data_2HQQ
# 
_entry.id   2HQQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HQQ         
RCSB  RCSB038649   
WWPDB D_1000038649 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HQQ 
_pdbx_database_status.recvd_initial_deposition_date   2006-07-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Trinh, C.H.'      1 
'Asipu, A.'        2 
'Bonthron, D.T.'   3 
'Phillips, S.E.V.' 4 
# 
_citation.id                        primary 
_citation.title                     'Structures of alternatively spliced isoforms of human ketohexokinase.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            65 
_citation.page_first                201 
_citation.page_last                 211 
_citation.year                      2009 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19237742 
_citation.pdbx_database_id_DOI      10.1107/S0907444908041115 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Trinh, C.H.'    1 
primary 'Asipu, A.'      2 
primary 'Bonthron, D.T.' 3 
primary 'Phillips, S.E.' 4 
# 
_cell.entry_id           2HQQ 
_cell.length_a           61.260 
_cell.length_b           109.619 
_cell.length_c           146.290 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HQQ 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Ketohexokinase 32768.277 1   2.7.1.3 ? ? ? 
2 non-polymer syn 'SULFATE ION'  96.063    3   ?       ? ? ? 
3 water       nat water          18.015    268 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Hepatic fructokinase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYS
VDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQ
PPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYS
VDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQ
PPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   GLU n 
1 4   LYS n 
1 5   GLN n 
1 6   ILE n 
1 7   LEU n 
1 8   CYS n 
1 9   VAL n 
1 10  GLY n 
1 11  LEU n 
1 12  VAL n 
1 13  VAL n 
1 14  LEU n 
1 15  ASP n 
1 16  VAL n 
1 17  ILE n 
1 18  SER n 
1 19  LEU n 
1 20  VAL n 
1 21  ASP n 
1 22  LYS n 
1 23  TYR n 
1 24  PRO n 
1 25  LYS n 
1 26  GLU n 
1 27  ASP n 
1 28  SER n 
1 29  GLU n 
1 30  ILE n 
1 31  ARG n 
1 32  CYS n 
1 33  LEU n 
1 34  SER n 
1 35  GLN n 
1 36  ARG n 
1 37  TRP n 
1 38  GLN n 
1 39  ARG n 
1 40  GLY n 
1 41  GLY n 
1 42  ASN n 
1 43  ALA n 
1 44  SER n 
1 45  ASN n 
1 46  SER n 
1 47  CYS n 
1 48  THR n 
1 49  VAL n 
1 50  LEU n 
1 51  SER n 
1 52  LEU n 
1 53  LEU n 
1 54  GLY n 
1 55  ALA n 
1 56  PRO n 
1 57  CYS n 
1 58  ALA n 
1 59  PHE n 
1 60  MET n 
1 61  GLY n 
1 62  SER n 
1 63  MET n 
1 64  ALA n 
1 65  PRO n 
1 66  GLY n 
1 67  HIS n 
1 68  VAL n 
1 69  ALA n 
1 70  ASP n 
1 71  PHE n 
1 72  VAL n 
1 73  LEU n 
1 74  ASP n 
1 75  ASP n 
1 76  LEU n 
1 77  ARG n 
1 78  ARG n 
1 79  TYR n 
1 80  SER n 
1 81  VAL n 
1 82  ASP n 
1 83  LEU n 
1 84  ARG n 
1 85  TYR n 
1 86  THR n 
1 87  VAL n 
1 88  PHE n 
1 89  GLN n 
1 90  THR n 
1 91  THR n 
1 92  GLY n 
1 93  SER n 
1 94  VAL n 
1 95  PRO n 
1 96  ILE n 
1 97  ALA n 
1 98  THR n 
1 99  VAL n 
1 100 ILE n 
1 101 ILE n 
1 102 ASN n 
1 103 GLU n 
1 104 ALA n 
1 105 SER n 
1 106 GLY n 
1 107 SER n 
1 108 ARG n 
1 109 THR n 
1 110 ILE n 
1 111 LEU n 
1 112 TYR n 
1 113 TYR n 
1 114 ASP n 
1 115 ARG n 
1 116 SER n 
1 117 LEU n 
1 118 PRO n 
1 119 ASP n 
1 120 VAL n 
1 121 SER n 
1 122 ALA n 
1 123 THR n 
1 124 ASP n 
1 125 PHE n 
1 126 GLU n 
1 127 LYS n 
1 128 VAL n 
1 129 ASP n 
1 130 LEU n 
1 131 THR n 
1 132 GLN n 
1 133 PHE n 
1 134 LYS n 
1 135 TRP n 
1 136 ILE n 
1 137 HIS n 
1 138 ILE n 
1 139 GLU n 
1 140 GLY n 
1 141 ARG n 
1 142 ASN n 
1 143 ALA n 
1 144 SER n 
1 145 GLU n 
1 146 GLN n 
1 147 VAL n 
1 148 LYS n 
1 149 MET n 
1 150 LEU n 
1 151 GLN n 
1 152 ARG n 
1 153 ILE n 
1 154 ASP n 
1 155 ALA n 
1 156 HIS n 
1 157 ASN n 
1 158 THR n 
1 159 ARG n 
1 160 GLN n 
1 161 PRO n 
1 162 PRO n 
1 163 GLU n 
1 164 GLN n 
1 165 LYS n 
1 166 ILE n 
1 167 ARG n 
1 168 VAL n 
1 169 SER n 
1 170 VAL n 
1 171 GLU n 
1 172 VAL n 
1 173 GLU n 
1 174 LYS n 
1 175 PRO n 
1 176 ARG n 
1 177 GLU n 
1 178 GLU n 
1 179 LEU n 
1 180 PHE n 
1 181 GLN n 
1 182 LEU n 
1 183 PHE n 
1 184 GLY n 
1 185 TYR n 
1 186 GLY n 
1 187 ASP n 
1 188 VAL n 
1 189 VAL n 
1 190 PHE n 
1 191 VAL n 
1 192 SER n 
1 193 LYS n 
1 194 ASP n 
1 195 VAL n 
1 196 ALA n 
1 197 LYS n 
1 198 HIS n 
1 199 LEU n 
1 200 GLY n 
1 201 PHE n 
1 202 GLN n 
1 203 SER n 
1 204 ALA n 
1 205 GLU n 
1 206 GLU n 
1 207 ALA n 
1 208 LEU n 
1 209 ARG n 
1 210 GLY n 
1 211 LEU n 
1 212 TYR n 
1 213 GLY n 
1 214 ARG n 
1 215 VAL n 
1 216 ARG n 
1 217 LYS n 
1 218 GLY n 
1 219 ALA n 
1 220 VAL n 
1 221 LEU n 
1 222 VAL n 
1 223 CYS n 
1 224 ALA n 
1 225 TRP n 
1 226 ALA n 
1 227 GLU n 
1 228 GLU n 
1 229 GLY n 
1 230 ALA n 
1 231 ASP n 
1 232 ALA n 
1 233 LEU n 
1 234 GLY n 
1 235 PRO n 
1 236 ASP n 
1 237 GLY n 
1 238 LYS n 
1 239 LEU n 
1 240 LEU n 
1 241 HIS n 
1 242 SER n 
1 243 ASP n 
1 244 ALA n 
1 245 PHE n 
1 246 PRO n 
1 247 PRO n 
1 248 PRO n 
1 249 ARG n 
1 250 VAL n 
1 251 VAL n 
1 252 ASP n 
1 253 THR n 
1 254 LEU n 
1 255 GLY n 
1 256 ALA n 
1 257 GLY n 
1 258 ASP n 
1 259 THR n 
1 260 PHE n 
1 261 ASN n 
1 262 ALA n 
1 263 SER n 
1 264 VAL n 
1 265 ILE n 
1 266 PHE n 
1 267 SER n 
1 268 LEU n 
1 269 SER n 
1 270 GLN n 
1 271 GLY n 
1 272 ARG n 
1 273 SER n 
1 274 VAL n 
1 275 GLN n 
1 276 GLU n 
1 277 ALA n 
1 278 LEU n 
1 279 ARG n 
1 280 PHE n 
1 281 GLY n 
1 282 CYS n 
1 283 GLN n 
1 284 VAL n 
1 285 ALA n 
1 286 GLY n 
1 287 LYS n 
1 288 LYS n 
1 289 CYS n 
1 290 GLY n 
1 291 LEU n 
1 292 GLN n 
1 293 GLY n 
1 294 PHE n 
1 295 ASP n 
1 296 GLY n 
1 297 ILE n 
1 298 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 KHK 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'JM109 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET11a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KHK_HUMAN 
_struct_ref.pdbx_db_accession          P50053 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYS
VDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQ
PPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2HQQ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 298 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P50053 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  298 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       298 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2HQQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.75 
_exptl_crystal.density_percent_sol   67.17 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.7 
_exptl_crystal_grow.pdbx_details    
'0.7M ammonium sulphate, 0.5M lithium sulphate, 0.1M sodium citrate, pH 5.7, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2003-05-10 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 optimized for 0.9795' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX14.2' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX14.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
# 
_reflns.entry_id                     2HQQ 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            1.860 
_reflns.d_resolution_low             87.706 
_reflns.number_all                   41681 
_reflns.number_obs                   41681 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.063 
_reflns.pdbx_Rsym_value              0.063 
_reflns.pdbx_netI_over_sigmaI        6.6 
_reflns.B_iso_Wilson_estimate        27.3 
_reflns.pdbx_redundancy              7.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.86 
_reflns_shell.d_res_low              1.96 
_reflns_shell.percent_possible_all   99.2 
_reflns_shell.Rmerge_I_obs           0.325 
_reflns_shell.pdbx_Rsym_value        0.325 
_reflns_shell.meanI_over_sigI_obs    5.0 
_reflns_shell.pdbx_redundancy        7.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6030 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2HQQ 
_refine.ls_number_reflns_obs                     37359 
_refine.ls_number_reflns_all                     41795 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             87.71 
_refine.ls_d_res_high                            1.86 
_refine.ls_percent_reflns_obs                    99.27 
_refine.ls_R_factor_obs                          0.20768 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20474 
_refine.ls_R_factor_R_free                       0.23384 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  4129 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.951 
_refine.correlation_coeff_Fo_to_Fc_free          0.941 
_refine.B_iso_mean                               26.285 
_refine.aniso_B[1][1]                            -0.02 
_refine.aniso_B[2][2]                            1.38 
_refine.aniso_B[3][3]                            -1.36 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1RKD' 
_refine.pdbx_method_to_determine_struct          'Single Isomorphous Replacement' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.121 
_refine.pdbx_overall_ESU_R_Free                  0.118 
_refine.overall_SU_ML                            0.082 
_refine.overall_SU_B                             2.689 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2277 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             268 
_refine_hist.number_atoms_total               2560 
_refine_hist.d_res_high                       1.86 
_refine_hist.d_res_low                        87.71 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.022  ? 2332 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 2141 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.296  1.953  ? 3159 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.702  3.000  ? 4963 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.434  5.000  ? 295  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.599 23.558 ? 104  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.294 15.000 ? 390  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.067 15.000 ? 19   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.075  0.200  ? 356  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 2614 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 482  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.217  0.300  ? 476  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.203  0.300  ? 2154 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.188  0.500  ? 1160 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.088  0.500  ? 1394 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.212  0.500  ? 352  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          0.065  0.500  ? 1    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.132  0.300  ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.270  0.300  ? 52   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.200  0.500  ? 27   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.764  2.000  ? 1895 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.284  2.000  ? 608  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.030  3.000  ? 2355 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.349  2.000  ? 994  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.026  3.000  ? 804  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.860 
_refine_ls_shell.d_res_low                        1.908 
_refine_ls_shell.number_reflns_R_work             2746 
_refine_ls_shell.R_factor_R_work                  0.254 
_refine_ls_shell.percent_reflns_obs               98.95 
_refine_ls_shell.R_factor_R_free                  0.282 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             276 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2HQQ 
_struct.title                     'Crystal structure of human ketohexokinase complexed to different sugar molecules' 
_struct.pdbx_descriptor           'Ketohexokinase (E.C.2.7.1.3)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HQQ 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'Fructose Kinase, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;The biological assembly is a dimer generated from the monomer 
in the asymmetric unit by the operations: 1-x,-y,z
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 41  ? GLY A 54  ? GLY A 41  GLY A 54  1 ? 14 
HELX_P HELX_P2  2  GLY A 66  ? TYR A 79  ? GLY A 66  TYR A 79  1 ? 14 
HELX_P HELX_P3  3  SER A 121 ? GLU A 126 ? SER A 121 GLU A 126 1 ? 6  
HELX_P HELX_P4  4  LYS A 127 ? VAL A 128 ? LYS A 127 VAL A 128 5 ? 2  
HELX_P HELX_P5  5  ASP A 129 ? THR A 131 ? ASP A 129 THR A 131 5 ? 3  
HELX_P HELX_P6  6  ASN A 142 ? ARG A 159 ? ASN A 142 ARG A 159 1 ? 18 
HELX_P HELX_P7  7  GLN A 160 ? LYS A 165 ? GLN A 160 LYS A 165 5 ? 6  
HELX_P HELX_P8  8  ARG A 176 ? TYR A 185 ? ARG A 176 TYR A 185 5 ? 10 
HELX_P HELX_P9  9  SER A 192 ? LEU A 199 ? SER A 192 LEU A 199 1 ? 8  
HELX_P HELX_P10 10 SER A 203 ? TYR A 212 ? SER A 203 TYR A 212 1 ? 10 
HELX_P HELX_P11 11 GLY A 213 ? VAL A 215 ? GLY A 213 VAL A 215 5 ? 3  
HELX_P HELX_P12 12 ALA A 226 ? GLU A 228 ? ALA A 226 GLU A 228 5 ? 3  
HELX_P HELX_P13 13 GLY A 255 ? GLN A 270 ? GLY A 255 GLN A 270 1 ? 16 
HELX_P HELX_P14 14 SER A 273 ? GLY A 290 ? SER A 273 GLY A 290 1 ? 18 
HELX_P HELX_P15 15 PHE A 294 ? VAL A 298 ? PHE A 294 VAL A 298 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 4 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 57  ? MET A 60  ? CYS A 57  MET A 60  
A 2 GLN A 5   ? VAL A 9   ? GLN A 5   VAL A 9   
A 3 PHE A 133 ? GLU A 139 ? PHE A 133 GLU A 139 
A 4 ARG A 167 ? VAL A 172 ? ARG A 167 VAL A 172 
A 5 VAL A 188 ? VAL A 191 ? VAL A 188 VAL A 191 
A 6 VAL A 220 ? ALA A 224 ? VAL A 220 ALA A 224 
A 7 ALA A 230 ? LEU A 233 ? ALA A 230 LEU A 233 
A 8 LEU A 239 ? SER A 242 ? LEU A 239 SER A 242 
B 1 SER A 34  ? GLY A 40  ? SER A 34  GLY A 40  
B 2 VAL A 13  ? VAL A 20  ? VAL A 13  VAL A 20  
B 3 ILE A 96  ? ASN A 102 ? ILE A 96  ASN A 102 
B 4 ARG A 108 ? LEU A 111 ? ARG A 108 LEU A 111 
C 1 SER A 62  ? MET A 63  ? SER A 62  MET A 63  
C 2 VAL A 87  ? PHE A 88  ? VAL A 87  PHE A 88  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O MET A 60  ? O MET A 60  N CYS A 8   ? N CYS A 8   
A 2 3 N VAL A 9   ? N VAL A 9   O HIS A 137 ? O HIS A 137 
A 3 4 N ILE A 138 ? N ILE A 138 O GLU A 171 ? O GLU A 171 
A 4 5 N VAL A 172 ? N VAL A 172 O PHE A 190 ? O PHE A 190 
A 5 6 N VAL A 189 ? N VAL A 189 O VAL A 222 ? O VAL A 222 
A 6 7 N CYS A 223 ? N CYS A 223 O ASP A 231 ? O ASP A 231 
A 7 8 N ALA A 232 ? N ALA A 232 O LEU A 240 ? O LEU A 240 
B 1 2 O GLY A 40  ? O GLY A 40  N VAL A 13  ? N VAL A 13  
B 2 3 N VAL A 16  ? N VAL A 16  O ALA A 97  ? O ALA A 97  
B 3 4 N THR A 98  ? N THR A 98  O LEU A 111 ? O LEU A 111 
C 1 2 N MET A 63  ? N MET A 63  O VAL A 87  ? O VAL A 87  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE SO4 A 301' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 302' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 303' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9 ARG A 108 ? ARG A 108 . ? 1_555 ? 
2  AC1 9 THR A 253 ? THR A 253 . ? 1_555 ? 
3  AC1 9 GLY A 255 ? GLY A 255 . ? 1_555 ? 
4  AC1 9 ALA A 256 ? ALA A 256 . ? 1_555 ? 
5  AC1 9 GLY A 257 ? GLY A 257 . ? 1_555 ? 
6  AC1 9 ASP A 258 ? ASP A 258 . ? 1_555 ? 
7  AC1 9 HOH E .   ? HOH A 349 . ? 1_555 ? 
8  AC1 9 HOH E .   ? HOH A 510 . ? 1_555 ? 
9  AC1 9 HOH E .   ? HOH A 536 . ? 1_555 ? 
10 AC2 5 GLY A 66  ? GLY A 66  . ? 1_555 ? 
11 AC2 5 HIS A 67  ? HIS A 67  . ? 1_555 ? 
12 AC2 5 HIS A 67  ? HIS A 67  . ? 3_654 ? 
13 AC2 5 HOH E .   ? HOH A 543 . ? 1_555 ? 
14 AC2 5 HOH E .   ? HOH A 544 . ? 1_555 ? 
15 AC3 3 ARG A 115 ? ARG A 115 . ? 1_555 ? 
16 AC3 3 PRO A 118 ? PRO A 118 . ? 1_555 ? 
17 AC3 3 HOH E .   ? HOH A 511 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2HQQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HQQ 
_atom_sites.fract_transf_matrix[1][1]   0.016324 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009123 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006836 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 3   ? 20.674 38.074  -65.755 1.00 46.72  ? 3   GLU A N   1 
ATOM   2    C CA  . GLU A 1 3   ? 21.130 37.650  -64.393 1.00 45.67  ? 3   GLU A CA  1 
ATOM   3    C C   . GLU A 1 3   ? 22.447 36.878  -64.492 1.00 45.13  ? 3   GLU A C   1 
ATOM   4    O O   . GLU A 1 3   ? 22.474 35.757  -65.016 1.00 46.50  ? 3   GLU A O   1 
ATOM   5    C CB  . GLU A 1 3   ? 20.051 36.792  -63.706 1.00 46.40  ? 3   GLU A CB  1 
ATOM   6    N N   . LYS A 1 4   ? 23.533 37.476  -64.001 1.00 43.01  ? 4   LYS A N   1 
ATOM   7    C CA  . LYS A 1 4   ? 24.834 36.824  -64.029 1.00 40.93  ? 4   LYS A CA  1 
ATOM   8    C C   . LYS A 1 4   ? 24.738 35.541  -63.244 1.00 38.97  ? 4   LYS A C   1 
ATOM   9    O O   . LYS A 1 4   ? 23.890 35.401  -62.372 1.00 39.16  ? 4   LYS A O   1 
ATOM   10   C CB  . LYS A 1 4   ? 25.928 37.705  -63.430 1.00 41.26  ? 4   LYS A CB  1 
ATOM   11   C CG  . LYS A 1 4   ? 26.295 38.912  -64.254 1.00 41.50  ? 4   LYS A CG  1 
ATOM   12   C CD  . LYS A 1 4   ? 27.527 39.583  -63.706 1.00 41.64  ? 4   LYS A CD  1 
ATOM   13   C CE  . LYS A 1 4   ? 27.918 40.827  -64.490 1.00 42.10  ? 4   LYS A CE  1 
ATOM   14   N NZ  . LYS A 1 4   ? 29.196 41.378  -63.960 1.00 42.15  ? 4   LYS A NZ  1 
ATOM   15   N N   . GLN A 1 5   ? 25.639 34.617  -63.549 1.00 36.59  ? 5   GLN A N   1 
ATOM   16   C CA  . GLN A 1 5   ? 25.605 33.291  -62.973 1.00 34.59  ? 5   GLN A CA  1 
ATOM   17   C C   . GLN A 1 5   ? 26.408 33.245  -61.664 1.00 30.96  ? 5   GLN A C   1 
ATOM   18   O O   . GLN A 1 5   ? 27.222 34.128  -61.361 1.00 27.97  ? 5   GLN A O   1 
ATOM   19   C CB  . GLN A 1 5   ? 26.173 32.282  -63.988 1.00 35.45  ? 5   GLN A CB  1 
ATOM   20   C CG  . GLN A 1 5   ? 25.212 31.905  -65.113 1.00 36.40  ? 5   GLN A CG  1 
ATOM   21   C CD  . GLN A 1 5   ? 25.843 31.029  -66.201 1.00 37.24  ? 5   GLN A CD  1 
ATOM   22   O OE1 . GLN A 1 5   ? 27.030 30.700  -66.153 1.00 39.22  ? 5   GLN A OE1 1 
ATOM   23   N NE2 . GLN A 1 5   ? 25.038 30.651  -67.186 1.00 38.12  ? 5   GLN A NE2 1 
ATOM   24   N N   . ILE A 1 6   ? 26.160 32.202  -60.884 1.00 28.72  ? 6   ILE A N   1 
ATOM   25   C CA  . ILE A 1 6   ? 27.065 31.836  -59.805 1.00 26.88  ? 6   ILE A CA  1 
ATOM   26   C C   . ILE A 1 6   ? 27.910 30.672  -60.297 1.00 26.62  ? 6   ILE A C   1 
ATOM   27   O O   . ILE A 1 6   ? 27.353 29.646  -60.708 1.00 26.65  ? 6   ILE A O   1 
ATOM   28   C CB  . ILE A 1 6   ? 26.281 31.402  -58.577 1.00 25.33  ? 6   ILE A CB  1 
ATOM   29   C CG1 . ILE A 1 6   ? 25.417 32.556  -58.063 1.00 25.15  ? 6   ILE A CG1 1 
ATOM   30   C CG2 . ILE A 1 6   ? 27.262 30.870  -57.502 1.00 26.11  ? 6   ILE A CG2 1 
ATOM   31   C CD1 . ILE A 1 6   ? 24.601 32.174  -56.912 1.00 25.20  ? 6   ILE A CD1 1 
ATOM   32   N N   . LEU A 1 7   ? 29.237 30.825  -60.253 1.00 25.55  ? 7   LEU A N   1 
ATOM   33   C CA  . LEU A 1 7   ? 30.155 29.771  -60.671 1.00 24.18  ? 7   LEU A CA  1 
ATOM   34   C C   . LEU A 1 7   ? 30.659 28.983  -59.465 1.00 23.48  ? 7   LEU A C   1 
ATOM   35   O O   . LEU A 1 7   ? 31.115 29.565  -58.483 1.00 20.56  ? 7   LEU A O   1 
ATOM   36   C CB  . LEU A 1 7   ? 31.357 30.363  -61.370 1.00 24.01  ? 7   LEU A CB  1 
ATOM   37   C CG  . LEU A 1 7   ? 32.471 29.396  -61.715 1.00 24.77  ? 7   LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 7   ? 31.925 28.343  -62.718 1.00 23.68  ? 7   LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 7   ? 33.660 30.157  -62.263 1.00 24.02  ? 7   LEU A CD2 1 
ATOM   40   N N   . CYS A 1 8   ? 30.557 27.656  -59.536 1.00 22.71  ? 8   CYS A N   1 
ATOM   41   C CA  . CYS A 1 8   ? 31.164 26.793  -58.510 1.00 22.04  ? 8   CYS A CA  1 
ATOM   42   C C   . CYS A 1 8   ? 32.327 26.000  -59.110 1.00 22.21  ? 8   CYS A C   1 
ATOM   43   O O   . CYS A 1 8   ? 32.156 25.322  -60.107 1.00 21.59  ? 8   CYS A O   1 
ATOM   44   C CB  . CYS A 1 8   ? 30.142 25.844  -57.959 1.00 23.17  ? 8   CYS A CB  1 
ATOM   45   S SG  . CYS A 1 8   ? 28.845 26.657  -57.014 1.00 26.06  ? 8   CYS A SG  1 
ATOM   46   N N   . VAL A 1 9   ? 33.498 26.090  -58.497 1.00 20.83  ? 9   VAL A N   1 
ATOM   47   C CA  . VAL A 1 9   ? 34.664 25.353  -58.933 1.00 20.46  ? 9   VAL A CA  1 
ATOM   48   C C   . VAL A 1 9   ? 34.881 24.218  -57.951 1.00 19.83  ? 9   VAL A C   1 
ATOM   49   O O   . VAL A 1 9   ? 35.087 24.437  -56.764 1.00 18.93  ? 9   VAL A O   1 
ATOM   50   C CB  . VAL A 1 9   ? 35.915 26.245  -58.993 1.00 20.92  ? 9   VAL A CB  1 
ATOM   51   C CG1 . VAL A 1 9   ? 37.103 25.465  -59.503 1.00 20.17  ? 9   VAL A CG1 1 
ATOM   52   C CG2 . VAL A 1 9   ? 35.650 27.481  -59.844 1.00 22.00  ? 9   VAL A CG2 1 
ATOM   53   N N   . GLY A 1 10  ? 34.821 22.988  -58.425 1.00 20.59  ? 10  GLY A N   1 
ATOM   54   C CA  . GLY A 1 10  ? 35.031 21.867  -57.533 1.00 21.20  ? 10  GLY A CA  1 
ATOM   55   C C   . GLY A 1 10  ? 35.196 20.576  -58.295 1.00 22.97  ? 10  GLY A C   1 
ATOM   56   O O   . GLY A 1 10  ? 35.710 20.587  -59.395 1.00 23.58  ? 10  GLY A O   1 
ATOM   57   N N   . LEU A 1 11  ? 34.828 19.449  -57.700 1.00 24.90  ? 11  LEU A N   1 
ATOM   58   C CA  . LEU A 1 11  ? 35.028 18.185  -58.413 1.00 25.77  ? 11  LEU A CA  1 
ATOM   59   C C   . LEU A 1 11  ? 33.765 17.347  -58.300 1.00 26.27  ? 11  LEU A C   1 
ATOM   60   O O   . LEU A 1 11  ? 33.242 17.168  -57.231 1.00 30.33  ? 11  LEU A O   1 
ATOM   61   C CB  . LEU A 1 11  ? 36.269 17.449  -57.872 1.00 28.88  ? 11  LEU A CB  1 
ATOM   62   C CG  . LEU A 1 11  ? 36.576 16.007  -58.326 1.00 28.58  ? 11  LEU A CG  1 
ATOM   63   C CD1 . LEU A 1 11  ? 36.677 15.882  -59.849 1.00 29.39  ? 11  LEU A CD1 1 
ATOM   64   C CD2 . LEU A 1 11  ? 37.866 15.524  -57.652 1.00 29.06  ? 11  LEU A CD2 1 
ATOM   65   N N   . VAL A 1 12  ? 33.266 16.863  -59.423 1.00 23.66  ? 12  VAL A N   1 
ATOM   66   C CA  . VAL A 1 12  ? 32.101 16.001  -59.431 1.00 23.05  ? 12  VAL A CA  1 
ATOM   67   C C   . VAL A 1 12  ? 32.542 14.584  -59.077 1.00 22.17  ? 12  VAL A C   1 
ATOM   68   O O   . VAL A 1 12  ? 33.607 14.112  -59.515 1.00 21.85  ? 12  VAL A O   1 
ATOM   69   C CB  . VAL A 1 12  ? 31.409 15.962  -60.821 1.00 24.11  ? 12  VAL A CB  1 
ATOM   70   C CG1 . VAL A 1 12  ? 30.319 14.945  -60.832 1.00 25.74  ? 12  VAL A CG1 1 
ATOM   71   C CG2 . VAL A 1 12  ? 30.775 17.253  -61.140 1.00 25.73  ? 12  VAL A CG2 1 
ATOM   72   N N   . VAL A 1 13  ? 31.703 13.916  -58.294 1.00 20.11  ? 13  VAL A N   1 
ATOM   73   C CA  . VAL A 1 13  ? 31.972 12.596  -57.797 1.00 20.73  ? 13  VAL A CA  1 
ATOM   74   C C   . VAL A 1 13  ? 30.764 11.709  -58.094 1.00 21.02  ? 13  VAL A C   1 
ATOM   75   O O   . VAL A 1 13  ? 29.630 12.155  -58.027 1.00 22.73  ? 13  VAL A O   1 
ATOM   76   C CB  . VAL A 1 13  ? 32.200 12.655  -56.294 1.00 20.59  ? 13  VAL A CB  1 
ATOM   77   C CG1 . VAL A 1 13  ? 32.390 11.255  -55.703 1.00 20.49  ? 13  VAL A CG1 1 
ATOM   78   C CG2 . VAL A 1 13  ? 33.376 13.544  -55.982 1.00 19.48  ? 13  VAL A CG2 1 
ATOM   79   N N   . LEU A 1 14  ? 31.001 10.454  -58.464 1.00 20.63  ? 14  LEU A N   1 
ATOM   80   C CA  . LEU A 1 14  ? 29.902 9.524   -58.539 1.00 19.08  ? 14  LEU A CA  1 
ATOM   81   C C   . LEU A 1 14  ? 29.701 8.853   -57.176 1.00 18.52  ? 14  LEU A C   1 
ATOM   82   O O   . LEU A 1 14  ? 30.562 8.100   -56.718 1.00 18.02  ? 14  LEU A O   1 
ATOM   83   C CB  . LEU A 1 14  ? 30.170 8.466   -59.599 1.00 20.37  ? 14  LEU A CB  1 
ATOM   84   C CG  . LEU A 1 14  ? 29.019 7.450   -59.683 1.00 21.26  ? 14  LEU A CG  1 
ATOM   85   C CD1 . LEU A 1 14  ? 27.751 8.072   -60.166 1.00 21.84  ? 14  LEU A CD1 1 
ATOM   86   C CD2 . LEU A 1 14  ? 29.441 6.248   -60.552 1.00 22.43  ? 14  LEU A CD2 1 
ATOM   87   N N   . ASP A 1 15  ? 28.534 9.090   -56.572 1.00 18.36  ? 15  ASP A N   1 
ATOM   88   C CA  . ASP A 1 15  ? 28.195 8.455   -55.330 1.00 19.07  ? 15  ASP A CA  1 
ATOM   89   C C   . ASP A 1 15  ? 27.443 7.181   -55.634 1.00 18.39  ? 15  ASP A C   1 
ATOM   90   O O   . ASP A 1 15  ? 26.360 7.185   -56.265 1.00 20.25  ? 15  ASP A O   1 
ATOM   91   C CB  . ASP A 1 15  ? 27.353 9.346   -54.444 1.00 20.21  ? 15  ASP A CB  1 
ATOM   92   C CG  . ASP A 1 15  ? 28.062 10.559  -53.963 1.00 21.35  ? 15  ASP A CG  1 
ATOM   93   O OD1 . ASP A 1 15  ? 29.314 10.630  -53.879 1.00 22.14  ? 15  ASP A OD1 1 
ATOM   94   O OD2 . ASP A 1 15  ? 27.404 11.520  -53.581 1.00 22.98  ? 15  ASP A OD2 1 
ATOM   95   N N   . VAL A 1 16  ? 28.037 6.075   -55.197 1.00 18.47  ? 16  VAL A N   1 
ATOM   96   C CA  . VAL A 1 16  ? 27.420 4.801   -55.325 1.00 18.75  ? 16  VAL A CA  1 
ATOM   97   C C   . VAL A 1 16  ? 26.854 4.442   -53.939 1.00 18.40  ? 16  VAL A C   1 
ATOM   98   O O   . VAL A 1 16  ? 27.586 4.060   -53.036 1.00 18.64  ? 16  VAL A O   1 
ATOM   99   C CB  . VAL A 1 16  ? 28.430 3.742   -55.827 1.00 19.89  ? 16  VAL A CB  1 
ATOM   100  C CG1 . VAL A 1 16  ? 27.743 2.426   -55.946 1.00 20.70  ? 16  VAL A CG1 1 
ATOM   101  C CG2 . VAL A 1 16  ? 29.034 4.194   -57.175 1.00 19.99  ? 16  VAL A CG2 1 
ATOM   102  N N   . ILE A 1 17  ? 25.538 4.566   -53.828 1.00 19.18  ? 17  ILE A N   1 
ATOM   103  C CA  . ILE A 1 17  ? 24.841 4.581   -52.561 1.00 20.68  ? 17  ILE A CA  1 
ATOM   104  C C   . ILE A 1 17  ? 24.133 3.261   -52.282 1.00 20.23  ? 17  ILE A C   1 
ATOM   105  O O   . ILE A 1 17  ? 23.217 2.870   -53.016 1.00 22.45  ? 17  ILE A O   1 
ATOM   106  C CB  . ILE A 1 17  ? 23.784 5.716   -52.526 1.00 21.48  ? 17  ILE A CB  1 
ATOM   107  C CG1 . ILE A 1 17  ? 24.438 7.088   -52.737 1.00 22.74  ? 17  ILE A CG1 1 
ATOM   108  C CG2 . ILE A 1 17  ? 23.008 5.632   -51.217 1.00 21.97  ? 17  ILE A CG2 1 
ATOM   109  C CD1 . ILE A 1 17  ? 23.456 8.196   -53.025 1.00 22.62  ? 17  ILE A CD1 1 
ATOM   110  N N   . SER A 1 18  ? 24.539 2.620   -51.186 1.00 19.44  ? 18  SER A N   1 
ATOM   111  C CA  . SER A 1 18  ? 23.900 1.434   -50.652 1.00 20.88  ? 18  SER A CA  1 
ATOM   112  C C   . SER A 1 18  ? 23.048 1.811   -49.430 1.00 21.82  ? 18  SER A C   1 
ATOM   113  O O   . SER A 1 18  ? 23.577 2.292   -48.439 1.00 21.97  ? 18  SER A O   1 
ATOM   114  C CB  . SER A 1 18  ? 24.952 0.421   -50.222 1.00 20.39  ? 18  SER A CB  1 
ATOM   115  O OG  . SER A 1 18  ? 25.604 -0.129  -51.374 1.00 20.61  ? 18  SER A OG  1 
ATOM   116  N N   . LEU A 1 19  ? 21.746 1.580   -49.531 1.00 23.40  ? 19  LEU A N   1 
ATOM   117  C CA  . LEU A 1 19  ? 20.827 1.837   -48.432 1.00 25.10  ? 19  LEU A CA  1 
ATOM   118  C C   . LEU A 1 19  ? 20.669 0.558   -47.610 1.00 24.76  ? 19  LEU A C   1 
ATOM   119  O O   . LEU A 1 19  ? 20.319 -0.491  -48.155 1.00 23.78  ? 19  LEU A O   1 
ATOM   120  C CB  . LEU A 1 19  ? 19.479 2.272   -48.987 1.00 25.87  ? 19  LEU A CB  1 
ATOM   121  C CG  . LEU A 1 19  ? 18.446 2.728   -47.961 1.00 27.26  ? 19  LEU A CG  1 
ATOM   122  C CD1 . LEU A 1 19  ? 18.883 4.030   -47.333 1.00 28.59  ? 19  LEU A CD1 1 
ATOM   123  C CD2 . LEU A 1 19  ? 17.094 2.882   -48.638 1.00 27.78  ? 19  LEU A CD2 1 
ATOM   124  N N   . VAL A 1 20  ? 20.943 0.655   -46.313 1.00 27.63  ? 20  VAL A N   1 
ATOM   125  C CA  . VAL A 1 20  ? 20.862 -0.495  -45.399 1.00 29.60  ? 20  VAL A CA  1 
ATOM   126  C C   . VAL A 1 20  ? 19.889 -0.225  -44.222 1.00 31.97  ? 20  VAL A C   1 
ATOM   127  O O   . VAL A 1 20  ? 19.676 0.924   -43.846 1.00 32.13  ? 20  VAL A O   1 
ATOM   128  C CB  . VAL A 1 20  ? 22.251 -0.868  -44.854 1.00 28.94  ? 20  VAL A CB  1 
ATOM   129  C CG1 . VAL A 1 20  ? 23.176 -1.315  -46.011 1.00 29.02  ? 20  VAL A CG1 1 
ATOM   130  C CG2 . VAL A 1 20  ? 22.882 0.278   -44.064 1.00 28.91  ? 20  VAL A CG2 1 
ATOM   131  N N   . ASP A 1 21  ? 19.304 -1.278  -43.657 1.00 33.63  ? 21  ASP A N   1 
ATOM   132  C CA  . ASP A 1 21  ? 18.274 -1.070  -42.621 1.00 35.94  ? 21  ASP A CA  1 
ATOM   133  C C   . ASP A 1 21  ? 18.895 -0.737  -41.269 1.00 36.16  ? 21  ASP A C   1 
ATOM   134  O O   . ASP A 1 21  ? 18.217 -0.209  -40.389 1.00 36.21  ? 21  ASP A O   1 
ATOM   135  C CB  . ASP A 1 21  ? 17.341 -2.284  -42.528 1.00 38.85  ? 21  ASP A CB  1 
ATOM   136  C CG  . ASP A 1 21  ? 18.000 -3.477  -41.894 1.00 40.69  ? 21  ASP A CG  1 
ATOM   137  O OD1 . ASP A 1 21  ? 19.182 -3.752  -42.184 1.00 41.40  ? 21  ASP A OD1 1 
ATOM   138  O OD2 . ASP A 1 21  ? 17.404 -4.210  -41.066 1.00 44.71  ? 21  ASP A OD2 1 
ATOM   139  N N   . LYS A 1 22  ? 20.187 -1.050  -41.119 1.00 36.09  ? 22  LYS A N   1 
ATOM   140  C CA  . LYS A 1 22  ? 20.980 -0.719  -39.942 1.00 36.59  ? 22  LYS A CA  1 
ATOM   141  C C   . LYS A 1 22  ? 22.441 -0.597  -40.351 1.00 35.55  ? 22  LYS A C   1 
ATOM   142  O O   . LYS A 1 22  ? 22.845 -1.159  -41.360 1.00 35.78  ? 22  LYS A O   1 
ATOM   143  C CB  . LYS A 1 22  ? 20.854 -1.806  -38.859 1.00 37.84  ? 22  LYS A CB  1 
ATOM   144  C CG  . LYS A 1 22  ? 21.376 -3.192  -39.278 1.00 39.27  ? 22  LYS A CG  1 
ATOM   145  C CD  . LYS A 1 22  ? 21.509 -4.154  -38.088 1.00 39.85  ? 22  LYS A CD  1 
ATOM   146  C CE  . LYS A 1 22  ? 22.907 -4.132  -37.458 1.00 40.97  ? 22  LYS A CE  1 
ATOM   147  N NZ  . LYS A 1 22  ? 23.080 -5.150  -36.343 1.00 41.53  ? 22  LYS A NZ  1 
ATOM   148  N N   . TYR A 1 23  ? 23.245 0.109   -39.568 1.00 34.55  ? 23  TYR A N   1 
ATOM   149  C CA  . TYR A 1 23  ? 24.664 0.206   -39.873 1.00 34.31  ? 23  TYR A CA  1 
ATOM   150  C C   . TYR A 1 23  ? 25.332 -1.164  -39.718 1.00 35.17  ? 23  TYR A C   1 
ATOM   151  O O   . TYR A 1 23  ? 25.174 -1.830  -38.709 1.00 34.34  ? 23  TYR A O   1 
ATOM   152  C CB  . TYR A 1 23  ? 25.362 1.247   -39.014 1.00 33.24  ? 23  TYR A CB  1 
ATOM   153  C CG  . TYR A 1 23  ? 26.743 1.582   -39.515 1.00 33.50  ? 23  TYR A CG  1 
ATOM   154  C CD1 . TYR A 1 23  ? 26.922 2.377   -40.645 1.00 33.10  ? 23  TYR A CD1 1 
ATOM   155  C CD2 . TYR A 1 23  ? 27.867 1.077   -38.887 1.00 33.03  ? 23  TYR A CD2 1 
ATOM   156  C CE1 . TYR A 1 23  ? 28.178 2.671   -41.110 1.00 32.94  ? 23  TYR A CE1 1 
ATOM   157  C CE2 . TYR A 1 23  ? 29.128 1.374   -39.341 1.00 33.02  ? 23  TYR A CE2 1 
ATOM   158  C CZ  . TYR A 1 23  ? 29.275 2.166   -40.458 1.00 32.90  ? 23  TYR A CZ  1 
ATOM   159  O OH  . TYR A 1 23  ? 30.521 2.433   -40.909 1.00 32.52  ? 23  TYR A OH  1 
ATOM   160  N N   . PRO A 1 24  ? 26.077 -1.599  -40.730 1.00 34.84  ? 24  PRO A N   1 
ATOM   161  C CA  . PRO A 1 24  ? 26.620 -2.952  -40.721 1.00 34.29  ? 24  PRO A CA  1 
ATOM   162  C C   . PRO A 1 24  ? 27.655 -3.190  -39.631 1.00 33.38  ? 24  PRO A C   1 
ATOM   163  O O   . PRO A 1 24  ? 28.565 -2.386  -39.436 1.00 31.22  ? 24  PRO A O   1 
ATOM   164  C CB  . PRO A 1 24  ? 27.286 -3.081  -42.101 1.00 33.90  ? 24  PRO A CB  1 
ATOM   165  C CG  . PRO A 1 24  ? 26.825 -1.925  -42.890 1.00 34.80  ? 24  PRO A CG  1 
ATOM   166  C CD  . PRO A 1 24  ? 26.449 -0.851  -41.942 1.00 35.04  ? 24  PRO A CD  1 
ATOM   167  N N   . LYS A 1 25  ? 27.510 -4.298  -38.921 1.00 35.54  ? 25  LYS A N   1 
ATOM   168  C CA  . LYS A 1 25  ? 28.509 -4.712  -37.966 1.00 35.90  ? 25  LYS A CA  1 
ATOM   169  C C   . LYS A 1 25  ? 29.709 -5.291  -38.703 1.00 35.18  ? 25  LYS A C   1 
ATOM   170  O O   . LYS A 1 25  ? 29.539 -6.100  -39.632 1.00 33.57  ? 25  LYS A O   1 
ATOM   171  C CB  . LYS A 1 25  ? 27.904 -5.757  -37.029 1.00 37.94  ? 25  LYS A CB  1 
ATOM   172  C CG  . LYS A 1 25  ? 28.918 -6.405  -36.102 1.00 39.42  ? 25  LYS A CG  1 
ATOM   173  C CD  . LYS A 1 25  ? 28.254 -7.088  -34.893 1.00 40.33  ? 25  LYS A CD  1 
ATOM   174  C CE  . LYS A 1 25  ? 27.431 -8.318  -35.295 1.00 41.78  ? 25  LYS A CE  1 
ATOM   175  N NZ  . LYS A 1 25  ? 26.819 -8.974  -34.070 1.00 42.12  ? 25  LYS A NZ  1 
ATOM   176  N N   . GLU A 1 26  ? 30.911 -4.887  -38.288 1.00 34.88  ? 26  GLU A N   1 
ATOM   177  C CA  . GLU A 1 26  ? 32.132 -5.401  -38.878 1.00 34.68  ? 26  GLU A CA  1 
ATOM   178  C C   . GLU A 1 26  ? 32.080 -6.924  -38.926 1.00 35.21  ? 26  GLU A C   1 
ATOM   179  O O   . GLU A 1 26  ? 31.656 -7.587  -37.972 1.00 33.83  ? 26  GLU A O   1 
ATOM   180  C CB  . GLU A 1 26  ? 33.382 -4.922  -38.139 1.00 34.34  ? 26  GLU A CB  1 
ATOM   181  C CG  . GLU A 1 26  ? 34.682 -5.485  -38.697 1.00 34.19  ? 26  GLU A CG  1 
ATOM   182  C CD  . GLU A 1 26  ? 35.919 -4.832  -38.129 1.00 34.05  ? 26  GLU A CD  1 
ATOM   183  O OE1 . GLU A 1 26  ? 35.783 -4.039  -37.174 1.00 35.67  ? 26  GLU A OE1 1 
ATOM   184  O OE2 . GLU A 1 26  ? 37.038 -5.081  -38.639 1.00 32.34  ? 26  GLU A OE2 1 
ATOM   185  N N   . ASP A 1 27  ? 32.498 -7.456  -40.069 1.00 33.94  ? 27  ASP A N   1 
ATOM   186  C CA  . ASP A 1 27  ? 32.547 -8.895  -40.344 1.00 34.36  ? 27  ASP A CA  1 
ATOM   187  C C   . ASP A 1 27  ? 31.193 -9.552  -40.639 1.00 33.03  ? 27  ASP A C   1 
