.251  -3.039  -0.005  1.00 0.00 ? 138 LEU A N    9  
ATOM 10473 C CA   . LEU A 1 54 ? -8.509  -4.273  0.265   1.00 0.00 ? 138 LEU A CA   9  
ATOM 10474 C C    . LEU A 1 54 ? -8.681  -4.690  1.726   1.00 0.00 ? 138 LEU A C    9  
ATOM 10475 O O    . LEU A 1 54 ? -9.510  -4.127  2.446   1.00 0.00 ? 138 LEU A O    9  
ATOM 10476 C CB   . LEU A 1 54 ? -7.021  -4.117  -0.083  1.00 0.00 ? 138 LEU A CB   9  
ATOM 10477 C CG   . LEU A 1 54 ? -6.732  -3.625  -1.506  1.00 0.00 ? 138 LEU A CG   9  
ATOM 10478 C CD1  . LEU A 1 54 ? -5.232  -3.538  -1.749  1.00 0.00 ? 138 LEU A CD1  9  
ATOM 10479 C CD2  . LEU A 1 54 ? -7.393  -4.532  -2.534  1.00 0.00 ? 138 LEU A CD2  9  
ATOM 10480 H H    . LEU A 1 54 ? -10.068 -3.094  -0.543  1.00 0.00 ? 138 LEU A H    9  
ATOM 10481 H HA   . LEU A 1 54 ? -8.931  -5.046  -0.360  1.00 0.00 ? 138 LEU A HA   9  
ATOM 10482 H HB2  . LEU A 1 54 ? -6.584  -3.418  0.614   1.00 0.00 ? 138 LEU A HB2  9  
ATOM 10483 H HB3  . LEU A 1 54 ? -6.540  -5.076  0.047   1.00 0.00 ? 138 LEU A HB3  9  
ATOM 10484 H HG   . LEU A 1 54 ? -7.142  -2.633  -1.623  1.00 0.00 ? 138 LEU A HG   9  
ATOM 10485 H HD11 . LEU A 1 54 ? -4.791  -4.518  -1.635  1.00 0.00 ? 138 LEU A HD11 9  
ATOM 10486 H HD12 . LEU A 1 54 ? -4.791  -2.860  -1.035  1.00 0.00 ? 138 LEU A HD12 9  
ATOM 10487 H HD13 . LEU A 1 54 ? -5.051  -3.175  -2.749  1.00 0.00 ? 138 LEU A HD13 9  
ATOM 10488 H HD21 . LEU A 1 54 ? -8.463  -4.524  -2.386  1.00 0.00 ? 138 LEU A HD21 9  
ATOM 10489 H HD22 . LEU A 1 54 ? -7.022  -5.540  -2.419  1.00 0.00 ? 138 LEU A HD22 9  
ATOM 10490 H HD23 . LEU A 1 54 ? -7.164  -4.176  -3.527  1.00 0.00 ? 138 LEU A HD23 9  
ATOM 10491 N N    . GLU A 1 55 ? -7.921  -5.687  2.157   1.00 0.00 ? 139 GLU A N    9  
ATOM 10492 C CA   . GLU A 1 55 ? -8.007  -6.168  3.527   1.00 0.00 ? 139 GLU A CA   9  
ATOM 10493 C C    . GLU A 1 55 ? -6.617  -6.479  4.062   1.00 0.00 ? 139 GLU A C    9  
ATOM 10494 O O    . GLU A 1 55 ? -5.822  -7.138  3.395   1.00 0.00 ? 139 GLU A O    9  
ATOM 10495 C CB   . GLU A 1 55 ? -8.899  -7.407  3.599   1.00 0.00 ? 139 GLU A CB   9  
ATOM 10496 C CG   . GLU A 1 55 ? -9.137  -7.908  5.011   1.00 0.00 ? 139 GLU A CG   9  
ATOM 10497 C CD   . GLU A 1 55 ? -10.199 -8.980  5.075   1.00 0.00 ? 139 GLU A CD   9  
ATOM 10498 O OE1  . GLU A 1 55 ? -11.395 -8.631  5.074   1.00 0.00 ? 139 GLU A OE1  9  
ATOM 10499 O OE2  . GLU A 1 55 ? -9.846  -10.174 5.134   1.00 0.00 ? 139 GLU A OE2  9  
ATOM 10500 H H    . GLU A 1 55 ? -7.284  -6.107  1.543   1.00 0.00 ? 139 GLU A H    9  
ATOM 10501 H HA   . GLU A 1 55 ? -8.445  -5.385  4.126   1.00 0.00 ? 139 GLU A HA   9  
ATOM 10502 H HB2  . GLU A 1 55 ? -9.856  -7.171  3.159   1.00 0.00 ? 139 GLU A HB2  9  
ATOM 10503 H HB3  . GLU A 1 55 ? -8.439  -8.203  3.031   1.00 0.00 ? 139 GLU A HB3  9  
ATOM 10504 H HG2  . GLU A 1 55 ? -8.213  -8.314  5.398   1.00 0.00 ? 139 GLU A HG2  9  
ATOM 10505 H HG3  . GLU A 1 55 ? -9.449  -7.077  5.627   1.00 0.00 ? 139 GLU A HG3  9  
ATOM 10506 N N    . ASP A 1 56 ? -6.333  -6.005  5.272   1.00 0.00 ? 140 ASP A N    9  
ATOM 10507 C CA   . ASP A 1 56 ? -4.998  -6.127  5.852   1.00 0.00 ? 140 ASP A CA   9  
ATOM 10508 C C    . ASP A 1 56 ? -4.674  -7.567  6.225   1.00 0.00 ? 140 ASP A C    9  
ATOM 10509 O O    . ASP A 1 56 ? -3.507  -7.929  6.347   1.00 0.00 ? 140 ASP A O    9  
ATOM 10510 C CB   . ASP A 1 56 ? -4.853  -5.224  7.078   1.00 0.00 ? 140 ASP A CB   9  
ATOM 10511 C CG   . ASP A 1 56 ? -5.652  -5.700  8.276   1.00 0.00 ? 140 ASP A CG   9  
ATOM 10512 O OD1  . ASP A 1 56 ? -6.839  -5.329  8.384   1.00 0.00 ? 140 ASP A OD1  9  
ATOM 10513 O OD2  . ASP A 1 56 ? -5.091  -6.431  9.120   1.00 0.00 ? 140 ASP A OD2  9  
ATOM 10514 H H    . ASP A 1 56 ? -7.039  -5.560  5.790   1.00 0.00 ? 140 ASP A H    9  
ATOM 10515 H HA   . ASP A 1 56 ? -4.291  -5.803  5.103   1.00 0.00 ? 140 ASP A HA   9  
ATOM 10516 H HB2  . ASP A 1 56 ? -3.812  -5.184  7.362   1.00 0.00 ? 140 ASP A HB2  9  
ATOM 10517 H HB3  . ASP A 1 56 ? -5.187  -4.231  6.821   1.00 0.00 ? 140 ASP A HB3  9  
ATOM 10518 N N    . GLN A 1 57 ? -5.705  -8.381  6.399   1.00 0.00 ? 141 GLN A N    9  
ATOM 10519 C CA   . GLN A 1 57 ? -5.522  -9.795  6.710   1.00 0.00 ? 141 GLN A CA   9  
ATOM 10520 C C    . GLN A 1 57 ? -4.853  -10.526 5.547   1.00 0.00 ? 141 GLN A C    9  
ATOM 10521 O O    . GLN A 1 57 ? -4.111  -11.490 5.745   1.00 0.00 ? 141 GLN A O    9  
ATOM 10522 C CB   . GLN A 1 57 ? -6.874  -10.439 7.038   1.00 0.00 ? 141 GLN A CB   9  
ATOM 10523 C CG   . GLN A 1 57 ? -6.854  -11.960 6.995   1.00 0.00 ? 141 GLN A CG   9  
ATOM 10524 C CD   . GLN A 1 57 ? -8.175  -12.588 7.394   1.00 0.00 ? 141 GLN A CD   9  
ATOM 10525 O OE1  . GLN A 1 57 ? -8.379  -12.944 8.554   1.00 0.00 ? 141 GLN A OE1  9  
ATOM 10526 N NE2  . GLN A 1 57 ? -9.084  -12.706 6.442   1.00 0.00 ? 141 GLN A NE2  9  
ATOM 10527 H H    . GLN A 1 57 ? -6.613  -8.023  6.322   1.00 0.00 ? 141 GLN A H    9  
ATOM 10528 H HA   . GLN A 1 57 ? -4.884  -9.863  7.579   1.00 0.00 ? 141 GLN A HA   9  
ATOM 10529 H HB2  . GLN A 1 57 ? -7.174  -10.130 8.028   1.00 0.00 ? 141 GLN A HB2  9  
ATOM 10530 H HB3  . GLN A 1 57 ? -7.607  -10.090 6.326   1.00 0.00 ? 141 GLN A HB3  9  
ATOM 10531 H HG2  . GLN A 1 57 ? -6.618  -12.272 5.989   1.00 0.00 ? 141 GLN A HG2  9  
ATOM 10532 H HG3  . GLN A 1 57 ? -6.086  -12.311 7.669   1.00 0.00 ? 141 GLN A HG3  9  
ATOM 10533 H HE21 . GLN A 1 57 ? -8.862  -12.381 5.543   1.00 0.00 ? 141 GLN A HE21 9  
ATOM 10534 H HE22 . GLN A 1 57 ? -9.954  -13.108 6.674   1.00 0.00 ? 141 GLN A HE22 9  
ATOM 10535 N N    . LEU A 1 58 ? -5.106  -10.052 4.338   1.00 0.00 ? 142 LEU A N    9  
ATOM 10536 C CA   . LEU A 1 58 ? -4.599  -10.705 3.143   1.00 0.00 ? 142 LEU A CA   9  
ATOM 10537 C C    . LEU A 1 58 ? -3.203  -10.195 2.803   1.00 0.00 ? 142 LEU A C    9  
ATOM 10538 O O    . LEU A 1 58 ? -2.898  -9.017  3.002   1.00 0.00 ? 142 LEU A O    9  
ATOM 10539 C CB   . LEU A 1 58 ? -5.558  -10.471 1.975   1.00 0.00 ? 142 LEU A CB   9  
ATOM 10540 C CG   . LEU A 1 58 ? -7.003  -10.906 2.237   1.00 0.00 ? 142 LEU A CG   9  
ATOM 10541 C CD1  . LEU A 1 58 ? -7.877  -10.609 1.030   1.00 0.00 ? 142 LEU A CD1  9  
ATOM 10542 C CD2  . LEU A 1 58 ? -7.063  -12.386 2.593   1.00 0.00 ? 142 LEU A CD2  9  
ATOM 10543 H H    . LEU A 1 58 ? -5.628  -9.227  4.248   1.00 0.00 ? 142 LEU A H    9  
ATOM 10544 H HA   . LEU A 1 58 ? -4.543  -11.764 3.343   1.00 0.00 ? 142 LEU A HA   9  
ATOM 10545 H HB2  . LEU A 1 58 ? -5.557  -9.415  1.739   1.00 0.00 ? 142 LEU A HB2  9  
ATOM 10546 H HB3  . LEU A 1 58 ? -5.191  -11.015 1.118   1.00 0.00 ? 142 LEU A HB3  9  
ATOM 10547 H HG   . LEU A 1 58 ? -7.393  -10.347 3.076   1.00 0.00 ? 142 LEU A HG   9  
ATOM 10548 H HD11 . LEU A 1 58 ? -7.479  -11.117 0.163   1.00 0.00 ? 142 LEU A HD11 9  
ATOM 10549 H HD12 . LEU A 1 58 ? -7.892  -9.545  0.849   1.00 0.00 ? 142 LEU A HD12 9  
ATOM 10550 H HD13 . LEU A 1 58 ? -8.884  -10.954 1.221   1.00 0.00 ? 142 LEU A HD13 9  
ATOM 10551 H HD21 . LEU A 1 58 ? -8.087  -12.668 2.789   1.00 0.00 ? 142 LEU A HD21 9  
ATOM 10552 H HD22 . LEU A 1 58 ? -6.465  -12.567 3.475   1.00 0.00 ? 142 LEU A HD22 9  
ATOM 10553 H HD23 . LEU A 1 58 ? -6.678  -12.970 1.771   1.00 0.00 ? 142 LEU A HD23 9  
ATOM 10554 N N    . PRO A 1 59 ? -2.331  -11.085 2.302   1.00 0.00 ? 143 PRO A N    9  
ATOM 10555 C CA   . PRO A 1 59 ? -0.962  -10.726 1.932   1.00 0.00 ? 143 PRO A CA   9  
ATOM 10556 C C    . PRO A 1 59 ? -0.931  -9.723  0.785   1.00 0.00 ? 143 PRO A C    9  
ATOM 10557 O O    . PRO A 1 59 ? -1.596  -9.909  -0.236  1.00 0.00 ? 143 PRO A O    9  
ATOM 10558 C CB   . PRO A 1 59 ? -0.328  -12.055 1.499   1.00 0.00 ? 143 PRO A CB   9  
ATOM 10559 C CG   . PRO A 1 59 ? -1.242  -13.120 2.006   1.00 0.00 ? 143 PRO A CG   9  
ATOM 10560 C CD   . PRO A 1 59 ? -2.611  -12.508 2.053   1.00 0.00 ? 143 PRO A CD   9  
ATOM 10561 H HA   . PRO A 1 59 ? -0.419  -10.323 2.776   1.00 0.00 ? 143 PRO A HA   9  
ATOM 10562 H HB2  . PRO A 1 59 ? -0.253  -12.083 0.422   1.00 0.00 ? 143 PRO A HB2  9  
ATOM 10563 H HB3  . PRO A 1 59 ? 0.658   -12.144 1.933   1.00 0.00 ? 143 PRO A HB3  9  
ATOM 10564 H HG2  . PRO A 1 59 ? -1.232  -13.963 1.333   1.00 0.00 ? 143 PRO A HG2  9  
ATOM 10565 H HG3  . PRO A 1 59 ? -0.935  -13.426 2.997   1.00 0.00 ? 143 PRO A HG3  9  
ATOM 10566 H HD2  . PRO A 1 59 ? -3.118  -12.641 1.107   1.00 0.00 ? 143 PRO A HD2  9  
ATOM 10567 H HD3  . PRO A 1 59 ? -3.191  -12.934 2.859   1.00 0.00 ? 143 PRO A HD3  9  
ATOM 10568 N N    . LEU A 1 60 ? -0.140  -8.671  0.960   1.00 0.00 ? 144 LEU A N    9  
ATOM 10569 C CA   . LEU A 1 60 ? -0.018  -7.604  -0.032  1.00 0.00 ? 144 LEU A CA   9  
ATOM 10570 C C    . LEU A 1 60 ? 0.378   -8.183  -1.388  1.00 0.00 ? 144 LEU A C    9  
ATOM 10571 O O    . LEU A 1 60 ? -0.087  -7.727  -2.436  1.00 0.00 ? 144 LEU A O    9  
ATOM 10572 C CB   . LEU A 1 60 ? 1.031   -6.591  0.449   1.00 0.00 ? 144 LEU A CB   9  
ATOM 10573 C CG   . LEU A 1 60 ? 0.907   -5.165  -0.100  1.00 0.00 ? 144 LEU A CG   9  
ATOM 10574 C CD1  . LEU A 1 60 ? 1.775   -4.224  0.716   1.00 0.00 ? 144 LEU A CD1  9  
ATOM 10575 C CD2  . LEU A 1 60 ? 1.310   -5.096  -1.566  1.00 0.00 ? 144 LEU A CD2  9  
ATOM 10576 H H    . LEU A 1 60 ? 0.381   -8.603  1.795   1.00 0.00 ? 144 LEU A H    9  
ATOM 10577 H HA   . LEU A 1 60 ? -0.975  -7.113  -0.118  1.00 0.00 ? 144 LEU A HA   9  
ATOM 10578 H HB2  . LEU A 1 60 ? 0.979   -6.542  1.526   1.00 0.00 ? 144 LEU A HB2  9  
ATOM 10579 H HB3  . LEU A 1 60 ? 2.006   -6.971  0.176   1.00 0.00 ? 144 LEU A HB3  9  
ATOM 10580 H HG   . LEU A 1 60 ? -0.120  -4.838  -0.015  1.00 0.00 ? 144 LEU A HG   9  
ATOM 10581 H HD11 . LEU A 1 60 ? 2.810   -4.514  0.618   1.00 0.00 ? 144 LEU A HD11 9  
ATOM 10582 H HD12 . LEU A 1 60 ? 1.482   -4.276  1.756   1.00 0.00 ? 144 LEU A HD12 9  
ATOM 10583 H HD13 . LEU A 1 60 ? 1.648   -3.213  0.357   1.00 0.00 ? 144 LEU A HD13 9  
ATOM 10584 H HD21 . LEU A 1 60 ? 2.347   -5.387  -1.669  1.00 0.00 ? 144 LEU A HD21 9  
ATOM 10585 H HD22 . LEU A 1 60 ? 1.184   -4.087  -1.928  1.00 0.00 ? 144 LEU A HD22 9  
ATOM 10586 H HD23 . LEU A 1 60 ? 0.691   -5.766  -2.144  1.00 0.00 ? 144 LEU A HD23 9  
ATOM 10587 N N    . GLY A 1 61 ? 1.206   -9.223  -1.353  1.00 0.00 ? 145 GLY A N    9  
ATOM 10588 C CA   . GLY A 1 61 ? 1.702   -9.840  -2.568  1.00 0.00 ? 145 GLY A CA   9  
ATOM 10589 C C    . GLY A 1 61 ? 0.604   -10.368 -3.475  1.00 0.00 ? 145 GLY A C    9  
ATOM 10590 O O    . GLY A 1 61 ? 0.807   -10.497 -4.677  1.00 0.00 ? 145 GLY A O    9  
ATOM 10591 H H    . GLY A 1 61 ? 1.482   -9.578  -0.482  1.00 0.00 ? 145 GLY A H    9  
ATOM 10592 H HA2  . GLY A 1 61 ? 2.277   -9.110  -3.115  1.00 0.00 ? 145 GLY A HA2  9  
ATOM 10593 H HA3  . GLY A 1 61 ? 2.352   -10.662 -2.299  1.00 0.00 ? 145 GLY A HA3  9  
ATOM 10594 N N    . GLU A 1 62 ? -0.565  -10.655 -2.911  1.00 0.00 ? 146 GLU A N    9  
ATOM 10595 C CA   . GLU A 1 62 ? -1.674  -11.182 -3.696  1.00 0.00 ? 146 GLU A CA   9  
ATOM 10596 C C    . GLU A 1 62 ? -2.164  -10.137 -4.699  1.00 0.00 ? 146 GLU A C    9  
ATOM 10597 O O    . GLU A 1 62 ? -2.621  -10.472 -5.791  1.00 0.00 ? 146 GLU A O    9  
ATOM 10598 C CB   . GLU A 1 62 ? -2.815  -11.619 -2.776  1.00 0.00 ? 146 GLU A CB   9  
ATOM 10599 C CG   . GLU A 1 62 ? -3.956  -12.313 -3.504  1.00 0.00 ? 146 GLU A CG   9  
ATOM 10600 C CD   . GLU A 1 62 ? -5.020  -12.844 -2.565  1.00 0.00 ? 146 GLU A CD   9  
ATOM 10601 O OE1  . GLU A 1 62 ? -4.801  -13.912 -1.954  1.00 0.00 ? 146 GLU A OE1  9  
ATOM 10602 O OE2  . GLU A 1 62 ? -6.090  -12.211 -2.447  1.00 0.00 ? 146 GLU A OE2  9  
ATOM 10603 H H    . GLU A 1 62 ? -0.691  -10.495 -1.951  1.00 0.00 ? 146 GLU A H    9  
ATOM 10604 H HA   . GLU A 1 62 ? -1.312  -12.040 -4.241  1.00 0.00 ? 146 GLU A HA   9  
ATOM 10605 H HB2  . GLU A 1 62 ? -2.422  -12.296 -2.034  1.00 0.00 ? 146 GLU A HB2  9  
ATOM 10606 H HB3  . GLU A 1 62 ? -3.212  -10.744 -2.278  1.00 0.00 ? 146 GLU A HB3  9  
ATOM 10607 H HG2  . GLU A 1 62 ? -4.418  -11.608 -4.178  1.00 0.00 ? 146 GLU A HG2  9  
ATOM 10608 H HG3  . GLU A 1 62 ? -3.554  -13.141 -4.070  1.00 0.00 ? 146 GLU A HG3  9  
ATOM 10609 N N    . TYR A 1 63 ? -2.045  -8.869  -4.327  1.00 0.00 ? 147 TYR A N    9  
ATOM 10610 C CA   . TYR A 1 63 ? -2.468  -7.776  -5.193  1.00 0.00 ? 147 TYR A CA   9  
ATOM 10611 C C    . TYR A 1 63 ? -1.272  -7.159  -5.910  1.00 0.00 ? 147 TYR A C    9  
ATOM 10612 O O    . TYR A 1 63 ? -1.394  -6.636  -7.021  1.00 0.00 ? 147 TYR A O    9  
ATOM 10613 C CB   . TYR A 1 63 ? -3.173  -6.687  -4.379  1.00 0.00 ? 147 TYR A CB   9  
ATOM 10614 C CG   . TYR A 1 63 ? -4.330  -7.184  -3.544  1.00 0.00 ? 147 TYR A CG   9  
ATOM 10615 C CD1  . TYR A 1 63 ? -5.529  -7.560  -4.135  1.00 0.00 ? 147 TYR A CD1  9  
ATOM 10616 C CD2  . TYR A 1 63 ? -4.225  -7.268  -2.160  1.00 0.00 ? 147 TYR A CD2  9  
