data_2HQR
# 
_entry.id   2HQR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HQR         
RCSB  RCSB038650   
WWPDB D_1000038650 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2HQN 'The C-terminal domain of the same protein in monomer form' unspecified 
PDB 2HQO 'The N-terminal domain of the same protein in dimer form'   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HQR 
_pdbx_database_status.recvd_initial_deposition_date   2006-07-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hong, E.' 1 
'Lee, W.'  2 
# 
_citation.id                        primary 
_citation.title                     
'Structure of an Atypical Orphan Response Regulator Protein Supports a New Phosphorylation-independent Regulatory Mechanism' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            282 
_citation.page_first                20667 
_citation.page_last                 20675 
_citation.year                      2007 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17491010 
_citation.pdbx_database_id_DOI      10.1074/jbc.M609104200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hong, E.'    1  
primary 'Lee, H.M.'   2  
primary 'Ko, H.'      3  
primary 'Kim, D.-U.'  4  
primary 'Jeon, B.-Y.' 5  
primary 'Jung, J.'    6  
primary 'Shin, J.'    7  
primary 'Lee, S.-A.'  8  
primary 'Kim, Y.'     9  
primary 'Jeon, Y.H.'  10 
primary 'Cheong, C.'  11 
primary 'Cho, H.-S.'  12 
primary 'Lee, W.'     13 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Putative TRANSCRIPTIONAL REGULATOR' 
_entity.formula_weight             25473.162 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MRVLLIEKNSVLGGEIEKGLNVKGFMADVTESLEDGEYLMDIRNYDLVMVSDKNALSFVSRIKEKHSSIVVLVSSDNPTS
EEEVHAFEQGADDYIAKPYRSIKALVARIEARLRFWGSNVIEIGDLTISPDEEKIIYKGREVEVKGKPFEVLTHLARHRD
QIVSKEQLLDAIWEEPEMVTPNVIEVAINQIRQKMDKPLGISTVETVRRRGYRFCYPKPACEE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRVLLIEKNSVLGGEIEKGLNVKGFMADVTESLEDGEYLMDIRNYDLVMVSDKNALSFVSRIKEKHSSIVVLVSSDNPTS
EEEVHAFEQGADDYIAKPYRSIKALVARIEARLRFWGSNVIEIGDLTISPDEEKIIYKGREVEVKGKPFEVLTHLARHRD
QIVSKEQLLDAIWEEPEMVTPNVIEVAINQIRQKMDKPLGISTVETVRRRGYRFCYPKPACEE
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   VAL n 
1 4   LEU n 
1 5   LEU n 
1 6   ILE n 
1 7   GLU n 
1 8   LYS n 
1 9   ASN n 
1 10  SER n 
1 11  VAL n 
1 12  LEU n 
1 13  GLY n 
1 14  GLY n 
1 15  GLU n 
1 16  ILE n 
1 17  GLU n 
1 18  LYS n 
1 19  GLY n 
1 20  LEU n 
1 21  ASN n 
1 22  VAL n 
1 23  LYS n 
1 24  GLY n 
1 25  PHE n 
1 26  MET n 
1 27  ALA n 
1 28  ASP n 
1 29  VAL n 
1 30  THR n 
1 31  GLU n 
1 32  SER n 
1 33  LEU n 
1 34  GLU n 
1 35  ASP n 
1 36  GLY n 
1 37  GLU n 
1 38  TYR n 
1 39  LEU n 
1 40  MET n 
1 41  ASP n 
1 42  ILE n 
1 43  ARG n 
1 44  ASN n 
1 45  TYR n 
1 46  ASP n 
1 47  LEU n 
1 48  VAL n 
1 49  MET n 
1 50  VAL n 
1 51  SER n 
1 52  ASP n 
1 53  LYS n 
1 54  ASN n 
1 55  ALA n 
1 56  LEU n 
1 57  SER n 
1 58  PHE n 
1 59  VAL n 
1 60  SER n 
1 61  ARG n 
1 62  ILE n 
1 63  LYS n 
1 64  GLU n 
1 65  LYS n 
1 66  HIS n 
1 67  SER n 
1 68  SER n 
1 69  ILE n 
1 70  VAL n 
1 71  VAL n 
1 72  LEU n 
1 73  VAL n 
1 74  SER n 
1 75  SER n 
1 76  ASP n 
1 77  ASN n 
1 78  PRO n 
1 79  THR n 
1 80  SER n 
1 81  GLU n 
1 82  GLU n 
1 83  GLU n 
1 84  VAL n 
1 85  HIS n 
1 86  ALA n 
1 87  PHE n 
1 88  GLU n 
1 89  GLN n 
1 90  GLY n 
1 91  ALA n 
1 92  ASP n 
1 93  ASP n 
1 94  TYR n 
1 95  ILE n 
1 96  ALA n 
1 97  LYS n 
1 98  PRO n 
1 99  TYR n 
1 100 ARG n 
1 101 SER n 
1 102 ILE n 
1 103 LYS n 
1 104 ALA n 
1 105 LEU n 
1 106 VAL n 
1 107 ALA n 
1 108 ARG n 
1 109 ILE n 
1 110 GLU n 
1 111 ALA n 
1 112 ARG n 
1 113 LEU n 
1 114 ARG n 
1 115 PHE n 
1 116 TRP n 
1 117 GLY n 
1 118 SER n 
1 119 ASN n 
1 120 VAL n 
1 121 ILE n 
1 122 GLU n 
1 123 ILE n 
1 124 GLY n 
1 125 ASP n 
1 126 LEU n 
1 127 THR n 
1 128 ILE n 
1 129 SER n 
1 130 PRO n 
1 131 ASP n 
1 132 GLU n 
1 133 GLU n 
1 134 LYS n 
1 135 ILE n 
1 136 ILE n 
1 137 TYR n 
1 138 LYS n 
1 139 GLY n 
1 140 ARG n 
1 141 GLU n 
1 142 VAL n 
1 143 GLU n 
1 144 VAL n 
1 145 LYS n 
1 146 GLY n 
1 147 LYS n 
1 148 PRO n 
1 149 PHE n 
1 150 GLU n 
1 151 VAL n 
1 152 LEU n 
1 153 THR n 
1 154 HIS n 
1 155 LEU n 
1 156 ALA n 
1 157 ARG n 
1 158 HIS n 
1 159 ARG n 
1 160 ASP n 
1 161 GLN n 
1 162 ILE n 
1 163 VAL n 
1 164 SER n 
1 165 LYS n 
1 166 GLU n 
1 167 GLN n 
1 168 LEU n 
1 169 LEU n 
1 170 ASP n 
1 171 ALA n 
1 172 ILE n 
1 173 TRP n 
1 174 GLU n 
1 175 GLU n 
1 176 PRO n 
1 177 GLU n 
1 178 MET n 
1 179 VAL n 
1 180 THR n 
1 181 PRO n 
1 182 ASN n 
1 183 VAL n 
1 184 ILE n 
1 185 GLU n 
1 186 VAL n 
1 187 ALA n 
1 188 ILE n 
1 189 ASN n 
1 190 GLN n 
1 191 ILE n 
1 192 ARG n 
1 193 GLN n 
1 194 LYS n 
1 195 MET n 
1 196 ASP n 
1 197 LYS n 
1 198 PRO n 
1 199 LEU n 
1 200 GLY n 
1 201 ILE n 
1 202 SER n 
1 203 THR n 
1 204 VAL n 
1 205 GLU n 
1 206 THR n 
1 207 VAL n 
1 208 ARG n 
1 209 ARG n 
1 210 ARG n 
1 211 GLY n 
1 212 TYR n 
1 213 ARG n 
1 214 PHE n 
1 215 CYS n 
1 216 TYR n 
1 217 PRO n 
1 218 LYS n 
1 219 PRO n 
1 220 ALA n 
1 221 CYS n 
1 222 GLU n 
1 223 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Helicobacter 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   'Helicobacter pylori' 
_entity_src_gen.gene_src_strain                    J99 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Helicobacter pylori' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     85963 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q9ZM42_HELPJ 
_struct_ref.pdbx_db_accession          Q9ZM42 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MRVLLIEKNSVLGGEIEKGLNVKGFMADVTESLEDGEYLMDIRNYDLVMVSDKNALSFVSRIKEKHSSIVVLVSSDNPTS
EEEVHAFEQGADDYIAKPYRSIKALVARIEARLRFWGSNVIEIGDLTISPDEEKIIYKGREVEVKGKPFEVLTHLARHRD
QIVSKEQLLDAIWEEPEMVTPNVIEVAINQIRQKMDKPLGISTVETVRRRGYRFCYPKPACEE
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2HQR A 1 ? 223 ? Q9ZM42 1 ? 223 ? 1 223 
2 1 2HQR B 1 ? 223 ? Q9ZM42 1 ? 223 ? 1 223 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_13C-separated_NOESY 1 
2 1 3D_15N-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.23 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      300 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '50mM KH2PO4; 300mM KCl; 2mM DTT; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 DRX Bruker 500 ? 
2 DRX Bruker 600 ? 
3 DRX Bruker 800 ? 
# 
_pdbx_nmr_refine.entry_id           2HQR 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2HQR 
_pdbx_nmr_details.text       'This structure was determined using 3D heteronuclear techniques.' 
# 
_pdbx_nmr_ensemble.entry_id                                      2HQR 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2HQR 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
'structure solution' Cyana   2.1   'Guentert, P.'        1 
processing           NMRPipe 2.4   'Delaglio et al.'     2 
'data analysis'      Sparky  3.112 'Goddard and Kneller' 3 
refinement           Cyana   2.1   'Guentert, P.'        4 
# 
_exptl.entry_id          2HQR 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2HQR 
_struct.title                     
'Structure of a Atypical Orphan Response Regulator Protein Revealed a New Phosphorylation-Independent Regulatory Mechanism' 
_struct.pdbx_descriptor           'Putative TRANSCRIPTIONAL REGULATOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HQR 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'Phosporylation-Independent Response Regulator, H. pylori, symmetric dimer, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 9   ? ASN A 21  ? ASN A 9   ASN A 21  1 ? 13 
HELX_P HELX_P2  2  VAL A 22  ? GLY A 24  ? VAL A 22  GLY A 24  5 ? 3  
HELX_P HELX_P3  3  SER A 32  ? ASP A 41  ? SER A 32  ASP A 41  1 ? 10 
HELX_P HELX_P4  4  ASN A 54  ? HIS A 66  ? ASN A 54  HIS A 66  1 ? 13 
HELX_P HELX_P5  5  THR A 79  ? GLY A 90  ? THR A 79  GLY A 90  1 ? 12 
HELX_P HELX_P6  6  ILE A 102 ? LEU A 113 ? ILE A 102 LEU A 113 1 ? 12 
HELX_P HELX_P7  7  PHE A 149 ? HIS A 158 ? PHE A 149 HIS A 158 1 ? 10 
HELX_P HELX_P8  8  LYS A 165 ? TRP A 173 ? LYS A 165 TRP A 173 1 ? 9  
HELX_P HELX_P9  9  VAL A 179 ? ASN A 182 ? VAL A 179 ASN A 182 5 ? 4  
HELX_P HELX_P10 10 VAL A 183 ? LYS A 197 ? VAL A 183 LYS A 197 1 ? 15 
HELX_P HELX_P11 11 PRO A 217 ? CYS A 221 ? PRO A 217 CYS A 221 5 ? 5  
HELX_P HELX_P12 12 ASN B 9   ? ASN B 21  ? ASN B 9   ASN B 21  1 ? 13 
HELX_P HELX_P13 13 VAL B 22  ? GLY B 24  ? VAL B 22  GLY B 24  5 ? 3  
HELX_P HELX_P14 14 SER B 32  ? ARG B 43  ? SER B 32  ARG B 43  1 ? 12 
HELX_P HELX_P15 15 ASN B 54  ? HIS B 66  ? ASN B 54  HIS B 66  1 ? 13 
HELX_P HELX_P16 16 THR B 79  ? GLY B 90  ? THR B 79  GLY B 90  1 ? 12 
HELX_P HELX_P17 17 ILE B 102 ? LEU B 113 ? ILE B 102 LEU B 113 1 ? 12 
HELX_P HELX_P18 18 GLY B 146 ? HIS B 158 ? GLY B 146 HIS B 158 1 ? 13 
HELX_P HELX_P19 19 SER B 164 ? ILE B 172 ? SER B 164 ILE B 172 1 ? 9  
HELX_P HELX_P20 20 ASN B 182 ? GLY B 200 ? ASN B 182 GLY B 200 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 3 ? 
D ? 5 ? 
E ? 4 ? 
F ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 27  ? THR A 30  ? ALA A 27  THR A 30  
A 2 VAL A 3   ? ILE A 6   ? VAL A 3   ILE A 6   
A 3 LEU A 47  ? VAL A 50  ? LEU A 47  VAL A 50  
A 4 VAL A 70  ? SER A 75  ? VAL A 70  SER A 75  
A 5 ASP A 93  ? ALA A 96  ? ASP A 93  ALA A 96  
B 1 ILE A 121 ? ILE A 123 ? ILE A 121 ILE A 123 
B 2 LEU A 126 ? SER A 129 ? LEU A 126 SER A 129 
B 3 LYS A 134 ? TYR A 137 ? LYS A 134 TYR A 137 
B 4 ARG A 140 ? VAL A 142 ? ARG A 140 VAL A 142 
C 1 GLN A 161 ? SER A 164 ? GLN A 161 SER A 164 
C 2 GLY A 211 ? PHE A 214 ? GLY A 211 PHE A 214 
C 3 VAL A 204 ? THR A 206 ? VAL A 204 THR A 206 
D 1 MET B 26  ? THR B 30  ? MET B 26  THR B 30  
D 2 ARG B 2   ? ILE B 6   ? ARG B 2   ILE B 6   
D 3 LEU B 47  ? VAL B 50  ? LEU B 47  VAL B 50  
D 4 VAL B 70  ? SER B 75  ? VAL B 70  SER B 75  
D 5 ASP B 93  ? ALA B 96  ? ASP B 93  ALA B 96  
E 1 ILE B 121 ? ILE B 123 ? ILE B 121 ILE B 123 
E 2 LEU B 126 ? SER B 129 ? LEU B 126 SER B 129 
E 3 LYS B 134 ? TYR B 137 ? LYS B 134 TYR B 137 
E 4 ARG B 140 ? GLU B 143 ? ARG B 140 GLU B 143 
F 1 GLN B 161 ? VAL B 163 ? GLN B 161 VAL B 163 
F 2 TYR B 212 ? PHE B 214 ? TYR B 212 PHE B 214 
F 3 VAL B 204 ? THR B 206 ? VAL B 204 THR B 206 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ASP A 28  ? O ASP A 28  N LEU A 5   ? N LEU A 5   
A 2 3 N LEU A 4   ? N LEU A 4   O LEU A 47  ? O LEU A 47  
A 3 4 N VAL A 50  ? N VAL A 50  O SER A 74  ? O SER A 74  
A 4 5 N VAL A 73  ? N VAL A 73  O ILE A 95  ? O ILE A 95  
B 1 2 N ILE A 123 ? N ILE A 123 O LEU A 126 ? O LEU A 126 
B 2 3 N SER A 129 ? N SER A 129 O LYS A 134 ? O LYS A 134 
B 3 4 N ILE A 135 ? N ILE A 135 O VAL A 142 ? O VAL A 142 
C 1 2 N GLN A 161 ? N GLN A 161 O PHE A 214 ? O PHE A 214 
C 2 3 O ARG A 213 ? O ARG A 213 N GLU A 205 ? N GLU A 205 
D 1 2 O MET B 26  ? O MET B 26  N VAL B 3   ? N VAL B 3   
D 2 3 N LEU B 4   ? N LEU B 4   O LEU B 47  ? O LEU B 47  
D 3 4 N VAL B 48  ? N VAL B 48  O LEU B 72  ? O LEU B 72  
D 4 5 N VAL B 73  ? N VAL B 73  O ILE B 95  ? O ILE B 95  
E 1 2 N ILE B 123 ? N ILE B 123 O LEU B 126 ? O LEU B 126 
E 2 3 N SER B 129 ? N SER B 129 O LYS B 134 ? O LYS B 134 
E 3 4 N TYR B 137 ? N TYR B 137 O ARG B 140 ? O ARG B 140 
F 1 2 N VAL B 163 ? N VAL B 163 O TYR B 212 ? O TYR B 212 
F 2 3 O ARG B 213 ? O ARG B 213 N GLU B 205 ? N GLU B 205 
# 
_database_PDB_matrix.entry_id          2HQR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HQR 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N    . MET A 1 1   ? 3.098   2.325   3.744   1.00 53.03 ? 1   MET A N    1  
ATOM 2      C CA   . MET A 1 1   ? 3.671   1.964   2.417   1.00 52.53 ? 1   MET A CA   1  
ATOM 3      C C    . MET A 1 1   ? 4.152   0.512   2.446   1.00 40.10 ? 1   MET A C    1  
ATOM 4      O O    . MET A 1 1   ? 4.387   -0.052  3.496   1.00 15.25 ? 1   MET A O    1  