ATOM   188  O O   . ASP A 1 27  ? 31.134 -10.755 -40.851 1.00 33.80  ? 27  ASP A O   1 
ATOM   189  C CB  . ASP A 1 27  ? 33.302 -9.647  -39.235 1.00 36.01  ? 27  ASP A CB  1 
ATOM   190  C CG  . ASP A 1 27  ? 34.361 -10.604 -39.778 1.00 37.74  ? 27  ASP A CG  1 
ATOM   191  O OD1 . ASP A 1 27  ? 34.645 -10.650 -41.003 1.00 37.49  ? 27  ASP A OD1 1 
ATOM   192  O OD2 . ASP A 1 27  ? 34.998 -11.363 -39.026 1.00 39.09  ? 27  ASP A OD2 1 
ATOM   193  N N   . SER A 1 28  ? 30.109 -8.788  -40.696 1.00 32.18  ? 28  SER A N   1 
ATOM   194  C CA  . SER A 1 28  ? 28.833 -9.364  -41.066 1.00 33.16  ? 28  SER A CA  1 
ATOM   195  C C   . SER A 1 28  ? 28.609 -9.328  -42.581 1.00 33.22  ? 28  SER A C   1 
ATOM   196  O O   . SER A 1 28  ? 29.422 -8.774  -43.328 1.00 32.54  ? 28  SER A O   1 
ATOM   197  C CB  . SER A 1 28  ? 27.674 -8.651  -40.360 1.00 33.86  ? 28  SER A CB  1 
ATOM   198  O OG  . SER A 1 28  ? 27.601 -7.277  -40.726 1.00 35.19  ? 28  SER A OG  1 
ATOM   199  N N   . GLU A 1 29  ? 27.516 -9.944  -43.004 1.00 33.20  ? 29  GLU A N   1 
ATOM   200  C CA  . GLU A 1 29  ? 26.994 -9.806  -44.346 1.00 34.29  ? 29  GLU A CA  1 
ATOM   201  C C   . GLU A 1 29  ? 25.561 -9.331  -44.212 1.00 34.94  ? 29  GLU A C   1 
ATOM   202  O O   . GLU A 1 29  ? 24.766 -9.943  -43.489 1.00 36.06  ? 29  GLU A O   1 
ATOM   203  C CB  . GLU A 1 29  ? 27.033 -11.138 -45.089 1.00 36.48  ? 29  GLU A CB  1 
ATOM   204  C CG  . GLU A 1 29  ? 28.288 -11.953 -44.829 1.00 39.03  ? 29  GLU A CG  1 
ATOM   205  C CD  . GLU A 1 29  ? 28.206 -12.821 -43.571 1.00 41.88  ? 29  GLU A CD  1 
ATOM   206  O OE1 . GLU A 1 29  ? 27.098 -13.358 -43.278 1.00 44.72  ? 29  GLU A OE1 1 
ATOM   207  O OE2 . GLU A 1 29  ? 29.252 -12.988 -42.884 1.00 42.77  ? 29  GLU A OE2 1 
ATOM   208  N N   . ILE A 1 30  ? 25.232 -8.241  -44.900 1.00 32.94  ? 30  ILE A N   1 
ATOM   209  C CA  . ILE A 1 30  ? 23.921 -7.631  -44.828 1.00 33.30  ? 30  ILE A CA  1 
ATOM   210  C C   . ILE A 1 30  ? 23.347 -7.426  -46.225 1.00 32.85  ? 30  ILE A C   1 
ATOM   211  O O   . ILE A 1 30  ? 24.063 -7.080  -47.175 1.00 29.19  ? 30  ILE A O   1 
ATOM   212  C CB  . ILE A 1 30  ? 24.004 -6.276  -44.054 1.00 33.86  ? 30  ILE A CB  1 
ATOM   213  C CG1 . ILE A 1 30  ? 22.613 -5.736  -43.710 1.00 34.73  ? 30  ILE A CG1 1 
ATOM   214  C CG2 . ILE A 1 30  ? 24.766 -5.207  -44.829 1.00 33.47  ? 30  ILE A CG2 1 
ATOM   215  C CD1 . ILE A 1 30  ? 22.683 -4.555  -42.723 1.00 35.32  ? 30  ILE A CD1 1 
ATOM   216  N N   . ARG A 1 31  ? 22.053 -7.667  -46.346 1.00 32.80  ? 31  ARG A N   1 
ATOM   217  C CA  . ARG A 1 31  ? 21.365 -7.454  -47.600 1.00 34.26  ? 31  ARG A CA  1 
ATOM   218  C C   . ARG A 1 31  ? 20.898 -6.009  -47.631 1.00 34.25  ? 31  ARG A C   1 
ATOM   219  O O   . ARG A 1 31  ? 20.117 -5.573  -46.778 1.00 35.45  ? 31  ARG A O   1 
ATOM   220  C CB  . ARG A 1 31  ? 20.180 -8.408  -47.736 1.00 35.28  ? 31  ARG A CB  1 
ATOM   221  C CG  . ARG A 1 31  ? 19.217 -8.046  -48.848 1.00 36.28  ? 31  ARG A CG  1 
ATOM   222  C CD  . ARG A 1 31  ? 17.854 -8.716  -48.687 1.00 38.15  ? 31  ARG A CD  1 
ATOM   223  N NE  . ARG A 1 31  ? 18.017 -10.162 -48.661 1.00 39.80  ? 31  ARG A NE  1 
ATOM   224  C CZ  . ARG A 1 31  ? 18.079 -10.926 -49.740 1.00 40.70  ? 31  ARG A CZ  1 
ATOM   225  N NH1 . ARG A 1 31  ? 17.963 -10.390 -50.956 1.00 41.26  ? 31  ARG A NH1 1 
ATOM   226  N NH2 . ARG A 1 31  ? 18.241 -12.241 -49.601 1.00 41.20  ? 31  ARG A NH2 1 
ATOM   227  N N   . CYS A 1 32  ? 21.373 -5.265  -48.617 1.00 32.55  ? 32  CYS A N   1 
ATOM   228  C CA  . CYS A 1 32  ? 20.962 -3.900  -48.764 1.00 32.64  ? 32  CYS A CA  1 
ATOM   229  C C   . CYS A 1 32  ? 19.534 -3.806  -49.288 1.00 31.68  ? 32  CYS A C   1 
ATOM   230  O O   . CYS A 1 32  ? 19.089 -4.651  -50.069 1.00 32.78  ? 32  CYS A O   1 
ATOM   231  C CB  . CYS A 1 32  ? 21.899 -3.196  -49.711 1.00 32.07  ? 32  CYS A CB  1 
ATOM   232  S SG  . CYS A 1 32  ? 23.583 -3.137  -49.061 1.00 33.98  ? 32  CYS A SG  1 
ATOM   233  N N   . LEU A 1 33  ? 18.860 -2.743  -48.872 1.00 31.82  ? 33  LEU A N   1 
ATOM   234  C CA  . LEU A 1 33  ? 17.506 -2.418  -49.328 1.00 31.71  ? 33  LEU A CA  1 
ATOM   235  C C   . LEU A 1 33  ? 17.528 -1.974  -50.781 1.00 31.44  ? 33  LEU A C   1 
ATOM   236  O O   . LEU A 1 33  ? 16.658 -2.344  -51.568 1.00 31.90  ? 33  LEU A O   1 
ATOM   237  C CB  . LEU A 1 33  ? 16.916 -1.294  -48.462 1.00 33.18  ? 33  LEU A CB  1 
ATOM   238  C CG  . LEU A 1 33  ? 16.895 -1.507  -46.939 1.00 35.09  ? 33  LEU A CG  1 
ATOM   239  C CD1 . LEU A 1 33  ? 16.582 -0.228  -46.211 1.00 35.44  ? 33  LEU A CD1 1 
ATOM   240  C CD2 . LEU A 1 33  ? 15.897 -2.561  -46.556 1.00 35.90  ? 33  LEU A CD2 1 
ATOM   241  N N   . SER A 1 34  ? 18.525 -1.163  -51.139 1.00 29.83  ? 34  SER A N   1 
ATOM   242  C CA  . SER A 1 34  ? 18.658 -0.680  -52.508 1.00 28.80  ? 34  SER A CA  1 
ATOM   243  C C   . SER A 1 34  ? 20.102 -0.236  -52.765 1.00 27.98  ? 34  SER A C   1 
ATOM   244  O O   . SER A 1 34  ? 20.873 -0.071  -51.822 1.00 24.22  ? 34  SER A O   1 
ATOM   245  C CB  . SER A 1 34  ? 17.712 0.489   -52.758 1.00 28.74  ? 34  SER A CB  1 
ATOM   246  O OG  . SER A 1 34  ? 18.056 1.600   -51.949 1.00 28.46  ? 34  SER A OG  1 
ATOM   247  N N   . GLN A 1 35  ? 20.452 -0.083  -54.042 1.00 28.86  ? 35  GLN A N   1 
ATOM   248  C CA  . GLN A 1 35  ? 21.712 0.556   -54.436 1.00 29.03  ? 35  GLN A CA  1 
ATOM   249  C C   . GLN A 1 35  ? 21.370 1.519   -55.548 1.00 29.51  ? 35  GLN A C   1 
ATOM   250  O O   . GLN A 1 35  ? 20.665 1.132   -56.470 1.00 30.61  ? 35  GLN A O   1 
ATOM   251  C CB  . GLN A 1 35  ? 22.738 -0.449  -54.949 1.00 30.70  ? 35  GLN A CB  1 
ATOM   252  C CG  . GLN A 1 35  ? 24.184 0.122   -55.049 1.00 31.17  ? 35  GLN A CG  1 
ATOM   253  C CD  . GLN A 1 35  ? 25.174 -0.813  -55.765 1.00 33.37  ? 35  GLN A CD  1 
ATOM   254  O OE1 . GLN A 1 35  ? 24.850 -1.415  -56.783 1.00 37.90  ? 35  GLN A OE1 1 
ATOM   255  N NE2 . GLN A 1 35  ? 26.368 -0.914  -55.240 1.00 35.54  ? 35  GLN A NE2 1 
ATOM   256  N N   . ARG A 1 36  ? 21.870 2.752   -55.466 1.00 29.00  ? 36  ARG A N   1 
ATOM   257  C CA  . ARG A 1 36  ? 21.605 3.779   -56.486 1.00 28.98  ? 36  ARG A CA  1 
ATOM   258  C C   . ARG A 1 36  ? 22.860 4.609   -56.791 1.00 26.39  ? 36  ARG A C   1 
ATOM   259  O O   . ARG A 1 36  ? 23.742 4.737   -55.953 1.00 22.76  ? 36  ARG A O   1 
ATOM   260  C CB  . ARG A 1 36  ? 20.444 4.679   -56.060 1.00 30.44  ? 36  ARG A CB  1 
ATOM   261  C CG  . ARG A 1 36  ? 20.751 5.772   -55.021 1.00 32.74  ? 36  ARG A CG  1 
ATOM   262  C CD  . ARG A 1 36  ? 19.494 6.630   -54.630 1.00 34.27  ? 36  ARG A CD  1 
ATOM   263  N NE  . ARG A 1 36  ? 19.831 7.914   -54.017 1.00 35.45  ? 36  ARG A NE  1 
ATOM   264  C CZ  . ARG A 1 36  ? 19.898 8.148   -52.699 1.00 37.92  ? 36  ARG A CZ  1 
ATOM   265  N NH1 . ARG A 1 36  ? 19.631 7.170   -51.836 1.00 40.29  ? 36  ARG A NH1 1 
ATOM   266  N NH2 . ARG A 1 36  ? 20.221 9.371   -52.230 1.00 37.66  ? 36  ARG A NH2 1 
ATOM   267  N N   . TRP A 1 37  ? 22.918 5.169   -57.998 1.00 26.07  ? 37  TRP A N   1 
ATOM   268  C CA  . TRP A 1 37  ? 23.935 6.167   -58.372 1.00 25.67  ? 37  TRP A CA  1 
ATOM   269  C C   . TRP A 1 37  ? 23.360 7.550   -58.146 1.00 25.60  ? 37  TRP A C   1 
ATOM   270  O O   . TRP A 1 37  ? 22.227 7.803   -58.514 1.00 27.77  ? 37  TRP A O   1 
ATOM   271  C CB  . TRP A 1 37  ? 24.291 6.027   -59.848 1.00 27.02  ? 37  TRP A CB  1 
ATOM   272  C CG  . TRP A 1 37  ? 25.227 4.933   -60.149 1.00 27.54  ? 37  TRP A CG  1 
ATOM   273  C CD1 . TRP A 1 37  ? 25.549 3.878   -59.343 1.00 27.64  ? 37  TRP A CD1 1 
ATOM   274  C CD2 . TRP A 1 37  ? 25.988 4.764   -61.349 1.00 27.16  ? 37  TRP A CD2 1 
ATOM   275  N NE1 . TRP A 1 37  ? 26.470 3.073   -59.972 1.00 27.32  ? 37  TRP A NE1 1 
ATOM   276  C CE2 . TRP A 1 37  ? 26.753 3.596   -61.203 1.00 27.53  ? 37  TRP A CE2 1 
ATOM   277  C CE3 . TRP A 1 37  ? 26.088 5.482   -62.551 1.00 27.64  ? 37  TRP A CE3 1 
ATOM   278  C CZ2 . TRP A 1 37  ? 27.614 3.138   -62.197 1.00 28.03  ? 37  TRP A CZ2 1 
ATOM   279  C CZ3 . TRP A 1 37  ? 26.952 5.024   -63.535 1.00 27.51  ? 37  TRP A CZ3 1 
ATOM   280  C CH2 . TRP A 1 37  ? 27.692 3.870   -63.358 1.00 28.07  ? 37  TRP A CH2 1 
ATOM   281  N N   . GLN A 1 38  ? 24.146 8.446   -57.571 1.00 24.09  ? 38  GLN A N   1 
ATOM   282  C CA  . GLN A 1 38  ? 23.761 9.834   -57.412 1.00 23.74  ? 38  GLN A CA  1 
ATOM   283  C C   . GLN A 1 38  ? 24.984 10.690  -57.735 1.00 22.77  ? 38  GLN A C   1 
ATOM   284  O O   . GLN A 1 38  ? 26.062 10.437  -57.208 1.00 19.76  ? 38  GLN A O   1 
ATOM   285  C CB  . GLN A 1 38  ? 23.306 10.057  -55.980 1.00 25.07  ? 38  GLN A CB  1 
ATOM   286  C CG  . GLN A 1 38  ? 22.857 11.471  -55.628 1.00 26.24  ? 38  GLN A CG  1 
ATOM   287  C CD  . GLN A 1 38  ? 22.155 11.565  -54.257 1.00 27.52  ? 38  GLN A CD  1 
ATOM   288  O OE1 . GLN A 1 38  ? 21.047 11.059  -54.089 1.00 32.24  ? 38  GLN A OE1 1 
ATOM   289  N NE2 . GLN A 1 38  ? 22.768 12.246  -53.319 1.00 24.74  ? 38  GLN A NE2 1 
ATOM   290  N N   . ARG A 1 39  ? 24.831 11.733  -58.550 1.00 20.79  ? 39  ARG A N   1 
ATOM   291  C CA  . ARG A 1 39  ? 25.926 12.702  -58.693 1.00 20.42  ? 39  ARG A CA  1 
ATOM   292  C C   . ARG A 1 39  ? 26.209 13.387  -57.344 1.00 20.72  ? 39  ARG A C   1 
ATOM   293  O O   . ARG A 1 39  ? 25.283 13.774  -56.616 1.00 21.27  ? 39  ARG A O   1 
ATOM   294  C CB  . ARG A 1 39  ? 25.581 13.774  -59.734 1.00 21.31  ? 39  ARG A CB  1 
ATOM   295  C CG  . ARG A 1 39  ? 26.548 14.941  -59.778 1.00 19.90  ? 39  ARG A CG  1 
ATOM   296  C CD  . ARG A 1 39  ? 26.312 15.910  -60.918 1.00 19.72  ? 39  ARG A CD  1 
ATOM   297  N NE  . ARG A 1 39  ? 24.954 16.444  -60.882 1.00 19.79  ? 39  ARG A NE  1 
ATOM   298  C CZ  . ARG A 1 39  ? 24.577 17.558  -60.255 1.00 19.27  ? 39  ARG A CZ  1 
ATOM   299  N NH1 . ARG A 1 39  ? 25.437 18.306  -59.612 1.00 20.19  ? 39  ARG A NH1 1 
ATOM   300  N NH2 . ARG A 1 39  ? 23.314 17.929  -60.306 1.00 20.59  ? 39  ARG A NH2 1 
ATOM   301  N N   . GLY A 1 40  ? 27.478 13.492  -56.988 1.00 19.91  ? 40  GLY A N   1 
ATOM   302  C CA  . GLY A 1 40  ? 27.880 14.154  -55.754 1.00 20.18  ? 40  GLY A CA  1 
ATOM   303  C C   . GLY A 1 40  ? 29.095 15.030  -55.987 1.00 20.85  ? 40  GLY A C   1 
ATOM   304  O O   . GLY A 1 40  ? 29.333 15.485  -57.114 1.00 19.75  ? 40  GLY A O   1 
ATOM   305  N N   . GLY A 1 41  ? 29.901 15.202  -54.929 1.00 19.97  ? 41  GLY A N   1 
ATOM   306  C CA  . GLY A 1 41  ? 30.917 16.236  -54.899 1.00 19.97  ? 41  GLY A CA  1 
ATOM   307  C C   . GLY A 1 41  ? 30.357 17.478  -54.240 1.00 20.98  ? 41  GLY A C   1 
ATOM   308  O O   . GLY A 1 41  ? 29.180 17.824  -54.448 1.00 19.61  ? 41  GLY A O   1 
ATOM   309  N N   . ASN A 1 42  ? 31.174 18.148  -53.431 1.00 20.88  ? 42  ASN A N   1 
ATOM   310  C CA  . ASN A 1 42  ? 30.665 19.301  -52.652 1.00 22.27  ? 42  ASN A CA  1 
ATOM   311  C C   . ASN A 1 42  ? 30.116 20.418  -53.509 1.00 22.58  ? 42  ASN A C   1 
ATOM   312  O O   . ASN A 1 42  ? 28.926 20.730  -53.413 1.00 23.40  ? 42  ASN A O   1 
ATOM   313  C CB  . ASN A 1 42  ? 31.726 19.851  -51.694 1.00 23.19  ? 42  ASN A CB  1 
ATOM   314  C CG  . ASN A 1 42  ? 32.021 18.921  -50.574 1.00 24.71  ? 42  ASN A CG  1 
ATOM   315  O OD1 . ASN A 1 42  ? 31.755 17.726  -50.671 1.00 25.24  ? 42  ASN A OD1 1 
ATOM   316  N ND2 . ASN A 1 42  ? 32.606 19.455  -49.489 1.00 25.69  ? 42  ASN A ND2 1 
ATOM   317  N N   . ALA A 1 43  ? 30.961 21.018  -54.346 1.00 21.71  ? 43  ALA A N   1 
ATOM   318  C CA  . ALA A 1 43  ? 30.554 22.138  -55.169 1.00 23.79  ? 43  ALA A CA  1 
ATOM   319  C C   . ALA A 1 43  ? 29.523 21.691  -56.204 1.00 23.85  ? 43  ALA A C   1 
ATOM   320  O O   . ALA A 1 43  ? 28.657 22.464  -56.577 1.00 22.98  ? 43  ALA A O   1 
ATOM   321  C CB  . ALA A 1 43  ? 31.726 22.732  -55.874 1.00 24.93  ? 43  ALA A CB  1 
ATOM   322  N N   . SER A 1 44  ? 29.651 20.447  -56.674 1.00 22.73  ? 44  SER A N   1 
ATOM   323  C CA  . SER A 1 44  ? 28.667 19.855  -57.562 1.00 21.51  ? 44  SER A CA  1 
ATOM   324  C C   . SER A 1 44  ? 27.267 19.845  -56.899 1.00 20.46  ? 44  SER A C   1 
ATOM   325  O O   . SER A 1 44  ? 26.294 20.329  -57.471 1.00 21.87  ? 44  SER A O   1 
ATOM   326  C CB  . SER A 1 44  ? 29.147 18.450  -57.917 1.00 21.61  ? 44  SER A CB  1 
ATOM   327  O OG  . SER A 1 44  ? 28.138 17.627  -58.457 1.00 21.13  ? 44  SER A OG  1 
ATOM   328  N N   . ASN A 1 45  ? 27.175 19.303  -55.694 1.00 20.98  ? 45  ASN A N   1 
ATOM   329  C CA  . ASN A 1 45  ? 25.925 19.269  -54.965 1.00 20.81  ? 45  ASN A CA  1 
ATOM   330  C C   . ASN A 1 45  ? 25.389 20.698  -54.718 1.00 22.52  ? 45  ASN A C   1 
ATOM   331  O O   . ASN A 1 45  ? 24.165 20.952  -54.803 1.00 20.33  ? 45  ASN A O   1 
ATOM   332  C CB  . ASN A 1 45  ? 26.107 18.558  -53.633 1.00 20.57  ? 45  ASN A CB  1 
ATOM   333  C CG  . ASN A 1 45  ? 26.126 17.050  -53.755 1.00 20.55  ? 45  ASN A CG  1 
ATOM   334  O OD1 . ASN A 1 45  ? 25.695 16.460  -54.760 1.00 22.99  ? 45  ASN A OD1 1 
ATOM   335  N ND2 . ASN A 1 45  ? 26.651 16.425  -52.740 1.00 21.01  ? 45  ASN A ND2 1 
ATOM   336  N N   . SER A 1 46  ? 26.299 21.638  -54.428 1.00 21.27  ? 46  SER A N   1 
ATOM   337  C CA  . SER A 1 46  ? 25.895 23.037  -54.194 1.00 21.94  ? 46  SER A CA  1 
ATOM   338  C C   . SER A 1 46  ? 25.266 23.656  -55.468 1.00 21.88  ? 46  SER A C   1 
ATOM   339  O O   . SER A 1 46  ? 24.302 24.448  -55.358 1.00 21.08  ? 46  SER A O   1 
ATOM   340  C CB  . SER A 1 46  ? 27.079 23.866  -53.617 1.00 22.99  ? 46  SER A CB  1 
ATOM   341  O OG  . SER A 1 46  ? 27.344 23.457  -52.261 1.00 22.73  ? 46  SER A OG  1 
ATOM   342  N N   . CYS A 1 47  ? 25.749 23.286  -56.659 1.00 22.18  ? 47  CYS A N   1 
ATOM   343  C CA  . CYS A 1 47  ? 25.099 23.726  -57.912 1.00 23.06  ? 47  CYS A CA  1 
ATOM   344  C C   . CYS A 1 47  ? 23.693 23.188  -58.001 1.00 22.75  ? 47  CYS A C   1 
ATOM   345  O O   . CYS A 1 47  ? 22.811 23.874  -58.483 1.00 24.31  ? 47  CYS A O   1 
ATOM   346  C CB  . CYS A 1 47  ? 25.865 23.311  -59.180 1.00 25.10  ? 47  CYS A CB  1 
ATOM   347  S SG  . CYS A 1 47  ? 27.312 24.307  -59.494 1.00 28.70  ? 47  CYS A SG  1 
ATOM   348  N N   . THR A 1 48  ? 23.491 21.942  -57.572 1.00 21.04  ? 48  THR A N   1 
ATOM   349  C CA  . THR A 1 48  ? 22.188 21.318  -57.655 1.00 21.42  ? 48  THR A CA  1 
ATOM   350  C C   . THR A 1 48  ? 21.229 22.169  -56.843 1.00 22.12  ? 48  THR A C   1 
ATOM   351  O O   . THR A 1 48  ? 20.151 22.551  -57.302 1.00 22.08  ? 48  THR A O   1 
ATOM   352  C CB  . THR A 1 48  ? 22.252 19.902  -57.102 1.00 20.56  ? 48  THR A CB  1 
ATOM   353  O OG1 . THR A 1 48  ? 23.169 19.126  -57.897 1.00 19.51  ? 48  THR A OG1 1 
ATOM   354  C CG2 . THR A 1 48  ? 20.915 19.185  -57.237 1.00 20.52  ? 48  THR A CG2 1 
ATOM   355  N N   . VAL A 1 49  ? 21.650 22.498  -55.636 1.00 20.69  ? 49  VAL A N   1 
ATOM   356  C CA  . VAL A 1 49  ? 20.819 23.255  -54.710 1.00 21.65  ? 49  VAL A CA  1 
ATOM   357  C C   . VAL A 1 49  ? 20.580 24.683  -55.182 1.00 21.96  ? 49  VAL A C   1 
ATOM   358  O O   . VAL A 1 49  ? 19.440 25.162  -55.137 1.00 23.91  ? 49  VAL A O   1 
ATOM   359  C CB  . VAL A 1 49  ? 21.430 23.222  -53.302 1.00 21.08  ? 49  VAL A CB  1 
ATOM   360  C CG1 . VAL A 1 49  ? 20.739 24.251  -52.378 1.00 21.60  ? 49  VAL A CG1 1 
ATOM   361  C CG2 . VAL A 1 49  ? 21.322 21.796  -52.734 1.00 20.54  ? 49  VAL A CG2 1 
ATOM   362  N N   . LEU A 1 50  ? 21.628 25.356  -55.634 1.00 22.17  ? 50  LEU A N   1 
ATOM   363  C CA  . LEU A 1 50  ? 21.507 26.700  -56.207 1.00 23.02  ? 50  LEU A CA  1 
ATOM   364  C C   . LEU A 1 50  ? 20.510 26.707  -57.375 1.00 25.14  ? 50  LEU A C   1 
ATOM   365  O O   . LEU A 1 50  ? 19.649 27.579  -57.462 1.00 25.15  ? 50  LEU A O   1 
ATOM   366  C CB  . LEU A 1 50  ? 22.854 27.185  -56.692 1.00 23.12  ? 50  LEU A CB  1 
ATOM   367  C CG  . LEU A 1 50  ? 23.832 27.625  -55.600 1.00 22.41  ? 50  LEU A CG  1 
ATOM   368  C CD1 . LEU A 1 50  ? 25.110 27.956  -56.258 1.00 23.29  ? 50  LEU A CD1 1 
ATOM   369  C CD2 . LEU A 1 50  ? 23.269 28.833  -54.797 1.00 22.20  ? 50  LEU A CD2 1 
ATOM   370  N N   . SER A 1 51  ? 20.642 25.729  -58.261 1.00 24.32  ? 51  SER A N   1 
ATOM   371  C CA  . SER A 1 51  ? 19.722 25.566  -59.374 1.00 26.07  ? 51  SER A CA  1 
ATOM   372  C C   . SER A 1 51  ? 18.281 25.393  -58.872 1.00 26.93  ? 51  SER A C   1 
ATOM   373  O O   . SER A 1 51  ? 17.374 26.103  -59.334 1.00 28.36  ? 51  SER A O   1 
ATOM   374  C CB  . SER A 1 51  ? 20.177 24.386  -60.260 1.00 28.10  ? 51  SER A CB  1 
ATOM   375  O OG  . SER A 1 51  ? 19.205 24.063  -61.266 1.00 31.82  ? 51  SER A OG  1 
ATOM   376  N N   . LEU A 1 52  ? 18.076 24.504  -57.911 1.00 25.46  ? 52  LEU A N   1 
ATOM   377  C CA  . LEU A 1 52  ? 16.752 24.241  -57.351 1.00 26.81  ? 52  LEU A CA  1 
ATOM   378  C C   . LEU A 1 52  ? 16.172 25.489  -56.683 1.00 28.01  ? 52  LEU A C   1 
ATOM   379  O O   . LEU A 1 52  ? 14.949 25.752  -56.732 1.00 25.17  ? 52  LEU A O   1 
ATOM   380  C CB  . LEU A 1 52  ? 16.812 23.088  -56.364 1.00 26.72  ? 52  LEU A CB  1 
ATOM   381  C CG  . LEU A 1 52  ? 16.957 21.687  -56.979 1.00 26.32  ? 52  LEU A CG  1 
ATOM   382  C CD1 . LEU A 1 52  ? 17.378 20.708  -55.914 1.00 25.55  ? 52  LEU A CD1 1 
ATOM   383  C CD2 . LEU A 1 52  ? 15.641 21.228  -57.679 1.00 26.28  ? 52  LEU A CD2 1 
ATOM   384  N N   . LEU A 1 53  ? 17.039 26.294  -56.083 1.00 26.85  ? 53  LEU A N   1 
ATOM   385  C CA  . LEU A 1 53  ? 16.573 27.513  -55.420 1.00 28.03  ? 53  LEU A CA  1 
ATOM   386  C C   . LEU A 1 53  ? 16.306 28.647  -56.407 1.00 28.97  ? 53  LEU A C   1 
ATOM   387  O O   . LEU A 1 53  ? 15.749 29.666  -56.026 1.00 30.23  ? 53  LEU A O   1 
ATOM   388  C CB  . LEU A 1 53  ? 17.587 27.980  -54.365 1.00 27.46  ? 53  LEU A CB  1 
ATOM   389  C CG  . LEU A 1 53  ? 17.750 27.075  -53.146 1.00 27.56  ? 53  LEU A CG  1 
ATOM   390  C CD1 . LEU A 1 53  ? 18.912 27.558  -52.257 1.00 27.13  ? 53  LEU A CD1 1 
ATOM   391  C CD2 . LEU A 1 53  ? 16.484 27.022  -52.368 1.00 27.96  ? 53  LEU A CD2 1 
ATOM   392  N N   . GLY A 1 54  ? 16.744 28.495  -57.645 1.00 30.27  ? 54  GLY A N   1 
ATOM   393  C CA  . GLY A 1 54  ? 16.389 29.415  -58.714 1.00 31.61  ? 54  GLY A CA  1 
ATOM   394  C C   . GLY A 1 54  ? 17.514 30.313  -59.172 1.00 33.59  ? 54  GLY A C   1 
ATOM   395  O O   . GLY A 1 54  ? 17.280 31.321  -59.851 1.00 35.88  ? 54  GLY A O   1 
ATOM   396  N N   . ALA A 1 55  ? 18.744 29.967  -58.802 1.00 32.17  ? 55  ALA A N   1 
ATOM   397  C CA  . ALA A 1 55  ? 19.896 30.751  -59.193 1.00 32.14  ? 55  ALA A CA  1 
ATOM   398  C C   . ALA A 1 55  ? 20.618 30.087  -60.333 1.00 32.75  ? 55  ALA A C   1 
ATOM   399  O O   . ALA A 1 55  ? 21.113 28.979  -60.176 1.00 33.83  ? 55  ALA A O   1 
ATOM   400  C CB  . ALA A 1 55  ? 20.852 30.904  -58.000 1.00 32.38  ? 55  ALA A CB  1 
ATOM   401  N N   . PRO A 1 56  ? 20.706 30.757  -61.474 1.00 32.85  ? 56  PRO A N   1 
ATOM   402  C CA  . PRO A 1 56  ? 21.491 30.254  -62.584 1.00 32.21  ? 56  PRO A CA  1 
ATOM   403  C C   . PRO A 1 56  ? 22.937 30.102  -62.159 1.00 31.97  ? 56  PRO A C   1 
ATOM   404  O O   . PRO A 1 56  ? 23.499 31.003  -61.529 1.00 29.33  ? 56  PRO A O   1 
ATOM   405  C CB  . PRO A 1 56  ? 21.356 31.355  -63.637 1.00 33.81  ? 56  PRO A CB  1 
ATOM   406  C CG  . PRO A 1 56  ? 20.101 32.060  -63.293 1.00 33.62  ? 56  PRO A CG  1 
ATOM   407  C CD  . PRO A 1 56  ? 20.027 32.023  -61.814 1.00 33.88  ? 56  PRO A CD  1 
ATOM   408  N N   . CYS A 1 57  ? 23.525 28.955  -62.475 1.00 31.16  ? 57  CYS A N   1 
ATOM   409  C CA  . CYS A 1 57  ? 24.882 28.707  -62.055 1.00 30.57  ? 57  CYS A CA  1 
ATOM   410  C C   . CYS A 1 57  ? 25.639 27.860  -63.055 1.00 27.67  ? 57  CYS A C   1 
ATOM   411  O O   . CYS A 1 57  ? 25.081 27.317  -64.017 1.00 26.27  ? 57  CYS A O   1 
ATOM   412  C CB  . CYS A 1 57  ? 24.876 28.092  -60.646 1.00 32.65  ? 57  CYS A CB  1 
ATOM   413  S SG  . CYS A 1 57  ? 24.016 26.528  -60.540 1.00 35.35  ? 57  CYS A SG  1 
ATOM   414  N N   . ALA A 1 58  ? 26.941 27.812  -62.858 1.00 25.69  ? 58  ALA A N   1 
ATOM   415  C CA  . ALA A 1 58  ? 27.838 27.140  -63.738 1.00 24.82  ? 58  ALA A CA  1 
ATOM   416  C C   . ALA A 1 58  ? 28.747 26.299  -62.867 1.00 25.66  ? 58  ALA A C   1 
ATOM   417  O O   . ALA A 1 58  ? 29.001 26.651  -61.717 1.00 24.51  ? 58  ALA A O   1 
ATOM   418  C CB  . ALA A 1 58  ? 28.666 28.117  -64.495 1.00 26.10  ? 58  ALA A CB  1 
ATOM   419  N N   . PHE A 1 59  ? 29.186 25.178  -63.414 1.00 24.62  ? 59  PHE A N   1 
ATOM   420  C CA  . PHE A 1 59  ? 30.068 24.282  -62.697 1.00 23.65  ? 59  PHE A CA  1 
ATOM   421  C C   . PHE A 1 59  ? 31.357 24.095  -63.482 1.00 22.97  ? 59  PHE A C   1 
ATOM   422  O O   . PHE A 1 59  ? 31.352 23.762  -64.684 1.00 23.73  ? 59  PHE A O   1 
ATOM   423  C CB  . PHE A 1 59  ? 29.418 22.931  -62.410 1.00 24.54  ? 59  PHE A CB  1 
ATOM   424  C CG  . PHE A 1 59  ? 30.318 22.011  -61.639 1.00 24.37  ? 59  PHE A CG  1 
ATOM   425  C CD1 . PHE A 1 59  ? 30.482 22.171  -60.272 1.00 26.07  ? 59  PHE A CD1 1 
ATOM   426  C CD2 . PHE A 1 59  ? 31.045 21.054  -62.275 1.00 25.61  ? 59  PHE A CD2 1 
ATOM   427  C CE1 . PHE A 1 59  ? 31.351 21.346  -59.559 1.00 24.94  ? 59  PHE A CE1 1 
ATOM   428  C CE2 . PHE A 1 59  ? 31.903 20.226  -61.556 1.00 25.82  ? 59  PHE A CE2 1 
ATOM   429  C CZ  . PHE A 1 59  ? 32.043 20.391  -60.214 1.00 25.26  ? 59  PHE A CZ  1 
ATOM   430  N N   . MET A 1 60  ? 32.462 24.291  -62.798 1.00 21.65  ? 60  MET A N   1 
ATOM   431  C CA  . MET A 1 60  ? 33.768 24.050  -63.384 1.00 22.30  ? 60  MET A CA  1 
ATOM   432  C C   . MET A 1 60  ? 34.514 22.975  -62.626 1.00 21.56  ? 60  MET A C   1 
ATOM   433  O O   . MET A 1 60  ? 34.860 23.121  -61.450 1.00 21.06  ? 60  MET A O   1 
ATOM   434  C CB  . MET A 1 60  ? 34.596 25.323  -63.448 1.00 22.66  ? 60  MET A CB  1 
ATOM   435  C CG  . MET A 1 60  ? 36.019 25.098  -63.978 1.00 23.29  ? 60  MET A CG  1 
ATOM   436  S SD  . MET A 1 60  ? 36.865 26.669  -64.224 1.00 24.39  ? 60  MET A SD  1 
ATOM   437  C CE  . MET A 1 60  ? 38.166 26.206  -65.340 1.00 24.49  ? 60  MET A CE  1 
ATOM   438  N N   . GLY A 1 61  ? 34.728 21.859  -63.312 1.00 22.28  ? 61  GLY A N   1 
ATOM   439  C CA  . GLY A 1 61  ? 35.456 20.749  -62.766 1.00 21.36  ? 61  GLY A CA  1 
ATOM   440  C C   . GLY A 1 61  ? 36.038 19.915  -63.900 1.00 21.96  ? 61  GLY A C   1 
ATOM   441  O O   . GLY A 1 61  ? 35.590 20.009  -65.058 1.00 20.38  ? 61  GLY A O   1 
ATOM   442  N N   . SER A 1 62  ? 36.995 19.083  -63.517 1.00 21.28  ? 62  SER A N   1 
ATOM   443  C CA  . SER A 1 62  ? 37.622 18.104  -64.371 1.00 22.65  ? 62  SER A CA  1 
ATOM   444  C C   . SER A 1 62  ? 36.669 16.962  -64.701 1.00 23.54  ? 62  SER A C   1 
ATOM   445  O O   . SER A 1 62  ? 35.769 16.602  -63.916 1.00 19.85  ? 62  SER A O   1 
ATOM   446  C CB  . SER A 1 62  ? 38.860 17.564  -63.673 1.00 23.27  ? 62  SER A CB  1 
ATOM   447  O OG  . SER A 1 62  ? 39.908 18.531  -63.643 1.00 25.02  ? 62  SER A OG  1 
ATOM   448  N N   . MET A 1 63  ? 36.884 16.362  -65.867 1.00 25.05  ? 63  MET A N   1 
ATOM   449  C CA  . MET A 1 63  ? 36.006 15.310  -66.342 1.00 24.63  ? 63  MET A CA  1 
ATOM   450  C C   . MET A 1 63  ? 36.806 14.362  -67.251 1.00 26.35  ? 63  MET A C   1 
ATOM   451  O O   . MET A 1 63  ? 37.672 14.813  -68.006 1.00 26.00  ? 63  MET A O   1 
ATOM   452  C CB  . MET A 1 63  ? 34.835 15.944  -67.066 1.00 25.42  ? 63  MET A CB  1 
ATOM   453  C CG  . MET A 1 63  ? 33.736 14.983  -67.513 1.00 27.07  ? 63  MET A CG  1 
ATOM   454  S SD  . MET A 1 63  ? 33.029 13.974  -66.175 1.00 28.93  ? 63  MET A SD  1 
ATOM   455  C CE  . MET A 1 63  ? 32.622 15.268  -64.984 1.00 29.05  ? 63  MET A CE  1 
ATOM   456  N N   . ALA A 1 64  ? 36.567 13.062  -67.092 1.00 25.34  ? 64  ALA A N   1 
ATOM   457  C CA  . ALA A 1 64  ? 37.129 12.009  -67.958 1.00 25.45  ? 64  ALA A CA  1 
ATOM   458  C C   . ALA A 1 64  ? 35.967 11.392  -68.746 1.00 25.98  ? 64  ALA A C   1 
ATOM   459  O O   . ALA A 1 64  ? 35.015 10.889  -68.167 1.00 25.11  ? 64  ALA A O   1 
ATOM   460  C CB  . ALA A 1 64  ? 37.833 10.964  -67.128 1.00 26.44  ? 64  ALA A CB  1 
ATOM   461  N N   . PRO A 1 65  ? 35.997 11.479  -70.076 1.00 25.69  ? 65  PRO A N   1 
ATOM   462  C CA  . PRO A 1 65  ? 34.905 10.923  -70.866 1.00 24.74  ? 65  PRO A CA  1 
ATOM   463  C C   . PRO A 1 65  ? 34.675 9.425   -70.609 1.00 22.69  ? 65  PRO A C   1 
ATOM   464  O O   . PRO A 1 65  ? 35.613 8.685   -70.307 1.00 23.27  ? 65  PRO A O   1 
ATOM   465  C CB  . PRO A 1 65  ? 35.350 11.201  -72.309 1.00 25.72  ? 65  PRO A CB  1 
ATOM   466  C CG  . PRO A 1 65  ? 36.181 12.440  -72.171 1.00 26.74  ? 65  PRO A CG  1 
ATOM   467  C CD  . PRO A 1 65  ? 37.017 12.130  -70.921 1.00 26.26  ? 65  PRO A CD  1 
ATOM   468  N N   . GLY A 1 66  ? 33.426 9.012   -70.719 1.00 23.81  ? 66  GLY A N   1 
ATOM   469  C CA  . GLY A 1 66  ? 33.032 7.637   -70.520 1.00 23.64  ? 66  GLY A CA  1 
ATOM   470  C C   . GLY A 1 66  ? 31.617 7.620   -70.027 1.00 22.70  ? 66  GLY A C   1 
ATOM   471  O O   . GLY A 1 66  ? 30.982 8.656   -69.961 1.00 20.67  ? 66  GLY A O   1 
ATOM   472  N N   . HIS A 1 67  ? 31.112 6.440   -69.687 1.00 22.22  ? 67  HIS A N   1 
ATOM   473  C CA  . HIS A 1 67  ? 29.733 6.294   -69.306 1.00 23.25  ? 67  HIS A CA  1 
ATOM   474  C C   . HIS A 1 67  ? 29.457 6.976   -67.968 1.00 20.80  ? 67  HIS A C   1 
ATOM   475  O O   . HIS A 1 67  ? 28.357 7.451   -67.722 1.00 19.89  ? 67  HIS A O   1 
ATOM   476  C CB  . HIS A 1 67  ? 29.371 4.810   -69.247 1.00 27.21  ? 67  HIS A CB  1 
ATOM   477  C CG  . HIS A 1 67  ? 29.210 4.183   -70.604 1.00 29.56  ? 67  HIS A CG  1 
ATOM   478  N ND1 . HIS A 1 67  ? 29.133 4.931   -71.763 1.00 32.35  ? 67  HIS A ND1 1 
ATOM   479  C CD2 . HIS A 1 67  ? 29.110 2.889   -70.986 1.00 30.60  ? 67  HIS A CD2 1 
ATOM   480  C CE1 . HIS A 1 67  ? 28.981 4.123   -72.798 1.00 31.34  ? 67  HIS A CE1 1 
ATOM   481  N NE2 . HIS A 1 67  ? 28.959 2.877   -72.353 1.00 32.40  ? 67  HIS A NE2 1 
ATOM   482  N N   . VAL A 1 68  ? 30.455 7.028   -67.096 1.00 20.82  ? 68  VAL A N   1 
ATOM   483  C CA  . VAL A 1 68  ? 30.217 7.709   -65.805 1.00 21.09  ? 68  VAL A CA  1 
ATOM   484  C C   . VAL A 1 68  ? 30.060 9.227   -66.036 1.00 21.36  ? 68  VAL A C   1 
ATOM   485  O O   . VAL A 1 68  ? 29.155 9.853   -65.507 1.00 18.85  ? 68  VAL A O   1 
ATOM   486  C CB  . VAL A 1 68  ? 31.289 7.396   -64.756 1.00 21.92  ? 68  VAL A CB  1 
ATOM   487  C CG1 . VAL A 1 68  ? 31.107 8.292   -63.521 1.00 21.06  ? 68  VAL A CG1 1 
ATOM   488  C CG2 . VAL A 1 68  ? 31.236 5.904   -64.357 1.00 23.44  ? 68  VAL A CG2 1 
ATOM   489  N N   . ALA A 1 69  ? 30.945 9.797   -66.850 1.00 21.22  ? 69  ALA A N   1 
ATOM   490  C CA  . ALA A 1 69  ? 30.833 11.193  -67.237 1.00 21.20  ? 69  ALA A CA  1 
ATOM   491  C C   . ALA A 1 69  ? 29.465 11.508  -67.820 1.00 20.86  ? 69  ALA A C   1 
ATOM   492  O O   . ALA A 1 69  ? 28.840 12.496  -67.469 1.00 21.22  ? 69  ALA A O   1 
ATOM   493  C CB  . ALA A 1 69  ? 31.945 11.547  -68.212 1.00 22.20  ? 69  ALA A CB  1 
ATOM   494  N N   . ASP A 1 70  ? 28.981 10.668  -68.726 1.00 19.74  ? 70  ASP A N   1 
ATOM   495  C CA  . ASP A 1 70  ? 27.663 10.845  -69.302 1.00 20.31  ? 70  ASP A CA  1 
ATOM   496  C C   . ASP A 1 70  ? 26.562 10.920  -68.254 1.00 20.95  ? 70  ASP A C   1 
ATOM   497  O O   . ASP A 1 70  ? 25.661 11.755  -68.323 1.00 20.04  ? 70  ASP A O   1 
ATOM   498  C CB  . ASP A 1 70  ? 27.356 9.678   -70.262 1.00 21.32  ? 70  ASP A CB  1 
ATOM   499  C CG  . ASP A 1 70  ? 28.230 9.686   -71.499 1.00 23.81  ? 70  ASP A CG  1 
ATOM   500  O OD1 . ASP A 1 70  ? 28.879 10.719  -71.792 1.00 23.33  ? 70  ASP A OD1 1 
ATOM   501  O OD2 . ASP A 1 70  ? 28.306 8.691   -72.254 1.00 24.76  ? 70  ASP A OD2 1 
ATOM   502  N N   . PHE A 1 71  ? 26.622 10.015  -67.280 1.00 20.91  ? 71  PHE A N   1 
ATOM   503  C CA  . PHE A 1 71  ? 25.628 10.016  -66.212 1.00 19.63  ? 71  PHE A CA  1 
ATOM   504  C C   . PHE A 1 71  ? 25.675 11.336  -65.432 1.00 18.52  ? 71  PHE A C   1 
ATOM   505  O O   . PHE A 1 71  ? 24.636 11.969  -65.239 1.00 21.19  ? 71  PHE A O   1 
ATOM   506  C CB  . PHE A 1 71  ? 25.829 8.823   -65.277 1.00 20.80  ? 71  PHE A CB  1 
ATOM   507  C CG  . PHE A 1 71  ? 24.936 8.864   -64.066 1.00 20.57  ? 71  PHE A CG  1 
ATOM   508  C CD1 . PHE A 1 71  ? 23.625 8.444   -64.146 1.00 21.84  ? 71  PHE A CD1 1 
ATOM   509  C CD2 . PHE A 1 71  ? 25.402 9.373   -62.871 1.00 20.47  ? 71  PHE A CD2 1 
ATOM   510  C CE1 . PHE A 1 71  ? 22.778 8.517   -63.029 1.00 22.11  ? 71  PHE A CE1 1 
ATOM   511  C CE2 . PHE A 1 71  ? 24.557 9.461   -61.754 1.00 20.97  ? 71  PHE A CE2 1 
ATOM   512  C CZ  . PHE A 1 71  ? 23.242 9.040   -61.849 1.00 21.73  ? 71  PHE A CZ  1 
ATOM   513  N N   . VAL A 1 72  ? 26.856 11.740  -64.992 1.00 19.44  ? 72  VAL A N   1 
ATOM   514  C CA  . VAL A 1 72  ? 26.957 12.964  -64.164 1.00 20.48  ? 72  VAL A CA  1 
ATOM   515  C C   . VAL A 1 72  ? 26.721 14.238  -64.954 1.00 21.42  ? 72  VAL A C   1 
ATOM   516  O O   . VAL A 1 72  ? 26.085 15.160  -64.436 1.00 22.91  ? 72  VAL A O   1 
ATOM   517  C CB  . VAL A 1 72  ? 28.247 13.061  -63.336 1.00 19.84  ? 72  VAL A CB  1 
ATOM   518  C CG1 . VAL A 1 72  ? 28.291 11.908  -62.345 1.00 20.86  ? 72  VAL A CG1 1 
ATOM   519  C CG2 . VAL A 1 72  ? 29.498 13.110  -64.141 1.00 19.65  ? 72  VAL A CG2 1 
ATOM   520  N N   . LEU A 1 73  ? 27.203 14.294  -66.195 1.00 21.37  ? 73  LEU A N   1 
ATOM   521  C CA  . LEU A 1 73  ? 26.926 15.472  -67.042 1.00 22.90  ? 73  LEU A CA  1 
ATOM   522  C C   . LEU A 1 73  ? 25.467 15.598  -67.441 1.00 23.18  ? 73  LEU A C   1 
ATOM   523  O O   . LEU A 1 73  ? 24.897 16.682  -67.352 1.00 22.28  ? 73  LEU A O   1 
ATOM   524  C CB  . LEU A 1 73  ? 27.843 15.497  -68.273 1.00 24.45  ? 73  LEU A CB  1 
ATOM   525  C CG  . LEU A 1 73  ? 29.324 15.588  -67.963 1.00 24.90  ? 73  LEU A CG  1 
ATOM   526  C CD1 . LEU A 1 73  ? 30.102 15.436  -69.235 1.00 26.86  ? 73  LEU A CD1 1 
ATOM   527  C CD2 . LEU A 1 73  ? 29.652 16.895  -67.227 1.00 27.31  ? 73  LEU A CD2 1 
ATOM   528  N N   . ASP A 1 74  ? 24.824 14.499  -67.857 1.00 25.84  ? 74  ASP A N   1 
ATOM   529  C CA  . ASP A 1 74  ? 23.388 14.536  -68.092 1.00 25.46  ? 74  ASP A CA  1 
ATOM   530  C C   . ASP A 1 74  ? 22.670 15.090  -66.874 1.00 25.28  ? 74  ASP A C   1 
ATOM   531  O O   . ASP A 1 74  ? 21.731 15.858  -66.988 1.00 24.44  ? 74  ASP A O   1 
ATOM   532  C CB  . ASP A 1 74  ? 22.793 13.143  -68.422 1.00 27.70  ? 74  ASP A CB  1 
ATOM   533  C CG  . ASP A 1 74  ? 21.236 13.111  -68.305 1.00 30.24  ? 74  ASP A CG  1 
ATOM   534  O OD1 . ASP A 1 74  ? 20.511 13.555  -69.253 1.00 34.02  ? 74  ASP A OD1 1 
ATOM   535  O OD2 . ASP A 1 74  ? 20.615 12.674  -67.302 1.00 34.30  ? 74  ASP A OD2 1 
ATOM   536  N N   . ASP A 1 75  ? 23.087 14.668  -65.686 1.00 24.37  ? 75  ASP A N   1 
ATOM   537  C CA  . ASP A 1 75  ? 22.399 15.091  -64.484 1.00 23.03  ? 75  ASP A CA  1 
ATOM   538  C C   . ASP A 1 75  ? 22.551 16.608  -64.262 1.00 21.33  ? 75  ASP A C   1 
ATOM   539  O O   . ASP A 1 75  ? 21.565 17.307  -64.013 1.00 23.18  ? 75  ASP A O   1 
ATOM   540  C CB  . ASP A 1 75  ? 22.904 14.286  -63.282 1.00 22.95  ? 75  ASP A CB  1 
ATOM   541  C CG  . ASP A 1 75  ? 22.031 14.473  -62.075 1.00 24.14  ? 75  ASP A CG  1 
ATOM   542  O OD1 . ASP A 1 75  ? 22.394 15.294  -61.219 1.00 20.60  ? 75  ASP A OD1 1 
ATOM   543  O OD2 . ASP A 1 75  ? 20.917 13.928  -61.973 1.00 25.20  ? 75  ASP A OD2 1 
ATOM   544  N N   . LEU A 1 76  ? 23.765 17.122  -64.419 1.00 22.14  ? 76  LEU A N   1 
ATOM   545  C CA  . LEU A 1 76  ? 24.015 18.569  -64.352 1.00 21.84  ? 76  LEU A CA  1 
ATOM   546  C C   . LEU A 1 76  ? 23.142 19.332  -65.376 1.00 23.93  ? 76  LEU A C   1 
ATOM   547  O O   . LEU A 1 76  ? 22.558 20.376  -65.072 1.00 23.53  ? 76  LEU A O   1 
ATOM   548  C CB  . LEU A 1 76  ? 25.493 18.842  -64.609 1.00 21.98  ? 76  LEU A CB  1 
ATOM   549  C CG  . LEU A 1 76  ? 26.399 18.560  -63.395 1.00 21.66  ? 76  LEU A CG  1 
ATOM   550  C CD1 . LEU A 1 76  ? 27.800 18.203  -63.764 1.00 23.61  ? 76  LEU A CD1 1 
ATOM   551  C CD2 . LEU A 1 76  ? 26.366 19.737  -62.416 1.00 22.33  ? 76  LEU A CD2 1 
ATOM   552  N N   . ARG A 1 77  ? 23.066 18.799  -66.594 1.00 25.21  ? 77  ARG A N   1 
ATOM   553  C CA  . ARG A 1 77  ? 22.211 19.385  -67.628 1.00 26.72  ? 77  ARG A CA  1 
ATOM   554  C C   . ARG A 1 77  ? 20.738 19.420  -67.223 1.00 27.08  ? 77  ARG A C   1 
ATOM   555  O O   . ARG A 1 77  ? 20.028 20.405  -67.490 1.00 27.16  ? 77  ARG A O   1 
ATOM   556  C CB  . ARG A 1 77  ? 22.386 18.613  -68.938 1.00 28.26  ? 77  ARG A CB  1 