ATOM 10617 C CE1  . TYR A 1 63 ? -6.591  -8.005  -3.372  1.00 0.00 ? 147 TYR A CE1  9  
ATOM 10618 C CE2  . TYR A 1 63 ? -5.284  -7.709  -1.389  1.00 0.00 ? 147 TYR A CE2  9  
ATOM 10619 C CZ   . TYR A 1 63 ? -6.464  -8.077  -2.001  1.00 0.00 ? 147 TYR A CZ   9  
ATOM 10620 O OH   . TYR A 1 63 ? -7.519  -8.513  -1.239  1.00 0.00 ? 147 TYR A OH   9  
ATOM 10621 H H    . TYR A 1 63 ? -1.663  -8.662  -3.448  1.00 0.00 ? 147 TYR A H    9  
ATOM 10622 H HA   . TYR A 1 63 ? -3.154  -8.171  -5.927  1.00 0.00 ? 147 TYR A HA   9  
ATOM 10623 H HB2  . TYR A 1 63 ? -2.457  -6.231  -3.712  1.00 0.00 ? 147 TYR A HB2  9  
ATOM 10624 H HB3  . TYR A 1 63 ? -3.553  -5.935  -5.057  1.00 0.00 ? 147 TYR A HB3  9  
ATOM 10625 H HD1  . TYR A 1 63 ? -5.627  -7.502  -5.209  1.00 0.00 ? 147 TYR A HD1  9  
ATOM 10626 H HD2  . TYR A 1 63 ? -3.300  -6.979  -1.683  1.00 0.00 ? 147 TYR A HD2  9  
ATOM 10627 H HE1  . TYR A 1 63 ? -7.516  -8.294  -3.849  1.00 0.00 ? 147 TYR A HE1  9  
ATOM 10628 H HE2  . TYR A 1 63 ? -5.183  -7.767  -0.314  1.00 0.00 ? 147 TYR A HE2  9  
ATOM 10629 H HH   . TYR A 1 63 ? -7.843  -9.356  -1.590  1.00 0.00 ? 147 TYR A HH   9  
ATOM 10630 N N    . GLY A 1 64 ? -0.119  -7.229  -5.265  1.00 0.00 ? 148 GLY A N    9  
ATOM 10631 C CA   . GLY A 1 64 ? 1.059   -6.543  -5.757  1.00 0.00 ? 148 GLY A CA   9  
ATOM 10632 C C    . GLY A 1 64 ? 2.026   -7.440  -6.504  1.00 0.00 ? 148 GLY A C    9  
ATOM 10633 O O    . GLY A 1 64 ? 3.108   -6.996  -6.857  1.00 0.00 ? 148 GLY A O    9  
ATOM 10634 H H    . GLY A 1 64 ? -0.062  -7.750  -4.435  1.00 0.00 ? 148 GLY A H    9  
ATOM 10635 H HA2  . GLY A 1 64 ? 0.737   -5.755  -6.427  1.00 0.00 ? 148 GLY A HA2  9  
ATOM 10636 H HA3  . GLY A 1 64 ? 1.574   -6.097  -4.923  1.00 0.00 ? 148 GLY A HA3  9  
ATOM 10637 N N    . LEU A 1 65 ? 1.644   -8.698  -6.726  1.00 0.00 ? 149 LEU A N    9  
ATOM 10638 C CA   . LEU A 1 65 ? 2.509   -9.702  -7.374  1.00 0.00 ? 149 LEU A CA   9  
ATOM 10639 C C    . LEU A 1 65 ? 3.206   -9.175  -8.640  1.00 0.00 ? 149 LEU A C    9  
ATOM 10640 O O    . LEU A 1 65 ? 4.306   -9.612  -8.974  1.00 0.00 ? 149 LEU A O    9  
ATOM 10641 C CB   . LEU A 1 65 ? 1.710   -10.972 -7.726  1.00 0.00 ? 149 LEU A CB   9  
ATOM 10642 C CG   . LEU A 1 65 ? 0.698   -10.843 -8.875  1.00 0.00 ? 149 LEU A CG   9  
ATOM 10643 C CD1  . LEU A 1 65 ? 0.175   -12.215 -9.269  1.00 0.00 ? 149 LEU A CD1  9  
ATOM 10644 C CD2  . LEU A 1 65 ? -0.461  -9.934  -8.487  1.00 0.00 ? 149 LEU A CD2  9  
ATOM 10645 H H    . LEU A 1 65 ? 0.752   -8.975  -6.432  1.00 0.00 ? 149 LEU A H    9  
ATOM 10646 H HA   . LEU A 1 65 ? 3.272   -9.972  -6.660  1.00 0.00 ? 149 LEU A HA   9  
ATOM 10647 H HB2  . LEU A 1 65 ? 2.413   -11.748 -7.988  1.00 0.00 ? 149 LEU A HB2  9  
ATOM 10648 H HB3  . LEU A 1 65 ? 1.174   -11.282 -6.842  1.00 0.00 ? 149 LEU A HB3  9  
ATOM 10649 H HG   . LEU A 1 65 ? 1.189   -10.413 -9.734  1.00 0.00 ? 149 LEU A HG   9  
ATOM 10650 H HD11 . LEU A 1 65 ? 1.000   -12.841 -9.572  1.00 0.00 ? 149 LEU A HD11 9  
ATOM 10651 H HD12 . LEU A 1 65 ? -0.520  -12.114 -10.090 1.00 0.00 ? 149 LEU A HD12 9  
ATOM 10652 H HD13 . LEU A 1 65 ? -0.329  -12.664 -8.427  1.00 0.00 ? 149 LEU A HD13 9  
ATOM 10653 H HD21 . LEU A 1 65 ? -0.072  -8.974  -8.174  1.00 0.00 ? 149 LEU A HD21 9  
ATOM 10654 H HD22 . LEU A 1 65 ? -1.015  -10.380 -7.675  1.00 0.00 ? 149 LEU A HD22 9  
ATOM 10655 H HD23 . LEU A 1 65 ? -1.112  -9.799  -9.338  1.00 0.00 ? 149 LEU A HD23 9  
ATOM 10656 N N    . LYS A 1 66 ? 2.563   -8.251  -9.338  1.00 0.00 ? 150 LYS A N    9  
ATOM 10657 C CA   . LYS A 1 66 ? 3.147   -7.651  -10.529 1.00 0.00 ? 150 LYS A CA   9  
ATOM 10658 C C    . LYS A 1 66 ? 3.972   -6.417  -10.148 1.00 0.00 ? 150 LYS A C    9  
ATOM 10659 O O    . LYS A 1 66 ? 3.435   -5.460  -9.587  1.00 0.00 ? 150 LYS A O    9  
ATOM 10660 C CB   . LYS A 1 66 ? 2.037   -7.267  -11.518 1.00 0.00 ? 150 LYS A CB   9  
ATOM 10661 C CG   . LYS A 1 66 ? 2.526   -6.568  -12.779 1.00 0.00 ? 150 LYS A CG   9  
ATOM 10662 C CD   . LYS A 1 66 ? 3.452   -7.449  -13.608 1.00 0.00 ? 150 LYS A CD   9  
ATOM 10663 C CE   . LYS A 1 66 ? 2.766   -8.723  -14.070 1.00 0.00 ? 150 LYS A CE   9  
ATOM 10664 N NZ   . LYS A 1 66 ? 3.603   -9.479  -15.037 1.00 0.00 ? 150 LYS A NZ   9  
ATOM 10665 H H    . LYS A 1 66 ? 1.682   -7.954  -9.037  1.00 0.00 ? 150 LYS A H    9  
ATOM 10666 H HA   . LYS A 1 66 ? 3.797   -8.382  -10.988 1.00 0.00 ? 150 LYS A HA   9  
ATOM 10667 H HB2  . LYS A 1 66 ? 1.509   -8.161  -11.814 1.00 0.00 ? 150 LYS A HB2  9  
ATOM 10668 H HB3  . LYS A 1 66 ? 1.347   -6.607  -11.016 1.00 0.00 ? 150 LYS A HB3  9  
ATOM 10669 H HG2  . LYS A 1 66 ? 1.672   -6.302  -13.381 1.00 0.00 ? 150 LYS A HG2  9  
ATOM 10670 H HG3  . LYS A 1 66 ? 3.059   -5.671  -12.493 1.00 0.00 ? 150 LYS A HG3  9  
ATOM 10671 H HD2  . LYS A 1 66 ? 3.776   -6.894  -14.477 1.00 0.00 ? 150 LYS A HD2  9  
ATOM 10672 H HD3  . LYS A 1 66 ? 4.311   -7.711  -13.008 1.00 0.00 ? 150 LYS A HD3  9  
ATOM 10673 H HE2  . LYS A 1 66 ? 2.576   -9.346  -13.208 1.00 0.00 ? 150 LYS A HE2  9  
ATOM 10674 H HE3  . LYS A 1 66 ? 1.829   -8.463  -14.541 1.00 0.00 ? 150 LYS A HE3  9  
ATOM 10675 H HZ1  . LYS A 1 66 ? 4.538   -9.689  -14.621 1.00 0.00 ? 150 LYS A HZ1  9  
ATOM 10676 H HZ2  . LYS A 1 66 ? 3.739   -8.918  -15.906 1.00 0.00 ? 150 LYS A HZ2  9  
ATOM 10677 H HZ3  . LYS A 1 66 ? 3.137   -10.375 -15.291 1.00 0.00 ? 150 LYS A HZ3  9  
ATOM 10678 N N    . PRO A 1 67 ? 5.285   -6.434  -10.455 1.00 0.00 ? 151 PRO A N    9  
ATOM 10679 C CA   . PRO A 1 67 ? 6.210   -5.330  -10.138 1.00 0.00 ? 151 PRO A CA   9  
ATOM 10680 C C    . PRO A 1 67 ? 5.957   -4.100  -11.005 1.00 0.00 ? 151 PRO A C    9  
ATOM 10681 O O    . PRO A 1 67 ? 6.834   -3.634  -11.734 1.00 0.00 ? 151 PRO A O    9  
ATOM 10682 C CB   . PRO A 1 67 ? 7.591   -5.929  -10.418 1.00 0.00 ? 151 PRO A CB   9  
ATOM 10683 C CG   . PRO A 1 67 ? 7.349   -7.017  -11.409 1.00 0.00 ? 151 PRO A CG   9  
ATOM 10684 C CD   . PRO A 1 67 ? 5.968   -7.547  -11.135 1.00 0.00 ? 151 PRO A CD   9  
ATOM 10685 H HA   . PRO A 1 67 ? 6.141   -5.048  -9.097  1.00 0.00 ? 151 PRO A HA   9  
ATOM 10686 H HB2  . PRO A 1 67 ? 8.241   -5.166  -10.818 1.00 0.00 ? 151 PRO A HB2  9  
ATOM 10687 H HB3  . PRO A 1 67 ? 8.007   -6.320  -9.502  1.00 0.00 ? 151 PRO A HB3  9  
ATOM 10688 H HG2  . PRO A 1 67 ? 7.403   -6.616  -12.411 1.00 0.00 ? 151 PRO A HG2  9  
ATOM 10689 H HG3  . PRO A 1 67 ? 8.082   -7.799  -11.279 1.00 0.00 ? 151 PRO A HG3  9  
ATOM 10690 H HD2  . PRO A 1 67 ? 5.470   -7.790  -12.062 1.00 0.00 ? 151 PRO A HD2  9  
ATOM 10691 H HD3  . PRO A 1 67 ? 6.015   -8.415  -10.496 1.00 0.00 ? 151 PRO A HD3  9  
ATOM 10692 N N    . LEU A 1 68 ? 4.760   -3.563  -10.869 1.00 0.00 ? 152 LEU A N    9  
ATOM 10693 C CA   . LEU A 1 68 ? 4.268   -2.481  -11.710 1.00 0.00 ? 152 LEU A CA   9  
ATOM 10694 C C    . LEU A 1 68 ? 2.852   -2.106  -11.274 1.00 0.00 ? 152 LEU A C    9  
ATOM 10695 O O    . LEU A 1 68 ? 2.410   -0.971  -11.477 1.00 0.00 ? 152 LEU A O    9  
ATOM 10696 C CB   . LEU A 1 68 ? 4.268   -2.911  -13.186 1.00 0.00 ? 152 LEU A CB   9  
ATOM 10697 C CG   . LEU A 1 68 ? 3.890   -1.821  -14.190 1.00 0.00 ? 152 LEU A CG   9  
ATOM 10698 C CD1  . LEU A 1 68 ? 4.893   -0.681  -14.145 1.00 0.00 ? 152 LEU A CD1  9  
ATOM 10699 C CD2  . LEU A 1 68 ? 3.801   -2.398  -15.593 1.00 0.00 ? 152 LEU A CD2  9  
ATOM 10700 H H    . LEU A 1 68 ? 4.188   -3.901  -10.149 1.00 0.00 ? 152 LEU A H    9  
ATOM 10701 H HA   . LEU A 1 68 ? 4.920   -1.629  -11.583 1.00 0.00 ? 152 LEU A HA   9  
ATOM 10702 H HB2  . LEU A 1 68 ? 5.256   -3.271  -13.432 1.00 0.00 ? 152 LEU A HB2  9  
ATOM 10703 H HB3  . LEU A 1 68 ? 3.570   -3.726  -13.299 1.00 0.00 ? 152 LEU A HB3  9  
ATOM 10704 H HG   . LEU A 1 68 ? 2.921   -1.423  -13.930 1.00 0.00 ? 152 LEU A HG   9  
ATOM 10705 H HD11 . LEU A 1 68 ? 4.619   0.069   -14.871 1.00 0.00 ? 152 LEU A HD11 9  
ATOM 10706 H HD12 . LEU A 1 68 ? 5.879   -1.059  -14.374 1.00 0.00 ? 152 LEU A HD12 9  
ATOM 10707 H HD13 . LEU A 1 68 ? 4.897   -0.241  -13.158 1.00 0.00 ? 152 LEU A HD13 9  
ATOM 10708 H HD21 . LEU A 1 68 ? 3.462   -1.633  -16.276 1.00 0.00 ? 152 LEU A HD21 9  
ATOM 10709 H HD22 . LEU A 1 68 ? 3.104   -3.222  -15.600 1.00 0.00 ? 152 LEU A HD22 9  
ATOM 10710 H HD23 . LEU A 1 68 ? 4.776   -2.748  -15.900 1.00 0.00 ? 152 LEU A HD23 9  
ATOM 10711 N N    . SER A 1 69 ? 2.151   -3.087  -10.691 1.00 0.00 ? 153 SER A N    9  
ATOM 10712 C CA   . SER A 1 69 ? 0.826   -2.881  -10.123 1.00 0.00 ? 153 SER A CA   9  
ATOM 10713 C C    . SER A 1 69 ? 0.801   -1.611  -9.274  1.00 0.00 ? 153 SER A C    9  
ATOM 10714 O O    . SER A 1 69 ? 1.676   -1.392  -8.429  1.00 0.00 ? 153 SER A O    9  
ATOM 10715 C CB   . SER A 1 69 ? 0.426   -4.099  -9.280  1.00 0.00 ? 153 SER A CB   9  
ATOM 10716 O OG   . SER A 1 69 ? -0.915  -4.003  -8.825  1.00 0.00 ? 153 SER A OG   9  
ATOM 10717 H H    . SER A 1 69 ? 2.533   -3.986  -10.655 1.00 0.00 ? 153 SER A H    9  
ATOM 10718 H HA   . SER A 1 69 ? 0.127   -2.771  -10.940 1.00 0.00 ? 153 SER A HA   9  
ATOM 10719 H HB2  . SER A 1 69 ? 0.523   -4.992  -9.876  1.00 0.00 ? 153 SER A HB2  9  
ATOM 10720 H HB3  . SER A 1 69 ? 1.078   -4.168  -8.421  1.00 0.00 ? 153 SER A HB3  9  
ATOM 10721 H HG   . SER A 1 69 ? -1.103  -4.739  -8.226  1.00 0.00 ? 153 SER A HG   9  
ATOM 10722 N N    . THR A 1 70 ? -0.190  -0.772  -9.520  1.00 0.00 ? 154 THR A N    9  
ATOM 10723 C CA   . THR A 1 70 ? -0.250  0.532   -8.897  1.00 0.00 ? 154 THR A CA   9  
ATOM 10724 C C    . THR A 1 70 ? -1.390  0.628   -7.890  1.00 0.00 ? 154 THR A C    9  
ATOM 10725 O O    . THR A 1 70 ? -2.540  0.307   -8.196  1.00 0.00 ? 154 THR A O    9  
ATOM 10726 C CB   . THR A 1 70 ? -0.415  1.624   -9.966  1.00 0.00 ? 154 THR A CB   9  
ATOM 10727 O OG1  . THR A 1 70 ? 0.619   1.484   -10.947 1.00 0.00 ? 154 THR A OG1  9  
ATOM 10728 C CG2  . THR A 1 70 ? -0.349  3.014   -9.349  1.00 0.00 ? 154 THR A CG2  9  
ATOM 10729 H H    . THR A 1 70 ? -0.910  -1.045  -10.131 1.00 0.00 ? 154 THR A H    9  
ATOM 10730 H HA   . THR A 1 70 ? 0.686   0.699   -8.388  1.00 0.00 ? 154 THR A HA   9  
ATOM 10731 H HB   . THR A 1 70 ? -1.378  1.499   -10.443 1.00 0.00 ? 154 THR A HB   9  
ATOM 10732 H HG1  . THR A 1 70 ? 1.115   0.672   -10.770 1.00 0.00 ? 154 THR A HG1  9  
ATOM 10733 H HG21 . THR A 1 70 ? 0.602   3.146   -8.855  1.00 0.00 ? 154 THR A HG21 9  
ATOM 10734 H HG22 . THR A 1 70 ? -1.148  3.127   -8.629  1.00 0.00 ? 154 THR A HG22 9  
ATOM 10735 H HG23 . THR A 1 70 ? -0.458  3.756   -10.125 1.00 0.00 ? 154 THR A HG23 9  
ATOM 10736 N N    . VAL A 1 71 ? -1.051  1.067   -6.689  1.00 0.00 ? 155 VAL A N    9  
ATOM 10737 C CA   . VAL A 1 71 ? -2.037  1.320   -5.655  1.00 0.00 ? 155 VAL A CA   9  
ATOM 10738 C C    . VAL A 1 71 ? -2.340  2.813   -5.612  1.00 0.00 ? 155 VAL A C    9  
ATOM 10739 O O    . VAL A 1 71 ? -1.433  3.635   -5.736  1.00 0.00 ? 155 VAL A O    9  
ATOM 10740 C CB   . VAL A 1 71 ? -1.540  0.851   -4.270  1.00 0.00 ? 155 VAL A CB   9  
ATOM 10741 C CG1  . VAL A 1 71 ? -2.611  1.046   -3.204  1.00 0.00 ? 155 VAL A CG1  9  
ATOM 10742 C CG2  . VAL A 1 71 ? -1.098  -0.604  -4.327  1.00 0.00 ? 155 VAL A CG2  9  
ATOM 10743 H H    . VAL A 1 71 ? -0.101  1.240   -6.496  1.00 0.00 ? 155 VAL A H    9  
ATOM 10744 H HA   . VAL A 1 71 ? -2.940  0.779   -5.905  1.00 0.00 ? 155 VAL A HA   9  
ATOM 10745 H HB   . VAL A 1 71 ? -0.683  1.450   -3.996  1.00 0.00 ? 155 VAL A HB   9  
ATOM 10746 H HG11 . VAL A 1 71 ? -3.484  0.462   -3.459  1.00 0.00 ? 155 VAL A HG11 9  
ATOM 10747 H HG12 . VAL A 1 71 ? -2.879  2.090   -3.153  1.00 0.00 ? 155 VAL A HG12 9  
ATOM 10748 H HG13 . VAL A 1 71 ? -2.229  0.725   -2.246  1.00 0.00 ? 155 VAL A HG13 9  
ATOM 10749 H HG21 . VAL A 1 71 ? -0.789  -0.925  -3.343  1.00 0.00 ? 155 VAL A HG21 9  
ATOM 10750 H HG22 . VAL A 1 71 ? -0.269  -0.701  -5.014  1.00 0.00 ? 155 VAL A HG22 9  
ATOM 10751 H HG23 . VAL A 1 71 ? -1.919  -1.218  -4.664  1.00 0.00 ? 155 VAL A HG23 9  
ATOM 10752 N N    . PHE A 1 72 ? -3.606  3.167   -5.458  1.00 0.00 ? 156 PHE A N    9  
ATOM 10753 C CA   . PHE A 1 72 ? -4.004  4.567   -5.471  1.00 0.00 ? 156 PHE A CA   9  
ATOM 10754 C C    . PHE A 1 72 ? -4.441  5.030   -4.090  1.00 0.00 ? 156 PHE A C    9  
ATOM 10755 O O    . PHE A 1 72 ? -5.416  4.526   -3.532  1.00 0.00 ? 156 PHE A O    9  
ATOM 10756 C CB   . PHE A 1 72 ? -5.136  4.796   -6.472  1.00 0.00 ? 156 PHE A CB   9  
ATOM 10757 C CG   . PHE A 1 72 ? -4.741  4.520   -7.893  1.00 0.00 ? 156 PHE A CG   9  
ATOM 10758 C CD1  . PHE A 1 72 ? -4.177  5.514   -8.676  1.00 0.00 ? 156 PHE A CD1  9  
ATOM 10759 C CD2  . PHE A 1 72 ? -4.930  3.264   -8.446  1.00 0.00 ? 156 PHE A CD2  9  
ATOM 10760 C CE1  . PHE A 1 72 ? -3.810  5.259   -9.983  1.00 0.00 ? 156 PHE A CE1  9  
ATOM 10761 C CE2  . PHE A 1 72 ? -4.565  3.004   -9.749  1.00 0.00 ? 156 PHE A CE2  9  
ATOM 10762 C CZ   . PHE A 1 72 ? -4.004  4.002   -10.519 1.00 0.00 ? 156 PHE A CZ   9  