ATOM 5      C CB   . MET A 1 1   ? 4.852   2.885   2.102   1.00 24.31 ? 1   MET A CB   1  
ATOM 6      C CG   . MET A 1 1   ? 5.854   2.850   3.260   1.00 5.14  ? 1   MET A CG   1  
ATOM 7      S SD   . MET A 1 1   ? 7.289   3.874   2.848   1.00 64.55 ? 1   MET A SD   1  
ATOM 8      C CE   . MET A 1 1   ? 6.427   5.463   2.754   1.00 65.12 ? 1   MET A CE   1  
ATOM 9      H H1   . MET A 1 1   ? 2.065   2.213   3.718   1.00 0.00  ? 1   MET A H1   1  
ATOM 10     H H2   . MET A 1 1   ? 3.334   3.314   3.965   1.00 0.00  ? 1   MET A H2   1  
ATOM 11     H H3   . MET A 1 1   ? 3.494   1.701   4.475   1.00 0.00  ? 1   MET A H3   1  
ATOM 12     H HA   . MET A 1 1   ? 2.913   2.077   1.655   1.00 51.41 ? 1   MET A HA   1  
ATOM 13     H HB2  . MET A 1 1   ? 5.336   2.552   1.196   1.00 14.22 ? 1   MET A HB2  1  
ATOM 14     H HB3  . MET A 1 1   ? 4.494   3.895   1.969   1.00 12.45 ? 1   MET A HB3  1  
ATOM 15     H HG2  . MET A 1 1   ? 5.384   3.230   4.155   1.00 24.01 ? 1   MET A HG2  1  
ATOM 16     H HG3  . MET A 1 1   ? 6.175   1.833   3.427   1.00 64.30 ? 1   MET A HG3  1  
ATOM 17     H HE1  . MET A 1 1   ? 5.561   5.442   3.402   1.00 62.55 ? 1   MET A HE1  1  
ATOM 18     H HE2  . MET A 1 1   ? 6.109   5.642   1.740   1.00 10.31 ? 1   MET A HE2  1  
ATOM 19     H HE3  . MET A 1 1   ? 7.096   6.254   3.064   1.00 63.15 ? 1   MET A HE3  1  
ATOM 20     N N    . ARG A 1 2   ? 4.303   -0.097  1.298   1.00 72.33 ? 2   ARG A N    1  
ATOM 21     C CA   . ARG A 1 2   ? 4.773   -1.517  1.245   1.00 30.31 ? 2   ARG A CA   1  
ATOM 22     C C    . ARG A 1 2   ? 5.747   -1.681  0.076   1.00 53.21 ? 2   ARG A C    1  
ATOM 23     O O    . ARG A 1 2   ? 5.675   -0.966  -0.907  1.00 63.20 ? 2   ARG A O    1  
ATOM 24     C CB   . ARG A 1 2   ? 3.573   -2.444  1.042   1.00 45.33 ? 2   ARG A CB   1  
ATOM 25     C CG   . ARG A 1 2   ? 2.628   -2.329  2.239   1.00 70.40 ? 2   ARG A CG   1  
ATOM 26     C CD   . ARG A 1 2   ? 1.443   -3.276  2.047   1.00 10.12 ? 2   ARG A CD   1  
ATOM 27     N NE   . ARG A 1 2   ? 0.477   -3.096  3.168   1.00 11.22 ? 2   ARG A NE   1  
ATOM 28     C CZ   . ARG A 1 2   ? -0.769  -3.457  3.024   1.00 41.32 ? 2   ARG A CZ   1  
ATOM 29     N NH1  . ARG A 1 2   ? -1.173  -3.974  1.895   1.00 62.11 ? 2   ARG A NH1  1  
ATOM 30     N NH2  . ARG A 1 2   ? -1.612  -3.301  4.008   1.00 61.51 ? 2   ARG A NH2  1  
ATOM 31     H H    . ARG A 1 2   ? 4.108   0.381   0.465   1.00 35.21 ? 2   ARG A H    1  
ATOM 32     H HA   . ARG A 1 2   ? 5.277   -1.775  2.169   1.00 21.15 ? 2   ARG A HA   1  
ATOM 33     H HB2  . ARG A 1 2   ? 3.050   -2.163  0.140   1.00 22.23 ? 2   ARG A HB2  1  
ATOM 34     H HB3  . ARG A 1 2   ? 3.918   -3.464  0.956   1.00 11.01 ? 2   ARG A HB3  1  
ATOM 35     H HG2  . ARG A 1 2   ? 3.158   -2.592  3.143   1.00 2.20  ? 2   ARG A HG2  1  
ATOM 36     H HG3  . ARG A 1 2   ? 2.267   -1.314  2.316   1.00 10.54 ? 2   ARG A HG3  1  
ATOM 37     H HD2  . ARG A 1 2   ? 0.954   -3.054  1.110   1.00 42.43 ? 2   ARG A HD2  1  
ATOM 38     H HD3  . ARG A 1 2   ? 1.796   -4.297  2.035   1.00 43.11 ? 2   ARG A HD3  1  
ATOM 39     H HE   . ARG A 1 2   ? 0.779   -2.707  4.016   1.00 64.54 ? 2   ARG A HE   1  
ATOM 40     H HH11 . ARG A 1 2   ? -0.528  -4.093  1.140   1.00 4.02  ? 2   ARG A HH11 1  
ATOM 41     H HH12 . ARG A 1 2   ? -2.128  -4.249  1.785   1.00 62.10 ? 2   ARG A HH12 1  
ATOM 42     H HH21 . ARG A 1 2   ? -1.302  -2.905  4.873   1.00 3.13  ? 2   ARG A HH21 1  
ATOM 43     H HH22 . ARG A 1 2   ? -2.566  -3.577  3.898   1.00 73.31 ? 2   ARG A HH22 1  
ATOM 44     N N    . VAL A 1 3   ? 6.659   -2.619  0.180   1.00 52.41 ? 3   VAL A N    1  
ATOM 45     C CA   . VAL A 1 3   ? 7.658   -2.852  -0.913  1.00 12.42 ? 3   VAL A CA   1  
ATOM 46     C C    . VAL A 1 3   ? 7.459   -4.250  -1.505  1.00 32.15 ? 3   VAL A C    1  
ATOM 47     O O    . VAL A 1 3   ? 7.225   -5.207  -0.794  1.00 13.13 ? 3   VAL A O    1  
ATOM 48     C CB   . VAL A 1 3   ? 9.071   -2.744  -0.331  1.00 21.43 ? 3   VAL A CB   1  
ATOM 49     C CG1  . VAL A 1 3   ? 10.106  -2.964  -1.439  1.00 13.41 ? 3   VAL A CG1  1  
ATOM 50     C CG2  . VAL A 1 3   ? 9.264   -1.355  0.289   1.00 71.42 ? 3   VAL A CG2  1  
ATOM 51     H H    . VAL A 1 3   ? 6.689   -3.175  0.987   1.00 51.25 ? 3   VAL A H    1  
ATOM 52     H HA   . VAL A 1 3   ? 7.536   -2.116  -1.694  1.00 15.44 ? 3   VAL A HA   1  
ATOM 53     H HB   . VAL A 1 3   ? 9.201   -3.498  0.430   1.00 60.31 ? 3   VAL A HB   1  
ATOM 54     H HG11 . VAL A 1 3   ? 11.070  -2.603  -1.111  1.00 35.42 ? 3   VAL A HG11 1  
ATOM 55     H HG12 . VAL A 1 3   ? 9.806   -2.430  -2.328  1.00 55.14 ? 3   VAL A HG12 1  
ATOM 56     H HG13 . VAL A 1 3   ? 10.175  -4.018  -1.661  1.00 44.13 ? 3   VAL A HG13 1  
ATOM 57     H HG21 . VAL A 1 3   ? 8.863   -0.604  -0.374  1.00 22.35 ? 3   VAL A HG21 1  
ATOM 58     H HG22 . VAL A 1 3   ? 10.317  -1.172  0.445   1.00 40.50 ? 3   VAL A HG22 1  
ATOM 59     H HG23 . VAL A 1 3   ? 8.748   -1.311  1.237   1.00 20.43 ? 3   VAL A HG23 1  
ATOM 60     N N    . LEU A 1 4   ? 7.549   -4.371  -2.809  1.00 14.02 ? 4   LEU A N    1  
ATOM 61     C CA   . LEU A 1 4   ? 7.365   -5.707  -3.473  1.00 65.12 ? 4   LEU A CA   1  
ATOM 62     C C    . LEU A 1 4   ? 8.683   -6.116  -4.151  1.00 24.13 ? 4   LEU A C    1  
ATOM 63     O O    . LEU A 1 4   ? 9.188   -5.427  -5.015  1.00 40.52 ? 4   LEU A O    1  
ATOM 64     C CB   . LEU A 1 4   ? 6.205   -5.585  -4.496  1.00 64.50 ? 4   LEU A CB   1  
ATOM 65     C CG   . LEU A 1 4   ? 6.380   -6.528  -5.708  1.00 51.23 ? 4   LEU A CG   1  
ATOM 66     C CD1  . LEU A 1 4   ? 6.450   -7.993  -5.225  1.00 34.04 ? 4   LEU A CD1  1  
ATOM 67     C CD2  . LEU A 1 4   ? 5.178   -6.355  -6.652  1.00 40.50 ? 4   LEU A CD2  1  
ATOM 68     H H    . LEU A 1 4   ? 7.737   -3.575  -3.358  1.00 30.13 ? 4   LEU A H    1  
ATOM 69     H HA   . LEU A 1 4   ? 7.110   -6.457  -2.734  1.00 65.22 ? 4   LEU A HA   1  
ATOM 70     H HB2  . LEU A 1 4   ? 5.276   -5.831  -4.001  1.00 24.12 ? 4   LEU A HB2  1  
ATOM 71     H HB3  . LEU A 1 4   ? 6.149   -4.571  -4.841  1.00 42.31 ? 4   LEU A HB3  1  
ATOM 72     H HG   . LEU A 1 4   ? 7.292   -6.270  -6.247  1.00 31.24 ? 4   LEU A HG   1  
ATOM 73     H HD11 . LEU A 1 4   ? 7.473   -8.255  -5.015  1.00 64.32 ? 4   LEU A HD11 1  
ATOM 74     H HD12 . LEU A 1 4   ? 6.065   -8.651  -5.991  1.00 24.02 ? 4   LEU A HD12 1  
ATOM 75     H HD13 . LEU A 1 4   ? 5.858   -8.112  -4.328  1.00 45.41 ? 4   LEU A HD13 1  
ATOM 76     H HD21 . LEU A 1 4   ? 5.312   -5.462  -7.243  1.00 20.13 ? 4   LEU A HD21 1  
ATOM 77     H HD22 . LEU A 1 4   ? 4.269   -6.271  -6.074  1.00 53.55 ? 4   LEU A HD22 1  
ATOM 78     H HD23 . LEU A 1 4   ? 5.108   -7.211  -7.308  1.00 12.41 ? 4   LEU A HD23 1  
ATOM 79     N N    . LEU A 1 5   ? 9.230   -7.245  -3.765  1.00 2.23  ? 5   LEU A N    1  
ATOM 80     C CA   . LEU A 1 5   ? 10.508  -7.738  -4.375  1.00 43.52 ? 5   LEU A CA   1  
ATOM 81     C C    . LEU A 1 5   ? 10.245  -9.073  -5.074  1.00 42.23 ? 5   LEU A C    1  
ATOM 82     O O    . LEU A 1 5   ? 10.068  -10.093 -4.436  1.00 24.35 ? 5   LEU A O    1  
ATOM 83     C CB   . LEU A 1 5   ? 11.551  -7.957  -3.272  1.00 62.43 ? 5   LEU A CB   1  
ATOM 84     C CG   . LEU A 1 5   ? 11.766  -6.659  -2.474  1.00 60.00 ? 5   LEU A CG   1  
ATOM 85     C CD1  . LEU A 1 5   ? 12.378  -6.989  -1.110  1.00 21.21 ? 5   LEU A CD1  1  
ATOM 86     C CD2  . LEU A 1 5   ? 12.718  -5.728  -3.234  1.00 31.11 ? 5   LEU A CD2  1  
ATOM 87     H H    . LEU A 1 5   ? 8.790   -7.781  -3.072  1.00 13.15 ? 5   LEU A H    1  
ATOM 88     H HA   . LEU A 1 5   ? 10.885  -7.027  -5.098  1.00 32.23 ? 5   LEU A HA   1  
ATOM 89     H HB2  . LEU A 1 5   ? 11.201  -8.735  -2.607  1.00 61.12 ? 5   LEU A HB2  1  
ATOM 90     H HB3  . LEU A 1 5   ? 12.485  -8.266  -3.718  1.00 53.20 ? 5   LEU A HB3  1  
ATOM 91     H HG   . LEU A 1 5   ? 10.817  -6.165  -2.329  1.00 43.21 ? 5   LEU A HG   1  
ATOM 92     H HD11 . LEU A 1 5   ? 11.698  -7.618  -0.553  1.00 71.33 ? 5   LEU A HD11 1  
ATOM 93     H HD12 . LEU A 1 5   ? 12.553  -6.075  -0.563  1.00 53.20 ? 5   LEU A HD12 1  
ATOM 94     H HD13 . LEU A 1 5   ? 13.314  -7.509  -1.252  1.00 61.13 ? 5   LEU A HD13 1  
ATOM 95     H HD21 . LEU A 1 5   ? 12.255  -5.407  -4.152  1.00 11.25 ? 5   LEU A HD21 1  
ATOM 96     H HD22 . LEU A 1 5   ? 13.635  -6.252  -3.457  1.00 34.43 ? 5   LEU A HD22 1  
ATOM 97     H HD23 . LEU A 1 5   ? 12.938  -4.864  -2.623  1.00 71.44 ? 5   LEU A HD23 1  
ATOM 98     N N    . ILE A 1 6   ? 10.227  -9.079  -6.382  1.00 14.42 ? 6   ILE A N    1  
ATOM 99     C CA   . ILE A 1 6   ? 9.987   -10.352 -7.129  1.00 71.15 ? 6   ILE A CA   1  
ATOM 100    C C    . ILE A 1 6   ? 11.332  -10.917 -7.586  1.00 44.41 ? 6   ILE A C    1  
ATOM 101    O O    . ILE A 1 6   ? 12.006  -10.342 -8.418  1.00 24.15 ? 6   ILE A O    1  
ATOM 102    C CB   . ILE A 1 6   ? 9.109   -10.073 -8.351  1.00 51.24 ? 6   ILE A CB   1  
ATOM 103    C CG1  . ILE A 1 6   ? 7.793   -9.436  -7.895  1.00 34.42 ? 6   ILE A CG1  1  
ATOM 104    C CG2  . ILE A 1 6   ? 8.819   -11.389 -9.075  1.00 15.55 ? 6   ILE A CG2  1  
ATOM 105    C CD1  . ILE A 1 6   ? 6.981   -8.954  -9.105  1.00 61.12 ? 6   ILE A CD1  1  
ATOM 106    H H    . ILE A 1 6   ? 10.380  -8.246  -6.874  1.00 54.30 ? 6   ILE A H    1  
ATOM 107    H HA   . ILE A 1 6   ? 9.494   -11.072 -6.489  1.00 63.34 ? 6   ILE A HA   1  
ATOM 108    H HB   . ILE A 1 6   ? 9.623   -9.399  -9.017  1.00 24.25 ? 6   ILE A HB   1  
ATOM 109    H HG12 . ILE A 1 6   ? 7.216   -10.163 -7.344  1.00 44.34 ? 6   ILE A HG12 1  
ATOM 110    H HG13 . ILE A 1 6   ? 8.012   -8.594  -7.257  1.00 30.23 ? 6   ILE A HG13 1  
ATOM 111    H HG21 . ILE A 1 6   ? 9.739   -11.792 -9.470  1.00 60.45 ? 6   ILE A HG21 1  
ATOM 112    H HG22 . ILE A 1 6   ? 8.128   -11.209 -9.885  1.00 1.33  ? 6   ILE A HG22 1  
ATOM 113    H HG23 . ILE A 1 6   ? 8.385   -12.094 -8.381  1.00 24.33 ? 6   ILE A HG23 1  
ATOM 114    H HD11 . ILE A 1 6   ? 7.301   -7.960  -9.378  1.00 12.30 ? 6   ILE A HD11 1  
ATOM 115    H HD12 . ILE A 1 6   ? 5.933   -8.933  -8.847  1.00 41.01 ? 6   ILE A HD12 1  
ATOM 116    H HD13 . ILE A 1 6   ? 7.130   -9.622  -9.941  1.00 23.55 ? 6   ILE A HD13 1  
ATOM 117    N N    . GLU A 1 7   ? 11.735  -12.036 -7.045  1.00 61.45 ? 7   GLU A N    1  
ATOM 118    C CA   . GLU A 1 7   ? 13.044  -12.634 -7.443  1.00 75.34 ? 7   GLU A CA   1  
ATOM 119    C C    . GLU A 1 7   ? 12.969  -14.157 -7.323  1.00 13.13 ? 7   GLU A C    1  
ATOM 120    O O    . GLU A 1 7   ? 12.594  -14.692 -6.299  1.00 72.45 ? 7   GLU A O    1  
ATOM 121    C CB   . GLU A 1 7   ? 14.142  -12.102 -6.520  1.00 23.11 ? 7   GLU A CB   1  
ATOM 122    C CG   . GLU A 1 7   ? 15.512  -12.528 -7.050  1.00 43.20 ? 7   GLU A CG   1  
ATOM 123    C CD   . GLU A 1 7   ? 16.609  -11.911 -6.181  1.00 21.41 ? 7   GLU A CD   1  
ATOM 124    O OE1  . GLU A 1 7   ? 16.310  -11.543 -5.057  1.00 61.32 ? 7   GLU A OE1  1  
ATOM 125    O OE2  . GLU A 1 7   ? 17.729  -11.816 -6.655  1.00 72.12 ? 7   GLU A OE2  1  
ATOM 126    H H    . GLU A 1 7   ? 11.179  -12.482 -6.371  1.00 35.12 ? 7   GLU A H    1  
ATOM 127    H HA   . GLU A 1 7   ? 13.273  -12.367 -8.466  1.00 71.54 ? 7   GLU A HA   1  
ATOM 128    H HB2  . GLU A 1 7   ? 14.089  -11.023 -6.483  1.00 11.31 ? 7   GLU A HB2  1  
ATOM 129    H HB3  . GLU A 1 7   ? 14.003  -12.502 -5.527  1.00 11.52 ? 7   GLU A HB3  1  
ATOM 130    H HG2  . GLU A 1 7   ? 15.590  -13.605 -7.019  1.00 43.31 ? 7   GLU A HG2  1  
ATOM 131    H HG3  . GLU A 1 7   ? 15.627  -12.187 -8.067  1.00 10.14 ? 7   GLU A HG3  1  
ATOM 132    N N    . LYS A 1 8   ? 13.326  -14.859 -8.363  1.00 41.50 ? 8   LYS A N    1  
ATOM 133    C CA   . LYS A 1 8   ? 13.279  -16.347 -8.312  1.00 13.21 ? 8   LYS A CA   1  
ATOM 134    C C    . LYS A 1 8   ? 14.254  -16.851 -7.245  1.00 72.44 ? 8   LYS A C    1  