ATOM   557  C CG  . ARG A 1 77  ? 23.684 18.851  -69.582 1.00 29.10  ? 77  ARG A CG  1 
ATOM   558  C CD  . ARG A 1 77  ? 23.805 18.218  -70.957 1.00 29.82  ? 77  ARG A CD  1 
ATOM   559  N NE  . ARG A 1 77  ? 25.210 18.065  -71.249 1.00 31.31  ? 77  ARG A NE  1 
ATOM   560  C CZ  . ARG A 1 77  ? 25.863 16.922  -71.307 1.00 30.92  ? 77  ARG A CZ  1 
ATOM   561  N NH1 . ARG A 1 77  ? 25.241 15.778  -71.151 1.00 33.16  ? 77  ARG A NH1 1 
ATOM   562  N NH2 . ARG A 1 77  ? 27.165 16.933  -71.527 1.00 32.16  ? 77  ARG A NH2 1 
ATOM   563  N N   . ARG A 1 78  ? 20.270 18.374  -66.546 1.00 27.38  ? 78  ARG A N   1 
ATOM   564  C CA  . ARG A 1 78  ? 18.906 18.359  -66.032 1.00 29.20  ? 78  ARG A CA  1 
ATOM   565  C C   . ARG A 1 78  ? 18.603 19.544  -65.134 1.00 28.60  ? 78  ARG A C   1 
ATOM   566  O O   . ARG A 1 78  ? 17.467 19.972  -65.044 1.00 29.04  ? 78  ARG A O   1 
ATOM   567  C CB  . ARG A 1 78  ? 18.608 17.079  -65.256 1.00 31.83  ? 78  ARG A CB  1 
ATOM   568  C CG  . ARG A 1 78  ? 18.591 15.834  -66.084 1.00 33.63  ? 78  ARG A CG  1 
ATOM   569  C CD  . ARG A 1 78  ? 17.907 14.655  -65.405 1.00 35.10  ? 78  ARG A CD  1 
ATOM   570  N NE  . ARG A 1 78  ? 18.425 14.404  -64.050 1.00 36.49  ? 78  ARG A NE  1 
ATOM   571  C CZ  . ARG A 1 78  ? 17.805 14.753  -62.929 1.00 36.99  ? 78  ARG A CZ  1 
ATOM   572  N NH1 . ARG A 1 78  ? 16.610 15.344  -62.977 1.00 38.43  ? 78  ARG A NH1 1 
ATOM   573  N NH2 . ARG A 1 78  ? 18.352 14.471  -61.752 1.00 37.17  ? 78  ARG A NH2 1 
ATOM   574  N N   . TYR A 1 79  ? 19.624 20.086  -64.464 1.00 28.46  ? 79  TYR A N   1 
ATOM   575  C CA  . TYR A 1 79  ? 19.435 21.190  -63.551 1.00 27.88  ? 79  TYR A CA  1 
ATOM   576  C C   . TYR A 1 79  ? 19.784 22.502  -64.220 1.00 28.80  ? 79  TYR A C   1 
ATOM   577  O O   . TYR A 1 79  ? 19.880 23.535  -63.554 1.00 29.48  ? 79  TYR A O   1 
ATOM   578  C CB  . TYR A 1 79  ? 20.294 20.977  -62.280 1.00 27.16  ? 79  TYR A CB  1 
ATOM   579  C CG  . TYR A 1 79  ? 19.708 19.891  -61.432 1.00 26.60  ? 79  TYR A CG  1 
ATOM   580  C CD1 . TYR A 1 79  ? 20.104 18.584  -61.587 1.00 26.45  ? 79  TYR A CD1 1 
ATOM   581  C CD2 . TYR A 1 79  ? 18.692 20.167  -60.546 1.00 25.95  ? 79  TYR A CD2 1 
ATOM   582  C CE1 . TYR A 1 79  ? 19.514 17.579  -60.880 1.00 26.91  ? 79  TYR A CE1 1 
ATOM   583  C CE2 . TYR A 1 79  ? 18.124 19.186  -59.802 1.00 27.08  ? 79  TYR A CE2 1 
ATOM   584  C CZ  . TYR A 1 79  ? 18.531 17.889  -59.982 1.00 26.84  ? 79  TYR A CZ  1 
ATOM   585  O OH  . TYR A 1 79  ? 17.957 16.900  -59.236 1.00 28.06  ? 79  TYR A OH  1 
ATOM   586  N N   . SER A 1 80  ? 20.002 22.450  -65.530 1.00 29.37  ? 80  SER A N   1 
ATOM   587  C CA  . SER A 1 80  ? 20.418 23.602  -66.312 1.00 29.67  ? 80  SER A CA  1 
ATOM   588  C C   . SER A 1 80  ? 21.700 24.257  -65.790 1.00 29.83  ? 80  SER A C   1 
ATOM   589  O O   . SER A 1 80  ? 21.867 25.463  -65.895 1.00 27.54  ? 80  SER A O   1 
ATOM   590  C CB  . SER A 1 80  ? 19.298 24.642  -66.355 1.00 31.63  ? 80  SER A CB  1 
ATOM   591  O OG  . SER A 1 80  ? 18.132 24.130  -66.972 1.00 34.01  ? 80  SER A OG  1 
ATOM   592  N N   . VAL A 1 81  ? 22.604 23.471  -65.225 1.00 28.35  ? 81  VAL A N   1 
ATOM   593  C CA  . VAL A 1 81  ? 23.892 23.994  -64.832 1.00 28.58  ? 81  VAL A CA  1 
ATOM   594  C C   . VAL A 1 81  ? 24.766 24.143  -66.062 1.00 29.55  ? 81  VAL A C   1 
ATOM   595  O O   . VAL A 1 81  ? 24.944 23.193  -66.812 1.00 30.06  ? 81  VAL A O   1 
ATOM   596  C CB  . VAL A 1 81  ? 24.580 23.055  -63.837 1.00 27.19  ? 81  VAL A CB  1 
ATOM   597  C CG1 . VAL A 1 81  ? 25.956 23.590  -63.444 1.00 27.02  ? 81  VAL A CG1 1 
ATOM   598  C CG2 . VAL A 1 81  ? 23.701 22.868  -62.646 1.00 26.25  ? 81  VAL A CG2 1 
ATOM   599  N N   . ASP A 1 82  ? 25.317 25.338  -66.260 1.00 30.87  ? 82  ASP A N   1 
ATOM   600  C CA  . ASP A 1 82  ? 26.194 25.629  -67.381 1.00 31.09  ? 82  ASP A CA  1 
ATOM   601  C C   . ASP A 1 82  ? 27.520 24.899  -67.242 1.00 30.94  ? 82  ASP A C   1 
ATOM   602  O O   . ASP A 1 82  ? 28.194 25.030  -66.223 1.00 31.74  ? 82  ASP A O   1 
ATOM   603  C CB  . ASP A 1 82  ? 26.438 27.144  -67.463 1.00 33.19  ? 82  ASP A CB  1 
ATOM   604  C CG  . ASP A 1 82  ? 27.201 27.561  -68.709 1.00 34.51  ? 82  ASP A CG  1 
ATOM   605  O OD1 . ASP A 1 82  ? 27.971 26.782  -69.292 1.00 38.67  ? 82  ASP A OD1 1 
ATOM   606  O OD2 . ASP A 1 82  ? 27.107 28.701  -69.188 1.00 38.01  ? 82  ASP A OD2 1 
ATOM   607  N N   . LEU A 1 83  ? 27.904 24.155  -68.278 1.00 29.20  ? 83  LEU A N   1 
ATOM   608  C CA  . LEU A 1 83  ? 29.095 23.315  -68.243 1.00 29.35  ? 83  LEU A CA  1 
ATOM   609  C C   . LEU A 1 83  ? 30.165 23.731  -69.252 1.00 28.38  ? 83  LEU A C   1 
ATOM   610  O O   . LEU A 1 83  ? 31.057 22.971  -69.571 1.00 26.94  ? 83  LEU A O   1 
ATOM   611  C CB  . LEU A 1 83  ? 28.699 21.864  -68.499 1.00 29.99  ? 83  LEU A CB  1 
ATOM   612  C CG  . LEU A 1 83  ? 27.621 21.327  -67.568 1.00 30.78  ? 83  LEU A CG  1 
ATOM   613  C CD1 . LEU A 1 83  ? 27.163 19.956  -68.028 1.00 31.03  ? 83  LEU A CD1 1 
ATOM   614  C CD2 . LEU A 1 83  ? 28.184 21.292  -66.147 1.00 31.29  ? 83  LEU A CD2 1 
ATOM   615  N N   . ARG A 1 84  ? 30.069 24.965  -69.730 1.00 29.34  ? 84  ARG A N   1 
ATOM   616  C CA  . ARG A 1 84  ? 31.061 25.542  -70.636 1.00 29.81  ? 84  ARG A CA  1 
ATOM   617  C C   . ARG A 1 84  ? 32.514 25.351  -70.189 1.00 28.41  ? 84  ARG A C   1 
ATOM   618  O O   . ARG A 1 84  ? 33.411 25.177  -71.006 1.00 26.38  ? 84  ARG A O   1 
ATOM   619  C CB  . ARG A 1 84  ? 30.749 27.034  -70.708 1.00 30.89  ? 84  ARG A CB  1 
ATOM   620  C CG  . ARG A 1 84  ? 31.707 27.859  -71.436 1.00 33.42  ? 84  ARG A CG  1 
ATOM   621  C CD  . ARG A 1 84  ? 31.298 29.310  -71.409 1.00 34.02  ? 84  ARG A CD  1 
ATOM   622  N NE  . ARG A 1 84  ? 32.231 30.145  -72.151 1.00 36.39  ? 84  ARG A NE  1 
ATOM   623  C CZ  . ARG A 1 84  ? 32.136 31.469  -72.206 1.00 35.87  ? 84  ARG A CZ  1 
ATOM   624  N NH1 . ARG A 1 84  ? 31.154 32.086  -71.573 1.00 35.83  ? 84  ARG A NH1 1 
ATOM   625  N NH2 . ARG A 1 84  ? 33.036 32.160  -72.883 1.00 37.30  ? 84  ARG A NH2 1 
ATOM   626  N N   . TYR A 1 85  ? 32.749 25.396  -68.878 1.00 27.50  ? 85  TYR A N   1 
ATOM   627  C CA  . TYR A 1 85  ? 34.101 25.351  -68.354 1.00 27.88  ? 85  TYR A CA  1 
ATOM   628  C C   . TYR A 1 85  ? 34.534 23.983  -67.845 1.00 28.62  ? 85  TYR A C   1 
ATOM   629  O O   . TYR A 1 85  ? 35.565 23.853  -67.181 1.00 29.13  ? 85  TYR A O   1 
ATOM   630  C CB  . TYR A 1 85  ? 34.246 26.410  -67.270 1.00 28.54  ? 85  TYR A CB  1 
ATOM   631  C CG  . TYR A 1 85  ? 34.132 27.795  -67.852 1.00 28.35  ? 85  TYR A CG  1 
ATOM   632  C CD1 . TYR A 1 85  ? 33.094 28.637  -67.514 1.00 27.94  ? 85  TYR A CD1 1 
ATOM   633  C CD2 . TYR A 1 85  ? 35.056 28.232  -68.789 1.00 28.79  ? 85  TYR A CD2 1 
ATOM   634  C CE1 . TYR A 1 85  ? 32.986 29.926  -68.098 1.00 28.85  ? 85  TYR A CE1 1 
ATOM   635  C CE2 . TYR A 1 85  ? 34.955 29.478  -69.364 1.00 28.67  ? 85  TYR A CE2 1 
ATOM   636  C CZ  . TYR A 1 85  ? 33.926 30.325  -69.014 1.00 28.43  ? 85  TYR A CZ  1 
ATOM   637  O OH  . TYR A 1 85  ? 33.870 31.595  -69.598 1.00 29.73  ? 85  TYR A OH  1 
ATOM   638  N N   . THR A 1 86  ? 33.760 22.955  -68.181 1.00 28.15  ? 86  THR A N   1 
ATOM   639  C CA  . THR A 1 86  ? 34.203 21.591  -67.934 1.00 27.75  ? 86  THR A CA  1 
ATOM   640  C C   . THR A 1 86  ? 35.606 21.379  -68.471 1.00 28.50  ? 86  THR A C   1 
ATOM   641  O O   . THR A 1 86  ? 35.858 21.581  -69.662 1.00 30.08  ? 86  THR A O   1 
ATOM   642  C CB  . THR A 1 86  ? 33.253 20.588  -68.589 1.00 26.45  ? 86  THR A CB  1 
ATOM   643  O OG1 . THR A 1 86  ? 31.916 20.751  -68.088 1.00 25.13  ? 86  THR A OG1 1 
ATOM   644  C CG2 . THR A 1 86  ? 33.642 19.175  -68.215 1.00 27.70  ? 86  THR A CG2 1 
ATOM   645  N N   . VAL A 1 87  ? 36.523 20.958  -67.609 1.00 26.92  ? 87  VAL A N   1 
ATOM   646  C CA  . VAL A 1 87  ? 37.876 20.663  -68.038 1.00 27.78  ? 87  VAL A CA  1 
ATOM   647  C C   . VAL A 1 87  ? 38.073 19.171  -68.356 1.00 28.69  ? 87  VAL A C   1 
ATOM   648  O O   . VAL A 1 87  ? 38.324 18.353  -67.468 1.00 27.04  ? 87  VAL A O   1 
ATOM   649  C CB  . VAL A 1 87  ? 38.909 21.134  -67.013 1.00 27.60  ? 87  VAL A CB  1 
ATOM   650  C CG1 . VAL A 1 87  ? 40.325 20.878  -67.517 1.00 28.67  ? 87  VAL A CG1 1 
ATOM   651  C CG2 . VAL A 1 87  ? 38.722 22.638  -66.729 1.00 27.61  ? 87  VAL A CG2 1 
ATOM   652  N N   . PHE A 1 88  ? 38.003 18.822  -69.644 1.00 29.17  ? 88  PHE A N   1 
ATOM   653  C CA  . PHE A 1 88  ? 38.211 17.429  -70.045 1.00 29.55  ? 88  PHE A CA  1 
ATOM   654  C C   . PHE A 1 88  ? 39.645 16.974  -69.928 1.00 29.82  ? 88  PHE A C   1 
ATOM   655  O O   . PHE A 1 88  ? 40.579 17.683  -70.310 1.00 30.85  ? 88  PHE A O   1 
ATOM   656  C CB  . PHE A 1 88  ? 37.634 17.172  -71.439 1.00 29.97  ? 88  PHE A CB  1 
ATOM   657  C CG  . PHE A 1 88  ? 36.184 17.259  -71.453 1.00 29.53  ? 88  PHE A CG  1 
ATOM   658  C CD1 . PHE A 1 88  ? 35.565 18.462  -71.693 1.00 28.90  ? 88  PHE A CD1 1 
ATOM   659  C CD2 . PHE A 1 88  ? 35.418 16.160  -71.128 1.00 29.74  ? 88  PHE A CD2 1 
ATOM   660  C CE1 . PHE A 1 88  ? 34.211 18.560  -71.642 1.00 30.35  ? 88  PHE A CE1 1 
ATOM   661  C CE2 . PHE A 1 88  ? 34.067 16.254  -71.080 1.00 29.59  ? 88  PHE A CE2 1 
ATOM   662  C CZ  . PHE A 1 88  ? 33.454 17.454  -71.339 1.00 30.04  ? 88  PHE A CZ  1 
ATOM   663  N N   . GLN A 1 89  ? 39.822 15.802  -69.328 1.00 28.19  ? 89  GLN A N   1 
ATOM   664  C CA  . GLN A 1 89  ? 41.126 15.260  -69.052 1.00 29.57  ? 89  GLN A CA  1 
ATOM   665  C C   . GLN A 1 89  ? 41.293 14.016  -69.906 1.00 30.76  ? 89  GLN A C   1 
ATOM   666  O O   . GLN A 1 89  ? 40.384 13.194  -70.007 1.00 31.50  ? 89  GLN A O   1 
ATOM   667  C CB  . GLN A 1 89  ? 41.258 14.902  -67.579 1.00 28.86  ? 89  GLN A CB  1 
ATOM   668  C CG  . GLN A 1 89  ? 40.960 16.077  -66.633 1.00 28.68  ? 89  GLN A CG  1 
ATOM   669  C CD  . GLN A 1 89  ? 41.998 17.187  -66.664 1.00 29.62  ? 89  GLN A CD  1 
ATOM   670  O OE1 . GLN A 1 89  ? 43.063 17.042  -67.269 1.00 31.07  ? 89  GLN A OE1 1 
ATOM   671  N NE2 . GLN A 1 89  ? 41.698 18.296  -66.001 1.00 28.13  ? 89  GLN A NE2 1 
ATOM   672  N N   . THR A 1 90  ? 42.443 13.870  -70.539 1.00 33.01  ? 90  THR A N   1 
ATOM   673  C CA  . THR A 1 90  ? 42.643 12.688  -71.375 1.00 33.64  ? 90  THR A CA  1 
ATOM   674  C C   . THR A 1 90  ? 43.215 11.536  -70.563 1.00 34.37  ? 90  THR A C   1 
ATOM   675  O O   . THR A 1 90  ? 43.422 10.467  -71.112 1.00 36.53  ? 90  THR A O   1 
ATOM   676  C CB  . THR A 1 90  ? 43.552 13.023  -72.562 1.00 33.20  ? 90  THR A CB  1 
ATOM   677  O OG1 . THR A 1 90  ? 44.738 13.630  -72.068 1.00 33.52  ? 90  THR A OG1 1 
ATOM   678  C CG2 . THR A 1 90  ? 42.914 14.089  -73.431 1.00 34.10  ? 90  THR A CG2 1 
ATOM   679  N N   . THR A 1 91  ? 43.482 11.754  -69.271 1.00 34.92  ? 91  THR A N   1 
ATOM   680  C CA  . THR A 1 91  ? 43.819 10.680  -68.330 1.00 34.98  ? 91  THR A CA  1 
ATOM   681  C C   . THR A 1 91  ? 42.986 10.706  -67.033 1.00 35.21  ? 91  THR A C   1 
ATOM   682  O O   . THR A 1 91  ? 42.484 11.753  -66.617 1.00 35.55  ? 91  THR A O   1 
ATOM   683  C CB  . THR A 1 91  ? 45.266 10.779  -67.880 1.00 36.99  ? 91  THR A CB  1 
ATOM   684  O OG1 . THR A 1 91  ? 45.437 11.981  -67.116 1.00 37.65  ? 91  THR A OG1 1 
ATOM   685  C CG2 . THR A 1 91  ? 46.227 10.910  -69.077 1.00 37.89  ? 91  THR A CG2 1 
ATOM   686  N N   . GLY A 1 92  ? 42.934 9.561   -66.363 1.00 33.89  ? 92  GLY A N   1 
ATOM   687  C CA  . GLY A 1 92  ? 42.269 9.441   -65.050 1.00 32.43  ? 92  GLY A CA  1 
ATOM   688  C C   . GLY A 1 92  ? 40.803 9.149   -65.219 1.00 30.70  ? 92  GLY A C   1 
ATOM   689  O O   . GLY A 1 92  ? 40.305 9.013   -66.340 1.00 31.46  ? 92  GLY A O   1 
ATOM   690  N N   . SER A 1 93  ? 40.080 9.038   -64.107 1.00 29.14  ? 93  SER A N   1 
ATOM   691  C CA  . SER A 1 93  ? 38.658 8.766   -64.185 1.00 27.47  ? 93  SER A CA  1 
ATOM   692  C C   . SER A 1 93  ? 37.877 9.598   -63.168 1.00 24.25  ? 93  SER A C   1 
ATOM   693  O O   . SER A 1 93  ? 38.444 10.073  -62.195 1.00 24.39  ? 93  SER A O   1 
ATOM   694  C CB  . SER A 1 93  ? 38.409 7.279   -63.938 1.00 29.02  ? 93  SER A CB  1 
ATOM   695  O OG  . SER A 1 93  ? 38.778 6.926   -62.619 1.00 30.62  ? 93  SER A OG  1 
ATOM   696  N N   . VAL A 1 94  ? 36.583 9.734   -63.395 1.00 23.23  ? 94  VAL A N   1 
ATOM   697  C CA  . VAL A 1 94  ? 35.679 10.375  -62.417 1.00 23.58  ? 94  VAL A CA  1 
ATOM   698  C C   . VAL A 1 94  ? 35.773 9.637   -61.078 1.00 24.28  ? 94  VAL A C   1 
ATOM   699  O O   . VAL A 1 94  ? 35.657 8.403   -61.008 1.00 23.62  ? 94  VAL A O   1 
ATOM   700  C CB  . VAL A 1 94  ? 34.211 10.389  -62.926 1.00 24.79  ? 94  VAL A CB  1 
ATOM   701  C CG1 . VAL A 1 94  ? 33.297 11.021  -61.911 1.00 24.77  ? 94  VAL A CG1 1 
ATOM   702  C CG2 . VAL A 1 94  ? 34.063 11.133  -64.264 1.00 25.09  ? 94  VAL A CG2 1 
ATOM   703  N N   . PRO A 1 95  ? 35.973 10.358  -59.979 1.00 24.07  ? 95  PRO A N   1 
ATOM   704  C CA  . PRO A 1 95  ? 36.085 9.709   -58.705 1.00 23.48  ? 95  PRO A CA  1 
ATOM   705  C C   . PRO A 1 95  ? 34.783 9.040   -58.311 1.00 23.01  ? 95  PRO A C   1 
ATOM   706  O O   . PRO A 1 95  ? 33.723 9.509   -58.671 1.00 24.11  ? 95  PRO A O   1 
ATOM   707  C CB  . PRO A 1 95  ? 36.376 10.855  -57.720 1.00 24.27  ? 95  PRO A CB  1 
ATOM   708  C CG  . PRO A 1 95  ? 36.323 12.066  -58.454 1.00 24.65  ? 95  PRO A CG  1 
ATOM   709  C CD  . PRO A 1 95  ? 36.076 11.824  -59.876 1.00 25.13  ? 95  PRO A CD  1 
ATOM   710  N N   . ILE A 1 96  ? 34.908 7.969   -57.554 1.00 24.78  ? 96  ILE A N   1 
ATOM   711  C CA  . ILE A 1 96  ? 33.775 7.231   -56.996 1.00 24.68  ? 96  ILE A CA  1 
ATOM   712  C C   . ILE A 1 96  ? 33.790 7.359   -55.502 1.00 24.50  ? 96  ILE A C   1 
ATOM   713  O O   . ILE A 1 96  ? 34.852 7.293   -54.874 1.00 27.06  ? 96  ILE A O   1 
ATOM   714  C CB  . ILE A 1 96  ? 33.916 5.736   -57.317 1.00 25.87  ? 96  ILE A CB  1 
ATOM   715  C CG1 . ILE A 1 96  ? 34.039 5.535   -58.809 1.00 27.10  ? 96  ILE A CG1 1 
ATOM   716  C CG2 . ILE A 1 96  ? 32.753 4.934   -56.694 1.00 25.74  ? 96  ILE A CG2 1 
ATOM   717  C CD1 . ILE A 1 96  ? 33.068 6.313   -59.601 1.00 28.37  ? 96  ILE A CD1 1 
ATOM   718  N N   . ALA A 1 97  ? 32.615 7.485   -54.912 1.00 21.56  ? 97  ALA A N   1 
ATOM   719  C CA  . ALA A 1 97  ? 32.514 7.393   -53.482 1.00 20.87  ? 97  ALA A CA  1 
ATOM   720  C C   . ALA A 1 97  ? 31.502 6.320   -53.176 1.00 20.74  ? 97  ALA A C   1 
ATOM   721  O O   . ALA A 1 97  ? 30.401 6.303   -53.729 1.00 20.61  ? 97  ALA A O   1 
ATOM   722  C CB  . ALA A 1 97  ? 32.073 8.675   -52.881 1.00 20.77  ? 97  ALA A CB  1 
ATOM   723  N N   . THR A 1 98  ? 31.888 5.427   -52.285 1.00 18.57  ? 98  THR A N   1 
ATOM   724  C CA  . THR A 1 98  ? 31.001 4.359   -51.841 1.00 18.77  ? 98  THR A CA  1 
ATOM   725  C C   . THR A 1 98  ? 30.287 4.881   -50.598 1.00 19.79  ? 98  THR A C   1 
ATOM   726  O O   . THR A 1 98  ? 30.945 5.197   -49.603 1.00 19.33  ? 98  THR A O   1 
ATOM   727  C CB  . THR A 1 98  ? 31.832 3.121   -51.525 1.00 20.13  ? 98  THR A CB  1 
ATOM   728  O OG1 . THR A 1 98  ? 32.395 2.605   -52.740 1.00 19.63  ? 98  THR A OG1 1 
ATOM   729  C CG2 . THR A 1 98  ? 30.967 1.998   -50.960 1.00 20.05  ? 98  THR A CG2 1 
ATOM   730  N N   . VAL A 1 99  ? 28.967 5.017   -50.679 1.00 19.24  ? 99  VAL A N   1 
ATOM   731  C CA  . VAL A 1 99  ? 28.202 5.655   -49.605 1.00 20.39  ? 99  VAL A CA  1 
ATOM   732  C C   . VAL A 1 99  ? 27.214 4.692   -48.984 1.00 21.26  ? 99  VAL A C   1 
ATOM   733  O O   . VAL A 1 99  ? 26.354 4.149   -49.656 1.00 22.60  ? 99  VAL A O   1 
ATOM   734  C CB  . VAL A 1 99  ? 27.427 6.895   -50.101 1.00 20.97  ? 99  VAL A CB  1 
ATOM   735  C CG1 . VAL A 1 99  ? 26.774 7.593   -48.894 1.00 21.67  ? 99  VAL A CG1 1 
ATOM   736  C CG2 . VAL A 1 99  ? 28.349 7.856   -50.834 1.00 21.11  ? 99  VAL A CG2 1 
ATOM   737  N N   . ILE A 1 100 ? 27.338 4.489   -47.674 1.00 21.88  ? 100 ILE A N   1 
ATOM   738  C CA  . ILE A 1 100 ? 26.409 3.681   -46.926 1.00 22.77  ? 100 ILE A CA  1 
ATOM   739  C C   . ILE A 1 100 ? 25.447 4.619   -46.207 1.00 22.75  ? 100 ILE A C   1 
ATOM   740  O O   . ILE A 1 100 ? 25.898 5.440   -45.409 1.00 22.03  ? 100 ILE A O   1 
ATOM   741  C CB  . ILE A 1 100 ? 27.165 2.855   -45.881 1.00 23.65  ? 100 ILE A CB  1 
ATOM   742  C CG1 . ILE A 1 100 ? 28.193 1.946   -46.565 1.00 24.58  ? 100 ILE A CG1 1 
ATOM   743  C CG2 . ILE A 1 100 ? 26.168 2.046   -45.064 1.00 24.59  ? 100 ILE A CG2 1 
ATOM   744  C CD1 . ILE A 1 100 ? 29.087 1.191   -45.603 1.00 24.81  ? 100 ILE A CD1 1 
ATOM   745  N N   . ILE A 1 101 ? 24.158 4.500   -46.505 1.00 25.00  ? 101 ILE A N   1 
ATOM   746  C CA  . ILE A 1 101 ? 23.125 5.259   -45.792 1.00 26.40  ? 101 ILE A CA  1 
ATOM   747  C C   . ILE A 1 101 ? 22.317 4.332   -44.895 1.00 26.76  ? 101 ILE A C   1 
ATOM   748  O O   . ILE A 1 101 ? 21.804 3.325   -45.330 1.00 26.15  ? 101 ILE A O   1 
ATOM   749  C CB  . ILE A 1 101 ? 22.230 6.039   -46.767 1.00 26.99  ? 101 ILE A CB  1 
ATOM   750  C CG1 . ILE A 1 101 ? 23.106 7.093   -47.468 1.00 27.73  ? 101 ILE A CG1 1 
ATOM   751  C CG2 . ILE A 1 101 ? 21.024 6.706   -46.016 1.00 26.74  ? 101 ILE A CG2 1 
ATOM   752  C CD1 . ILE A 1 101 ? 22.408 7.966   -48.401 1.00 28.82  ? 101 ILE A CD1 1 
ATOM   753  N N   . ASN A 1 102 ? 22.240 4.678   -43.623 1.00 28.80  ? 102 ASN A N   1 
ATOM   754  C CA  . ASN A 1 102 ? 21.462 3.892   -42.657 1.00 30.55  ? 102 ASN A CA  1 
ATOM   755  C C   . ASN A 1 102 ? 20.004 4.378   -42.699 1.00 31.84  ? 102 ASN A C   1 
ATOM   756  O O   . ASN A 1 102 ? 19.705 5.521   -42.366 1.00 33.27  ? 102 ASN A O   1 
ATOM   757  C CB  . ASN A 1 102 ? 22.112 4.003   -41.261 1.00 30.36  ? 102 ASN A CB  1 
ATOM   758  C CG  . ASN A 1 102 ? 21.383 3.191   -40.198 1.00 29.18  ? 102 ASN A CG  1 
ATOM   759  O OD1 . ASN A 1 102 ? 20.348 2.624   -40.461 1.00 31.31  ? 102 ASN A OD1 1 
ATOM   760  N ND2 . ASN A 1 102 ? 21.950 3.123   -39.006 1.00 30.09  ? 102 ASN A ND2 1 
ATOM   761  N N   . GLU A 1 103 ? 19.108 3.526   -43.179 1.00 35.02  ? 103 GLU A N   1 
ATOM   762  C CA  . GLU A 1 103 ? 17.692 3.896   -43.338 1.00 36.72  ? 103 GLU A CA  1 
ATOM   763  C C   . GLU A 1 103 ? 17.127 4.347   -41.996 1.00 37.89  ? 103 GLU A C   1 
ATOM   764  O O   . GLU A 1 103 ? 16.340 5.286   -41.928 1.00 40.22  ? 103 GLU A O   1 
ATOM   765  C CB  . GLU A 1 103 ? 16.881 2.707   -43.847 1.00 37.45  ? 103 GLU A CB  1 
ATOM   766  C CG  . GLU A 1 103 ? 15.501 3.063   -44.384 1.00 38.36  ? 103 GLU A CG  1 
ATOM   767  C CD  . GLU A 1 103 ? 14.600 1.855   -44.534 1.00 40.03  ? 103 GLU A CD  1 
ATOM   768  O OE1 . GLU A 1 103 ? 14.740 0.903   -43.717 1.00 42.63  ? 103 GLU A OE1 1 
ATOM   769  O OE2 . GLU A 1 103 ? 13.754 1.852   -45.467 1.00 41.75  ? 103 GLU A OE2 1 
ATOM   770  N N   . ALA A 1 104 ? 17.564 3.684   -40.933 1.00 38.80  ? 104 ALA A N   1 
ATOM   771  C CA  . ALA A 1 104 ? 17.083 3.958   -39.581 1.00 38.78  ? 104 ALA A CA  1 
ATOM   772  C C   . ALA A 1 104 ? 17.370 5.396   -39.138 1.00 39.16  ? 104 ALA A C   1 
ATOM   773  O O   . ALA A 1 104 ? 16.486 6.035   -38.560 1.00 39.61  ? 104 ALA A O   1 
ATOM   774  C CB  . ALA A 1 104 ? 17.694 2.967   -38.596 1.00 39.53  ? 104 ALA A CB  1 
ATOM   775  N N   . SER A 1 105 ? 18.581 5.896   -39.415 1.00 37.75  ? 105 SER A N   1 
ATOM   776  C CA  . SER A 1 105 ? 19.035 7.210   -38.926 1.00 36.65  ? 105 SER A CA  1 
ATOM   777  C C   . SER A 1 105 ? 19.224 8.314   -39.983 1.00 36.79  ? 105 SER A C   1 
ATOM   778  O O   . SER A 1 105 ? 19.278 9.505   -39.656 1.00 35.47  ? 105 SER A O   1 
ATOM   779  C CB  . SER A 1 105 ? 20.362 7.039   -38.202 1.00 37.35  ? 105 SER A CB  1 
ATOM   780  O OG  . SER A 1 105 ? 21.404 6.692   -39.107 1.00 37.65  ? 105 SER A OG  1 
ATOM   781  N N   . GLY A 1 106 ? 19.372 7.920   -41.244 1.00 35.66  ? 106 GLY A N   1 
ATOM   782  C CA  . GLY A 1 106 ? 19.743 8.854   -42.292 1.00 33.68  ? 106 GLY A CA  1 
ATOM   783  C C   . GLY A 1 106 ? 21.229 9.164   -42.328 1.00 32.05  ? 106 GLY A C   1 
ATOM   784  O O   . GLY A 1 106 ? 21.662 9.981   -43.127 1.00 32.76  ? 106 GLY A O   1 
ATOM   785  N N   . SER A 1 107 ? 22.023 8.517   -41.482 1.00 30.78  ? 107 SER A N   1 
ATOM   786  C CA  . SER A 1 107 ? 23.455 8.761   -41.458 1.00 30.06  ? 107 SER A CA  1 
ATOM   787  C C   . SER A 1 107 ? 24.020 8.381   -42.828 1.00 29.38  ? 107 SER A C   1 
ATOM   788  O O   . SER A 1 107 ? 23.455 7.521   -43.500 1.00 27.47  ? 107 SER A O   1 
ATOM   789  C CB  . SER A 1 107 ? 24.159 7.903   -40.412 1.00 30.62  ? 107 SER A CB  1 
ATOM   790  O OG  . SER A 1 107 ? 24.116 6.523   -40.765 1.00 30.33  ? 107 SER A OG  1 
ATOM   791  N N   . ARG A 1 108 ? 25.113 9.032   -43.218 1.00 29.15  ? 108 ARG A N   1 
ATOM   792  C CA  . ARG A 1 108 ? 25.824 8.662   -44.439 1.00 28.35  ? 108 ARG A CA  1 
ATOM   793  C C   . ARG A 1 108 ? 27.270 8.455   -44.072 1.00 27.45  ? 108 ARG A C   1 
ATOM   794  O O   . ARG A 1 108 ? 27.876 9.273   -43.400 1.00 28.46  ? 108 ARG A O   1 
ATOM   795  C CB  . ARG A 1 108 ? 25.643 9.727   -45.543 1.00 28.26  ? 108 ARG A CB  1 
ATOM   796  C CG  . ARG A 1 108 ? 26.706 10.781  -45.663 1.00 28.50  ? 108 ARG A CG  1 
ATOM   797  C CD  . ARG A 1 108 ? 26.627 11.832  -44.631 1.00 29.13  ? 108 ARG A CD  1 
ATOM   798  N NE  . ARG A 1 108 ? 27.667 12.842  -44.795 1.00 28.85  ? 108 ARG A NE  1 
ATOM   799  C CZ  . ARG A 1 108 ? 28.851 12.811  -44.222 1.00 27.68  ? 108 ARG A CZ  1 
ATOM   800  N NH1 . ARG A 1 108 ? 29.243 11.777  -43.493 1.00 28.59  ? 108 ARG A NH1 1 
ATOM   801  N NH2 . ARG A 1 108 ? 29.676 13.797  -44.435 1.00 28.10  ? 108 ARG A NH2 1 
ATOM   802  N N   . THR A 1 109 ? 27.815 7.330   -44.506 1.00 25.94  ? 109 THR A N   1 
ATOM   803  C CA  . THR A 1 109 ? 29.175 6.959   -44.219 1.00 25.06  ? 109 THR A CA  1 
ATOM   804  C C   . THR A 1 109 ? 29.864 6.809   -45.571 1.00 25.31  ? 109 THR A C   1 
ATOM   805  O O   . THR A 1 109 ? 29.388 6.060   -46.404 1.00 22.87  ? 109 THR A O   1 
ATOM   806  C CB  . THR A 1 109 ? 29.176 5.640   -43.433 1.00 25.82  ? 109 THR A CB  1 
ATOM   807  O OG1 . THR A 1 109 ? 28.446 5.822   -42.205 1.00 24.71  ? 109 THR A OG1 1 
ATOM   808  C CG2 . THR A 1 109 ? 30.583 5.243   -43.020 1.00 25.46  ? 109 THR A CG2 1 
ATOM   809  N N   . ILE A 1 110 ? 30.943 7.558   -45.784 1.00 24.66  ? 110 ILE A N   1 
ATOM   810  C CA  . ILE A 1 110 ? 31.538 7.691   -47.124 1.00 24.92  ? 110 ILE A CA  1 
ATOM   811  C C   . ILE A 1 110 ? 32.921 7.065   -47.221 1.00 24.62  ? 110 ILE A C   1 
ATOM   812  O O   . ILE A 1 110 ? 33.860 7.495   -46.546 1.00 24.77  ? 110 ILE A O   1 
ATOM   813  C CB  . ILE A 1 110 ? 31.607 9.161   -47.546 1.00 24.62  ? 110 ILE A CB  1 
ATOM   814  C CG1 . ILE A 1 110 ? 30.200 9.762   -47.589 1.00 24.42  ? 110 ILE A CG1 1 
ATOM   815  C CG2 . ILE A 1 110 ? 32.275 9.277   -48.919 1.00 24.82  ? 110 ILE A CG2 1 
ATOM   816  C CD1 . ILE A 1 110 ? 30.166 11.272  -47.759 1.00 25.45  ? 110 ILE A CD1 1 
ATOM   817  N N   . LEU A 1 111 ? 33.051 6.072   -48.097 1.00 23.32  ? 111 LEU A N   1 
ATOM   818  C CA  . LEU A 1 111 ? 34.350 5.508   -48.398 1.00 24.18  ? 111 LEU A CA  1 
ATOM   819  C C   . LEU A 1 111 ? 34.812 6.055   -49.745 1.00 24.70  ? 111 LEU A C   1 
ATOM   820  O O   . LEU A 1 111 ? 34.210 5.739   -50.768 1.00 22.65  ? 111 LEU A O   1 
ATOM   821  C CB  . LEU A 1 111 ? 34.311 3.989   -48.434 1.00 24.75  ? 111 LEU A CB  1 
ATOM   822  C CG  . LEU A 1 111 ? 33.583 3.149   -47.380 1.00 26.76  ? 111 LEU A CG  1 
ATOM   823  C CD1 . LEU A 1 111 ? 34.212 1.754   -47.234 1.00 26.95  ? 111 LEU A CD1 1 
ATOM   824  C CD2 . LEU A 1 111 ? 33.435 3.805   -46.076 1.00 27.67  ? 111 LEU A CD2 1 
ATOM   825  N N   . TYR A 1 112 ? 35.844 6.898   -49.738 1.00 25.29  ? 112 TYR A N   1 
ATOM   826  C CA  . TYR A 1 112 ? 36.305 7.498   -50.976 1.00 28.95  ? 112 TYR A CA  1 
ATOM   827  C C   . TYR A 1 112 ? 37.743 7.046   -51.276 1.00 28.84  ? 112 TYR A C   1 
ATOM   828  O O   . TYR A 1 112 ? 38.344 6.306   -50.528 1.00 28.18  ? 112 TYR A O   1 
ATOM   829  C CB  . TYR A 1 112 ? 36.158 9.016   -50.950 1.00 33.03  ? 112 TYR A CB  1 
ATOM   830  C CG  . TYR A 1 112 ? 36.988 9.722   -49.924 1.00 34.22  ? 112 TYR A CG  1 
ATOM   831  C CD1 . TYR A 1 112 ? 38.259 10.176  -50.228 1.00 35.14  ? 112 TYR A CD1 1 
ATOM   832  C CD2 . TYR A 1 112 ? 36.491 9.973   -48.648 1.00 35.62  ? 112 TYR A CD2 1 
ATOM   833  C CE1 . TYR A 1 112 ? 39.032 10.854  -49.279 1.00 34.92  ? 112 TYR A CE1 1 
ATOM   834  C CE2 . TYR A 1 112 ? 37.271 10.642  -47.691 1.00 35.12  ? 112 TYR A CE2 1 
ATOM   835  C CZ  . TYR A 1 112 ? 38.533 11.073  -48.027 1.00 34.71  ? 112 TYR A CZ  1 
ATOM   836  O OH  . TYR A 1 112 ? 39.311 11.747  -47.099 1.00 35.55  ? 112 TYR A OH  1 
ATOM   837  N N   . TYR A 1 113 ? 38.287 7.478   -52.386 1.00 31.04  ? 113 TYR A N   1 
ATOM   838  C CA  . TYR A 1 113 ? 39.528 6.902   -52.864 1.00 32.95  ? 113 TYR A CA  1 
ATOM   839  C C   . TYR A 1 113 ? 40.505 7.988   -53.276 1.00 34.98  ? 113 TYR A C   1 
ATOM   840  O O   . TYR A 1 113 ? 40.133 9.169   -53.383 1.00 35.50  ? 113 TYR A O   1 
ATOM   841  C CB  . TYR A 1 113 ? 39.208 5.961   -54.029 1.00 32.69  ? 113 TYR A CB  1 
ATOM   842  C CG  . TYR A 1 113 ? 38.172 4.954   -53.636 1.00 32.32  ? 113 TYR A CG  1 
ATOM   843  C CD1 . TYR A 1 113 ? 36.832 5.159   -53.922 1.00 32.46  ? 113 TYR A CD1 1 
ATOM   844  C CD2 . TYR A 1 113 ? 38.522 3.843   -52.874 1.00 31.95  ? 113 TYR A CD2 1 
ATOM   845  C CE1 . TYR A 1 113 ? 35.850 4.246   -53.493 1.00 32.35  ? 113 TYR A CE1 1 
ATOM   846  C CE2 . TYR A 1 113 ? 37.578 2.930   -52.462 1.00 32.65  ? 113 TYR A CE2 1 
ATOM   847  C CZ  . TYR A 1 113 ? 36.242 3.131   -52.774 1.00 32.39  ? 113 TYR A CZ  1 
ATOM   848  O OH  . TYR A 1 113 ? 35.304 2.226   -52.354 1.00 32.30  ? 113 TYR A OH  1 
ATOM   849  N N   . ASP A 1 114 ? 41.757 7.595   -53.492 1.00 36.02  ? 114 ASP A N   1 
ATOM   850  C CA  . ASP A 1 114 ? 42.759 8.500   -54.058 1.00 37.76  ? 114 ASP A CA  1 
ATOM   851  C C   . ASP A 1 114 ? 42.243 9.198   -55.327 1.00 38.43  ? 114 ASP A C   1 
ATOM   852  O O   . ASP A 1 114 ? 41.389 8.664   -56.053 1.00 38.26  ? 114 ASP A O   1 
ATOM   853  C CB  . ASP A 1 114 ? 44.051 7.738   -54.391 1.00 39.30  ? 114 ASP A CB  1 
ATOM   854  C CG  . ASP A 1 114 ? 44.815 7.291   -53.148 1.00 40.92  ? 114 ASP A CG  1 
ATOM   855  O OD1 . ASP A 1 114 ? 44.535 7.798   -52.037 1.00 42.08  ? 114 ASP A OD1 1 
ATOM   856  O OD2 . ASP A 1 114 ? 45.727 6.438   -53.194 1.00 42.70  ? 114 ASP A OD2 1 
ATOM   857  N N   . ARG A 1 115 ? 42.789 10.389  -55.573 1.00 39.59  ? 115 ARG A N   1 
ATOM   858  C CA  . ARG A 1 115 ? 42.444 11.213  -56.701 1.00 39.80  ? 115 ARG A CA  1 
ATOM   859  C C   . ARG A 1 115 ? 42.559 10.406  -57.979 1.00 39.09  ? 115 ARG A C   1 
ATOM   860  O O   . ARG A 1 115 ? 43.545 9.728   -58.214 1.00 39.88  ? 115 ARG A O   1 
ATOM   861  C CB  . ARG A 1 115 ? 43.373 12.433  -56.781 1.00 41.24  ? 115 ARG A CB  1 
ATOM   862  C CG  . ARG A 1 115 ? 43.154 13.272  -58.041 1.00 41.89  ? 115 ARG A CG  1 
ATOM   863  C CD  . ARG A 1 115 ? 43.778 14.681  -57.996 1.00 43.60  ? 115 ARG A CD  1 
ATOM   864  N NE  . ARG A 1 115 ? 45.199 14.604  -57.730 1.00 44.06  ? 115 ARG A NE  1 
ATOM   865  C CZ  . ARG A 1 115 ? 46.085 14.184  -58.618 1.00 45.68  ? 115 ARG A CZ  1 
ATOM   866  N NH1 . ARG A 1 115 ? 45.693 13.830  -59.841 1.00 46.58  ? 115 ARG A NH1 1 
ATOM   867  N NH2 . ARG A 1 115 ? 47.371 14.118  -58.297 1.00 45.98  ? 115 ARG A NH2 1 
ATOM   868  N N   . SER A 1 116 ? 41.544 10.490  -58.818 1.00 38.29  ? 116 SER A N   1 
ATOM   869  C CA  . SER A 1 116 ? 41.451 9.584   -59.954 1.00 37.04  ? 116 SER A CA  1 
ATOM   870  C C   . SER A 1 116 ? 41.650 10.310  -61.275 1.00 35.84  ? 116 SER A C   1 
ATOM   871  O O   . SER A 1 116 ? 41.597 9.658   -62.318 1.00 34.47  ? 116 SER A O   1 
ATOM   872  C CB  . SER A 1 116 ? 40.076 8.925   -59.947 1.00 37.70  ? 116 SER A CB  1 
ATOM   873  O OG  . SER A 1 116 ? 39.084 9.931   -60.022 1.00 38.22  ? 116 SER A OG  1 
ATOM   874  N N   . LEU A 1 117 ? 41.858 11.639  -61.220 1.00 32.33  ? 117 LEU A N   1 
ATOM   875  C CA  . LEU A 1 117 ? 42.039 12.462  -62.407 1.00 32.18  ? 117 LEU A CA  1 
ATOM   876  C C   . LEU A 1 117 ? 42.612 13.836  -62.030 1.00 30.43  ? 117 LEU A C   1 
ATOM   877  O O   . LEU A 1 117 ? 42.533 14.260  -60.881 1.00 28.91  ? 117 LEU A O   1 
ATOM   878  C CB  . LEU A 1 117 ? 40.747 12.582  -63.235 1.00 34.03  ? 117 LEU A CB  1 
ATOM   879  C CG  . LEU A 1 117 ? 39.745 13.720  -63.083 1.00 33.48  ? 117 LEU A CG  1 
ATOM   880  C CD1 . LEU A 1 117 ? 38.758 13.650  -64.212 1.00 34.35  ? 117 LEU A CD1 1 
ATOM   881  C CD2 . LEU A 1 117 ? 39.040 13.647  -61.784 1.00 34.45  ? 117 LEU A CD2 1 
ATOM   882  N N   . PRO A 1 118 ? 43.260 14.495  -62.984 1.00 29.02  ? 118 PRO A N   1 
ATOM   883  C CA  . PRO A 1 118 ? 43.864 15.795  -62.738 1.00 28.44  ? 118 PRO A CA  1 
ATOM   884  C C   . PRO A 1 118 ? 42.882 16.863  -62.272 1.00 27.11  ? 118 PRO A C   1 
ATOM   885  O O   . PRO A 1 118 ? 41.780 16.954  -62.777 1.00 25.79  ? 118 PRO A O   1 
ATOM   886  C CB  . PRO A 1 118 ? 44.426 16.184  -64.118 1.00 28.77  ? 118 PRO A CB  1 
ATOM   887  C CG  . PRO A 1 118 ? 44.656 14.898  -64.788 1.00 29.49  ? 118 PRO A CG  1 
ATOM   888  C CD  . PRO A 1 118 ? 43.517 14.022  -64.359 1.00 29.45  ? 118 PRO A CD  1 
ATOM   889  N N   . ASP A 1 119 ? 43.341 17.692  -61.343 1.00 27.23  ? 119 ASP A N   1 
ATOM   890  C CA  . ASP A 1 119 ? 42.585 18.828  -60.858 1.00 27.62  ? 119 ASP A CA  1 
ATOM   891  C C   . ASP A 1 119 ? 42.566 20.004  -61.839 1.00 28.38  ? 119 ASP A C   1 
ATOM   892  O O   . ASP A 1 119 ? 43.486 20.153  -62.668 1.00 28.84  ? 119 ASP A O   1 
ATOM   893  C CB  . ASP A 1 119 ? 43.205 19.312  -59.550 1.00 27.34  ? 119 ASP A CB  1 
ATOM   894  C CG  . ASP A 1 119 ? 42.852 18.440  -58.379 1.00 28.12  ? 119 ASP A CG  1 
ATOM   895  O OD1 . ASP A 1 119 ? 41.654 18.077  -58.246 1.00 27.49  ? 119 ASP A OD1 1 
ATOM   896  O OD2 . ASP A 1 119 ? 43.706 18.088  -57.521 1.00 28.50  ? 119 ASP A OD2 1 
ATOM   897  N N   . VAL A 1 120 ? 41.527 20.838  -61.722 1.00 26.66  ? 120 VAL A N   1 
ATOM   898  C CA  . VAL A 1 120 ? 41.450 22.128  -62.421 1.00 27.84  ? 120 VAL A CA  1 
ATOM   899  C C   . VAL A 1 120 ? 42.616 23.019  -61.975 1.00 28.24  ? 120 VAL A C   1 
ATOM   900  O O   . VAL A 1 120 ? 42.840 23.224  -60.789 1.00 28.66  ? 120 VAL A O   1 
ATOM   901  C CB  . VAL A 1 120 ? 40.141 22.850  -62.134 1.00 27.51  ? 120 VAL A CB  1 
ATOM   902  C CG1 . VAL A 1 120 ? 40.112 24.232  -62.757 1.00 28.53  ? 120 VAL A CG1 1 
ATOM   903  C CG2 . VAL A 1 120 ? 38.947 22.035  -62.611 1.00 27.04  ? 120 VAL A CG2 1 
ATOM   904  N N   . SER A 1 121 ? 43.348 23.546  -62.944 1.00 29.29  ? 121 SER A N   1 
ATOM   905  C CA  . SER A 1 121 ? 44.541 24.326  -62.672 1.00 29.58  ? 121 SER A CA  1 
ATOM   906  C C   . SER A 1 121 ? 44.263 25.817  -62.792 1.00 29.60  ? 121 SER A C   1 
ATOM   907  O O   . SER A 1 121 ? 43.254 26.260  -63.364 1.00 29.89  ? 121 SER A O   1 
ATOM   908  C CB  . SER A 1 121 ? 45.648 23.949  -63.652 1.00 29.86  ? 121 SER A CB  1 
ATOM   909  O OG  . SER A 1 121 ? 45.386 24.501  -64.932 1.00 30.25  ? 121 SER A OG  1 
ATOM   910  N N   . ALA A 1 122 ? 45.186 26.594  -62.247 1.00 30.57  ? 122 ALA A N   1 
ATOM   911  C CA  . ALA A 1 122 ? 45.159 28.035  -62.402 1.00 31.07  ? 122 ALA A CA  1 
ATOM   912  C C   . ALA A 1 122 ? 45.108 28.446  -63.875 1.00 30.78  ? 122 ALA A C   1 
ATOM   913  O O   . ALA A 1 122 ? 44.370 29.354  -64.235 1.00 28.40  ? 122 ALA A O   1 
ATOM   914  C CB  . ALA A 1 122 ? 46.393 28.649  -61.700 1.00 31.88  ? 122 ALA A CB  1 
ATOM   915  N N   . THR A 1 123 ? 45.887 27.774  -64.725 1.00 32.16  ? 123 THR A N   1 
ATOM   916  C CA  . THR A 1 123 ? 45.858 28.065  -66.169 1.00 32.41  ? 123 THR A CA  1 
ATOM   917  C C   . THR A 1 123 ? 44.499 27.764  -66.813 1.00 32.04  ? 123 THR A C   1 
ATOM   918  O O   . THR A 1 123 ? 44.047 28.475  -67.717 1.00 30.94  ? 123 THR A O   1 
ATOM   919  C CB  . THR A 1 123 ? 46.974 27.300  -66.886 1.00 34.39  ? 123 THR A CB  1 
ATOM   920  O OG1 . THR A 1 123 ? 48.238 27.734  -66.381 1.00 36.39  ? 123 THR A OG1 1 
ATOM   921  C CG2 . THR A 1 123 ? 47.038 27.699  -68.356 1.00 34.86  ? 123 THR A CG2 1 
ATOM   922  N N   . ASP A 1 124 ? 43.827 26.713  -66.333 1.00 31.78  ? 124 ASP A N   1 
ATOM   923  C CA  . ASP A 1 124 ? 42.443 26.432  -66.760 1.00 30.88  ? 124 ASP A CA  1 
ATOM   924  C C   . ASP A 1 124 ? 41.537 27.591  -66.403 1.00 29.29  ? 124 ASP A C   1 
ATOM   925  O O   . ASP A 1 124 ? 40.718 28.035  -67.202 1.00 29.85  ? 124 ASP A O   1 