ATOM 10763 H H    . PHE A 1 72 ? -4.293  2.473   -5.329  1.00 0.00 ? 156 PHE A H    9  
ATOM 10764 H HA   . PHE A 1 72 ? -3.146  5.147   -5.775  1.00 0.00 ? 156 PHE A HA   9  
ATOM 10765 H HB2  . PHE A 1 72 ? -5.963  4.148   -6.224  1.00 0.00 ? 156 PHE A HB2  9  
ATOM 10766 H HB3  . PHE A 1 72 ? -5.459  5.825   -6.407  1.00 0.00 ? 156 PHE A HB3  9  
ATOM 10767 H HD1  . PHE A 1 72 ? -4.025  6.498   -8.255  1.00 0.00 ? 156 PHE A HD1  9  
ATOM 10768 H HD2  . PHE A 1 72 ? -5.370  2.481   -7.844  1.00 0.00 ? 156 PHE A HD2  9  
ATOM 10769 H HE1  . PHE A 1 72 ? -3.372  6.041   -10.583 1.00 0.00 ? 156 PHE A HE1  9  
ATOM 10770 H HE2  . PHE A 1 72 ? -4.717  2.019   -10.167 1.00 0.00 ? 156 PHE A HE2  9  
ATOM 10771 H HZ   . PHE A 1 72 ? -3.717  3.803   -11.540 1.00 0.00 ? 156 PHE A HZ   9  
ATOM 10772 N N    . MET A 1 73 ? -3.709  5.986   -3.539  1.00 0.00 ? 157 MET A N    9  
ATOM 10773 C CA   . MET A 1 73 ? -4.089  6.607   -2.281  1.00 0.00 ? 157 MET A CA   9  
ATOM 10774 C C    . MET A 1 73 ? -5.160  7.656   -2.526  1.00 0.00 ? 157 MET A C    9  
ATOM 10775 O O    . MET A 1 73 ? -4.869  8.775   -2.944  1.00 0.00 ? 157 MET A O    9  
ATOM 10776 C CB   . MET A 1 73 ? -2.879  7.245   -1.601  1.00 0.00 ? 157 MET A CB   9  
ATOM 10777 C CG   . MET A 1 73 ? -1.948  6.249   -0.932  1.00 0.00 ? 157 MET A CG   9  
ATOM 10778 S SD   . MET A 1 73 ? -0.434  7.026   -0.330  1.00 0.00 ? 157 MET A SD   9  
ATOM 10779 C CE   . MET A 1 73 ? -1.105  8.337   0.693   1.00 0.00 ? 157 MET A CE   9  
ATOM 10780 H H    . MET A 1 73 ? -2.889  6.285   -3.992  1.00 0.00 ? 157 MET A H    9  
ATOM 10781 H HA   . MET A 1 73 ? -4.495  5.839   -1.637  1.00 0.00 ? 157 MET A HA   9  
ATOM 10782 H HB2  . MET A 1 73 ? -2.312  7.787   -2.342  1.00 0.00 ? 157 MET A HB2  9  
ATOM 10783 H HB3  . MET A 1 73 ? -3.225  7.940   -0.849  1.00 0.00 ? 157 MET A HB3  9  
ATOM 10784 H HG2  . MET A 1 73 ? -2.463  5.800   -0.093  1.00 0.00 ? 157 MET A HG2  9  
ATOM 10785 H HG3  . MET A 1 73 ? -1.687  5.482   -1.643  1.00 0.00 ? 157 MET A HG3  9  
ATOM 10786 H HE1  . MET A 1 73 ? -0.295  8.914   1.116   1.00 0.00 ? 157 MET A HE1  9  
ATOM 10787 H HE2  . MET A 1 73 ? -1.693  7.907   1.490   1.00 0.00 ? 157 MET A HE2  9  
ATOM 10788 H HE3  . MET A 1 73 ? -1.730  8.980   0.092   1.00 0.00 ? 157 MET A HE3  9  
ATOM 10789 N N    . ASN A 1 74 ? -6.400  7.281   -2.287  1.00 0.00 ? 158 ASN A N    9  
ATOM 10790 C CA   . ASN A 1 74 ? -7.515  8.190   -2.470  1.00 0.00 ? 158 ASN A CA   9  
ATOM 10791 C C    . ASN A 1 74 ? -7.629  9.135   -1.286  1.00 0.00 ? 158 ASN A C    9  
ATOM 10792 O O    . ASN A 1 74 ? -8.177  8.788   -0.238  1.00 0.00 ? 158 ASN A O    9  
ATOM 10793 C CB   . ASN A 1 74 ? -8.821  7.416   -2.670  1.00 0.00 ? 158 ASN A CB   9  
ATOM 10794 C CG   . ASN A 1 74 ? -9.190  7.268   -4.134  1.00 0.00 ? 158 ASN A CG   9  
ATOM 10795 O OD1  . ASN A 1 74 ? -9.908  8.097   -4.689  1.00 0.00 ? 158 ASN A OD1  9  
ATOM 10796 N ND2  . ASN A 1 74 ? -8.707  6.210   -4.767  1.00 0.00 ? 158 ASN A ND2  9  
ATOM 10797 H H    . ASN A 1 74 ? -6.573  6.371   -1.962  1.00 0.00 ? 158 ASN A H    9  
ATOM 10798 H HA   . ASN A 1 74 ? -7.318  8.775   -3.356  1.00 0.00 ? 158 ASN A HA   9  
ATOM 10799 H HB2  . ASN A 1 74 ? -8.714  6.428   -2.248  1.00 0.00 ? 158 ASN A HB2  9  
ATOM 10800 H HB3  . ASN A 1 74 ? -9.618  7.931   -2.164  1.00 0.00 ? 158 ASN A HB3  9  
ATOM 10801 H HD21 . ASN A 1 74 ? -8.142  5.586   -4.266  1.00 0.00 ? 158 ASN A HD21 9  
ATOM 10802 H HD22 . ASN A 1 74 ? -8.931  6.096   -5.722  1.00 0.00 ? 158 ASN A HD22 9  
ATOM 10803 N N    . LEU A 1 75 ? -7.052  10.312  -1.447  1.00 0.00 ? 159 LEU A N    9  
ATOM 10804 C CA   . LEU A 1 75 ? -7.122  11.343  -0.430  1.00 0.00 ? 159 LEU A CA   9  
ATOM 10805 C C    . LEU A 1 75 ? -8.527  11.927  -0.387  1.00 0.00 ? 159 LEU A C    9  
ATOM 10806 O O    . LEU A 1 75 ? -8.925  12.678  -1.283  1.00 0.00 ? 159 LEU A O    9  
ATOM 10807 C CB   . LEU A 1 75 ? -6.105  12.451  -0.718  1.00 0.00 ? 159 LEU A CB   9  
ATOM 10808 C CG   . LEU A 1 75 ? -4.646  11.994  -0.824  1.00 0.00 ? 159 LEU A CG   9  
ATOM 10809 C CD1  . LEU A 1 75 ? -3.748  13.168  -1.185  1.00 0.00 ? 159 LEU A CD1  9  
ATOM 10810 C CD2  . LEU A 1 75 ? -4.189  11.352  0.478   1.00 0.00 ? 159 LEU A CD2  9  
ATOM 10811 H H    . LEU A 1 75 ? -6.560  10.488  -2.274  1.00 0.00 ? 159 LEU A H    9  
ATOM 10812 H HA   . LEU A 1 75 ? -6.896  10.893  0.525   1.00 0.00 ? 159 LEU A HA   9  
ATOM 10813 H HB2  . LEU A 1 75 ? -6.380  12.928  -1.647  1.00 0.00 ? 159 LEU A HB2  9  
ATOM 10814 H HB3  . LEU A 1 75 ? -6.170  13.182  0.074   1.00 0.00 ? 159 LEU A HB3  9  
ATOM 10815 H HG   . LEU A 1 75 ? -4.563  11.256  -1.612  1.00 0.00 ? 159 LEU A HG   9  
ATOM 10816 H HD11 . LEU A 1 75 ? -3.861  13.949  -0.448  1.00 0.00 ? 159 LEU A HD11 9  
ATOM 10817 H HD12 . LEU A 1 75 ? -4.024  13.549  -2.159  1.00 0.00 ? 159 LEU A HD12 9  
ATOM 10818 H HD13 . LEU A 1 75 ? -2.718  12.841  -1.206  1.00 0.00 ? 159 LEU A HD13 9  
ATOM 10819 H HD21 . LEU A 1 75 ? -4.828  10.511  0.710   1.00 0.00 ? 159 LEU A HD21 9  
ATOM 10820 H HD22 . LEU A 1 75 ? -4.244  12.076  1.276   1.00 0.00 ? 159 LEU A HD22 9  
ATOM 10821 H HD23 . LEU A 1 75 ? -3.169  11.009  0.373   1.00 0.00 ? 159 LEU A HD23 9  
ATOM 10822 N N    . ARG A 1 76 ? -9.281  11.576  0.641   1.00 0.00 ? 160 ARG A N    9  
ATOM 10823 C CA   . ARG A 1 76 ? -10.643 12.066  0.761   1.00 0.00 ? 160 ARG A CA   9  
ATOM 10824 C C    . ARG A 1 76 ? -10.625 13.513  1.220   1.00 0.00 ? 160 ARG A C    9  
ATOM 10825 O O    . ARG A 1 76 ? -10.309 13.807  2.372   1.00 0.00 ? 160 ARG A O    9  
ATOM 10826 C CB   . ARG A 1 76 ? -11.470 11.218  1.725   1.00 0.00 ? 160 ARG A CB   9  
ATOM 10827 C CG   . ARG A 1 76 ? -12.929 11.633  1.744   1.00 0.00 ? 160 ARG A CG   9  
ATOM 10828 C CD   . ARG A 1 76 ? -13.749 10.812  2.721   1.00 0.00 ? 160 ARG A CD   9  
ATOM 10829 N NE   . ARG A 1 76 ? -13.311 10.991  4.108   1.00 0.00 ? 160 ARG A NE   9  
ATOM 10830 C CZ   . ARG A 1 76 ? -13.576 12.075  4.848   1.00 0.00 ? 160 ARG A CZ   9  
ATOM 10831 N NH1  . ARG A 1 76 ? -14.194 13.122  4.313   1.00 0.00 ? 160 ARG A NH1  9  
ATOM 10832 N NH2  . ARG A 1 76 ? -13.204 12.119  6.118   1.00 0.00 ? 160 ARG A NH2  9  
ATOM 10833 H H    . ARG A 1 76 ? -8.904  10.991  1.340   1.00 0.00 ? 160 ARG A H    9  
ATOM 10834 H HA   . ARG A 1 76 ? -11.096 12.023  -0.219  1.00 0.00 ? 160 ARG A HA   9  
ATOM 10835 H HB2  . ARG A 1 76 ? -11.408 10.182  1.427   1.00 0.00 ? 160 ARG A HB2  9  
ATOM 10836 H HB3  . ARG A 1 76 ? -11.071 11.327  2.721   1.00 0.00 ? 160 ARG A HB3  9  
ATOM 10837 H HG2  . ARG A 1 76 ? -12.991 12.673  2.028   1.00 0.00 ? 160 ARG A HG2  9  
ATOM 10838 H HG3  . ARG A 1 76 ? -13.339 11.509  0.752   1.00 0.00 ? 160 ARG A HG3  9  
ATOM 10839 H HD2  . ARG A 1 76 ? -14.782 11.113  2.638   1.00 0.00 ? 160 ARG A HD2  9  
ATOM 10840 H HD3  . ARG A 1 76 ? -13.656 9.771   2.456   1.00 0.00 ? 160 ARG A HD3  9  
ATOM 10841 H HE   . ARG A 1 76 ? -12.812 10.247  4.520   1.00 0.00 ? 160 ARG A HE   9  
ATOM 10842 H HH11 . ARG A 1 76 ? -14.471 13.110  3.355   1.00 0.00 ? 160 ARG A HH11 9  
ATOM 10843 H HH12 . ARG A 1 76 ? -14.372 13.946  4.873   1.00 0.00 ? 160 ARG A HH12 9  
ATOM 10844 H HH21 . ARG A 1 76 ? -12.719 11.339  6.539   1.00 0.00 ? 160 ARG A HH21 9  
ATOM 10845 H HH22 . ARG A 1 76 ? -13.409 12.928  6.674   1.00 0.00 ? 160 ARG A HH22 9  
ATOM 10846 N N    . ASP A 1 2  ? 14.237  -14.085 0.587   1.00 0.00 ? 86  ASP A N    10 
ATOM 10847 C CA   . ASP A 1 2  ? 13.822  -12.726 0.891   1.00 0.00 ? 86  ASP A CA   10 
ATOM 10848 C C    . ASP A 1 2  ? 13.378  -12.058 -0.399  1.00 0.00 ? 86  ASP A C    10 
ATOM 10849 O O    . ASP A 1 2  ? 14.171  -11.419 -1.093  1.00 0.00 ? 86  ASP A O    10 
ATOM 10850 C CB   . ASP A 1 2  ? 14.951  -11.936 1.554   1.00 0.00 ? 86  ASP A CB   10 
ATOM 10851 C CG   . ASP A 1 2  ? 14.502  -10.561 2.000   1.00 0.00 ? 86  ASP A CG   10 
ATOM 10852 O OD1  . ASP A 1 2  ? 13.627  -10.475 2.886   1.00 0.00 ? 86  ASP A OD1  10 
ATOM 10853 O OD2  . ASP A 1 2  ? 15.027  -9.558  1.471   1.00 0.00 ? 86  ASP A OD2  10 
ATOM 10854 H H    . ASP A 1 2  ? 15.187  -14.274 0.412   1.00 0.00 ? 86  ASP A H    10 
ATOM 10855 H HA   . ASP A 1 2  ? 12.978  -12.778 1.563   1.00 0.00 ? 86  ASP A HA   10 
ATOM 10856 H HB2  . ASP A 1 2  ? 15.306  -12.476 2.420   1.00 0.00 ? 86  ASP A HB2  10 
ATOM 10857 H HB3  . ASP A 1 2  ? 15.761  -11.819 0.851   1.00 0.00 ? 86  ASP A HB3  10 
ATOM 10858 N N    . GLU A 1 3  ? 12.117  -12.269 -0.736  1.00 0.00 ? 87  GLU A N    10 
ATOM 10859 C CA   . GLU A 1 3  ? 11.576  -11.871 -2.025  1.00 0.00 ? 87  GLU A CA   10 
ATOM 10860 C C    . GLU A 1 3  ? 10.901  -10.505 -1.948  1.00 0.00 ? 87  GLU A C    10 
ATOM 10861 O O    . GLU A 1 3  ? 9.853   -10.355 -1.316  1.00 0.00 ? 87  GLU A O    10 
ATOM 10862 C CB   . GLU A 1 3  ? 10.590  -12.937 -2.498  1.00 0.00 ? 87  GLU A CB   10 
ATOM 10863 C CG   . GLU A 1 3  ? 11.248  -14.290 -2.735  1.00 0.00 ? 87  GLU A CG   10 
ATOM 10864 C CD   . GLU A 1 3  ? 10.340  -15.455 -2.405  1.00 0.00 ? 87  GLU A CD   10 
ATOM 10865 O OE1  . GLU A 1 3  ? 9.270   -15.584 -3.040  1.00 0.00 ? 87  GLU A OE1  10 
ATOM 10866 O OE2  . GLU A 1 3  ? 10.696  -16.252 -1.507  1.00 0.00 ? 87  GLU A OE2  10 
ATOM 10867 H H    . GLU A 1 3  ? 11.525  -12.715 -0.096  1.00 0.00 ? 87  GLU A H    10 
ATOM 10868 H HA   . GLU A 1 3  ? 12.396  -11.817 -2.727  1.00 0.00 ? 87  GLU A HA   10 
ATOM 10869 H HB2  . GLU A 1 3  ? 9.820   -13.055 -1.750  1.00 0.00 ? 87  GLU A HB2  10 
ATOM 10870 H HB3  . GLU A 1 3  ? 10.139  -12.611 -3.423  1.00 0.00 ? 87  GLU A HB3  10 
ATOM 10871 H HG2  . GLU A 1 3  ? 11.531  -14.359 -3.774  1.00 0.00 ? 87  GLU A HG2  10 
ATOM 10872 H HG3  . GLU A 1 3  ? 12.134  -14.357 -2.119  1.00 0.00 ? 87  GLU A HG3  10 
ATOM 10873 N N    . PRO A 1 4  ? 11.514  -9.491  -2.575  1.00 0.00 ? 88  PRO A N    10 
ATOM 10874 C CA   . PRO A 1 4  ? 10.986  -8.133  -2.624  1.00 0.00 ? 88  PRO A CA   10 
ATOM 10875 C C    . PRO A 1 4  ? 9.912   -7.969  -3.698  1.00 0.00 ? 88  PRO A C    10 
ATOM 10876 O O    . PRO A 1 4  ? 9.488   -8.944  -4.323  1.00 0.00 ? 88  PRO A O    10 
ATOM 10877 C CB   . PRO A 1 4  ? 12.218  -7.272  -2.961  1.00 0.00 ? 88  PRO A CB   10 
ATOM 10878 C CG   . PRO A 1 4  ? 13.373  -8.219  -3.053  1.00 0.00 ? 88  PRO A CG   10 
ATOM 10879 C CD   . PRO A 1 4  ? 12.788  -9.579  -3.285  1.00 0.00 ? 88  PRO A CD   10 
ATOM 10880 H HA   . PRO A 1 4  ? 10.585  -7.833  -1.669  1.00 0.00 ? 88  PRO A HA   10 
ATOM 10881 H HB2  . PRO A 1 4  ? 12.054  -6.762  -3.899  1.00 0.00 ? 88  PRO A HB2  10 
ATOM 10882 H HB3  . PRO A 1 4  ? 12.371  -6.546  -2.176  1.00 0.00 ? 88  PRO A HB3  10 
ATOM 10883 H HG2  . PRO A 1 4  ? 14.010  -7.944  -3.881  1.00 0.00 ? 88  PRO A HG2  10 
ATOM 10884 H HG3  . PRO A 1 4  ? 13.934  -8.204  -2.129  1.00 0.00 ? 88  PRO A HG3  10 
ATOM 10885 H HD2  . PRO A 1 4  ? 12.635  -9.756  -4.339  1.00 0.00 ? 88  PRO A HD2  10 
ATOM 10886 H HD3  . PRO A 1 4  ? 13.417  -10.344 -2.855  1.00 0.00 ? 88  PRO A HD3  10 
ATOM 10887 N N    . LEU A 1 5  ? 9.491   -6.730  -3.909  1.00 0.00 ? 89  LEU A N    10 
ATOM 10888 C CA   . LEU A 1 5  ? 8.409   -6.414  -4.828  1.00 0.00 ? 89  LEU A CA   10 
ATOM 10889 C C    . LEU A 1 5  ? 8.263   -4.904  -4.958  1.00 0.00 ? 89  LEU A C    10 
ATOM 10890 O O    . LEU A 1 5  ? 7.763   -4.237  -4.052  1.00 0.00 ? 89  LEU A O    10 
ATOM 10891 C CB   . LEU A 1 5  ? 7.096   -7.023  -4.325  1.00 0.00 ? 89  LEU A CB   10 
ATOM 10892 C CG   . LEU A 1 5  ? 5.864   -6.748  -5.187  1.00 0.00 ? 89  LEU A CG   10 
ATOM 10893 C CD1  . LEU A 1 5  ? 6.033   -7.338  -6.578  1.00 0.00 ? 89  LEU A CD1  10 
ATOM 10894 C CD2  . LEU A 1 5  ? 4.623   -7.309  -4.513  1.00 0.00 ? 89  LEU A CD2  10 
ATOM 10895 H H    . LEU A 1 5  ? 9.919   -5.995  -3.419  1.00 0.00 ? 89  LEU A H    10 
ATOM 10896 H HA   . LEU A 1 5  ? 8.651   -6.833  -5.792  1.00 0.00 ? 89  LEU A HA   10 
ATOM 10897 H HB2  . LEU A 1 5  ? 7.228   -8.091  -4.256  1.00 0.00 ? 89  LEU A HB2  10 
ATOM 10898 H HB3  . LEU A 1 5  ? 6.907   -6.636  -3.333  1.00 0.00 ? 89  LEU A HB3  10 
ATOM 10899 H HG   . LEU A 1 5  ? 5.735   -5.680  -5.291  1.00 0.00 ? 89  LEU A HG   10 
ATOM 10900 H HD11 . LEU A 1 5  ? 6.869   -6.864  -7.070  1.00 0.00 ? 89  LEU A HD11 10 
ATOM 10901 H HD12 . LEU A 1 5  ? 5.135   -7.168  -7.154  1.00 0.00 ? 89  LEU A HD12 10 
ATOM 10902 H HD13 . LEU A 1 5  ? 6.217   -8.400  -6.499  1.00 0.00 ? 89  LEU A HD13 10 
ATOM 10903 H HD21 . LEU A 1 5  ? 4.747   -8.371  -4.357  1.00 0.00 ? 89  LEU A HD21 10 
ATOM 10904 H HD22 . LEU A 1 5  ? 3.764   -7.138  -5.144  1.00 0.00 ? 89  LEU A HD22 10 
ATOM 10905 H HD23 . LEU A 1 5  ? 4.477   -6.820  -3.562  1.00 0.00 ? 89  LEU A HD23 10 
ATOM 10906 N N    . SER A 1 6  ? 8.732   -4.364  -6.065  1.00 0.00 ? 90  SER A N    10 
ATOM 10907 C CA   . SER A 1 6  ? 8.632   -2.944  -6.310  1.00 0.00 ? 90  SER A CA   10 