ATOM 135    O O    . LYS A 1 8   ? 14.022  -17.855 -6.603  1.00 42.44 ? 8   LYS A O    1  
ATOM 136    C CB   . LYS A 1 8   ? 13.674  -16.915 -9.676  1.00 12.41 ? 8   LYS A CB   1  
ATOM 137    C CG   . LYS A 1 8   ? 12.676  -16.439 -10.734 1.00 65.30 ? 8   LYS A CG   1  
ATOM 138    C CD   . LYS A 1 8   ? 13.038  -17.046 -12.091 1.00 70.50 ? 8   LYS A CD   1  
ATOM 139    C CE   . LYS A 1 8   ? 12.147  -16.438 -13.175 1.00 5.32  ? 8   LYS A CE   1  
ATOM 140    N NZ   . LYS A 1 8   ? 12.446  -17.082 -14.485 1.00 55.23 ? 8   LYS A NZ   1  
ATOM 141    H H    . LYS A 1 8   ? 13.627  -14.407 -9.179  1.00 54.40 ? 8   LYS A H    1  
ATOM 142    H HA   . LYS A 1 8   ? 12.277  -16.667 -8.064  1.00 63.23 ? 8   LYS A HA   1  
ATOM 143    H HB2  . LYS A 1 8   ? 14.666  -16.572 -9.935  1.00 61.24 ? 8   LYS A HB2  1  
ATOM 144    H HB3  . LYS A 1 8   ? 13.665  -17.993 -9.634  1.00 43.53 ? 8   LYS A HB3  1  
ATOM 145    H HG2  . LYS A 1 8   ? 11.680  -16.751 -10.453 1.00 21.04 ? 8   LYS A HG2  1  
ATOM 146    H HG3  . LYS A 1 8   ? 12.710  -15.363 -10.802 1.00 35.41 ? 8   LYS A HG3  1  
ATOM 147    H HD2  . LYS A 1 8   ? 14.074  -16.835 -12.314 1.00 73.04 ? 8   LYS A HD2  1  
ATOM 148    H HD3  . LYS A 1 8   ? 12.886  -18.114 -12.060 1.00 12.51 ? 8   LYS A HD3  1  
ATOM 149    H HE2  . LYS A 1 8   ? 11.110  -16.602 -12.922 1.00 30.32 ? 8   LYS A HE2  1  
ATOM 150    H HE3  . LYS A 1 8   ? 12.337  -15.377 -13.243 1.00 53.34 ? 8   LYS A HE3  1  
ATOM 151    H HZ1  . LYS A 1 8   ? 13.431  -17.415 -14.491 1.00 4.55  ? 8   LYS A HZ1  1  
ATOM 152    H HZ2  . LYS A 1 8   ? 12.309  -16.390 -15.250 1.00 30.52 ? 8   LYS A HZ2  1  
ATOM 153    H HZ3  . LYS A 1 8   ? 11.809  -17.890 -14.629 1.00 34.52 ? 8   LYS A HZ3  1  
ATOM 154    N N    . ASN A 1 9   ? 15.345  -16.160 -7.052  1.00 34.13 ? 9   ASN A N    1  
ATOM 155    C CA   . ASN A 1 9   ? 16.336  -16.599 -6.028  1.00 62.03 ? 9   ASN A CA   1  
ATOM 156    C C    . ASN A 1 9   ? 15.887  -16.120 -4.646  1.00 50.30 ? 9   ASN A C    1  
ATOM 157    O O    . ASN A 1 9   ? 15.991  -14.955 -4.317  1.00 41.42 ? 9   ASN A O    1  
ATOM 158    C CB   . ASN A 1 9   ? 17.705  -16.000 -6.355  1.00 52.35 ? 9   ASN A CB   1  
ATOM 159    C CG   . ASN A 1 9   ? 18.143  -16.456 -7.748  1.00 62.42 ? 9   ASN A CG   1  
ATOM 160    O OD1  . ASN A 1 9   ? 18.416  -15.642 -8.608  1.00 63.02 ? 9   ASN A OD1  1  
ATOM 161    N ND2  . ASN A 1 9   ? 18.222  -17.732 -8.009  1.00 23.44 ? 9   ASN A ND2  1  
ATOM 162    H H    . ASN A 1 9   ? 15.514  -15.353 -7.581  1.00 50.02 ? 9   ASN A H    1  
ATOM 163    H HA   . ASN A 1 9   ? 16.406  -17.677 -6.030  1.00 31.10 ? 9   ASN A HA   1  
ATOM 164    H HB2  . ASN A 1 9   ? 17.641  -14.921 -6.331  1.00 52.54 ? 9   ASN A HB2  1  
ATOM 165    H HB3  . ASN A 1 9   ? 18.428  -16.334 -5.626  1.00 11.54 ? 9   ASN A HB3  1  
ATOM 166    H HD21 . ASN A 1 9   ? 18.002  -18.388 -7.315  1.00 72.22 ? 9   ASN A HD21 1  
ATOM 167    H HD22 . ASN A 1 9   ? 18.501  -18.034 -8.898  1.00 72.42 ? 9   ASN A HD22 1  
ATOM 168    N N    . SER A 1 10  ? 15.387  -17.011 -3.834  1.00 55.20 ? 10  SER A N    1  
ATOM 169    C CA   . SER A 1 10  ? 14.929  -16.610 -2.474  1.00 42.33 ? 10  SER A CA   1  
ATOM 170    C C    . SER A 1 10  ? 16.124  -16.131 -1.645  1.00 50.12 ? 10  SER A C    1  
ATOM 171    O O    . SER A 1 10  ? 15.984  -15.324 -0.749  1.00 54.35 ? 10  SER A O    1  
ATOM 172    C CB   . SER A 1 10  ? 14.278  -17.808 -1.783  1.00 72.34 ? 10  SER A CB   1  
ATOM 173    O OG   . SER A 1 10  ? 13.189  -18.270 -2.571  1.00 31.54 ? 10  SER A OG   1  
ATOM 174    H H    . SER A 1 10  ? 15.312  -17.945 -4.120  1.00 62.32 ? 10  SER A H    1  
ATOM 175    H HA   . SER A 1 10  ? 14.208  -15.810 -2.559  1.00 1.44  ? 10  SER A HA   1  
ATOM 176    H HB2  . SER A 1 10  ? 14.999  -18.601 -1.676  1.00 50.45 ? 10  SER A HB2  1  
ATOM 177    H HB3  . SER A 1 10  ? 13.926  -17.510 -0.803  1.00 54.41 ? 10  SER A HB3  1  
ATOM 178    H HG   . SER A 1 10  ? 13.347  -19.192 -2.785  1.00 21.13 ? 10  SER A HG   1  
ATOM 179    N N    . VAL A 1 11  ? 17.297  -16.628 -1.929  1.00 31.02 ? 11  VAL A N    1  
ATOM 180    C CA   . VAL A 1 11  ? 18.494  -16.202 -1.149  1.00 41.13 ? 11  VAL A CA   1  
ATOM 181    C C    . VAL A 1 11  ? 18.748  -14.708 -1.364  1.00 45.14 ? 11  VAL A C    1  
ATOM 182    O O    . VAL A 1 11  ? 18.932  -13.959 -0.425  1.00 54.05 ? 11  VAL A O    1  
ATOM 183    C CB   . VAL A 1 11  ? 19.714  -16.999 -1.616  1.00 74.02 ? 11  VAL A CB   1  
ATOM 184    C CG1  . VAL A 1 11  ? 20.946  -16.559 -0.823  1.00 63.12 ? 11  VAL A CG1  1  
ATOM 185    C CG2  . VAL A 1 11  ? 19.466  -18.491 -1.383  1.00 43.33 ? 11  VAL A CG2  1  
ATOM 186    H H    . VAL A 1 11  ? 17.390  -17.283 -2.652  1.00 54.41 ? 11  VAL A H    1  
ATOM 187    H HA   . VAL A 1 11  ? 18.324  -16.390 -0.100  1.00 21.33 ? 11  VAL A HA   1  
ATOM 188    H HB   . VAL A 1 11  ? 19.880  -16.819 -2.668  1.00 72.11 ? 11  VAL A HB   1  
ATOM 189    H HG11 . VAL A 1 11  ? 20.704  -16.526 0.229   1.00 23.13 ? 11  VAL A HG11 1  
ATOM 190    H HG12 . VAL A 1 11  ? 21.254  -15.577 -1.152  1.00 73.33 ? 11  VAL A HG12 1  
ATOM 191    H HG13 . VAL A 1 11  ? 21.749  -17.262 -0.985  1.00 43.33 ? 11  VAL A HG13 1  
ATOM 192    H HG21 . VAL A 1 11  ? 20.361  -19.046 -1.623  1.00 13.33 ? 11  VAL A HG21 1  
ATOM 193    H HG22 . VAL A 1 11  ? 18.656  -18.824 -2.015  1.00 4.50  ? 11  VAL A HG22 1  
ATOM 194    H HG23 . VAL A 1 11  ? 19.206  -18.655 -0.348  1.00 74.42 ? 11  VAL A HG23 1  
ATOM 195    N N    . LEU A 1 12  ? 18.762  -14.267 -2.593  1.00 23.44 ? 12  LEU A N    1  
ATOM 196    C CA   . LEU A 1 12  ? 19.006  -12.821 -2.865  1.00 71.15 ? 12  LEU A CA   1  
ATOM 197    C C    . LEU A 1 12  ? 17.797  -12.003 -2.399  1.00 50.15 ? 12  LEU A C    1  
ATOM 198    O O    . LEU A 1 12  ? 17.934  -10.992 -1.738  1.00 35.30 ? 12  LEU A O    1  
ATOM 199    C CB   . LEU A 1 12  ? 19.217  -12.615 -4.371  1.00 43.45 ? 12  LEU A CB   1  
ATOM 200    C CG   . LEU A 1 12  ? 20.632  -13.058 -4.783  1.00 71.43 ? 12  LEU A CG   1  
ATOM 201    C CD1  . LEU A 1 12  ? 21.696  -12.089 -4.227  1.00 70.13 ? 12  LEU A CD1  1  
ATOM 202    C CD2  . LEU A 1 12  ? 20.898  -14.475 -4.260  1.00 32.44 ? 12  LEU A CD2  1  
ATOM 203    H H    . LEU A 1 12  ? 18.612  -14.887 -3.337  1.00 33.33 ? 12  LEU A H    1  
ATOM 204    H HA   . LEU A 1 12  ? 19.884  -12.497 -2.329  1.00 3.13  ? 12  LEU A HA   1  
ATOM 205    H HB2  . LEU A 1 12  ? 18.490  -13.204 -4.911  1.00 72.01 ? 12  LEU A HB2  1  
ATOM 206    H HB3  . LEU A 1 12  ? 19.081  -11.572 -4.616  1.00 43.02 ? 12  LEU A HB3  1  
ATOM 207    H HG   . LEU A 1 12  ? 20.695  -13.063 -5.862  1.00 71.01 ? 12  LEU A HG   1  
ATOM 208    H HD11 . LEU A 1 12  ? 22.556  -12.096 -4.880  1.00 71.22 ? 12  LEU A HD11 1  
ATOM 209    H HD12 . LEU A 1 12  ? 22.001  -12.400 -3.238  1.00 1.05  ? 12  LEU A HD12 1  
ATOM 210    H HD13 . LEU A 1 12  ? 21.295  -11.087 -4.180  1.00 31.10 ? 12  LEU A HD13 1  
ATOM 211    H HD21 . LEU A 1 12  ? 20.038  -15.098 -4.454  1.00 25.23 ? 12  LEU A HD21 1  
ATOM 212    H HD22 . LEU A 1 12  ? 21.084  -14.438 -3.197  1.00 53.53 ? 12  LEU A HD22 1  
ATOM 213    H HD23 . LEU A 1 12  ? 21.761  -14.887 -4.762  1.00 42.20 ? 12  LEU A HD23 1  
ATOM 214    N N    . GLY A 1 13  ? 16.611  -12.437 -2.726  1.00 1.44  ? 13  GLY A N    1  
ATOM 215    C CA   . GLY A 1 13  ? 15.405  -11.685 -2.290  1.00 41.23 ? 13  GLY A CA   1  
ATOM 216    C C    . GLY A 1 13  ? 15.312  -11.764 -0.773  1.00 61.32 ? 13  GLY A C    1  
ATOM 217    O O    . GLY A 1 13  ? 14.621  -10.994 -0.138  1.00 44.22 ? 13  GLY A O    1  
ATOM 218    H H    . GLY A 1 13  ? 16.513  -13.258 -3.245  1.00 22.20 ? 13  GLY A H    1  
ATOM 219    H HA2  . GLY A 1 13  ? 15.489  -10.653 -2.600  1.00 44.13 ? 13  GLY A HA2  1  
ATOM 220    H HA3  . GLY A 1 13  ? 14.523  -12.127 -2.728  1.00 72.14 ? 13  GLY A HA3  1  
ATOM 221    N N    . GLY A 1 14  ? 16.008  -12.698 -0.190  1.00 34.11 ? 14  GLY A N    1  
ATOM 222    C CA   . GLY A 1 14  ? 15.972  -12.844 1.285   1.00 71.20 ? 14  GLY A CA   1  
ATOM 223    C C    . GLY A 1 14  ? 16.769  -11.713 1.931   1.00 55.01 ? 14  GLY A C    1  
ATOM 224    O O    . GLY A 1 14  ? 16.260  -10.960 2.737   1.00 42.42 ? 14  GLY A O    1  
ATOM 225    H H    . GLY A 1 14  ? 16.556  -13.306 -0.728  1.00 72.33 ? 14  GLY A H    1  
ATOM 226    H HA2  . GLY A 1 14  ? 14.948  -12.806 1.618   1.00 35.45 ? 14  GLY A HA2  1  
ATOM 227    H HA3  . GLY A 1 14  ? 16.411  -13.789 1.565   1.00 23.31 ? 14  GLY A HA3  1  
ATOM 228    N N    . GLU A 1 15  ? 18.020  -11.594 1.585   1.00 51.24 ? 15  GLU A N    1  
ATOM 229    C CA   . GLU A 1 15  ? 18.858  -10.519 2.181   1.00 71.32 ? 15  GLU A CA   1  
ATOM 230    C C    . GLU A 1 15  ? 18.166  -9.165  2.001   1.00 23.24 ? 15  GLU A C    1  
ATOM 231    O O    . GLU A 1 15  ? 18.059  -8.391  2.932   1.00 64.10 ? 15  GLU A O    1  
ATOM 232    C CB   . GLU A 1 15  ? 20.236  -10.506 1.509   1.00 55.24 ? 15  GLU A CB   1  
ATOM 233    C CG   . GLU A 1 15  ? 20.086  -10.657 -0.004  1.00 2.34  ? 15  GLU A CG   1  
ATOM 234    C CD   . GLU A 1 15  ? 21.469  -10.622 -0.657  1.00 31.14 ? 15  GLU A CD   1  
ATOM 235    O OE1  . GLU A 1 15  ? 22.447  -10.679 0.069   1.00 15.22 ? 15  GLU A OE1  1  
ATOM 236    O OE2  . GLU A 1 15  ? 21.525  -10.539 -1.873  1.00 12.42 ? 15  GLU A OE2  1  
ATOM 237    H H    . GLU A 1 15  ? 18.408  -12.218 0.939   1.00 43.41 ? 15  GLU A H    1  
ATOM 238    H HA   . GLU A 1 15  ? 18.982  -10.713 3.237   1.00 52.34 ? 15  GLU A HA   1  
ATOM 239    H HB2  . GLU A 1 15  ? 20.734  -9.575  1.726   1.00 61.44 ? 15  GLU A HB2  1  
ATOM 240    H HB3  . GLU A 1 15  ? 20.822  -11.327 1.891   1.00 72.14 ? 15  GLU A HB3  1  
ATOM 241    H HG2  . GLU A 1 15  ? 19.610  -11.598 -0.222  1.00 72.34 ? 15  GLU A HG2  1  
ATOM 242    H HG3  . GLU A 1 15  ? 19.488  -9.849  -0.392  1.00 64.34 ? 15  GLU A HG3  1  
ATOM 243    N N    . ILE A 1 16  ? 17.678  -8.869  0.825   1.00 14.42 ? 16  ILE A N    1  
ATOM 244    C CA   . ILE A 1 16  ? 16.983  -7.562  0.632   1.00 32.43 ? 16  ILE A CA   1  
ATOM 245    C C    . ILE A 1 16  ? 15.770  -7.513  1.558   1.00 0.21  ? 16  ILE A C    1  
ATOM 246    O O    . ILE A 1 16  ? 15.537  -6.536  2.239   1.00 33.53 ? 16  ILE A O    1  
ATOM 247    C CB   . ILE A 1 16  ? 16.515  -7.421  -0.822  1.00 30.33 ? 16  ILE A CB   1  
ATOM 248    C CG1  . ILE A 1 16  ? 17.692  -7.631  -1.785  1.00 45.13 ? 16  ILE A CG1  1  
ATOM 249    C CG2  . ILE A 1 16  ? 15.929  -6.024  -1.035  1.00 23.13 ? 16  ILE A CG2  1  
ATOM 250    C CD1  . ILE A 1 16  ? 18.877  -6.747  -1.385  1.00 63.23 ? 16  ILE A CD1  1  
ATOM 251    H H    . ILE A 1 16  ? 17.758  -9.504  0.079   1.00 74.24 ? 16  ILE A H    1  
ATOM 252    H HA   . ILE A 1 16  ? 17.650  -6.749  0.883   1.00 65.54 ? 16  ILE A HA   1  
ATOM 253    H HB   . ILE A 1 16  ? 15.751  -8.159  -1.021  1.00 11.33 ? 16  ILE A HB   1  
ATOM 254    H HG12 . ILE A 1 16  ? 17.995  -8.664  -1.758  1.00 45.54 ? 16  ILE A HG12 1  
ATOM 255    H HG13 . ILE A 1 16  ? 17.382  -7.376  -2.788  1.00 41.52 ? 16  ILE A HG13 1  
ATOM 256    H HG21 . ILE A 1 16  ? 16.637  -5.281  -0.696  1.00 40.40 ? 16  ILE A HG21 1  
ATOM 257    H HG22 . ILE A 1 16  ? 15.012  -5.928  -0.473  1.00 2.41  ? 16  ILE A HG22 1  
ATOM 258    H HG23 . ILE A 1 16  ? 15.726  -5.875  -2.085  1.00 44.12 ? 16  ILE A HG23 1  
ATOM 259    H HD11 . ILE A 1 16  ? 19.415  -7.215  -0.574  1.00 34.52 ? 16  ILE A HD11 1  
ATOM 260    H HD12 . ILE A 1 16  ? 18.519  -5.778  -1.068  1.00 42.23 ? 16  ILE A HD12 1  
ATOM 261    H HD13 . ILE A 1 16  ? 19.537  -6.627  -2.231  1.00 20.43 ? 16  ILE A HD13 1  
ATOM 262    N N    . GLU A 1 17  ? 14.996  -8.565  1.594   1.00 14.30 ? 17  GLU A N    1  
ATOM 263    C CA   . GLU A 1 17  ? 13.795  -8.580  2.477   1.00 51.11 ? 17  GLU A CA   1  