ATOM   926  C CB  . ASP A 1 124 ? 41.870 25.173  -66.063 1.00 30.70  ? 124 ASP A CB  1 
ATOM   927  C CG  . ASP A 1 124 ? 42.563 23.891  -66.463 1.00 31.74  ? 124 ASP A CG  1 
ATOM   928  O OD1 . ASP A 1 124 ? 43.037 23.769  -67.633 1.00 31.30  ? 124 ASP A OD1 1 
ATOM   929  O OD2 . ASP A 1 124 ? 42.678 22.929  -65.663 1.00 30.91  ? 124 ASP A OD2 1 
ATOM   930  N N   . PHE A 1 125 ? 41.652 28.058  -65.167 1.00 29.19  ? 125 PHE A N   1 
ATOM   931  C CA  . PHE A 1 125 ? 40.759 29.077  -64.664 1.00 30.08  ? 125 PHE A CA  1 
ATOM   932  C C   . PHE A 1 125 ? 40.998 30.385  -65.426 1.00 30.80  ? 125 PHE A C   1 
ATOM   933  O O   . PHE A 1 125 ? 40.076 31.191  -65.609 1.00 29.28  ? 125 PHE A O   1 
ATOM   934  C CB  . PHE A 1 125 ? 40.964 29.273  -63.149 1.00 28.66  ? 125 PHE A CB  1 
ATOM   935  C CG  . PHE A 1 125 ? 39.973 30.204  -62.525 1.00 28.38  ? 125 PHE A CG  1 
ATOM   936  C CD1 . PHE A 1 125 ? 38.699 29.767  -62.207 1.00 28.20  ? 125 PHE A CD1 1 
ATOM   937  C CD2 . PHE A 1 125 ? 40.308 31.532  -62.264 1.00 28.05  ? 125 PHE A CD2 1 
ATOM   938  C CE1 . PHE A 1 125 ? 37.750 30.631  -61.648 1.00 28.94  ? 125 PHE A CE1 1 
ATOM   939  C CE2 . PHE A 1 125 ? 39.382 32.393  -61.697 1.00 28.05  ? 125 PHE A CE2 1 
ATOM   940  C CZ  . PHE A 1 125 ? 38.088 31.945  -61.386 1.00 28.48  ? 125 PHE A CZ  1 
ATOM   941  N N   . GLU A 1 126 ? 42.234 30.572  -65.886 1.00 32.77  ? 126 GLU A N   1 
ATOM   942  C CA  . GLU A 1 126 ? 42.590 31.775  -66.636 1.00 35.61  ? 126 GLU A CA  1 
ATOM   943  C C   . GLU A 1 126 ? 41.638 32.003  -67.794 1.00 36.26  ? 126 GLU A C   1 
ATOM   944  O O   . GLU A 1 126 ? 41.426 33.131  -68.207 1.00 37.19  ? 126 GLU A O   1 
ATOM   945  C CB  . GLU A 1 126 ? 44.034 31.687  -67.149 1.00 37.52  ? 126 GLU A CB  1 
ATOM   946  C CG  . GLU A 1 126 ? 45.080 32.083  -66.121 1.00 39.40  ? 126 GLU A CG  1 
ATOM   947  C CD  . GLU A 1 126 ? 46.504 31.857  -66.609 1.00 41.24  ? 126 GLU A CD  1 
ATOM   948  O OE1 . GLU A 1 126 ? 46.753 31.892  -67.843 1.00 44.69  ? 126 GLU A OE1 1 
ATOM   949  O OE2 . GLU A 1 126 ? 47.389 31.632  -65.756 1.00 44.31  ? 126 GLU A OE2 1 
ATOM   950  N N   . LYS A 1 127 ? 41.052 30.929  -68.310 1.00 36.39  ? 127 LYS A N   1 
ATOM   951  C CA  . LYS A 1 127 ? 40.205 31.010  -69.487 1.00 36.40  ? 127 LYS A CA  1 
ATOM   952  C C   . LYS A 1 127 ? 38.787 31.424  -69.180 1.00 35.48  ? 127 LYS A C   1 
ATOM   953  O O   . LYS A 1 127 ? 38.018 31.758  -70.087 1.00 36.21  ? 127 LYS A O   1 
ATOM   954  C CB  . LYS A 1 127 ? 40.215 29.667  -70.210 1.00 37.80  ? 127 LYS A CB  1 
ATOM   955  C CG  . LYS A 1 127 ? 41.612 29.286  -70.679 1.00 38.71  ? 127 LYS A CG  1 
ATOM   956  C CD  . LYS A 1 127 ? 41.627 27.906  -71.246 1.00 38.89  ? 127 LYS A CD  1 
ATOM   957  C CE  . LYS A 1 127 ? 43.019 27.321  -71.240 1.00 39.46  ? 127 LYS A CE  1 
ATOM   958  N NZ  . LYS A 1 127 ? 43.021 26.022  -71.971 1.00 40.07  ? 127 LYS A NZ  1 
ATOM   959  N N   . VAL A 1 128 ? 38.419 31.412  -67.906 1.00 34.36  ? 128 VAL A N   1 
ATOM   960  C CA  . VAL A 1 128 ? 37.076 31.826  -67.517 1.00 33.65  ? 128 VAL A CA  1 
ATOM   961  C C   . VAL A 1 128 ? 36.834 33.310  -67.785 1.00 33.56  ? 128 VAL A C   1 
ATOM   962  O O   . VAL A 1 128 ? 37.631 34.164  -67.395 1.00 32.91  ? 128 VAL A O   1 
ATOM   963  C CB  . VAL A 1 128 ? 36.788 31.537  -66.010 1.00 31.66  ? 128 VAL A CB  1 
ATOM   964  C CG1 . VAL A 1 128 ? 35.384 31.963  -65.633 1.00 31.07  ? 128 VAL A CG1 1 
ATOM   965  C CG2 . VAL A 1 128 ? 36.968 30.050  -65.706 1.00 31.44  ? 128 VAL A CG2 1 
ATOM   966  N N   . ASP A 1 129 ? 35.704 33.593  -68.422 1.00 34.80  ? 129 ASP A N   1 
ATOM   967  C CA  . ASP A 1 129 ? 35.204 34.959  -68.617 1.00 34.93  ? 129 ASP A CA  1 
ATOM   968  C C   . ASP A 1 129 ? 34.553 35.471  -67.334 1.00 35.08  ? 129 ASP A C   1 
ATOM   969  O O   . ASP A 1 129 ? 33.385 35.228  -67.086 1.00 34.43  ? 129 ASP A O   1 
ATOM   970  C CB  . ASP A 1 129 ? 34.190 34.989  -69.764 1.00 35.62  ? 129 ASP A CB  1 
ATOM   971  C CG  . ASP A 1 129 ? 33.728 36.401  -70.109 1.00 35.73  ? 129 ASP A CG  1 
ATOM   972  O OD1 . ASP A 1 129 ? 34.129 37.349  -69.402 1.00 36.36  ? 129 ASP A OD1 1 
ATOM   973  O OD2 . ASP A 1 129 ? 32.944 36.646  -71.051 1.00 35.65  ? 129 ASP A OD2 1 
ATOM   974  N N   . LEU A 1 130 ? 35.328 36.186  -66.521 1.00 36.11  ? 130 LEU A N   1 
ATOM   975  C CA  . LEU A 1 130 ? 34.876 36.580  -65.188 1.00 36.40  ? 130 LEU A CA  1 
ATOM   976  C C   . LEU A 1 130 ? 33.691 37.535  -65.220 1.00 36.92  ? 130 LEU A C   1 
ATOM   977  O O   . LEU A 1 130 ? 32.932 37.628  -64.263 1.00 37.81  ? 130 LEU A O   1 
ATOM   978  C CB  . LEU A 1 130 ? 36.039 37.200  -64.410 1.00 36.84  ? 130 LEU A CB  1 
ATOM   979  C CG  . LEU A 1 130 ? 37.190 36.250  -64.067 1.00 36.84  ? 130 LEU A CG  1 
ATOM   980  C CD1 . LEU A 1 130 ? 38.371 37.010  -63.496 1.00 36.60  ? 130 LEU A CD1 1 
ATOM   981  C CD2 . LEU A 1 130 ? 36.733 35.160  -63.090 1.00 36.66  ? 130 LEU A CD2 1 
ATOM   982  N N   . THR A 1 131 ? 33.511 38.225  -66.338 1.00 37.38  ? 131 THR A N   1 
ATOM   983  C CA  . THR A 1 131 ? 32.418 39.177  -66.483 1.00 37.27  ? 131 THR A CA  1 
ATOM   984  C C   . THR A 1 131 ? 31.053 38.503  -66.473 1.00 37.45  ? 131 THR A C   1 
ATOM   985  O O   . THR A 1 131 ? 30.042 39.178  -66.377 1.00 38.98  ? 131 THR A O   1 
ATOM   986  C CB  . THR A 1 131 ? 32.588 40.009  -67.787 1.00 37.96  ? 131 THR A CB  1 
ATOM   987  O OG1 . THR A 1 131 ? 32.289 39.207  -68.940 1.00 37.43  ? 131 THR A OG1 1 
ATOM   988  C CG2 . THR A 1 131 ? 34.059 40.428  -67.989 1.00 37.97  ? 131 THR A CG2 1 
ATOM   989  N N   . GLN A 1 132 ? 31.012 37.179  -66.554 1.00 37.39  ? 132 GLN A N   1 
ATOM   990  C CA  . GLN A 1 132 ? 29.742 36.463  -66.622 1.00 36.75  ? 132 GLN A CA  1 
ATOM   991  C C   . GLN A 1 132 ? 29.146 36.132  -65.242 1.00 35.79  ? 132 GLN A C   1 
ATOM   992  O O   . GLN A 1 132 ? 28.002 35.693  -65.151 1.00 32.89  ? 132 GLN A O   1 
ATOM   993  C CB  . GLN A 1 132 ? 29.915 35.155  -67.404 1.00 39.34  ? 132 GLN A CB  1 
ATOM   994  C CG  . GLN A 1 132 ? 30.586 35.293  -68.768 1.00 41.79  ? 132 GLN A CG  1 
ATOM   995  C CD  . GLN A 1 132 ? 29.776 36.125  -69.759 1.00 43.71  ? 132 GLN A CD  1 
ATOM   996  O OE1 . GLN A 1 132 ? 28.539 36.108  -69.734 1.00 44.88  ? 132 GLN A OE1 1 
ATOM   997  N NE2 . GLN A 1 132 ? 30.474 36.851  -70.638 1.00 45.13  ? 132 GLN A NE2 1 
ATOM   998  N N   . PHE A 1 133 ? 29.921 36.357  -64.181 1.00 34.43  ? 133 PHE A N   1 
ATOM   999  C CA  . PHE A 1 133 ? 29.601 35.837  -62.856 1.00 32.74  ? 133 PHE A CA  1 
ATOM   1000 C C   . PHE A 1 133 ? 29.516 36.918  -61.801 1.00 32.06  ? 133 PHE A C   1 
ATOM   1001 O O   . PHE A 1 133 ? 30.335 37.826  -61.773 1.00 33.43  ? 133 PHE A O   1 
ATOM   1002 C CB  . PHE A 1 133 ? 30.662 34.808  -62.455 1.00 31.46  ? 133 PHE A CB  1 
ATOM   1003 C CG  . PHE A 1 133 ? 30.790 33.685  -63.435 1.00 31.33  ? 133 PHE A CG  1 
ATOM   1004 C CD1 . PHE A 1 133 ? 31.900 33.556  -64.231 1.00 31.22  ? 133 PHE A CD1 1 
ATOM   1005 C CD2 . PHE A 1 133 ? 29.759 32.789  -63.595 1.00 31.00  ? 133 PHE A CD2 1 
ATOM   1006 C CE1 . PHE A 1 133 ? 31.981 32.526  -65.154 1.00 31.50  ? 133 PHE A CE1 1 
ATOM   1007 C CE2 . PHE A 1 133 ? 29.844 31.769  -64.518 1.00 31.50  ? 133 PHE A CE2 1 
ATOM   1008 C CZ  . PHE A 1 133 ? 30.949 31.639  -65.290 1.00 30.87  ? 133 PHE A CZ  1 
ATOM   1009 N N   . LYS A 1 134 ? 28.531 36.803  -60.924 1.00 32.11  ? 134 LYS A N   1 
ATOM   1010 C CA  . LYS A 1 134 ? 28.409 37.711  -59.792 1.00 31.78  ? 134 LYS A CA  1 
ATOM   1011 C C   . LYS A 1 134 ? 28.885 37.103  -58.483 1.00 30.56  ? 134 LYS A C   1 
ATOM   1012 O O   . LYS A 1 134 ? 28.977 37.805  -57.473 1.00 29.71  ? 134 LYS A O   1 
ATOM   1013 C CB  . LYS A 1 134 ? 26.965 38.126  -59.614 1.00 33.06  ? 134 LYS A CB  1 
ATOM   1014 C CG  . LYS A 1 134 ? 26.016 36.998  -59.380 1.00 34.49  ? 134 LYS A CG  1 
ATOM   1015 C CD  . LYS A 1 134 ? 24.691 37.564  -59.014 1.00 35.22  ? 134 LYS A CD  1 
ATOM   1016 C CE  . LYS A 1 134 ? 23.636 36.551  -59.039 1.00 36.57  ? 134 LYS A CE  1 
ATOM   1017 N NZ  . LYS A 1 134 ? 22.361 37.193  -58.615 1.00 37.82  ? 134 LYS A NZ  1 
ATOM   1018 N N   . TRP A 1 135 ? 29.147 35.792  -58.497 1.00 27.97  ? 135 TRP A N   1 
ATOM   1019 C CA  . TRP A 1 135 ? 29.614 35.076  -57.328 1.00 26.76  ? 135 TRP A CA  1 
ATOM   1020 C C   . TRP A 1 135 ? 30.410 33.884  -57.836 1.00 26.15  ? 135 TRP A C   1 
ATOM   1021 O O   . TRP A 1 135 ? 29.997 33.247  -58.812 1.00 26.20  ? 135 TRP A O   1 
ATOM   1022 C CB  . TRP A 1 135 ? 28.428 34.611  -56.473 1.00 26.54  ? 135 TRP A CB  1 
ATOM   1023 C CG  . TRP A 1 135 ? 28.801 34.131  -55.097 1.00 26.06  ? 135 TRP A CG  1 
ATOM   1024 C CD1 . TRP A 1 135 ? 29.554 33.044  -54.776 1.00 26.37  ? 135 TRP A CD1 1 
ATOM   1025 C CD2 . TRP A 1 135 ? 28.411 34.723  -53.864 1.00 26.47  ? 135 TRP A CD2 1 
ATOM   1026 N NE1 . TRP A 1 135 ? 29.664 32.931  -53.410 1.00 26.40  ? 135 TRP A NE1 1 
ATOM   1027 C CE2 . TRP A 1 135 ? 28.977 33.955  -52.826 1.00 25.34  ? 135 TRP A CE2 1 
ATOM   1028 C CE3 . TRP A 1 135 ? 27.622 35.833  -53.521 1.00 26.43  ? 135 TRP A CE3 1 
ATOM   1029 C CZ2 . TRP A 1 135 ? 28.783 34.253  -51.491 1.00 26.07  ? 135 TRP A CZ2 1 
ATOM   1030 C CZ3 . TRP A 1 135 ? 27.447 36.128  -52.189 1.00 26.28  ? 135 TRP A CZ3 1 
ATOM   1031 C CH2 . TRP A 1 135 ? 28.011 35.332  -51.190 1.00 26.40  ? 135 TRP A CH2 1 
ATOM   1032 N N   . ILE A 1 136 ? 31.570 33.630  -57.228 1.00 24.55  ? 136 ILE A N   1 
ATOM   1033 C CA  . ILE A 1 136 ? 32.379 32.451  -57.540 1.00 23.42  ? 136 ILE A CA  1 
ATOM   1034 C C   . ILE A 1 136 ? 32.699 31.742  -56.224 1.00 23.78  ? 136 ILE A C   1 
ATOM   1035 O O   . ILE A 1 136 ? 33.246 32.353  -55.293 1.00 23.30  ? 136 ILE A O   1 
ATOM   1036 C CB  . ILE A 1 136 ? 33.678 32.823  -58.289 1.00 22.80  ? 136 ILE A CB  1 
ATOM   1037 C CG1 . ILE A 1 136 ? 33.354 33.544  -59.610 1.00 23.86  ? 136 ILE A CG1 1 
ATOM   1038 C CG2 . ILE A 1 136 ? 34.530 31.554  -58.496 1.00 23.59  ? 136 ILE A CG2 1 
ATOM   1039 C CD1 . ILE A 1 136 ? 34.556 34.008  -60.396 1.00 23.76  ? 136 ILE A CD1 1 
ATOM   1040 N N   . HIS A 1 137 ? 32.350 30.461  -56.152 1.00 21.98  ? 137 HIS A N   1 
ATOM   1041 C CA  . HIS A 1 137 ? 32.621 29.637  -55.000 1.00 21.23  ? 137 HIS A CA  1 
ATOM   1042 C C   . HIS A 1 137 ? 33.612 28.550  -55.355 1.00 22.30  ? 137 HIS A C   1 
ATOM   1043 O O   . HIS A 1 137 ? 33.483 27.879  -56.383 1.00 22.66  ? 137 HIS A O   1 
ATOM   1044 C CB  . HIS A 1 137 ? 31.341 29.006  -54.481 1.00 20.02  ? 137 HIS A CB  1 
ATOM   1045 C CG  . HIS A 1 137 ? 31.561 27.986  -53.410 1.00 19.56  ? 137 HIS A CG  1 
ATOM   1046 N ND1 . HIS A 1 137 ? 31.767 28.328  -52.091 1.00 19.46  ? 137 HIS A ND1 1 
ATOM   1047 C CD2 . HIS A 1 137 ? 31.581 26.634  -53.453 1.00 19.64  ? 137 HIS A CD2 1 
ATOM   1048 C CE1 . HIS A 1 137 ? 31.909 27.232  -51.370 1.00 20.24  ? 137 HIS A CE1 1 
ATOM   1049 N NE2 . HIS A 1 137 ? 31.816 26.186  -52.175 1.00 18.99  ? 137 HIS A NE2 1 
ATOM   1050 N N   . ILE A 1 138 ? 34.615 28.404  -54.498 1.00 21.52  ? 138 ILE A N   1 
ATOM   1051 C CA  . ILE A 1 138 ? 35.675 27.443  -54.690 1.00 21.90  ? 138 ILE A CA  1 
ATOM   1052 C C   . ILE A 1 138 ? 35.697 26.400  -53.576 1.00 19.93  ? 138 ILE A C   1 
ATOM   1053 O O   . ILE A 1 138 ? 35.821 26.717  -52.389 1.00 20.30  ? 138 ILE A O   1 
ATOM   1054 C CB  . ILE A 1 138 ? 37.034 28.163  -54.816 1.00 23.23  ? 138 ILE A CB  1 
ATOM   1055 C CG1 . ILE A 1 138 ? 37.000 29.170  -55.963 1.00 25.20  ? 138 ILE A CG1 1 
ATOM   1056 C CG2 . ILE A 1 138 ? 38.158 27.137  -55.051 1.00 22.83  ? 138 ILE A CG2 1 
ATOM   1057 C CD1 . ILE A 1 138 ? 38.389 29.789  -56.245 1.00 25.92  ? 138 ILE A CD1 1 
ATOM   1058 N N   . GLU A 1 139 ? 35.530 25.136  -53.957 1.00 18.96  ? 139 GLU A N   1 
ATOM   1059 C CA  . GLU A 1 139 ? 35.679 24.033  -53.028 1.00 19.86  ? 139 GLU A CA  1 
ATOM   1060 C C   . GLU A 1 139 ? 37.158 23.763  -52.830 1.00 20.52  ? 139 GLU A C   1 
ATOM   1061 O O   . GLU A 1 139 ? 37.868 23.361  -53.756 1.00 19.67  ? 139 GLU A O   1 
ATOM   1062 C CB  . GLU A 1 139 ? 34.988 22.793  -53.548 1.00 20.81  ? 139 GLU A CB  1 
ATOM   1063 C CG  . GLU A 1 139 ? 35.292 21.564  -52.738 1.00 20.12  ? 139 GLU A CG  1 
ATOM   1064 C CD  . GLU A 1 139 ? 34.798 20.299  -53.386 1.00 22.43  ? 139 GLU A CD  1 
ATOM   1065 O OE1 . GLU A 1 139 ? 33.998 20.377  -54.337 1.00 20.98  ? 139 GLU A OE1 1 
ATOM   1066 O OE2 . GLU A 1 139 ? 35.162 19.219  -52.851 1.00 27.61  ? 139 GLU A OE2 1 
ATOM   1067 N N   . GLY A 1 140 ? 37.643 23.989  -51.615 1.00 20.45  ? 140 GLY A N   1 
ATOM   1068 C CA  . GLY A 1 140 ? 39.096 23.890  -51.388 1.00 19.75  ? 140 GLY A CA  1 
ATOM   1069 C C   . GLY A 1 140 ? 39.671 22.527  -51.688 1.00 19.62  ? 140 GLY A C   1 
ATOM   1070 O O   . GLY A 1 140 ? 39.218 21.543  -51.135 1.00 18.11  ? 140 GLY A O   1 
ATOM   1071 N N   . ARG A 1 141 ? 40.710 22.467  -52.520 1.00 21.96  ? 141 ARG A N   1 
ATOM   1072 C CA  . ARG A 1 141 ? 41.288 21.187  -52.893 1.00 24.19  ? 141 ARG A CA  1 
ATOM   1073 C C   . ARG A 1 141 ? 42.785 21.303  -53.166 1.00 24.03  ? 141 ARG A C   1 
ATOM   1074 O O   . ARG A 1 141 ? 43.595 20.911  -52.319 1.00 24.27  ? 141 ARG A O   1 
ATOM   1075 C CB  . ARG A 1 141 ? 40.554 20.610  -54.103 1.00 27.11  ? 141 ARG A CB  1 
ATOM   1076 C CG  . ARG A 1 141 ? 40.989 19.192  -54.396 1.00 28.42  ? 141 ARG A CG  1 
ATOM   1077 C CD  . ARG A 1 141 ? 40.034 18.469  -55.298 1.00 31.05  ? 141 ARG A CD  1 
ATOM   1078 N NE  . ARG A 1 141 ? 40.657 17.312  -55.918 1.00 32.29  ? 141 ARG A NE  1 
ATOM   1079 C CZ  . ARG A 1 141 ? 40.849 16.137  -55.322 1.00 34.23  ? 141 ARG A CZ  1 
ATOM   1080 N NH1 . ARG A 1 141 ? 40.489 15.914  -54.061 1.00 34.76  ? 141 ARG A NH1 1 
ATOM   1081 N NH2 . ARG A 1 141 ? 41.416 15.169  -56.010 1.00 34.16  ? 141 ARG A NH2 1 
ATOM   1082 N N   . ASN A 1 142 ? 43.130 21.871  -54.313 1.00 23.99  ? 142 ASN A N   1 
ATOM   1083 C CA  . ASN A 1 142 ? 44.541 22.054  -54.706 1.00 25.30  ? 142 ASN A CA  1 
ATOM   1084 C C   . ASN A 1 142 ? 44.868 23.505  -54.480 1.00 24.52  ? 142 ASN A C   1 
ATOM   1085 O O   . ASN A 1 142 ? 44.777 24.322  -55.385 1.00 25.23  ? 142 ASN A O   1 
ATOM   1086 C CB  . ASN A 1 142 ? 44.796 21.612  -56.158 1.00 24.68  ? 142 ASN A CB  1 
ATOM   1087 C CG  . ASN A 1 142 ? 43.848 22.234  -57.169 1.00 25.16  ? 142 ASN A CG  1 
ATOM   1088 O OD1 . ASN A 1 142 ? 42.682 22.538  -56.881 1.00 26.15  ? 142 ASN A OD1 1 
ATOM   1089 N ND2 . ASN A 1 142 ? 44.338 22.392  -58.388 1.00 24.14  ? 142 ASN A ND2 1 
ATOM   1090 N N   . ALA A 1 143 ? 45.213 23.814  -53.238 1.00 25.77  ? 143 ALA A N   1 
ATOM   1091 C CA  . ALA A 1 143 ? 45.142 25.177  -52.744 1.00 27.25  ? 143 ALA A CA  1 
ATOM   1092 C C   . ALA A 1 143 ? 46.117 26.118  -53.438 1.00 27.19  ? 143 ALA A C   1 
ATOM   1093 O O   . ALA A 1 143 ? 45.782 27.268  -53.684 1.00 26.46  ? 143 ALA A O   1 
ATOM   1094 C CB  . ALA A 1 143 ? 45.373 25.182  -51.240 1.00 27.85  ? 143 ALA A CB  1 
ATOM   1095 N N   . SER A 1 144 ? 47.319 25.627  -53.753 1.00 28.87  ? 144 SER A N   1 
ATOM   1096 C CA  . SER A 1 144 ? 48.343 26.487  -54.342 1.00 29.03  ? 144 SER A CA  1 
ATOM   1097 C C   . SER A 1 144 ? 47.844 27.028  -55.676 1.00 28.63  ? 144 SER A C   1 
ATOM   1098 O O   . SER A 1 144 ? 47.937 28.228  -55.935 1.00 28.46  ? 144 SER A O   1 
ATOM   1099 C CB  . SER A 1 144 ? 49.696 25.750  -54.454 1.00 30.45  ? 144 SER A CB  1 
ATOM   1100 O OG  . SER A 1 144 ? 49.726 24.853  -55.566 1.00 33.12  ? 144 SER A OG  1 
ATOM   1101 N N   . GLU A 1 145 ? 47.248 26.156  -56.495 1.00 27.83  ? 145 GLU A N   1 
ATOM   1102 C CA  . GLU A 1 145 ? 46.579 26.571  -57.724 1.00 27.52  ? 145 GLU A CA  1 
ATOM   1103 C C   . GLU A 1 145 ? 45.360 27.458  -57.460 1.00 26.21  ? 145 GLU A C   1 
ATOM   1104 O O   . GLU A 1 145 ? 45.136 28.456  -58.128 1.00 23.83  ? 145 GLU A O   1 
ATOM   1105 C CB  . GLU A 1 145 ? 46.141 25.341  -58.538 1.00 28.79  ? 145 GLU A CB  1 
ATOM   1106 C CG  . GLU A 1 145 ? 47.297 24.570  -59.161 1.00 30.62  ? 145 GLU A CG  1 
ATOM   1107 C CD  . GLU A 1 145 ? 48.102 25.405  -60.137 1.00 31.55  ? 145 GLU A CD  1 
ATOM   1108 O OE1 . GLU A 1 145 ? 47.537 25.904  -61.128 1.00 32.50  ? 145 GLU A OE1 1 
ATOM   1109 O OE2 . GLU A 1 145 ? 49.312 25.562  -59.894 1.00 33.72  ? 145 GLU A OE2 1 
ATOM   1110 N N   . GLN A 1 146 ? 44.542 27.091  -56.480 1.00 25.54  ? 146 GLN A N   1 
ATOM   1111 C CA  . GLN A 1 146 ? 43.325 27.857  -56.260 1.00 24.90  ? 146 GLN A CA  1 
ATOM   1112 C C   . GLN A 1 146 ? 43.624 29.263  -55.743 1.00 24.59  ? 146 GLN A C   1 
ATOM   1113 O O   . GLN A 1 146 ? 42.885 30.202  -56.027 1.00 24.04  ? 146 GLN A O   1 
ATOM   1114 C CB  . GLN A 1 146 ? 42.407 27.096  -55.312 1.00 24.07  ? 146 GLN A CB  1 
ATOM   1115 C CG  . GLN A 1 146 ? 41.891 25.800  -55.923 1.00 22.61  ? 146 GLN A CG  1 
ATOM   1116 C CD  . GLN A 1 146 ? 41.055 24.962  -54.966 1.00 22.93  ? 146 GLN A CD  1 
ATOM   1117 O OE1 . GLN A 1 146 ? 41.372 24.850  -53.772 1.00 22.63  ? 146 GLN A OE1 1 
ATOM   1118 N NE2 . GLN A 1 146 ? 40.005 24.339  -55.496 1.00 20.03  ? 146 GLN A NE2 1 
ATOM   1119 N N   . VAL A 1 147 ? 44.715 29.417  -54.999 1.00 25.94  ? 147 VAL A N   1 
ATOM   1120 C CA  . VAL A 1 147 ? 45.107 30.754  -54.536 1.00 27.26  ? 147 VAL A CA  1 
ATOM   1121 C C   . VAL A 1 147 ? 45.340 31.694  -55.739 1.00 28.29  ? 147 VAL A C   1 
ATOM   1122 O O   . VAL A 1 147 ? 44.912 32.860  -55.751 1.00 27.67  ? 147 VAL A O   1 
ATOM   1123 C CB  . VAL A 1 147 ? 46.313 30.686  -53.597 1.00 27.91  ? 147 VAL A CB  1 
ATOM   1124 C CG1 . VAL A 1 147 ? 47.006 32.043  -53.485 1.00 28.26  ? 147 VAL A CG1 1 
ATOM   1125 C CG2 . VAL A 1 147 ? 45.892 30.177  -52.224 1.00 28.06  ? 147 VAL A CG2 1 
ATOM   1126 N N   . LYS A 1 148 ? 45.998 31.171  -56.763 1.00 29.70  ? 148 LYS A N   1 
ATOM   1127 C CA  . LYS A 1 148 ? 46.179 31.912  -58.005 1.00 30.64  ? 148 LYS A CA  1 
ATOM   1128 C C   . LYS A 1 148 ? 44.849 32.268  -58.650 1.00 29.35  ? 148 LYS A C   1 
ATOM   1129 O O   . LYS A 1 148 ? 44.646 33.382  -59.130 1.00 27.41  ? 148 LYS A O   1 
ATOM   1130 C CB  . LYS A 1 148 ? 47.024 31.092  -58.982 1.00 32.82  ? 148 LYS A CB  1 
ATOM   1131 C CG  . LYS A 1 148 ? 48.446 30.797  -58.511 1.00 34.02  ? 148 LYS A CG  1 
ATOM   1132 C CD  . LYS A 1 148 ? 49.209 30.084  -59.635 1.00 34.61  ? 148 LYS A CD  1 
ATOM   1133 C CE  . LYS A 1 148 ? 50.218 29.059  -59.133 1.00 35.57  ? 148 LYS A CE  1 
ATOM   1134 N NZ  . LYS A 1 148 ? 50.647 28.079  -60.237 1.00 37.15  ? 148 LYS A NZ  1 
ATOM   1135 N N   . MET A 1 149 ? 43.927 31.317  -58.687 1.00 28.63  ? 149 MET A N   1 
ATOM   1136 C CA  . MET A 1 149 ? 42.602 31.625  -59.179 1.00 27.49  ? 149 MET A CA  1 
ATOM   1137 C C   . MET A 1 149 ? 41.996 32.789  -58.392 1.00 26.97  ? 149 MET A C   1 
ATOM   1138 O O   . MET A 1 149 ? 41.377 33.700  -58.960 1.00 26.87  ? 149 MET A O   1 
ATOM   1139 C CB  . MET A 1 149 ? 41.675 30.410  -59.035 1.00 26.79  ? 149 MET A CB  1 
ATOM   1140 C CG  . MET A 1 149 ? 42.134 29.157  -59.752 1.00 26.58  ? 149 MET A CG  1 
ATOM   1141 S SD  . MET A 1 149 ? 40.963 27.791  -59.423 1.00 25.93  ? 149 MET A SD  1 
ATOM   1142 C CE  . MET A 1 149 ? 41.942 26.426  -59.949 1.00 27.15  ? 149 MET A CE  1 
ATOM   1143 N N   . LEU A 1 150 ? 42.128 32.720  -57.077 1.00 26.26  ? 150 LEU A N   1 
ATOM   1144 C CA  . LEU A 1 150 ? 41.560 33.750  -56.203 1.00 28.67  ? 150 LEU A CA  1 
ATOM   1145 C C   . LEU A 1 150 ? 42.264 35.103  -56.403 1.00 28.52  ? 150 LEU A C   1 
ATOM   1146 O O   . LEU A 1 150 ? 41.642 36.146  -56.321 1.00 30.22  ? 150 LEU A O   1 
ATOM   1147 C CB  . LEU A 1 150 ? 41.630 33.297  -54.741 1.00 27.13  ? 150 LEU A CB  1 
ATOM   1148 C CG  . LEU A 1 150 ? 40.628 32.147  -54.492 1.00 26.71  ? 150 LEU A CG  1 
ATOM   1149 C CD1 . LEU A 1 150 ? 41.086 31.272  -53.369 1.00 26.43  ? 150 LEU A CD1 1 
ATOM   1150 C CD2 . LEU A 1 150 ? 39.221 32.695  -54.231 1.00 26.72  ? 150 LEU A CD2 1 
ATOM   1151 N N   . GLN A 1 151 ? 43.559 35.063  -56.659 1.00 31.26  ? 151 GLN A N   1 
ATOM   1152 C CA  . GLN A 1 151 ? 44.321 36.285  -56.961 1.00 32.48  ? 151 GLN A CA  1 
ATOM   1153 C C   . GLN A 1 151 ? 43.862 36.887  -58.292 1.00 33.37  ? 151 GLN A C   1 
ATOM   1154 O O   . GLN A 1 151 ? 43.760 38.110  -58.441 1.00 34.43  ? 151 GLN A O   1 
ATOM   1155 C CB  . GLN A 1 151 ? 45.820 35.964  -56.955 1.00 33.48  ? 151 GLN A CB  1 
ATOM   1156 C CG  . GLN A 1 151 ? 46.309 35.599  -55.567 1.00 34.38  ? 151 GLN A CG  1 
ATOM   1157 C CD  . GLN A 1 151 ? 47.735 35.137  -55.521 1.00 35.33  ? 151 GLN A CD  1 
ATOM   1158 O OE1 . GLN A 1 151 ? 48.263 34.598  -56.495 1.00 36.80  ? 151 GLN A OE1 1 
ATOM   1159 N NE2 . GLN A 1 151 ? 48.367 35.311  -54.362 1.00 36.90  ? 151 GLN A NE2 1 
ATOM   1160 N N   . ARG A 1 152 ? 43.525 36.024  -59.249 1.00 32.74  ? 152 ARG A N   1 
ATOM   1161 C CA  . ARG A 1 152 ? 42.997 36.478  -60.515 1.00 32.27  ? 152 ARG A CA  1 
ATOM   1162 C C   . ARG A 1 152 ? 41.650 37.169  -60.339 1.00 31.36  ? 152 ARG A C   1 
ATOM   1163 O O   . ARG A 1 152 ? 41.394 38.197  -60.954 1.00 32.44  ? 152 ARG A O   1 
ATOM   1164 C CB  . ARG A 1 152 ? 42.881 35.318  -61.508 1.00 32.50  ? 152 ARG A CB  1 
ATOM   1165 C CG  . ARG A 1 152 ? 42.575 35.799  -62.906 1.00 33.12  ? 152 ARG A CG  1 
ATOM   1166 C CD  . ARG A 1 152 ? 42.112 34.768  -63.927 1.00 33.44  ? 152 ARG A CD  1 
ATOM   1167 N NE  . ARG A 1 152 ? 41.547 35.518  -65.049 1.00 33.74  ? 152 ARG A NE  1 
ATOM   1168 C CZ  . ARG A 1 152 ? 40.445 35.219  -65.710 1.00 34.93  ? 152 ARG A CZ  1 
ATOM   1169 N NH1 . ARG A 1 152 ? 39.724 34.128  -65.431 1.00 34.92  ? 152 ARG A NH1 1 
ATOM   1170 N NH2 . ARG A 1 152 ? 40.051 36.038  -66.670 1.00 35.74  ? 152 ARG A NH2 1 
ATOM   1171 N N   . ILE A 1 153 ? 40.776 36.616  -59.508 1.00 30.77  ? 153 ILE A N   1 
ATOM   1172 C CA  . ILE A 1 153 ? 39.504 37.265  -59.246 1.00 30.89  ? 153 ILE A CA  1 
ATOM   1173 C C   . ILE A 1 153 ? 39.713 38.604  -58.532 1.00 31.42  ? 153 ILE A C   1 
ATOM   1174 O O   . ILE A 1 153 ? 39.015 39.570  -58.806 1.00 31.30  ? 153 ILE A O   1 
ATOM   1175 C CB  . ILE A 1 153 ? 38.557 36.366  -58.400 1.00 29.89  ? 153 ILE A CB  1 
ATOM   1176 C CG1 . ILE A 1 153 ? 38.253 35.040  -59.121 1.00 29.25  ? 153 ILE A CG1 1 
ATOM   1177 C CG2 . ILE A 1 153 ? 37.249 37.095  -58.122 1.00 30.04  ? 153 ILE A CG2 1 
ATOM   1178 C CD1 . ILE A 1 153 ? 37.618 33.990  -58.214 1.00 28.94  ? 153 ILE A CD1 1 
ATOM   1179 N N   . ASP A 1 154 ? 40.633 38.627  -57.581 1.00 32.26  ? 154 ASP A N   1 
ATOM   1180 C CA  . ASP A 1 154 ? 40.951 39.849  -56.831 1.00 33.61  ? 154 ASP A CA  1 
ATOM   1181 C C   . ASP A 1 154 ? 41.436 40.950  -57.783 1.00 35.05  ? 154 ASP A C   1 
ATOM   1182 O O   . ASP A 1 154 ? 40.950 42.077  -57.742 1.00 35.62  ? 154 ASP A O   1 
ATOM   1183 C CB  . ASP A 1 154 ? 42.043 39.578  -55.792 1.00 33.59  ? 154 ASP A CB  1 
ATOM   1184 C CG  . ASP A 1 154 ? 41.534 38.857  -54.563 1.00 33.83  ? 154 ASP A CG  1 
ATOM   1185 O OD1 . ASP A 1 154 ? 40.335 38.796  -54.321 1.00 33.85  ? 154 ASP A OD1 1 
ATOM   1186 O OD2 . ASP A 1 154 ? 42.457 38.335  -53.755 1.00 33.81  ? 154 ASP A OD2 1 
ATOM   1187 N N   . ALA A 1 155 ? 42.398 40.609  -58.636 1.00 35.62  ? 155 ALA A N   1 
ATOM   1188 C CA  . ALA A 1 155 ? 42.917 41.552  -59.620 1.00 36.21  ? 155 ALA A CA  1 
ATOM   1189 C C   . ALA A 1 155 ? 41.795 42.066  -60.496 1.00 37.44  ? 155 ALA A C   1 
ATOM   1190 O O   . ALA A 1 155 ? 41.733 43.254  -60.803 1.00 39.03  ? 155 ALA A O   1 
ATOM   1191 C CB  . ALA A 1 155 ? 43.979 40.891  -60.473 1.00 36.78  ? 155 ALA A CB  1 
ATOM   1192 N N   . HIS A 1 156 ? 40.899 41.174  -60.905 1.00 37.14  ? 156 HIS A N   1 
ATOM   1193 C CA  . HIS A 1 156 ? 39.743 41.573  -61.696 1.00 37.58  ? 156 HIS A CA  1 
ATOM   1194 C C   . HIS A 1 156 ? 38.893 42.583  -60.950 1.00 38.15  ? 156 HIS A C   1 
ATOM   1195 O O   . HIS A 1 156 ? 38.439 43.550  -61.530 1.00 39.56  ? 156 HIS A O   1 
ATOM   1196 C CB  . HIS A 1 156 ? 38.877 40.355  -62.057 1.00 37.04  ? 156 HIS A CB  1 
ATOM   1197 C CG  . HIS A 1 156 ? 37.556 40.707  -62.661 1.00 36.71  ? 156 HIS A CG  1 
ATOM   1198 N ND1 . HIS A 1 156 ? 37.362 40.807  -64.021 1.00 36.53  ? 156 HIS A ND1 1 
ATOM   1199 C CD2 . HIS A 1 156 ? 36.356 40.968  -62.091 1.00 36.63  ? 156 HIS A CD2 1 
ATOM   1200 C CE1 . HIS A 1 156 ? 36.105 41.128  -64.260 1.00 35.94  ? 156 HIS A CE1 1 
ATOM   1201 N NE2 . HIS A 1 156 ? 35.471 41.226  -63.106 1.00 36.84  ? 156 HIS A NE2 1 
ATOM   1202 N N   . ASN A 1 157 ? 38.646 42.326  -59.672 1.00 38.71  ? 157 ASN A N   1 
ATOM   1203 C CA  . ASN A 1 157 ? 37.758 43.165  -58.882 1.00 39.88  ? 157 ASN A CA  1 
ATOM   1204 C C   . ASN A 1 157 ? 38.334 44.565  -58.622 1.00 41.10  ? 157 ASN A C   1 
ATOM   1205 O O   . ASN A 1 157 ? 37.583 45.512  -58.453 1.00 42.21  ? 157 ASN A O   1 
ATOM   1206 C CB  . ASN A 1 157 ? 37.432 42.481  -57.551 1.00 38.37  ? 157 ASN A CB  1 
ATOM   1207 C CG  . ASN A 1 157 ? 36.308 41.449  -57.672 1.00 37.12  ? 157 ASN A CG  1 
ATOM   1208 O OD1 . ASN A 1 157 ? 35.513 41.468  -58.613 1.00 35.58  ? 157 ASN A OD1 1 
ATOM   1209 N ND2 . ASN A 1 157 ? 36.234 40.563  -56.700 1.00 36.91  ? 157 ASN A ND2 1 
ATOM   1210 N N   . THR A 1 158 ? 39.654 44.684  -58.576 1.00 43.53  ? 158 THR A N   1 
ATOM   1211 C CA  . THR A 1 158 ? 40.273 45.990  -58.348 1.00 45.67  ? 158 THR A CA  1 
ATOM   1212 C C   . THR A 1 158 ? 39.916 46.928  -59.486 1.00 47.60  ? 158 THR A C   1 
ATOM   1213 O O   . THR A 1 158 ? 39.759 48.124  -59.282 1.00 49.48  ? 158 THR A O   1 
ATOM   1214 C CB  . THR A 1 158 ? 41.817 45.896  -58.226 1.00 45.98  ? 158 THR A CB  1 
ATOM   1215 O OG1 . THR A 1 158 ? 42.394 45.457  -59.465 1.00 46.78  ? 158 THR A OG1 1 
ATOM   1216 C CG2 . THR A 1 158 ? 42.240 44.842  -57.221 1.00 45.81  ? 158 THR A CG2 1 
ATOM   1217 N N   . ARG A 1 159 ? 39.777 46.378  -60.686 1.00 49.41  ? 159 ARG A N   1 
ATOM   1218 C CA  . ARG A 1 159 ? 39.447 47.165  -61.854 1.00 50.74  ? 159 ARG A CA  1 
ATOM   1219 C C   . ARG A 1 159 ? 37.938 47.330  -62.019 1.00 52.16  ? 159 ARG A C   1 
ATOM   1220 O O   . ARG A 1 159 ? 37.463 47.730  -63.083 1.00 52.93  ? 159 ARG A O   1 
ATOM   1221 C CB  . ARG A 1 159 ? 40.076 46.527  -63.093 1.00 51.12  ? 159 ARG A CB  1 
ATOM   1222 C CG  . ARG A 1 159 ? 41.586 46.466  -63.002 1.00 51.51  ? 159 ARG A CG  1 
ATOM   1223 C CD  . ARG A 1 159 ? 42.284 45.834  -64.193 1.00 51.97  ? 159 ARG A CD  1 
ATOM   1224 N NE  . ARG A 1 159 ? 42.598 44.424  -63.957 1.00 52.47  ? 159 ARG A NE  1 
ATOM   1225 C CZ  . ARG A 1 159 ? 41.830 43.409  -64.335 1.00 52.85  ? 159 ARG A CZ  1 
ATOM   1226 N NH1 . ARG A 1 159 ? 40.689 43.634  -64.973 1.00 53.55  ? 159 ARG A NH1 1 
ATOM   1227 N NH2 . ARG A 1 159 ? 42.195 42.162  -64.070 1.00 52.71  ? 159 ARG A NH2 1 
ATOM   1228 N N   . GLN A 1 160 ? 37.183 47.039  -60.963 1.00 53.24  ? 160 GLN A N   1 
ATOM   1229 C CA  . GLN A 1 160 ? 35.735 47.126  -61.025 1.00 54.12  ? 160 GLN A CA  1 
ATOM   1230 C C   . GLN A 1 160 ? 35.189 48.096  -59.998 1.00 54.85  ? 160 GLN A C   1 
ATOM   1231 O O   . GLN A 1 160 ? 35.758 48.250  -58.923 1.00 54.86  ? 160 GLN A O   1 
ATOM   1232 C CB  . GLN A 1 160 ? 35.101 45.758  -60.749 1.00 54.68  ? 160 GLN A CB  1 
ATOM   1233 C CG  . GLN A 1 160 ? 35.485 44.681  -61.735 1.00 55.22  ? 160 GLN A CG  1 
ATOM   1234 C CD  . GLN A 1 160 ? 35.001 44.969  -63.129 1.00 55.48  ? 160 GLN A CD  1 
ATOM   1235 O OE1 . GLN A 1 160 ? 33.863 45.411  -63.322 1.00 56.35  ? 160 GLN A OE1 1 
ATOM   1236 N NE2 . GLN A 1 160 ? 35.856 44.719  -64.111 1.00 55.80  ? 160 GLN A NE2 1 
ATOM   1237 N N   . PRO A 1 161 ? 34.074 48.734  -60.333 1.00 55.81  ? 161 PRO A N   1 
ATOM   1238 C CA  . PRO A 1 161 ? 33.236 49.402  -59.345 1.00 56.61  ? 161 PRO A CA  1 
ATOM   1239 C C   . PRO A 1 161 ? 32.772 48.427  -58.268 1.00 57.59  ? 161 PRO A C   1 
ATOM   1240 O O   . PRO A 1 161 ? 32.619 47.238  -58.540 1.00 58.48  ? 161 PRO A O   1 
ATOM   1241 C CB  . PRO A 1 161 ? 32.017 49.859  -60.153 1.00 56.58  ? 161 PRO A CB  1 
ATOM   1242 C CG  . PRO A 1 161 ? 32.413 49.801  -61.580 1.00 56.30  ? 161 PRO A CG  1 
ATOM   1243 C CD  . PRO A 1 161 ? 33.564 48.885  -61.704 1.00 56.04  ? 161 PRO A CD  1 
ATOM   1244 N N   . PRO A 1 162 ? 32.536 48.919  -57.058 1.00 58.24  ? 162 PRO A N   1 
ATOM   1245 C CA  . PRO A 1 162 ? 31.986 48.080  -55.995 1.00 58.00  ? 162 PRO A CA  1 
ATOM   1246 C C   . PRO A 1 162 ? 30.691 47.412  -56.445 1.00 58.35  ? 162 PRO A C   1 
ATOM   1247 O O   . PRO A 1 162 ? 30.384 46.291  -56.032 1.00 59.80  ? 162 PRO A O   1 
ATOM   1248 C CB  . PRO A 1 162 ? 31.711 49.077  -54.862 1.00 58.40  ? 162 PRO A CB  1 
ATOM   1249 C CG  . PRO A 1 162 ? 32.624 50.228  -55.128 1.00 58.42  ? 162 PRO A CG  1 
ATOM   1250 C CD  . PRO A 1 162 ? 32.782 50.303  -56.616 1.00 58.44  ? 162 PRO A CD  1 
ATOM   1251 N N   . GLU A 1 163 ? 29.941 48.111  -57.288 1.00 57.69  ? 163 GLU A N   1 
ATOM   1252 C CA  . GLU A 1 163 ? 28.697 47.595  -57.834 1.00 56.58  ? 163 GLU A CA  1 
ATOM   1253 C C   . GLU A 1 163 ? 28.927 46.327  -58.646 1.00 55.78  ? 163 GLU A C   1 
ATOM   1254 O O   . GLU A 1 163 ? 28.079 45.433  -58.660 1.00 56.24  ? 163 GLU A O   1 
ATOM   1255 C CB  . GLU A 1 163 ? 28.037 48.658  -58.709 1.00 57.24  ? 163 GLU A CB  1 
ATOM   1256 N N   . GLN A 1 164 ? 30.073 46.262  -59.321 1.00 54.38  ? 164 GLN A N   1 
ATOM   1257 C CA  . GLN A 1 164 ? 30.364 45.187  -60.263 1.00 52.27  ? 164 GLN A CA  1 
ATOM   1258 C C   . GLN A 1 164 ? 31.388 44.196  -59.729 1.00 50.01  ? 164 GLN A C   1 
ATOM   1259 O O   . GLN A 1 164 ? 32.008 43.464  -60.509 1.00 49.51  ? 164 GLN A O   1 
ATOM   1260 C CB  . GLN A 1 164 ? 30.879 45.772  -61.575 1.00 53.74  ? 164 GLN A CB  1 
ATOM   1261 C CG  . GLN A 1 164 ? 29.968 46.819  -62.154 1.00 55.10  ? 164 GLN A CG  1 
ATOM   1262 C CD  . GLN A 1 164 ? 28.561 46.305  -62.325 1.00 56.26  ? 164 GLN A CD  1 
ATOM   1263 O OE1 . GLN A 1 164 ? 28.355 45.207  -62.859 1.00 57.25  ? 164 GLN A OE1 1 
ATOM   1264 N NE2 . GLN A 1 164 ? 27.584 47.085  -61.873 1.00 57.05  ? 164 GLN A NE2 1 
ATOM   1265 N N   . LYS A 1 165 ? 31.568 44.152  -58.413 1.00 46.68  ? 165 LYS A N   1 
ATOM   1266 C CA  . LYS A 1 165 ? 32.567 43.252  -57.863 1.00 44.63  ? 165 LYS A CA  1 
ATOM   1267 C C   . LYS A 1 165 ? 31.987 41.836  -57.742 1.00 41.79  ? 165 LYS A C   1 
ATOM   1268 O O   . LYS A 1 165 ? 30.832 41.650  -57.357 1.00 41.95  ? 165 LYS A O   1 
ATOM   1269 C CB  . LYS A 1 165 ? 33.115 43.770  -56.539 1.00 45.36  ? 165 LYS A CB  1 
ATOM   1270 C CG  . LYS A 1 165 ? 34.012 45.026  -56.715 1.00 46.18  ? 165 LYS A CG  1 
ATOM   1271 C CD  . LYS A 1 165 ? 34.893 45.269  -55.493 1.00 46.25  ? 165 LYS A CD  1 
ATOM   1272 C CE  . LYS A 1 165 ? 35.428 46.696  -55.433 1.00 46.56  ? 165 LYS A CE  1 
ATOM   1273 N NZ  . LYS A 1 165 ? 36.522 46.965  -56.407 1.00 47.40  ? 165 LYS A NZ  1 
ATOM   1274 N N   . ILE A 1 166 ? 32.786 40.852  -58.127 1.00 37.36  ? 166 ILE A N   1 
ATOM   1275 C CA  . ILE A 1 166 ? 32.398 39.446  -57.981 1.00 35.64  ? 166 ILE A CA  1 
ATOM   1276 C C   . ILE A 1 166 ? 32.603 39.044  -56.525 1.00 32.44  ? 166 ILE A C   1 
ATOM   1277 O O   . ILE A 1 166 ? 33.715 39.137  -55.999 1.00 31.20  ? 166 ILE A O   1 
ATOM   1278 C CB  . ILE A 1 166 ? 33.261 38.553  -58.893 1.00 34.86  ? 166 ILE A CB  1 
ATOM   1279 C CG1 . ILE A 1 166 ? 33.100 38.948  -60.358 1.00 34.63  ? 166 ILE A CG1 1 
ATOM   1280 C CG2 . ILE A 1 166 ? 32.914 37.068  -58.698 1.00 35.18  ? 166 ILE A CG2 1 
ATOM   1281 C CD1 . ILE A 1 166 ? 34.020 38.203  -61.289 1.00 34.41  ? 166 ILE A CD1 1 
ATOM   1282 N N   . ARG A 1 167 ? 31.534 38.613  -55.878 1.00 31.87  ? 167 ARG A N   1 
ATOM   1283 C CA  . ARG A 1 167 ? 31.612 38.116  -54.515 1.00 31.76  ? 167 ARG A CA  1 
ATOM   1284 C C   . ARG A 1 167 ? 32.207 36.700  -54.534 1.00 30.06  ? 167 ARG A C   1 
ATOM   1285 O O   . ARG A 1 167 ? 31.949 35.933  -55.446 1.00 27.14  ? 167 ARG A O   1 
ATOM   1286 C CB  . ARG A 1 167 ? 30.235 38.143  -53.861 1.00 33.52  ? 167 ARG A CB  1 
ATOM   1287 C CG  . ARG A 1 167 ? 30.275 38.026  -52.354 1.00 34.67  ? 167 ARG A CG  1 
ATOM   1288 C CD  . ARG A 1 167 ? 29.270 38.919  -51.651 1.00 36.27  ? 167 ARG A CD  1 
ATOM   1289 N NE  . ARG A 1 167 ? 29.309 38.767  -50.192 1.00 37.53  ? 167 ARG A NE  1 
ATOM   1290 C CZ  . ARG A 1 167 ? 28.243 38.810  -49.401 1.00 38.48  ? 167 ARG A CZ  1 
ATOM   1291 N NH1 . ARG A 1 167 ? 27.025 38.960  -49.906 1.00 39.50  ? 167 ARG A NH1 1 
ATOM   1292 N NH2 . ARG A 1 167 ? 28.390 38.669  -48.097 1.00 38.67  ? 167 ARG A NH2 1 
ATOM   1293 N N   . VAL A 1 168 ? 33.038 36.385  -53.548 1.00 28.25  ? 168 VAL A N   1 