ATOM 10908 C C    . SER A 1 6  ? 7.281   -2.593  -6.930  1.00 0.00 ? 90  SER A C    10 
ATOM 10909 O O    . SER A 1 6  ? 7.027   -2.878  -8.102  1.00 0.00 ? 90  SER A O    10 
ATOM 10910 C CB   . SER A 1 6  ? 9.771   -2.512  -7.223  1.00 0.00 ? 90  SER A CB   10 
ATOM 10911 O OG   . SER A 1 6  ? 11.031  -2.860  -6.669  1.00 0.00 ? 90  SER A OG   10 
ATOM 10912 H H    . SER A 1 6  ? 9.172   -4.926  -6.729  1.00 0.00 ? 90  SER A H    10 
ATOM 10913 H HA   . SER A 1 6  ? 8.727   -2.437  -5.364  1.00 0.00 ? 90  SER A HA   10 
ATOM 10914 H HB2  . SER A 1 6  ? 9.662   -3.000  -8.182  1.00 0.00 ? 90  SER A HB2  10 
ATOM 10915 H HB3  . SER A 1 6  ? 9.733   -1.449  -7.356  1.00 0.00 ? 90  SER A HB3  10 
ATOM 10916 H HG   . SER A 1 6  ? 10.898  -3.312  -5.812  1.00 0.00 ? 90  SER A HG   10 
ATOM 10917 N N    . ILE A 1 7  ? 6.413   -1.995  -6.130  1.00 0.00 ? 91  ILE A N    10 
ATOM 10918 C CA   . ILE A 1 7  ? 5.115   -1.548  -6.610  1.00 0.00 ? 91  ILE A CA   10 
ATOM 10919 C C    . ILE A 1 7  ? 5.094   -0.029  -6.730  1.00 0.00 ? 91  ILE A C    10 
ATOM 10920 O O    . ILE A 1 7  ? 5.725   0.673   -5.939  1.00 0.00 ? 91  ILE A O    10 
ATOM 10921 C CB   . ILE A 1 7  ? 3.969   -2.013  -5.682  1.00 0.00 ? 91  ILE A CB   10 
ATOM 10922 C CG1  . ILE A 1 7  ? 4.231   -1.575  -4.235  1.00 0.00 ? 91  ILE A CG1  10 
ATOM 10923 C CG2  . ILE A 1 7  ? 3.802   -3.524  -5.771  1.00 0.00 ? 91  ILE A CG2  10 
ATOM 10924 C CD1  . ILE A 1 7  ? 3.109   -1.921  -3.277  1.00 0.00 ? 91  ILE A CD1  10 
ATOM 10925 H H    . ILE A 1 7  ? 6.653   -1.845  -5.188  1.00 0.00 ? 91  ILE A H    10 
ATOM 10926 H HA   . ILE A 1 7  ? 4.958   -1.976  -7.589  1.00 0.00 ? 91  ILE A HA   10 
ATOM 10927 H HB   . ILE A 1 7  ? 3.052   -1.556  -6.027  1.00 0.00 ? 91  ILE A HB   10 
ATOM 10928 H HG12 . ILE A 1 7  ? 5.130   -2.058  -3.880  1.00 0.00 ? 91  ILE A HG12 10 
ATOM 10929 H HG13 . ILE A 1 7  ? 4.371   -0.504  -4.213  1.00 0.00 ? 91  ILE A HG13 10 
ATOM 10930 H HG21 . ILE A 1 7  ? 3.544   -3.797  -6.785  1.00 0.00 ? 91  ILE A HG21 10 
ATOM 10931 H HG22 . ILE A 1 7  ? 3.016   -3.840  -5.101  1.00 0.00 ? 91  ILE A HG22 10 
ATOM 10932 H HG23 . ILE A 1 7  ? 4.728   -4.005  -5.493  1.00 0.00 ? 91  ILE A HG23 10 
ATOM 10933 H HD11 . ILE A 1 7  ? 2.986   -2.992  -3.239  1.00 0.00 ? 91  ILE A HD11 10 
ATOM 10934 H HD12 . ILE A 1 7  ? 2.193   -1.464  -3.619  1.00 0.00 ? 91  ILE A HD12 10 
ATOM 10935 H HD13 . ILE A 1 7  ? 3.349   -1.550  -2.291  1.00 0.00 ? 91  ILE A HD13 10 
ATOM 10936 N N    . LEU A 1 8  ? 4.383   0.477   -7.722  1.00 0.00 ? 92  LEU A N    10 
ATOM 10937 C CA   . LEU A 1 8  ? 4.331   1.912   -7.950  1.00 0.00 ? 92  LEU A CA   10 
ATOM 10938 C C    . LEU A 1 8  ? 3.043   2.480   -7.371  1.00 0.00 ? 92  LEU A C    10 
ATOM 10939 O O    . LEU A 1 8  ? 1.946   2.172   -7.844  1.00 0.00 ? 92  LEU A O    10 
ATOM 10940 C CB   . LEU A 1 8  ? 4.427   2.223   -9.447  1.00 0.00 ? 92  LEU A CB   10 
ATOM 10941 C CG   . LEU A 1 8  ? 4.854   3.648   -9.786  1.00 0.00 ? 92  LEU A CG   10 
ATOM 10942 C CD1  . LEU A 1 8  ? 6.283   3.890   -9.332  1.00 0.00 ? 92  LEU A CD1  10 
ATOM 10943 C CD2  . LEU A 1 8  ? 4.717   3.901   -11.276 1.00 0.00 ? 92  LEU A CD2  10 
ATOM 10944 H H    . LEU A 1 8  ? 3.873   -0.123  -8.305  1.00 0.00 ? 92  LEU A H    10 
ATOM 10945 H HA   . LEU A 1 8  ? 5.173   2.360   -7.440  1.00 0.00 ? 92  LEU A HA   10 
ATOM 10946 H HB2  . LEU A 1 8  ? 5.141   1.546   -9.888  1.00 0.00 ? 92  LEU A HB2  10 
ATOM 10947 H HB3  . LEU A 1 8  ? 3.461   2.046   -9.896  1.00 0.00 ? 92  LEU A HB3  10 
ATOM 10948 H HG   . LEU A 1 8  ? 4.212   4.344   -9.265  1.00 0.00 ? 92  LEU A HG   10 
ATOM 10949 H HD11 . LEU A 1 8  ? 6.356   3.724   -8.267  1.00 0.00 ? 92  LEU A HD11 10 
ATOM 10950 H HD12 . LEU A 1 8  ? 6.566   4.906   -9.558  1.00 0.00 ? 92  LEU A HD12 10 
ATOM 10951 H HD13 . LEU A 1 8  ? 6.945   3.211   -9.848  1.00 0.00 ? 92  LEU A HD13 10 
ATOM 10952 H HD21 . LEU A 1 8  ? 5.331   3.196   -11.816 1.00 0.00 ? 92  LEU A HD21 10 
ATOM 10953 H HD22 . LEU A 1 8  ? 5.038   4.905   -11.501 1.00 0.00 ? 92  LEU A HD22 10 
ATOM 10954 H HD23 . LEU A 1 8  ? 3.684   3.778   -11.568 1.00 0.00 ? 92  LEU A HD23 10 
ATOM 10955 N N    . VAL A 1 9  ? 3.176   3.288   -6.332  1.00 0.00 ? 93  VAL A N    10 
ATOM 10956 C CA   . VAL A 1 9  ? 2.018   3.861   -5.664  1.00 0.00 ? 93  VAL A CA   10 
ATOM 10957 C C    . VAL A 1 9  ? 1.685   5.246   -6.214  1.00 0.00 ? 93  VAL A C    10 
ATOM 10958 O O    . VAL A 1 9  ? 2.509   6.165   -6.180  1.00 0.00 ? 93  VAL A O    10 
ATOM 10959 C CB   . VAL A 1 9  ? 2.233   3.944   -4.135  1.00 0.00 ? 93  VAL A CB   10 
ATOM 10960 C CG1  . VAL A 1 9  ? 1.021   4.547   -3.445  1.00 0.00 ? 93  VAL A CG1  10 
ATOM 10961 C CG2  . VAL A 1 9  ? 2.535   2.564   -3.568  1.00 0.00 ? 93  VAL A CG2  10 
ATOM 10962 H H    . VAL A 1 9  ? 4.078   3.498   -6.000  1.00 0.00 ? 93  VAL A H    10 
ATOM 10963 H HA   . VAL A 1 9  ? 1.179   3.207   -5.849  1.00 0.00 ? 93  VAL A HA   10 
ATOM 10964 H HB   . VAL A 1 9  ? 3.082   4.582   -3.943  1.00 0.00 ? 93  VAL A HB   10 
ATOM 10965 H HG11 . VAL A 1 9  ? 0.147   3.956   -3.671  1.00 0.00 ? 93  VAL A HG11 10 
ATOM 10966 H HG12 . VAL A 1 9  ? 0.874   5.557   -3.797  1.00 0.00 ? 93  VAL A HG12 10 
ATOM 10967 H HG13 . VAL A 1 9  ? 1.185   4.557   -2.379  1.00 0.00 ? 93  VAL A HG13 10 
ATOM 10968 H HG21 . VAL A 1 9  ? 2.675   2.638   -2.499  1.00 0.00 ? 93  VAL A HG21 10 
ATOM 10969 H HG22 . VAL A 1 9  ? 3.435   2.178   -4.022  1.00 0.00 ? 93  VAL A HG22 10 
ATOM 10970 H HG23 . VAL A 1 9  ? 1.710   1.899   -3.779  1.00 0.00 ? 93  VAL A HG23 10 
ATOM 10971 N N    . ARG A 1 10 ? 0.470   5.376   -6.728  1.00 0.00 ? 94  ARG A N    10 
ATOM 10972 C CA   . ARG A 1 10 ? -0.032  6.650   -7.209  1.00 0.00 ? 94  ARG A CA   10 
ATOM 10973 C C    . ARG A 1 10 ? -0.617  7.416   -6.031  1.00 0.00 ? 94  ARG A C    10 
ATOM 10974 O O    . ARG A 1 10 ? -1.560  6.955   -5.402  1.00 0.00 ? 94  ARG A O    10 
ATOM 10975 C CB   . ARG A 1 10 ? -1.090  6.419   -8.289  1.00 0.00 ? 94  ARG A CB   10 
ATOM 10976 C CG   . ARG A 1 10 ? -1.576  7.694   -8.953  1.00 0.00 ? 94  ARG A CG   10 
ATOM 10977 C CD   . ARG A 1 10 ? -2.588  7.394   -10.049 1.00 0.00 ? 94  ARG A CD   10 
ATOM 10978 N NE   . ARG A 1 10 ? -3.095  8.613   -10.677 1.00 0.00 ? 94  ARG A NE   10 
ATOM 10979 C CZ   . ARG A 1 10 ? -3.051  8.856   -11.986 1.00 0.00 ? 94  ARG A CZ   10 
ATOM 10980 N NH1  . ARG A 1 10 ? -2.539  7.960   -12.823 1.00 0.00 ? 94  ARG A NH1  10 
ATOM 10981 N NH2  . ARG A 1 10 ? -3.536  9.996   -12.460 1.00 0.00 ? 94  ARG A NH2  10 
ATOM 10982 H H    . ARG A 1 10 ? -0.118  4.591   -6.764  1.00 0.00 ? 94  ARG A H    10 
ATOM 10983 H HA   . ARG A 1 10 ? 0.795   7.207   -7.624  1.00 0.00 ? 94  ARG A HA   10 
ATOM 10984 H HB2  . ARG A 1 10 ? -0.673  5.780   -9.054  1.00 0.00 ? 94  ARG A HB2  10 
ATOM 10985 H HB3  . ARG A 1 10 ? -1.941  5.924   -7.845  1.00 0.00 ? 94  ARG A HB3  10 
ATOM 10986 H HG2  . ARG A 1 10 ? -2.037  8.325   -8.208  1.00 0.00 ? 94  ARG A HG2  10 
ATOM 10987 H HG3  . ARG A 1 10 ? -0.726  8.203   -9.387  1.00 0.00 ? 94  ARG A HG3  10 
ATOM 10988 H HD2  . ARG A 1 10 ? -2.114  6.781   -10.802 1.00 0.00 ? 94  ARG A HD2  10 
ATOM 10989 H HD3  . ARG A 1 10 ? -3.419  6.851   -9.619  1.00 0.00 ? 94  ARG A HD3  10 
ATOM 10990 H HE   . ARG A 1 10 ? -3.497  9.296   -10.083 1.00 0.00 ? 94  ARG A HE   10 
ATOM 10991 H HH11 . ARG A 1 10 ? -2.173  7.087   -12.474 1.00 0.00 ? 94  ARG A HH11 10 
ATOM 10992 H HH12 . ARG A 1 10 ? -2.512  8.146   -13.817 1.00 0.00 ? 94  ARG A HH12 10 
ATOM 10993 H HH21 . ARG A 1 10 ? -3.937  10.672  -11.836 1.00 0.00 ? 94  ARG A HH21 10 
ATOM 10994 H HH22 . ARG A 1 10 ? -3.491  10.195  -13.448 1.00 0.00 ? 94  ARG A HH22 10 
ATOM 10995 N N    . ASN A 1 11 ? -0.051  8.576   -5.737  1.00 0.00 ? 95  ASN A N    10 
ATOM 10996 C CA   . ASN A 1 11 ? -0.340  9.271   -4.484  1.00 0.00 ? 95  ASN A CA   10 
ATOM 10997 C C    . ASN A 1 11 ? -0.570  10.763  -4.716  1.00 0.00 ? 95  ASN A C    10 
ATOM 10998 O O    . ASN A 1 11 ? -0.935  11.173  -5.812  1.00 0.00 ? 95  ASN A O    10 
ATOM 10999 C CB   . ASN A 1 11 ? 0.825   9.051   -3.517  1.00 0.00 ? 95  ASN A CB   10 
ATOM 11000 C CG   . ASN A 1 11 ? 2.118   9.659   -4.025  1.00 0.00 ? 95  ASN A CG   10 
ATOM 11001 O OD1  . ASN A 1 11 ? 2.535   10.730  -3.581  1.00 0.00 ? 95  ASN A OD1  10 
ATOM 11002 N ND2  . ASN A 1 11 ? 2.731   9.008   -5.002  1.00 0.00 ? 95  ASN A ND2  10 
ATOM 11003 H H    . ASN A 1 11 ? 0.564   8.987   -6.376  1.00 0.00 ? 95  ASN A H    10 
ATOM 11004 H HA   . ASN A 1 11 ? -1.235  8.839   -4.061  1.00 0.00 ? 95  ASN A HA   10 
ATOM 11005 H HB2  . ASN A 1 11 ? 0.587   9.503   -2.565  1.00 0.00 ? 95  ASN A HB2  10 
ATOM 11006 H HB3  . ASN A 1 11 ? 0.976   7.991   -3.380  1.00 0.00 ? 95  ASN A HB3  10 
ATOM 11007 H HD21 . ASN A 1 11 ? 2.323   8.183   -5.343  1.00 0.00 ? 95  ASN A HD21 10 
ATOM 11008 H HD22 . ASN A 1 11 ? 3.578   9.376   -5.346  1.00 0.00 ? 95  ASN A HD22 10 
ATOM 11009 N N    . ASN A 1 12 ? -0.357  11.564  -3.676  1.00 0.00 ? 96  ASN A N    10 
ATOM 11010 C CA   . ASN A 1 12 ? -0.613  13.001  -3.751  1.00 0.00 ? 96  ASN A CA   10 
ATOM 11011 C C    . ASN A 1 12 ? 0.638   13.791  -4.139  1.00 0.00 ? 96  ASN A C    10 
ATOM 11012 O O    . ASN A 1 12 ? 0.602   14.601  -5.063  1.00 0.00 ? 96  ASN A O    10 
ATOM 11013 C CB   . ASN A 1 12 ? -1.136  13.516  -2.410  1.00 0.00 ? 96  ASN A CB   10 
ATOM 11014 C CG   . ASN A 1 12 ? -1.433  15.008  -2.429  1.00 0.00 ? 96  ASN A CG   10 
ATOM 11015 O OD1  . ASN A 1 12 ? -1.829  15.564  -3.450  1.00 0.00 ? 96  ASN A OD1  10 
ATOM 11016 N ND2  . ASN A 1 12 ? -1.229  15.670  -1.300  1.00 0.00 ? 96  ASN A ND2  10 
ATOM 11017 H H    . ASN A 1 12 ? -0.021  11.182  -2.839  1.00 0.00 ? 96  ASN A H    10 
ATOM 11018 H HA   . ASN A 1 12 ? -1.372  13.159  -4.503  1.00 0.00 ? 96  ASN A HA   10 
ATOM 11019 H HB2  . ASN A 1 12 ? -2.048  12.993  -2.161  1.00 0.00 ? 96  ASN A HB2  10 
ATOM 11020 H HB3  . ASN A 1 12 ? -0.397  13.324  -1.647  1.00 0.00 ? 96  ASN A HB3  10 
ATOM 11021 H HD21 . ASN A 1 12 ? -0.897  15.172  -0.517  1.00 0.00 ? 96  ASN A HD21 10 
ATOM 11022 H HD22 . ASN A 1 12 ? -1.419  16.633  -1.288  1.00 0.00 ? 96  ASN A HD22 10 
ATOM 11023 N N    . LYS A 1 13 ? 1.742   13.551  -3.435  1.00 0.00 ? 97  LYS A N    10 
ATOM 11024 C CA   . LYS A 1 13 ? 2.950   14.367  -3.595  1.00 0.00 ? 97  LYS A CA   10 
ATOM 11025 C C    . LYS A 1 13 ? 3.583   14.143  -4.967  1.00 0.00 ? 97  LYS A C    10 
ATOM 11026 O O    . LYS A 1 13 ? 3.457   14.977  -5.862  1.00 0.00 ? 97  LYS A O    10 
ATOM 11027 C CB   . LYS A 1 13 ? 3.961   14.054  -2.486  1.00 0.00 ? 97  LYS A CB   10 
ATOM 11028 C CG   . LYS A 1 13 ? 3.345   14.005  -1.094  1.00 0.00 ? 97  LYS A CG   10 
ATOM 11029 C CD   . LYS A 1 13 ? 4.401   13.752  -0.027  1.00 0.00 ? 97  LYS A CD   10 
ATOM 11030 C CE   . LYS A 1 13 ? 3.785   13.307  1.291   1.00 0.00 ? 97  LYS A CE   10 
ATOM 11031 N NZ   . LYS A 1 13 ? 2.851   14.318  1.858   1.00 0.00 ? 97  LYS A NZ   10 
ATOM 11032 H H    . LYS A 1 13 ? 1.754   12.799  -2.806  1.00 0.00 ? 97  LYS A H    10 
ATOM 11033 H HA   . LYS A 1 13 ? 2.657   15.404  -3.516  1.00 0.00 ? 97  LYS A HA   10 
ATOM 11034 H HB2  . LYS A 1 13 ? 4.415   13.095  -2.687  1.00 0.00 ? 97  LYS A HB2  10 
ATOM 11035 H HB3  . LYS A 1 13 ? 4.728   14.814  -2.489  1.00 0.00 ? 97  LYS A HB3  10 
ATOM 11036 H HG2  . LYS A 1 13 ? 2.861   14.950  -0.890  1.00 0.00 ? 97  LYS A HG2  10 
ATOM 11037 H HG3  . LYS A 1 13 ? 2.614   13.210  -1.061  1.00 0.00 ? 97  LYS A HG3  10 
ATOM 11038 H HD2  . LYS A 1 13 ? 5.068   12.980  -0.375  1.00 0.00 ? 97  LYS A HD2  10 
ATOM 11039 H HD3  . LYS A 1 13 ? 4.957   14.665  0.135   1.00 0.00 ? 97  LYS A HD3  10 
ATOM 11040 H HE2  . LYS A 1 13 ? 3.243   12.387  1.125   1.00 0.00 ? 97  LYS A HE2  10 
ATOM 11041 H HE3  . LYS A 1 13 ? 4.581   13.128  1.999   1.00 0.00 ? 97  LYS A HE3  10 
ATOM 11042 H HZ1  . LYS A 1 13 ? 3.378   15.157  2.192   1.00 0.00 ? 97  LYS A HZ1  10 
ATOM 11043 H HZ2  . LYS A 1 13 ? 2.326   13.905  2.665   1.00 0.00 ? 97  LYS A HZ2  10 
ATOM 11044 H HZ3  . LYS A 1 13 ? 2.162   14.617  1.137   1.00 0.00 ? 97  LYS A HZ3  10 
ATOM 11045 N N    . GLY A 1 14 ? 4.252   13.014  -5.120  1.00 0.00 ? 98  GLY A N    10 
ATOM 11046 C CA   . GLY A 1 14 ? 4.799   12.630  -6.404  1.00 0.00 ? 98  GLY A CA   10 
ATOM 11047 C C    . GLY A 1 14 ? 4.257   11.280  -6.791  1.00 0.00 ? 98  GLY A C    10 
ATOM 11048 O O    . GLY A 1 14 ? 4.670   10.269  -6.228  1.00 0.00 ? 98  GLY A O    10 
ATOM 11049 H H    . GLY A 1 14 ? 4.364   12.416  -4.352  1.00 0.00 ? 98  GLY A H    10 
ATOM 11050 H HA2  . GLY A 1 14 ? 4.516   13.361  -7.147  1.00 0.00 ? 98  GLY A HA2  10 
ATOM 11051 H HA3  . GLY A 1 14 ? 5.874   12.577  -6.337  1.00 0.00 ? 98  GLY A HA3  10 
ATOM 11052 N N    . ARG A 1 15 ? 3.337   11.257  -7.747  1.00 0.00 ? 99  ARG A N    10 