ATOM 264    C C    . GLU A 1 17  ? 14.170  -8.066  3.869   1.00 22.10 ? 17  GLU A C    1  
ATOM 265    O O    . GLU A 1 17  ? 13.545  -7.169  4.395   1.00 0.24  ? 17  GLU A O    1  
ATOM 266    C CB   . GLU A 1 17  ? 13.264  -10.011 2.593   1.00 22.03 ? 17  GLU A CB   1  
ATOM 267    C CG   . GLU A 1 17  ? 11.906  -9.994  3.297   1.00 23.22 ? 17  GLU A CG   1  
ATOM 268    C CD   . GLU A 1 17  ? 11.415  -11.430 3.495   1.00 4.12  ? 17  GLU A CD   1  
ATOM 269    O OE1  . GLU A 1 17  ? 12.141  -12.339 3.126   1.00 22.03 ? 17  GLU A OE1  1  
ATOM 270    O OE2  . GLU A 1 17  ? 10.323  -11.596 4.012   1.00 25.24 ? 17  GLU A OE2  1  
ATOM 271    H H    . GLU A 1 17  ? 15.206  -9.345  1.039   1.00 3.12  ? 17  GLU A H    1  
ATOM 272    H HA   . GLU A 1 17  ? 13.030  -7.947  2.054   1.00 44.10 ? 17  GLU A HA   1  
ATOM 273    H HB2  . GLU A 1 17  ? 13.155  -10.437 1.607   1.00 63.40 ? 17  GLU A HB2  1  
ATOM 274    H HB3  . GLU A 1 17  ? 13.957  -10.606 3.168   1.00 54.10 ? 17  GLU A HB3  1  
ATOM 275    H HG2  . GLU A 1 17  ? 12.005  -9.511  4.259   1.00 22.53 ? 17  GLU A HG2  1  
ATOM 276    H HG3  . GLU A 1 17  ? 11.193  -9.453  2.693   1.00 71.41 ? 17  GLU A HG3  1  
ATOM 277    N N    . LYS A 1 18  ? 15.186  -8.626  4.471   1.00 1.35  ? 18  LYS A N    1  
ATOM 278    C CA   . LYS A 1 18  ? 15.598  -8.168  5.831   1.00 70.42 ? 18  LYS A CA   1  
ATOM 279    C C    . LYS A 1 18  ? 16.602  -7.027  5.708   1.00 64.53 ? 18  LYS A C    1  
ATOM 280    O O    . LYS A 1 18  ? 17.143  -6.553  6.688   1.00 41.44 ? 18  LYS A O    1  
ATOM 281    C CB   . LYS A 1 18  ? 16.235  -9.332  6.593   1.00 73.34 ? 18  LYS A CB   1  
ATOM 282    C CG   . LYS A 1 18  ? 15.201  -10.444 6.783   1.00 53.23 ? 18  LYS A CG   1  
ATOM 283    C CD   . LYS A 1 18  ? 15.800  -11.559 7.642   1.00 53.13 ? 18  LYS A CD   1  
ATOM 284    C CE   . LYS A 1 18  ? 14.824  -12.736 7.705   1.00 4.44  ? 18  LYS A CE   1  
ATOM 285    N NZ   . LYS A 1 18  ? 13.454  -12.229 8.001   1.00 1.10  ? 18  LYS A NZ   1  
ATOM 286    H H    . LYS A 1 18  ? 15.678  -9.350  4.029   1.00 75.54 ? 18  LYS A H    1  
ATOM 287    H HA   . LYS A 1 18  ? 14.736  -7.816  6.370   1.00 11.42 ? 18  LYS A HA   1  
ATOM 288    H HB2  . LYS A 1 18  ? 17.076  -9.713  6.031   1.00 12.33 ? 18  LYS A HB2  1  
ATOM 289    H HB3  . LYS A 1 18  ? 16.573  -8.989  7.559   1.00 72.55 ? 18  LYS A HB3  1  
ATOM 290    H HG2  . LYS A 1 18  ? 14.326  -10.041 7.273   1.00 1.03  ? 18  LYS A HG2  1  
ATOM 291    H HG3  . LYS A 1 18  ? 14.922  -10.845 5.820   1.00 64.21 ? 18  LYS A HG3  1  
ATOM 292    H HD2  . LYS A 1 18  ? 16.733  -11.887 7.207   1.00 53.52 ? 18  LYS A HD2  1  
ATOM 293    H HD3  . LYS A 1 18  ? 15.978  -11.189 8.640   1.00 43.30 ? 18  LYS A HD3  1  
ATOM 294    H HE2  . LYS A 1 18  ? 14.820  -13.251 6.756   1.00 43.35 ? 18  LYS A HE2  1  
ATOM 295    H HE3  . LYS A 1 18  ? 15.131  -13.417 8.484   1.00 74.41 ? 18  LYS A HE3  1  
ATOM 296    H HZ1  . LYS A 1 18  ? 13.517  -11.407 8.634   1.00 42.41 ? 18  LYS A HZ1  1  
ATOM 297    H HZ2  . LYS A 1 18  ? 12.899  -12.980 8.461   1.00 11.42 ? 18  LYS A HZ2  1  
ATOM 298    H HZ3  . LYS A 1 18  ? 12.989  -11.946 7.115   1.00 32.32 ? 18  LYS A HZ3  1  
ATOM 299    N N    . GLY A 1 19  ? 16.856  -6.581  4.514   1.00 2.13  ? 19  GLY A N    1  
ATOM 300    C CA   . GLY A 1 19  ? 17.824  -5.471  4.325   1.00 62.15 ? 19  GLY A CA   1  
ATOM 301    C C    . GLY A 1 19  ? 17.135  -4.128  4.579   1.00 22.13 ? 19  GLY A C    1  
ATOM 302    O O    . GLY A 1 19  ? 17.489  -3.400  5.485   1.00 15.24 ? 19  GLY A O    1  
ATOM 303    H H    . GLY A 1 19  ? 16.411  -6.978  3.737   1.00 54.31 ? 19  GLY A H    1  
ATOM 304    H HA2  . GLY A 1 19  ? 18.651  -5.589  5.010   1.00 21.21 ? 19  GLY A HA2  1  
ATOM 305    H HA3  . GLY A 1 19  ? 18.187  -5.496  3.315   1.00 15.13 ? 19  GLY A HA3  1  
ATOM 306    N N    . LEU A 1 20  ? 16.161  -3.787  3.779   1.00 33.40 ? 20  LEU A N    1  
ATOM 307    C CA   . LEU A 1 20  ? 15.462  -2.483  3.970   1.00 10.01 ? 20  LEU A CA   1  
ATOM 308    C C    . LEU A 1 20  ? 14.565  -2.539  5.214   1.00 34.22 ? 20  LEU A C    1  
ATOM 309    O O    . LEU A 1 20  ? 14.189  -1.522  5.760   1.00 20.10 ? 20  LEU A O    1  
ATOM 310    C CB   . LEU A 1 20  ? 14.641  -2.146  2.709   1.00 73.51 ? 20  LEU A CB   1  
ATOM 311    C CG   . LEU A 1 20  ? 13.321  -2.935  2.653   1.00 35.33 ? 20  LEU A CG   1  
ATOM 312    C CD1  . LEU A 1 20  ? 12.541  -2.509  1.408   1.00 55.24 ? 20  LEU A CD1  1  
ATOM 313    C CD2  . LEU A 1 20  ? 13.620  -4.430  2.563   1.00 24.13 ? 20  LEU A CD2  1  
ATOM 314    H H    . LEU A 1 20  ? 15.897  -4.384  3.047   1.00 1.32  ? 20  LEU A H    1  
ATOM 315    H HA   . LEU A 1 20  ? 16.203  -1.710  4.115   1.00 20.14 ? 20  LEU A HA   1  
ATOM 316    H HB2  . LEU A 1 20  ? 14.421  -1.090  2.702   1.00 65.10 ? 20  LEU A HB2  1  
ATOM 317    H HB3  . LEU A 1 20  ? 15.232  -2.391  1.835   1.00 74.42 ? 20  LEU A HB3  1  
ATOM 318    H HG   . LEU A 1 20  ? 12.723  -2.731  3.527   1.00 71.41 ? 20  LEU A HG   1  
ATOM 319    H HD11 . LEU A 1 20  ? 12.507  -1.431  1.356   1.00 42.20 ? 20  LEU A HD11 1  
ATOM 320    H HD12 . LEU A 1 20  ? 11.536  -2.898  1.464   1.00 25.23 ? 20  LEU A HD12 1  
ATOM 321    H HD13 . LEU A 1 20  ? 13.029  -2.897  0.527   1.00 2.35  ? 20  LEU A HD13 1  
ATOM 322    H HD21 . LEU A 1 20  ? 14.002  -4.782  3.509   1.00 62.11 ? 20  LEU A HD21 1  
ATOM 323    H HD22 . LEU A 1 20  ? 14.354  -4.599  1.790   1.00 21.10 ? 20  LEU A HD22 1  
ATOM 324    H HD23 . LEU A 1 20  ? 12.716  -4.964  2.320   1.00 61.40 ? 20  LEU A HD23 1  
ATOM 325    N N    . ASN A 1 21  ? 14.216  -3.711  5.668   1.00 3.33  ? 21  ASN A N    1  
ATOM 326    C CA   . ASN A 1 21  ? 13.343  -3.807  6.875   1.00 20.45 ? 21  ASN A CA   1  
ATOM 327    C C    . ASN A 1 21  ? 13.954  -2.986  8.013   1.00 64.41 ? 21  ASN A C    1  
ATOM 328    O O    . ASN A 1 21  ? 13.252  -2.411  8.822   1.00 51.00 ? 21  ASN A O    1  
ATOM 329    C CB   . ASN A 1 21  ? 13.223  -5.269  7.312   1.00 74.25 ? 21  ASN A CB   1  
ATOM 330    C CG   . ASN A 1 21  ? 12.280  -6.012  6.364   1.00 22.12 ? 21  ASN A CG   1  
ATOM 331    O OD1  . ASN A 1 21  ? 11.607  -5.402  5.557   1.00 51.31 ? 21  ASN A OD1  1  
ATOM 332    N ND2  . ASN A 1 21  ? 12.202  -7.313  6.428   1.00 33.11 ? 21  ASN A ND2  1  
ATOM 333    H H    . ASN A 1 21  ? 14.524  -4.525  5.219   1.00 23.23 ? 21  ASN A H    1  
ATOM 334    H HA   . ASN A 1 21  ? 12.363  -3.420  6.640   1.00 24.01 ? 21  ASN A HA   1  
ATOM 335    H HB2  . ASN A 1 21  ? 14.199  -5.732  7.286   1.00 43.04 ? 21  ASN A HB2  1  
ATOM 336    H HB3  . ASN A 1 21  ? 12.829  -5.316  8.316   1.00 70.44 ? 21  ASN A HB3  1  
ATOM 337    H HD21 . ASN A 1 21  ? 12.744  -7.805  7.079   1.00 31.11 ? 21  ASN A HD21 1  
ATOM 338    H HD22 . ASN A 1 21  ? 11.600  -7.798  5.825   1.00 23.31 ? 21  ASN A HD22 1  
ATOM 339    N N    . VAL A 1 22  ? 15.254  -2.926  8.083   1.00 23.44 ? 22  VAL A N    1  
ATOM 340    C CA   . VAL A 1 22  ? 15.906  -2.142  9.170   1.00 10.23 ? 22  VAL A CA   1  
ATOM 341    C C    . VAL A 1 22  ? 15.442  -0.687  9.093   1.00 45.40 ? 22  VAL A C    1  
ATOM 342    O O    . VAL A 1 22  ? 15.337  -0.004  10.093  1.00 33.43 ? 22  VAL A O    1  
ATOM 343    C CB   . VAL A 1 22  ? 17.425  -2.203  9.003   1.00 41.11 ? 22  VAL A CB   1  
ATOM 344    C CG1  . VAL A 1 22  ? 18.093  -1.376  10.103  1.00 70.04 ? 22  VAL A CG1  1  
ATOM 345    C CG2  . VAL A 1 22  ? 17.889  -3.658  9.105   1.00 12.42 ? 22  VAL A CG2  1  
ATOM 346    H H    . VAL A 1 22  ? 15.803  -3.397  7.421   1.00 64.11 ? 22  VAL A H    1  
ATOM 347    H HA   . VAL A 1 22  ? 15.631  -2.558  10.128  1.00 24.52 ? 22  VAL A HA   1  
ATOM 348    H HB   . VAL A 1 22  ? 17.696  -1.803  8.037   1.00 42.15 ? 22  VAL A HB   1  
ATOM 349    H HG11 . VAL A 1 22  ? 17.664  -1.636  11.059  1.00 45.52 ? 22  VAL A HG11 1  
ATOM 350    H HG12 . VAL A 1 22  ? 17.934  -0.326  9.910   1.00 24.54 ? 22  VAL A HG12 1  
ATOM 351    H HG13 . VAL A 1 22  ? 19.153  -1.584  10.115  1.00 54.44 ? 22  VAL A HG13 1  
ATOM 352    H HG21 . VAL A 1 22  ? 18.953  -3.709  8.926   1.00 72.11 ? 22  VAL A HG21 1  
ATOM 353    H HG22 . VAL A 1 22  ? 17.371  -4.254  8.369   1.00 64.21 ? 22  VAL A HG22 1  
ATOM 354    H HG23 . VAL A 1 22  ? 17.672  -4.037  10.093  1.00 71.14 ? 22  VAL A HG23 1  
ATOM 355    N N    . LYS A 1 23  ? 15.167  -0.206  7.913   1.00 34.31 ? 23  LYS A N    1  
ATOM 356    C CA   . LYS A 1 23  ? 14.713  1.206   7.769   1.00 1.14  ? 23  LYS A CA   1  
ATOM 357    C C    . LYS A 1 23  ? 13.263  1.323   8.255   1.00 51.00 ? 23  LYS A C    1  
ATOM 358    O O    . LYS A 1 23  ? 12.695  2.396   8.287   1.00 22.44 ? 23  LYS A O    1  
ATOM 359    C CB   . LYS A 1 23  ? 14.813  1.624   6.293   1.00 73.23 ? 23  LYS A CB   1  
ATOM 360    C CG   . LYS A 1 23  ? 16.250  2.054   5.969   1.00 5.04  ? 23  LYS A CG   1  
ATOM 361    C CD   . LYS A 1 23  ? 17.221  0.928   6.337   1.00 23.14 ? 23  LYS A CD   1  
ATOM 362    C CE   . LYS A 1 23  ? 18.616  1.255   5.799   1.00 44.42 ? 23  LYS A CE   1  
ATOM 363    N NZ   . LYS A 1 23  ? 19.487  0.052   5.920   1.00 1.14  ? 23  LYS A NZ   1  
ATOM 364    H H    . LYS A 1 23  ? 15.260  -0.773  7.119   1.00 24.13 ? 23  LYS A H    1  
ATOM 365    H HA   . LYS A 1 23  ? 15.341  1.846   8.372   1.00 52.42 ? 23  LYS A HA   1  
ATOM 366    H HB2  . LYS A 1 23  ? 14.539  0.791   5.665   1.00 0.21  ? 23  LYS A HB2  1  
ATOM 367    H HB3  . LYS A 1 23  ? 14.145  2.449   6.102   1.00 1.43  ? 23  LYS A HB3  1  
ATOM 368    H HG2  . LYS A 1 23  ? 16.329  2.268   4.913   1.00 11.13 ? 23  LYS A HG2  1  
ATOM 369    H HG3  . LYS A 1 23  ? 16.497  2.939   6.535   1.00 44.14 ? 23  LYS A HG3  1  
ATOM 370    H HD2  . LYS A 1 23  ? 17.268  0.831   7.412   1.00 63.22 ? 23  LYS A HD2  1  
ATOM 371    H HD3  . LYS A 1 23  ? 16.879  0.000   5.904   1.00 41.31 ? 23  LYS A HD3  1  
ATOM 372    H HE2  . LYS A 1 23  ? 18.546  1.546   4.762   1.00 20.33 ? 23  LYS A HE2  1  
ATOM 373    H HE3  . LYS A 1 23  ? 19.041  2.065   6.372   1.00 12.23 ? 23  LYS A HE3  1  
ATOM 374    H HZ1  . LYS A 1 23  ? 18.972  -0.701  6.418   1.00 64.31 ? 23  LYS A HZ1  1  
ATOM 375    H HZ2  . LYS A 1 23  ? 20.346  0.298   6.454   1.00 35.22 ? 23  LYS A HZ2  1  
ATOM 376    H HZ3  . LYS A 1 23  ? 19.751  -0.282  4.971   1.00 54.43 ? 23  LYS A HZ3  1  
ATOM 377    N N    . GLY A 1 24  ? 12.664  0.227   8.641   1.00 42.42 ? 24  GLY A N    1  
ATOM 378    C CA   . GLY A 1 24  ? 11.255  0.273   9.134   1.00 31.41 ? 24  GLY A CA   1  
ATOM 379    C C    . GLY A 1 24  ? 10.283  0.156   7.958   1.00 10.20 ? 24  GLY A C    1  
ATOM 380    O O    . GLY A 1 24  ? 9.144   0.571   8.042   1.00 75.54 ? 24  GLY A O    1  
ATOM 381    H H    . GLY A 1 24  ? 13.144  -0.627  8.613   1.00 42.23 ? 24  GLY A H    1  
ATOM 382    H HA2  . GLY A 1 24  ? 11.090  -0.547  9.819   1.00 33.31 ? 24  GLY A HA2  1  
ATOM 383    H HA3  . GLY A 1 24  ? 11.081  1.208   9.648   1.00 24.23 ? 24  GLY A HA3  1  
ATOM 384    N N    . PHE A 1 25  ? 10.720  -0.409  6.861   1.00 73.43 ? 25  PHE A N    1  
ATOM 385    C CA   . PHE A 1 25  ? 9.820   -0.560  5.675   1.00 73.42 ? 25  PHE A CA   1  
ATOM 386    C C    . PHE A 1 25  ? 9.264   -1.987  5.639   1.00 71.33 ? 25  PHE A C    1  
ATOM 387    O O    . PHE A 1 25  ? 9.833   -2.900  6.204   1.00 11.43 ? 25  PHE A O    1  
ATOM 388    C CB   . PHE A 1 25  ? 10.620  -0.293  4.393   1.00 21.03 ? 25  PHE A CB   1  
ATOM 389    C CG   . PHE A 1 25  ? 10.802  1.199   4.205   1.00 23.20 ? 25  PHE A CG   1  
ATOM 390    C CD1  . PHE A 1 25  ? 11.571  1.929   5.119   1.00 61.32 ? 25  PHE A CD1  1  
ATOM 391    C CD2  . PHE A 1 25  ? 10.201  1.852   3.119   1.00 62.51 ? 25  PHE A CD2  1  
ATOM 392    C CE1  . PHE A 1 25  ? 11.740  3.309   4.949   1.00 22.52 ? 25  PHE A CE1  1  
ATOM 393    C CE2  . PHE A 1 25  ? 10.371  3.231   2.950   1.00 1.44  ? 25  PHE A CE2  1  