ATOM   1294 C CA  . VAL A 1 168 ? 33.751 35.119  -53.545 1.00 27.18  ? 168 VAL A CA  1 
ATOM   1295 C C   . VAL A 1 168 ? 33.519 34.371  -52.249 1.00 26.17  ? 168 VAL A C   1 
ATOM   1296 O O   . VAL A 1 168 ? 33.500 34.960  -51.166 1.00 24.24  ? 168 VAL A O   1 
ATOM   1297 C CB  . VAL A 1 168 ? 35.274 35.335  -53.729 1.00 27.47  ? 168 VAL A CB  1 
ATOM   1298 C CG1 . VAL A 1 168 ? 36.050 34.020  -53.590 1.00 27.91  ? 168 VAL A CG1 1 
ATOM   1299 C CG2 . VAL A 1 168 ? 35.551 36.006  -55.056 1.00 28.11  ? 168 VAL A CG2 1 
ATOM   1300 N N   . SER A 1 169 ? 33.353 33.060  -52.377 1.00 23.81  ? 169 SER A N   1 
ATOM   1301 C CA  . SER A 1 169 ? 33.270 32.179  -51.230 1.00 22.69  ? 169 SER A CA  1 
ATOM   1302 C C   . SER A 1 169 ? 34.244 31.017  -51.421 1.00 22.16  ? 169 SER A C   1 
ATOM   1303 O O   . SER A 1 169 ? 34.571 30.628  -52.549 1.00 20.55  ? 169 SER A O   1 
ATOM   1304 C CB  . SER A 1 169 ? 31.832 31.686  -50.963 1.00 23.72  ? 169 SER A CB  1 
ATOM   1305 O OG  . SER A 1 169 ? 31.257 30.960  -52.060 1.00 22.67  ? 169 SER A OG  1 
ATOM   1306 N N   . VAL A 1 170 ? 34.751 30.492  -50.307 1.00 21.08  ? 170 VAL A N   1 
ATOM   1307 C CA  . VAL A 1 170 ? 35.606 29.331  -50.333 1.00 21.11  ? 170 VAL A CA  1 
ATOM   1308 C C   . VAL A 1 170 ? 35.162 28.376  -49.242 1.00 20.22  ? 170 VAL A C   1 
ATOM   1309 O O   . VAL A 1 170 ? 34.658 28.798  -48.190 1.00 21.16  ? 170 VAL A O   1 
ATOM   1310 C CB  . VAL A 1 170 ? 37.119 29.695  -50.122 1.00 22.35  ? 170 VAL A CB  1 
ATOM   1311 C CG1 . VAL A 1 170 ? 37.617 30.709  -51.159 1.00 22.48  ? 170 VAL A CG1 1 
ATOM   1312 C CG2 . VAL A 1 170 ? 37.343 30.210  -48.736 1.00 23.68  ? 170 VAL A CG2 1 
ATOM   1313 N N   . GLU A 1 171 ? 35.332 27.074  -49.475 1.00 19.23  ? 171 GLU A N   1 
ATOM   1314 C CA  . GLU A 1 171 ? 35.072 26.063  -48.445 1.00 19.21  ? 171 GLU A CA  1 
ATOM   1315 C C   . GLU A 1 171 ? 36.373 25.367  -48.078 1.00 20.74  ? 171 GLU A C   1 
ATOM   1316 O O   . GLU A 1 171 ? 37.107 24.888  -48.953 1.00 19.29  ? 171 GLU A O   1 
ATOM   1317 C CB  . GLU A 1 171 ? 34.083 24.976  -48.923 1.00 19.26  ? 171 GLU A CB  1 
ATOM   1318 C CG  . GLU A 1 171 ? 33.846 23.914  -47.848 1.00 19.35  ? 171 GLU A CG  1 
ATOM   1319 C CD  . GLU A 1 171 ? 32.967 22.758  -48.263 1.00 20.44  ? 171 GLU A CD  1 
ATOM   1320 O OE1 . GLU A 1 171 ? 33.117 22.291  -49.416 1.00 20.40  ? 171 GLU A OE1 1 
ATOM   1321 O OE2 . GLU A 1 171 ? 32.155 22.314  -47.419 1.00 21.56  ? 171 GLU A OE2 1 
ATOM   1322 N N   . VAL A 1 172 ? 36.642 25.312  -46.787 1.00 20.53  ? 172 VAL A N   1 
ATOM   1323 C CA  . VAL A 1 172 ? 37.753 24.537  -46.251 1.00 22.44  ? 172 VAL A CA  1 
ATOM   1324 C C   . VAL A 1 172 ? 37.131 23.431  -45.410 1.00 22.63  ? 172 VAL A C   1 
ATOM   1325 O O   . VAL A 1 172 ? 36.828 23.614  -44.231 1.00 21.93  ? 172 VAL A O   1 
ATOM   1326 C CB  . VAL A 1 172 ? 38.701 25.392  -45.415 1.00 21.81  ? 172 VAL A CB  1 
ATOM   1327 C CG1 . VAL A 1 172 ? 39.754 24.524  -44.758 1.00 23.04  ? 172 VAL A CG1 1 
ATOM   1328 C CG2 . VAL A 1 172 ? 39.330 26.538  -46.267 1.00 22.28  ? 172 VAL A CG2 1 
ATOM   1329 N N   . GLU A 1 173 ? 36.983 22.261  -46.015 1.00 24.14  ? 173 GLU A N   1 
ATOM   1330 C CA  . GLU A 1 173 ? 36.293 21.166  -45.375 1.00 26.86  ? 173 GLU A CA  1 
ATOM   1331 C C   . GLU A 1 173 ? 37.193 20.053  -44.848 1.00 27.76  ? 173 GLU A C   1 
ATOM   1332 O O   . GLU A 1 173 ? 36.884 19.431  -43.829 1.00 27.11  ? 173 GLU A O   1 
ATOM   1333 C CB  . GLU A 1 173 ? 35.275 20.568  -46.329 1.00 28.29  ? 173 GLU A CB  1 
ATOM   1334 C CG  . GLU A 1 173 ? 34.438 19.494  -45.672 1.00 29.45  ? 173 GLU A CG  1 
ATOM   1335 C CD  . GLU A 1 173 ? 33.909 18.485  -46.650 1.00 32.27  ? 173 GLU A CD  1 
ATOM   1336 O OE1 . GLU A 1 173 ? 34.606 18.181  -47.653 1.00 34.46  ? 173 GLU A OE1 1 
ATOM   1337 O OE2 . GLU A 1 173 ? 32.763 18.013  -46.421 1.00 37.02  ? 173 GLU A OE2 1 
ATOM   1338 N N   . LYS A 1 174 ? 38.289 19.783  -45.539 1.00 29.91  ? 174 LYS A N   1 
ATOM   1339 C CA  . LYS A 1 174 ? 39.182 18.713  -45.105 1.00 32.40  ? 174 LYS A CA  1 
ATOM   1340 C C   . LYS A 1 174 ? 40.275 19.305  -44.232 1.00 32.66  ? 174 LYS A C   1 
ATOM   1341 O O   . LYS A 1 174 ? 40.778 20.386  -44.526 1.00 30.64  ? 174 LYS A O   1 
ATOM   1342 C CB  . LYS A 1 174 ? 39.808 17.999  -46.306 1.00 34.68  ? 174 LYS A CB  1 
ATOM   1343 C CG  . LYS A 1 174 ? 38.863 17.719  -47.465 1.00 36.26  ? 174 LYS A CG  1 
ATOM   1344 C CD  . LYS A 1 174 ? 38.099 16.420  -47.295 1.00 37.21  ? 174 LYS A CD  1 
ATOM   1345 C CE  . LYS A 1 174 ? 37.194 16.159  -48.501 1.00 37.44  ? 174 LYS A CE  1 
ATOM   1346 N NZ  . LYS A 1 174 ? 36.022 15.262  -48.178 1.00 38.04  ? 174 LYS A NZ  1 
ATOM   1347 N N   . PRO A 1 175 ? 40.660 18.585  -43.173 1.00 34.34  ? 175 PRO A N   1 
ATOM   1348 C CA  . PRO A 1 175 ? 41.676 19.053  -42.249 1.00 35.76  ? 175 PRO A CA  1 
ATOM   1349 C C   . PRO A 1 175 ? 43.100 18.849  -42.795 1.00 37.16  ? 175 PRO A C   1 
ATOM   1350 O O   . PRO A 1 175 ? 43.890 18.122  -42.191 1.00 38.31  ? 175 PRO A O   1 
ATOM   1351 C CB  . PRO A 1 175 ? 41.441 18.180  -41.014 1.00 35.27  ? 175 PRO A CB  1 
ATOM   1352 C CG  . PRO A 1 175 ? 40.914 16.921  -41.554 1.00 35.48  ? 175 PRO A CG  1 
ATOM   1353 C CD  . PRO A 1 175 ? 40.131 17.265  -42.786 1.00 35.00  ? 175 PRO A CD  1 
ATOM   1354 N N   . ARG A 1 176 ? 43.397 19.499  -43.916 1.00 38.14  ? 176 ARG A N   1 
ATOM   1355 C CA  . ARG A 1 176 ? 44.673 19.401  -44.607 1.00 38.46  ? 176 ARG A CA  1 
ATOM   1356 C C   . ARG A 1 176 ? 45.350 20.764  -44.609 1.00 37.61  ? 176 ARG A C   1 
ATOM   1357 O O   . ARG A 1 176 ? 44.767 21.760  -45.046 1.00 36.03  ? 176 ARG A O   1 
ATOM   1358 C CB  . ARG A 1 176 ? 44.454 18.929  -46.045 1.00 40.60  ? 176 ARG A CB  1 
ATOM   1359 C CG  . ARG A 1 176 ? 43.679 17.603  -46.148 1.00 42.41  ? 176 ARG A CG  1 
ATOM   1360 C CD  . ARG A 1 176 ? 43.219 17.237  -47.579 1.00 43.06  ? 176 ARG A CD  1 
ATOM   1361 N NE  . ARG A 1 176 ? 42.343 16.052  -47.609 1.00 44.21  ? 176 ARG A NE  1 
ATOM   1362 C CZ  . ARG A 1 176 ? 41.797 15.536  -48.712 1.00 44.61  ? 176 ARG A CZ  1 
ATOM   1363 N NH1 . ARG A 1 176 ? 42.024 16.096  -49.899 1.00 46.36  ? 176 ARG A NH1 1 
ATOM   1364 N NH2 . ARG A 1 176 ? 41.015 14.461  -48.634 1.00 45.40  ? 176 ARG A NH2 1 
ATOM   1365 N N   . GLU A 1 177 ? 46.593 20.796  -44.144 1.00 36.12  ? 177 GLU A N   1 
ATOM   1366 C CA  . GLU A 1 177 ? 47.343 22.036  -43.967 1.00 36.03  ? 177 GLU A CA  1 
ATOM   1367 C C   . GLU A 1 177 ? 47.298 22.954  -45.156 1.00 33.56  ? 177 GLU A C   1 
ATOM   1368 O O   . GLU A 1 177 ? 47.174 24.160  -44.990 1.00 33.16  ? 177 GLU A O   1 
ATOM   1369 C CB  . GLU A 1 177 ? 48.830 21.738  -43.680 1.00 37.30  ? 177 GLU A CB  1 
ATOM   1370 C CG  . GLU A 1 177 ? 49.792 22.901  -43.990 1.00 38.27  ? 177 GLU A CG  1 
ATOM   1371 C CD  . GLU A 1 177 ? 49.689 24.090  -43.021 1.00 39.39  ? 177 GLU A CD  1 
ATOM   1372 O OE1 . GLU A 1 177 ? 49.191 23.906  -41.900 1.00 38.60  ? 177 GLU A OE1 1 
ATOM   1373 O OE2 . GLU A 1 177 ? 50.154 25.212  -43.375 1.00 40.21  ? 177 GLU A OE2 1 
ATOM   1374 N N   . GLU A 1 178 ? 47.479 22.375  -46.344 1.00 32.00  ? 178 GLU A N   1 
ATOM   1375 C CA  . GLU A 1 178 ? 47.587 23.130  -47.584 1.00 32.42  ? 178 GLU A CA  1 
ATOM   1376 C C   . GLU A 1 178 ? 46.366 24.012  -47.758 1.00 29.54  ? 178 GLU A C   1 
ATOM   1377 O O   . GLU A 1 178 ? 46.448 25.057  -48.386 1.00 28.60  ? 178 GLU A O   1 
ATOM   1378 C CB  . GLU A 1 178 ? 47.724 22.193  -48.811 1.00 34.27  ? 178 GLU A CB  1 
ATOM   1379 C CG  . GLU A 1 178 ? 46.425 21.493  -49.226 1.00 36.45  ? 178 GLU A CG  1 
ATOM   1380 C CD  . GLU A 1 178 ? 46.535 20.607  -50.466 1.00 38.12  ? 178 GLU A CD  1 
ATOM   1381 O OE1 . GLU A 1 178 ? 46.887 21.120  -51.583 1.00 40.41  ? 178 GLU A OE1 1 
ATOM   1382 O OE2 . GLU A 1 178 ? 46.229 19.386  -50.318 1.00 40.86  ? 178 GLU A OE2 1 
ATOM   1383 N N   . LEU A 1 179 ? 45.228 23.576  -47.222 1.00 27.81  ? 179 LEU A N   1 
ATOM   1384 C CA  . LEU A 1 179 ? 43.981 24.321  -47.410 1.00 26.78  ? 179 LEU A CA  1 
ATOM   1385 C C   . LEU A 1 179 ? 43.876 25.590  -46.558 1.00 25.64  ? 179 LEU A C   1 
ATOM   1386 O O   . LEU A 1 179 ? 43.142 26.499  -46.910 1.00 24.72  ? 179 LEU A O   1 
ATOM   1387 C CB  . LEU A 1 179 ? 42.765 23.431  -47.131 1.00 24.91  ? 179 LEU A CB  1 
ATOM   1388 C CG  . LEU A 1 179 ? 42.534 22.219  -48.047 1.00 24.85  ? 179 LEU A CG  1 
ATOM   1389 C CD1 . LEU A 1 179 ? 41.193 21.527  -47.718 1.00 25.84  ? 179 LEU A CD1 1 
ATOM   1390 C CD2 . LEU A 1 179 ? 42.608 22.626  -49.496 1.00 25.20  ? 179 LEU A CD2 1 
ATOM   1391 N N   . PHE A 1 180 ? 44.597 25.663  -45.436 1.00 26.94  ? 180 PHE A N   1 
ATOM   1392 C CA  . PHE A 1 180 ? 44.402 26.795  -44.506 1.00 27.03  ? 180 PHE A CA  1 
ATOM   1393 C C   . PHE A 1 180 ? 44.750 28.147  -45.099 1.00 27.12  ? 180 PHE A C   1 
ATOM   1394 O O   . PHE A 1 180 ? 44.221 29.170  -44.679 1.00 26.77  ? 180 PHE A O   1 
ATOM   1395 C CB  . PHE A 1 180 ? 45.154 26.554  -43.194 1.00 28.58  ? 180 PHE A CB  1 
ATOM   1396 C CG  . PHE A 1 180 ? 44.797 25.259  -42.540 1.00 28.70  ? 180 PHE A CG  1 
ATOM   1397 C CD1 . PHE A 1 180 ? 45.691 24.610  -41.717 1.00 29.53  ? 180 PHE A CD1 1 
ATOM   1398 C CD2 . PHE A 1 180 ? 43.577 24.647  -42.796 1.00 28.67  ? 180 PHE A CD2 1 
ATOM   1399 C CE1 . PHE A 1 180 ? 45.348 23.393  -41.122 1.00 29.38  ? 180 PHE A CE1 1 
ATOM   1400 C CE2 . PHE A 1 180 ? 43.243 23.437  -42.222 1.00 28.79  ? 180 PHE A CE2 1 
ATOM   1401 C CZ  . PHE A 1 180 ? 44.128 22.804  -41.383 1.00 29.75  ? 180 PHE A CZ  1 
ATOM   1402 N N   . GLN A 1 181 ? 45.644 28.168  -46.077 1.00 26.95  ? 181 GLN A N   1 
ATOM   1403 C CA  . GLN A 1 181 ? 45.939 29.400  -46.776 1.00 26.90  ? 181 GLN A CA  1 
ATOM   1404 C C   . GLN A 1 181 ? 44.703 30.034  -47.426 1.00 26.97  ? 181 GLN A C   1 
ATOM   1405 O O   . GLN A 1 181 ? 44.615 31.265  -47.588 1.00 26.16  ? 181 GLN A O   1 
ATOM   1406 C CB  . GLN A 1 181 ? 47.032 29.165  -47.806 1.00 29.06  ? 181 GLN A CB  1 
ATOM   1407 C CG  . GLN A 1 181 ? 46.729 28.148  -48.877 1.00 29.49  ? 181 GLN A CG  1 
ATOM   1408 C CD  . GLN A 1 181 ? 47.959 27.860  -49.705 1.00 30.37  ? 181 GLN A CD  1 
ATOM   1409 O OE1 . GLN A 1 181 ? 48.537 28.788  -50.304 1.00 32.82  ? 181 GLN A OE1 1 
ATOM   1410 N NE2 . GLN A 1 181 ? 48.381 26.604  -49.729 1.00 30.92  ? 181 GLN A NE2 1 
ATOM   1411 N N   . LEU A 1 182 ? 43.715 29.201  -47.756 1.00 24.25  ? 182 LEU A N   1 
ATOM   1412 C CA  . LEU A 1 182 ? 42.475 29.715  -48.364 1.00 23.33  ? 182 LEU A CA  1 
ATOM   1413 C C   . LEU A 1 182 ? 41.654 30.581  -47.421 1.00 22.31  ? 182 LEU A C   1 
ATOM   1414 O O   . LEU A 1 182 ? 40.830 31.343  -47.877 1.00 21.65  ? 182 LEU A O   1 
ATOM   1415 C CB  . LEU A 1 182 ? 41.605 28.554  -48.860 1.00 22.67  ? 182 LEU A CB  1 
ATOM   1416 C CG  . LEU A 1 182 ? 42.242 27.725  -49.983 1.00 22.54  ? 182 LEU A CG  1 
ATOM   1417 C CD1 . LEU A 1 182 ? 41.299 26.554  -50.366 1.00 21.93  ? 182 LEU A CD1 1 
ATOM   1418 C CD2 . LEU A 1 182 ? 42.539 28.579  -51.172 1.00 22.97  ? 182 LEU A CD2 1 
ATOM   1419 N N   . PHE A 1 183 ? 41.873 30.459  -46.117 1.00 22.58  ? 183 PHE A N   1 
ATOM   1420 C CA  . PHE A 1 183 ? 41.153 31.299  -45.133 1.00 24.47  ? 183 PHE A CA  1 
ATOM   1421 C C   . PHE A 1 183 ? 41.250 32.788  -45.457 1.00 23.81  ? 183 PHE A C   1 
ATOM   1422 O O   . PHE A 1 183 ? 40.306 33.559  -45.226 1.00 23.00  ? 183 PHE A O   1 
ATOM   1423 C CB  . PHE A 1 183 ? 41.658 31.072  -43.698 1.00 24.55  ? 183 PHE A CB  1 
ATOM   1424 C CG  . PHE A 1 183 ? 41.310 29.717  -43.091 1.00 24.99  ? 183 PHE A CG  1 
ATOM   1425 C CD1 . PHE A 1 183 ? 42.195 29.112  -42.210 1.00 24.16  ? 183 PHE A CD1 1 
ATOM   1426 C CD2 . PHE A 1 183 ? 40.120 29.057  -43.374 1.00 25.02  ? 183 PHE A CD2 1 
ATOM   1427 C CE1 . PHE A 1 183 ? 41.915 27.900  -41.616 1.00 23.94  ? 183 PHE A CE1 1 
ATOM   1428 C CE2 . PHE A 1 183 ? 39.821 27.814  -42.776 1.00 24.69  ? 183 PHE A CE2 1 
ATOM   1429 C CZ  . PHE A 1 183 ? 40.708 27.238  -41.901 1.00 24.80  ? 183 PHE A CZ  1 
ATOM   1430 N N   . GLY A 1 184 ? 42.371 33.194  -46.046 1.00 23.91  ? 184 GLY A N   1 
ATOM   1431 C CA  . GLY A 1 184 ? 42.649 34.610  -46.323 1.00 25.76  ? 184 GLY A CA  1 
ATOM   1432 C C   . GLY A 1 184 ? 42.075 35.113  -47.618 1.00 25.90  ? 184 GLY A C   1 
ATOM   1433 O O   . GLY A 1 184 ? 42.299 36.245  -48.022 1.00 25.64  ? 184 GLY A O   1 
ATOM   1434 N N   . TYR A 1 185 ? 41.320 34.256  -48.303 1.00 26.33  ? 185 TYR A N   1 
ATOM   1435 C CA  . TYR A 1 185 ? 40.663 34.658  -49.521 1.00 27.83  ? 185 TYR A CA  1 
ATOM   1436 C C   . TYR A 1 185 ? 39.167 34.539  -49.318 1.00 27.64  ? 185 TYR A C   1 
ATOM   1437 O O   . TYR A 1 185 ? 38.713 33.823  -48.438 1.00 26.66  ? 185 TYR A O   1 
ATOM   1438 C CB  . TYR A 1 185 ? 41.149 33.767  -50.664 1.00 30.51  ? 185 TYR A CB  1 
ATOM   1439 C CG  . TYR A 1 185 ? 42.623 34.003  -50.924 1.00 30.81  ? 185 TYR A CG  1 
ATOM   1440 C CD1 . TYR A 1 185 ? 43.586 33.293  -50.239 1.00 30.55  ? 185 TYR A CD1 1 
ATOM   1441 C CD2 . TYR A 1 185 ? 43.030 34.984  -51.806 1.00 30.60  ? 185 TYR A CD2 1 
ATOM   1442 C CE1 . TYR A 1 185 ? 44.916 33.532  -50.443 1.00 31.72  ? 185 TYR A CE1 1 
ATOM   1443 C CE2 . TYR A 1 185 ? 44.370 35.231  -52.021 1.00 31.32  ? 185 TYR A CE2 1 
ATOM   1444 C CZ  . TYR A 1 185 ? 45.300 34.508  -51.344 1.00 31.28  ? 185 TYR A CZ  1 
ATOM   1445 O OH  . TYR A 1 185 ? 46.639 34.747  -51.567 1.00 32.93  ? 185 TYR A OH  1 
ATOM   1446 N N   . GLY A 1 186 ? 38.407 35.251  -50.122 1.00 28.31  ? 186 GLY A N   1 
ATOM   1447 C CA  . GLY A 1 186 ? 36.962 35.124  -50.078 1.00 28.72  ? 186 GLY A CA  1 
ATOM   1448 C C   . GLY A 1 186 ? 36.245 36.069  -49.134 1.00 28.39  ? 186 GLY A C   1 
ATOM   1449 O O   . GLY A 1 186 ? 36.699 36.365  -48.015 1.00 30.38  ? 186 GLY A O   1 
ATOM   1450 N N   . ASP A 1 187 ? 35.090 36.512  -49.589 1.00 27.08  ? 187 ASP A N   1 
ATOM   1451 C CA  . ASP A 1 187 ? 34.220 37.333  -48.800 1.00 26.60  ? 187 ASP A CA  1 
ATOM   1452 C C   . ASP A 1 187 ? 33.459 36.514  -47.793 1.00 25.64  ? 187 ASP A C   1 
ATOM   1453 O O   . ASP A 1 187 ? 33.015 37.037  -46.754 1.00 24.03  ? 187 ASP A O   1 
ATOM   1454 C CB  . ASP A 1 187 ? 33.261 38.065  -49.726 1.00 29.70  ? 187 ASP A CB  1 
ATOM   1455 C CG  . ASP A 1 187 ? 33.991 38.858  -50.752 1.00 31.71  ? 187 ASP A CG  1 
ATOM   1456 O OD1 . ASP A 1 187 ? 34.872 39.667  -50.336 1.00 34.28  ? 187 ASP A OD1 1 
ATOM   1457 O OD2 . ASP A 1 187 ? 33.840 38.689  -51.975 1.00 31.82  ? 187 ASP A OD2 1 
ATOM   1458 N N   . VAL A 1 188 ? 33.299 35.225  -48.108 1.00 23.38  ? 188 VAL A N   1 
ATOM   1459 C CA  . VAL A 1 188 ? 32.642 34.296  -47.232 1.00 22.33  ? 188 VAL A CA  1 
ATOM   1460 C C   . VAL A 1 188 ? 33.474 33.039  -47.187 1.00 21.36  ? 188 VAL A C   1 
ATOM   1461 O O   . VAL A 1 188 ? 33.843 32.465  -48.255 1.00 20.60  ? 188 VAL A O   1 
ATOM   1462 C CB  . VAL A 1 188 ? 31.211 33.905  -47.693 1.00 23.24  ? 188 VAL A CB  1 
ATOM   1463 C CG1 . VAL A 1 188 ? 30.605 32.971  -46.670 1.00 23.15  ? 188 VAL A CG1 1 
ATOM   1464 C CG2 . VAL A 1 188 ? 30.325 35.167  -47.892 1.00 23.87  ? 188 VAL A CG2 1 
ATOM   1465 N N   . VAL A 1 189 ? 33.783 32.623  -45.972 1.00 19.60  ? 189 VAL A N   1 
ATOM   1466 C CA  . VAL A 1 189 ? 34.642 31.480  -45.741 1.00 20.23  ? 189 VAL A CA  1 
ATOM   1467 C C   . VAL A 1 189 ? 33.904 30.439  -44.928 1.00 18.74  ? 189 VAL A C   1 
ATOM   1468 O O   . VAL A 1 189 ? 33.536 30.679  -43.778 1.00 18.71  ? 189 VAL A O   1 
ATOM   1469 C CB  . VAL A 1 189 ? 35.970 31.896  -45.044 1.00 21.63  ? 189 VAL A CB  1 
ATOM   1470 C CG1 . VAL A 1 189 ? 36.835 30.674  -44.736 1.00 23.58  ? 189 VAL A CG1 1 
ATOM   1471 C CG2 . VAL A 1 189 ? 36.731 32.893  -45.908 1.00 22.97  ? 189 VAL A CG2 1 
ATOM   1472 N N   . PHE A 1 190 ? 33.651 29.280  -45.538 1.00 18.22  ? 190 PHE A N   1 
ATOM   1473 C CA  . PHE A 1 190 ? 33.043 28.157  -44.844 1.00 18.97  ? 190 PHE A CA  1 
ATOM   1474 C C   . PHE A 1 190 ? 34.118 27.242  -44.291 1.00 19.84  ? 190 PHE A C   1 
ATOM   1475 O O   . PHE A 1 190 ? 34.924 26.701  -45.064 1.00 19.85  ? 190 PHE A O   1 
ATOM   1476 C CB  . PHE A 1 190 ? 32.173 27.335  -45.797 1.00 19.44  ? 190 PHE A CB  1 
ATOM   1477 C CG  . PHE A 1 190 ? 31.001 28.072  -46.347 1.00 17.85  ? 190 PHE A CG  1 
ATOM   1478 C CD1 . PHE A 1 190 ? 31.067 28.693  -47.583 1.00 18.50  ? 190 PHE A CD1 1 
ATOM   1479 C CD2 . PHE A 1 190 ? 29.823 28.154  -45.624 1.00 19.06  ? 190 PHE A CD2 1 
ATOM   1480 C CE1 . PHE A 1 190 ? 29.999 29.378  -48.080 1.00 20.73  ? 190 PHE A CE1 1 
ATOM   1481 C CE2 . PHE A 1 190 ? 28.729 28.825  -46.157 1.00 18.85  ? 190 PHE A CE2 1 
ATOM   1482 C CZ  . PHE A 1 190 ? 28.812 29.430  -47.363 1.00 18.76  ? 190 PHE A CZ  1 
ATOM   1483 N N   . VAL A 1 191 ? 34.124 27.043  -42.982 1.00 19.31  ? 191 VAL A N   1 
ATOM   1484 C CA  . VAL A 1 191 ? 35.050 26.113  -42.381 1.00 20.38  ? 191 VAL A CA  1 
ATOM   1485 C C   . VAL A 1 191 ? 34.268 24.995  -41.724 1.00 20.55  ? 191 VAL A C   1 
ATOM   1486 O O   . VAL A 1 191 ? 33.301 25.229  -40.998 1.00 20.32  ? 191 VAL A O   1 
ATOM   1487 C CB  . VAL A 1 191 ? 36.048 26.808  -41.400 1.00 20.98  ? 191 VAL A CB  1 
ATOM   1488 C CG1 . VAL A 1 191 ? 35.329 27.555  -40.284 1.00 21.86  ? 191 VAL A CG1 1 
ATOM   1489 C CG2 . VAL A 1 191 ? 37.001 25.822  -40.830 1.00 21.78  ? 191 VAL A CG2 1 
ATOM   1490 N N   . SER A 1 192 ? 34.692 23.771  -41.979 1.00 20.63  ? 192 SER A N   1 
ATOM   1491 C CA  . SER A 1 192 ? 33.982 22.607  -41.460 1.00 22.05  ? 192 SER A CA  1 
ATOM   1492 C C   . SER A 1 192 ? 34.224 22.362  -39.976 1.00 23.31  ? 192 SER A C   1 
ATOM   1493 O O   . SER A 1 192 ? 35.283 22.729  -39.403 1.00 20.37  ? 192 SER A O   1 
ATOM   1494 C CB  . SER A 1 192 ? 34.372 21.347  -42.229 1.00 23.18  ? 192 SER A CB  1 
ATOM   1495 O OG  . SER A 1 192 ? 35.658 20.894  -41.810 1.00 22.61  ? 192 SER A OG  1 
ATOM   1496 N N   . LYS A 1 193 ? 33.230 21.750  -39.342 1.00 24.45  ? 193 LYS A N   1 
ATOM   1497 C CA  . LYS A 1 193 ? 33.383 21.275  -37.992 1.00 25.58  ? 193 LYS A CA  1 
ATOM   1498 C C   . LYS A 1 193 ? 34.629 20.391  -37.870 1.00 26.55  ? 193 LYS A C   1 
ATOM   1499 O O   . LYS A 1 193 ? 35.394 20.521  -36.911 1.00 27.33  ? 193 LYS A O   1 
ATOM   1500 C CB  . LYS A 1 193 ? 32.113 20.543  -37.515 1.00 26.59  ? 193 LYS A CB  1 
ATOM   1501 C CG  . LYS A 1 193 ? 32.285 19.821  -36.196 1.00 27.54  ? 193 LYS A CG  1 
ATOM   1502 C CD  . LYS A 1 193 ? 31.001 19.160  -35.754 1.00 28.35  ? 193 LYS A CD  1 
ATOM   1503 C CE  . LYS A 1 193 ? 31.232 18.245  -34.567 1.00 29.20  ? 193 LYS A CE  1 
ATOM   1504 N NZ  . LYS A 1 193 ? 29.974 17.557  -34.131 1.00 30.18  ? 193 LYS A NZ  1 
ATOM   1505 N N   . ASP A 1 194 ? 34.860 19.505  -38.839 1.00 28.38  ? 194 ASP A N   1 
ATOM   1506 C CA  . ASP A 1 194 ? 36.009 18.598  -38.785 1.00 27.52  ? 194 ASP A CA  1 
ATOM   1507 C C   . ASP A 1 194 ? 37.334 19.366  -38.748 1.00 26.56  ? 194 ASP A C   1 
ATOM   1508 O O   . ASP A 1 194 ? 38.222 19.038  -37.970 1.00 27.65  ? 194 ASP A O   1 
ATOM   1509 C CB  . ASP A 1 194 ? 35.980 17.668  -40.005 1.00 30.14  ? 194 ASP A CB  1 
ATOM   1510 C CG  . ASP A 1 194 ? 36.962 16.520  -39.907 1.00 32.81  ? 194 ASP A CG  1 
ATOM   1511 O OD1 . ASP A 1 194 ? 37.512 16.141  -40.970 1.00 36.39  ? 194 ASP A OD1 1 
ATOM   1512 O OD2 . ASP A 1 194 ? 37.233 15.906  -38.839 1.00 36.03  ? 194 ASP A OD2 1 
ATOM   1513 N N   . VAL A 1 195 ? 37.463 20.380  -39.594 1.00 25.17  ? 195 VAL A N   1 
ATOM   1514 C CA  . VAL A 1 195 ? 38.646 21.223  -39.582 1.00 26.18  ? 195 VAL A CA  1 
ATOM   1515 C C   . VAL A 1 195 ? 38.773 21.915  -38.230 1.00 26.58  ? 195 VAL A C   1 
ATOM   1516 O O   . VAL A 1 195 ? 39.847 21.947  -37.653 1.00 26.53  ? 195 VAL A O   1 
ATOM   1517 C CB  . VAL A 1 195 ? 38.630 22.266  -40.762 1.00 24.80  ? 195 VAL A CB  1 
ATOM   1518 C CG1 . VAL A 1 195 ? 39.692 23.340  -40.578 1.00 24.68  ? 195 VAL A CG1 1 
ATOM   1519 C CG2 . VAL A 1 195 ? 38.798 21.585  -42.104 1.00 24.40  ? 195 VAL A CG2 1 
ATOM   1520 N N   . ALA A 1 196 ? 37.677 22.475  -37.716 1.00 27.60  ? 196 ALA A N   1 
ATOM   1521 C CA  . ALA A 1 196 ? 37.699 23.180  -36.424 1.00 28.83  ? 196 ALA A CA  1 
ATOM   1522 C C   . ALA A 1 196 ? 38.197 22.263  -35.333 1.00 30.22  ? 196 ALA A C   1 
ATOM   1523 O O   . ALA A 1 196 ? 39.123 22.610  -34.575 1.00 30.93  ? 196 ALA A O   1 
ATOM   1524 C CB  . ALA A 1 196 ? 36.319 23.731  -36.068 1.00 28.35  ? 196 ALA A CB  1 
ATOM   1525 N N   . LYS A 1 197 ? 37.612 21.074  -35.264 1.00 31.09  ? 197 LYS A N   1 
ATOM   1526 C CA  . LYS A 1 197 ? 38.002 20.120  -34.243 1.00 33.09  ? 197 LYS A CA  1 
ATOM   1527 C C   . LYS A 1 197 ? 39.464 19.688  -34.427 1.00 34.07  ? 197 LYS A C   1 
ATOM   1528 O O   . LYS A 1 197 ? 40.177 19.538  -33.436 1.00 35.10  ? 197 LYS A O   1 
ATOM   1529 C CB  . LYS A 1 197 ? 37.054 18.933  -34.212 1.00 33.88  ? 197 LYS A CB  1 
ATOM   1530 C CG  . LYS A 1 197 ? 35.657 19.316  -33.732 1.00 34.92  ? 197 LYS A CG  1 
ATOM   1531 C CD  . LYS A 1 197 ? 34.719 18.138  -33.684 1.00 35.91  ? 197 LYS A CD  1 
ATOM   1532 C CE  . LYS A 1 197 ? 34.981 17.247  -32.462 1.00 36.39  ? 197 LYS A CE  1 
ATOM   1533 N NZ  . LYS A 1 197 ? 33.954 16.152  -32.346 1.00 37.79  ? 197 LYS A NZ  1 
ATOM   1534 N N   . HIS A 1 198 ? 39.909 19.517  -35.672 1.00 34.42  ? 198 HIS A N   1 
ATOM   1535 C CA  . HIS A 1 198 ? 41.314 19.143  -35.954 1.00 34.84  ? 198 HIS A CA  1 
ATOM   1536 C C   . HIS A 1 198 ? 42.276 20.208  -35.401 1.00 35.32  ? 198 HIS A C   1 
ATOM   1537 O O   . HIS A 1 198 ? 43.407 19.905  -34.972 1.00 34.59  ? 198 HIS A O   1 
ATOM   1538 C CB  . HIS A 1 198 ? 41.554 18.944  -37.457 1.00 36.27  ? 198 HIS A CB  1 
ATOM   1539 C CG  . HIS A 1 198 ? 43.010 18.838  -37.839 1.00 38.02  ? 198 HIS A CG  1 
ATOM   1540 N ND1 . HIS A 1 198 ? 43.766 17.707  -37.601 1.00 39.89  ? 198 HIS A ND1 1 
ATOM   1541 C CD2 . HIS A 1 198 ? 43.844 19.720  -38.446 1.00 39.67  ? 198 HIS A CD2 1 
ATOM   1542 C CE1 . HIS A 1 198 ? 45.000 17.898  -38.043 1.00 39.47  ? 198 HIS A CE1 1 
ATOM   1543 N NE2 . HIS A 1 198 ? 45.076 19.113  -38.556 1.00 40.05  ? 198 HIS A NE2 1 
ATOM   1544 N N   . LEU A 1 199 ? 41.818 21.452  -35.405 1.00 34.29  ? 199 LEU A N   1 
ATOM   1545 C CA  . LEU A 1 199 ? 42.630 22.571  -34.946 1.00 34.93  ? 199 LEU A CA  1 
ATOM   1546 C C   . LEU A 1 199 ? 42.426 22.864  -33.455 1.00 36.17  ? 199 LEU A C   1 
ATOM   1547 O O   . LEU A 1 199 ? 42.982 23.830  -32.930 1.00 36.97  ? 199 LEU A O   1 
ATOM   1548 C CB  . LEU A 1 199 ? 42.315 23.816  -35.778 1.00 33.37  ? 199 LEU A CB  1 
ATOM   1549 C CG  . LEU A 1 199 ? 42.723 23.706  -37.253 1.00 32.85  ? 199 LEU A CG  1 
ATOM   1550 C CD1 . LEU A 1 199 ? 42.380 24.988  -38.013 1.00 32.03  ? 199 LEU A CD1 1 
ATOM   1551 C CD2 . LEU A 1 199 ? 44.215 23.366  -37.392 1.00 33.27  ? 199 LEU A CD2 1 
ATOM   1552 N N   . GLY A 1 200 ? 41.625 22.043  -32.785 1.00 36.34  ? 200 GLY A N   1 
ATOM   1553 C CA  . GLY A 1 200 ? 41.494 22.137  -31.336 1.00 36.89  ? 200 GLY A CA  1 
ATOM   1554 C C   . GLY A 1 200 ? 40.346 22.957  -30.790 1.00 37.29  ? 200 GLY A C   1 
ATOM   1555 O O   . GLY A 1 200 ? 40.321 23.258  -29.602 1.00 38.25  ? 200 GLY A O   1 
ATOM   1556 N N   . PHE A 1 201 ? 39.380 23.319  -31.626 1.00 36.49  ? 201 PHE A N   1 
ATOM   1557 C CA  . PHE A 1 201 ? 38.207 24.038  -31.132 1.00 37.18  ? 201 PHE A CA  1 
ATOM   1558 C C   . PHE A 1 201 ? 37.030 23.072  -30.906 1.00 37.42  ? 201 PHE A C   1 
ATOM   1559 O O   . PHE A 1 201 ? 36.853 22.108  -31.654 1.00 37.89  ? 201 PHE A O   1 
ATOM   1560 C CB  . PHE A 1 201 ? 37.810 25.154  -32.098 1.00 37.11  ? 201 PHE A CB  1 
ATOM   1561 C CG  . PHE A 1 201 ? 38.955 26.032  -32.525 1.00 37.22  ? 201 PHE A CG  1 
ATOM   1562 C CD1 . PHE A 1 201 ? 39.504 25.918  -33.791 1.00 37.61  ? 201 PHE A CD1 1 
ATOM   1563 C CD2 . PHE A 1 201 ? 39.484 26.970  -31.669 1.00 37.61  ? 201 PHE A CD2 1 
ATOM   1564 C CE1 . PHE A 1 201 ? 40.543 26.735  -34.190 1.00 36.94  ? 201 PHE A CE1 1 
ATOM   1565 C CE2 . PHE A 1 201 ? 40.534 27.782  -32.062 1.00 37.37  ? 201 PHE A CE2 1 
ATOM   1566 C CZ  . PHE A 1 201 ? 41.057 27.668  -33.315 1.00 37.51  ? 201 PHE A CZ  1 
ATOM   1567 N N   . GLN A 1 202 ? 36.244 23.335  -29.867 1.00 37.89  ? 202 GLN A N   1 
ATOM   1568 C CA  . GLN A 1 202 ? 35.187 22.420  -29.413 1.00 37.14  ? 202 GLN A CA  1 
ATOM   1569 C C   . GLN A 1 202 ? 33.802 22.947  -29.731 1.00 36.36  ? 202 GLN A C   1 
ATOM   1570 O O   . GLN A 1 202 ? 32.807 22.300  -29.431 1.00 35.58  ? 202 GLN A O   1 
ATOM   1571 C CB  . GLN A 1 202 ? 35.271 22.205  -27.898 1.00 39.54  ? 202 GLN A CB  1 
ATOM   1572 C CG  . GLN A 1 202 ? 36.633 21.776  -27.408 1.00 41.32  ? 202 GLN A CG  1 
ATOM   1573 C CD  . GLN A 1 202 ? 37.180 20.612  -28.200 1.00 42.89  ? 202 GLN A CD  1 
ATOM   1574 O OE1 . GLN A 1 202 ? 36.522 19.573  -28.322 1.00 44.82  ? 202 GLN A OE1 1 
ATOM   1575 N NE2 . GLN A 1 202 ? 38.383 20.777  -28.746 1.00 44.00  ? 202 GLN A NE2 1 
ATOM   1576 N N   . SER A 1 203 ? 33.712 24.128  -30.322 1.00 34.56  ? 203 SER A N   1 
ATOM   1577 C CA  . SER A 1 203 ? 32.403 24.618  -30.698 1.00 33.36  ? 203 SER A CA  1 
ATOM   1578 C C   . SER A 1 203 ? 32.575 25.579  -31.848 1.00 31.72  ? 203 SER A C   1 
ATOM   1579 O O   . SER A 1 203 ? 33.690 26.026  -32.099 1.00 29.37  ? 203 SER A O   1 
ATOM   1580 C CB  . SER A 1 203 ? 31.748 25.311  -29.509 1.00 33.78  ? 203 SER A CB  1 
ATOM   1581 O OG  . SER A 1 203 ? 32.518 26.430  -29.095 1.00 33.13  ? 203 SER A OG  1 
ATOM   1582 N N   . ALA A 1 204 ? 31.480 25.883  -32.546 1.00 30.35  ? 204 ALA A N   1 
ATOM   1583 C CA  . ALA A 1 204 ? 31.541 26.809  -33.662 1.00 31.54  ? 204 ALA A CA  1 
ATOM   1584 C C   . ALA A 1 204 ? 31.984 28.187  -33.160 1.00 31.61  ? 204 ALA A C   1 
ATOM   1585 O O   . ALA A 1 204 ? 32.818 28.838  -33.781 1.00 30.77  ? 204 ALA A O   1 
ATOM   1586 C CB  . ALA A 1 204 ? 30.198 26.897  -34.386 1.00 30.27  ? 204 ALA A CB  1 
ATOM   1587 N N   . GLU A 1 205 ? 31.424 28.635  -32.038 1.00 32.90  ? 205 GLU A N   1 
ATOM   1588 C CA  . GLU A 1 205 ? 31.772 29.956  -31.514 1.00 34.21  ? 205 GLU A CA  1 
ATOM   1589 C C   . GLU A 1 205 ? 33.274 30.071  -31.255 1.00 33.29  ? 205 GLU A C   1 
ATOM   1590 O O   . GLU A 1 205 ? 33.911 31.070  -31.596 1.00 33.37  ? 205 GLU A O   1 
ATOM   1591 C CB  . GLU A 1 205 ? 31.034 30.238  -30.207 1.00 35.51  ? 205 GLU A CB  1 
ATOM   1592 C CG  . GLU A 1 205 ? 31.700 31.373  -29.433 1.00 37.43  ? 205 GLU A CG  1 
ATOM   1593 C CD  . GLU A 1 205 ? 30.882 31.845  -28.255 1.00 38.97  ? 205 GLU A CD  1 
ATOM   1594 O OE1 . GLU A 1 205 ? 31.265 32.897  -27.667 1.00 43.03  ? 205 GLU A OE1 1 
ATOM   1595 O OE2 . GLU A 1 205 ? 29.859 31.179  -27.950 1.00 40.89  ? 205 GLU A OE2 1 
ATOM   1596 N N   . GLU A 1 206 ? 33.813 29.046  -30.615 1.00 33.42  ? 206 GLU A N   1 
ATOM   1597 C CA  . GLU A 1 206 ? 35.239 28.919  -30.339 1.00 33.68  ? 206 GLU A CA  1 
ATOM   1598 C C   . GLU A 1 206 ? 36.088 28.955  -31.617 1.00 32.15  ? 206 GLU A C   1 
ATOM   1599 O O   . GLU A 1 206 ? 37.130 29.593  -31.678 1.00 29.95  ? 206 GLU A O   1 
ATOM   1600 C CB  . GLU A 1 206 ? 35.442 27.573  -29.672 1.00 36.56  ? 206 GLU A CB  1 
ATOM   1601 C CG  . GLU A 1 206 ? 36.632 27.417  -28.755 1.00 38.84  ? 206 GLU A CG  1 
ATOM   1602 C CD  . GLU A 1 206 ? 36.499 26.145  -27.937 1.00 39.10  ? 206 GLU A CD  1 
ATOM   1603 O OE1 . GLU A 1 206 ? 35.539 26.041  -27.121 1.00 43.29  ? 206 GLU A OE1 1 
ATOM   1604 O OE2 . GLU A 1 206 ? 37.319 25.230  -28.121 1.00 41.40  ? 206 GLU A OE2 1 
ATOM   1605 N N   . ALA A 1 207 ? 35.655 28.228  -32.638 1.00 30.00  ? 207 ALA A N   1 
ATOM   1606 C CA  . ALA A 1 207 ? 36.393 28.170  -33.885 1.00 28.30  ? 207 ALA A CA  1 
ATOM   1607 C C   . ALA A 1 207 ? 36.390 29.530  -34.563 1.00 26.29  ? 207 ALA A C   1 
ATOM   1608 O O   . ALA A 1 207 ? 37.398 29.984  -35.118 1.00 24.31  ? 207 ALA A O   1 
ATOM   1609 C CB  . ALA A 1 207 ? 35.775 27.121  -34.811 1.00 28.91  ? 207 ALA A CB  1 
ATOM   1610 N N   . LEU A 1 208 ? 35.231 30.164  -34.584 1.00 24.33  ? 208 LEU A N   1 
ATOM   1611 C CA  . LEU A 1 208 ? 35.104 31.435  -35.273 1.00 24.47  ? 208 LEU A CA  1 
ATOM   1612 C C   . LEU A 1 208 ? 36.020 32.485  -34.609 1.00 23.48  ? 208 LEU A C   1 
ATOM   1613 O O   . LEU A 1 208 ? 36.746 33.198  -35.285 1.00 22.06  ? 208 LEU A O   1 
ATOM   1614 C CB  . LEU A 1 208 ? 33.663 31.905  -35.226 1.00 24.48  ? 208 LEU A CB  1 
ATOM   1615 C CG  . LEU A 1 208 ? 32.707 31.071  -36.114 1.00 23.06  ? 208 LEU A CG  1 
ATOM   1616 C CD1 . LEU A 1 208 ? 31.270 31.560  -35.964 1.00 24.61  ? 208 LEU A CD1 1 
ATOM   1617 C CD2 . LEU A 1 208 ? 33.138 31.116  -37.513 1.00 23.48  ? 208 LEU A CD2 1 
ATOM   1618 N N   . ARG A 1 209 ? 35.960 32.567  -33.290 1.00 25.85  ? 209 ARG A N   1 
ATOM   1619 C CA  . ARG A 1 209 ? 36.805 33.535  -32.554 1.00 27.56  ? 209 ARG A CA  1 
ATOM   1620 C C   . ARG A 1 209 ? 38.271 33.187  -32.777 1.00 26.77  ? 209 ARG A C   1 
ATOM   1621 O O   . ARG A 1 209 ? 39.106 34.064  -32.977 1.00 27.58  ? 209 ARG A O   1 
ATOM   1622 C CB  . ARG A 1 209 ? 36.479 33.494  -31.076 1.00 31.12  ? 209 ARG A CB  1 
ATOM   1623 C CG  . ARG A 1 209 ? 35.091 34.017  -30.780 1.00 33.44  ? 209 ARG A CG  1 
ATOM   1624 C CD  . ARG A 1 209 ? 35.060 35.419  -30.263 1.00 35.57  ? 209 ARG A CD  1 
ATOM   1625 N NE  . ARG A 1 209 ? 33.713 35.860  -29.887 1.00 36.23  ? 209 ARG A NE  1 
ATOM   1626 C CZ  . ARG A 1 209 ? 33.072 36.885  -30.440 1.00 37.13  ? 209 ARG A CZ  1 
ATOM   1627 N NH1 . ARG A 1 209 ? 33.640 37.609  -31.394 1.00 37.70  ? 209 ARG A NH1 1 
ATOM   1628 N NH2 . ARG A 1 209 ? 31.852 37.193  -30.026 1.00 38.60  ? 209 ARG A NH2 1 
ATOM   1629 N N   . GLY A 1 210 ? 38.548 31.895  -32.767 1.00 26.64  ? 210 GLY A N   1 
ATOM   1630 C CA  . GLY A 1 210 ? 39.893 31.370  -32.942 1.00 26.07  ? 210 GLY A CA  1 
ATOM   1631 C C   . GLY A 1 210 ? 40.497 31.583  -34.301 1.00 25.99  ? 210 GLY A C   1 
ATOM   1632 O O   . GLY A 1 210 ? 41.710 31.586  -34.432 1.00 26.04  ? 210 GLY A O   1 
ATOM   1633 N N   . LEU A 1 211 ? 39.664 31.755  -35.337 1.00 24.26  ? 211 LEU A N   1 
ATOM   1634 C CA  . LEU A 1 211 ? 40.152 31.779  -36.696 1.00 22.12  ? 211 LEU A CA  1 
ATOM   1635 C C   . LEU A 1 211 ? 39.881 33.075  -37.453 1.00 21.56  ? 211 LEU A C   1 
ATOM   1636 O O   . LEU A 1 211 ? 40.402 33.268  -38.546 1.00 21.83  ? 211 LEU A O   1 
ATOM   1637 C CB  . LEU A 1 211 ? 39.525 30.600  -37.501 1.00 21.66  ? 211 LEU A CB  1 
ATOM   1638 C CG  . LEU A 1 211 ? 39.907 29.182  -37.109 1.00 22.37  ? 211 LEU A CG  1 
ATOM   1639 C CD1 . LEU A 1 211 ? 38.995 28.152  -37.837 1.00 23.06  ? 211 LEU A CD1 1 
ATOM   1640 C CD2 . LEU A 1 211 ? 41.371 28.915  -37.449 1.00 23.43  ? 211 LEU A CD2 1 
ATOM   1641 N N   . TYR A 1 212 ? 39.060 33.970  -36.899 1.00 22.08  ? 212 TYR A N   1 
ATOM   1642 C CA  . TYR A 1 212 ? 38.665 35.157  -37.620 1.00 22.16  ? 212 TYR A CA  1 
ATOM   1643 C C   . TYR A 1 212 ? 39.877 36.018  -38.044 1.00 22.03  ? 212 TYR A C   1 
ATOM   1644 O O   . TYR A 1 212 ? 39.869 36.678  -39.073 1.00 22.20  ? 212 TYR A O   1 
ATOM   1645 C CB  . TYR A 1 212 ? 37.651 36.014  -36.836 1.00 22.91  ? 212 TYR A CB  1 
ATOM   1646 C CG  . TYR A 1 212 ? 37.069 37.038  -37.750 1.00 23.27  ? 212 TYR A CG  1 
ATOM   1647 C CD1 . TYR A 1 212 ? 36.043 36.700  -38.626 1.00 23.37  ? 212 TYR A CD1 1 
ATOM   1648 C CD2 . TYR A 1 212 ? 37.592 38.314  -37.833 1.00 23.37  ? 212 TYR A CD2 1 
ATOM   1649 C CE1 . TYR A 1 212 ? 35.559 37.609  -39.519 1.00 22.30  ? 212 TYR A CE1 1 
ATOM   1650 C CE2 . TYR A 1 212 ? 37.114 39.227  -38.739 1.00 23.30  ? 212 TYR A CE2 1 
ATOM   1651 C CZ  . TYR A 1 212 ? 36.094 38.883  -39.558 1.00 22.54  ? 212 TYR A CZ  1 
ATOM   1652 O OH  . TYR A 1 212 ? 35.627 39.788  -40.447 1.00 23.34  ? 212 TYR A OH  1 
ATOM   1653 N N   . GLY A 1 213 ? 40.913 36.008  -37.229 1.00 22.10  ? 213 GLY A N   1 
ATOM   1654 C CA  . GLY A 1 213 ? 42.102 36.767  -37.532 1.00 22.96  ? 213 GLY A CA  1 
ATOM   1655 C C   . GLY A 1 213 ? 42.821 36.349  -38.788 1.00 24.54  ? 213 GLY A C   1 
ATOM   1656 O O   . GLY A 1 213 ? 43.683 37.084  -39.263 1.00 23.64  ? 213 GLY A O   1 
ATOM   1657 N N   . ARG A 1 214 ? 42.462 35.187  -39.345 1.00 24.61  ? 214 ARG A N   1 
ATOM   1658 C CA  . ARG A 1 214 ? 43.052 34.703  -40.585 1.00 26.48  ? 214 ARG A CA  1 
ATOM   1659 C C   . ARG A 1 214 ? 42.268 35.065  -41.848 1.00 26.17  ? 214 ARG A C   1 
ATOM   1660 O O   . ARG A 1 214 ? 42.776 34.887  -42.940 1.00 25.75  ? 214 ARG A O   1 
ATOM   1661 C CB  . ARG A 1 214 ? 43.197 33.189  -40.542 1.00 28.75  ? 214 ARG A CB  1 
ATOM   1662 C CG  . ARG A 1 214 ? 44.150 32.609  -39.473 1.00 29.95  ? 214 ARG A CG  1 