ATOM 11053 C CA   . ARG A 1 15 ? 2.472   10.096  -7.955  1.00 0.00 ? 99  ARG A CA   10 
ATOM 11054 C C    . ARG A 1 15 ? 3.180   8.965   -8.697  1.00 0.00 ? 99  ARG A C    10 
ATOM 11055 O O    . ARG A 1 15 ? 2.743   8.548   -9.771  1.00 0.00 ? 99  ARG A O    10 
ATOM 11056 C CB   . ARG A 1 15 ? 1.207   10.474  -8.729  1.00 0.00 ? 99  ARG A CB   10 
ATOM 11057 C CG   . ARG A 1 15 ? 0.545   11.782  -8.311  1.00 0.00 ? 99  ARG A CG   10 
ATOM 11058 C CD   . ARG A 1 15 ? 1.164   12.986  -9.012  1.00 0.00 ? 99  ARG A CD   10 
ATOM 11059 N NE   . ARG A 1 15 ? 1.099   12.863  -10.472 1.00 0.00 ? 99  ARG A NE   10 
ATOM 11060 C CZ   . ARG A 1 15 ? 1.482   13.818  -11.321 1.00 0.00 ? 99  ARG A CZ   10 
ATOM 11061 N NH1  . ARG A 1 15 ? 1.906   14.987  -10.862 1.00 0.00 ? 99  ARG A NH1  10 
ATOM 11062 N NH2  . ARG A 1 15 ? 1.415   13.608  -12.631 1.00 0.00 ? 99  ARG A NH2  10 
ATOM 11063 H H    . ARG A 1 15 ? 3.251   12.036  -8.341  1.00 0.00 ? 99  ARG A H    10 
ATOM 11064 H HA   . ARG A 1 15 ? 2.182   9.733   -6.981  1.00 0.00 ? 99  ARG A HA   10 
ATOM 11065 H HB2  . ARG A 1 15 ? 1.468   10.548  -9.765  1.00 0.00 ? 99  ARG A HB2  10 
ATOM 11066 H HB3  . ARG A 1 15 ? 0.484   9.678   -8.611  1.00 0.00 ? 99  ARG A HB3  10 
ATOM 11067 H HG2  . ARG A 1 15 ? -0.504  11.738  -8.556  1.00 0.00 ? 99  ARG A HG2  10 
ATOM 11068 H HG3  . ARG A 1 15 ? 0.660   11.902  -7.242  1.00 0.00 ? 99  ARG A HG3  10 
ATOM 11069 H HD2  . ARG A 1 15 ? 0.634   13.878  -8.714  1.00 0.00 ? 99  ARG A HD2  10 
ATOM 11070 H HD3  . ARG A 1 15 ? 2.200   13.067  -8.715  1.00 0.00 ? 99  ARG A HD3  10 
ATOM 11071 H HE   . ARG A 1 15 ? 0.766   12.016  -10.836 1.00 0.00 ? 99  ARG A HE   10 
ATOM 11072 H HH11 . ARG A 1 15 ? 1.948   15.154  -9.876  1.00 0.00 ? 99  ARG A HH11 10 
ATOM 11073 H HH12 . ARG A 1 15 ? 2.174   15.716  -11.501 1.00 0.00 ? 99  ARG A HH12 10 
ATOM 11074 H HH21 . ARG A 1 15 ? 1.072   12.735  -12.988 1.00 0.00 ? 99  ARG A HH21 10 
ATOM 11075 H HH22 . ARG A 1 15 ? 1.734   14.315  -13.277 1.00 0.00 ? 99  ARG A HH22 10 
ATOM 11076 N N    . SER A 1 16 ? 4.255   8.477   -8.115  1.00 0.00 ? 100 SER A N    10 
ATOM 11077 C CA   . SER A 1 16 ? 4.941   7.300   -8.607  1.00 0.00 ? 100 SER A CA   10 
ATOM 11078 C C    . SER A 1 16 ? 5.965   6.845   -7.576  1.00 0.00 ? 100 SER A C    10 
ATOM 11079 O O    . SER A 1 16 ? 7.168   6.795   -7.841  1.00 0.00 ? 100 SER A O    10 
ATOM 11080 C CB   . SER A 1 16 ? 5.607   7.575   -9.959  1.00 0.00 ? 100 SER A CB   10 
ATOM 11081 O OG   . SER A 1 16 ? 6.350   8.786   -9.933  1.00 0.00 ? 100 SER A OG   10 
ATOM 11082 H H    . SER A 1 16 ? 4.615   8.937   -7.323  1.00 0.00 ? 100 SER A H    10 
ATOM 11083 H HA   . SER A 1 16 ? 4.201   6.521   -8.730  1.00 0.00 ? 100 SER A HA   10 
ATOM 11084 H HB2  . SER A 1 16 ? 6.277   6.758   -10.196 1.00 0.00 ? 100 SER A HB2  10 
ATOM 11085 H HB3  . SER A 1 16 ? 4.848   7.646   -10.721 1.00 0.00 ? 100 SER A HB3  10 
ATOM 11086 H HG   . SER A 1 16 ? 7.300   8.576   -9.898  1.00 0.00 ? 100 SER A HG   10 
ATOM 11087 N N    . SER A 1 17 ? 5.477   6.533   -6.388  1.00 0.00 ? 101 SER A N    10 
ATOM 11088 C CA   . SER A 1 17 ? 6.333   6.082   -5.309  1.00 0.00 ? 101 SER A CA   10 
ATOM 11089 C C    . SER A 1 17 ? 6.660   4.606   -5.483  1.00 0.00 ? 101 SER A C    10 
ATOM 11090 O O    . SER A 1 17 ? 5.809   3.743   -5.256  1.00 0.00 ? 101 SER A O    10 
ATOM 11091 C CB   . SER A 1 17 ? 5.648   6.324   -3.965  1.00 0.00 ? 101 SER A CB   10 
ATOM 11092 O OG   . SER A 1 17 ? 5.258   7.682   -3.830  1.00 0.00 ? 101 SER A OG   10 
ATOM 11093 H H    . SER A 1 17 ? 4.510   6.607   -6.232  1.00 0.00 ? 101 SER A H    10 
ATOM 11094 H HA   . SER A 1 17 ? 7.249   6.652   -5.348  1.00 0.00 ? 101 SER A HA   10 
ATOM 11095 H HB2  . SER A 1 17 ? 4.767   5.701   -3.895  1.00 0.00 ? 101 SER A HB2  10 
ATOM 11096 H HB3  . SER A 1 17 ? 6.328   6.075   -3.163  1.00 0.00 ? 101 SER A HB3  10 
ATOM 11097 H HG   . SER A 1 17 ? 5.354   7.953   -2.913  1.00 0.00 ? 101 SER A HG   10 
ATOM 11098 N N    . THR A 1 18 ? 7.879   4.322   -5.919  1.00 0.00 ? 102 THR A N    10 
ATOM 11099 C CA   . THR A 1 18 ? 8.319   2.950   -6.099  1.00 0.00 ? 102 THR A CA   10 
ATOM 11100 C C    . THR A 1 18 ? 8.620   2.313   -4.743  1.00 0.00 ? 102 THR A C    10 
ATOM 11101 O O    . THR A 1 18 ? 9.735   2.415   -4.227  1.00 0.00 ? 102 THR A O    10 
ATOM 11102 C CB   . THR A 1 18 ? 9.573   2.871   -6.995  1.00 0.00 ? 102 THR A CB   10 
ATOM 11103 O OG1  . THR A 1 18 ? 9.395   3.699   -8.153  1.00 0.00 ? 102 THR A OG1  10 
ATOM 11104 C CG2  . THR A 1 18 ? 9.836   1.437   -7.435  1.00 0.00 ? 102 THR A CG2  10 
ATOM 11105 H H    . THR A 1 18 ? 8.499   5.055   -6.133  1.00 0.00 ? 102 THR A H    10 
ATOM 11106 H HA   . THR A 1 18 ? 7.520   2.402   -6.577  1.00 0.00 ? 102 THR A HA   10 
ATOM 11107 H HB   . THR A 1 18 ? 10.426  3.224   -6.435  1.00 0.00 ? 102 THR A HB   10 
ATOM 11108 H HG1  . THR A 1 18 ? 9.986   3.399   -8.857  1.00 0.00 ? 102 THR A HG1  10 
ATOM 11109 H HG21 . THR A 1 18 ? 10.723  1.407   -8.050  1.00 0.00 ? 102 THR A HG21 10 
ATOM 11110 H HG22 . THR A 1 18 ? 8.992   1.075   -8.004  1.00 0.00 ? 102 THR A HG22 10 
ATOM 11111 H HG23 . THR A 1 18 ? 9.976   0.813   -6.564  1.00 0.00 ? 102 THR A HG23 10 
ATOM 11112 N N    . TYR A 1 19 ? 7.609   1.690   -4.159  1.00 0.00 ? 103 TYR A N    10 
ATOM 11113 C CA   . TYR A 1 19 ? 7.752   1.054   -2.864  1.00 0.00 ? 103 TYR A CA   10 
ATOM 11114 C C    . TYR A 1 19 ? 8.348   -0.331  -3.005  1.00 0.00 ? 103 TYR A C    10 
ATOM 11115 O O    . TYR A 1 19 ? 7.766   -1.206  -3.643  1.00 0.00 ? 103 TYR A O    10 
ATOM 11116 C CB   . TYR A 1 19 ? 6.403   0.965   -2.147  1.00 0.00 ? 103 TYR A CB   10 
ATOM 11117 C CG   . TYR A 1 19 ? 6.078   2.173   -1.300  1.00 0.00 ? 103 TYR A CG   10 
ATOM 11118 C CD1  . TYR A 1 19 ? 5.471   3.295   -1.847  1.00 0.00 ? 103 TYR A CD1  10 
ATOM 11119 C CD2  . TYR A 1 19 ? 6.375   2.185   0.059   1.00 0.00 ? 103 TYR A CD2  10 
ATOM 11120 C CE1  . TYR A 1 19 ? 5.172   4.396   -1.066  1.00 0.00 ? 103 TYR A CE1  10 
ATOM 11121 C CE2  . TYR A 1 19 ? 6.078   3.280   0.846   1.00 0.00 ? 103 TYR A CE2  10 
ATOM 11122 C CZ   . TYR A 1 19 ? 5.478   4.383   0.280   1.00 0.00 ? 103 TYR A CZ   10 
ATOM 11123 O OH   . TYR A 1 19 ? 5.183   5.476   1.060   1.00 0.00 ? 103 TYR A OH   10 
ATOM 11124 H H    . TYR A 1 19 ? 6.743   1.643   -4.626  1.00 0.00 ? 103 TYR A H    10 
ATOM 11125 H HA   . TYR A 1 19 ? 8.421   1.662   -2.272  1.00 0.00 ? 103 TYR A HA   10 
ATOM 11126 H HB2  . TYR A 1 19 ? 5.621   0.857   -2.883  1.00 0.00 ? 103 TYR A HB2  10 
ATOM 11127 H HB3  . TYR A 1 19 ? 6.405   0.098   -1.502  1.00 0.00 ? 103 TYR A HB3  10 
ATOM 11128 H HD1  . TYR A 1 19 ? 5.234   3.304   -2.901  1.00 0.00 ? 103 TYR A HD1  10 
ATOM 11129 H HD2  . TYR A 1 19 ? 6.849   1.321   0.500   1.00 0.00 ? 103 TYR A HD2  10 
ATOM 11130 H HE1  . TYR A 1 19 ? 4.699   5.261   -1.510  1.00 0.00 ? 103 TYR A HE1  10 
ATOM 11131 H HE2  . TYR A 1 19 ? 6.319   3.271   1.899   1.00 0.00 ? 103 TYR A HE2  10 
ATOM 11132 H HH   . TYR A 1 19 ? 5.929   5.671   1.630   1.00 0.00 ? 103 TYR A HH   10 
ATOM 11133 N N    . GLU A 1 20 ? 9.520   -0.514  -2.423  1.00 0.00 ? 104 GLU A N    10 
ATOM 11134 C CA   . GLU A 1 20 ? 10.133  -1.824  -2.364  1.00 0.00 ? 104 GLU A CA   10 
ATOM 11135 C C    . GLU A 1 20 ? 9.607   -2.555  -1.140  1.00 0.00 ? 104 GLU A C    10 
ATOM 11136 O O    . GLU A 1 20 ? 10.026  -2.284  -0.013  1.00 0.00 ? 104 GLU A O    10 
ATOM 11137 C CB   . GLU A 1 20 ? 11.657  -1.716  -2.293  1.00 0.00 ? 104 GLU A CB   10 
ATOM 11138 C CG   . GLU A 1 20 ? 12.361  -3.056  -2.428  1.00 0.00 ? 104 GLU A CG   10 
ATOM 11139 C CD   . GLU A 1 20 ? 12.320  -3.593  -3.840  1.00 0.00 ? 104 GLU A CD   10 
ATOM 11140 O OE1  . GLU A 1 20 ? 11.274  -4.133  -4.252  1.00 0.00 ? 104 GLU A OE1  10 
ATOM 11141 O OE2  . GLU A 1 20 ? 13.343  -3.477  -4.548  1.00 0.00 ? 104 GLU A OE2  10 
ATOM 11142 H H    . GLU A 1 20 ? 9.980   0.250   -2.019  1.00 0.00 ? 104 GLU A H    10 
ATOM 11143 H HA   . GLU A 1 20 ? 9.850   -2.367  -3.253  1.00 0.00 ? 104 GLU A HA   10 
ATOM 11144 H HB2  . GLU A 1 20 ? 12.000  -1.072  -3.090  1.00 0.00 ? 104 GLU A HB2  10 
ATOM 11145 H HB3  . GLU A 1 20 ? 11.934  -1.281  -1.345  1.00 0.00 ? 104 GLU A HB3  10 
ATOM 11146 H HG2  . GLU A 1 20 ? 13.389  -2.939  -2.135  1.00 0.00 ? 104 GLU A HG2  10 
ATOM 11147 H HG3  . GLU A 1 20 ? 11.879  -3.770  -1.775  1.00 0.00 ? 104 GLU A HG3  10 
ATOM 11148 N N    . VAL A 1 21 ? 8.666   -3.450  -1.362  1.00 0.00 ? 105 VAL A N    10 
ATOM 11149 C CA   . VAL A 1 21 ? 8.030   -4.174  -0.276  1.00 0.00 ? 105 VAL A CA   10 
ATOM 11150 C C    . VAL A 1 21 ? 8.229   -5.668  -0.448  1.00 0.00 ? 105 VAL A C    10 
ATOM 11151 O O    . VAL A 1 21 ? 8.877   -6.107  -1.389  1.00 0.00 ? 105 VAL A O    10 
ATOM 11152 C CB   . VAL A 1 21 ? 6.517   -3.867  -0.185  1.00 0.00 ? 105 VAL A CB   10 
ATOM 11153 C CG1  . VAL A 1 21 ? 6.283   -2.393  0.103   1.00 0.00 ? 105 VAL A CG1  10 
ATOM 11154 C CG2  . VAL A 1 21 ? 5.795   -4.281  -1.461  1.00 0.00 ? 105 VAL A CG2  10 
ATOM 11155 H H    . VAL A 1 21 ? 8.403   -3.645  -2.291  1.00 0.00 ? 105 VAL A H    10 
ATOM 11156 H HA   . VAL A 1 21 ? 8.495   -3.863  0.649   1.00 0.00 ? 105 VAL A HA   10 
ATOM 11157 H HB   . VAL A 1 21 ? 6.105   -4.438  0.634   1.00 0.00 ? 105 VAL A HB   10 
ATOM 11158 H HG11 . VAL A 1 21 ? 6.749   -1.798  -0.668  1.00 0.00 ? 105 VAL A HG11 10 
ATOM 11159 H HG12 . VAL A 1 21 ? 6.712   -2.140  1.062   1.00 0.00 ? 105 VAL A HG12 10 
ATOM 11160 H HG13 . VAL A 1 21 ? 5.222   -2.194  0.120   1.00 0.00 ? 105 VAL A HG13 10 
ATOM 11161 H HG21 . VAL A 1 21 ? 4.742   -4.062  -1.364  1.00 0.00 ? 105 VAL A HG21 10 
ATOM 11162 H HG22 . VAL A 1 21 ? 5.930   -5.339  -1.624  1.00 0.00 ? 105 VAL A HG22 10 
ATOM 11163 H HG23 . VAL A 1 21 ? 6.202   -3.733  -2.298  1.00 0.00 ? 105 VAL A HG23 10 
ATOM 11164 N N    . ARG A 1 22 ? 7.692   -6.444  0.472   1.00 0.00 ? 106 ARG A N    10 
ATOM 11165 C CA   . ARG A 1 22 ? 7.750   -7.889  0.372   1.00 0.00 ? 106 ARG A CA   10 
ATOM 11166 C C    . ARG A 1 22 ? 6.348   -8.472  0.461   1.00 0.00 ? 106 ARG A C    10 
ATOM 11167 O O    . ARG A 1 22 ? 5.495   -7.946  1.174   1.00 0.00 ? 106 ARG A O    10 
ATOM 11168 C CB   . ARG A 1 22 ? 8.668   -8.459  1.459   1.00 0.00 ? 106 ARG A CB   10 
ATOM 11169 C CG   . ARG A 1 22 ? 10.145  -8.304  1.125   1.00 0.00 ? 106 ARG A CG   10 
ATOM 11170 C CD   . ARG A 1 22 ? 11.043  -8.635  2.305   1.00 0.00 ? 106 ARG A CD   10 
ATOM 11171 N NE   . ARG A 1 22 ? 11.095  -7.544  3.278   1.00 0.00 ? 106 ARG A NE   10 
ATOM 11172 C CZ   . ARG A 1 22 ? 12.103  -7.350  4.127   1.00 0.00 ? 106 ARG A CZ   10 
ATOM 11173 N NH1  . ARG A 1 22 ? 13.134  -8.185  4.149   1.00 0.00 ? 106 ARG A NH1  10 
ATOM 11174 N NH2  . ARG A 1 22 ? 12.080  -6.310  4.953   1.00 0.00 ? 106 ARG A NH2  10 
ATOM 11175 H H    . ARG A 1 22 ? 7.245   -6.033  1.244   1.00 0.00 ? 106 ARG A H    10 
ATOM 11176 H HA   . ARG A 1 22 ? 8.164   -8.131  -0.598  1.00 0.00 ? 106 ARG A HA   10 
ATOM 11177 H HB2  . ARG A 1 22 ? 8.474   -7.942  2.388   1.00 0.00 ? 106 ARG A HB2  10 
ATOM 11178 H HB3  . ARG A 1 22 ? 8.455   -9.509  1.586   1.00 0.00 ? 106 ARG A HB3  10 
ATOM 11179 H HG2  . ARG A 1 22 ? 10.390  -8.968  0.308   1.00 0.00 ? 106 ARG A HG2  10 
ATOM 11180 H HG3  . ARG A 1 22 ? 10.327  -7.284  0.824   1.00 0.00 ? 106 ARG A HG3  10 
ATOM 11181 H HD2  . ARG A 1 22 ? 10.666  -9.522  2.792   1.00 0.00 ? 106 ARG A HD2  10 
ATOM 11182 H HD3  . ARG A 1 22 ? 12.042  -8.823  1.938   1.00 0.00 ? 106 ARG A HD3  10 
ATOM 11183 H HE   . ARG A 1 22 ? 10.343  -6.909  3.289   1.00 0.00 ? 106 ARG A HE   10 
ATOM 11184 H HH11 . ARG A 1 22 ? 13.164  -8.976  3.518   1.00 0.00 ? 106 ARG A HH11 10 
ATOM 11185 H HH12 . ARG A 1 22 ? 13.893  -8.037  4.796   1.00 0.00 ? 106 ARG A HH12 10 
ATOM 11186 H HH21 . ARG A 1 22 ? 11.301  -5.668  4.935   1.00 0.00 ? 106 ARG A HH21 10 
ATOM 11187 H HH22 . ARG A 1 22 ? 12.836  -6.153  5.590   1.00 0.00 ? 106 ARG A HH22 10 
ATOM 11188 N N    . LEU A 1 23 ? 6.114   -9.559  -0.270  1.00 0.00 ? 107 LEU A N    10 
ATOM 11189 C CA   . LEU A 1 23 ? 4.776   -10.144 -0.388  1.00 0.00 ? 107 LEU A CA   10 
ATOM 11190 C C    . LEU A 1 23 ? 4.278   -10.706 0.943   1.00 0.00 ? 107 LEU A C    10 
ATOM 11191 O O    . LEU A 1 23 ? 3.097   -11.013 1.090   1.00 0.00 ? 107 LEU A O    10 
ATOM 11192 C CB   . LEU A 1 23 ? 4.748   -11.248 -1.457  1.00 0.00 ? 107 LEU A CB   10 
ATOM 11193 C CG   . LEU A 1 23 ? 4.923   -10.779 -2.907  1.00 0.00 ? 107 LEU A CG   10 
ATOM 11194 C CD1  . LEU A 1 23 ? 6.370   -10.420 -3.195  1.00 0.00 ? 107 LEU A CD1  10 
ATOM 11195 C CD2  . LEU A 1 23 ? 4.434   -11.844 -3.873  1.00 0.00 ? 107 LEU A CD2  10 
ATOM 11196 H H    . LEU A 1 23 ? 6.861   -9.976  -0.753  1.00 0.00 ? 107 LEU A H    10 
ATOM 11197 H HA   . LEU A 1 23 ? 4.106   -9.354  -0.694  1.00 0.00 ? 107 LEU A HA   10 