ATOM 394    C CZ   . PHE A 1 25  ? 11.140  3.959   3.865   1.00 35.11 ? 25  PHE A CZ   1  
ATOM 395    H H    . PHE A 1 25  ? 11.642  -0.740  6.818   1.00 54.31 ? 25  PHE A H    1  
ATOM 396    H HA   . PHE A 1 25  ? 8.998   0.142   5.740   1.00 50.24 ? 25  PHE A HA   1  
ATOM 397    H HB2  . PHE A 1 25  ? 11.589  -0.764  4.472   1.00 74.51 ? 25  PHE A HB2  1  
ATOM 398    H HB3  . PHE A 1 25  ? 10.091  -0.702  3.544   1.00 34.12 ? 25  PHE A HB3  1  
ATOM 399    H HD1  . PHE A 1 25  ? 12.034  1.428   5.956   1.00 62.22 ? 25  PHE A HD1  1  
ATOM 400    H HD2  . PHE A 1 25  ? 9.607   1.291   2.413   1.00 70.35 ? 25  PHE A HD2  1  
ATOM 401    H HE1  . PHE A 1 25  ? 12.333  3.871   5.655   1.00 4.30  ? 25  PHE A HE1  1  
ATOM 402    H HE2  . PHE A 1 25  ? 9.908   3.733   2.113   1.00 11.12 ? 25  PHE A HE2  1  
ATOM 403    H HZ   . PHE A 1 25  ? 11.271  5.023   3.734   1.00 21.13 ? 25  PHE A HZ   1  
ATOM 404    N N    . MET A 1 26  ? 8.158   -2.187  4.967   1.00 33.24 ? 26  MET A N    1  
ATOM 405    C CA   . MET A 1 26  ? 7.557   -3.550  4.871   1.00 43.24 ? 26  MET A CA   1  
ATOM 406    C C    . MET A 1 26  ? 7.910   -4.126  3.505   1.00 13.50 ? 26  MET A C    1  
ATOM 407    O O    . MET A 1 26  ? 7.900   -3.421  2.515   1.00 34.21 ? 26  MET A O    1  
ATOM 408    C CB   . MET A 1 26  ? 6.035   -3.445  5.009   1.00 40.23 ? 26  MET A CB   1  
ATOM 409    C CG   . MET A 1 26  ? 5.695   -2.491  6.154   1.00 32.23 ? 26  MET A CG   1  
ATOM 410    S SD   . MET A 1 26  ? 3.958   -2.693  6.619   1.00 35.35 ? 26  MET A SD   1  
ATOM 411    C CE   . MET A 1 26  ? 3.974   -1.560  8.029   1.00 4.12  ? 26  MET A CE   1  
ATOM 412    H H    . MET A 1 26  ? 7.726   -1.438  4.509   1.00 62.55 ? 26  MET A H    1  
ATOM 413    H HA   . MET A 1 26  ? 7.949   -4.189  5.651   1.00 24.50 ? 26  MET A HA   1  
ATOM 414    H HB2  . MET A 1 26  ? 5.612   -3.068  4.089   1.00 31.44 ? 26  MET A HB2  1  
ATOM 415    H HB3  . MET A 1 26  ? 5.624   -4.421  5.222   1.00 14.11 ? 26  MET A HB3  1  
ATOM 416    H HG2  . MET A 1 26  ? 6.323   -2.712  7.004   1.00 33.53 ? 26  MET A HG2  1  
ATOM 417    H HG3  . MET A 1 26  ? 5.866   -1.473  5.837   1.00 0.43  ? 26  MET A HG3  1  
ATOM 418    H HE1  . MET A 1 26  ? 4.925   -1.634  8.539   1.00 64.32 ? 26  MET A HE1  1  
ATOM 419    H HE2  . MET A 1 26  ? 3.181   -1.821  8.712   1.00 43.32 ? 26  MET A HE2  1  
ATOM 420    H HE3  . MET A 1 26  ? 3.826   -0.548  7.678   1.00 33.23 ? 26  MET A HE3  1  
ATOM 421    N N    . ALA A 1 27  ? 8.240   -5.390  3.430   1.00 62.11 ? 27  ALA A N    1  
ATOM 422    C CA   . ALA A 1 27  ? 8.608   -5.979  2.107   1.00 53.12 ? 27  ALA A CA   1  
ATOM 423    C C    . ALA A 1 27  ? 8.103   -7.417  1.995   1.00 13.21 ? 27  ALA A C    1  
ATOM 424    O O    . ALA A 1 27  ? 7.953   -8.119  2.975   1.00 11.01 ? 27  ALA A O    1  
ATOM 425    C CB   . ALA A 1 27  ? 10.130  -5.964  1.957   1.00 12.45 ? 27  ALA A CB   1  
ATOM 426    H H    . ALA A 1 27  ? 8.256   -5.944  4.238   1.00 74.31 ? 27  ALA A H    1  
ATOM 427    H HA   . ALA A 1 27  ? 8.171   -5.392  1.317   1.00 64.53 ? 27  ALA A HA   1  
ATOM 428    H HB1  . ALA A 1 27  ? 10.418  -6.600  1.132   1.00 54.42 ? 27  ALA A HB1  1  
ATOM 429    H HB2  . ALA A 1 27  ? 10.586  -6.325  2.867   1.00 45.45 ? 27  ALA A HB2  1  
ATOM 430    H HB3  . ALA A 1 27  ? 10.459  -4.955  1.764   1.00 30.24 ? 27  ALA A HB3  1  
ATOM 431    N N    . ASP A 1 28  ? 7.852   -7.857  0.787   1.00 3.02  ? 28  ASP A N    1  
ATOM 432    C CA   . ASP A 1 28  ? 7.367   -9.252  0.558   1.00 74.42 ? 28  ASP A CA   1  
ATOM 433    C C    . ASP A 1 28  ? 8.149   -9.854  -0.613  1.00 31.22 ? 28  ASP A C    1  
ATOM 434    O O    . ASP A 1 28  ? 8.436   -9.181  -1.583  1.00 62.21 ? 28  ASP A O    1  
ATOM 435    C CB   . ASP A 1 28  ? 5.875   -9.223  0.215   1.00 71.44 ? 28  ASP A CB   1  
ATOM 436    C CG   . ASP A 1 28  ? 5.360   -10.654 0.048   1.00 61.35 ? 28  ASP A CG   1  
ATOM 437    O OD1  . ASP A 1 28  ? 5.015   -11.259 1.050   1.00 4.40  ? 28  ASP A OD1  1  
ATOM 438    O OD2  . ASP A 1 28  ? 5.319   -11.120 -1.079  1.00 34.32 ? 28  ASP A OD2  1  
ATOM 439    H H    . ASP A 1 28  ? 7.992   -7.262  0.019   1.00 0.02  ? 28  ASP A H    1  
ATOM 440    H HA   . ASP A 1 28  ? 7.525   -9.853  1.443   1.00 75.40 ? 28  ASP A HA   1  
ATOM 441    H HB2  . ASP A 1 28  ? 5.333   -8.735  1.012   1.00 74.24 ? 28  ASP A HB2  1  
ATOM 442    H HB3  . ASP A 1 28  ? 5.728   -8.680  -0.707  1.00 74.41 ? 28  ASP A HB3  1  
ATOM 443    N N    . VAL A 1 29  ? 8.502   -11.113 -0.528  1.00 64.21 ? 29  VAL A N    1  
ATOM 444    C CA   . VAL A 1 29  ? 9.273   -11.767 -1.624  1.00 23.20 ? 29  VAL A CA   1  
ATOM 445    C C    . VAL A 1 29  ? 8.354   -12.731 -2.372  1.00 52.41 ? 29  VAL A C    1  
ATOM 446    O O    . VAL A 1 29  ? 7.573   -13.444 -1.773  1.00 2.10  ? 29  VAL A O    1  
ATOM 447    C CB   . VAL A 1 29  ? 10.437  -12.546 -1.008  1.00 42.24 ? 29  VAL A CB   1  
ATOM 448    C CG1  . VAL A 1 29  ? 11.568  -11.582 -0.642  1.00 72.15 ? 29  VAL A CG1  1  
ATOM 449    C CG2  . VAL A 1 29  ? 9.956   -13.263 0.256   1.00 64.35 ? 29  VAL A CG2  1  
ATOM 450    H H    . VAL A 1 29  ? 8.263   -11.635 0.262   1.00 75.13 ? 29  VAL A H    1  
ATOM 451    H HA   . VAL A 1 29  ? 9.657   -11.026 -2.313  1.00 63.42 ? 29  VAL A HA   1  
ATOM 452    H HB   . VAL A 1 29  ? 10.800  -13.271 -1.716  1.00 35.51 ? 29  VAL A HB   1  
ATOM 453    H HG11 . VAL A 1 29  ? 12.071  -11.259 -1.542  1.00 35.52 ? 29  VAL A HG11 1  
ATOM 454    H HG12 . VAL A 1 29  ? 12.274  -12.083 0.004   1.00 2.32  ? 29  VAL A HG12 1  
ATOM 455    H HG13 . VAL A 1 29  ? 11.159  -10.724 -0.130  1.00 53.54 ? 29  VAL A HG13 1  
ATOM 456    H HG21 . VAL A 1 29  ? 10.720  -13.947 0.595   1.00 44.31 ? 29  VAL A HG21 1  
ATOM 457    H HG22 . VAL A 1 29  ? 9.053   -13.814 0.035   1.00 31.05 ? 29  VAL A HG22 1  
ATOM 458    H HG23 . VAL A 1 29  ? 9.754   -12.536 1.028   1.00 34.32 ? 29  VAL A HG23 1  
ATOM 459    N N    . THR A 1 30  ? 8.440   -12.758 -3.678  1.00 3.44  ? 30  THR A N    1  
ATOM 460    C CA   . THR A 1 30  ? 7.573   -13.677 -4.479  1.00 44.22 ? 30  THR A CA   1  
ATOM 461    C C    . THR A 1 30  ? 8.417   -14.372 -5.548  1.00 15.33 ? 30  THR A C    1  
ATOM 462    O O    . THR A 1 30  ? 9.551   -14.010 -5.792  1.00 42.54 ? 30  THR A O    1  
ATOM 463    C CB   . THR A 1 30  ? 6.465   -12.872 -5.160  1.00 71.42 ? 30  THR A CB   1  
ATOM 464    O OG1  . THR A 1 30  ? 6.981   -12.267 -6.336  1.00 11.22 ? 30  THR A OG1  1  
ATOM 465    C CG2  . THR A 1 30  ? 5.955   -11.790 -4.207  1.00 11.43 ? 30  THR A CG2  1  
ATOM 466    H H    . THR A 1 30  ? 9.079   -12.171 -4.135  1.00 33.45 ? 30  THR A H    1  
ATOM 467    H HA   . THR A 1 30  ? 7.129   -14.423 -3.833  1.00 54.15 ? 30  THR A HA   1  
ATOM 468    H HB   . THR A 1 30  ? 5.652   -13.531 -5.421  1.00 2.32  ? 30  THR A HB   1  
ATOM 469    H HG1  . THR A 1 30  ? 6.632   -12.744 -7.093  1.00 64.32 ? 30  THR A HG1  1  
ATOM 470    H HG21 . THR A 1 30  ? 6.674   -10.985 -4.158  1.00 4.51  ? 30  THR A HG21 1  
ATOM 471    H HG22 . THR A 1 30  ? 5.818   -12.211 -3.222  1.00 25.23 ? 30  THR A HG22 1  
ATOM 472    H HG23 . THR A 1 30  ? 5.012   -11.408 -4.569  1.00 32.25 ? 30  THR A HG23 1  
ATOM 473    N N    . GLU A 1 31  ? 7.870   -15.371 -6.190  1.00 14.33 ? 31  GLU A N    1  
ATOM 474    C CA   . GLU A 1 31  ? 8.635   -16.095 -7.247  1.00 0.14  ? 31  GLU A CA   1  
ATOM 475    C C    . GLU A 1 31  ? 8.443   -15.389 -8.594  1.00 12.42 ? 31  GLU A C    1  
ATOM 476    O O    . GLU A 1 31  ? 9.037   -14.363 -8.859  1.00 12.40 ? 31  GLU A O    1  
ATOM 477    C CB   . GLU A 1 31  ? 8.126   -17.539 -7.339  1.00 30.15 ? 31  GLU A CB   1  
ATOM 478    C CG   . GLU A 1 31  ? 6.608   -17.561 -7.135  1.00 14.13 ? 31  GLU A CG   1  
ATOM 479    C CD   . GLU A 1 31  ? 6.058   -18.922 -7.567  1.00 53.32 ? 31  GLU A CD   1  
ATOM 480    O OE1  . GLU A 1 31  ? 6.855   -19.776 -7.919  1.00 72.33 ? 31  GLU A OE1  1  
ATOM 481    O OE2  . GLU A 1 31  ? 4.850   -19.088 -7.540  1.00 42.24 ? 31  GLU A OE2  1  
ATOM 482    H H    . GLU A 1 31  ? 6.954   -15.645 -5.977  1.00 33.13 ? 31  GLU A H    1  
ATOM 483    H HA   . GLU A 1 31  ? 9.685   -16.101 -6.993  1.00 73.11 ? 31  GLU A HA   1  
ATOM 484    H HB2  . GLU A 1 31  ? 8.367   -17.951 -8.309  1.00 41.31 ? 31  GLU A HB2  1  
ATOM 485    H HB3  . GLU A 1 31  ? 8.596   -18.134 -6.571  1.00 5.04  ? 31  GLU A HB3  1  
ATOM 486    H HG2  . GLU A 1 31  ? 6.385   -17.397 -6.091  1.00 30.21 ? 31  GLU A HG2  1  
ATOM 487    H HG3  . GLU A 1 31  ? 6.150   -16.783 -7.729  1.00 1.53  ? 31  GLU A HG3  1  
ATOM 488    N N    . SER A 1 32  ? 7.618   -15.933 -9.448  1.00 24.24 ? 32  SER A N    1  
ATOM 489    C CA   . SER A 1 32  ? 7.389   -15.298 -10.777 1.00 34.44 ? 32  SER A CA   1  
ATOM 490    C C    . SER A 1 32  ? 6.454   -14.100 -10.615 1.00 74.24 ? 32  SER A C    1  
ATOM 491    O O    . SER A 1 32  ? 5.788   -13.947 -9.611  1.00 30.34 ? 32  SER A O    1  
ATOM 492    C CB   . SER A 1 32  ? 6.754   -16.316 -11.724 1.00 61.35 ? 32  SER A CB   1  
ATOM 493    O OG   . SER A 1 32  ? 5.385   -16.486 -11.381 1.00 32.10 ? 32  SER A OG   1  
ATOM 494    H H    . SER A 1 32  ? 7.151   -16.763 -9.216  1.00 33.13 ? 32  SER A H    1  
ATOM 495    H HA   . SER A 1 32  ? 8.333   -14.963 -11.187 1.00 51.14 ? 32  SER A HA   1  
ATOM 496    H HB2  . SER A 1 32  ? 6.824   -15.960 -12.738 1.00 0.34  ? 32  SER A HB2  1  
ATOM 497    H HB3  . SER A 1 32  ? 7.278   -17.260 -11.640 1.00 70.44 ? 32  SER A HB3  1  
ATOM 498    H HG   . SER A 1 32  ? 5.342   -16.769 -10.464 1.00 55.21 ? 32  SER A HG   1  
ATOM 499    N N    . LEU A 1 33  ? 6.408   -13.246 -11.598 1.00 11.55 ? 33  LEU A N    1  
ATOM 500    C CA   . LEU A 1 33  ? 5.528   -12.049 -11.512 1.00 53.02 ? 33  LEU A CA   1  
ATOM 501    C C    . LEU A 1 33  ? 4.074   -12.481 -11.308 1.00 61.34 ? 33  LEU A C    1  
ATOM 502    O O    . LEU A 1 33  ? 3.289   -11.777 -10.704 1.00 41.35 ? 33  LEU A O    1  
ATOM 503    C CB   . LEU A 1 33  ? 5.640   -11.235 -12.808 1.00 41.15 ? 33  LEU A CB   1  
ATOM 504    C CG   . LEU A 1 33  ? 7.124   -10.852 -13.085 1.00 61.12 ? 33  LEU A CG   1  
ATOM 505    C CD1  . LEU A 1 33  ? 7.716   -11.759 -14.177 1.00 54.41 ? 33  LEU A CD1  1  
ATOM 506    C CD2  . LEU A 1 33  ? 7.212   -9.389  -13.549 1.00 71.53 ? 33  LEU A CD2  1  
ATOM 507    H H    . LEU A 1 33  ? 6.958   -13.391 -12.393 1.00 2.01  ? 33  LEU A H    1  
ATOM 508    H HA   . LEU A 1 33  ? 5.838   -11.437 -10.678 1.00 13.13 ? 33  LEU A HA   1  
ATOM 509    H HB2  . LEU A 1 33  ? 5.251   -11.826 -13.627 1.00 23.54 ? 33  LEU A HB2  1  
ATOM 510    H HB3  . LEU A 1 33  ? 5.043   -10.339 -12.707 1.00 44.23 ? 33  LEU A HB3  1  
ATOM 511    H HG   . LEU A 1 33  ? 7.707   -10.969 -12.180 1.00 15.21 ? 33  LEU A HG   1  
ATOM 512    H HD11 . LEU A 1 33  ? 8.795   -11.716 -14.133 1.00 63.12 ? 33  LEU A HD11 1  
ATOM 513    H HD12 . LEU A 1 33  ? 7.382   -11.423 -15.148 1.00 70.03 ? 33  LEU A HD12 1  
ATOM 514    H HD13 . LEU A 1 33  ? 7.390   -12.775 -14.019 1.00 24.42 ? 33  LEU A HD13 1  
ATOM 515    H HD21 . LEU A 1 33  ? 7.081   -8.734  -12.700 1.00 15.05 ? 33  LEU A HD21 1  
ATOM 516    H HD22 . LEU A 1 33  ? 6.438   -9.196  -14.275 1.00 65.32 ? 33  LEU A HD22 1  
ATOM 517    H HD23 . LEU A 1 33  ? 8.178   -9.209  -13.997 1.00 64.14 ? 33  LEU A HD23 1  
ATOM 518    N N    . GLU A 1 34  ? 3.702   -13.628 -11.809 1.00 44.01 ? 34  GLU A N    1  
ATOM 519    C CA   . GLU A 1 34  ? 2.293   -14.085 -11.640 1.00 61.03 ? 34  GLU A CA   1  
ATOM 520    C C    . GLU A 1 34  ? 1.890   -13.966 -10.169 1.00 72.14 ? 34  GLU A C    1  
ATOM 521    O O    . GLU A 1 34  ? 0.811   -13.509 -9.849  1.00 74.23 ? 34  GLU A O    1  
ATOM 522    C CB   . GLU A 1 34  ? 2.167   -15.543 -12.085 1.00 72.20 ? 34  GLU A CB   1  
ATOM 523    C CG   . GLU A 1 34  ? 2.444   -15.644 -13.586 1.00 3.25  ? 34  GLU A CG   1  