ATOM   1663 C CD  . ARG A 1 214 ? 43.695 31.236  -39.226 1.00 31.39  ? 214 ARG A CD  1 
ATOM   1664 N NE  . ARG A 1 214 ? 44.540 30.185  -38.686 1.00 33.94  ? 214 ARG A NE  1 
ATOM   1665 C CZ  . ARG A 1 214 ? 45.373 29.418  -39.399 1.00 33.33  ? 214 ARG A CZ  1 
ATOM   1666 N NH1 . ARG A 1 214 ? 45.710 29.671  -40.674 1.00 34.19  ? 214 ARG A NH1 1 
ATOM   1667 N NH2 . ARG A 1 214 ? 45.937 28.433  -38.788 1.00 34.79  ? 214 ARG A NH2 1 
ATOM   1668 N N   . VAL A 1 215 ? 41.039 35.560  -41.732 1.00 24.82  ? 215 VAL A N   1 
ATOM   1669 C CA  . VAL A 1 215 ? 40.299 35.894  -42.940 1.00 26.20  ? 215 VAL A CA  1 
ATOM   1670 C C   . VAL A 1 215 ? 40.617 37.300  -43.420 1.00 27.62  ? 215 VAL A C   1 
ATOM   1671 O O   . VAL A 1 215 ? 41.190 38.109  -42.673 1.00 25.68  ? 215 VAL A O   1 
ATOM   1672 C CB  . VAL A 1 215 ? 38.786 35.730  -42.744 1.00 24.95  ? 215 VAL A CB  1 
ATOM   1673 C CG1 . VAL A 1 215 ? 38.503 34.391  -42.141 1.00 24.98  ? 215 VAL A CG1 1 
ATOM   1674 C CG2 . VAL A 1 215 ? 38.216 36.846  -41.884 1.00 25.26  ? 215 VAL A CG2 1 
ATOM   1675 N N   . ARG A 1 216 ? 40.239 37.595  -44.656 1.00 27.71  ? 216 ARG A N   1 
ATOM   1676 C CA  . ARG A 1 216 ? 40.522 38.896  -45.232 1.00 31.62  ? 216 ARG A CA  1 
ATOM   1677 C C   . ARG A 1 216 ? 39.620 39.977  -44.651 1.00 31.59  ? 216 ARG A C   1 
ATOM   1678 O O   . ARG A 1 216 ? 38.510 39.707  -44.171 1.00 29.65  ? 216 ARG A O   1 
ATOM   1679 C CB  . ARG A 1 216 ? 40.398 38.859  -46.751 1.00 33.93  ? 216 ARG A CB  1 
ATOM   1680 C CG  . ARG A 1 216 ? 39.013 39.072  -47.291 1.00 36.35  ? 216 ARG A CG  1 
ATOM   1681 C CD  . ARG A 1 216 ? 38.934 38.998  -48.800 1.00 38.26  ? 216 ARG A CD  1 
ATOM   1682 N NE  . ARG A 1 216 ? 40.238 39.226  -49.397 1.00 40.90  ? 216 ARG A NE  1 
ATOM   1683 C CZ  . ARG A 1 216 ? 40.526 38.988  -50.670 1.00 42.48  ? 216 ARG A CZ  1 
ATOM   1684 N NH1 . ARG A 1 216 ? 39.590 38.543  -51.501 1.00 42.79  ? 216 ARG A NH1 1 
ATOM   1685 N NH2 . ARG A 1 216 ? 41.759 39.217  -51.117 1.00 43.24  ? 216 ARG A NH2 1 
ATOM   1686 N N   . LYS A 1 217 ? 40.099 41.215  -44.713 1.00 33.45  ? 217 LYS A N   1 
ATOM   1687 C CA  . LYS A 1 217 ? 39.318 42.338  -44.212 1.00 33.34  ? 217 LYS A CA  1 
ATOM   1688 C C   . LYS A 1 217 ? 37.933 42.341  -44.829 1.00 31.79  ? 217 LYS A C   1 
ATOM   1689 O O   . LYS A 1 217 ? 37.787 42.255  -46.039 1.00 32.77  ? 217 LYS A O   1 
ATOM   1690 C CB  . LYS A 1 217 ? 40.023 43.682  -44.462 1.00 34.93  ? 217 LYS A CB  1 
ATOM   1691 C CG  . LYS A 1 217 ? 39.606 44.765  -43.464 1.00 36.37  ? 217 LYS A CG  1 
ATOM   1692 C CD  . LYS A 1 217 ? 40.277 46.127  -43.759 1.00 37.14  ? 217 LYS A CD  1 
ATOM   1693 C CE  . LYS A 1 217 ? 39.520 46.914  -44.843 1.00 38.50  ? 217 LYS A CE  1 
ATOM   1694 N NZ  . LYS A 1 217 ? 39.879 48.390  -44.826 1.00 39.40  ? 217 LYS A NZ  1 
ATOM   1695 N N   . GLY A 1 218 ? 36.912 42.385  -43.979 1.00 31.10  ? 218 GLY A N   1 
ATOM   1696 C CA  . GLY A 1 218 ? 35.540 42.460  -44.447 1.00 29.99  ? 218 GLY A CA  1 
ATOM   1697 C C   . GLY A 1 218 ? 34.850 41.109  -44.525 1.00 29.30  ? 218 GLY A C   1 
ATOM   1698 O O   . GLY A 1 218 ? 33.641 41.043  -44.728 1.00 28.98  ? 218 GLY A O   1 
ATOM   1699 N N   . ALA A 1 219 ? 35.598 40.017  -44.366 1.00 27.52  ? 219 ALA A N   1 
ATOM   1700 C CA  . ALA A 1 219 ? 35.027 38.693  -44.639 1.00 25.82  ? 219 ALA A CA  1 
ATOM   1701 C C   . ALA A 1 219 ? 34.110 38.169  -43.547 1.00 24.29  ? 219 ALA A C   1 
ATOM   1702 O O   . ALA A 1 219 ? 34.222 38.524  -42.360 1.00 22.57  ? 219 ALA A O   1 
ATOM   1703 C CB  . ALA A 1 219 ? 36.133 37.674  -44.907 1.00 25.77  ? 219 ALA A CB  1 
ATOM   1704 N N   . VAL A 1 220 ? 33.208 37.292  -43.960 1.00 22.94  ? 220 VAL A N   1 
ATOM   1705 C CA  . VAL A 1 220 ? 32.361 36.555  -43.046 1.00 22.86  ? 220 VAL A CA  1 
ATOM   1706 C C   . VAL A 1 220 ? 32.789 35.091  -42.984 1.00 22.32  ? 220 VAL A C   1 
ATOM   1707 O O   . VAL A 1 220 ? 32.897 34.414  -44.017 1.00 22.28  ? 220 VAL A O   1 
ATOM   1708 C CB  . VAL A 1 220 ? 30.871 36.642  -43.446 1.00 24.46  ? 220 VAL A CB  1 
ATOM   1709 C CG1 . VAL A 1 220 ? 30.027 35.900  -42.426 1.00 24.85  ? 220 VAL A CG1 1 
ATOM   1710 C CG2 . VAL A 1 220 ? 30.456 38.116  -43.570 1.00 26.47  ? 220 VAL A CG2 1 
ATOM   1711 N N   . LEU A 1 221 ? 33.072 34.646  -41.774 1.00 20.60  ? 221 LEU A N   1 
ATOM   1712 C CA  . LEU A 1 221 ? 33.471 33.290  -41.475 1.00 21.19  ? 221 LEU A CA  1 
ATOM   1713 C C   . LEU A 1 221 ? 32.277 32.529  -40.946 1.00 21.34  ? 221 LEU A C   1 
ATOM   1714 O O   . LEU A 1 221 ? 31.605 32.974  -40.019 1.00 20.78  ? 221 LEU A O   1 
ATOM   1715 C CB  . LEU A 1 221 ? 34.597 33.275  -40.462 1.00 20.88  ? 221 LEU A CB  1 
ATOM   1716 C CG  . LEU A 1 221 ? 35.275 31.955  -40.106 1.00 21.63  ? 221 LEU A CG  1 
ATOM   1717 C CD1 . LEU A 1 221 ? 35.952 31.251  -41.311 1.00 20.32  ? 221 LEU A CD1 1 
ATOM   1718 C CD2 . LEU A 1 221 ? 36.286 32.221  -39.010 1.00 21.62  ? 221 LEU A CD2 1 
ATOM   1719 N N   . VAL A 1 222 ? 32.001 31.388  -41.562 1.00 20.30  ? 222 VAL A N   1 
ATOM   1720 C CA  . VAL A 1 222 ? 30.833 30.576  -41.234 1.00 20.30  ? 222 VAL A CA  1 
ATOM   1721 C C   . VAL A 1 222 ? 31.224 29.165  -40.829 1.00 20.29  ? 222 VAL A C   1 
ATOM   1722 O O   . VAL A 1 222 ? 32.033 28.514  -41.528 1.00 20.40  ? 222 VAL A O   1 
ATOM   1723 C CB  . VAL A 1 222 ? 29.924 30.447  -42.482 1.00 19.55  ? 222 VAL A CB  1 
ATOM   1724 C CG1 . VAL A 1 222 ? 28.699 29.621  -42.181 1.00 20.73  ? 222 VAL A CG1 1 
ATOM   1725 C CG2 . VAL A 1 222 ? 29.577 31.831  -43.082 1.00 19.99  ? 222 VAL A CG2 1 
ATOM   1726 N N   . CYS A 1 223 ? 30.660 28.676  -39.726 1.00 19.93  ? 223 CYS A N   1 
ATOM   1727 C CA  . CYS A 1 223 ? 30.903 27.326  -39.264 1.00 21.66  ? 223 CYS A CA  1 
ATOM   1728 C C   . CYS A 1 223 ? 29.602 26.636  -38.832 1.00 23.89  ? 223 CYS A C   1 
ATOM   1729 O O   . CYS A 1 223 ? 28.977 27.025  -37.838 1.00 24.33  ? 223 CYS A O   1 
ATOM   1730 C CB  . CYS A 1 223 ? 31.942 27.303  -38.126 1.00 21.54  ? 223 CYS A CB  1 
ATOM   1731 S SG  . CYS A 1 223 ? 32.453 25.676  -37.589 1.00 23.88  ? 223 CYS A SG  1 
ATOM   1732 N N   . ALA A 1 224 ? 29.209 25.614  -39.583 1.00 23.46  ? 224 ALA A N   1 
ATOM   1733 C CA  . ALA A 1 224 ? 28.053 24.785  -39.241 1.00 23.58  ? 224 ALA A CA  1 
ATOM   1734 C C   . ALA A 1 224 ? 28.503 23.682  -38.311 1.00 24.28  ? 224 ALA A C   1 
ATOM   1735 O O   . ALA A 1 224 ? 29.597 23.112  -38.498 1.00 24.38  ? 224 ALA A O   1 
ATOM   1736 C CB  . ALA A 1 224 ? 27.420 24.221  -40.518 1.00 23.86  ? 224 ALA A CB  1 
ATOM   1737 N N   . TRP A 1 225 ? 27.712 23.403  -37.274 1.00 23.48  ? 225 TRP A N   1 
ATOM   1738 C CA  . TRP A 1 225 ? 28.096 22.441  -36.249 1.00 26.42  ? 225 TRP A CA  1 
ATOM   1739 C C   . TRP A 1 225 ? 27.010 21.402  -36.020 1.00 28.43  ? 225 TRP A C   1 
ATOM   1740 O O   . TRP A 1 225 ? 26.639 21.122  -34.892 1.00 28.48  ? 225 TRP A O   1 
ATOM   1741 C CB  . TRP A 1 225 ? 28.446 23.161  -34.941 1.00 26.09  ? 225 TRP A CB  1 
ATOM   1742 C CG  . TRP A 1 225 ? 29.410 22.441  -34.100 1.00 26.08  ? 225 TRP A CG  1 
ATOM   1743 C CD1 . TRP A 1 225 ? 29.137 21.507  -33.166 1.00 26.29  ? 225 TRP A CD1 1 
ATOM   1744 C CD2 . TRP A 1 225 ? 30.839 22.598  -34.105 1.00 25.89  ? 225 TRP A CD2 1 
ATOM   1745 N NE1 . TRP A 1 225 ? 30.300 21.067  -32.578 1.00 26.65  ? 225 TRP A NE1 1 
ATOM   1746 C CE2 . TRP A 1 225 ? 31.360 21.723  -33.149 1.00 25.63  ? 225 TRP A CE2 1 
ATOM   1747 C CE3 . TRP A 1 225 ? 31.727 23.405  -34.825 1.00 25.71  ? 225 TRP A CE3 1 
ATOM   1748 C CZ2 . TRP A 1 225 ? 32.728 21.619  -32.892 1.00 26.15  ? 225 TRP A CZ2 1 
ATOM   1749 C CZ3 . TRP A 1 225 ? 33.091 23.296  -34.564 1.00 25.93  ? 225 TRP A CZ3 1 
ATOM   1750 C CH2 . TRP A 1 225 ? 33.566 22.413  -33.611 1.00 25.88  ? 225 TRP A CH2 1 
ATOM   1751 N N   . ALA A 1 226 ? 26.500 20.860  -37.130 1.00 31.18  ? 226 ALA A N   1 
ATOM   1752 C CA  . ALA A 1 226 ? 25.505 19.765  -37.145 1.00 32.07  ? 226 ALA A CA  1 
ATOM   1753 C C   . ALA A 1 226 ? 24.243 20.083  -36.367 1.00 33.40  ? 226 ALA A C   1 
ATOM   1754 O O   . ALA A 1 226 ? 23.514 21.039  -36.682 1.00 34.80  ? 226 ALA A O   1 
ATOM   1755 C CB  . ALA A 1 226 ? 26.150 18.475  -36.626 1.00 33.07  ? 226 ALA A CB  1 
ATOM   1756 N N   . GLU A 1 227 ? 23.969 19.278  -35.345 1.00 34.88  ? 227 GLU A N   1 
ATOM   1757 C CA  . GLU A 1 227 ? 22.712 19.414  -34.620 1.00 35.42  ? 227 GLU A CA  1 
ATOM   1758 C C   . GLU A 1 227 ? 22.741 20.647  -33.768 1.00 35.21  ? 227 GLU A C   1 
ATOM   1759 O O   . GLU A 1 227 ? 21.707 21.042  -33.227 1.00 34.90  ? 227 GLU A O   1 
ATOM   1760 C CB  . GLU A 1 227 ? 22.443 18.200  -33.737 1.00 37.40  ? 227 GLU A CB  1 
ATOM   1761 C CG  . GLU A 1 227 ? 22.216 16.928  -34.533 1.00 40.21  ? 227 GLU A CG  1 
ATOM   1762 C CD  . GLU A 1 227 ? 23.519 16.380  -35.066 1.00 41.52  ? 227 GLU A CD  1 
ATOM   1763 O OE1 . GLU A 1 227 ? 24.558 16.632  -34.392 1.00 43.19  ? 227 GLU A OE1 1 
ATOM   1764 O OE2 . GLU A 1 227 ? 23.499 15.723  -36.137 1.00 43.27  ? 227 GLU A OE2 1 
ATOM   1765 N N   . GLU A 1 228 ? 23.918 21.264  -33.648 1.00 33.94  ? 228 GLU A N   1 
ATOM   1766 C CA  . GLU A 1 228 ? 24.040 22.492  -32.883 1.00 33.99  ? 228 GLU A CA  1 
ATOM   1767 C C   . GLU A 1 228 ? 23.786 23.726  -33.741 1.00 32.10  ? 228 GLU A C   1 
ATOM   1768 O O   . GLU A 1 228 ? 23.923 24.862  -33.271 1.00 33.21  ? 228 GLU A O   1 
ATOM   1769 C CB  . GLU A 1 228 ? 25.407 22.566  -32.192 1.00 35.81  ? 228 GLU A CB  1 
ATOM   1770 C CG  . GLU A 1 228 ? 25.569 21.600  -31.016 1.00 37.90  ? 228 GLU A CG  1 
ATOM   1771 C CD  . GLU A 1 228 ? 26.921 21.725  -30.300 1.00 39.11  ? 228 GLU A CD  1 
ATOM   1772 O OE1 . GLU A 1 228 ? 27.500 22.841  -30.262 1.00 42.86  ? 228 GLU A OE1 1 
ATOM   1773 O OE2 . GLU A 1 228 ? 27.426 20.707  -29.753 1.00 42.49  ? 228 GLU A OE2 1 
ATOM   1774 N N   . GLY A 1 229 ? 23.380 23.513  -34.985 1.00 29.30  ? 229 GLY A N   1 
ATOM   1775 C CA  . GLY A 1 229 ? 23.089 24.599  -35.891 1.00 27.10  ? 229 GLY A CA  1 
ATOM   1776 C C   . GLY A 1 229 ? 24.314 25.162  -36.588 1.00 26.48  ? 229 GLY A C   1 
ATOM   1777 O O   . GLY A 1 229 ? 25.265 24.433  -36.930 1.00 26.86  ? 229 GLY A O   1 
ATOM   1778 N N   . ALA A 1 230 ? 24.294 26.457  -36.824 1.00 23.35  ? 230 ALA A N   1 
ATOM   1779 C CA  . ALA A 1 230 ? 25.404 27.133  -37.518 1.00 23.37  ? 230 ALA A CA  1 
ATOM   1780 C C   . ALA A 1 230 ? 25.644 28.541  -36.973 1.00 23.36  ? 230 ALA A C   1 
ATOM   1781 O O   . ALA A 1 230 ? 24.698 29.202  -36.554 1.00 22.40  ? 230 ALA A O   1 
ATOM   1782 C CB  . ALA A 1 230 ? 25.119 27.224  -38.943 1.00 23.79  ? 230 ALA A CB  1 
ATOM   1783 N N   . ASP A 1 231 ? 26.906 28.986  -37.034 1.00 21.66  ? 231 ASP A N   1 
ATOM   1784 C CA  . ASP A 1 231 ? 27.329 30.301  -36.563 1.00 22.69  ? 231 ASP A CA  1 
ATOM   1785 C C   . ASP A 1 231 ? 28.132 31.024  -37.638 1.00 22.58  ? 231 ASP A C   1 
ATOM   1786 O O   . ASP A 1 231 ? 28.702 30.391  -38.539 1.00 21.11  ? 231 ASP A O   1 
ATOM   1787 C CB  . ASP A 1 231 ? 28.227 30.147  -35.313 1.00 25.03  ? 231 ASP A CB  1 
ATOM   1788 C CG  . ASP A 1 231 ? 27.493 29.642  -34.090 1.00 28.54  ? 231 ASP A CG  1 
ATOM   1789 O OD1 . ASP A 1 231 ? 26.614 28.772  -34.186 1.00 30.74  ? 231 ASP A OD1 1 
ATOM   1790 O OD2 . ASP A 1 231 ? 27.815 30.015  -32.940 1.00 31.81  ? 231 ASP A OD2 1 
ATOM   1791 N N   . ALA A 1 232 ? 28.191 32.349  -37.543 1.00 20.65  ? 232 ALA A N   1 
ATOM   1792 C CA  . ALA A 1 232 ? 28.969 33.176  -38.406 1.00 21.64  ? 232 ALA A CA  1 
ATOM   1793 C C   . ALA A 1 232 ? 29.521 34.344  -37.597 1.00 23.41  ? 232 ALA A C   1 
ATOM   1794 O O   . ALA A 1 232 ? 28.989 34.692  -36.542 1.00 22.95  ? 232 ALA A O   1 
ATOM   1795 C CB  . ALA A 1 232 ? 28.166 33.706  -39.544 1.00 21.54  ? 232 ALA A CB  1 
ATOM   1796 N N   . LEU A 1 233 ? 30.583 34.921  -38.122 1.00 23.22  ? 233 LEU A N   1 
ATOM   1797 C CA  . LEU A 1 233 ? 31.293 36.038  -37.484 1.00 24.04  ? 233 LEU A CA  1 
ATOM   1798 C C   . LEU A 1 233 ? 31.816 36.902  -38.602 1.00 24.16  ? 233 LEU A C   1 
ATOM   1799 O O   . LEU A 1 233 ? 32.498 36.412  -39.497 1.00 23.51  ? 233 LEU A O   1 
ATOM   1800 C CB  . LEU A 1 233 ? 32.445 35.504  -36.629 1.00 23.88  ? 233 LEU A CB  1 
ATOM   1801 C CG  . LEU A 1 233 ? 33.267 36.543  -35.858 1.00 24.70  ? 233 LEU A CG  1 
ATOM   1802 C CD1 . LEU A 1 233 ? 32.332 37.374  -34.937 1.00 25.84  ? 233 LEU A CD1 1 
ATOM   1803 C CD2 . LEU A 1 233 ? 34.307 35.813  -35.064 1.00 24.62  ? 233 LEU A CD2 1 
ATOM   1804 N N   . GLY A 1 234 ? 31.474 38.190  -38.555 1.00 24.23  ? 234 GLY A N   1 
ATOM   1805 C CA  . GLY A 1 234 ? 31.848 39.153  -39.545 1.00 26.35  ? 234 GLY A CA  1 
ATOM   1806 C C   . GLY A 1 234 ? 32.672 40.273  -38.904 1.00 27.45  ? 234 GLY A C   1 
ATOM   1807 O O   . GLY A 1 234 ? 33.045 40.196  -37.716 1.00 26.53  ? 234 GLY A O   1 
ATOM   1808 N N   . PRO A 1 235 ? 33.002 41.279  -39.700 1.00 29.53  ? 235 PRO A N   1 
ATOM   1809 C CA  . PRO A 1 235 ? 33.936 42.326  -39.262 1.00 30.74  ? 235 PRO A CA  1 
ATOM   1810 C C   . PRO A 1 235 ? 33.488 43.063  -38.006 1.00 33.05  ? 235 PRO A C   1 
ATOM   1811 O O   . PRO A 1 235 ? 34.335 43.609  -37.305 1.00 35.05  ? 235 PRO A O   1 
ATOM   1812 C CB  . PRO A 1 235 ? 33.979 43.281  -40.445 1.00 30.57  ? 235 PRO A CB  1 
ATOM   1813 C CG  . PRO A 1 235 ? 33.478 42.536  -41.570 1.00 30.91  ? 235 PRO A CG  1 
ATOM   1814 C CD  . PRO A 1 235 ? 32.549 41.490  -41.078 1.00 29.53  ? 235 PRO A CD  1 
ATOM   1815 N N   . ASP A 1 236 ? 32.198 43.038  -37.675 1.00 34.01  ? 236 ASP A N   1 
ATOM   1816 C CA  . ASP A 1 236 ? 31.726 43.808  -36.517 1.00 33.04  ? 236 ASP A CA  1 
ATOM   1817 C C   . ASP A 1 236 ? 31.922 43.084  -35.202 1.00 33.41  ? 236 ASP A C   1 
ATOM   1818 O O   . ASP A 1 236 ? 31.639 43.629  -34.130 1.00 33.49  ? 236 ASP A O   1 
ATOM   1819 C CB  . ASP A 1 236 ? 30.294 44.296  -36.712 1.00 35.05  ? 236 ASP A CB  1 
ATOM   1820 C CG  . ASP A 1 236 ? 29.266 43.178  -36.718 1.00 35.73  ? 236 ASP A CG  1 
ATOM   1821 O OD1 . ASP A 1 236 ? 29.584 41.998  -36.389 1.00 34.84  ? 236 ASP A OD1 1 
ATOM   1822 O OD2 . ASP A 1 236 ? 28.083 43.432  -37.026 1.00 37.33  ? 236 ASP A OD2 1 
ATOM   1823 N N   . GLY A 1 237 ? 32.433 41.855  -35.273 1.00 30.68  ? 237 GLY A N   1 
ATOM   1824 C CA  . GLY A 1 237 ? 32.742 41.090  -34.083 1.00 31.31  ? 237 GLY A CA  1 
ATOM   1825 C C   . GLY A 1 237 ? 31.549 40.490  -33.375 1.00 29.92  ? 237 GLY A C   1 
ATOM   1826 O O   . GLY A 1 237 ? 31.700 39.911  -32.318 1.00 29.63  ? 237 GLY A O   1 
ATOM   1827 N N   . LYS A 1 238 ? 30.361 40.607  -33.962 1.00 30.99  ? 238 LYS A N   1 
ATOM   1828 C CA  . LYS A 1 238 ? 29.159 40.006  -33.376 1.00 32.17  ? 238 LYS A CA  1 
ATOM   1829 C C   . LYS A 1 238 ? 28.972 38.553  -33.851 1.00 31.01  ? 238 LYS A C   1 
ATOM   1830 O O   . LYS A 1 238 ? 28.801 38.307  -35.042 1.00 31.02  ? 238 LYS A O   1 
ATOM   1831 C CB  . LYS A 1 238 ? 27.927 40.847  -33.738 1.00 34.14  ? 238 LYS A CB  1 
ATOM   1832 C CG  . LYS A 1 238 ? 27.999 42.308  -33.233 1.00 35.49  ? 238 LYS A CG  1 
ATOM   1833 C CD  . LYS A 1 238 ? 26.845 43.165  -33.761 1.00 35.89  ? 238 LYS A CD  1 
ATOM   1834 C CE  . LYS A 1 238 ? 27.124 44.665  -33.597 1.00 36.77  ? 238 LYS A CE  1 
ATOM   1835 N NZ  . LYS A 1 238 ? 26.635 45.460  -34.779 1.00 37.31  ? 238 LYS A NZ  1 
ATOM   1836 N N   . LEU A 1 239 ? 29.022 37.616  -32.916 1.00 30.79  ? 239 LEU A N   1 
ATOM   1837 C CA  . LEU A 1 239 ? 28.752 36.233  -33.200 1.00 31.04  ? 239 LEU A CA  1 
ATOM   1838 C C   . LEU A 1 239 ? 27.281 36.096  -33.555 1.00 30.69  ? 239 LEU A C   1 
ATOM   1839 O O   . LEU A 1 239 ? 26.412 36.576  -32.816 1.00 29.55  ? 239 LEU A O   1 
ATOM   1840 C CB  . LEU A 1 239 ? 29.063 35.367  -31.996 1.00 31.63  ? 239 LEU A CB  1 
ATOM   1841 C CG  . LEU A 1 239 ? 29.081 33.864  -32.257 1.00 32.99  ? 239 LEU A CG  1 
ATOM   1842 C CD1 . LEU A 1 239 ? 30.288 33.470  -33.107 1.00 34.42  ? 239 LEU A CD1 1 
ATOM   1843 C CD2 . LEU A 1 239 ? 29.095 33.102  -30.963 1.00 33.31  ? 239 LEU A CD2 1 
ATOM   1844 N N   . LEU A 1 240 ? 27.000 35.466  -34.692 1.00 28.66  ? 240 LEU A N   1 
ATOM   1845 C CA  . LEU A 1 240 ? 25.609 35.189  -35.081 1.00 27.86  ? 240 LEU A CA  1 
ATOM   1846 C C   . LEU A 1 240 ? 25.381 33.687  -35.071 1.00 26.86  ? 240 LEU A C   1 
ATOM   1847 O O   . LEU A 1 240 ? 26.313 32.896  -35.270 1.00 23.97  ? 240 LEU A O   1 
ATOM   1848 C CB  . LEU A 1 240 ? 25.306 35.777  -36.444 1.00 27.89  ? 240 LEU A CB  1 
ATOM   1849 C CG  . LEU A 1 240 ? 25.645 37.245  -36.620 1.00 28.84  ? 240 LEU A CG  1 
ATOM   1850 C CD1 . LEU A 1 240 ? 25.520 37.657  -38.050 1.00 28.07  ? 240 LEU A CD1 1 
ATOM   1851 C CD2 . LEU A 1 240 ? 24.738 38.086  -35.730 1.00 29.17  ? 240 LEU A CD2 1 
ATOM   1852 N N   . HIS A 1 241 ? 24.143 33.285  -34.799 1.00 26.20  ? 241 HIS A N   1 
ATOM   1853 C CA  . HIS A 1 241 ? 23.824 31.884  -34.632 1.00 25.95  ? 241 HIS A CA  1 
ATOM   1854 C C   . HIS A 1 241 ? 22.408 31.582  -35.158 1.00 26.98  ? 241 HIS A C   1 
ATOM   1855 O O   . HIS A 1 241 ? 21.487 32.437  -35.063 1.00 23.94  ? 241 HIS A O   1 
ATOM   1856 C CB  . HIS A 1 241 ? 23.910 31.492  -33.163 1.00 27.16  ? 241 HIS A CB  1 
ATOM   1857 C CG  . HIS A 1 241 ? 23.407 30.108  -32.863 1.00 26.75  ? 241 HIS A CG  1 
ATOM   1858 N ND1 . HIS A 1 241 ? 24.153 28.977  -33.110 1.00 26.42  ? 241 HIS A ND1 1 
ATOM   1859 C CD2 . HIS A 1 241 ? 22.217 29.671  -32.376 1.00 27.39  ? 241 HIS A CD2 1 
ATOM   1860 C CE1 . HIS A 1 241 ? 23.457 27.906  -32.772 1.00 27.65  ? 241 HIS A CE1 1 
ATOM   1861 N NE2 . HIS A 1 241 ? 22.273 28.297  -32.328 1.00 27.23  ? 241 HIS A NE2 1 
ATOM   1862 N N   . SER A 1 242 ? 22.267 30.388  -35.741 1.00 24.92  ? 242 SER A N   1 
ATOM   1863 C CA  . SER A 1 242 ? 20.955 29.756  -35.968 1.00 24.62  ? 242 SER A CA  1 
ATOM   1864 C C   . SER A 1 242 ? 20.969 28.337  -35.402 1.00 24.53  ? 242 SER A C   1 
ATOM   1865 O O   . SER A 1 242 ? 21.947 27.588  -35.546 1.00 23.91  ? 242 SER A O   1 
ATOM   1866 C CB  . SER A 1 242 ? 20.563 29.765  -37.456 1.00 25.74  ? 242 SER A CB  1 
ATOM   1867 O OG  . SER A 1 242 ? 19.316 29.112  -37.686 1.00 24.68  ? 242 SER A OG  1 
ATOM   1868 N N   . ASP A 1 243 ? 19.882 27.983  -34.704 1.00 23.66  ? 243 ASP A N   1 
ATOM   1869 C CA  . ASP A 1 243 ? 19.657 26.655  -34.212 1.00 23.65  ? 243 ASP A CA  1 
ATOM   1870 C C   . ASP A 1 243 ? 19.423 25.786  -35.457 1.00 22.03  ? 243 ASP A C   1 
ATOM   1871 O O   . ASP A 1 243 ? 19.032 26.291  -36.482 1.00 21.17  ? 243 ASP A O   1 
ATOM   1872 C CB  . ASP A 1 243 ? 18.383 26.602  -33.369 1.00 25.11  ? 243 ASP A CB  1 
ATOM   1873 C CG  . ASP A 1 243 ? 18.556 27.167  -31.972 1.00 27.39  ? 243 ASP A CG  1 
ATOM   1874 O OD1 . ASP A 1 243 ? 19.699 27.535  -31.586 1.00 26.41  ? 243 ASP A OD1 1 
ATOM   1875 O OD2 . ASP A 1 243 ? 17.588 27.258  -31.182 1.00 26.52  ? 243 ASP A OD2 1 
ATOM   1876 N N   . ALA A 1 244 ? 19.679 24.496  -35.352 1.00 23.62  ? 244 ALA A N   1 
ATOM   1877 C CA  . ALA A 1 244 ? 19.343 23.555  -36.443 1.00 24.24  ? 244 ALA A CA  1 
ATOM   1878 C C   . ALA A 1 244 ? 17.813 23.479  -36.604 1.00 24.14  ? 244 ALA A C   1 
ATOM   1879 O O   . ALA A 1 244 ? 17.065 23.752  -35.634 1.00 24.81  ? 244 ALA A O   1 
ATOM   1880 C CB  . ALA A 1 244 ? 19.898 22.175  -36.135 1.00 23.98  ? 244 ALA A CB  1 
ATOM   1881 N N   . PHE A 1 245 ? 17.380 23.106  -37.809 1.00 24.58  ? 245 PHE A N   1 
ATOM   1882 C CA  . PHE A 1 245 ? 15.964 22.816  -38.104 1.00 25.09  ? 245 PHE A CA  1 
ATOM   1883 C C   . PHE A 1 245 ? 15.742 21.409  -38.605 1.00 22.82  ? 245 PHE A C   1 
ATOM   1884 O O   . PHE A 1 245 ? 15.463 21.203  -39.787 1.00 21.84  ? 245 PHE A O   1 
ATOM   1885 C CB  . PHE A 1 245 ? 15.445 23.794  -39.112 1.00 27.69  ? 245 PHE A CB  1 
ATOM   1886 C CG  . PHE A 1 245 ? 15.281 25.160  -38.545 1.00 28.80  ? 245 PHE A CG  1 
ATOM   1887 C CD1 . PHE A 1 245 ? 16.328 26.055  -38.576 1.00 28.66  ? 245 PHE A CD1 1 
ATOM   1888 C CD2 . PHE A 1 245 ? 14.096 25.509  -37.868 1.00 30.10  ? 245 PHE A CD2 1 
ATOM   1889 C CE1 . PHE A 1 245 ? 16.196 27.319  -38.026 1.00 29.92  ? 245 PHE A CE1 1 
ATOM   1890 C CE2 . PHE A 1 245 ? 13.948 26.751  -37.326 1.00 29.24  ? 245 PHE A CE2 1 
ATOM   1891 C CZ  . PHE A 1 245 ? 15.004 27.674  -37.401 1.00 30.19  ? 245 PHE A CZ  1 
ATOM   1892 N N   . PRO A 1 246 ? 15.835 20.460  -37.695 1.00 23.93  ? 246 PRO A N   1 
ATOM   1893 C CA  . PRO A 1 246 ? 15.675 19.072  -38.046 1.00 25.52  ? 246 PRO A CA  1 
ATOM   1894 C C   . PRO A 1 246 ? 14.281 18.798  -38.619 1.00 25.44  ? 246 PRO A C   1 
ATOM   1895 O O   . PRO A 1 246 ? 13.301 19.477  -38.245 1.00 23.29  ? 246 PRO A O   1 
ATOM   1896 C CB  . PRO A 1 246 ? 15.893 18.358  -36.736 1.00 25.56  ? 246 PRO A CB  1 
ATOM   1897 C CG  . PRO A 1 246 ? 15.770 19.376  -35.687 1.00 25.69  ? 246 PRO A CG  1 
ATOM   1898 C CD  . PRO A 1 246 ? 16.113 20.640  -36.259 1.00 25.82  ? 246 PRO A CD  1 
ATOM   1899 N N   . PRO A 1 247 ? 14.211 17.827  -39.537 1.00 26.42  ? 247 PRO A N   1 
ATOM   1900 C CA  . PRO A 1 247 ? 12.934 17.391  -40.057 1.00 26.48  ? 247 PRO A CA  1 
ATOM   1901 C C   . PRO A 1 247 ? 12.309 16.444  -39.042 1.00 25.39  ? 247 PRO A C   1 
ATOM   1902 O O   . PRO A 1 247 ? 12.989 15.976  -38.156 1.00 24.74  ? 247 PRO A O   1 
ATOM   1903 C CB  . PRO A 1 247 ? 13.333 16.654  -41.341 1.00 26.54  ? 247 PRO A CB  1 
ATOM   1904 C CG  . PRO A 1 247 ? 14.663 16.005  -41.004 1.00 26.43  ? 247 PRO A CG  1 
ATOM   1905 C CD  . PRO A 1 247 ? 15.333 17.043  -40.104 1.00 26.27  ? 247 PRO A CD  1 
ATOM   1906 N N   . PRO A 1 248 ? 11.027 16.132  -39.183 1.00 27.39  ? 248 PRO A N   1 
ATOM   1907 C CA  . PRO A 1 248 ? 10.382 15.178  -38.301 1.00 28.59  ? 248 PRO A CA  1 
ATOM   1908 C C   . PRO A 1 248 ? 11.056 13.807  -38.320 1.00 30.72  ? 248 PRO A C   1 
ATOM   1909 O O   . PRO A 1 248 ? 11.180 13.126  -37.275 1.00 31.21  ? 248 PRO A O   1 
ATOM   1910 C CB  . PRO A 1 248 ? 8.954  15.116  -38.844 1.00 27.83  ? 248 PRO A CB  1 
ATOM   1911 C CG  . PRO A 1 248 ? 8.763  16.386  -39.542 1.00 28.20  ? 248 PRO A CG  1 
ATOM   1912 C CD  . PRO A 1 248 ? 10.106 16.707  -40.178 1.00 27.42  ? 248 PRO A CD  1 
ATOM   1913 N N   . ARG A 1 249 ? 11.521 13.386  -39.495 1.00 31.95  ? 249 ARG A N   1 
ATOM   1914 C CA  . ARG A 1 249 ? 12.287 12.162  -39.576 1.00 32.68  ? 249 ARG A CA  1 
ATOM   1915 C C   . ARG A 1 249 ? 13.456 12.339  -40.529 1.00 30.43  ? 249 ARG A C   1 
ATOM   1916 O O   . ARG A 1 249 ? 13.265 12.770  -41.643 1.00 29.78  ? 249 ARG A O   1 
ATOM   1917 C CB  . ARG A 1 249 ? 11.426 11.005  -40.071 1.00 34.55  ? 249 ARG A CB  1 
ATOM   1918 C CG  . ARG A 1 249 ? 12.157 9.672   -40.031 1.00 36.17  ? 249 ARG A CG  1 
ATOM   1919 C CD  . ARG A 1 249 ? 11.442 8.540   -40.748 1.00 38.93  ? 249 ARG A CD  1 
ATOM   1920 N NE  . ARG A 1 249 ? 11.062 8.941   -42.106 1.00 41.40  ? 249 ARG A NE  1 
ATOM   1921 C CZ  . ARG A 1 249 ? 9.816  9.175   -42.507 1.00 42.92  ? 249 ARG A CZ  1 
ATOM   1922 N NH1 . ARG A 1 249 ? 8.778  9.001   -41.679 1.00 43.36  ? 249 ARG A NH1 1 
ATOM   1923 N NH2 . ARG A 1 249 ? 9.602  9.550   -43.764 1.00 43.20  ? 249 ARG A NH2 1 
ATOM   1924 N N   . VAL A 1 250 ? 14.647 12.008  -40.061 1.00 29.84  ? 250 VAL A N   1 
ATOM   1925 C CA  . VAL A 1 250 ? 15.853 12.173  -40.857 1.00 30.82  ? 250 VAL A CA  1 
ATOM   1926 C C   . VAL A 1 250 ? 15.974 10.898  -41.688 1.00 31.47  ? 250 VAL A C   1 
ATOM   1927 O O   . VAL A 1 250 ? 16.054 9.800   -41.132 1.00 31.38  ? 250 VAL A O   1 
ATOM   1928 C CB  . VAL A 1 250 ? 17.086 12.326  -39.994 1.00 30.07  ? 250 VAL A CB  1 
ATOM   1929 C CG1 . VAL A 1 250 ? 18.358 12.475  -40.882 1.00 29.49  ? 250 VAL A CG1 1 
ATOM   1930 C CG2 . VAL A 1 250 ? 16.951 13.524  -39.065 1.00 29.80  ? 250 VAL A CG2 1 
ATOM   1931 N N   . VAL A 1 251 ? 15.964 11.039  -43.009 1.00 32.10  ? 251 VAL A N   1 
ATOM   1932 C CA  . VAL A 1 251 ? 16.114 9.858   -43.874 1.00 31.59  ? 251 VAL A CA  1 
ATOM   1933 C C   . VAL A 1 251 ? 17.409 9.830   -44.705 1.00 31.14  ? 251 VAL A C   1 
ATOM   1934 O O   . VAL A 1 251 ? 17.886 8.741   -45.051 1.00 31.71  ? 251 VAL A O   1 
ATOM   1935 C CB  . VAL A 1 251 ? 14.893 9.653   -44.775 1.00 33.66  ? 251 VAL A CB  1 
ATOM   1936 C CG1 . VAL A 1 251 ? 13.637 9.569   -43.943 1.00 34.49  ? 251 VAL A CG1 1 
ATOM   1937 C CG2 . VAL A 1 251 ? 14.744 10.744  -45.772 1.00 34.12  ? 251 VAL A CG2 1 
ATOM   1938 N N   . ASP A 1 252 ? 17.989 11.001  -44.992 1.00 28.94  ? 252 ASP A N   1 
ATOM   1939 C CA  . ASP A 1 252 ? 19.197 11.078  -45.862 1.00 27.48  ? 252 ASP A CA  1 
ATOM   1940 C C   . ASP A 1 252 ? 19.982 12.390  -45.686 1.00 23.83  ? 252 ASP A C   1 
ATOM   1941 O O   . ASP A 1 252 ? 19.569 13.434  -46.145 1.00 22.97  ? 252 ASP A O   1 
ATOM   1942 C CB  . ASP A 1 252 ? 18.776 10.893  -47.315 1.00 26.53  ? 252 ASP A CB  1 
ATOM   1943 C CG  . ASP A 1 252 ? 19.876 11.245  -48.295 1.00 26.71  ? 252 ASP A CG  1 
ATOM   1944 O OD1 . ASP A 1 252 ? 21.048 11.098  -47.934 1.00 25.93  ? 252 ASP A OD1 1 
ATOM   1945 O OD2 . ASP A 1 252 ? 19.638 11.735  -49.411 1.00 28.57  ? 252 ASP A OD2 1 
ATOM   1946 N N   . THR A 1 253 ? 21.115 12.311  -45.024 1.00 23.49  ? 253 THR A N   1 
ATOM   1947 C CA  . THR A 1 253 ? 21.933 13.492  -44.745 1.00 25.23  ? 253 THR A CA  1 
ATOM   1948 C C   . THR A 1 253 ? 23.108 13.698  -45.709 1.00 24.36  ? 253 THR A C   1 
ATOM   1949 O O   . THR A 1 253 ? 23.958 14.554  -45.484 1.00 23.80  ? 253 THR A O   1 
ATOM   1950 C CB  . THR A 1 253 ? 22.453 13.429  -43.309 1.00 27.36  ? 253 THR A CB  1 
ATOM   1951 O OG1 . THR A 1 253 ? 23.363 12.334  -43.165 1.00 29.41  ? 253 THR A OG1 1 
ATOM   1952 C CG2 . THR A 1 253 ? 21.295 13.139  -42.324 1.00 27.92  ? 253 THR A CG2 1 
ATOM   1953 N N   . LEU A 1 254 ? 23.167 12.882  -46.760 1.00 23.02  ? 254 LEU A N   1 
ATOM   1954 C CA  . LEU A 1 254 ? 24.203 13.031  -47.788 1.00 22.24  ? 254 LEU A CA  1 
ATOM   1955 C C   . LEU A 1 254 ? 24.017 14.338  -48.530 1.00 19.43  ? 254 LEU A C   1 
ATOM   1956 O O   . LEU A 1 254 ? 23.006 14.524  -49.204 1.00 19.87  ? 254 LEU A O   1 
ATOM   1957 C CB  . LEU A 1 254 ? 24.134 11.852  -48.783 1.00 21.80  ? 254 LEU A CB  1 
ATOM   1958 C CG  . LEU A 1 254 ? 25.126 11.901  -49.954 1.00 22.95  ? 254 LEU A CG  1 
ATOM   1959 C CD1 . LEU A 1 254 ? 26.537 11.810  -49.450 1.00 22.93  ? 254 LEU A CD1 1 
ATOM   1960 C CD2 . LEU A 1 254 ? 24.850 10.794  -50.971 1.00 23.67  ? 254 LEU A CD2 1 
ATOM   1961 N N   . GLY A 1 255 ? 24.992 15.245  -48.407 1.00 19.22  ? 255 GLY A N   1 
ATOM   1962 C CA  . GLY A 1 255 ? 24.940 16.530  -49.108 1.00 19.22  ? 255 GLY A CA  1 
ATOM   1963 C C   . GLY A 1 255 ? 24.224 17.615  -48.304 1.00 19.13  ? 255 GLY A C   1 
ATOM   1964 O O   . GLY A 1 255 ? 23.931 18.680  -48.813 1.00 18.62  ? 255 GLY A O   1 
ATOM   1965 N N   . ALA A 1 256 ? 23.940 17.324  -47.045 1.00 20.77  ? 256 ALA A N   1 
ATOM   1966 C CA  . ALA A 1 256 ? 23.252 18.305  -46.182 1.00 20.35  ? 256 ALA A CA  1 
ATOM   1967 C C   . ALA A 1 256 ? 24.157 19.507  -45.984 1.00 20.34  ? 256 ALA A C   1 
ATOM   1968 O O   . ALA A 1 256 ? 23.713 20.653  -45.989 1.00 21.18  ? 256 ALA A O   1 
ATOM   1969 C CB  . ALA A 1 256 ? 22.865 17.673  -44.854 1.00 21.59  ? 256 ALA A CB  1 
ATOM   1970 N N   . GLY A 1 257 ? 25.451 19.268  -45.843 1.00 20.24  ? 257 GLY A N   1 
ATOM   1971 C CA  . GLY A 1 257 ? 26.375 20.368  -45.652 1.00 19.90  ? 257 GLY A CA  1 
ATOM   1972 C C   . GLY A 1 257 ? 26.495 21.190  -46.904 1.00 19.01  ? 257 GLY A C   1 
ATOM   1973 O O   . GLY A 1 257 ? 26.570 22.406  -46.853 1.00 17.37  ? 257 GLY A O   1 
ATOM   1974 N N   . ASP A 1 258 ? 26.475 20.523  -48.058 1.00 18.36  ? 258 ASP A N   1 
ATOM   1975 C CA  . ASP A 1 258 ? 26.485 21.211  -49.330 1.00 18.22  ? 258 ASP A CA  1 
ATOM   1976 C C   . ASP A 1 258 ? 25.222 22.048  -49.520 1.00 17.15  ? 258 ASP A C   1 
ATOM   1977 O O   . ASP A 1 258 ? 25.249 23.094  -50.157 1.00 17.40  ? 258 ASP A O   1 
ATOM   1978 C CB  . ASP A 1 258 ? 26.575 20.196  -50.465 1.00 19.69  ? 258 ASP A CB  1 
ATOM   1979 C CG  . ASP A 1 258 ? 27.863 19.379  -50.413 1.00 19.97  ? 258 ASP A CG  1 
ATOM   1980 O OD1 . ASP A 1 258 ? 28.907 19.960  -50.017 1.00 21.85  ? 258 ASP A OD1 1 
ATOM   1981 O OD2 . ASP A 1 258 ? 27.889 18.158  -50.690 1.00 19.58  ? 258 ASP A OD2 1 
ATOM   1982 N N   . THR A 1 259 ? 24.123 21.538  -49.013 1.00 19.24  ? 259 THR A N   1 
ATOM   1983 C CA  . THR A 1 259 ? 22.841 22.244  -49.092 1.00 18.60  ? 259 THR A CA  1 
ATOM   1984 C C   . THR A 1 259 ? 22.910 23.514  -48.218 1.00 18.75  ? 259 THR A C   1 
ATOM   1985 O O   . THR A 1 259 ? 22.502 24.598  -48.640 1.00 20.06  ? 259 THR A O   1 
ATOM   1986 C CB  . THR A 1 259 ? 21.738 21.331  -48.645 1.00 19.83  ? 259 THR A CB  1 
ATOM   1987 O OG1 . THR A 1 259 ? 21.679 20.159  -49.492 1.00 19.76  ? 259 THR A OG1 1 
ATOM   1988 C CG2 . THR A 1 259 ? 20.367 22.025  -48.734 1.00 20.36  ? 259 THR A CG2 1 
ATOM   1989 N N   . PHE A 1 260 ? 23.445 23.376  -47.014 1.00 18.46  ? 260 PHE A N   1 
ATOM   1990 C CA  . PHE A 1 260 ? 23.689 24.530  -46.172 1.00 18.41  ? 260 PHE A CA  1 
ATOM   1991 C C   . PHE A 1 260 ? 24.533 25.568  -46.891 1.00 19.05  ? 260 PHE A C   1 
ATOM   1992 O O   . PHE A 1 260 ? 24.135 26.724  -46.974 1.00 19.87  ? 260 PHE A O   1 
ATOM   1993 C CB  . PHE A 1 260 ? 24.326 24.098  -44.856 1.00 19.45  ? 260 PHE A CB  1 
ATOM   1994 C CG  . PHE A 1 260 ? 24.804 25.249  -44.020 1.00 18.57  ? 260 PHE A CG  1 
ATOM   1995 C CD1 . PHE A 1 260 ? 23.937 25.891  -43.150 1.00 19.72  ? 260 PHE A CD1 1 
ATOM   1996 C CD2 . PHE A 1 260 ? 26.109 25.730  -44.146 1.00 18.68  ? 260 PHE A CD2 1 
ATOM   1997 C CE1 . PHE A 1 260 ? 24.358 26.963  -42.392 1.00 19.02  ? 260 PHE A CE1 1 
ATOM   1998 C CE2 . PHE A 1 260 ? 26.532 26.829  -43.407 1.00 18.73  ? 260 PHE A CE2 1 
ATOM   1999 C CZ  . PHE A 1 260 ? 25.661 27.434  -42.515 1.00 19.93  ? 260 PHE A CZ  1 
ATOM   2000 N N   . ASN A 1 261 ? 25.724 25.184  -47.394 1.00 18.23  ? 261 ASN A N   1 
ATOM   2001 C CA  . ASN A 1 261 ? 26.586 26.116  -48.107 1.00 18.53  ? 261 ASN A CA  1 
ATOM   2002 C C   . ASN A 1 261 ? 25.858 26.841  -49.246 1.00 20.97  ? 261 ASN A C   1 
ATOM   2003 O O   . ASN A 1 261 ? 25.883 28.078  -49.347 1.00 20.04  ? 261 ASN A O   1 
ATOM   2004 C CB  . ASN A 1 261 ? 27.820 25.420  -48.679 1.00 18.54  ? 261 ASN A CB  1 
ATOM   2005 C CG  . ASN A 1 261 ? 28.734 24.844  -47.615 1.00 18.43  ? 261 ASN A CG  1 
ATOM   2006 O OD1 . ASN A 1 261 ? 28.612 25.133  -46.423 1.00 18.20  ? 261 ASN A OD1 1 
ATOM   2007 N ND2 . ASN A 1 261 ? 29.652 23.966  -48.054 1.00 17.37  ? 261 ASN A ND2 1 
ATOM   2008 N N   . ALA A 1 262 ? 25.243 26.073  -50.134 1.00 19.20  ? 262 ALA A N   1 
ATOM   2009 C CA  . ALA A 1 262 ? 24.515 26.650  -51.258 1.00 19.73  ? 262 ALA A CA  1 
ATOM   2010 C C   . ALA A 1 262 ? 23.455 27.654  -50.801 1.00 17.99  ? 262 ALA A C   1 
ATOM   2011 O O   . ALA A 1 262 ? 23.263 28.710  -51.433 1.00 20.07  ? 262 ALA A O   1 
ATOM   2012 C CB  . ALA A 1 262 ? 23.841 25.527  -52.068 1.00 19.91  ? 262 ALA A CB  1 
ATOM   2013 N N   . SER A 1 263 ? 22.762 27.318  -49.723 1.00 19.57  ? 263 SER A N   1 
ATOM   2014 C CA  . SER A 1 263 ? 21.583 28.107  -49.303 1.00 20.37  ? 263 SER A CA  1 
ATOM   2015 C C   . SER A 1 263 ? 22.054 29.425  -48.686 1.00 20.98  ? 263 SER A C   1 
ATOM   2016 O O   . SER A 1 263 ? 21.474 30.497  -48.898 1.00 20.97  ? 263 SER A O   1 
ATOM   2017 C CB  . SER A 1 263 ? 20.715 27.310  -48.336 1.00 20.45  ? 263 SER A CB  1 
ATOM   2018 O OG  . SER A 1 263 ? 20.179 26.151  -48.947 1.00 21.05  ? 263 SER A OG  1 
ATOM   2019 N N   . VAL A 1 264 ? 23.156 29.356  -47.956 1.00 21.27  ? 264 VAL A N   1 
ATOM   2020 C CA  . VAL A 1 264 ? 23.802 30.582  -47.455 1.00 20.87  ? 264 VAL A CA  1 
ATOM   2021 C C   . VAL A 1 264 ? 24.300 31.475  -48.586 1.00 21.81  ? 264 VAL A C   1 
ATOM   2022 O O   . VAL A 1 264 ? 24.046 32.689  -48.587 1.00 22.15  ? 264 VAL A O   1 
ATOM   2023 C CB  . VAL A 1 264 ? 24.954 30.232  -46.480 1.00 20.34  ? 264 VAL A CB  1 
ATOM   2024 C CG1 . VAL A 1 264 ? 25.798 31.517  -46.100 1.00 21.70  ? 264 VAL A CG1 1 
ATOM   2025 C CG2 . VAL A 1 264 ? 24.412 29.581  -45.251 1.00 20.32  ? 264 VAL A CG2 1 
ATOM   2026 N N   . ILE A 1 265 ? 24.979 30.896  -49.580 1.00 21.36  ? 265 ILE A N   1 
ATOM   2027 C CA  . ILE A 1 265 ? 25.412 31.657  -50.729 1.00 21.74  ? 265 ILE A CA  1 
ATOM   2028 C C   . ILE A 1 265 ? 24.186 32.309  -51.416 1.00 24.09  ? 265 ILE A C   1 
ATOM   2029 O O   . ILE A 1 265 ? 24.208 33.506  -51.801 1.00 22.68  ? 265 ILE A O   1 
ATOM   2030 C CB  . ILE A 1 265 ? 26.123 30.745  -51.769 1.00 21.54  ? 265 ILE A CB  1 
ATOM   2031 C CG1 . ILE A 1 265 ? 27.547 30.346  -51.309 1.00 21.79  ? 265 ILE A CG1 1 