ATOM 11198 H HB2  . LEU A 1 23 ? 5.538   -11.952 -1.234  1.00 0.00 ? 107 LEU A HB2  10 
ATOM 11199 H HB3  . LEU A 1 23 ? 3.803   -11.764 -1.385  1.00 0.00 ? 107 LEU A HB3  10 
ATOM 11200 H HG   . LEU A 1 23 ? 4.325   -9.892  -3.060  1.00 0.00 ? 107 LEU A HG   10 
ATOM 11201 H HD11 . LEU A 1 23 ? 6.996   -11.280 -3.021  1.00 0.00 ? 107 LEU A HD11 10 
ATOM 11202 H HD12 . LEU A 1 23 ? 6.675   -9.615  -2.544  1.00 0.00 ? 107 LEU A HD12 10 
ATOM 11203 H HD13 . LEU A 1 23 ? 6.465   -10.108 -4.224  1.00 0.00 ? 107 LEU A HD13 10 
ATOM 11204 H HD21 . LEU A 1 23 ? 3.392   -12.054 -3.680  1.00 0.00 ? 107 LEU A HD21 10 
ATOM 11205 H HD22 . LEU A 1 23 ? 5.015   -12.745 -3.739  1.00 0.00 ? 107 LEU A HD22 10 
ATOM 11206 H HD23 . LEU A 1 23 ? 4.546   -11.488 -4.886  1.00 0.00 ? 107 LEU A HD23 10 
ATOM 11207 N N    . THR A 1 24 ? 5.180   -10.815 1.909   1.00 0.00 ? 108 THR A N    10 
ATOM 11208 C CA   . THR A 1 24 ? 4.844   -11.361 3.215   1.00 0.00 ? 108 THR A CA   10 
ATOM 11209 C C    . THR A 1 24 ? 4.264   -10.276 4.135   1.00 0.00 ? 108 THR A C    10 
ATOM 11210 O O    . THR A 1 24 ? 4.036   -10.513 5.325   1.00 0.00 ? 108 THR A O    10 
ATOM 11211 C CB   . THR A 1 24 ? 6.092   -12.004 3.869   1.00 0.00 ? 108 THR A CB   10 
ATOM 11212 O OG1  . THR A 1 24 ? 5.747   -12.641 5.105   1.00 0.00 ? 108 THR A OG1  10 
ATOM 11213 C CG2  . THR A 1 24 ? 7.174   -10.964 4.121   1.00 0.00 ? 108 THR A CG2  10 
ATOM 11214 H H    . THR A 1 24 ? 6.095   -10.515 1.741   1.00 0.00 ? 108 THR A H    10 
ATOM 11215 H HA   . THR A 1 24 ? 4.100   -12.133 3.073   1.00 0.00 ? 108 THR A HA   10 
ATOM 11216 H HB   . THR A 1 24 ? 6.487   -12.749 3.193   1.00 0.00 ? 108 THR A HB   10 
ATOM 11217 H HG1  . THR A 1 24 ? 5.073   -12.113 5.560   1.00 0.00 ? 108 THR A HG1  10 
ATOM 11218 H HG21 . THR A 1 24 ? 7.435   -10.484 3.189   1.00 0.00 ? 108 THR A HG21 10 
ATOM 11219 H HG22 . THR A 1 24 ? 8.048   -11.446 4.533   1.00 0.00 ? 108 THR A HG22 10 
ATOM 11220 H HG23 . THR A 1 24 ? 6.809   -10.225 4.818   1.00 0.00 ? 108 THR A HG23 10 
ATOM 11221 N N    . GLN A 1 25 ? 4.014   -9.094  3.580   1.00 0.00 ? 109 GLN A N    10 
ATOM 11222 C CA   . GLN A 1 25 ? 3.498   -7.985  4.369   1.00 0.00 ? 109 GLN A CA   10 
ATOM 11223 C C    . GLN A 1 25 ? 1.985   -7.895  4.293   1.00 0.00 ? 109 GLN A C    10 
ATOM 11224 O O    . GLN A 1 25 ? 1.373   -8.232  3.274   1.00 0.00 ? 109 GLN A O    10 
ATOM 11225 C CB   . GLN A 1 25 ? 4.072   -6.655  3.896   1.00 0.00 ? 109 GLN A CB   10 
ATOM 11226 C CG   . GLN A 1 25 ? 5.578   -6.536  4.021   1.00 0.00 ? 109 GLN A CG   10 
ATOM 11227 C CD   . GLN A 1 25 ? 6.096   -5.218  3.480   1.00 0.00 ? 109 GLN A CD   10 
ATOM 11228 O OE1  . GLN A 1 25 ? 7.222   -5.134  3.001   1.00 0.00 ? 109 GLN A OE1  10 
ATOM 11229 N NE2  . GLN A 1 25 ? 5.276   -4.177  3.546   1.00 0.00 ? 109 GLN A NE2  10 
ATOM 11230 H H    . GLN A 1 25 ? 4.172   -8.968  2.622   1.00 0.00 ? 109 GLN A H    10 
ATOM 11231 H HA   . GLN A 1 25 ? 3.785   -8.145  5.398   1.00 0.00 ? 109 GLN A HA   10 
ATOM 11232 H HB2  . GLN A 1 25 ? 3.808   -6.514  2.862   1.00 0.00 ? 109 GLN A HB2  10 
ATOM 11233 H HB3  . GLN A 1 25 ? 3.623   -5.866  4.481   1.00 0.00 ? 109 GLN A HB3  10 
ATOM 11234 H HG2  . GLN A 1 25 ? 5.849   -6.615  5.063   1.00 0.00 ? 109 GLN A HG2  10 
ATOM 11235 H HG3  . GLN A 1 25 ? 6.039   -7.343  3.467   1.00 0.00 ? 109 GLN A HG3  10 
ATOM 11236 H HE21 . GLN A 1 25 ? 4.384   -4.309  3.934   1.00 0.00 ? 109 GLN A HE21 10 
ATOM 11237 H HE22 . GLN A 1 25 ? 5.590   -3.318  3.192   1.00 0.00 ? 109 GLN A HE22 10 
ATOM 11238 N N    . THR A 1 26 ? 1.400   -7.425  5.379   1.00 0.00 ? 110 THR A N    10 
ATOM 11239 C CA   . THR A 1 26 ? -0.006  -7.075  5.420   1.00 0.00 ? 110 THR A CA   10 
ATOM 11240 C C    . THR A 1 26 ? -0.218  -5.679  4.843   1.00 0.00 ? 110 THR A C    10 
ATOM 11241 O O    . THR A 1 26 ? 0.746   -4.925  4.653   1.00 0.00 ? 110 THR A O    10 
ATOM 11242 C CB   . THR A 1 26 ? -0.518  -7.115  6.870   1.00 0.00 ? 110 THR A CB   10 
ATOM 11243 O OG1  . THR A 1 26 ? 0.441   -6.480  7.733   1.00 0.00 ? 110 THR A OG1  10 
ATOM 11244 C CG2  . THR A 1 26 ? -0.759  -8.548  7.321   1.00 0.00 ? 110 THR A CG2  10 
ATOM 11245 H H    . THR A 1 26 ? 1.934   -7.317  6.195   1.00 0.00 ? 110 THR A H    10 
ATOM 11246 H HA   . THR A 1 26 ? -0.559  -7.792  4.838   1.00 0.00 ? 110 THR A HA   10 
ATOM 11247 H HB   . THR A 1 26 ? -1.452  -6.573  6.921   1.00 0.00 ? 110 THR A HB   10 
ATOM 11248 H HG1  . THR A 1 26 ? 0.673   -7.082  8.456   1.00 0.00 ? 110 THR A HG1  10 
ATOM 11249 H HG21 . THR A 1 26 ? -1.095  -8.552  8.348   1.00 0.00 ? 110 THR A HG21 10 
ATOM 11250 H HG22 . THR A 1 26 ? 0.158   -9.111  7.242   1.00 0.00 ? 110 THR A HG22 10 
ATOM 11251 H HG23 . THR A 1 26 ? -1.515  -9.001  6.694   1.00 0.00 ? 110 THR A HG23 10 
ATOM 11252 N N    . VAL A 1 27 ? -1.469  -5.330  4.567   1.00 0.00 ? 111 VAL A N    10 
ATOM 11253 C CA   . VAL A 1 27 ? -1.797  -4.000  4.064   1.00 0.00 ? 111 VAL A CA   10 
ATOM 11254 C C    . VAL A 1 27 ? -1.455  -2.952  5.120   1.00 0.00 ? 111 VAL A C    10 
ATOM 11255 O O    . VAL A 1 27 ? -1.011  -1.843  4.805   1.00 0.00 ? 111 VAL A O    10 
ATOM 11256 C CB   . VAL A 1 27 ? -3.290  -3.892  3.682   1.00 0.00 ? 111 VAL A CB   10 
ATOM 11257 C CG1  . VAL A 1 27 ? -3.605  -2.523  3.092   1.00 0.00 ? 111 VAL A CG1  10 
ATOM 11258 C CG2  . VAL A 1 27 ? -3.671  -4.996  2.704   1.00 0.00 ? 111 VAL A CG2  10 
ATOM 11259 H H    . VAL A 1 27 ? -2.193  -5.978  4.714   1.00 0.00 ? 111 VAL A H    10 
ATOM 11260 H HA   . VAL A 1 27 ? -1.201  -3.818  3.180   1.00 0.00 ? 111 VAL A HA   10 
ATOM 11261 H HB   . VAL A 1 27 ? -3.880  -4.016  4.579   1.00 0.00 ? 111 VAL A HB   10 
ATOM 11262 H HG11 . VAL A 1 27 ? -4.653  -2.474  2.835   1.00 0.00 ? 111 VAL A HG11 10 
ATOM 11263 H HG12 . VAL A 1 27 ? -3.010  -2.367  2.205   1.00 0.00 ? 111 VAL A HG12 10 
ATOM 11264 H HG13 . VAL A 1 27 ? -3.376  -1.757  3.818   1.00 0.00 ? 111 VAL A HG13 10 
ATOM 11265 H HG21 . VAL A 1 27 ? -3.091  -4.892  1.799   1.00 0.00 ? 111 VAL A HG21 10 
ATOM 11266 H HG22 . VAL A 1 27 ? -4.723  -4.926  2.470   1.00 0.00 ? 111 VAL A HG22 10 
ATOM 11267 H HG23 . VAL A 1 27 ? -3.467  -5.958  3.153   1.00 0.00 ? 111 VAL A HG23 10 
ATOM 11268 N N    . ALA A 1 28 ? -1.642  -3.333  6.374   1.00 0.00 ? 112 ALA A N    10 
ATOM 11269 C CA   . ALA A 1 28 ? -1.290  -2.491  7.504   1.00 0.00 ? 112 ALA A CA   10 
ATOM 11270 C C    . ALA A 1 28 ? 0.195   -2.156  7.494   1.00 0.00 ? 112 ALA A C    10 
ATOM 11271 O O    . ALA A 1 28 ? 0.581   -1.013  7.742   1.00 0.00 ? 112 ALA A O    10 
ATOM 11272 C CB   . ALA A 1 28 ? -1.651  -3.186  8.803   1.00 0.00 ? 112 ALA A CB   10 
ATOM 11273 H H    . ALA A 1 28 ? -2.050  -4.220  6.549   1.00 0.00 ? 112 ALA A H    10 
ATOM 11274 H HA   . ALA A 1 28 ? -1.861  -1.576  7.437   1.00 0.00 ? 112 ALA A HA   10 
ATOM 11275 H HB1  . ALA A 1 28 ? -1.126  -4.129  8.861   1.00 0.00 ? 112 ALA A HB1  10 
ATOM 11276 H HB2  . ALA A 1 28 ? -2.716  -3.367  8.830   1.00 0.00 ? 112 ALA A HB2  10 
ATOM 11277 H HB3  . ALA A 1 28 ? -1.370  -2.563  9.638   1.00 0.00 ? 112 ALA A HB3  10 
ATOM 11278 N N    . HIS A 1 29 ? 1.026   -3.146  7.174   1.00 0.00 ? 113 HIS A N    10 
ATOM 11279 C CA   . HIS A 1 29 ? 2.472   -2.952  7.176   1.00 0.00 ? 113 HIS A CA   10 
ATOM 11280 C C    . HIS A 1 29 ? 2.884   -1.981  6.073   1.00 0.00 ? 113 HIS A C    10 
ATOM 11281 O O    . HIS A 1 29 ? 4.003   -1.473  6.064   1.00 0.00 ? 113 HIS A O    10 
ATOM 11282 C CB   . HIS A 1 29 ? 3.218   -4.281  7.003   1.00 0.00 ? 113 HIS A CB   10 
ATOM 11283 C CG   . HIS A 1 29 ? 4.633   -4.222  7.502   1.00 0.00 ? 113 HIS A CG   10 
ATOM 11284 N ND1  . HIS A 1 29 ? 5.725   -4.082  6.672   1.00 0.00 ? 113 HIS A ND1  10 
ATOM 11285 C CD2  . HIS A 1 29 ? 5.130   -4.261  8.762   1.00 0.00 ? 113 HIS A CD2  10 
ATOM 11286 C CE1  . HIS A 1 29 ? 6.826   -4.035  7.401   1.00 0.00 ? 113 HIS A CE1  10 
ATOM 11287 N NE2  . HIS A 1 29 ? 6.496   -4.138  8.675   1.00 0.00 ? 113 HIS A NE2  10 
ATOM 11288 H H    . HIS A 1 29 ? 0.656   -4.027  6.943   1.00 0.00 ? 113 HIS A H    10 
ATOM 11289 H HA   . HIS A 1 29 ? 2.742   -2.521  8.130   1.00 0.00 ? 113 HIS A HA   10 
ATOM 11290 H HB2  . HIS A 1 29 ? 2.700   -5.056  7.547   1.00 0.00 ? 113 HIS A HB2  10 
ATOM 11291 H HB3  . HIS A 1 29 ? 3.243   -4.537  5.956   1.00 0.00 ? 113 HIS A HB3  10 
ATOM 11292 H HD1  . HIS A 1 29 ? 5.699   -4.020  5.695   1.00 0.00 ? 113 HIS A HD1  10 
ATOM 11293 H HD2  . HIS A 1 29 ? 4.558   -4.368  9.671   1.00 0.00 ? 113 HIS A HD2  10 
ATOM 11294 H HE1  . HIS A 1 29 ? 7.830   -3.933  7.016   1.00 0.00 ? 113 HIS A HE1  10 
ATOM 11295 H HE2  . HIS A 1 29 ? 7.077   -3.844  9.420   1.00 0.00 ? 113 HIS A HE2  10 
ATOM 11296 N N    . LEU A 1 30 ? 1.979   -1.742  5.138   1.00 0.00 ? 114 LEU A N    10 
ATOM 11297 C CA   . LEU A 1 30 ? 2.215   -0.774  4.083   1.00 0.00 ? 114 LEU A CA   10 
ATOM 11298 C C    . LEU A 1 30 ? 1.689   0.600   4.491   1.00 0.00 ? 114 LEU A C    10 
ATOM 11299 O O    . LEU A 1 30 ? 2.436   1.580   4.510   1.00 0.00 ? 114 LEU A O    10 
ATOM 11300 C CB   . LEU A 1 30 ? 1.542   -1.229  2.783   1.00 0.00 ? 114 LEU A CB   10 
ATOM 11301 C CG   . LEU A 1 30 ? 1.746   -0.301  1.581   1.00 0.00 ? 114 LEU A CG   10 
ATOM 11302 C CD1  . LEU A 1 30 ? 3.218   -0.216  1.209   1.00 0.00 ? 114 LEU A CD1  10 
ATOM 11303 C CD2  . LEU A 1 30 ? 0.923   -0.778  0.392   1.00 0.00 ? 114 LEU A CD2  10 
ATOM 11304 H H    . LEU A 1 30 ? 1.127   -2.229  5.161   1.00 0.00 ? 114 LEU A H    10 
ATOM 11305 H HA   . LEU A 1 30 ? 3.282   -0.709  3.924   1.00 0.00 ? 114 LEU A HA   10 
ATOM 11306 H HB2  . LEU A 1 30 ? 1.925   -2.205  2.527   1.00 0.00 ? 114 LEU A HB2  10 
ATOM 11307 H HB3  . LEU A 1 30 ? 0.482   -1.315  2.967   1.00 0.00 ? 114 LEU A HB3  10 
ATOM 11308 H HG   . LEU A 1 30 ? 1.412   0.693   1.841   1.00 0.00 ? 114 LEU A HG   10 
ATOM 11309 H HD11 . LEU A 1 30 ? 3.783   0.140   2.059   1.00 0.00 ? 114 LEU A HD11 10 
ATOM 11310 H HD12 . LEU A 1 30 ? 3.340   0.468   0.384   1.00 0.00 ? 114 LEU A HD12 10 
ATOM 11311 H HD13 . LEU A 1 30 ? 3.573   -1.195  0.923   1.00 0.00 ? 114 LEU A HD13 10 
ATOM 11312 H HD21 . LEU A 1 30 ? 1.222   -1.781  0.129   1.00 0.00 ? 114 LEU A HD21 10 
ATOM 11313 H HD22 . LEU A 1 30 ? 1.093   -0.121  -0.451  1.00 0.00 ? 114 LEU A HD22 10 
ATOM 11314 H HD23 . LEU A 1 30 ? -0.125  -0.769  0.652   1.00 0.00 ? 114 LEU A HD23 10 
ATOM 11315 N N    . LYS A 1 31 ? 0.413   0.659   4.858   1.00 0.00 ? 115 LYS A N    10 
ATOM 11316 C CA   . LYS A 1 31 ? -0.239  1.935   5.119   1.00 0.00 ? 115 LYS A CA   10 
ATOM 11317 C C    . LYS A 1 31 ? 0.177   2.531   6.466   1.00 0.00 ? 115 LYS A C    10 
ATOM 11318 O O    . LYS A 1 31 ? -0.128  3.684   6.750   1.00 0.00 ? 115 LYS A O    10 
ATOM 11319 C CB   . LYS A 1 31 ? -1.765  1.796   5.023   1.00 0.00 ? 115 LYS A CB   10 
ATOM 11320 C CG   . LYS A 1 31 ? -2.423  1.073   6.186   1.00 0.00 ? 115 LYS A CG   10 
ATOM 11321 C CD   . LYS A 1 31 ? -3.892  0.809   5.891   1.00 0.00 ? 115 LYS A CD   10 
ATOM 11322 C CE   . LYS A 1 31 ? -4.675  0.464   7.148   1.00 0.00 ? 115 LYS A CE   10 
ATOM 11323 N NZ   . LYS A 1 31 ? -4.914  1.662   8.000   1.00 0.00 ? 115 LYS A NZ   10 
ATOM 11324 H H    . LYS A 1 31 ? -0.103  -0.176  4.949   1.00 0.00 ? 115 LYS A H    10 
ATOM 11325 H HA   . LYS A 1 31 ? 0.081   2.619   4.345   1.00 0.00 ? 115 LYS A HA   10 
ATOM 11326 H HB2  . LYS A 1 31 ? -2.197  2.781   4.964   1.00 0.00 ? 115 LYS A HB2  10 
ATOM 11327 H HB3  . LYS A 1 31 ? -2.005  1.259   4.117   1.00 0.00 ? 115 LYS A HB3  10 
ATOM 11328 H HG2  . LYS A 1 31 ? -1.918  0.131   6.346   1.00 0.00 ? 115 LYS A HG2  10 
ATOM 11329 H HG3  . LYS A 1 31 ? -2.344  1.686   7.071   1.00 0.00 ? 115 LYS A HG3  10 
ATOM 11330 H HD2  . LYS A 1 31 ? -4.322  1.695   5.450   1.00 0.00 ? 115 LYS A HD2  10 
ATOM 11331 H HD3  . LYS A 1 31 ? -3.966  -0.013  5.195   1.00 0.00 ? 115 LYS A HD3  10 
ATOM 11332 H HE2  . LYS A 1 31 ? -5.627  0.041   6.860   1.00 0.00 ? 115 LYS A HE2  10 
ATOM 11333 H HE3  . LYS A 1 31 ? -4.115  -0.265  7.714   1.00 0.00 ? 115 LYS A HE3  10 
ATOM 11334 H HZ1  . LYS A 1 31 ? -5.400  2.405   7.447   1.00 0.00 ? 115 LYS A HZ1  10 
ATOM 11335 H HZ2  . LYS A 1 31 ? -4.018  2.045   8.352   1.00 0.00 ? 115 LYS A HZ2  10 
ATOM 11336 H HZ3  . LYS A 1 31 ? -5.512  1.410   8.810   1.00 0.00 ? 115 LYS A HZ3  10 
ATOM 11337 N N    . GLN A 1 32 ? 0.879   1.759   7.291   1.00 0.00 ? 116 GLN A N    10 
ATOM 11338 C CA   . GLN A 1 32 ? 1.429   2.295   8.538   1.00 0.00 ? 116 GLN A CA   10 
ATOM 11339 C C    . GLN A 1 32 ? 2.737   3.032   8.262   1.00 0.00 ? 116 GLN A C    10 
ATOM 11340 O O    . GLN A 1 32 ? 3.062   4.021   8.924   1.00 0.00 ? 116 GLN A O    10 
ATOM 11341 C CB   . GLN A 1 32 ? 1.641   1.193   9.580   1.00 0.00 ? 116 GLN A CB   10 
ATOM 11342 C CG   . GLN A 1 32 ? 2.165   1.713   10.909  1.00 0.00 ? 116 GLN A CG   10 