ATOM 524    C CD   . GLU A 1 34  ? 2.211   -17.082 -14.053 1.00 4.44  ? 34  GLU A CD   1  
ATOM 525    O OE1  . GLU A 1 34  ? 1.934   -17.920 -13.211 1.00 2.23  ? 34  GLU A OE1  1  
ATOM 526    O OE2  . GLU A 1 34  ? 2.312   -17.320 -15.246 1.00 11.41 ? 34  GLU A OE2  1  
ATOM 527    H H    . GLU A 1 34  ? 4.344   -14.183 -12.297 1.00 25.00 ? 34  GLU A H    1  
ATOM 528    H HA   . GLU A 1 34  ? 1.641   -13.469 -12.242 1.00 22.12 ? 34  GLU A HA   1  
ATOM 529    H HB2  . GLU A 1 34  ? 2.881   -16.147 -11.544 1.00 63.22 ? 34  GLU A HB2  1  
ATOM 530    H HB3  . GLU A 1 34  ? 1.167   -15.895 -11.881 1.00 72.21 ? 34  GLU A HB3  1  
ATOM 531    H HG2  . GLU A 1 34  ? 1.781   -14.979 -14.120 1.00 14.21 ? 34  GLU A HG2  1  
ATOM 532    H HG3  . GLU A 1 34  ? 3.469   -15.365 -13.783 1.00 52.22 ? 34  GLU A HG3  1  
ATOM 533    N N    . ASP A 1 35  ? 2.748   -14.366 -9.271  1.00 4.44  ? 35  ASP A N    1  
ATOM 534    C CA   . ASP A 1 35  ? 2.406   -14.264 -7.825  1.00 42.44 ? 35  ASP A CA   1  
ATOM 535    C C    . ASP A 1 35  ? 2.313   -12.788 -7.437  1.00 12.02 ? 35  ASP A C    1  
ATOM 536    O O    . ASP A 1 35  ? 1.423   -12.379 -6.719  1.00 44.05 ? 35  ASP A O    1  
ATOM 537    C CB   . ASP A 1 35  ? 3.492   -14.943 -6.989  1.00 22.43 ? 35  ASP A CB   1  
ATOM 538    C CG   . ASP A 1 35  ? 3.397   -16.460 -7.162  1.00 43.13 ? 35  ASP A CG   1  
ATOM 539    O OD1  . ASP A 1 35  ? 2.663   -16.892 -8.036  1.00 43.42 ? 35  ASP A OD1  1  
ATOM 540    O OD2  . ASP A 1 35  ? 4.061   -17.163 -6.419  1.00 54.03 ? 35  ASP A OD2  1  
ATOM 541    H H    . ASP A 1 35  ? 3.617   -14.727 -9.547  1.00 13.11 ? 35  ASP A H    1  
ATOM 542    H HA   . ASP A 1 35  ? 1.457   -14.745 -7.644  1.00 54.04 ? 35  ASP A HA   1  
ATOM 543    H HB2  . ASP A 1 35  ? 4.464   -14.603 -7.317  1.00 51.41 ? 35  ASP A HB2  1  
ATOM 544    H HB3  . ASP A 1 35  ? 3.355   -14.693 -5.948  1.00 71.01 ? 35  ASP A HB3  1  
ATOM 545    N N    . GLY A 1 36  ? 3.226   -11.986 -7.911  1.00 32.42 ? 36  GLY A N    1  
ATOM 546    C CA   . GLY A 1 36  ? 3.190   -10.535 -7.575  1.00 4.34  ? 36  GLY A CA   1  
ATOM 547    C C    . GLY A 1 36  ? 1.938   -9.901  -8.184  1.00 54.21 ? 36  GLY A C    1  
ATOM 548    O O    . GLY A 1 36  ? 1.267   -9.107  -7.558  1.00 61.41 ? 36  GLY A O    1  
ATOM 549    H H    . GLY A 1 36  ? 3.934   -12.338 -8.491  1.00 52.31 ? 36  GLY A H    1  
ATOM 550    H HA2  . GLY A 1 36  ? 3.170   -10.415 -6.501  1.00 51.24 ? 36  GLY A HA2  1  
ATOM 551    H HA3  . GLY A 1 36  ? 4.066   -10.050 -7.976  1.00 31.10 ? 36  GLY A HA3  1  
ATOM 552    N N    . GLU A 1 37  ? 1.618   -10.246 -9.403  1.00 32.30 ? 37  GLU A N    1  
ATOM 553    C CA   . GLU A 1 37  ? 0.408   -9.663  -10.049 1.00 22.33 ? 37  GLU A CA   1  
ATOM 554    C C    . GLU A 1 37  ? -0.843  -10.140 -9.306  1.00 53.21 ? 37  GLU A C    1  
ATOM 555    O O    . GLU A 1 37  ? -1.794  -9.403  -9.129  1.00 24.44 ? 37  GLU A O    1  
ATOM 556    C CB   . GLU A 1 37  ? 0.339   -10.119 -11.508 1.00 5.42  ? 37  GLU A CB   1  
ATOM 557    C CG   . GLU A 1 37  ? -0.759  -9.341  -12.237 1.00 73.41 ? 37  GLU A CG   1  
ATOM 558    C CD   . GLU A 1 37  ? -0.906  -9.881  -13.660 1.00 13.51 ? 37  GLU A CD   1  
ATOM 559    O OE1  . GLU A 1 37  ? -0.215  -10.831 -13.987 1.00 74.34 ? 37  GLU A OE1  1  
ATOM 560    O OE2  . GLU A 1 37  ? -1.708  -9.334  -14.400 1.00 74.10 ? 37  GLU A OE2  1  
ATOM 561    H H    . GLU A 1 37  ? 2.173   -10.889 -9.892  1.00 21.50 ? 37  GLU A H    1  
ATOM 562    H HA   . GLU A 1 37  ? 0.462   -8.585  -10.011 1.00 52.12 ? 37  GLU A HA   1  
ATOM 563    H HB2  . GLU A 1 37  ? 1.290   -9.936  -11.986 1.00 23.44 ? 37  GLU A HB2  1  
ATOM 564    H HB3  . GLU A 1 37  ? 0.114   -11.174 -11.544 1.00 21.41 ? 37  GLU A HB3  1  
ATOM 565    H HG2  . GLU A 1 37  ? -1.694  -9.456  -11.708 1.00 11.35 ? 37  GLU A HG2  1  
ATOM 566    H HG3  . GLU A 1 37  ? -0.494  -8.295  -12.276 1.00 22.34 ? 37  GLU A HG3  1  
ATOM 567    N N    . TYR A 1 38  ? -0.850  -11.370 -8.870  1.00 1.21  ? 38  TYR A N    1  
ATOM 568    C CA   . TYR A 1 38  ? -2.036  -11.897 -8.139  1.00 25.33 ? 38  TYR A CA   1  
ATOM 569    C C    . TYR A 1 38  ? -2.011  -11.397 -6.693  1.00 1.14  ? 38  TYR A C    1  
ATOM 570    O O    . TYR A 1 38  ? -3.019  -11.372 -6.017  1.00 44.44 ? 38  TYR A O    1  
ATOM 571    C CB   . TYR A 1 38  ? -2.001  -13.427 -8.151  1.00 12.00 ? 38  TYR A CB   1  
ATOM 572    C CG   . TYR A 1 38  ? -3.271  -13.966 -7.537  1.00 44.22 ? 38  TYR A CG   1  
ATOM 573    C CD1  . TYR A 1 38  ? -4.426  -14.093 -8.317  1.00 64.54 ? 38  TYR A CD1  1  
ATOM 574    C CD2  . TYR A 1 38  ? -3.292  -14.341 -6.188  1.00 63.13 ? 38  TYR A CD2  1  
ATOM 575    C CE1  . TYR A 1 38  ? -5.603  -14.595 -7.748  1.00 61.22 ? 38  TYR A CE1  1  
ATOM 576    C CE2  . TYR A 1 38  ? -4.469  -14.843 -5.620  1.00 75.33 ? 38  TYR A CE2  1  
ATOM 577    C CZ   . TYR A 1 38  ? -5.625  -14.970 -6.400  1.00 64.13 ? 38  TYR A CZ   1  
ATOM 578    O OH   . TYR A 1 38  ? -6.785  -15.465 -5.839  1.00 50.34 ? 38  TYR A OH   1  
ATOM 579    H H    . TYR A 1 38  ? -0.073  -11.948 -9.025  1.00 34.01 ? 38  TYR A H    1  
ATOM 580    H HA   . TYR A 1 38  ? -2.939  -11.554 -8.621  1.00 11.42 ? 38  TYR A HA   1  
ATOM 581    H HB2  . TYR A 1 38  ? -1.917  -13.776 -9.170  1.00 33.42 ? 38  TYR A HB2  1  
ATOM 582    H HB3  . TYR A 1 38  ? -1.152  -13.772 -7.581  1.00 75.31 ? 38  TYR A HB3  1  
ATOM 583    H HD1  . TYR A 1 38  ? -4.410  -13.804 -9.358  1.00 11.23 ? 38  TYR A HD1  1  
ATOM 584    H HD2  . TYR A 1 38  ? -2.401  -14.243 -5.586  1.00 25.32 ? 38  TYR A HD2  1  
ATOM 585    H HE1  . TYR A 1 38  ? -6.495  -14.693 -8.350  1.00 74.11 ? 38  TYR A HE1  1  
ATOM 586    H HE2  . TYR A 1 38  ? -4.486  -15.132 -4.579  1.00 52.33 ? 38  TYR A HE2  1  
ATOM 587    H HH   . TYR A 1 38  ? -6.990  -14.934 -5.066  1.00 63.10 ? 38  TYR A HH   1  
ATOM 588    N N    . LEU A 1 39  ? -0.861  -11.010 -6.208  1.00 74.33 ? 39  LEU A N    1  
ATOM 589    C CA   . LEU A 1 39  ? -0.763  -10.518 -4.800  1.00 32.41 ? 39  LEU A CA   1  
ATOM 590    C C    . LEU A 1 39  ? -0.991  -9.001  -4.761  1.00 51.34 ? 39  LEU A C    1  
ATOM 591    O O    . LEU A 1 39  ? -1.513  -8.469  -3.802  1.00 4.22  ? 39  LEU A O    1  
ATOM 592    C CB   . LEU A 1 39  ? 0.634   -10.845 -4.254  1.00 11.03 ? 39  LEU A CB   1  
ATOM 593    C CG   . LEU A 1 39  ? 0.833   -10.224 -2.863  1.00 44.34 ? 39  LEU A CG   1  
ATOM 594    C CD1  . LEU A 1 39  ? -0.296  -10.665 -1.920  1.00 62.13 ? 39  LEU A CD1  1  
ATOM 595    C CD2  . LEU A 1 39  ? 2.180   -10.687 -2.300  1.00 72.50 ? 39  LEU A CD2  1  
ATOM 596    H H    . LEU A 1 39  ? -0.058  -11.047 -6.768  1.00 33.10 ? 39  LEU A H    1  
ATOM 597    H HA   . LEU A 1 39  ? -1.509  -11.010 -4.193  1.00 33.32 ? 39  LEU A HA   1  
ATOM 598    H HB2  . LEU A 1 39  ? 0.747   -11.917 -4.185  1.00 21.53 ? 39  LEU A HB2  1  
ATOM 599    H HB3  . LEU A 1 39  ? 1.381   -10.452 -4.929  1.00 33.21 ? 39  LEU A HB3  1  
ATOM 600    H HG   . LEU A 1 39  ? 0.832   -9.146  -2.944  1.00 61.45 ? 39  LEU A HG   1  
ATOM 601    H HD11 . LEU A 1 39  ? 0.020   -10.543 -0.893  1.00 72.31 ? 39  LEU A HD11 1  
ATOM 602    H HD12 . LEU A 1 39  ? -0.535  -11.703 -2.100  1.00 63.34 ? 39  LEU A HD12 1  
ATOM 603    H HD13 . LEU A 1 39  ? -1.171  -10.058 -2.097  1.00 24.13 ? 39  LEU A HD13 1  
ATOM 604    H HD21 . LEU A 1 39  ? 2.216   -11.766 -2.295  1.00 52.20 ? 39  LEU A HD21 1  
ATOM 605    H HD22 . LEU A 1 39  ? 2.295   -10.318 -1.292  1.00 34.31 ? 39  LEU A HD22 1  
ATOM 606    H HD23 . LEU A 1 39  ? 2.979   -10.303 -2.917  1.00 73.51 ? 39  LEU A HD23 1  
ATOM 607    N N    . MET A 1 40  ? -0.587  -8.300  -5.785  1.00 70.32 ? 40  MET A N    1  
ATOM 608    C CA   . MET A 1 40  ? -0.762  -6.817  -5.792  1.00 44.10 ? 40  MET A CA   1  
ATOM 609    C C    . MET A 1 40  ? -2.206  -6.445  -6.148  1.00 65.01 ? 40  MET A C    1  
ATOM 610    O O    . MET A 1 40  ? -2.709  -5.421  -5.732  1.00 43.21 ? 40  MET A O    1  
ATOM 611    C CB   . MET A 1 40  ? 0.199   -6.196  -6.816  1.00 24.20 ? 40  MET A CB   1  
ATOM 612    C CG   . MET A 1 40  ? -0.250  -6.539  -8.243  1.00 30.03 ? 40  MET A CG   1  
ATOM 613    S SD   . MET A 1 40  ? -1.490  -5.339  -8.792  1.00 1.45  ? 40  MET A SD   1  
ATOM 614    C CE   . MET A 1 40  ? -0.341  -4.124  -9.483  1.00 31.21 ? 40  MET A CE   1  
ATOM 615    H H    . MET A 1 40  ? -0.155  -8.745  -6.543  1.00 21.14 ? 40  MET A H    1  
ATOM 616    H HA   . MET A 1 40  ? -0.529  -6.431  -4.813  1.00 34.12 ? 40  MET A HA   1  
ATOM 617    H HB2  . MET A 1 40  ? 0.209   -5.123  -6.692  1.00 24.14 ? 40  MET A HB2  1  
ATOM 618    H HB3  . MET A 1 40  ? 1.194   -6.584  -6.651  1.00 13.22 ? 40  MET A HB3  1  
ATOM 619    H HG2  . MET A 1 40  ? 0.602   -6.502  -8.907  1.00 42.54 ? 40  MET A HG2  1  
ATOM 620    H HG3  . MET A 1 40  ? -0.676  -7.531  -8.263  1.00 24.13 ? 40  MET A HG3  1  
ATOM 621    H HE1  . MET A 1 40  ? 0.159   -4.550  -10.342 1.00 52.43 ? 40  MET A HE1  1  
ATOM 622    H HE2  . MET A 1 40  ? 0.393   -3.857  -8.739  1.00 11.34 ? 40  MET A HE2  1  
ATOM 623    H HE3  . MET A 1 40  ? -0.888  -3.240  -9.779  1.00 11.21 ? 40  MET A HE3  1  
ATOM 624    N N    . ASP A 1 41  ? -2.877  -7.252  -6.920  1.00 11.23 ? 41  ASP A N    1  
ATOM 625    C CA   . ASP A 1 41  ? -4.281  -6.913  -7.295  1.00 55.00 ? 41  ASP A CA   1  
ATOM 626    C C    . ASP A 1 41  ? -5.137  -6.774  -6.033  1.00 12.43 ? 41  ASP A C    1  
ATOM 627    O O    . ASP A 1 41  ? -6.047  -5.971  -5.978  1.00 71.22 ? 41  ASP A O    1  
ATOM 628    C CB   . ASP A 1 41  ? -4.858  -8.015  -8.187  1.00 34.43 ? 41  ASP A CB   1  
ATOM 629    C CG   . ASP A 1 41  ? -4.978  -9.313  -7.389  1.00 53.53 ? 41  ASP A CG   1  
ATOM 630    O OD1  . ASP A 1 41  ? -4.288  -9.437  -6.393  1.00 33.14 ? 41  ASP A OD1  1  
ATOM 631    O OD2  . ASP A 1 41  ? -5.758  -10.162 -7.789  1.00 45.22 ? 41  ASP A OD2  1  
ATOM 632    H H    . ASP A 1 41  ? -2.461  -8.072  -7.258  1.00 40.41 ? 41  ASP A H    1  
ATOM 633    H HA   . ASP A 1 41  ? -4.288  -5.978  -7.834  1.00 20.43 ? 41  ASP A HA   1  
ATOM 634    H HB2  . ASP A 1 41  ? -5.836  -7.716  -8.539  1.00 22.35 ? 41  ASP A HB2  1  
ATOM 635    H HB3  . ASP A 1 41  ? -4.205  -8.173  -9.032  1.00 23.23 ? 41  ASP A HB3  1  
ATOM 636    N N    . ILE A 1 42  ? -4.861  -7.552  -5.019  1.00 61.34 ? 42  ILE A N    1  
ATOM 637    C CA   . ILE A 1 42  ? -5.668  -7.465  -3.763  1.00 74.14 ? 42  ILE A CA   1  
ATOM 638    C C    . ILE A 1 42  ? -5.039  -6.450  -2.804  1.00 74.11 ? 42  ILE A C    1  
ATOM 639    O O    . ILE A 1 42  ? -5.716  -5.870  -1.977  1.00 53.21 ? 42  ILE A O    1  
ATOM 640    C CB   . ILE A 1 42  ? -5.706  -8.838  -3.090  1.00 35.42 ? 42  ILE A CB   1  
ATOM 641    C CG1  . ILE A 1 42  ? -4.287  -9.407  -3.011  1.00 60.14 ? 42  ILE A CG1  1  
ATOM 642    C CG2  . ILE A 1 42  ? -6.589  -9.783  -3.907  1.00 51.11 ? 42  ILE A CG2  1  
ATOM 643    C CD1  . ILE A 1 42  ? -4.266  -10.592 -2.043  1.00 41.41 ? 42  ILE A CD1  1  
ATOM 644    H H    . ILE A 1 42  ? -4.126  -8.197  -5.084  1.00 41.35 ? 42  ILE A H    1  
ATOM 645    H HA   . ILE A 1 42  ? -6.677  -7.157  -3.999  1.00 55.01 ? 42  ILE A HA   1  
ATOM 646    H HB   . ILE A 1 42  ? -6.112  -8.738  -2.094  1.00 44.40 ? 42  ILE A HB   1  
ATOM 647    H HG12 . ILE A 1 42  ? -3.976  -9.736  -3.992  1.00 32.20 ? 42  ILE A HG12 1  
ATOM 648    H HG13 . ILE A 1 42  ? -3.612  -8.644  -2.657  1.00 20.32 ? 42  ILE A HG13 1  
ATOM 649    H HG21 . ILE A 1 42  ? -6.547  -10.774 -3.480  1.00 23.32 ? 42  ILE A HG21 1  
ATOM 650    H HG22 . ILE A 1 42  ? -6.235  -9.815  -4.927  1.00 13.35 ? 42  ILE A HG22 1  
ATOM 651    H HG23 . ILE A 1 42  ? -7.608  -9.427  -3.891  1.00 74.41 ? 42  ILE A HG23 1  
ATOM 652    H HD11 . ILE A 1 42  ? -5.040  -11.294 -2.317  1.00 52.51 ? 42  ILE A HD11 1  