ATOM   2032 C CG2 . ILE A 1 265 ? 26.281 31.507  -53.079 1.00 21.76  ? 265 ILE A CG2 1 
ATOM   2033 C CD1 . ILE A 1 265 ? 28.147 29.213  -52.100 1.00 22.72  ? 265 ILE A CD1 1 
ATOM   2034 N N   . PHE A 1 266 ? 23.141 31.506  -51.594 1.00 24.34  ? 266 PHE A N   1 
ATOM   2035 C CA  . PHE A 1 266 ? 21.936 31.985  -52.295 1.00 25.63  ? 266 PHE A CA  1 
ATOM   2036 C C   . PHE A 1 266 ? 21.353 33.211  -51.576 1.00 25.79  ? 266 PHE A C   1 
ATOM   2037 O O   . PHE A 1 266 ? 21.145 34.258  -52.202 1.00 26.35  ? 266 PHE A O   1 
ATOM   2038 C CB  . PHE A 1 266 ? 20.867 30.907  -52.384 1.00 26.75  ? 266 PHE A CB  1 
ATOM   2039 C CG  . PHE A 1 266 ? 19.618 31.378  -53.091 1.00 27.15  ? 266 PHE A CG  1 
ATOM   2040 C CD1 . PHE A 1 266 ? 19.620 31.559  -54.468 1.00 28.32  ? 266 PHE A CD1 1 
ATOM   2041 C CD2 . PHE A 1 266 ? 18.472 31.678  -52.380 1.00 28.57  ? 266 PHE A CD2 1 
ATOM   2042 C CE1 . PHE A 1 266 ? 18.470 32.008  -55.134 1.00 28.47  ? 266 PHE A CE1 1 
ATOM   2043 C CE2 . PHE A 1 266 ? 17.327 32.129  -53.053 1.00 28.12  ? 266 PHE A CE2 1 
ATOM   2044 C CZ  . PHE A 1 266 ? 17.346 32.288  -54.406 1.00 27.21  ? 266 PHE A CZ  1 
ATOM   2045 N N   . SER A 1 267 ? 21.086 33.048  -50.286 1.00 26.28  ? 267 SER A N   1 
ATOM   2046 C CA  . SER A 1 267 ? 20.508 34.105  -49.430 1.00 26.81  ? 267 SER A CA  1 
ATOM   2047 C C   . SER A 1 267 ? 21.357 35.367  -49.424 1.00 27.85  ? 267 SER A C   1 
ATOM   2048 O O   . SER A 1 267 ? 20.849 36.479  -49.666 1.00 27.46  ? 267 SER A O   1 
ATOM   2049 C CB  . SER A 1 267 ? 20.265 33.559  -48.007 1.00 28.00  ? 267 SER A CB  1 
ATOM   2050 O OG  . SER A 1 267 ? 19.752 34.539  -47.096 1.00 28.52  ? 267 SER A OG  1 
ATOM   2051 N N   . LEU A 1 268 ? 22.657 35.216  -49.181 1.00 25.69  ? 268 LEU A N   1 
ATOM   2052 C CA  . LEU A 1 268 ? 23.580 36.336  -49.311 1.00 27.48  ? 268 LEU A CA  1 
ATOM   2053 C C   . LEU A 1 268 ? 23.600 36.973  -50.704 1.00 28.24  ? 268 LEU A C   1 
ATOM   2054 O O   . LEU A 1 268 ? 23.625 38.203  -50.846 1.00 28.98  ? 268 LEU A O   1 
ATOM   2055 C CB  . LEU A 1 268 ? 24.996 35.902  -48.900 1.00 25.91  ? 268 LEU A CB  1 
ATOM   2056 C CG  . LEU A 1 268 ? 25.157 35.531  -47.425 1.00 26.67  ? 268 LEU A CG  1 
ATOM   2057 C CD1 . LEU A 1 268 ? 26.613 35.166  -47.147 1.00 26.86  ? 268 LEU A CD1 1 
ATOM   2058 C CD2 . LEU A 1 268 ? 24.703 36.683  -46.519 1.00 27.63  ? 268 LEU A CD2 1 
ATOM   2059 N N   . SER A 1 269 ? 23.603 36.160  -51.752 1.00 28.16  ? 269 SER A N   1 
ATOM   2060 C CA  . SER A 1 269 ? 23.652 36.706  -53.094 1.00 30.29  ? 269 SER A CA  1 
ATOM   2061 C C   . SER A 1 269 ? 22.372 37.481  -53.389 1.00 31.69  ? 269 SER A C   1 
ATOM   2062 O O   . SER A 1 269 ? 22.384 38.375  -54.225 1.00 33.94  ? 269 SER A O   1 
ATOM   2063 C CB  . SER A 1 269 ? 23.836 35.595  -54.145 1.00 31.12  ? 269 SER A CB  1 
ATOM   2064 O OG  . SER A 1 269 ? 22.622 34.881  -54.318 1.00 31.98  ? 269 SER A OG  1 
ATOM   2065 N N   . GLN A 1 270 ? 21.292 37.124  -52.695 1.00 32.75  ? 270 GLN A N   1 
ATOM   2066 C CA  . GLN A 1 270 ? 19.991 37.798  -52.804 1.00 33.97  ? 270 GLN A CA  1 
ATOM   2067 C C   . GLN A 1 270 ? 19.896 39.069  -51.943 1.00 34.61  ? 270 GLN A C   1 
ATOM   2068 O O   . GLN A 1 270 ? 18.856 39.723  -51.902 1.00 36.26  ? 270 GLN A O   1 
ATOM   2069 C CB  . GLN A 1 270 ? 18.888 36.817  -52.410 1.00 34.80  ? 270 GLN A CB  1 
ATOM   2070 C CG  . GLN A 1 270 ? 18.737 35.645  -53.379 1.00 36.01  ? 270 GLN A CG  1 
ATOM   2071 C CD  . GLN A 1 270 ? 17.899 35.991  -54.583 1.00 37.19  ? 270 GLN A CD  1 
ATOM   2072 O OE1 . GLN A 1 270 ? 16.665 35.930  -54.515 1.00 39.25  ? 270 GLN A OE1 1 
ATOM   2073 N NE2 . GLN A 1 270 ? 18.545 36.339  -55.682 1.00 37.69  ? 270 GLN A NE2 1 
ATOM   2074 N N   . GLY A 1 271 ? 20.967 39.409  -51.245 1.00 34.52  ? 271 GLY A N   1 
ATOM   2075 C CA  . GLY A 1 271 ? 21.011 40.625  -50.436 1.00 34.24  ? 271 GLY A CA  1 
ATOM   2076 C C   . GLY A 1 271 ? 20.521 40.498  -49.009 1.00 34.64  ? 271 GLY A C   1 
ATOM   2077 O O   . GLY A 1 271 ? 20.299 41.520  -48.326 1.00 35.86  ? 271 GLY A O   1 
ATOM   2078 N N   . ARG A 1 272 ? 20.347 39.276  -48.525 1.00 33.30  ? 272 ARG A N   1 
ATOM   2079 C CA  . ARG A 1 272 ? 19.847 39.082  -47.178 1.00 33.27  ? 272 ARG A CA  1 
ATOM   2080 C C   . ARG A 1 272 ? 20.995 39.235  -46.176 1.00 32.83  ? 272 ARG A C   1 
ATOM   2081 O O   . ARG A 1 272 ? 22.159 39.210  -46.573 1.00 32.21  ? 272 ARG A O   1 
ATOM   2082 C CB  . ARG A 1 272 ? 19.164 37.729  -47.056 1.00 36.00  ? 272 ARG A CB  1 
ATOM   2083 C CG  . ARG A 1 272 ? 18.093 37.495  -48.150 1.00 38.74  ? 272 ARG A CG  1 
ATOM   2084 C CD  . ARG A 1 272 ? 16.950 38.496  -48.107 1.00 41.33  ? 272 ARG A CD  1 
ATOM   2085 N NE  . ARG A 1 272 ? 16.264 38.410  -46.824 1.00 42.74  ? 272 ARG A NE  1 
ATOM   2086 C CZ  . ARG A 1 272 ? 15.167 39.088  -46.505 1.00 44.45  ? 272 ARG A CZ  1 
ATOM   2087 N NH1 . ARG A 1 272 ? 14.621 39.948  -47.364 1.00 45.44  ? 272 ARG A NH1 1 
ATOM   2088 N NH2 . ARG A 1 272 ? 14.630 38.925  -45.301 1.00 44.44  ? 272 ARG A NH2 1 
ATOM   2089 N N   . SER A 1 273 ? 20.655 39.449  -44.900 1.00 31.46  ? 273 SER A N   1 
ATOM   2090 C CA  . SER A 1 273 ? 21.645 39.602  -43.838 1.00 29.90  ? 273 SER A CA  1 
ATOM   2091 C C   . SER A 1 273 ? 22.314 38.248  -43.579 1.00 28.68  ? 273 SER A C   1 
ATOM   2092 O O   . SER A 1 273 ? 21.793 37.217  -43.967 1.00 27.55  ? 273 SER A O   1 
ATOM   2093 C CB  . SER A 1 273 ? 20.978 40.104  -42.554 1.00 29.22  ? 273 SER A CB  1 
ATOM   2094 O OG  . SER A 1 273 ? 20.167 39.111  -41.940 1.00 27.48  ? 273 SER A OG  1 
ATOM   2095 N N   . VAL A 1 274 ? 23.460 38.259  -42.919 1.00 27.92  ? 274 VAL A N   1 
ATOM   2096 C CA  . VAL A 1 274 ? 24.114 37.023  -42.520 1.00 27.56  ? 274 VAL A CA  1 
ATOM   2097 C C   . VAL A 1 274 ? 23.232 36.229  -41.575 1.00 26.82  ? 274 VAL A C   1 
ATOM   2098 O O   . VAL A 1 274 ? 23.122 35.015  -41.682 1.00 23.34  ? 274 VAL A O   1 
ATOM   2099 C CB  . VAL A 1 274 ? 25.486 37.313  -41.869 1.00 27.32  ? 274 VAL A CB  1 
ATOM   2100 C CG1 . VAL A 1 274 ? 26.064 36.091  -41.268 1.00 27.56  ? 274 VAL A CG1 1 
ATOM   2101 C CG2 . VAL A 1 274 ? 26.426 37.898  -42.889 1.00 27.72  ? 274 VAL A CG2 1 
ATOM   2102 N N   . GLN A 1 275 ? 22.580 36.912  -40.636 1.00 27.82  ? 275 GLN A N   1 
ATOM   2103 C CA  . GLN A 1 275 ? 21.730 36.225  -39.683 1.00 27.92  ? 275 GLN A CA  1 
ATOM   2104 C C   . GLN A 1 275 ? 20.633 35.446  -40.399 1.00 26.83  ? 275 GLN A C   1 
ATOM   2105 O O   . GLN A 1 275 ? 20.301 34.344  -39.977 1.00 26.68  ? 275 GLN A O   1 
ATOM   2106 C CB  . GLN A 1 275 ? 21.088 37.218  -38.706 1.00 29.67  ? 275 GLN A CB  1 
ATOM   2107 C CG  . GLN A 1 275 ? 20.092 36.597  -37.780 1.00 30.99  ? 275 GLN A CG  1 
ATOM   2108 C CD  . GLN A 1 275 ? 20.731 35.719  -36.748 1.00 33.67  ? 275 GLN A CD  1 
ATOM   2109 O OE1 . GLN A 1 275 ? 21.200 36.210  -35.715 1.00 36.63  ? 275 GLN A OE1 1 
ATOM   2110 N NE2 . GLN A 1 275 ? 20.738 34.411  -36.998 1.00 36.16  ? 275 GLN A NE2 1 
ATOM   2111 N N   . GLU A 1 276 ? 20.072 36.037  -41.449 1.00 28.53  ? 276 GLU A N   1 
ATOM   2112 C CA  . GLU A 1 276 ? 18.970 35.420  -42.187 1.00 28.20  ? 276 GLU A CA  1 
ATOM   2113 C C   . GLU A 1 276 ? 19.499 34.305  -43.050 1.00 26.57  ? 276 GLU A C   1 
ATOM   2114 O O   . GLU A 1 276 ? 18.847 33.282  -43.188 1.00 28.07  ? 276 GLU A O   1 
ATOM   2115 C CB  . GLU A 1 276 ? 18.236 36.399  -43.103 1.00 31.49  ? 276 GLU A CB  1 
ATOM   2116 C CG  . GLU A 1 276 ? 16.775 35.970  -43.314 1.00 34.50  ? 276 GLU A CG  1 
ATOM   2117 C CD  . GLU A 1 276 ? 16.382 35.632  -44.740 1.00 38.01  ? 276 GLU A CD  1 
ATOM   2118 O OE1 . GLU A 1 276 ? 16.386 36.555  -45.594 1.00 41.88  ? 276 GLU A OE1 1 
ATOM   2119 O OE2 . GLU A 1 276 ? 15.984 34.464  -45.014 1.00 39.82  ? 276 GLU A OE2 1 
ATOM   2120 N N   . ALA A 1 277 ? 20.657 34.543  -43.651 1.00 25.94  ? 277 ALA A N   1 
ATOM   2121 C CA  . ALA A 1 277 ? 21.320 33.516  -44.473 1.00 25.80  ? 277 ALA A CA  1 
ATOM   2122 C C   . ALA A 1 277 ? 21.620 32.257  -43.679 1.00 24.02  ? 277 ALA A C   1 
ATOM   2123 O O   . ALA A 1 277 ? 21.429 31.153  -44.203 1.00 25.18  ? 277 ALA A O   1 
ATOM   2124 C CB  . ALA A 1 277 ? 22.563 34.075  -45.108 1.00 26.06  ? 277 ALA A CB  1 
ATOM   2125 N N   . LEU A 1 278 ? 22.100 32.398  -42.439 1.00 23.03  ? 278 LEU A N   1 
ATOM   2126 C CA  . LEU A 1 278 ? 22.334 31.258  -41.549 1.00 24.63  ? 278 LEU A CA  1 
ATOM   2127 C C   . LEU A 1 278 ? 21.072 30.501  -41.248 1.00 25.30  ? 278 LEU A C   1 
ATOM   2128 O O   . LEU A 1 278 ? 21.032 29.281  -41.299 1.00 21.61  ? 278 LEU A O   1 
ATOM   2129 C CB  . LEU A 1 278 ? 22.869 31.703  -40.184 1.00 25.24  ? 278 LEU A CB  1 
ATOM   2130 C CG  . LEU A 1 278 ? 24.324 32.045  -39.966 1.00 26.16  ? 278 LEU A CG  1 
ATOM   2131 C CD1 . LEU A 1 278 ? 24.514 32.489  -38.504 1.00 25.43  ? 278 LEU A CD1 1 
ATOM   2132 C CD2 . LEU A 1 278 ? 25.244 30.878  -40.308 1.00 26.03  ? 278 LEU A CD2 1 
ATOM   2133 N N   . ARG A 1 279 ? 20.040 31.247  -40.846 1.00 26.09  ? 279 ARG A N   1 
ATOM   2134 C CA  . ARG A 1 279 ? 18.719 30.676  -40.646 1.00 27.02  ? 279 ARG A CA  1 
ATOM   2135 C C   . ARG A 1 279 ? 18.243 29.876  -41.868 1.00 23.37  ? 279 ARG A C   1 
ATOM   2136 O O   . ARG A 1 279 ? 17.818 28.751  -41.723 1.00 23.91  ? 279 ARG A O   1 
ATOM   2137 C CB  . ARG A 1 279 ? 17.709 31.810  -40.348 1.00 29.09  ? 279 ARG A CB  1 
ATOM   2138 C CG  . ARG A 1 279 ? 16.257 31.374  -40.265 1.00 31.39  ? 279 ARG A CG  1 
ATOM   2139 C CD  . ARG A 1 279 ? 15.212 32.564  -40.262 1.00 33.81  ? 279 ARG A CD  1 
ATOM   2140 N NE  . ARG A 1 279 ? 15.748 33.805  -39.676 1.00 37.07  ? 279 ARG A NE  1 
ATOM   2141 C CZ  . ARG A 1 279 ? 16.092 33.939  -38.388 1.00 38.03  ? 279 ARG A CZ  1 
ATOM   2142 N NH1 . ARG A 1 279 ? 15.939 32.916  -37.548 1.00 39.38  ? 279 ARG A NH1 1 
ATOM   2143 N NH2 . ARG A 1 279 ? 16.596 35.086  -37.933 1.00 38.40  ? 279 ARG A NH2 1 
ATOM   2144 N N   . PHE A 1 280 ? 18.288 30.499  -43.034 1.00 24.39  ? 280 PHE A N   1 
ATOM   2145 C CA  . PHE A 1 280 ? 17.854 29.891  -44.289 1.00 24.14  ? 280 PHE A CA  1 
ATOM   2146 C C   . PHE A 1 280 ? 18.671 28.637  -44.583 1.00 22.89  ? 280 PHE A C   1 
ATOM   2147 O O   . PHE A 1 280 ? 18.123 27.581  -44.901 1.00 22.84  ? 280 PHE A O   1 
ATOM   2148 C CB  . PHE A 1 280 ? 17.978 30.894  -45.424 1.00 24.77  ? 280 PHE A CB  1 
ATOM   2149 C CG  . PHE A 1 280 ? 17.447 30.391  -46.743 1.00 24.66  ? 280 PHE A CG  1 
ATOM   2150 C CD1 . PHE A 1 280 ? 16.081 30.183  -46.925 1.00 26.11  ? 280 PHE A CD1 1 
ATOM   2151 C CD2 . PHE A 1 280 ? 18.292 30.149  -47.796 1.00 24.36  ? 280 PHE A CD2 1 
ATOM   2152 C CE1 . PHE A 1 280 ? 15.576 29.719  -48.158 1.00 25.24  ? 280 PHE A CE1 1 
ATOM   2153 C CE2 . PHE A 1 280 ? 17.794 29.688  -49.031 1.00 25.79  ? 280 PHE A CE2 1 
ATOM   2154 C CZ  . PHE A 1 280 ? 16.433 29.473  -49.191 1.00 25.53  ? 280 PHE A CZ  1 
ATOM   2155 N N   . GLY A 1 281 ? 19.986 28.717  -44.402 1.00 22.08  ? 281 GLY A N   1 
ATOM   2156 C CA  . GLY A 1 281 ? 20.813 27.541  -44.580 1.00 21.03  ? 281 GLY A CA  1 
ATOM   2157 C C   . GLY A 1 281 ? 20.425 26.399  -43.704 1.00 20.92  ? 281 GLY A C   1 
ATOM   2158 O O   . GLY A 1 281 ? 20.329 25.276  -44.160 1.00 20.33  ? 281 GLY A O   1 
ATOM   2159 N N   . CYS A 1 282 ? 20.185 26.669  -42.418 1.00 19.83  ? 282 CYS A N   1 
ATOM   2160 C CA  . CYS A 1 282 ? 19.843 25.613  -41.502 1.00 20.33  ? 282 CYS A CA  1 
ATOM   2161 C C   . CYS A 1 282 ? 18.489 24.973  -41.865 1.00 21.01  ? 282 CYS A C   1 
ATOM   2162 O O   . CYS A 1 282 ? 18.282 23.762  -41.706 1.00 21.27  ? 282 CYS A O   1 
ATOM   2163 C CB  . CYS A 1 282 ? 19.805 26.153  -40.091 1.00 20.99  ? 282 CYS A CB  1 
ATOM   2164 S SG  . CYS A 1 282 ? 21.485 26.477  -39.417 1.00 22.32  ? 282 CYS A SG  1 
ATOM   2165 N N   . GLN A 1 283 ? 17.576 25.819  -42.283 1.00 22.53  ? 283 GLN A N   1 
ATOM   2166 C CA  . GLN A 1 283 ? 16.232 25.344  -42.628 1.00 23.12  ? 283 GLN A CA  1 
ATOM   2167 C C   . GLN A 1 283 ? 16.207 24.497  -43.893 1.00 21.37  ? 283 GLN A C   1 
ATOM   2168 O O   . GLN A 1 283 ? 15.623 23.422  -43.897 1.00 21.89  ? 283 GLN A O   1 
ATOM   2169 C CB  . GLN A 1 283 ? 15.320 26.521  -42.774 1.00 25.52  ? 283 GLN A CB  1 
ATOM   2170 C CG  . GLN A 1 283 ? 15.033 27.136  -41.434 1.00 26.72  ? 283 GLN A CG  1 
ATOM   2171 C CD  . GLN A 1 283 ? 14.146 28.346  -41.533 1.00 28.70  ? 283 GLN A CD  1 
ATOM   2172 O OE1 . GLN A 1 283 ? 13.976 28.909  -42.616 1.00 31.44  ? 283 GLN A OE1 1 
ATOM   2173 N NE2 . GLN A 1 283 ? 13.592 28.773  -40.387 1.00 31.95  ? 283 GLN A NE2 1 
ATOM   2174 N N   . VAL A 1 284 ? 16.875 24.961  -44.928 1.00 21.86  ? 284 VAL A N   1 
ATOM   2175 C CA  . VAL A 1 284 ? 16.922 24.192  -46.192 1.00 22.26  ? 284 VAL A CA  1 
ATOM   2176 C C   . VAL A 1 284 ? 17.705 22.914  -46.001 1.00 21.85  ? 284 VAL A C   1 
ATOM   2177 O O   . VAL A 1 284 ? 17.298 21.867  -46.509 1.00 21.34  ? 284 VAL A O   1 
ATOM   2178 C CB  . VAL A 1 284 ? 17.495 24.986  -47.348 1.00 22.11  ? 284 VAL A CB  1 
ATOM   2179 C CG1 . VAL A 1 284 ? 17.450 24.167  -48.667 1.00 21.64  ? 284 VAL A CG1 1 
ATOM   2180 C CG2 . VAL A 1 284 ? 16.766 26.297  -47.536 1.00 23.97  ? 284 VAL A CG2 1 
ATOM   2181 N N   . ALA A 1 285 ? 18.857 22.978  -45.299 1.00 21.17  ? 285 ALA A N   1 
ATOM   2182 C CA  . ALA A 1 285 ? 19.605 21.763  -44.975 1.00 20.67  ? 285 ALA A CA  1 
ATOM   2183 C C   . ALA A 1 285 ? 18.770 20.784  -44.149 1.00 22.48  ? 285 ALA A C   1 
ATOM   2184 O O   . ALA A 1 285 ? 18.782 19.599  -44.408 1.00 20.52  ? 285 ALA A O   1 
ATOM   2185 C CB  . ALA A 1 285 ? 20.951 22.076  -44.234 1.00 20.02  ? 285 ALA A CB  1 
ATOM   2186 N N   . GLY A 1 286 ? 18.062 21.277  -43.139 1.00 21.45  ? 286 GLY A N   1 
ATOM   2187 C CA  . GLY A 1 286 ? 17.180 20.428  -42.372 1.00 22.22  ? 286 GLY A CA  1 
ATOM   2188 C C   . GLY A 1 286 ? 16.105 19.755  -43.222 1.00 20.87  ? 286 GLY A C   1 
ATOM   2189 O O   . GLY A 1 286 ? 15.831 18.561  -43.066 1.00 20.41  ? 286 GLY A O   1 
ATOM   2190 N N   . LYS A 1 287 ? 15.505 20.518  -44.109 1.00 24.40  ? 287 LYS A N   1 
ATOM   2191 C CA  . LYS A 1 287 ? 14.433 20.001  -44.975 1.00 25.41  ? 287 LYS A CA  1 
ATOM   2192 C C   . LYS A 1 287 ? 15.010 18.891  -45.833 1.00 25.96  ? 287 LYS A C   1 
ATOM   2193 O O   . LYS A 1 287 ? 14.449 17.797  -45.908 1.00 25.74  ? 287 LYS A O   1 
ATOM   2194 C CB  . LYS A 1 287 ? 13.876 21.118  -45.831 1.00 27.71  ? 287 LYS A CB  1 
ATOM   2195 C CG  . LYS A 1 287 ? 12.569 20.759  -46.535 1.00 28.74  ? 287 LYS A CG  1 
ATOM   2196 C CD  . LYS A 1 287 ? 12.060 21.971  -47.266 1.00 29.89  ? 287 LYS A CD  1 
ATOM   2197 C CE  . LYS A 1 287 ? 10.746 21.713  -48.014 1.00 30.90  ? 287 LYS A CE  1 
ATOM   2198 N NZ  . LYS A 1 287 ? 10.575 22.809  -49.016 1.00 32.70  ? 287 LYS A NZ  1 
ATOM   2199 N N   . LYS A 1 288 ? 16.190 19.154  -46.386 1.00 25.01  ? 288 LYS A N   1 
ATOM   2200 C CA  . LYS A 1 288 ? 16.901 18.181  -47.183 1.00 24.68  ? 288 LYS A CA  1 
ATOM   2201 C C   . LYS A 1 288 ? 17.102 16.879  -46.430 1.00 24.08  ? 288 LYS A C   1 
ATOM   2202 O O   . LYS A 1 288 ? 16.951 15.796  -47.019 1.00 24.00  ? 288 LYS A O   1 
ATOM   2203 C CB  . LYS A 1 288 ? 18.215 18.775  -47.708 1.00 26.01  ? 288 LYS A CB  1 
ATOM   2204 C CG  . LYS A 1 288 ? 19.365 17.784  -47.814 1.00 28.70  ? 288 LYS A CG  1 
ATOM   2205 C CD  . LYS A 1 288 ? 19.197 16.892  -48.910 1.00 27.92  ? 288 LYS A CD  1 
ATOM   2206 C CE  . LYS A 1 288 ? 19.895 15.537  -48.652 1.00 26.72  ? 288 LYS A CE  1 
ATOM   2207 N NZ  . LYS A 1 288 ? 18.839 14.476  -48.773 1.00 25.51  ? 288 LYS A NZ  1 
ATOM   2208 N N   . CYS A 1 289 ? 17.423 16.953  -45.128 1.00 23.61  ? 289 CYS A N   1 
ATOM   2209 C CA  . CYS A 1 289 ? 17.702 15.753  -44.380 1.00 23.88  ? 289 CYS A CA  1 
ATOM   2210 C C   . CYS A 1 289 ? 16.479 14.851  -44.234 1.00 24.70  ? 289 CYS A C   1 
ATOM   2211 O O   . CYS A 1 289 ? 16.604 13.659  -43.919 1.00 24.17  ? 289 CYS A O   1 
ATOM   2212 C CB  . CYS A 1 289 ? 18.260 16.090  -43.003 1.00 24.00  ? 289 CYS A CB  1 
ATOM   2213 S SG  . CYS A 1 289 ? 19.960 16.707  -43.092 1.00 25.14  ? 289 CYS A SG  1 
ATOM   2214 N N   . GLY A 1 290 ? 15.301 15.432  -44.424 1.00 25.59  ? 290 GLY A N   1 
ATOM   2215 C CA  . GLY A 1 290 ? 14.060 14.677  -44.341 1.00 27.52  ? 290 GLY A CA  1 
ATOM   2216 C C   . GLY A 1 290 ? 13.615 14.079  -45.665 1.00 29.63  ? 290 GLY A C   1 
ATOM   2217 O O   . GLY A 1 290 ? 12.521 13.497  -45.743 1.00 30.35  ? 290 GLY A O   1 
ATOM   2218 N N   . LEU A 1 291 ? 14.460 14.198  -46.687 1.00 29.89  ? 291 LEU A N   1 
ATOM   2219 C CA  . LEU A 1 291 ? 14.134 13.804  -48.072 1.00 31.48  ? 291 LEU A CA  1 
ATOM   2220 C C   . LEU A 1 291 ? 15.256 12.993  -48.687 1.00 31.66  ? 291 LEU A C   1 
ATOM   2221 O O   . LEU A 1 291 ? 16.410 13.132  -48.301 1.00 29.63  ? 291 LEU A O   1 
ATOM   2222 C CB  . LEU A 1 291 ? 13.961 15.052  -48.939 1.00 32.90  ? 291 LEU A CB  1 
ATOM   2223 C CG  . LEU A 1 291 ? 12.867 16.060  -48.669 1.00 34.55  ? 291 LEU A CG  1 
ATOM   2224 C CD1 . LEU A 1 291 ? 13.259 17.408  -49.241 1.00 34.59  ? 291 LEU A CD1 1 
ATOM   2225 C CD2 . LEU A 1 291 ? 11.546 15.596  -49.291 1.00 35.95  ? 291 LEU A CD2 1 
ATOM   2226 N N   . GLN A 1 292 ? 14.935 12.139  -49.660 1.00 31.80  ? 292 GLN A N   1 
ATOM   2227 C CA  . GLN A 1 292 ? 15.989 11.448  -50.395 1.00 32.70  ? 292 GLN A CA  1 
ATOM   2228 C C   . GLN A 1 292 ? 16.478 12.371  -51.494 1.00 30.53  ? 292 GLN A C   1 
ATOM   2229 O O   . GLN A 1 292 ? 15.677 12.932  -52.236 1.00 31.91  ? 292 GLN A O   1 
ATOM   2230 C CB  . GLN A 1 292 ? 15.504 10.125  -50.998 1.00 36.29  ? 292 GLN A CB  1 
ATOM   2231 C CG  . GLN A 1 292 ? 16.596 9.096   -50.992 1.00 38.86  ? 292 GLN A CG  1 
ATOM   2232 C CD  . GLN A 1 292 ? 16.797 8.509   -49.604 1.00 42.23  ? 292 GLN A CD  1 
ATOM   2233 O OE1 . GLN A 1 292 ? 18.051 8.144   -49.254 1.00 45.27  ? 292 GLN A OE1 1 
ATOM   2234 N NE2 . GLN A 1 292 ? 15.824 8.381   -48.851 1.00 43.52  ? 292 GLN A NE2 1 
ATOM   2235 N N   . GLY A 1 293 ? 17.788 12.577  -51.553 1.00 30.01  ? 293 GLY A N   1 
ATOM   2236 C CA  . GLY A 1 293 ? 18.385 13.515  -52.513 1.00 29.23  ? 293 GLY A CA  1 
ATOM   2237 C C   . GLY A 1 293 ? 17.945 14.950  -52.263 1.00 28.89  ? 293 GLY A C   1 
ATOM   2238 O O   . GLY A 1 293 ? 17.621 15.306  -51.137 1.00 29.65  ? 293 GLY A O   1 
ATOM   2239 N N   . PHE A 1 294 ? 17.920 15.768  -53.313 1.00 26.71  ? 294 PHE A N   1 
ATOM   2240 C CA  . PHE A 1 294 ? 17.761 17.222  -53.184 1.00 28.05  ? 294 PHE A CA  1 
ATOM   2241 C C   . PHE A 1 294 ? 16.455 17.831  -53.700 1.00 28.76  ? 294 PHE A C   1 
ATOM   2242 O O   . PHE A 1 294 ? 16.082 18.940  -53.294 1.00 28.62  ? 294 PHE A O   1 
ATOM   2243 C CB  . PHE A 1 294 ? 18.907 17.891  -53.936 1.00 26.20  ? 294 PHE A CB  1 
ATOM   2244 C CG  . PHE A 1 294 ? 20.260 17.446  -53.460 1.00 25.97  ? 294 PHE A CG  1 
ATOM   2245 C CD1 . PHE A 1 294 ? 20.940 16.428  -54.119 1.00 26.02  ? 294 PHE A CD1 1 
ATOM   2246 C CD2 . PHE A 1 294 ? 20.828 18.005  -52.306 1.00 25.62  ? 294 PHE A CD2 1 
ATOM   2247 C CE1 . PHE A 1 294 ? 22.155 15.982  -53.662 1.00 24.54  ? 294 PHE A CE1 1 
ATOM   2248 C CE2 . PHE A 1 294 ? 22.058 17.559  -51.834 1.00 24.92  ? 294 PHE A CE2 1 
ATOM   2249 C CZ  . PHE A 1 294 ? 22.733 16.556  -52.523 1.00 25.46  ? 294 PHE A CZ  1 
ATOM   2250 N N   . ASP A 1 295 ? 15.794 17.161  -54.629 1.00 30.40  ? 295 ASP A N   1 
ATOM   2251 C CA  . ASP A 1 295 ? 14.682 17.799  -55.359 1.00 32.89  ? 295 ASP A CA  1 
ATOM   2252 C C   . ASP A 1 295 ? 13.524 18.327  -54.526 1.00 33.53  ? 295 ASP A C   1 
ATOM   2253 O O   . ASP A 1 295 ? 12.933 19.351  -54.868 1.00 35.52  ? 295 ASP A O   1 
ATOM   2254 C CB  . ASP A 1 295 ? 14.123 16.857  -56.418 1.00 34.65  ? 295 ASP A CB  1 
ATOM   2255 C CG  . ASP A 1 295 ? 15.106 16.587  -57.510 1.00 35.91  ? 295 ASP A CG  1 
ATOM   2256 O OD1 . ASP A 1 295 ? 16.039 17.414  -57.689 1.00 35.33  ? 295 ASP A OD1 1 
ATOM   2257 O OD2 . ASP A 1 295 ? 15.022 15.564  -58.233 1.00 37.59  ? 295 ASP A OD2 1 
ATOM   2258 N N   . GLY A 1 296 ? 13.180 17.645  -53.452 1.00 34.62  ? 296 GLY A N   1 
ATOM   2259 C CA  . GLY A 1 296 ? 12.042 18.101  -52.641 1.00 35.54  ? 296 GLY A CA  1 
ATOM   2260 C C   . GLY A 1 296 ? 12.288 19.346  -51.793 1.00 36.55  ? 296 GLY A C   1 
ATOM   2261 O O   . GLY A 1 296 ? 11.379 19.808  -51.079 1.00 36.92  ? 296 GLY A O   1 
ATOM   2262 N N   . ILE A 1 297 ? 13.495 19.916  -51.833 1.00 36.12  ? 297 ILE A N   1 
ATOM   2263 C CA  . ILE A 1 297 ? 13.720 21.117  -51.035 1.00 36.44  ? 297 ILE A CA  1 
ATOM   2264 C C   . ILE A 1 297 ? 12.876 22.278  -51.548 1.00 37.46  ? 297 ILE A C   1 
ATOM   2265 O O   . ILE A 1 297 ? 12.616 23.224  -50.814 1.00 38.52  ? 297 ILE A O   1 
ATOM   2266 C CB  . ILE A 1 297 ? 15.226 21.512  -50.944 1.00 35.40  ? 297 ILE A CB  1 
ATOM   2267 C CG1 . ILE A 1 297 ? 15.787 21.888  -52.321 1.00 34.96  ? 297 ILE A CG1 1 
ATOM   2268 C CG2 . ILE A 1 297 ? 16.005 20.392  -50.266 1.00 35.21  ? 297 ILE A CG2 1 
ATOM   2269 C CD1 . ILE A 1 297 ? 17.112 22.722  -52.256 1.00 35.33  ? 297 ILE A CD1 1 
ATOM   2270 N N   . VAL A 1 298 ? 12.443 22.206  -52.798 1.00 39.69  ? 298 VAL A N   1 
ATOM   2271 C CA  . VAL A 1 298 ? 11.536 23.226  -53.336 1.00 40.68  ? 298 VAL A CA  1 
ATOM   2272 C C   . VAL A 1 298 ? 10.260 22.593  -53.856 1.00 42.94  ? 298 VAL A C   1 
ATOM   2273 O O   . VAL A 1 298 ? 10.271 21.470  -54.338 1.00 44.22  ? 298 VAL A O   1 
ATOM   2274 C CB  . VAL A 1 298 ? 12.201 24.053  -54.451 1.00 41.18  ? 298 VAL A CB  1 
ATOM   2275 C CG1 . VAL A 1 298 ? 13.294 24.944  -53.856 1.00 40.87  ? 298 VAL A CG1 1 
ATOM   2276 C CG2 . VAL A 1 298 ? 12.755 23.148  -55.558 1.00 41.11  ? 298 VAL A CG2 1 
ATOM   2277 O OXT . VAL A 1 298 ? 9.189  23.201  -53.808 1.00 45.79  ? 298 VAL A OXT 1 
HETATM 2278 S S   . SO4 B 2 .   ? 27.582 16.444  -46.293 1.00 29.28  ? 301 SO4 A S   1 
HETATM 2279 O O1  . SO4 B 2 .   ? 27.414 17.509  -47.347 1.00 26.42  ? 301 SO4 A O1  1 
HETATM 2280 O O2  . SO4 B 2 .   ? 26.796 16.824  -45.046 1.00 26.68  ? 301 SO4 A O2  1 
HETATM 2281 O O3  . SO4 B 2 .   ? 27.199 15.080  -46.761 1.00 26.55  ? 301 SO4 A O3  1 
HETATM 2282 O O4  . SO4 B 2 .   ? 29.029 16.430  -45.877 1.00 29.66  ? 301 SO4 A O4  1 
HETATM 2283 S S   . SO4 C 2 .   ? 33.475 3.923   -70.236 1.00 61.06  ? 302 SO4 A S   1 
HETATM 2284 O O1  . SO4 C 2 .   ? 32.095 4.340   -70.630 1.00 59.97  ? 302 SO4 A O1  1 
HETATM 2285 O O2  . SO4 C 2 .   ? 33.592 2.426   -70.266 1.00 61.81  ? 302 SO4 A O2  1 
HETATM 2286 O O3  . SO4 C 2 .   ? 34.476 4.533   -71.193 1.00 61.85  ? 302 SO4 A O3  1 
HETATM 2287 O O4  . SO4 C 2 .   ? 33.772 4.395   -68.830 1.00 62.50  ? 302 SO4 A O4  1 
HETATM 2288 S S   . SO4 D 2 .   ? 47.612 14.703  -62.012 1.00 105.77 ? 303 SO4 A S   1 
HETATM 2289 O O1  . SO4 D 2 .   ? 46.438 13.807  -62.274 1.00 105.77 ? 303 SO4 A O1  1 
HETATM 2290 O O2  . SO4 D 2 .   ? 48.659 13.930  -61.262 1.00 105.54 ? 303 SO4 A O2  1 
HETATM 2291 O O3  . SO4 D 2 .   ? 48.164 15.171  -63.331 1.00 105.67 ? 303 SO4 A O3  1 
HETATM 2292 O O4  . SO4 D 2 .   ? 47.179 15.894  -61.196 1.00 105.71 ? 303 SO4 A O4  1 
HETATM 2293 O O   . HOH E 3 .   ? 23.869 16.831  -56.850 1.00 19.90  ? 304 HOH A O   1 
HETATM 2294 O O   . HOH E 3 .   ? 13.021 21.973  -37.103 1.00 23.37  ? 305 HOH A O   1 
HETATM 2295 O O   . HOH E 3 .   ? 29.403 22.585  -50.735 1.00 18.12  ? 306 HOH A O   1 
HETATM 2296 O O   . HOH E 3 .   ? 27.649 1.368   -52.389 1.00 23.46  ? 307 HOH A O   1 
HETATM 2297 O O   . HOH E 3 .   ? 39.924 19.923  -59.462 1.00 23.19  ? 308 HOH A O   1 
HETATM 2298 O O   . HOH E 3 .   ? 37.550 19.090  -60.617 1.00 20.64  ? 309 HOH A O   1 
HETATM 2299 O O   . HOH E 3 .   ? 41.174 35.050  -34.493 1.00 22.94  ? 310 HOH A O   1 
HETATM 2300 O O   . HOH E 3 .   ? 31.983 23.472  -51.500 1.00 20.08  ? 311 HOH A O   1 
HETATM 2301 O O   . HOH E 3 .   ? 31.986 0.225   -54.066 1.00 23.76  ? 312 HOH A O   1 
HETATM 2302 O O   . HOH E 3 .   ? 22.089 11.277  -65.374 1.00 22.07  ? 313 HOH A O   1 
HETATM 2303 O O   . HOH E 3 .   ? 39.004 35.713  -46.237 1.00 24.78  ? 314 HOH A O   1 
HETATM 2304 O O   . HOH E 3 .   ? 33.765 17.138  -52.985 1.00 24.88  ? 315 HOH A O   1 
HETATM 2305 O O   . HOH E 3 .   ? 21.459 12.931  -50.933 1.00 25.34  ? 316 HOH A O   1 
HETATM 2306 O O   . HOH E 3 .   ? 25.392 13.466  -53.682 1.00 30.46  ? 317 HOH A O   1 
HETATM 2307 O O   . HOH E 3 .   ? 29.581 11.117  -74.432 1.00 25.00  ? 318 HOH A O   1 
HETATM 2308 O O   . HOH E 3 .   ? 33.558 8.594   -67.426 1.00 22.38  ? 319 HOH A O   1 
HETATM 2309 O O   . HOH E 3 .   ? 32.763 18.453  -40.702 1.00 29.22  ? 320 HOH A O   1 
HETATM 2310 O O   . HOH E 3 .   ? 30.213 24.398  -44.363 1.00 24.20  ? 321 HOH A O   1 
HETATM 2311 O O   . HOH E 3 .   ? 19.301 22.333  -39.647 1.00 21.72  ? 322 HOH A O   1 
HETATM 2312 O O   . HOH E 3 .   ? 40.622 23.479  -58.283 1.00 27.27  ? 323 HOH A O   1 
HETATM 2313 O O   . HOH E 3 .   ? 37.420 6.461   -60.551 1.00 26.78  ? 324 HOH A O   1 
HETATM 2314 O O   . HOH E 3 .   ? 30.745 21.536  -40.565 1.00 23.48  ? 325 HOH A O   1 
HETATM 2315 O O   . HOH E 3 .   ? 46.898 21.032  -58.717 1.00 28.45  ? 326 HOH A O   1 
HETATM 2316 O O   . HOH E 3 .   ? 37.701 21.339  -48.603 1.00 24.30  ? 327 HOH A O   1 
HETATM 2317 O O   . HOH E 3 .   ? 29.194 39.454  -37.226 1.00 26.10  ? 328 HOH A O   1 
HETATM 2318 O O   . HOH E 3 .   ? 30.732 24.632  -41.720 1.00 24.65  ? 329 HOH A O   1 
HETATM 2319 O O   . HOH E 3 .   ? 32.241 22.871  -44.785 1.00 35.47  ? 330 HOH A O   1 
HETATM 2320 O O   . HOH E 3 .   ? 23.149 39.657  -39.797 1.00 26.62  ? 331 HOH A O   1 
HETATM 2321 O O   . HOH E 3 .   ? 30.291 20.438  -47.568 1.00 28.74  ? 332 HOH A O   1 
HETATM 2322 O O   . HOH E 3 .   ? 12.754 27.988  -44.414 1.00 42.28  ? 333 HOH A O   1 
HETATM 2323 O O   . HOH E 3 .   ? 40.998 15.435  -59.029 1.00 32.51  ? 334 HOH A O   1 
HETATM 2324 O O   . HOH E 3 .   ? 14.219 31.407  -42.959 1.00 29.56  ? 335 HOH A O   1 
HETATM 2325 O O   . HOH E 3 .   ? 35.347 7.907   -65.464 1.00 29.01  ? 336 HOH A O   1 
HETATM 2326 O O   . HOH E 3 .   ? 24.714 41.091  -42.763 1.00 35.45  ? 337 HOH A O   1 
HETATM 2327 O O   . HOH E 3 .   ? 30.968 25.776  -66.642 1.00 27.07  ? 338 HOH A O   1 
HETATM 2328 O O   . HOH E 3 .   ? 36.201 16.789  -43.421 1.00 33.06  ? 339 HOH A O   1 
HETATM 2329 O O   . HOH E 3 .   ? 25.825 5.268   -42.598 1.00 27.26  ? 340 HOH A O   1 
HETATM 2330 O O   . HOH E 3 .   ? 37.659 21.169  -55.453 1.00 26.38  ? 341 HOH A O   1 
HETATM 2331 O O   . HOH E 3 .   ? 17.091 34.154  -47.265 1.00 33.91  ? 342 HOH A O   1 
HETATM 2332 O O   . HOH E 3 .   ? 29.204 27.608  -30.587 1.00 34.21  ? 343 HOH A O   1 
HETATM 2333 O O   . HOH E 3 .   ? 18.311 14.481  -55.754 1.00 32.19  ? 344 HOH A O   1 
HETATM 2334 O O   . HOH E 3 .   ? 22.093 12.210  -59.456 1.00 30.01  ? 345 HOH A O   1 
HETATM 2335 O O   . HOH E 3 .   ? 32.089 34.712  -72.667 1.00 40.18  ? 346 HOH A O   1 
HETATM 2336 O O   . HOH E 3 .   ? 12.068 17.379  -45.109 1.00 29.57  ? 347 HOH A O   1 
HETATM 2337 O O   . HOH E 3 .   ? 26.552 24.383  -70.775 1.00 36.46  ? 348 HOH A O   1 
HETATM 2338 O O   . HOH E 3 .   ? 25.326 15.349  -43.547 1.00 30.72  ? 349 HOH A O   1 
HETATM 2339 O O   . HOH E 3 .   ? 43.313 40.098  -39.091 1.00 40.45  ? 350 HOH A O   1 
HETATM 2340 O O   . HOH E 3 .   ? 46.293 18.593  -58.113 1.00 32.80  ? 351 HOH A O   1 
HETATM 2341 O O   . HOH E 3 .   ? 38.956 9.178   -56.288 1.00 36.93  ? 352 HOH A O   1 
HETATM 2342 O O   . HOH E 3 .   ? 46.552 34.642  -60.649 1.00 34.63  ? 353 HOH A O   1 
HETATM 2343 O O   . HOH E 3 .   ? 31.300 17.119  -31.013 1.00 50.14  ? 354 HOH A O   1 
HETATM 2344 O O   . HOH E 3 .   ? 26.509 26.167  -33.656 1.00 33.48  ? 355 HOH A O   1 
HETATM 2345 O O   . HOH E 3 .   ? 47.774 23.111  -55.722 1.00 35.86  ? 356 HOH A O   1 
HETATM 2346 O O   . HOH E 3 .   ? 35.282 39.626  -35.664 1.00 34.09  ? 357 HOH A O   1 
HETATM 2347 O O   . HOH E 3 .   ? 36.969 9.022   -54.333 1.00 24.79  ? 358 HOH A O   1 
HETATM 2348 O O   . HOH E 3 .   ? 43.765 31.705  -62.678 1.00 32.14  ? 359 HOH A O   1 
HETATM 2349 O O   . HOH E 3 .   ? 37.607 25.034  -69.135 1.00 35.03  ? 360 HOH A O   1 
HETATM 2350 O O   . HOH E 3 .   ? 44.050 21.525  -68.557 1.00 41.82  ? 361 HOH A O   1 
HETATM 2351 O O   . HOH E 3 .   ? 20.734 11.501  -62.882 1.00 34.13  ? 362 HOH A O   1 
HETATM 2352 O O   . HOH E 3 .   ? 19.417 15.589  -57.548 1.00 44.11  ? 363 HOH A O   1 
HETATM 2353 O O   . HOH E 3 .   ? 28.675 -1.135  -56.645 1.00 36.85  ? 364 HOH A O   1 
HETATM 2354 O O   . HOH E 3 .   ? 20.420 23.600  -32.926 1.00 34.04  ? 365 HOH A O   1 
HETATM 2355 O O   . HOH E 3 .   ? 43.874 20.450  -65.349 1.00 35.28  ? 366 HOH A O   1 
HETATM 2356 O O   . HOH E 3 .   ? 22.564 35.157  -33.599 1.00 34.64  ? 367 HOH A O   1 
HETATM 2357 O O   . HOH E 3 .   ? 30.026 42.876  -39.820 1.00 39.14  ? 368 HOH A O   1 
HETATM 2358 O O   . HOH E 3 .   ? 48.650 24.775  -39.360 1.00 29.47  ? 369 HOH A O   1 
HETATM 2359 O O   . HOH E 3 .   ? 32.211 21.259  -65.410 1.00 33.11  ? 370 HOH A O   1 
HETATM 2360 O O   . HOH E 3 .   ? 32.531 19.117  -56.132 1.00 30.81  ? 371 HOH A O   1 
HETATM 2361 O O   . HOH E 3 .   ? 27.446 0.467   -59.279 1.00 34.20  ? 372 HOH A O   1 
HETATM 2362 O O   . HOH E 3 .   ? 14.116 14.764  -36.381 1.00 39.50  ? 373 HOH A O   1 
HETATM 2363 O O   . HOH E 3 .   ? 19.029 -4.914  -52.627 1.00 38.44  ? 374 HOH A O   1 
HETATM 2364 O O   . HOH E 3 .   ? 35.834 19.629  -49.885 1.00 38.06  ? 375 HOH A O   1 
HETATM 2365 O O   . HOH E 3 .   ? 26.843 40.075  -46.450 1.00 51.19  ? 376 HOH A O   1 
HETATM 2366 O O   . HOH E 3 .   ? 18.301 -1.011  -55.947 1.00 41.93  ? 377 HOH A O   1 
HETATM 2367 O O   . HOH E 3 .   ? 28.741 24.841  -31.765 1.00 29.99  ? 378 HOH A O   1 
HETATM 2368 O O   . HOH E 3 .   ? 35.828 38.322  -33.059 1.00 31.58  ? 379 HOH A O   1 
HETATM 2369 O O   . HOH E 3 .   ? 38.949 14.013  -72.723 1.00 30.91  ? 380 HOH A O   1 
HETATM 2370 O O   . HOH E 3 .   ? 27.971 13.582  -71.901 1.00 35.30  ? 381 HOH A O   1 
HETATM 2371 O O   . HOH E 3 .   ? 46.885 23.176  -66.538 1.00 43.70  ? 382 HOH A O   1 
HETATM 2372 O O   . HOH E 3 .   ? 26.152 -11.901 -41.117 1.00 47.11  ? 383 HOH A O   1 
HETATM 2373 O O   . HOH E 3 .   ? 45.151 33.986  -43.550 1.00 27.95  ? 384 HOH A O   1 
HETATM 2374 O O   . HOH E 3 .   ? 12.770 27.145  -56.630 1.00 40.18  ? 385 HOH A O   1 
HETATM 2375 O O   . HOH E 3 .   ? 41.742 6.605   -56.849 1.00 37.91  ? 386 HOH A O   1 
HETATM 2376 O O   . HOH E 3 .   ? 22.824 33.421  -60.516 1.00 32.35  ? 387 HOH A O   1 
HETATM 2377 O O   . HOH E 3 .   ? 29.549 31.677  -69.481 1.00 44.84  ? 388 HOH A O   1 
HETATM 2378 O O   . HOH E 3 .   ? 34.235 17.758  -62.128 1.00 30.06  ? 389 HOH A O   1 
HETATM 2379 O O   . HOH E 3 .   ? 44.920 39.050  -54.206 1.00 42.34  ? 390 HOH A O   1 
HETATM 2380 O O   . HOH E 3 .   ? 34.248 22.377  -71.644 1.00 41.21  ? 391 HOH A O   1 
HETATM 2381 O O   . HOH E 3 .   ? 30.739 12.324  -52.687 1.00 34.01  ? 392 HOH A O   1 
HETATM 2382 O O   . HOH E 3 .   ? 39.510 43.086  -48.074 1.00 52.08  ? 393 HOH A O   1 
HETATM 2383 O O   . HOH E 3 .   ? 40.315 10.439  -69.703 1.00 46.12  ? 394 HOH A O   1 
HETATM 2384 O O   . HOH E 3 .   ? 18.029 26.683  -29.017 1.00 44.44  ? 395 HOH A O   1 
HETATM 2385 O O   . HOH E 3 .   ? 48.576 26.429  -63.411 1.00 29.59  ? 396 HOH A O   1 
HETATM 2386 O O   . HOH E 3 .   ? 45.829 33.291  -46.455 1.00 36.38  ? 397 HOH A O   1 
HETATM 2387 O O   . HOH E 3 .   ? 45.567 18.231  -67.197 1.00 44.02  ? 398 HOH A O   1 
HETATM 2388 O O   . HOH E 3 .   ? 39.696 26.123  -68.776 1.00 37.84  ? 399 HOH A O   1 
HETATM 2389 O O   . HOH E 3 .   ? 17.022 30.482  -36.506 1.00 31.39  ? 400 HOH A O   1 
HETATM 2390 O O   . HOH E 3 .   ? 21.429 26.567  -62.925 1.00 36.66  ? 401 HOH A O   1 
HETATM 2391 O O   . HOH E 3 .   ? 14.051 25.121  -59.439 1.00 43.86  ? 402 HOH A O   1 
HETATM 2392 O O   . HOH E 3 .   ? 28.898 13.896  -52.294 1.00 37.91  ? 403 HOH A O   1 
HETATM 2393 O O   . HOH E 3 .   ? 26.217 39.908  -52.619 1.00 44.85  ? 404 HOH A O   1 
HETATM 2394 O O   . HOH E 3 .   ? 41.727 24.368  -69.718 1.00 42.37  ? 405 HOH A O   1 
HETATM 2395 O O   . HOH E 3 .   ? 20.887 34.391  -58.804 1.00 30.92  ? 406 HOH A O   1 
HETATM 2396 O O   . HOH E 3 .   ? 37.533 41.639  -41.179 1.00 34.17  ? 407 HOH A O   1 
HETATM 2397 O O   . HOH E 3 .   ? 48.127 26.374  -46.243 1.00 36.50  ? 408 HOH A O   1 
HETATM 2398 O O   . HOH E 3 .   ? 23.782 39.905  -48.448 1.00 36.37  ? 409 HOH A O   1 
HETATM 2399 O O   . HOH E 3 .   ? 31.458 39.079  -47.061 1.00 39.11  ? 410 HOH A O   1 