ATOM 11343 C CD   . GLN A 1 32 ? 2.209   0.652   11.991  1.00 0.00 ? 116 GLN A CD   10 
ATOM 11344 O OE1  . GLN A 1 32 ? 2.076   0.956   13.176  1.00 0.00 ? 116 GLN A OE1  10 
ATOM 11345 N NE2  . GLN A 1 32 ? 2.385   -0.598  11.599  1.00 0.00 ? 116 GLN A NE2  10 
ATOM 11346 H H    . GLN A 1 32 ? 1.018   0.811   7.070   1.00 0.00 ? 116 GLN A H    10 
ATOM 11347 H HA   . GLN A 1 32 ? 0.710   3.021   8.929   1.00 0.00 ? 116 GLN A HA   10 
ATOM 11348 H HB2  . GLN A 1 32 ? 0.700   0.692   9.756   1.00 0.00 ? 116 GLN A HB2  10 
ATOM 11349 H HB3  . GLN A 1 32 ? 2.351   0.478   9.192   1.00 0.00 ? 116 GLN A HB3  10 
ATOM 11350 H HG2  . GLN A 1 32 ? 3.165   2.089   10.759  1.00 0.00 ? 116 GLN A HG2  10 
ATOM 11351 H HG3  . GLN A 1 32 ? 1.526   2.520   11.241  1.00 0.00 ? 116 GLN A HG3  10 
ATOM 11352 H HE21 . GLN A 1 32 ? 2.474   -0.775  10.639  1.00 0.00 ? 116 GLN A HE21 10 
ATOM 11353 H HE22 . GLN A 1 32 ? 2.426   -1.298  12.285  1.00 0.00 ? 116 GLN A HE22 10 
ATOM 11354 N N    . GLN A 1 33 ? 3.475   2.570   7.262   1.00 0.00 ? 117 GLN A N    10 
ATOM 11355 C CA   . GLN A 1 33 ? 4.652   3.302   6.811   1.00 0.00 ? 117 GLN A CA   10 
ATOM 11356 C C    . GLN A 1 33 ? 4.190   4.629   6.227   1.00 0.00 ? 117 GLN A C    10 
ATOM 11357 O O    . GLN A 1 33 ? 4.835   5.666   6.391   1.00 0.00 ? 117 GLN A O    10 
ATOM 11358 C CB   . GLN A 1 33 ? 5.439   2.497   5.775   1.00 0.00 ? 117 GLN A CB   10 
ATOM 11359 C CG   . GLN A 1 33 ? 5.914   1.149   6.288   1.00 0.00 ? 117 GLN A CG   10 
ATOM 11360 C CD   . GLN A 1 33 ? 6.804   0.431   5.296   1.00 0.00 ? 117 GLN A CD   10 
ATOM 11361 O OE1  . GLN A 1 33 ? 8.023   0.584   5.318   1.00 0.00 ? 117 GLN A OE1  10 
ATOM 11362 N NE2  . GLN A 1 33 ? 6.206   -0.361  4.422   1.00 0.00 ? 117 GLN A NE2  10 
ATOM 11363 H H    . GLN A 1 33 ? 3.226   1.734   6.819   1.00 0.00 ? 117 GLN A H    10 
ATOM 11364 H HA   . GLN A 1 33 ? 5.279   3.493   7.670   1.00 0.00 ? 117 GLN A HA   10 
ATOM 11365 H HB2  . GLN A 1 33 ? 4.813   2.329   4.912   1.00 0.00 ? 117 GLN A HB2  10 
ATOM 11366 H HB3  . GLN A 1 33 ? 6.306   3.067   5.475   1.00 0.00 ? 117 GLN A HB3  10 
ATOM 11367 H HG2  . GLN A 1 33 ? 6.468   1.299   7.202   1.00 0.00 ? 117 GLN A HG2  10 
ATOM 11368 H HG3  . GLN A 1 33 ? 5.050   0.529   6.489   1.00 0.00 ? 117 GLN A HG3  10 
ATOM 11369 H HE21 . GLN A 1 33 ? 5.230   -0.440  4.465   1.00 0.00 ? 117 GLN A HE21 10 
ATOM 11370 H HE22 . GLN A 1 33 ? 6.765   -0.828  3.770   1.00 0.00 ? 117 GLN A HE22 10 
ATOM 11371 N N    . VAL A 1 34 ? 3.035   4.582   5.572   1.00 0.00 ? 118 VAL A N    10 
ATOM 11372 C CA   . VAL A 1 34 ? 2.381   5.783   5.078   1.00 0.00 ? 118 VAL A CA   10 
ATOM 11373 C C    . VAL A 1 34 ? 1.903   6.643   6.246   1.00 0.00 ? 118 VAL A C    10 
ATOM 11374 O O    . VAL A 1 34 ? 2.100   7.846   6.252   1.00 0.00 ? 118 VAL A O    10 
ATOM 11375 C CB   . VAL A 1 34 ? 1.182   5.436   4.169   1.00 0.00 ? 118 VAL A CB   10 
ATOM 11376 C CG1  . VAL A 1 34 ? 0.521   6.699   3.639   1.00 0.00 ? 118 VAL A CG1  10 
ATOM 11377 C CG2  . VAL A 1 34 ? 1.623   4.536   3.023   1.00 0.00 ? 118 VAL A CG2  10 
ATOM 11378 H H    . VAL A 1 34 ? 2.616   3.708   5.407   1.00 0.00 ? 118 VAL A H    10 
ATOM 11379 H HA   . VAL A 1 34 ? 3.102   6.347   4.498   1.00 0.00 ? 118 VAL A HA   10 
ATOM 11380 H HB   . VAL A 1 34 ? 0.456   4.898   4.760   1.00 0.00 ? 118 VAL A HB   10 
ATOM 11381 H HG11 . VAL A 1 34 ? -0.281  6.430   2.966   1.00 0.00 ? 118 VAL A HG11 10 
ATOM 11382 H HG12 . VAL A 1 34 ? 1.252   7.294   3.110   1.00 0.00 ? 118 VAL A HG12 10 
ATOM 11383 H HG13 . VAL A 1 34 ? 0.122   7.269   4.463   1.00 0.00 ? 118 VAL A HG13 10 
ATOM 11384 H HG21 . VAL A 1 34 ? 2.070   3.638   3.423   1.00 0.00 ? 118 VAL A HG21 10 
ATOM 11385 H HG22 . VAL A 1 34 ? 2.346   5.058   2.414   1.00 0.00 ? 118 VAL A HG22 10 
ATOM 11386 H HG23 . VAL A 1 34 ? 0.766   4.275   2.420   1.00 0.00 ? 118 VAL A HG23 10 
ATOM 11387 N N    . SER A 1 35 ? 1.311   6.018   7.261   1.00 0.00 ? 119 SER A N    10 
ATOM 11388 C CA   . SER A 1 35 ? 0.844   6.752   8.437   1.00 0.00 ? 119 SER A CA   10 
ATOM 11389 C C    . SER A 1 35 ? 2.009   7.185   9.334   1.00 0.00 ? 119 SER A C    10 
ATOM 11390 O O    . SER A 1 35 ? 1.805   7.766   10.401  1.00 0.00 ? 119 SER A O    10 
ATOM 11391 C CB   . SER A 1 35 ? -0.180  5.929   9.230   1.00 0.00 ? 119 SER A CB   10 
ATOM 11392 O OG   . SER A 1 35 ? 0.138   4.566   9.226   1.00 0.00 ? 119 SER A OG   10 
ATOM 11393 H H    . SER A 1 35 ? 1.178   5.049   7.219   1.00 0.00 ? 119 SER A H    10 
ATOM 11394 H HA   . SER A 1 35 ? 0.356   7.646   8.078   1.00 0.00 ? 119 SER A HA   10 
ATOM 11395 H HB2  . SER A 1 35 ? -0.196  6.261   10.248  1.00 0.00 ? 119 SER A HB2  10 
ATOM 11396 H HB3  . SER A 1 35 ? -1.158  6.052   8.791   1.00 0.00 ? 119 SER A HB3  10 
ATOM 11397 H HG   . SER A 1 35 ? -0.264  4.150   8.453   1.00 0.00 ? 119 SER A HG   10 
ATOM 11398 N N    . GLY A 1 36 ? 3.227   6.885   8.903   1.00 0.00 ? 120 GLY A N    10 
ATOM 11399 C CA   . GLY A 1 36 ? 4.402   7.450   9.541   1.00 0.00 ? 120 GLY A CA   10 
ATOM 11400 C C    . GLY A 1 36 ? 4.852   8.738   8.863   1.00 0.00 ? 120 GLY A C    10 
ATOM 11401 O O    . GLY A 1 36 ? 5.100   9.747   9.521   1.00 0.00 ? 120 GLY A O    10 
ATOM 11402 H H    . GLY A 1 36 ? 3.328   6.240   8.171   1.00 0.00 ? 120 GLY A H    10 
ATOM 11403 H HA2  . GLY A 1 36 ? 4.175   7.657   10.576  1.00 0.00 ? 120 GLY A HA2  10 
ATOM 11404 H HA3  . GLY A 1 36 ? 5.205   6.732   9.494   1.00 0.00 ? 120 GLY A HA3  10 
ATOM 11405 N N    . LEU A 1 37 ? 4.936   8.703   7.539   1.00 0.00 ? 121 LEU A N    10 
ATOM 11406 C CA   . LEU A 1 37 ? 5.397   9.853   6.753   1.00 0.00 ? 121 LEU A CA   10 
ATOM 11407 C C    . LEU A 1 37 ? 4.241   10.802  6.427   1.00 0.00 ? 121 LEU A C    10 
ATOM 11408 O O    . LEU A 1 37 ? 4.356   12.023  6.546   1.00 0.00 ? 121 LEU A O    10 
ATOM 11409 C CB   . LEU A 1 37 ? 6.036   9.358   5.453   1.00 0.00 ? 121 LEU A CB   10 
ATOM 11410 C CG   . LEU A 1 37 ? 7.279   8.482   5.627   1.00 0.00 ? 121 LEU A CG   10 
ATOM 11411 C CD1  . LEU A 1 37 ? 7.772   7.981   4.278   1.00 0.00 ? 121 LEU A CD1  10 
ATOM 11412 C CD2  . LEU A 1 37 ? 8.377   9.251   6.350   1.00 0.00 ? 121 LEU A CD2  10 
ATOM 11413 H H    . LEU A 1 37 ? 4.693   7.872   7.071   1.00 0.00 ? 121 LEU A H    10 
ATOM 11414 H HA   . LEU A 1 37 ? 6.137   10.381  7.335   1.00 0.00 ? 121 LEU A HA   10 
ATOM 11415 H HB2  . LEU A 1 37 ? 5.295   8.788   4.911   1.00 0.00 ? 121 LEU A HB2  10 
ATOM 11416 H HB3  . LEU A 1 37 ? 6.305   10.214  4.857   1.00 0.00 ? 121 LEU A HB3  10 
ATOM 11417 H HG   . LEU A 1 37 ? 7.022   7.623   6.226   1.00 0.00 ? 121 LEU A HG   10 
ATOM 11418 H HD11 . LEU A 1 37 ? 8.016   8.823   3.648   1.00 0.00 ? 121 LEU A HD11 10 
ATOM 11419 H HD12 . LEU A 1 37 ? 6.999   7.390   3.808   1.00 0.00 ? 121 LEU A HD12 10 
ATOM 11420 H HD13 . LEU A 1 37 ? 8.651   7.370   4.422   1.00 0.00 ? 121 LEU A HD13 10 
ATOM 11421 H HD21 . LEU A 1 37 ? 8.039   9.514   7.342   1.00 0.00 ? 121 LEU A HD21 10 
ATOM 11422 H HD22 . LEU A 1 37 ? 8.612   10.150  5.801   1.00 0.00 ? 121 LEU A HD22 10 
ATOM 11423 H HD23 . LEU A 1 37 ? 9.258   8.632   6.423   1.00 0.00 ? 121 LEU A HD23 10 
ATOM 11424 N N    . GLU A 1 38 ? 3.136   10.204  6.025   1.00 0.00 ? 122 GLU A N    10 
ATOM 11425 C CA   . GLU A 1 38 ? 1.919   10.903  5.622   1.00 0.00 ? 122 GLU A CA   10 
ATOM 11426 C C    . GLU A 1 38 ? 0.937   10.922  6.795   1.00 0.00 ? 122 GLU A C    10 
ATOM 11427 O O    . GLU A 1 38 ? -0.238  11.185  6.602   1.00 0.00 ? 122 GLU A O    10 
ATOM 11428 C CB   . GLU A 1 38 ? 1.291   10.226  4.395   1.00 0.00 ? 122 GLU A CB   10 
ATOM 11429 C CG   . GLU A 1 38 ? 0.218   11.058  3.705   1.00 0.00 ? 122 GLU A CG   10 
ATOM 11430 C CD   . GLU A 1 38 ? 0.776   12.310  3.067   1.00 0.00 ? 122 GLU A CD   10 
ATOM 11431 O OE1  . GLU A 1 38 ? 1.258   13.206  3.800   1.00 0.00 ? 122 GLU A OE1  10 
ATOM 11432 O OE2  . GLU A 1 38 ? 0.748   12.411  1.824   1.00 0.00 ? 122 GLU A OE2  10 
ATOM 11433 H H    . GLU A 1 38 ? 3.121   9.222   6.008   1.00 0.00 ? 122 GLU A H    10 
ATOM 11434 H HA   . GLU A 1 38 ? 2.186   11.919  5.372   1.00 0.00 ? 122 GLU A HA   10 
ATOM 11435 H HB2  . GLU A 1 38 ? 2.069   10.020  3.679   1.00 0.00 ? 122 GLU A HB2  10 
ATOM 11436 H HB3  . GLU A 1 38 ? 0.845   9.292   4.705   1.00 0.00 ? 122 GLU A HB3  10 
ATOM 11437 H HG2  . GLU A 1 38 ? -0.247  10.457  2.938   1.00 0.00 ? 122 GLU A HG2  10 
ATOM 11438 H HG3  . GLU A 1 38 ? -0.523  11.344  4.437   1.00 0.00 ? 122 GLU A HG3  10 
ATOM 11439 N N    . GLY A 1 39 ? 1.473   10.515  7.962   1.00 0.00 ? 123 GLY A N    10 
ATOM 11440 C CA   . GLY A 1 39 ? 0.779   10.298  9.258   1.00 0.00 ? 123 GLY A CA   10 
ATOM 11441 C C    . GLY A 1 39 ? -0.474  11.104  9.633   1.00 0.00 ? 123 GLY A C    10 
ATOM 11442 O O    . GLY A 1 39 ? -0.920  11.005  10.779  1.00 0.00 ? 123 GLY A O    10 
ATOM 11443 H H    . GLY A 1 39 ? 2.437   10.345  7.951   1.00 0.00 ? 123 GLY A H    10 
ATOM 11444 H HA2  . GLY A 1 39 ? 0.497   9.257   9.295   1.00 0.00 ? 123 GLY A HA2  10 
ATOM 11445 H HA3  . GLY A 1 39 ? 1.513   10.455  10.036  1.00 0.00 ? 123 GLY A HA3  10 
ATOM 11446 N N    . VAL A 1 40 ? -1.020  11.908  8.743   1.00 0.00 ? 124 VAL A N    10 
ATOM 11447 C CA   . VAL A 1 40 ? -2.329  12.522  8.940   1.00 0.00 ? 124 VAL A CA   10 
ATOM 11448 C C    . VAL A 1 40 ? -3.349  11.437  9.338   1.00 0.00 ? 124 VAL A C    10 
ATOM 11449 O O    . VAL A 1 40 ? -3.103  10.246  9.126   1.00 0.00 ? 124 VAL A O    10 
ATOM 11450 C CB   . VAL A 1 40 ? -2.808  13.223  7.642   1.00 0.00 ? 124 VAL A CB   10 
ATOM 11451 C CG1  . VAL A 1 40 ? -3.998  14.128  7.911   1.00 0.00 ? 124 VAL A CG1  10 
ATOM 11452 C CG2  . VAL A 1 40 ? -1.680  14.015  6.997   1.00 0.00 ? 124 VAL A CG2  10 
ATOM 11453 H H    . VAL A 1 40 ? -0.539  12.071  7.904   1.00 0.00 ? 124 VAL A H    10 
ATOM 11454 H HA   . VAL A 1 40 ? -2.252  13.254  9.731   1.00 0.00 ? 124 VAL A HA   10 
ATOM 11455 H HB   . VAL A 1 40 ? -3.121  12.459  6.946   1.00 0.00 ? 124 VAL A HB   10 
ATOM 11456 H HG11 . VAL A 1 40 ? -4.806  13.545  8.327   1.00 0.00 ? 124 VAL A HG11 10 
ATOM 11457 H HG12 . VAL A 1 40 ? -4.320  14.582  6.987   1.00 0.00 ? 124 VAL A HG12 10 
ATOM 11458 H HG13 . VAL A 1 40 ? -3.712  14.900  8.612   1.00 0.00 ? 124 VAL A HG13 10 
ATOM 11459 H HG21 . VAL A 1 40 ? -2.068  14.566  6.152   1.00 0.00 ? 124 VAL A HG21 10 
ATOM 11460 H HG22 . VAL A 1 40 ? -0.910  13.338  6.659   1.00 0.00 ? 124 VAL A HG22 10 
ATOM 11461 H HG23 . VAL A 1 40 ? -1.266  14.704  7.717   1.00 0.00 ? 124 VAL A HG23 10 
ATOM 11462 N N    . GLN A 1 41 ? -4.480  11.851  9.913   1.00 0.00 ? 125 GLN A N    10 
ATOM 11463 C CA   . GLN A 1 41 ? -5.501  10.925  10.426  1.00 0.00 ? 125 GLN A CA   10 
ATOM 11464 C C    . GLN A 1 41 ? -5.756  9.750   9.477   1.00 0.00 ? 125 GLN A C    10 
ATOM 11465 O O    . GLN A 1 41 ? -5.864  9.920   8.260   1.00 0.00 ? 125 GLN A O    10 
ATOM 11466 C CB   . GLN A 1 41 ? -6.813  11.668  10.705  1.00 0.00 ? 125 GLN A CB   10 
ATOM 11467 C CG   . GLN A 1 41 ? -6.788  12.526  11.966  1.00 0.00 ? 125 GLN A CG   10 
ATOM 11468 C CD   . GLN A 1 41 ? -5.816  13.689  11.891  1.00 0.00 ? 125 GLN A CD   10 
ATOM 11469 O OE1  . GLN A 1 41 ? -5.565  14.246  10.824  1.00 0.00 ? 125 GLN A OE1  10 
ATOM 11470 N NE2  . GLN A 1 41 ? -5.245  14.051  13.027  1.00 0.00 ? 125 GLN A NE2  10 
ATOM 11471 H H    . GLN A 1 41 ? -4.640  12.818  9.998   1.00 0.00 ? 125 GLN A H    10 
ATOM 11472 H HA   . GLN A 1 41 ? -5.129  10.531  11.358  1.00 0.00 ? 125 GLN A HA   10 
ATOM 11473 H HB2  . GLN A 1 41 ? -7.032  12.310  9.865   1.00 0.00 ? 125 GLN A HB2  10 
ATOM 11474 H HB3  . GLN A 1 41 ? -7.607  10.943  10.807  1.00 0.00 ? 125 GLN A HB3  10 
ATOM 11475 H HG2  . GLN A 1 41 ? -7.779  12.922  12.130  1.00 0.00 ? 125 GLN A HG2  10 
ATOM 11476 H HG3  . GLN A 1 41 ? -6.515  11.900  12.803  1.00 0.00 ? 125 GLN A HG3  10 
ATOM 11477 H HE21 . GLN A 1 41 ? -5.482  13.550  13.848  1.00 0.00 ? 125 GLN A HE21 10 
ATOM 11478 H HE22 . GLN A 1 41 ? -4.617  14.797  13.012  1.00 0.00 ? 125 GLN A HE22 10 
ATOM 11479 N N    . ASP A 1 42 ? -5.867  8.558   10.064  1.00 0.00 ? 126 ASP A N    10 
ATOM 11480 C CA   . ASP A 1 42 ? -5.956  7.303   9.307   1.00 0.00 ? 126 ASP A CA   10 
ATOM 11481 C C    . ASP A 1 42 ? -7.183  7.260   8.395   1.00 0.00 ? 126 ASP A C    10 
ATOM 11482 O O    . ASP A 1 42 ? -7.192  6.555   7.386   1.00 0.00 ? 126 ASP A O    10 
ATOM 11483 C CB   . ASP A 1 42 ? -5.973  6.117   10.282  1.00 0.00 ? 126 ASP A CB   10 
ATOM 11484 C CG   . ASP A 1 42 ? -6.170  4.774   9.599   1.00 0.00 ? 126 ASP A CG   10 
ATOM 11485 O OD1  . ASP A 1 42 ? -5.241  4.307   8.908   1.00 0.00 ? 126 ASP A OD1  10 
ATOM 11486 O OD2  . ASP A 1 42 ? -7.256  4.171   9.764   1.00 0.00 ? 126 ASP A OD2  10 
ATOM 11487 H H    . ASP A 1 42 ? -5.887  8.519   11.045  1.00 0.00 ? 126 ASP A H    10 