ATOM 653    H HD12 . ILE A 1 42  ? -4.441  -10.239 -1.038  1.00 70.54 ? 42  ILE A HD12 1  
ATOM 654    H HD13 . ILE A 1 42  ? -3.304  -11.080 -2.091  1.00 41.31 ? 42  ILE A HD13 1  
ATOM 655    N N    . ARG A 1 43  ? -3.749  -6.234  -2.904  1.00 40.51 ? 43  ARG A N    1  
ATOM 656    C CA   . ARG A 1 43  ? -3.059  -5.258  -1.996  1.00 64.41 ? 43  ARG A CA   1  
ATOM 657    C C    . ARG A 1 43  ? -2.262  -4.258  -2.836  1.00 72.24 ? 43  ARG A C    1  
ATOM 658    O O    . ARG A 1 43  ? -1.625  -4.614  -3.805  1.00 64.35 ? 43  ARG A O    1  
ATOM 659    C CB   . ARG A 1 43  ? -2.102  -6.017  -1.074  1.00 40.15 ? 43  ARG A CB   1  
ATOM 660    C CG   . ARG A 1 43  ? -2.901  -6.840  -0.062  1.00 54.34 ? 43  ARG A CG   1  
ATOM 661    C CD   . ARG A 1 43  ? -1.935  -7.571  0.872   1.00 31.33 ? 43  ARG A CD   1  
ATOM 662    N NE   . ARG A 1 43  ? -2.674  -8.612  1.641   1.00 61.12 ? 43  ARG A NE   1  
ATOM 663    C CZ   . ARG A 1 43  ? -2.074  -9.259  2.603   1.00 14.01 ? 43  ARG A CZ   1  
ATOM 664    N NH1  . ARG A 1 43  ? -0.828  -8.997  2.888   1.00 23.23 ? 43  ARG A NH1  1  
ATOM 665    N NH2  . ARG A 1 43  ? -2.719  -10.170 3.279   1.00 23.43 ? 43  ARG A NH2  1  
ATOM 666    H H    . ARG A 1 43  ? -3.229  -6.719  -3.578  1.00 63.20 ? 43  ARG A H    1  
ATOM 667    H HA   . ARG A 1 43  ? -3.783  -4.723  -1.398  1.00 11.44 ? 43  ARG A HA   1  
ATOM 668    H HB2  . ARG A 1 43  ? -1.483  -6.677  -1.665  1.00 54.12 ? 43  ARG A HB2  1  
ATOM 669    H HB3  . ARG A 1 43  ? -1.476  -5.312  -0.547  1.00 23.44 ? 43  ARG A HB3  1  
ATOM 670    H HG2  . ARG A 1 43  ? -3.536  -6.182  0.515   1.00 31.24 ? 43  ARG A HG2  1  
ATOM 671    H HG3  . ARG A 1 43  ? -3.510  -7.562  -0.584  1.00 34.44 ? 43  ARG A HG3  1  
ATOM 672    H HD2  . ARG A 1 43  ? -1.156  -8.039  0.289   1.00 22.53 ? 43  ARG A HD2  1  
ATOM 673    H HD3  . ARG A 1 43  ? -1.494  -6.863  1.558   1.00 44.42 ? 43  ARG A HD3  1  
ATOM 674    H HE   . ARG A 1 43  ? -3.609  -8.811  1.424   1.00 34.50 ? 43  ARG A HE   1  
ATOM 675    H HH11 . ARG A 1 43  ? -0.333  -8.300  2.369   1.00 34.21 ? 43  ARG A HH11 1  
ATOM 676    H HH12 . ARG A 1 43  ? -0.369  -9.492  3.625   1.00 75.41 ? 43  ARG A HH12 1  
ATOM 677    H HH21 . ARG A 1 43  ? -3.673  -10.373 3.061   1.00 0.41  ? 43  ARG A HH21 1  
ATOM 678    H HH22 . ARG A 1 43  ? -2.259  -10.665 4.017   1.00 43.31 ? 43  ARG A HH22 1  
ATOM 679    N N    . ASN A 1 44  ? -2.290  -3.003  -2.469  1.00 21.40 ? 44  ASN A N    1  
ATOM 680    C CA   . ASN A 1 44  ? -1.534  -1.974  -3.246  1.00 75.42 ? 44  ASN A CA   1  
ATOM 681    C C    . ASN A 1 44  ? -0.140  -1.791  -2.636  1.00 65.33 ? 44  ASN A C    1  
ATOM 682    O O    . ASN A 1 44  ? 0.067   -2.007  -1.458  1.00 23.23 ? 44  ASN A O    1  
ATOM 683    C CB   . ASN A 1 44  ? -2.301  -0.646  -3.201  1.00 52.53 ? 44  ASN A CB   1  
ATOM 684    C CG   . ASN A 1 44  ? -2.917  -0.458  -1.813  1.00 65.05 ? 44  ASN A CG   1  
ATOM 685    O OD1  . ASN A 1 44  ? -3.905  -1.083  -1.484  1.00 70.31 ? 44  ASN A OD1  1  
ATOM 686    N ND2  . ASN A 1 44  ? -2.372  0.386   -0.980  1.00 63.40 ? 44  ASN A ND2  1  
ATOM 687    H H    . ASN A 1 44  ? -2.809  -2.736  -1.682  1.00 54.01 ? 44  ASN A H    1  
ATOM 688    H HA   . ASN A 1 44  ? -1.435  -2.294  -4.275  1.00 42.40 ? 44  ASN A HA   1  
ATOM 689    H HB2  . ASN A 1 44  ? -1.627  0.172   -3.412  1.00 55.42 ? 44  ASN A HB2  1  
ATOM 690    H HB3  . ASN A 1 44  ? -3.088  -0.662  -3.940  1.00 42.44 ? 44  ASN A HB3  1  
ATOM 691    H HD21 . ASN A 1 44  ? -1.576  0.891   -1.245  1.00 2.55  ? 44  ASN A HD21 1  
ATOM 692    H HD22 . ASN A 1 44  ? -2.760  0.514   -0.089  1.00 23.31 ? 44  ASN A HD22 1  
ATOM 693    N N    . TYR A 1 45  ? 0.817   -1.392  -3.438  1.00 25.01 ? 45  TYR A N    1  
ATOM 694    C CA   . TYR A 1 45  ? 2.211   -1.185  -2.930  1.00 21.20 ? 45  TYR A CA   1  
ATOM 695    C C    . TYR A 1 45  ? 2.746   0.149   -3.454  1.00 41.02 ? 45  TYR A C    1  
ATOM 696    O O    . TYR A 1 45  ? 2.324   0.633   -4.485  1.00 3.21  ? 45  TYR A O    1  
ATOM 697    C CB   . TYR A 1 45  ? 3.109   -2.316  -3.437  1.00 74.23 ? 45  TYR A CB   1  
ATOM 698    C CG   . TYR A 1 45  ? 2.777   -3.598  -2.710  1.00 0.43  ? 45  TYR A CG   1  
ATOM 699    C CD1  . TYR A 1 45  ? 1.675   -4.363  -3.109  1.00 31.54 ? 45  TYR A CD1  1  
ATOM 700    C CD2  . TYR A 1 45  ? 3.573   -4.022  -1.639  1.00 4.43  ? 45  TYR A CD2  1  
ATOM 701    C CE1  . TYR A 1 45  ? 1.370   -5.552  -2.436  1.00 44.14 ? 45  TYR A CE1  1  
ATOM 702    C CE2  . TYR A 1 45  ? 3.267   -5.210  -0.967  1.00 51.13 ? 45  TYR A CE2  1  
ATOM 703    C CZ   . TYR A 1 45  ? 2.166   -5.976  -1.365  1.00 33.25 ? 45  TYR A CZ   1  
ATOM 704    O OH   . TYR A 1 45  ? 1.864   -7.148  -0.703  1.00 12.30 ? 45  TYR A OH   1  
ATOM 705    H H    . TYR A 1 45  ? 0.618   -1.226  -4.383  1.00 35.11 ? 45  TYR A H    1  
ATOM 706    H HA   . TYR A 1 45  ? 2.219   -1.175  -1.848  1.00 53.00 ? 45  TYR A HA   1  
ATOM 707    H HB2  . TYR A 1 45  ? 2.950   -2.452  -4.497  1.00 32.12 ? 45  TYR A HB2  1  
ATOM 708    H HB3  . TYR A 1 45  ? 4.143   -2.060  -3.259  1.00 40.05 ? 45  TYR A HB3  1  
ATOM 709    H HD1  . TYR A 1 45  ? 1.060   -4.037  -3.935  1.00 54.03 ? 45  TYR A HD1  1  
ATOM 710    H HD2  . TYR A 1 45  ? 4.422   -3.431  -1.333  1.00 22.11 ? 45  TYR A HD2  1  
ATOM 711    H HE1  . TYR A 1 45  ? 0.521   -6.143  -2.743  1.00 71.43 ? 45  TYR A HE1  1  
ATOM 712    H HE2  . TYR A 1 45  ? 3.882   -5.537  -0.141  1.00 4.34  ? 45  TYR A HE2  1  
ATOM 713    H HH   . TYR A 1 45  ? 1.404   -6.921  0.109   1.00 40.20 ? 45  TYR A HH   1  
ATOM 714    N N    . ASP A 1 46  ? 3.679   0.746   -2.759  1.00 3.24  ? 46  ASP A N    1  
ATOM 715    C CA   . ASP A 1 46  ? 4.249   2.048   -3.225  1.00 72.04 ? 46  ASP A CA   1  
ATOM 716    C C    . ASP A 1 46  ? 5.516   1.772   -4.037  1.00 71.40 ? 46  ASP A C    1  
ATOM 717    O O    . ASP A 1 46  ? 5.735   2.346   -5.089  1.00 5.32  ? 46  ASP A O    1  
ATOM 718    C CB   . ASP A 1 46  ? 4.599   2.914   -2.014  1.00 31.43 ? 46  ASP A CB   1  
ATOM 719    C CG   . ASP A 1 46  ? 3.314   3.327   -1.293  1.00 40.24 ? 46  ASP A CG   1  
ATOM 720    O OD1  . ASP A 1 46  ? 2.249   3.035   -1.810  1.00 62.45 ? 46  ASP A OD1  1  
ATOM 721    O OD2  . ASP A 1 46  ? 3.418   3.929   -0.237  1.00 13.21 ? 46  ASP A OD2  1  
ATOM 722    H H    . ASP A 1 46  ? 4.013   0.334   -1.932  1.00 43.34 ? 46  ASP A H    1  
ATOM 723    H HA   . ASP A 1 46  ? 3.529   2.566   -3.844  1.00 53.23 ? 46  ASP A HA   1  
ATOM 724    H HB2  . ASP A 1 46  ? 5.227   2.352   -1.338  1.00 4.15  ? 46  ASP A HB2  1  
ATOM 725    H HB3  . ASP A 1 46  ? 5.125   3.798   -2.342  1.00 75.32 ? 46  ASP A HB3  1  
ATOM 726    N N    . LEU A 1 47  ? 6.348   0.885   -3.550  1.00 42.22 ? 47  LEU A N    1  
ATOM 727    C CA   . LEU A 1 47  ? 7.611   0.536   -4.269  1.00 72.13 ? 47  LEU A CA   1  
ATOM 728    C C    . LEU A 1 47  ? 7.452   -0.846  -4.897  1.00 61.22 ? 47  LEU A C    1  
ATOM 729    O O    . LEU A 1 47  ? 7.446   -1.848  -4.210  1.00 65.31 ? 47  LEU A O    1  
ATOM 730    C CB   . LEU A 1 47  ? 8.770   0.518   -3.257  1.00 13.22 ? 47  LEU A CB   1  
ATOM 731    C CG   . LEU A 1 47  ? 10.138  0.622   -3.963  1.00 24.01 ? 47  LEU A CG   1  
ATOM 732    C CD1  . LEU A 1 47  ? 10.312  -0.524  -4.968  1.00 70.21 ? 47  LEU A CD1  1  
ATOM 733    C CD2  . LEU A 1 47  ? 10.273  1.981   -4.682  1.00 50.23 ? 47  LEU A CD2  1  
ATOM 734    H H    . LEU A 1 47  ? 6.136   0.438   -2.702  1.00 34.44 ? 47  LEU A H    1  
ATOM 735    H HA   . LEU A 1 47  ? 7.814   1.257   -5.041  1.00 3.44  ? 47  LEU A HA   1  
ATOM 736    H HB2  . LEU A 1 47  ? 8.659   1.352   -2.580  1.00 50.11 ? 47  LEU A HB2  1  
ATOM 737    H HB3  . LEU A 1 47  ? 8.734   -0.397  -2.692  1.00 2.12  ? 47  LEU A HB3  1  
ATOM 738    H HG   . LEU A 1 47  ? 10.916  0.541   -3.218  1.00 4.30  ? 47  LEU A HG   1  
ATOM 739    H HD11 . LEU A 1 47  ? 9.937   -1.442  -4.541  1.00 43.33 ? 47  LEU A HD11 1  
ATOM 740    H HD12 . LEU A 1 47  ? 11.362  -0.640  -5.197  1.00 51.22 ? 47  LEU A HD12 1  
ATOM 741    H HD13 . LEU A 1 47  ? 9.773   -0.296  -5.875  1.00 4.42  ? 47  LEU A HD13 1  
ATOM 742    H HD21 . LEU A 1 47  ? 11.303  2.301   -4.643  1.00 50.44 ? 47  LEU A HD21 1  
ATOM 743    H HD22 . LEU A 1 47  ? 9.654   2.721   -4.195  1.00 30.22 ? 47  LEU A HD22 1  
ATOM 744    H HD23 . LEU A 1 47  ? 9.969   1.883   -5.714  1.00 53.35 ? 47  LEU A HD23 1  
ATOM 745    N N    . VAL A 1 48  ? 7.344   -0.908  -6.204  1.00 63.22 ? 48  VAL A N    1  
ATOM 746    C CA   . VAL A 1 48  ? 7.209   -2.230  -6.892  1.00 21.21 ? 48  VAL A CA   1  
ATOM 747    C C    . VAL A 1 48  ? 8.520   -2.531  -7.613  1.00 35.23 ? 48  VAL A C    1  
ATOM 748    O O    . VAL A 1 48  ? 8.840   -1.942  -8.629  1.00 72.34 ? 48  VAL A O    1  
ATOM 749    C CB   . VAL A 1 48  ? 6.034   -2.199  -7.885  1.00 31.21 ? 48  VAL A CB   1  
ATOM 750    C CG1  . VAL A 1 48  ? 4.714   -2.406  -7.134  1.00 10.13 ? 48  VAL A CG1  1  
ATOM 751    C CG2  . VAL A 1 48  ? 5.985   -0.847  -8.592  1.00 62.52 ? 48  VAL A CG2  1  
ATOM 752    H H    . VAL A 1 48  ? 7.372   -0.083  -6.734  1.00 42.31 ? 48  VAL A H    1  
ATOM 753    H HA   . VAL A 1 48  ? 7.040   -3.005  -6.166  1.00 21.10 ? 48  VAL A HA   1  
ATOM 754    H HB   . VAL A 1 48  ? 6.158   -2.986  -8.616  1.00 4.03  ? 48  VAL A HB   1  
ATOM 755    H HG11 . VAL A 1 48  ? 4.538   -1.565  -6.480  1.00 33.15 ? 48  VAL A HG11 1  
ATOM 756    H HG12 . VAL A 1 48  ? 4.766   -3.311  -6.549  1.00 61.42 ? 48  VAL A HG12 1  
ATOM 757    H HG13 . VAL A 1 48  ? 3.904   -2.483  -7.845  1.00 13.22 ? 48  VAL A HG13 1  
ATOM 758    H HG21 . VAL A 1 48  ? 5.815   -0.068  -7.865  1.00 32.13 ? 48  VAL A HG21 1  
ATOM 759    H HG22 . VAL A 1 48  ? 5.181   -0.849  -9.312  1.00 43.25 ? 48  VAL A HG22 1  
ATOM 760    H HG23 . VAL A 1 48  ? 6.919   -0.673  -9.098  1.00 4.41  ? 48  VAL A HG23 1  
ATOM 761    N N    . MET A 1 49  ? 9.296   -3.436  -7.064  1.00 41.12 ? 49  MET A N    1  
ATOM 762    C CA   . MET A 1 49  ? 10.616  -3.792  -7.667  1.00 74.03 ? 49  MET A CA   1  
ATOM 763    C C    . MET A 1 49  ? 10.588  -5.247  -8.138  1.00 42.03 ? 49  MET A C    1  
ATOM 764    O O    . MET A 1 49  ? 9.953   -6.095  -7.543  1.00 61.14 ? 49  MET A O    1  
ATOM 765    C CB   . MET A 1 49  ? 11.713  -3.573  -6.607  1.00 74.11 ? 49  MET A CB   1  
ATOM 766    C CG   . MET A 1 49  ? 12.969  -4.393  -6.932  1.00 34.34 ? 49  MET A CG   1  
ATOM 767    S SD   . MET A 1 49  ? 14.398  -3.651  -6.106  1.00 0.30  ? 49  MET A SD   1  
ATOM 768    C CE   . MET A 1 49  ? 15.634  -4.852  -6.659  1.00 11.04 ? 49  MET A CE   1  
ATOM 769    H H    . MET A 1 49  ? 9.012   -3.873  -6.235  1.00 62.41 ? 49  MET A H    1  
ATOM 770    H HA   . MET A 1 49  ? 10.809  -3.162  -8.514  1.00 65.24 ? 49  MET A HA   1  
ATOM 771    H HB2  . MET A 1 49  ? 11.973  -2.524  -6.581  1.00 12.33 ? 49  MET A HB2  1  
ATOM 772    H HB3  . MET A 1 49  ? 11.335  -3.865  -5.639  1.00 41.31 ? 49  MET A HB3  1  
ATOM 773    H HG2  . MET A 1 49  ? 12.837  -5.406  -6.582  1.00 33.00 ? 49  MET A HG2  1  
ATOM 774    H HG3  . MET A 1 49  ? 13.132  -4.400  -7.999  1.00 53.42 ? 49  MET A HG3  1  
ATOM 775    H HE1  . MET A 1 49  ? 15.367  -5.215  -7.642  1.00 42.24 ? 49  MET A HE1  1  
ATOM 776    H HE2  . MET A 1 49  ? 15.666  -5.680  -5.969  1.00 14.10 ? 49  MET A HE2  1  
ATOM 777    H HE3  . MET A 1 49  ? 16.605  -4.377  -6.694  1.00 14.21 ? 49  MET A HE3  1  
ATOM 778    N N    . VAL A 1 50  ? 11.268  -5.535  -9.220  1.00 2.32  ? 50  VAL A N    1  
ATOM 779    C CA   . VAL A 1 50  ? 11.280  -6.928  -9.755  1.00 20.34 ? 50  VAL A CA   1  
ATOM 780    C C    . VAL A 1 50  ? 12.652  -7.253  -10.352 1.00 20.13 ? 50  VAL A C    1  
ATOM 781    O O    . VAL A 1 50  ? 13.211  -6.489  -11.114 1.00 11.33 ? 50  VAL A O    1  
ATOM 782    C CB   . VAL A 1 50  ? 10.195  -7.050  -10.837 1.00 20.04 ? 50  VAL A CB   1  