HETATM 2400 O O   . HOH E 3 .   ? 19.650 -3.818  -44.959 1.00 34.85  ? 411 HOH A O   1 
HETATM 2401 O O   . HOH E 3 .   ? 22.260 0.830   -36.890 1.00 34.52  ? 412 HOH A O   1 
HETATM 2402 O O   . HOH E 3 .   ? 45.415 31.185  -43.231 1.00 38.84  ? 413 HOH A O   1 
HETATM 2403 O O   . HOH E 3 .   ? 50.141 32.666  -55.674 1.00 53.78  ? 414 HOH A O   1 
HETATM 2404 O O   . HOH E 3 .   ? 42.457 39.150  -63.148 1.00 43.80  ? 415 HOH A O   1 
HETATM 2405 O O   . HOH E 3 .   ? 43.734 36.962  -66.131 1.00 59.74  ? 416 HOH A O   1 
HETATM 2406 O O   . HOH E 3 .   ? 40.675 39.260  -39.610 1.00 34.50  ? 417 HOH A O   1 
HETATM 2407 O O   . HOH E 3 .   ? 26.071 41.747  -37.224 1.00 41.34  ? 418 HOH A O   1 
HETATM 2408 O O   . HOH E 3 .   ? 34.466 -13.798 -41.593 1.00 48.56  ? 419 HOH A O   1 
HETATM 2409 O O   . HOH E 3 .   ? 43.154 30.292  -32.419 1.00 37.30  ? 420 HOH A O   1 
HETATM 2410 O O   . HOH E 3 .   ? 23.287 22.642  -68.843 1.00 40.90  ? 421 HOH A O   1 
HETATM 2411 O O   . HOH E 3 .   ? 29.773 22.617  -28.809 1.00 50.19  ? 422 HOH A O   1 
HETATM 2412 O O   . HOH E 3 .   ? 20.346 3.135   -52.410 1.00 41.67  ? 423 HOH A O   1 
HETATM 2413 O O   . HOH E 3 .   ? 44.543 15.457  -69.124 1.00 41.05  ? 424 HOH A O   1 
HETATM 2414 O O   . HOH E 3 .   ? 33.757 28.211  -73.921 1.00 39.21  ? 425 HOH A O   1 
HETATM 2415 O O   . HOH E 3 .   ? 43.225 19.007  -50.176 1.00 40.94  ? 426 HOH A O   1 
HETATM 2416 O O   . HOH E 3 .   ? 38.726 30.344  -29.746 1.00 40.34  ? 427 HOH A O   1 
HETATM 2417 O O   . HOH E 3 .   ? 13.840 22.435  -41.822 1.00 42.51  ? 428 HOH A O   1 
HETATM 2418 O O   . HOH E 3 .   ? 44.750 5.927   -49.850 1.00 40.99  ? 429 HOH A O   1 
HETATM 2419 O O   . HOH E 3 .   ? 31.938 -7.237  -35.302 1.00 45.28  ? 430 HOH A O   1 
HETATM 2420 O O   . HOH E 3 .   ? 27.923 39.910  -56.601 1.00 47.15  ? 431 HOH A O   1 
HETATM 2421 O O   . HOH E 3 .   ? 45.241 39.850  -56.878 1.00 41.75  ? 432 HOH A O   1 
HETATM 2422 O O   . HOH E 3 .   ? 21.975 25.498  -31.254 1.00 43.12  ? 433 HOH A O   1 
HETATM 2423 O O   . HOH E 3 .   ? 16.560 22.695  -64.983 1.00 44.75  ? 434 HOH A O   1 
HETATM 2424 O O   . HOH E 3 .   ? 17.639 -0.423  -37.829 1.00 41.98  ? 435 HOH A O   1 
HETATM 2425 O O   . HOH E 3 .   ? 8.846  13.199  -35.745 1.00 41.57  ? 436 HOH A O   1 
HETATM 2426 O O   . HOH E 3 .   ? 38.322 4.106   -56.659 1.00 42.84  ? 437 HOH A O   1 
HETATM 2427 O O   . HOH E 3 .   ? 25.245 -5.695  -39.938 1.00 42.24  ? 438 HOH A O   1 
HETATM 2428 O O   . HOH E 3 .   ? 48.843 34.618  -59.120 1.00 45.16  ? 439 HOH A O   1 
HETATM 2429 O O   . HOH E 3 .   ? 20.487 -8.543  -44.094 1.00 42.90  ? 440 HOH A O   1 
HETATM 2430 O O   . HOH E 3 .   ? 37.402 37.705  -67.425 1.00 41.46  ? 441 HOH A O   1 
HETATM 2431 O O   . HOH E 3 .   ? 20.689 4.742   -59.600 1.00 41.64  ? 442 HOH A O   1 
HETATM 2432 O O   . HOH E 3 .   ? 31.248 39.849  -63.061 1.00 43.58  ? 443 HOH A O   1 
HETATM 2433 O O   . HOH E 3 .   ? 22.672 14.405  -56.880 1.00 29.87  ? 444 HOH A O   1 
HETATM 2434 O O   . HOH E 3 .   ? 38.615 20.895  -71.764 1.00 35.86  ? 445 HOH A O   1 
HETATM 2435 O O   . HOH E 3 .   ? 39.836 40.691  -41.388 1.00 44.42  ? 446 HOH A O   1 
HETATM 2436 O O   . HOH E 3 .   ? 50.631 25.141  -50.838 1.00 49.76  ? 447 HOH A O   1 
HETATM 2437 O O   . HOH E 3 .   ? 30.961 19.450  -70.209 1.00 46.82  ? 448 HOH A O   1 
HETATM 2438 O O   . HOH E 3 .   ? 37.696 7.105   -57.607 1.00 35.88  ? 449 HOH A O   1 
HETATM 2439 O O   . HOH E 3 .   ? 48.234 31.397  -63.581 1.00 55.12  ? 450 HOH A O   1 
HETATM 2440 O O   . HOH E 3 .   ? 14.401 -3.632  -50.755 1.00 46.68  ? 451 HOH A O   1 
HETATM 2441 O O   . HOH E 3 .   ? 18.685 40.054  -39.704 1.00 52.51  ? 452 HOH A O   1 
HETATM 2442 O O   . HOH E 3 .   ? 49.831 29.801  -55.122 1.00 35.36  ? 453 HOH A O   1 
HETATM 2443 O O   . HOH E 3 .   ? 37.850 19.060  -52.145 1.00 48.00  ? 454 HOH A O   1 
HETATM 2444 O O   . HOH E 3 .   ? 44.527 7.045   -67.076 1.00 51.92  ? 455 HOH A O   1 
HETATM 2445 O O   . HOH E 3 .   ? 16.013 6.558   -44.643 1.00 40.74  ? 456 HOH A O   1 
HETATM 2446 O O   . HOH E 3 .   ? 33.030 18.834  -64.508 1.00 33.99  ? 457 HOH A O   1 
HETATM 2447 O O   . HOH E 3 .   ? 46.069 19.905  -62.573 1.00 39.88  ? 458 HOH A O   1 
HETATM 2448 O O   . HOH E 3 .   ? 26.352 6.880   -72.295 1.00 37.77  ? 459 HOH A O   1 
HETATM 2449 O O   . HOH E 3 .   ? 15.207 14.022  -55.053 1.00 47.03  ? 460 HOH A O   1 
HETATM 2450 O O   . HOH E 3 .   ? 21.058 26.261  -28.691 1.00 44.36  ? 461 HOH A O   1 
HETATM 2451 O O   . HOH E 3 .   ? 21.067 35.618  -56.371 1.00 44.37  ? 462 HOH A O   1 
HETATM 2452 O O   . HOH E 3 .   ? 26.737 29.240  -31.018 1.00 41.86  ? 463 HOH A O   1 
HETATM 2453 O O   . HOH E 3 .   ? 38.607 21.629  -58.087 1.00 27.90  ? 464 HOH A O   1 
HETATM 2454 O O   . HOH E 3 .   ? 36.111 11.602  -53.604 1.00 37.32  ? 465 HOH A O   1 
HETATM 2455 O O   . HOH E 3 .   ? 43.348 38.101  -49.648 1.00 52.86  ? 466 HOH A O   1 
HETATM 2456 O O   . HOH E 3 .   ? 21.827 15.881  -71.723 1.00 34.38  ? 467 HOH A O   1 
HETATM 2457 O O   . HOH E 3 .   ? 16.721 15.067  -35.751 1.00 36.06  ? 468 HOH A O   1 
HETATM 2458 O O   . HOH E 3 .   ? 31.585 -3.047  -35.828 1.00 41.77  ? 469 HOH A O   1 
HETATM 2459 O O   . HOH E 3 .   ? 29.092 13.788  -74.528 1.00 34.38  ? 470 HOH A O   1 
HETATM 2460 O O   . HOH E 3 .   ? 26.932 21.074  -42.341 1.00 42.56  ? 471 HOH A O   1 
HETATM 2461 O O   . HOH E 3 .   ? 11.470 19.436  -42.783 1.00 39.20  ? 472 HOH A O   1 
HETATM 2462 O O   . HOH E 3 .   ? 28.110 39.355  -39.988 1.00 32.52  ? 473 HOH A O   1 
HETATM 2463 O O   . HOH E 3 .   ? 29.830 -9.573  -37.128 1.00 46.86  ? 474 HOH A O   1 
HETATM 2464 O O   . HOH E 3 .   ? 19.561 19.562  -39.802 1.00 41.85  ? 475 HOH A O   1 
HETATM 2465 O O   . HOH E 3 .   ? 36.999 41.894  -36.059 1.00 37.08  ? 476 HOH A O   1 
HETATM 2466 O O   . HOH E 3 .   ? 17.131 22.917  -33.207 1.00 38.82  ? 477 HOH A O   1 
HETATM 2467 O O   . HOH E 3 .   ? 42.811 41.866  -45.726 1.00 39.62  ? 478 HOH A O   1 
HETATM 2468 O O   . HOH E 3 .   ? 49.260 24.603  -65.114 1.00 45.97  ? 479 HOH A O   1 
HETATM 2469 O O   . HOH E 3 .   ? 25.663 40.675  -39.962 1.00 38.12  ? 480 HOH A O   1 
HETATM 2470 O O   . HOH E 3 .   ? 19.516 9.809   -61.441 1.00 48.22  ? 481 HOH A O   1 
HETATM 2471 O O   . HOH E 3 .   ? 16.268 23.173  -61.027 1.00 37.99  ? 482 HOH A O   1 
HETATM 2472 O O   . HOH E 3 .   ? 34.763 6.686   -62.647 1.00 36.31  ? 483 HOH A O   1 
HETATM 2473 O O   . HOH E 3 .   ? 23.655 16.702  -41.477 1.00 40.39  ? 484 HOH A O   1 
HETATM 2474 O O   . HOH E 3 .   ? 23.070 10.988  -70.803 1.00 42.61  ? 485 HOH A O   1 
HETATM 2475 O O   . HOH E 3 .   ? 35.684 40.450  -47.621 1.00 39.45  ? 486 HOH A O   1 
HETATM 2476 O O   . HOH E 3 .   ? 46.194 33.116  -62.829 1.00 37.94  ? 487 HOH A O   1 
HETATM 2477 O O   . HOH E 3 .   ? 47.304 20.444  -39.689 1.00 56.00  ? 488 HOH A O   1 
HETATM 2478 O O   . HOH E 3 .   ? 28.713 19.827  -39.381 1.00 41.30  ? 489 HOH A O   1 
HETATM 2479 O O   . HOH E 3 .   ? 31.308 20.407  -43.305 1.00 41.22  ? 490 HOH A O   1 
HETATM 2480 O O   . HOH E 3 .   ? 29.614 19.628  -44.991 1.00 45.49  ? 491 HOH A O   1 
HETATM 2481 O O   . HOH E 3 .   ? 18.381 17.326  -69.752 1.00 39.05  ? 492 HOH A O   1 
HETATM 2482 O O   . HOH E 3 .   ? 13.372 27.655  -60.696 1.00 58.64  ? 493 HOH A O   1 
HETATM 2483 O O   . HOH E 3 .   ? 18.329 34.346  -59.299 1.00 44.23  ? 494 HOH A O   1 
HETATM 2484 O O   . HOH E 3 .   ? 28.563 22.807  -44.330 1.00 48.37  ? 495 HOH A O   1 
HETATM 2485 O O   . HOH E 3 .   ? 49.762 28.786  -63.230 1.00 43.53  ? 496 HOH A O   1 
HETATM 2486 O O   . HOH E 3 .   ? 31.193 3.037   -66.955 1.00 41.01  ? 497 HOH A O   1 
HETATM 2487 O O   . HOH E 3 .   ? 21.522 8.975   -66.844 1.00 39.71  ? 498 HOH A O   1 
HETATM 2488 O O   . HOH E 3 .   ? 38.971 12.584  -55.860 1.00 34.58  ? 499 HOH A O   1 
HETATM 2489 O O   . HOH E 3 .   ? 20.169 10.675  -57.201 1.00 48.17  ? 500 HOH A O   1 
HETATM 2490 O O   . HOH E 3 .   ? 33.046 25.294  -73.756 1.00 43.99  ? 501 HOH A O   1 
HETATM 2491 O O   . HOH E 3 .   ? 15.854 0.389   -40.955 1.00 51.84  ? 502 HOH A O   1 
HETATM 2492 O O   . HOH E 3 .   ? 39.996 25.884  -27.675 1.00 49.66  ? 503 HOH A O   1 
HETATM 2493 O O   . HOH E 3 .   ? 42.568 19.448  -70.234 1.00 38.33  ? 504 HOH A O   1 
HETATM 2494 O O   . HOH E 3 .   ? 22.588 31.924  -67.148 1.00 53.34  ? 505 HOH A O   1 
HETATM 2495 O O   . HOH E 3 .   ? 36.229 31.797  -71.971 1.00 38.49  ? 506 HOH A O   1 
HETATM 2496 O O   . HOH E 3 .   ? 23.579 7.835   -68.157 1.00 44.38  ? 507 HOH A O   1 
HETATM 2497 O O   . HOH E 3 .   ? 31.925 21.364  -72.415 1.00 50.73  ? 508 HOH A O   1 
HETATM 2498 O O   . HOH E 3 .   ? 22.657 -11.560 -44.416 1.00 53.08  ? 509 HOH A O   1 
HETATM 2499 O O   . HOH E 3 .   ? 28.210 18.010  -43.185 1.00 46.13  ? 510 HOH A O   1 
HETATM 2500 O O   . HOH E 3 .   ? 44.635 11.766  -62.051 1.00 36.16  ? 511 HOH A O   1 
HETATM 2501 O O   . HOH E 3 .   ? 23.979 21.005  -42.310 1.00 39.88  ? 512 HOH A O   1 
HETATM 2502 O O   . HOH E 3 .   ? 48.504 19.703  -46.944 1.00 44.99  ? 513 HOH A O   1 
HETATM 2503 O O   . HOH E 3 .   ? 40.765 3.422   -56.245 1.00 48.18  ? 514 HOH A O   1 
HETATM 2504 O O   . HOH E 3 .   ? 21.071 38.725  -35.095 1.00 42.27  ? 515 HOH A O   1 
HETATM 2505 O O   . HOH E 3 .   ? 18.983 27.285  -62.817 1.00 46.10  ? 516 HOH A O   1 
HETATM 2506 O O   . HOH E 3 .   ? 44.229 37.715  -46.829 1.00 50.08  ? 517 HOH A O   1 
HETATM 2507 O O   . HOH E 3 .   ? 50.587 25.543  -57.482 1.00 41.97  ? 518 HOH A O   1 
HETATM 2508 O O   . HOH E 3 .   ? 14.347 29.973  -53.957 1.00 46.79  ? 519 HOH A O   1 
HETATM 2509 O O   . HOH E 3 .   ? 48.565 30.865  -44.435 1.00 40.33  ? 520 HOH A O   1 
HETATM 2510 O O   . HOH E 3 .   ? 38.368 40.018  -54.505 1.00 48.76  ? 521 HOH A O   1 
HETATM 2511 O O   . HOH E 3 .   ? 22.767 43.378  -42.630 1.00 50.22  ? 522 HOH A O   1 
HETATM 2512 O O   . HOH E 3 .   ? 25.932 6.348   -68.440 1.00 42.64  ? 523 HOH A O   1 
HETATM 2513 O O   . HOH E 3 .   ? 29.212 38.550  -30.122 1.00 50.63  ? 524 HOH A O   1 
HETATM 2514 O O   . HOH E 3 .   ? 31.172 43.190  -31.458 1.00 49.81  ? 525 HOH A O   1 
HETATM 2515 O O   . HOH E 3 .   ? 8.762  19.617  -50.885 1.00 46.53  ? 526 HOH A O   1 
HETATM 2516 O O   . HOH E 3 .   ? 50.523 25.971  -47.108 1.00 47.55  ? 527 HOH A O   1 
HETATM 2517 O O   . HOH E 3 .   ? 24.024 41.833  -35.578 1.00 42.83  ? 528 HOH A O   1 
HETATM 2518 O O   . HOH E 3 .   ? 28.525 2.792   -66.540 1.00 44.51  ? 529 HOH A O   1 
HETATM 2519 O O   . HOH E 3 .   ? 45.485 6.347   -47.539 1.00 50.83  ? 530 HOH A O   1 
HETATM 2520 O O   . HOH E 3 .   ? 30.641 7.635   -73.143 0.50 27.61  ? 531 HOH A O   1 
HETATM 2521 O O   . HOH E 3 .   ? 41.145 39.224  -65.900 1.00 50.56  ? 532 HOH A O   1 
HETATM 2522 O O   . HOH E 3 .   ? 13.555 15.101  -53.194 1.00 53.17  ? 533 HOH A O   1 
HETATM 2523 O O   . HOH E 3 .   ? 10.463 14.248  -42.333 1.00 39.69  ? 534 HOH A O   1 
HETATM 2524 O O   . HOH E 3 .   ? 25.109 12.767  -70.886 1.00 40.79  ? 535 HOH A O   1 
HETATM 2525 O O   . HOH E 3 .   ? 29.752 17.959  -48.145 1.00 64.31  ? 536 HOH A O   1 
HETATM 2526 O O   . HOH E 3 .   ? 40.435 32.850  -29.483 1.00 50.72  ? 537 HOH A O   1 
HETATM 2527 O O   . HOH E 3 .   ? 24.165 40.927  -33.264 1.00 51.03  ? 538 HOH A O   1 
HETATM 2528 O O   . HOH E 3 .   ? 43.476 35.315  -68.710 1.00 53.95  ? 539 HOH A O   1 
HETATM 2529 O O   . HOH E 3 .   ? 29.216 29.685  -67.616 1.00 41.29  ? 540 HOH A O   1 
HETATM 2530 O O   . HOH E 3 .   ? 26.084 21.065  -71.754 1.00 42.41  ? 541 HOH A O   1 
HETATM 2531 O O   . HOH E 3 .   ? 37.894 -2.793  -35.910 1.00 47.47  ? 542 HOH A O   1 
HETATM 2532 O O   . HOH E 3 .   ? 31.450 0.870   -69.092 0.50 45.03  ? 543 HOH A O   1 
HETATM 2533 O O   . HOH E 3 .   ? 35.505 6.168   -69.090 1.00 49.98  ? 544 HOH A O   1 
HETATM 2534 O O   . HOH E 3 .   ? 14.980 16.371  -61.247 1.00 62.10  ? 545 HOH A O   1 
HETATM 2535 O O   . HOH E 3 .   ? 14.813 20.488  -61.652 1.00 54.08  ? 546 HOH A O   1 
HETATM 2536 O O   . HOH E 3 .   ? 15.934 13.912  -59.589 1.00 38.32  ? 547 HOH A O   1 
HETATM 2537 O O   . HOH E 3 .   ? 24.168 22.449  -39.446 1.00 46.48  ? 548 HOH A O   1 
HETATM 2538 O O   . HOH E 3 .   ? 33.505 12.386  -52.047 1.00 42.08  ? 549 HOH A O   1 
HETATM 2539 O O   . HOH E 3 .   ? 41.948 30.264  -29.310 1.00 40.22  ? 550 HOH A O   1 
HETATM 2540 O O   . HOH E 3 .   ? 48.430 22.827  -52.462 1.00 36.83  ? 551 HOH A O   1 
HETATM 2541 O O   . HOH E 3 .   ? 39.046 16.406  -37.362 1.00 51.37  ? 552 HOH A O   1 
HETATM 2542 O O   . HOH E 3 .   ? 21.921 22.916  -39.041 1.00 37.52  ? 553 HOH A O   1 
HETATM 2543 O O   . HOH E 3 .   ? 17.709 40.929  -44.355 1.00 50.39  ? 554 HOH A O   1 
HETATM 2544 O O   . HOH E 3 .   ? 46.321 26.030  -39.305 1.00 39.43  ? 555 HOH A O   1 
HETATM 2545 O O   . HOH E 3 .   ? 23.404 28.600  -65.937 1.00 38.50  ? 556 HOH A O   1 
HETATM 2546 O O   . HOH E 3 .   ? 45.569 34.792  -64.941 1.00 58.78  ? 557 HOH A O   1 
HETATM 2547 O O   . HOH E 3 .   ? 28.771 15.468  -49.961 1.00 49.81  ? 558 HOH A O   1 
HETATM 2548 O O   . HOH E 3 .   ? 44.900 9.814   -60.611 1.00 47.58  ? 559 HOH A O   1 
HETATM 2549 O O   . HOH E 3 .   ? 29.578 -1.311  -36.900 1.00 42.48  ? 560 HOH A O   1 
HETATM 2550 O O   . HOH E 3 .   ? 39.936 12.801  -58.526 1.00 49.98  ? 561 HOH A O   1 
HETATM 2551 O O   . HOH E 3 .   ? 45.113 29.694  -69.790 1.00 49.88  ? 562 HOH A O   1 
HETATM 2552 O O   . HOH E 3 .   ? 46.206 37.550  -60.879 1.00 54.91  ? 563 HOH A O   1 
HETATM 2553 O O   . HOH E 3 .   ? 39.121 36.515  -54.529 1.00 45.91  ? 564 HOH A O   1 
HETATM 2554 O O   . HOH E 3 .   ? 18.671 17.160  -39.627 1.00 42.17  ? 565 HOH A O   1 
HETATM 2555 O O   . HOH E 3 .   ? 46.381 13.852  -68.053 1.00 43.27  ? 566 HOH A O   1 
HETATM 2556 O O   . HOH E 3 .   ? 30.393 -4.804  -33.849 1.00 44.27  ? 567 HOH A O   1 
HETATM 2557 O O   . HOH E 3 .   ? 21.976 40.476  -37.361 1.00 45.74  ? 568 HOH A O   1 
HETATM 2558 O O   . HOH E 3 .   ? 39.998 11.504  -73.670 1.00 40.00  ? 569 HOH A O   1 
HETATM 2559 O O   . HOH E 3 .   ? 45.798 11.297  -64.887 1.00 48.11  ? 570 HOH A O   1 
HETATM 2560 O O   . HOH E 3 .   ? 17.163 37.777  -36.368 1.00 53.78  ? 571 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLU 2   2   ?   ?   ?   A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   GLN 5   5   5   GLN GLN A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   CYS 8   8   8   CYS CYS A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  ASP 15  15  15  ASP ASP A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  ILE 17  17  17  ILE ILE A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  TYR 23  23  23  TYR TYR A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  LYS 25  25  25  LYS LYS A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  ASP 27  27  27  ASP ASP A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  CYS 32  32  32  CYS CYS A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  GLN 35  35  35  GLN GLN A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  TRP 37  37  37  TRP TRP A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  ALA 43  43  43  ALA ALA A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ASN 45  45  45  ASN ASN A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  CYS 47  47  47  CYS CYS A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  CYS 57  57  57  CYS CYS A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  PHE 59  59  59  PHE PHE A . n 
A 1 60  MET 60  60  60  MET MET A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  MET 63  63  63  MET MET A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  HIS 67  67  67  HIS HIS A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  TYR 79  79  79  TYR TYR A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  VAL 81  81  81  VAL VAL A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  ARG 84  84  84  ARG ARG A . n 
A 1 85  TYR 85  85  85  TYR TYR A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  THR 91  91  91  THR THR A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 SER 107 107 107 SER SER A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 ILE 110 110 110 ILE ILE A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 TYR 112 112 112 TYR TYR A . n 
A 1 113 TYR 113 113 113 TYR TYR A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 SER 116 116 116 SER SER A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 PRO 118 118 118 PRO PRO A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 ASP 124 124 124 ASP ASP A . n 
A 1 125 PHE 125 125 125 PHE PHE A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 GLN 132 132 132 GLN GLN A . n 
A 1 133 PHE 133 133 133 PHE PHE A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 TRP 135 135 135 TRP TRP A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 HIS 137 137 137 HIS HIS A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 ARG 141 141 141 ARG ARG A . n 
A 1 142 ASN 142 142 142 ASN ASN A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 SER 144 144 144 SER SER A . n 
A 1 145 GLU 145 145 145 GLU GLU A . n 
A 1 146 GLN 146 146 146 GLN GLN A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 LYS 148 148 148 LYS LYS A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 ASP 154 154 154 ASP ASP A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 HIS 156 156 156 HIS HIS A . n 
A 1 157 ASN 157 157 157 ASN ASN A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 ARG 159 159 159 ARG ARG A . n 
A 1 160 GLN 160 160 160 GLN GLN A . n 
A 1 161 PRO 161 161 161 PRO PRO A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 GLN 164 164 164 GLN GLN A . n 
A 1 165 LYS 165 165 165 LYS LYS A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 SER 169 169 169 SER SER A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 GLU 171 171 171 GLU GLU A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 LYS 174 174 174 LYS LYS A . n 
A 1 175 PRO 175 175 175 PRO PRO A . n 
A 1 176 ARG 176 176 176 ARG ARG A . n 
A 1 177 GLU 177 177 177 GLU GLU A . n 
A 1 178 GLU 178 178 178 GLU GLU A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 PHE 180 180 180 PHE PHE A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 PHE 183 183 183 PHE PHE A . n 
A 1 184 GLY 184 184 184 GLY GLY A . n 
A 1 185 TYR 185 185 185 TYR TYR A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 SER 192 192 192 SER SER A . n 
A 1 193 LYS 193 193 193 LYS LYS A . n 
A 1 194 ASP 194 194 194 ASP ASP A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 LYS 197 197 197 LYS LYS A . n 
A 1 198 HIS 198 198 198 HIS HIS A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 PHE 201 201 201 PHE PHE A . n 
A 1 202 GLN 202 202 202 GLN GLN A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLU 205 205 205 GLU GLU A . n 
A 1 206 GLU 206 206 206 GLU GLU A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 ARG 209 209 209 ARG ARG A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 TYR 212 212 212 TYR TYR A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 ARG 214 214 214 ARG ARG A . n 
A 1 215 VAL 215 215 215 VAL VAL A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 LYS 217 217 217 LYS LYS A . n 
A 1 218 GLY 218 218 218 GLY GLY A . n 
A 1 219 ALA 219 219 219 ALA ALA A . n 
A 1 220 VAL 220 220 220 VAL VAL A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 CYS 223 223 223 CYS CYS A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 TRP 225 225 225 TRP TRP A . n 
A 1 226 ALA 226 226 226 ALA ALA A . n 
A 1 227 GLU 227 227 227 GLU GLU A . n 
A 1 228 GLU 228 228 228 GLU GLU A . n 
A 1 229 GLY 229 229 229 GLY GLY A . n 
A 1 230 ALA 230 230 230 ALA ALA A . n 
A 1 231 ASP 231 231 231 ASP ASP A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 ASP 236 236 236 ASP ASP A . n 
A 1 237 GLY 237 237 237 GLY GLY A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 LEU 239 239 239 LEU LEU A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 HIS 241 241 241 HIS HIS A . n 
A 1 242 SER 242 242 242 SER SER A . n 
A 1 243 ASP 243 243 243 ASP ASP A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 PHE 245 245 245 PHE PHE A . n 
A 1 246 PRO 246 246 246 PRO PRO A . n 
A 1 247 PRO 247 247 247 PRO PRO A . n 
A 1 248 PRO 248 248 248 PRO PRO A . n 
A 1 249 ARG 249 249 249 ARG ARG A . n 
A 1 250 VAL 250 250 250 VAL VAL A . n 
A 1 251 VAL 251 251 251 VAL VAL A . n 
A 1 252 ASP 252 252 252 ASP ASP A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 GLY 257 257 257 GLY GLY A . n 
A 1 258 ASP 258 258 258 ASP ASP A . n 
A 1 259 THR 259 259 259 THR THR A . n 
A 1 260 PHE 260 260 260 PHE PHE A . n 
A 1 261 ASN 261 261 261 ASN ASN A . n 
A 1 262 ALA 262 262 262 ALA ALA A . n 
A 1 263 SER 263 263 263 SER SER A . n 
A 1 264 VAL 264 264 264 VAL VAL A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 PHE 266 266 266 PHE PHE A . n 
A 1 267 SER 267 267 267 SER SER A . n 
A 1 268 LEU 268 268 268 LEU LEU A . n 
A 1 269 SER 269 269 269 SER SER A . n 
A 1 270 GLN 270 270 270 GLN GLN A . n 
A 1 271 GLY 271 271 271 GLY GLY A . n 
A 1 272 ARG 272 272 272 ARG ARG A . n 
A 1 273 SER 273 273 273 SER SER A . n 
A 1 274 VAL 274 274 274 VAL VAL A . n 
A 1 275 GLN 275 275 275 GLN GLN A . n 
A 1 276 GLU 276 276 276 GLU GLU A . n 
A 1 277 ALA 277 277 277 ALA ALA A . n 
A 1 278 LEU 278 278 278 LEU LEU A . n 
A 1 279 ARG 279 279 279 ARG ARG A . n 
A 1 280 PHE 280 280 280 PHE PHE A . n 
A 1 281 GLY 281 281 281 GLY GLY A . n 
A 1 282 CYS 282 282 282 CYS CYS A . n 
A 1 283 GLN 283 283 283 GLN GLN A . n 
A 1 284 VAL 284 284 284 VAL VAL A . n 
A 1 285 ALA 285 285 285 ALA ALA A . n 
A 1 286 GLY 286 286 286 GLY GLY A . n 
A 1 287 LYS 287 287 287 LYS LYS A . n 
A 1 288 LYS 288 288 288 LYS LYS A . n 
A 1 289 CYS 289 289 289 CYS CYS A . n 
A 1 290 GLY 290 290 290 GLY GLY A . n 
A 1 291 LEU 291 291 291 LEU LEU A . n 
A 1 292 GLN 292 292 292 GLN GLN A . n 
A 1 293 GLY 293 293 293 GLY GLY A . n 
A 1 294 PHE 294 294 294 PHE PHE A . n 
A 1 295 ASP 295 295 295 ASP ASP A . n 
A 1 296 GLY 296 296 296 GLY GLY A . n 
A 1 297 ILE 297 297 297 ILE ILE A . n 
A 1 298 VAL 298 298 298 VAL VAL A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   301 301 SO4 SO4 A . 
C 2 SO4 1   302 302 SO4 SO4 A . 
D 2 SO4 1   303 303 SO4 SO4 A . 
E 3 HOH 1   304 1   HOH HOH A . 
E 3 HOH 2   305 2   HOH HOH A . 
E 3 HOH 3   306 3   HOH HOH A . 
E 3 HOH 4   307 4   HOH HOH A . 
E 3 HOH 5   308 5   HOH HOH A . 
E 3 HOH 6   309 6   HOH HOH A . 
E 3 HOH 7   310 7   HOH HOH A . 
E 3 HOH 8   311 8   HOH HOH A . 
E 3 HOH 9   312 9   HOH HOH A . 
E 3 HOH 10  313 10  HOH HOH A . 
E 3 HOH 11  314 11  HOH HOH A . 
E 3 HOH 12  315 12  HOH HOH A . 
E 3 HOH 13  316 13  HOH HOH A . 
E 3 HOH 14  317 14  HOH HOH A . 
E 3 HOH 15  318 15  HOH HOH A . 
E 3 HOH 16  319 16  HOH HOH A . 
E 3 HOH 17  320 17  HOH HOH A . 
E 3 HOH 18  321 18  HOH HOH A . 
E 3 HOH 19  322 19  HOH HOH A . 
E 3 HOH 20  323 20  HOH HOH A . 
E 3 HOH 21  324 21  HOH HOH A . 
E 3 HOH 22  325 22  HOH HOH A . 
E 3 HOH 23  326 23  HOH HOH A . 
E 3 HOH 24  327 24  HOH HOH A . 
E 3 HOH 25  328 25  HOH HOH A . 
E 3 HOH 26  329 26  HOH HOH A . 
E 3 HOH 27  330 27  HOH HOH A . 
E 3 HOH 28  331 28  HOH HOH A . 
E 3 HOH 29  332 29  HOH HOH A . 
E 3 HOH 30  333 30  HOH HOH A . 
E 3 HOH 31  334 31  HOH HOH A . 
E 3 HOH 32  335 32  HOH HOH A . 
E 3 HOH 33  336 33  HOH HOH A . 
E 3 HOH 34  337 34  HOH HOH A . 
E 3 HOH 35  338 35  HOH HOH A . 
E 3 HOH 36  339 36  HOH HOH A . 
E 3 HOH 37  340 37  HOH HOH A . 
E 3 HOH 38  341 38  HOH HOH A . 
E 3 HOH 39  342 39  HOH HOH A . 
E 3 HOH 40  343 40  HOH HOH A . 
E 3 HOH 41  344 41  HOH HOH A . 
E 3 HOH 42  345 42  HOH HOH A . 
E 3 HOH 43  346 43  HOH HOH A . 
E 3 HOH 44  347 44  HOH HOH A . 
E 3 HOH 45  348 45  HOH HOH A . 
E 3 HOH 46  349 46  HOH HOH A . 
E 3 HOH 47  350 47  HOH HOH A . 
E 3 HOH 48  351 48  HOH HOH A . 
E 3 HOH 49  352 49  HOH HOH A . 
E 3 HOH 50  353 50  HOH HOH A . 
E 3 HOH 51  354 51  HOH HOH A . 
E 3 HOH 52  355 52  HOH HOH A . 
E 3 HOH 53  356 53  HOH HOH A . 
E 3 HOH 54  357 54  HOH HOH A . 
E 3 HOH 55  358 55  HOH HOH A . 
E 3 HOH 56  359 56  HOH HOH A . 
E 3 HOH 57  360 57  HOH HOH A . 
E 3 HOH 58  361 58  HOH HOH A . 
E 3 HOH 59  362 59  HOH HOH A . 
E 3 HOH 60  363 60  HOH HOH A . 
E 3 HOH 61  364 61  HOH HOH A . 
E 3 HOH 62  365 62  HOH HOH A . 
E 3 HOH 63  366 63  HOH HOH A . 
E 3 HOH 64  367 64  HOH HOH A . 
E 3 HOH 65  368 65  HOH HOH A . 
E 3 HOH 66  369 66  HOH HOH A . 
E 3 HOH 67  370 67  HOH HOH A . 
E 3 HOH 68  371 68  HOH HOH A . 
E 3 HOH 69  372 69  HOH HOH A . 
E 3 HOH 70  373 70  HOH HOH A . 
E 3 HOH 71  374 71  HOH HOH A . 
E 3 HOH 72  375 72  HOH HOH A . 
E 3 HOH 73  376 73  HOH HOH A . 
E 3 HOH 74  377 74  HOH HOH A . 
E 3 HOH 75  378 75  HOH HOH A . 
E 3 HOH 76  379 76  HOH HOH A . 
E 3 HOH 77  380 77  HOH HOH A . 
E 3 HOH 78  381 78  HOH HOH A . 
E 3 HOH 79  382 79  HOH HOH A . 
E 3 HOH 80  383 80  HOH HOH A . 
E 3 HOH 81  384 81  HOH HOH A . 
E 3 HOH 82  385 82  HOH HOH A . 
E 3 HOH 83  386 83  HOH HOH A . 
E 3 HOH 84  387 84  HOH HOH A . 
E 3 HOH 85  388 85  HOH HOH A . 
E 3 HOH 86  389 86  HOH HOH A . 
E 3 HOH 87  390 87  HOH HOH A . 
E 3 HOH 88  391 88  HOH HOH A . 
E 3 HOH 89  392 89  HOH HOH A . 
E 3 HOH 90  393 90  HOH HOH A . 
E 3 HOH 91  394 91  HOH HOH A . 
E 3 HOH 92  395 92  HOH HOH A . 
E 3 HOH 93  396 93  HOH HOH A . 
E 3 HOH 94  397 94  HOH HOH A . 
E 3 HOH 95  398 95  HOH HOH A . 
E 3 HOH 96  399 96  HOH HOH A . 
E 3 HOH 97  400 97  HOH HOH A . 
E 3 HOH 98  401 98  HOH HOH A . 
E 3 HOH 99  402 99  HOH HOH A . 
E 3 HOH 100 403 100 HOH HOH A . 
E 3 HOH 101 404 101 HOH HOH A . 
E 3 HOH 102 405 102 HOH HOH A . 
E 3 HOH 103 406 103 HOH HOH A . 
E 3 HOH 104 407 104 HOH HOH A . 
E 3 HOH 105 408 105 HOH HOH A . 
E 3 HOH 106 409 106 HOH HOH A . 
E 3 HOH 107 410 107 HOH HOH A . 
E 3 HOH 108 411 108 HOH HOH A . 
E 3 HOH 109 412 109 HOH HOH A . 
E 3 HOH 110 413 110 HOH HOH A . 
E 3 HOH 111 414 111 HOH HOH A . 
E 3 HOH 112 415 112 HOH HOH A . 
E 3 HOH 113 416 113 HOH HOH A . 
E 3 HOH 114 417 114 HOH HOH A . 
E 3 HOH 115 418 115 HOH HOH A . 
E 3 HOH 116 419 116 HOH HOH A . 
E 3 HOH 117 420 117 HOH HOH A . 
E 3 HOH 118 421 118 HOH HOH A . 
E 3 HOH 119 422 119 HOH HOH A . 
E 3 HOH 120 423 120 HOH HOH A . 
E 3 HOH 121 424 121 HOH HOH A . 
E 3 HOH 122 425 122 HOH HOH A . 
E 3 HOH 123 426 123 HOH HOH A . 
E 3 HOH 124 427 124 HOH HOH A . 
E 3 HOH 125 428 125 HOH HOH A . 
E 3 HOH 126 429 126 HOH HOH A . 
E 3 HOH 127 430 127 HOH HOH A . 
E 3 HOH 128 431 128 HOH HOH A . 
E 3 HOH 129 432 129 HOH HOH A . 
E 3 HOH 130 433 130 HOH HOH A . 
E 3 HOH 131 434 131 HOH HOH A . 
E 3 HOH 132 435 132 HOH HOH A . 
E 3 HOH 133 436 133 HOH HOH A . 
E 3 HOH 134 437 134 HOH HOH A . 
E 3 HOH 135 438 135 HOH HOH A . 
E 3 HOH 136 439 136 HOH HOH A . 
E 3 HOH 137 440 137 HOH HOH A . 
E 3 HOH 138 441 138 HOH HOH A . 
E 3 HOH 139 442 139 HOH HOH A . 
E 3 HOH 140 443 140 HOH HOH A . 
E 3 HOH 141 444 141 HOH HOH A . 
E 3 HOH 142 445 142 HOH HOH A . 
E 3 HOH 143 446 143 HOH HOH A . 
E 3 HOH 144 447 144 HOH HOH A . 
E 3 HOH 145 448 145 HOH HOH A . 
E 3 HOH 146 449 146 HOH HOH A . 
E 3 HOH 147 450 147 HOH HOH A . 
E 3 HOH 148 451 148 HOH HOH A . 
E 3 HOH 149 452 149 HOH HOH A . 
E 3 HOH 150 453 150 HOH HOH A . 
E 3 HOH 151 454 151 HOH HOH A . 
E 3 HOH 152 455 152 HOH HOH A . 
E 3 HOH 153 456 153 HOH HOH A . 
E 3 HOH 154 457 154 HOH HOH A . 
E 3 HOH 155 458 155 HOH HOH A . 
E 3 HOH 156 459 156 HOH HOH A . 
E 3 HOH 157 460 157 HOH HOH A . 
E 3 HOH 158 461 158 HOH HOH A . 
E 3 HOH 159 462 159 HOH HOH A . 
E 3 HOH 160 463 160 HOH HOH A . 
E 3 HOH 161 464 161 HOH HOH A . 
E 3 HOH 162 465 162 HOH HOH A . 
E 3 HOH 163 466 163 HOH HOH A . 
E 3 HOH 164 467 164 HOH HOH A . 
E 3 HOH 165 468 165 HOH HOH A . 
E 3 HOH 166 469 166 HOH HOH A . 
E 3 HOH 167 470 167 HOH HOH A . 
E 3 HOH 168 471 168 HOH HOH A . 
E 3 HOH 169 472 169 HOH HOH A . 
E 3 HOH 170 473 170 HOH HOH A . 
E 3 HOH 171 474 171 HOH HOH A . 
E 3 HOH 172 475 172 HOH HOH A . 
E 3 HOH 173 476 173 HOH HOH A . 
E 3 HOH 174 477 174 HOH HOH A . 
E 3 HOH 175 478 175 HOH HOH A . 
E 3 HOH 176 479 176 HOH HOH A . 
E 3 HOH 177 480 177 HOH HOH A . 
E 3 HOH 178 481 178 HOH HOH A . 
E 3 HOH 179 482 179 HOH HOH A . 
E 3 HOH 180 483 180 HOH HOH A . 
E 3 HOH 181 484 181 HOH HOH A . 
E 3 HOH 182 485 182 HOH HOH A . 
E 3 HOH 183 486 183 HOH HOH A . 
E 3 HOH 184 487 184 HOH HOH A . 
E 3 HOH 185 488 185 HOH HOH A . 
E 3 HOH 186 489 186 HOH HOH A . 
E 3 HOH 187 490 187 HOH HOH A . 
E 3 HOH 188 491 188 HOH HOH A . 
E 3 HOH 189 492 189 HOH HOH A . 
E 3 HOH 190 493 190 HOH HOH A . 
E 3 HOH 191 494 191 HOH HOH A . 
E 3 HOH 192 495 192 HOH HOH A . 
E 3 HOH 193 496 193 HOH HOH A . 
E 3 HOH 194 497 194 HOH HOH A . 
E 3 HOH 195 498 195 HOH HOH A . 
E 3 HOH 196 499 196 HOH HOH A . 
E 3 HOH 197 500 197 HOH HOH A . 
E 3 HOH 198 501 198 HOH HOH A . 
E 3 HOH 199 502 199 HOH HOH A . 
E 3 HOH 200 503 200 HOH HOH A . 
E 3 HOH 201 504 201 HOH HOH A . 
E 3 HOH 202 505 202 HOH HOH A . 
E 3 HOH 203 506 203 HOH HOH A . 
E 3 HOH 204 507 204 HOH HOH A . 
E 3 HOH 205 508 205 HOH HOH A . 
E 3 HOH 206 509 206 HOH HOH A . 
E 3 HOH 207 510 207 HOH HOH A . 
E 3 HOH 208 511 208 HOH HOH A . 
E 3 HOH 209 512 209 HOH HOH A . 
E 3 HOH 210 513 210 HOH HOH A . 
E 3 HOH 211 514 211 HOH HOH A . 
E 3 HOH 212 515 212 HOH HOH A . 
E 3 HOH 213 516 213 HOH HOH A . 
E 3 HOH 214 517 214 HOH HOH A . 
E 3 HOH 215 518 215 HOH HOH A . 
E 3 HOH 216 519 216 HOH HOH A . 
E 3 HOH 217 520 217 HOH HOH A . 
E 3 HOH 218 521 218 HOH HOH A . 
E 3 HOH 219 522 219 HOH HOH A . 
E 3 HOH 220 523 220 HOH HOH A . 
E 3 HOH 221 524 221 HOH HOH A . 
E 3 HOH 222 525 222 HOH HOH A . 
E 3 HOH 223 526 223 HOH HOH A . 
E 3 HOH 224 527 224 HOH HOH A . 
E 3 HOH 225 528 225 HOH HOH A . 
E 3 HOH 226 529 226 HOH HOH A . 
E 3 HOH 227 530 227 HOH HOH A . 
E 3 HOH 228 531 228 HOH HOH A . 
E 3 HOH 229 532 229 HOH HOH A . 
E 3 HOH 230 533 230 HOH HOH A . 
E 3 HOH 231 534 231 HOH HOH A . 
E 3 HOH 232 535 232 HOH HOH A . 
E 3 HOH 233 536 233 HOH HOH A . 
E 3 HOH 234 537 234 HOH HOH A . 
E 3 HOH 235 538 235 HOH HOH A . 
E 3 HOH 236 539 236 HOH HOH A . 
E 3 HOH 237 540 237 HOH HOH A . 
E 3 HOH 238 541 238 HOH HOH A . 
E 3 HOH 239 542 239 HOH HOH A . 
E 3 HOH 240 543 240 HOH HOH A . 
E 3 HOH 241 544 241 HOH HOH A . 
E 3 HOH 242 545 242 HOH HOH A . 
E 3 HOH 243 546 243 HOH HOH A . 
E 3 HOH 244 547 244 HOH HOH A . 
E 3 HOH 245 548 245 HOH HOH A . 
E 3 HOH 246 549 246 HOH HOH A . 
E 3 HOH 247 550 247 HOH HOH A . 
E 3 HOH 248 551 248 HOH HOH A . 
E 3 HOH 249 552 249 HOH HOH A . 
E 3 HOH 250 553 250 HOH HOH A . 
E 3 HOH 251 554 251 HOH HOH A . 
E 3 HOH 252 555 252 HOH HOH A . 
E 3 HOH 253 556 253 HOH HOH A . 
E 3 HOH 254 557 254 HOH HOH A . 
E 3 HOH 255 558 255 HOH HOH A . 
E 3 HOH 256 559 256 HOH HOH A . 
E 3 HOH 257 560 257 HOH HOH A . 
E 3 HOH 258 561 258 HOH HOH A . 
E 3 HOH 259 562 259 HOH HOH A . 
E 3 HOH 260 563 260 HOH HOH A . 
E 3 HOH 261 564 261 HOH HOH A . 
E 3 HOH 262 565 262 HOH HOH A . 
E 3 HOH 263 566 263 HOH HOH A . 
E 3 HOH 264 567 264 HOH HOH A . 
E 3 HOH 265 568 265 HOH HOH A . 
E 3 HOH 266 569 266 HOH HOH A . 
E 3 HOH 267 570 267 HOH HOH A . 
E 3 HOH 268 571 268 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 61.2600000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     531 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   E 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-07-10 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0003 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
SOLVE  phasing          .        ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 74  ? ? CG A ASP 74  ? ? OD2 A ASP 74  ? ? 123.99 118.30 5.69  0.90 N 
2 1 CB A ASP 194 ? ? CG A ASP 194 ? ? OD2 A ASP 194 ? ? 124.28 118.30 5.98  0.90 N 
3 1 NE A ARG 214 ? ? CZ A ARG 214 ? ? NH1 A ARG 214 ? ? 123.65 120.30 3.35  0.50 N 
4 1 NE A ARG 214 ? ? CZ A ARG 214 ? ? NH2 A ARG 214 ? ? 117.25 120.30 -3.05 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 114 ? ? -49.84  152.60  
2 1 ARG A 141 ? ? -148.96 -75.03  
3 1 ALA A 226 ? ? 56.33   -119.34 
4 1 ASP A 252 ? ? -160.21 106.01  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLU 3   ? CG  ? A GLU 3   CG  
2 1 Y 1 A GLU 3   ? CD  ? A GLU 3   CD  
3 1 Y 1 A GLU 3   ? OE1 ? A GLU 3   OE1 
4 1 Y 1 A GLU 3   ? OE2 ? A GLU 3   OE2 
5 1 Y 1 A GLU 163 ? CG  ? A GLU 163 CG  
6 1 Y 1 A GLU 163 ? CD  ? A GLU 163 CD  
7 1 Y 1 A GLU 163 ? OE1 ? A GLU 163 OE1 
8 1 Y 1 A GLU 163 ? OE2 ? A GLU 163 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1 ? A MET 1 
2 1 Y 1 A GLU 2 ? A GLU 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
#