ATOM 11488 H HA   . ASP A 1 42 ? -5.074  7.231   8.694   1.00 0.00 ? 126 ASP A HA   10 
ATOM 11489 H HB2  . ASP A 1 42 ? -5.033  6.090   10.812  1.00 0.00 ? 126 ASP A HB2  10 
ATOM 11490 H HB3  . ASP A 1 42 ? -6.775  6.259   10.992  1.00 0.00 ? 126 ASP A HB3  10 
ATOM 11491 N N    . ASP A 1 43 ? -8.205  8.033   8.730   1.00 0.00 ? 127 ASP A N    10 
ATOM 11492 C CA   . ASP A 1 43 ? -9.432  8.040   7.940   1.00 0.00 ? 127 ASP A CA   10 
ATOM 11493 C C    . ASP A 1 43 ? -9.356  9.082   6.826   1.00 0.00 ? 127 ASP A C    10 
ATOM 11494 O O    . ASP A 1 43 ? -10.284 9.221   6.026   1.00 0.00 ? 127 ASP A O    10 
ATOM 11495 C CB   . ASP A 1 43 ? -10.651 8.312   8.829   1.00 0.00 ? 127 ASP A CB   10 
ATOM 11496 C CG   . ASP A 1 43 ? -10.734 9.752   9.304   1.00 0.00 ? 127 ASP A CG   10 
ATOM 11497 O OD1  . ASP A 1 43 ? -9.763  10.239  9.913   1.00 0.00 ? 127 ASP A OD1  10 
ATOM 11498 O OD2  . ASP A 1 43 ? -11.778 10.401  9.068   1.00 0.00 ? 127 ASP A OD2  10 
ATOM 11499 H H    . ASP A 1 43 ? -8.135  8.611   9.518   1.00 0.00 ? 127 ASP A H    10 
ATOM 11500 H HA   . ASP A 1 43 ? -9.536  7.063   7.492   1.00 0.00 ? 127 ASP A HA   10 
ATOM 11501 H HB2  . ASP A 1 43 ? -11.548 8.087   8.274   1.00 0.00 ? 127 ASP A HB2  10 
ATOM 11502 H HB3  . ASP A 1 43 ? -10.601 7.669   9.696   1.00 0.00 ? 127 ASP A HB3  10 
ATOM 11503 N N    . LEU A 1 44 ? -8.251  9.813   6.772   1.00 0.00 ? 128 LEU A N    10 
ATOM 11504 C CA   . LEU A 1 44 ? -8.081  10.850  5.764   1.00 0.00 ? 128 LEU A CA   10 
ATOM 11505 C C    . LEU A 1 44 ? -7.273  10.348  4.571   1.00 0.00 ? 128 LEU A C    10 
ATOM 11506 O O    . LEU A 1 44 ? -7.445  10.830  3.455   1.00 0.00 ? 128 LEU A O    10 
ATOM 11507 C CB   . LEU A 1 44 ? -7.430  12.094  6.373   1.00 0.00 ? 128 LEU A CB   10 
ATOM 11508 C CG   . LEU A 1 44 ? -8.298  12.844  7.390   1.00 0.00 ? 128 LEU A CG   10 
ATOM 11509 C CD1  . LEU A 1 44 ? -7.568  14.069  7.919   1.00 0.00 ? 128 LEU A CD1  10 
ATOM 11510 C CD2  . LEU A 1 44 ? -9.625  13.245  6.766   1.00 0.00 ? 128 LEU A CD2  10 
ATOM 11511 H H    . LEU A 1 44 ? -7.534  9.652   7.425   1.00 0.00 ? 128 LEU A H    10 
ATOM 11512 H HA   . LEU A 1 44 ? -9.066  11.119  5.412   1.00 0.00 ? 128 LEU A HA   10 
ATOM 11513 H HB2  . LEU A 1 44 ? -6.514  11.791  6.862   1.00 0.00 ? 128 LEU A HB2  10 
ATOM 11514 H HB3  . LEU A 1 44 ? -7.183  12.775  5.573   1.00 0.00 ? 128 LEU A HB3  10 
ATOM 11515 H HG   . LEU A 1 44 ? -8.504  12.192  8.228   1.00 0.00 ? 128 LEU A HG   10 
ATOM 11516 H HD11 . LEU A 1 44 ? -6.639  13.764  8.374   1.00 0.00 ? 128 LEU A HD11 10 
ATOM 11517 H HD12 . LEU A 1 44 ? -8.183  14.564  8.655   1.00 0.00 ? 128 LEU A HD12 10 
ATOM 11518 H HD13 . LEU A 1 44 ? -7.365  14.748  7.105   1.00 0.00 ? 128 LEU A HD13 10 
ATOM 11519 H HD21 . LEU A 1 44 ? -10.147 12.363  6.430   1.00 0.00 ? 128 LEU A HD21 10 
ATOM 11520 H HD22 . LEU A 1 44 ? -9.445  13.900  5.926   1.00 0.00 ? 128 LEU A HD22 10 
ATOM 11521 H HD23 . LEU A 1 44 ? -10.227 13.761  7.500   1.00 0.00 ? 128 LEU A HD23 10 
ATOM 11522 N N    . PHE A 1 45 ? -6.396  9.381   4.789   1.00 0.00 ? 129 PHE A N    10 
ATOM 11523 C CA   . PHE A 1 45 ? -5.681  8.788   3.672   1.00 0.00 ? 129 PHE A CA   10 
ATOM 11524 C C    . PHE A 1 45 ? -6.272  7.421   3.338   1.00 0.00 ? 129 PHE A C    10 
ATOM 11525 O O    . PHE A 1 45 ? -6.229  6.487   4.137   1.00 0.00 ? 129 PHE A O    10 
ATOM 11526 C CB   . PHE A 1 45 ? -4.160  8.724   3.917   1.00 0.00 ? 129 PHE A CB   10 
ATOM 11527 C CG   . PHE A 1 45 ? -3.700  7.771   4.989   1.00 0.00 ? 129 PHE A CG   10 
ATOM 11528 C CD1  . PHE A 1 45 ? -3.697  8.148   6.322   1.00 0.00 ? 129 PHE A CD1  10 
ATOM 11529 C CD2  . PHE A 1 45 ? -3.249  6.503   4.654   1.00 0.00 ? 129 PHE A CD2  10 
ATOM 11530 C CE1  . PHE A 1 45 ? -3.257  7.277   7.300   1.00 0.00 ? 129 PHE A CE1  10 
ATOM 11531 C CE2  . PHE A 1 45 ? -2.807  5.628   5.628   1.00 0.00 ? 129 PHE A CE2  10 
ATOM 11532 C CZ   . PHE A 1 45 ? -2.811  6.016   6.952   1.00 0.00 ? 129 PHE A CZ   10 
ATOM 11533 H H    . PHE A 1 45 ? -6.236  9.059   5.701   1.00 0.00 ? 129 PHE A H    10 
ATOM 11534 H HA   . PHE A 1 45 ? -5.858  9.431   2.819   1.00 0.00 ? 129 PHE A HA   10 
ATOM 11535 H HB2  . PHE A 1 45 ? -3.676  8.431   2.998   1.00 0.00 ? 129 PHE A HB2  10 
ATOM 11536 H HB3  . PHE A 1 45 ? -3.815  9.712   4.187   1.00 0.00 ? 129 PHE A HB3  10 
ATOM 11537 H HD1  . PHE A 1 45 ? -4.044  9.133   6.596   1.00 0.00 ? 129 PHE A HD1  10 
ATOM 11538 H HD2  . PHE A 1 45 ? -3.247  6.199   3.615   1.00 0.00 ? 129 PHE A HD2  10 
ATOM 11539 H HE1  . PHE A 1 45 ? -3.261  7.582   8.337   1.00 0.00 ? 129 PHE A HE1  10 
ATOM 11540 H HE2  . PHE A 1 45 ? -2.458  4.644   5.352   1.00 0.00 ? 129 PHE A HE2  10 
ATOM 11541 H HZ   . PHE A 1 45 ? -2.466  5.334   7.716   1.00 0.00 ? 129 PHE A HZ   10 
ATOM 11542 N N    . TRP A 1 46 ? -6.866  7.340   2.159   1.00 0.00 ? 130 TRP A N    10 
ATOM 11543 C CA   . TRP A 1 46 ? -7.542  6.140   1.704   1.00 0.00 ? 130 TRP A CA   10 
ATOM 11544 C C    . TRP A 1 46 ? -6.754  5.549   0.540   1.00 0.00 ? 130 TRP A C    10 
ATOM 11545 O O    . TRP A 1 46 ? -6.001  6.262   -0.118  1.00 0.00 ? 130 TRP A O    10 
ATOM 11546 C CB   . TRP A 1 46 ? -8.969  6.519   1.279   1.00 0.00 ? 130 TRP A CB   10 
ATOM 11547 C CG   . TRP A 1 46 ? -9.917  5.370   1.101   1.00 0.00 ? 130 TRP A CG   10 
ATOM 11548 C CD1  . TRP A 1 46 ? -10.144 4.346   1.972   1.00 0.00 ? 130 TRP A CD1  10 
ATOM 11549 C CD2  . TRP A 1 46 ? -10.797 5.159   -0.008  1.00 0.00 ? 130 TRP A CD2  10 
ATOM 11550 N NE1  . TRP A 1 46 ? -11.107 3.507   1.470   1.00 0.00 ? 130 TRP A NE1  10 
ATOM 11551 C CE2  . TRP A 1 46 ? -11.521 3.981   0.255   1.00 0.00 ? 130 TRP A CE2  10 
ATOM 11552 C CE3  . TRP A 1 46 ? -11.043 5.848   -1.198  1.00 0.00 ? 130 TRP A CE3  10 
ATOM 11553 C CZ2  . TRP A 1 46 ? -12.474 3.480   -0.626  1.00 0.00 ? 130 TRP A CZ2  10 
ATOM 11554 C CZ3  . TRP A 1 46 ? -11.987 5.349   -2.075  1.00 0.00 ? 130 TRP A CZ3  10 
ATOM 11555 C CH2  . TRP A 1 46 ? -12.694 4.176   -1.784  1.00 0.00 ? 130 TRP A CH2  10 
ATOM 11556 H H    . TRP A 1 46 ? -6.846  8.118   1.560   1.00 0.00 ? 130 TRP A H    10 
ATOM 11557 H HA   . TRP A 1 46 ? -7.579  5.430   2.518   1.00 0.00 ? 130 TRP A HA   10 
ATOM 11558 H HB2  . TRP A 1 46 ? -9.389  7.172   2.028   1.00 0.00 ? 130 TRP A HB2  10 
ATOM 11559 H HB3  . TRP A 1 46 ? -8.917  7.055   0.342   1.00 0.00 ? 130 TRP A HB3  10 
ATOM 11560 H HD1  . TRP A 1 46 ? -9.633  4.224   2.913   1.00 0.00 ? 130 TRP A HD1  10 
ATOM 11561 H HE1  . TRP A 1 46 ? -11.448 2.696   1.914   1.00 0.00 ? 130 TRP A HE1  10 
ATOM 11562 H HE3  . TRP A 1 46 ? -10.508 6.754   -1.441  1.00 0.00 ? 130 TRP A HE3  10 
ATOM 11563 H HZ2  . TRP A 1 46 ? -13.027 2.575   -0.416  1.00 0.00 ? 130 TRP A HZ2  10 
ATOM 11564 H HZ3  . TRP A 1 46 ? -12.190 5.870   -2.998  1.00 0.00 ? 130 TRP A HZ3  10 
ATOM 11565 H HH2  . TRP A 1 46 ? -13.424 3.823   -2.498  1.00 0.00 ? 130 TRP A HH2  10 
ATOM 11566 N N    . LEU A 1 47 ? -6.884  4.257   0.305   1.00 0.00 ? 131 LEU A N    10 
ATOM 11567 C CA   . LEU A 1 47 ? -6.186  3.619   -0.804  1.00 0.00 ? 131 LEU A CA   10 
ATOM 11568 C C    . LEU A 1 47 ? -7.116  2.645   -1.500  1.00 0.00 ? 131 LEU A C    10 
ATOM 11569 O O    . LEU A 1 47 ? -8.053  2.138   -0.893  1.00 0.00 ? 131 LEU A O    10 
ATOM 11570 C CB   . LEU A 1 47 ? -4.924  2.874   -0.332  1.00 0.00 ? 131 LEU A CB   10 
ATOM 11571 C CG   . LEU A 1 47 ? -3.819  3.733   0.304   1.00 0.00 ? 131 LEU A CG   10 
ATOM 11572 C CD1  . LEU A 1 47 ? -4.089  3.978   1.785   1.00 0.00 ? 131 LEU A CD1  10 
ATOM 11573 C CD2  . LEU A 1 47 ? -2.462  3.075   0.116   1.00 0.00 ? 131 LEU A CD2  10 
ATOM 11574 H H    . LEU A 1 47 ? -7.466  3.716   0.879   1.00 0.00 ? 131 LEU A H    10 
ATOM 11575 H HA   . LEU A 1 47 ? -5.905  4.395   -1.505  1.00 0.00 ? 131 LEU A HA   10 
ATOM 11576 H HB2  . LEU A 1 47 ? -5.228  2.134   0.392   1.00 0.00 ? 131 LEU A HB2  10 
ATOM 11577 H HB3  . LEU A 1 47 ? -4.502  2.359   -1.184  1.00 0.00 ? 131 LEU A HB3  10 
ATOM 11578 H HG   . LEU A 1 47 ? -3.794  4.694   -0.190  1.00 0.00 ? 131 LEU A HG   10 
ATOM 11579 H HD11 . LEU A 1 47 ? -5.025  4.506   1.899   1.00 0.00 ? 131 LEU A HD11 10 
ATOM 11580 H HD12 . LEU A 1 47 ? -3.287  4.570   2.203   1.00 0.00 ? 131 LEU A HD12 10 
ATOM 11581 H HD13 . LEU A 1 47 ? -4.143  3.031   2.301   1.00 0.00 ? 131 LEU A HD13 10 
ATOM 11582 H HD21 . LEU A 1 47 ? -2.469  2.099   0.578   1.00 0.00 ? 131 LEU A HD21 10 
ATOM 11583 H HD22 . LEU A 1 47 ? -1.699  3.685   0.575   1.00 0.00 ? 131 LEU A HD22 10 
ATOM 11584 H HD23 . LEU A 1 47 ? -2.252  2.972   -0.940  1.00 0.00 ? 131 LEU A HD23 10 
ATOM 11585 N N    . THR A 1 48 ? -6.861  2.392   -2.774  1.00 0.00 ? 132 THR A N    10 
ATOM 11586 C CA   . THR A 1 48 ? -7.696  1.497   -3.551  1.00 0.00 ? 132 THR A CA   10 
ATOM 11587 C C    . THR A 1 48 ? -6.896  0.811   -4.646  1.00 0.00 ? 132 THR A C    10 
ATOM 11588 O O    . THR A 1 48 ? -5.974  1.395   -5.213  1.00 0.00 ? 132 THR A O    10 
ATOM 11589 C CB   . THR A 1 48 ? -8.873  2.252   -4.196  1.00 0.00 ? 132 THR A CB   10 
ATOM 11590 O OG1  . THR A 1 48 ? -8.436  3.541   -4.657  1.00 0.00 ? 132 THR A OG1  10 
ATOM 11591 C CG2  . THR A 1 48 ? -10.031 2.412   -3.222  1.00 0.00 ? 132 THR A CG2  10 
ATOM 11592 H H    . THR A 1 48 ? -6.086  2.818   -3.207  1.00 0.00 ? 132 THR A H    10 
ATOM 11593 H HA   . THR A 1 48 ? -8.094  0.746   -2.884  1.00 0.00 ? 132 THR A HA   10 
ATOM 11594 H HB   . THR A 1 48 ? -9.218  1.677   -5.045  1.00 0.00 ? 132 THR A HB   10 
ATOM 11595 H HG1  . THR A 1 48 ? -7.524  3.686   -4.373  1.00 0.00 ? 132 THR A HG1  10 
ATOM 11596 H HG21 . THR A 1 48 ? -10.377 1.437   -2.907  1.00 0.00 ? 132 THR A HG21 10 
ATOM 11597 H HG22 . THR A 1 48 ? -10.837 2.940   -3.708  1.00 0.00 ? 132 THR A HG22 10 
ATOM 11598 H HG23 . THR A 1 48 ? -9.701  2.974   -2.360  1.00 0.00 ? 132 THR A HG23 10 
ATOM 11599 N N    . PHE A 1 49 ? -7.238  -0.438  -4.920  1.00 0.00 ? 133 PHE A N    10 
ATOM 11600 C CA   . PHE A 1 49 ? -6.680  -1.148  -6.060  1.00 0.00 ? 133 PHE A CA   10 
ATOM 11601 C C    . PHE A 1 49 ? -7.779  -1.895  -6.809  1.00 0.00 ? 133 PHE A C    10 
ATOM 11602 O O    . PHE A 1 49 ? -8.120  -1.554  -7.939  1.00 0.00 ? 133 PHE A O    10 
ATOM 11603 C CB   . PHE A 1 49 ? -5.567  -2.114  -5.632  1.00 0.00 ? 133 PHE A CB   10 
ATOM 11604 C CG   . PHE A 1 49 ? -5.281  -3.147  -6.681  1.00 0.00 ? 133 PHE A CG   10 
ATOM 11605 C CD1  . PHE A 1 49 ? -4.828  -2.776  -7.939  1.00 0.00 ? 133 PHE A CD1  10 
ATOM 11606 C CD2  . PHE A 1 49 ? -5.519  -4.488  -6.426  1.00 0.00 ? 133 PHE A CD2  10 
ATOM 11607 C CE1  . PHE A 1 49 ? -4.627  -3.724  -8.920  1.00 0.00 ? 133 PHE A CE1  10 
ATOM 11608 C CE2  . PHE A 1 49 ? -5.308  -5.438  -7.401  1.00 0.00 ? 133 PHE A CE2  10 
ATOM 11609 C CZ   . PHE A 1 49 ? -4.868  -5.055  -8.649  1.00 0.00 ? 133 PHE A CZ   10 
ATOM 11610 H H    . PHE A 1 49 ? -7.880  -0.896  -4.334  1.00 0.00 ? 133 PHE A H    10 
ATOM 11611 H HA   . PHE A 1 49 ? -6.263  -0.413  -6.725  1.00 0.00 ? 133 PHE A HA   10 
ATOM 11612 H HB2  . PHE A 1 49 ? -4.660  -1.556  -5.448  1.00 0.00 ? 133 PHE A HB2  10 
ATOM 11613 H HB3  . PHE A 1 49 ? -5.866  -2.625  -4.728  1.00 0.00 ? 133 PHE A HB3  10 
ATOM 11614 H HD1  . PHE A 1 49 ? -4.638  -1.733  -8.150  1.00 0.00 ? 133 PHE A HD1  10 
ATOM 11615 H HD2  . PHE A 1 49 ? -5.863  -4.789  -5.448  1.00 0.00 ? 133 PHE A HD2  10 
ATOM 11616 H HE1  . PHE A 1 49 ? -4.274  -3.425  -9.897  1.00 0.00 ? 133 PHE A HE1  10 
ATOM 11617 H HE2  . PHE A 1 49 ? -5.495  -6.481  -7.191  1.00 0.00 ? 133 PHE A HE2  10 
ATOM 11618 H HZ   . PHE A 1 49 ? -4.729  -5.794  -9.414  1.00 0.00 ? 133 PHE A HZ   10 
ATOM 11619 N N    . GLU A 1 50 ? -8.349  -2.899  -6.159  1.00 0.00 ? 134 GLU A N    10 
ATOM 11620 C CA   . GLU A 1 50 ? -9.424  -3.691  -6.752  1.00 0.00 ? 134 GLU A CA   10 
ATOM 11621 C C    . GLU A 1 50 ? -10.764 -2.962  -6.628  1.00 0.00 ? 134 GLU A C    10 
ATOM 11622 O O    . GLU A 1 50 ? -11.821 -3.587  -6.606  1.00 0.00 ? 134 GLU A O    10 
ATOM 11623 C CB   . GLU A 1 50 ? -9.528  -5.054  -6.062  1.00 0.00 ? 134 GLU A CB   10 
ATOM 11624 C CG   . GLU A 1 50 ? -8.560  -6.088  -6.605  1.00 0.00 ? 134 GLU A CG   10 
ATOM 11625 C CD   . GLU A 1 50 ? -8.841  -6.438  -8.051  1.00 0.00 ? 134 GLU A CD   10 
ATOM 11626 O OE1  . GLU A 1 50 ? -8.341  -5.731  -8.949  1.00 0.00 ? 134 GLU A OE1  10 
ATOM 11627 O OE2  . GLU A 1 50 ? -9.570  -7.423  -8.295  1.00 0.00 ? 134 GLU A OE2  10 
ATOM 11628 H H    . GLU A 1 50 ? -8.030  -3.123  -5.264  1.00 0.00 ? 134 GLU A H    10 
ATOM 11629 H HA   . GLU A 1 50 ? -9.182  -3.844  -7.800  1.00 0.00 ? 134 GLU A HA   10 
ATOM 11630 H HB2  . GLU A 1 50 ? -9.329  -4.927  -5.009  1.00 0.00 ? 134 GLU A HB2  10 
ATOM 11631 H HB3  . GLU A 1 50 ? -10.532 -5.434  -6.187  1.00 0.00 ? 134 GLU A HB3  10 
ATOM 11632 H HG2  . GLU A 1 50 ? -7.557  -5.695  -6.534  1.00 0.00 ? 134 GLU A HG2  1