ATOM 783    C CG1  . VAL A 1 50  ? 10.247  -5.822  -11.750 1.00 61.12 ? 50  VAL A CG1  1  
ATOM 784    C CG2  . VAL A 1 50  ? 10.411  -8.322  -11.675 1.00 60.52 ? 50  VAL A CG2  1  
ATOM 785    H H    . VAL A 1 50  ? 11.764  -4.828  -9.685  1.00 23.43 ? 50  VAL A H    1  
ATOM 786    H HA   . VAL A 1 50  ? 11.071  -7.624  -8.958  1.00 10.35 ? 50  VAL A HA   1  
ATOM 787    H HB   . VAL A 1 50  ? 9.227   -7.094  -10.362 1.00 63.32 ? 50  VAL A HB   1  
ATOM 788    H HG11 . VAL A 1 50  ? 9.530   -5.938  -12.549 1.00 65.03 ? 50  VAL A HG11 1  
ATOM 789    H HG12 . VAL A 1 50  ? 11.238  -5.725  -12.168 1.00 3.05  ? 50  VAL A HG12 1  
ATOM 790    H HG13 . VAL A 1 50  ? 10.008  -4.937  -11.179 1.00 71.24 ? 50  VAL A HG13 1  
ATOM 791    H HG21 . VAL A 1 50  ? 9.490   -8.586  -12.170 1.00 53.54 ? 50  VAL A HG21 1  
ATOM 792    H HG22 . VAL A 1 50  ? 10.718  -9.131  -11.033 1.00 11.34 ? 50  VAL A HG22 1  
ATOM 793    H HG23 . VAL A 1 50  ? 11.179  -8.143  -12.416 1.00 21.33 ? 50  VAL A HG23 1  
ATOM 794    N N    . SER A 1 51  ? 13.188  -8.398  -10.017 1.00 55.11 ? 51  SER A N    1  
ATOM 795    C CA   . SER A 1 51  ? 14.518  -8.808  -10.565 1.00 44.20 ? 51  SER A CA   1  
ATOM 796    C C    . SER A 1 51  ? 14.311  -9.760  -11.749 1.00 5.33  ? 51  SER A C    1  
ATOM 797    O O    . SER A 1 51  ? 15.253  -10.290 -12.303 1.00 73.11 ? 51  SER A O    1  
ATOM 798    C CB   . SER A 1 51  ? 15.318  -9.523  -9.475  1.00 44.15 ? 51  SER A CB   1  
ATOM 799    O OG   . SER A 1 51  ? 16.297  -10.356 -10.082 1.00 52.34 ? 51  SER A OG   1  
ATOM 800    H H    . SER A 1 51  ? 12.707  -8.997  -9.406  1.00 21.32 ? 51  SER A H    1  
ATOM 801    H HA   . SER A 1 51  ? 15.064  -7.937  -10.898 1.00 64.11 ? 51  SER A HA   1  
ATOM 802    H HB2  . SER A 1 51  ? 15.808  -8.797  -8.849  1.00 70.40 ? 51  SER A HB2  1  
ATOM 803    H HB3  . SER A 1 51  ? 14.647  -10.120 -8.872  1.00 3.24  ? 51  SER A HB3  1  
ATOM 804    H HG   . SER A 1 51  ? 15.868  -10.862 -10.776 1.00 62.04 ? 51  SER A HG   1  
ATOM 805    N N    . ASP A 1 52  ? 13.084  -9.982  -12.141 1.00 12.03 ? 52  ASP A N    1  
ATOM 806    C CA   . ASP A 1 52  ? 12.819  -10.900 -13.287 1.00 45.34 ? 52  ASP A CA   1  
ATOM 807    C C    . ASP A 1 52  ? 13.160  -10.186 -14.600 1.00 3.52  ? 52  ASP A C    1  
ATOM 808    O O    . ASP A 1 52  ? 12.936  -9.001  -14.749 1.00 11.30 ? 52  ASP A O    1  
ATOM 809    C CB   . ASP A 1 52  ? 11.341  -11.306 -13.284 1.00 14.22 ? 52  ASP A CB   1  
ATOM 810    C CG   . ASP A 1 52  ? 11.017  -12.040 -11.982 1.00 52.55 ? 52  ASP A CG   1  
ATOM 811    O OD1  . ASP A 1 52  ? 11.940  -12.306 -11.229 1.00 45.31 ? 52  ASP A OD1  1  
ATOM 812    O OD2  . ASP A 1 52  ? 9.852   -12.326 -11.761 1.00 41.44 ? 52  ASP A OD2  1  
ATOM 813    H H    . ASP A 1 52  ? 12.337  -9.545  -11.681 1.00 3.33  ? 52  ASP A H    1  
ATOM 814    H HA   . ASP A 1 52  ? 13.434  -11.783 -13.189 1.00 5.50  ? 52  ASP A HA   1  
ATOM 815    H HB2  . ASP A 1 52  ? 10.725  -10.423 -13.364 1.00 63.40 ? 52  ASP A HB2  1  
ATOM 816    H HB3  . ASP A 1 52  ? 11.143  -11.961 -14.120 1.00 31.24 ? 52  ASP A HB3  1  
ATOM 817    N N    . LYS A 1 53  ? 13.717  -10.895 -15.545 1.00 43.01 ? 53  LYS A N    1  
ATOM 818    C CA   . LYS A 1 53  ? 14.093  -10.257 -16.842 1.00 15.35 ? 53  LYS A CA   1  
ATOM 819    C C    . LYS A 1 53  ? 12.856  -10.063 -17.728 1.00 21.44 ? 53  LYS A C    1  
ATOM 820    O O    . LYS A 1 53  ? 12.692  -9.038  -18.357 1.00 10.34 ? 53  LYS A O    1  
ATOM 821    C CB   . LYS A 1 53  ? 15.100  -11.149 -17.569 1.00 34.05 ? 53  LYS A CB   1  
ATOM 822    C CG   . LYS A 1 53  ? 16.359  -11.300 -16.713 1.00 44.22 ? 53  LYS A CG   1  
ATOM 823    C CD   . LYS A 1 53  ? 17.409  -12.102 -17.484 1.00 34.10 ? 53  LYS A CD   1  
ATOM 824    C CE   . LYS A 1 53  ? 18.600  -12.395 -16.570 1.00 44.22 ? 53  LYS A CE   1  
ATOM 825    N NZ   . LYS A 1 53  ? 19.197  -11.111 -16.104 1.00 11.42 ? 53  LYS A NZ   1  
ATOM 826    H H    . LYS A 1 53  ? 13.900  -11.847 -15.399 1.00 15.54 ? 53  LYS A H    1  
ATOM 827    H HA   . LYS A 1 53  ? 14.545  -9.296  -16.648 1.00 51.34 ? 53  LYS A HA   1  
ATOM 828    H HB2  . LYS A 1 53  ? 14.661  -12.122 -17.741 1.00 65.44 ? 53  LYS A HB2  1  
ATOM 829    H HB3  . LYS A 1 53  ? 15.363  -10.700 -18.515 1.00 55.13 ? 53  LYS A HB3  1  
ATOM 830    H HG2  . LYS A 1 53  ? 16.753  -10.322 -16.477 1.00 32.10 ? 53  LYS A HG2  1  
ATOM 831    H HG3  . LYS A 1 53  ? 16.113  -11.819 -15.799 1.00 53.31 ? 53  LYS A HG3  1  
ATOM 832    H HD2  . LYS A 1 53  ? 16.975  -13.032 -17.821 1.00 45.23 ? 53  LYS A HD2  1  
ATOM 833    H HD3  . LYS A 1 53  ? 17.745  -11.530 -18.336 1.00 10.42 ? 53  LYS A HD3  1  
ATOM 834    H HE2  . LYS A 1 53  ? 18.267  -12.968 -15.717 1.00 2.20  ? 53  LYS A HE2  1  
ATOM 835    H HE3  . LYS A 1 53  ? 19.342  -12.960 -17.115 1.00 4.44  ? 53  LYS A HE3  1  
ATOM 836    H HZ1  . LYS A 1 53  ? 20.192  -11.063 -16.400 1.00 50.12 ? 53  LYS A HZ1  1  
ATOM 837    H HZ2  . LYS A 1 53  ? 19.140  -11.060 -15.066 1.00 23.13 ? 53  LYS A HZ2  1  
ATOM 838    H HZ3  . LYS A 1 53  ? 18.675  -10.315 -16.520 1.00 1.02  ? 53  LYS A HZ3  1  
ATOM 839    N N    . ASN A 1 54  ? 11.992  -11.039 -17.795 1.00 70.44 ? 54  ASN A N    1  
ATOM 840    C CA   . ASN A 1 54  ? 10.779  -10.903 -18.656 1.00 20.31 ? 54  ASN A CA   1  
ATOM 841    C C    . ASN A 1 54  ? 9.815   -9.886  -18.040 1.00 25.20 ? 54  ASN A C    1  
ATOM 842    O O    . ASN A 1 54  ? 8.661   -9.807  -18.411 1.00 4.22  ? 54  ASN A O    1  
ATOM 843    C CB   . ASN A 1 54  ? 10.081  -12.261 -18.770 1.00 60.14 ? 54  ASN A CB   1  
ATOM 844    C CG   . ASN A 1 54  ? 11.046  -13.283 -19.374 1.00 41.52 ? 54  ASN A CG   1  
ATOM 845    O OD1  . ASN A 1 54  ? 11.137  -14.400 -18.904 1.00 61.11 ? 54  ASN A OD1  1  
ATOM 846    N ND2  . ASN A 1 54  ? 11.774  -12.948 -20.403 1.00 65.23 ? 54  ASN A ND2  1  
ATOM 847    H H    . ASN A 1 54  ? 12.144  -11.864 -17.288 1.00 45.32 ? 54  ASN A H    1  
ATOM 848    H HA   . ASN A 1 54  ? 11.074  -10.568 -19.639 1.00 73.13 ? 54  ASN A HA   1  
ATOM 849    H HB2  . ASN A 1 54  ? 9.774   -12.590 -17.788 1.00 13.23 ? 54  ASN A HB2  1  
ATOM 850    H HB3  . ASN A 1 54  ? 9.214   -12.167 -19.407 1.00 23.13 ? 54  ASN A HB3  1  
ATOM 851    H HD21 . ASN A 1 54  ? 11.700  -12.047 -20.783 1.00 1.44  ? 54  ASN A HD21 1  
ATOM 852    H HD22 . ASN A 1 54  ? 12.394  -13.596 -20.797 1.00 2.42  ? 54  ASN A HD22 1  
ATOM 853    N N    . ALA A 1 55  ? 10.277  -9.113  -17.098 1.00 2.24  ? 55  ALA A N    1  
ATOM 854    C CA   . ALA A 1 55  ? 9.389   -8.106  -16.452 1.00 15.35 ? 55  ALA A CA   1  
ATOM 855    C C    . ALA A 1 55  ? 9.166   -6.912  -17.386 1.00 64.14 ? 55  ALA A C    1  
ATOM 856    O O    . ALA A 1 55  ? 8.231   -6.157  -17.218 1.00 14.33 ? 55  ALA A O    1  
ATOM 857    C CB   . ALA A 1 55  ? 10.034  -7.624  -15.151 1.00 25.51 ? 55  ALA A CB   1  
ATOM 858    H H    . ALA A 1 55  ? 11.210  -9.197  -16.811 1.00 52.42 ? 55  ALA A H    1  
ATOM 859    H HA   . ALA A 1 55  ? 8.437   -8.564  -16.228 1.00 0.24  ? 55  ALA A HA   1  
ATOM 860    H HB1  . ALA A 1 55  ? 9.287   -7.149  -14.535 1.00 25.22 ? 55  ALA A HB1  1  
ATOM 861    H HB2  . ALA A 1 55  ? 10.819  -6.918  -15.376 1.00 24.11 ? 55  ALA A HB2  1  
ATOM 862    H HB3  . ALA A 1 55  ? 10.451  -8.468  -14.623 1.00 44.54 ? 55  ALA A HB3  1  
ATOM 863    N N    . LEU A 1 56  ? 10.025  -6.725  -18.356 1.00 10.43 ? 56  LEU A N    1  
ATOM 864    C CA   . LEU A 1 56  ? 9.874   -5.564  -19.291 1.00 44.14 ? 56  LEU A CA   1  
ATOM 865    C C    . LEU A 1 56  ? 8.404   -5.376  -19.685 1.00 41.01 ? 56  LEU A C    1  
ATOM 866    O O    . LEU A 1 56  ? 7.874   -4.285  -19.623 1.00 42.32 ? 56  LEU A O    1  
ATOM 867    C CB   . LEU A 1 56  ? 10.702  -5.814  -20.555 1.00 32.41 ? 56  LEU A CB   1  
ATOM 868    C CG   . LEU A 1 56  ? 12.125  -6.237  -20.177 1.00 24.14 ? 56  LEU A CG   1  
ATOM 869    C CD1  . LEU A 1 56  ? 12.975  -6.338  -21.447 1.00 42.45 ? 56  LEU A CD1  1  
ATOM 870    C CD2  . LEU A 1 56  ? 12.743  -5.202  -19.227 1.00 41.43 ? 56  LEU A CD2  1  
ATOM 871    H H    . LEU A 1 56  ? 10.779  -7.341  -18.462 1.00 32.45 ? 56  LEU A H    1  
ATOM 872    H HA   . LEU A 1 56  ? 10.226  -4.666  -18.806 1.00 15.44 ? 56  LEU A HA   1  
ATOM 873    H HB2  . LEU A 1 56  ? 10.238  -6.596  -21.138 1.00 51.13 ? 56  LEU A HB2  1  
ATOM 874    H HB3  . LEU A 1 56  ? 10.742  -4.908  -21.141 1.00 51.22 ? 56  LEU A HB3  1  
ATOM 875    H HG   . LEU A 1 56  ? 12.094  -7.200  -19.692 1.00 74.43 ? 56  LEU A HG   1  
ATOM 876    H HD11 . LEU A 1 56  ? 13.066  -5.361  -21.898 1.00 54.22 ? 56  LEU A HD11 1  
ATOM 877    H HD12 . LEU A 1 56  ? 12.502  -7.013  -22.144 1.00 22.31 ? 56  LEU A HD12 1  
ATOM 878    H HD13 . LEU A 1 56  ? 13.956  -6.711  -21.194 1.00 74.24 ? 56  LEU A HD13 1  
ATOM 879    H HD21 . LEU A 1 56  ? 12.369  -5.364  -18.226 1.00 45.12 ? 56  LEU A HD21 1  
ATOM 880    H HD22 . LEU A 1 56  ? 12.480  -4.206  -19.553 1.00 32.21 ? 56  LEU A HD22 1  
ATOM 881    H HD23 . LEU A 1 56  ? 13.819  -5.306  -19.227 1.00 34.55 ? 56  LEU A HD23 1  
ATOM 882    N N    . SER A 1 57  ? 7.740   -6.422  -20.091 1.00 12.42 ? 57  SER A N    1  
ATOM 883    C CA   . SER A 1 57  ? 6.308   -6.280  -20.483 1.00 11.20 ? 57  SER A CA   1  
ATOM 884    C C    . SER A 1 57  ? 5.466   -5.971  -19.242 1.00 55.23 ? 57  SER A C    1  
ATOM 885    O O    . SER A 1 57  ? 4.528   -5.198  -19.288 1.00 33.44 ? 57  SER A O    1  
ATOM 886    C CB   . SER A 1 57  ? 5.821   -7.584  -21.117 1.00 14.33 ? 57  SER A CB   1  
ATOM 887    O OG   . SER A 1 57  ? 5.800   -8.606  -20.129 1.00 30.24 ? 57  SER A OG   1  
ATOM 888    H H    . SER A 1 57  ? 8.179   -7.297  -20.138 1.00 44.13 ? 57  SER A H    1  
ATOM 889    H HA   . SER A 1 57  ? 6.208   -5.474  -21.196 1.00 4.31  ? 57  SER A HA   1  
ATOM 890    H HB2  . SER A 1 57  ? 4.827   -7.448  -21.508 1.00 42.32 ? 57  SER A HB2  1  
ATOM 891    H HB3  . SER A 1 57  ? 6.488   -7.862  -21.923 1.00 63.23 ? 57  SER A HB3  1  
ATOM 892    H HG   . SER A 1 57  ? 6.046   -8.212  -19.289 1.00 0.12  ? 57  SER A HG   1  
ATOM 893    N N    . PHE A 1 58  ? 5.794   -6.574  -18.134 1.00 74.44 ? 58  PHE A N    1  
ATOM 894    C CA   . PHE A 1 58  ? 5.018   -6.328  -16.886 1.00 64.52 ? 58  PHE A CA   1  
ATOM 895    C C    . PHE A 1 58  ? 5.237   -4.890  -16.411 1.00 74.33 ? 58  PHE A C    1  
ATOM 896    O O    . PHE A 1 58  ? 4.320   -4.099  -16.363 1.00 44.32 ? 58  PHE A O    1  
ATOM 897    C CB   . PHE A 1 58  ? 5.490   -7.305  -15.808 1.00 11.14 ? 58  PHE A CB   1  
ATOM 898    C CG   . PHE A 1 58  ? 4.611   -7.182  -14.585 1.00 33.22 ? 58  PHE A CG   1  
ATOM 899    C CD1  . PHE A 1 58  ? 3.311   -7.702  -14.604 1.00 14.02 ? 58  PHE A CD1  1  
ATOM 900    C CD2  . PHE A 1 58  ? 5.096   -6.553  -13.431 1.00 30.32 ? 58  PHE A CD2  1  
ATOM 901    C CE1  . PHE A 1 58  ? 2.497   -7.593  -13.470 1.00 61.32 ? 58  PHE A CE1  1  
ATOM 902    C CE2  . PHE A 1 58  ? 4.282   -6.444  -12.298 1.00 44.22 ? 58  PHE A CE2  1  
ATOM 903    C CZ   . PHE A 1 58  ? 2.982   -6.965  -12.317 1.00 33.41 ? 58  PHE A CZ   1  
ATOM 904    H H    . PHE A 1 58  ? 6.553   -7.195  -18.122 1.00 71.22 ? 58  PHE A H    1  
ATOM 905    H HA   . PHE A 1 58  ? 3.965   -6.486  -17.078 1.00 74.41 ? 58  PHE A HA   1  
ATOM 906    H HB2  . PHE A 1 58  ? 5.432   -8.313  -16.191 1.00 12.43 ? 58  PHE A HB2  1  
ATOM 907    H HB3  . PHE A 1 58  ? 6.512   -7.080  -15.542 1.00 70.24 ? 58  PHE A HB3  1  
ATOM 908    H HD1  . PHE A 1 58  ? 2.936   -8.186  -15.493 1.00 34.34 ? 58  PHE A HD1  1  
ATOM 909    H HD2  . PHE A 1 58  ? 6.099   -6.152  -13.416 1.00 32.50 ? 58  PHE A HD2  1  
ATOM 910    H HE1  . PHE A 1 58  ? 1.495   -7.995  -13.485 1.00 43.13 ? 58  PHE A HE1  1  
ATOM 911    H HE2  . PHE A 1 58  ? 4.657   -5.960  -11.408 1.00 22.54 ? 58  PHE A HE2  1  
ATOM 912    H HZ   . PHE A 1 58  ? 2.354   -6.881  -11.442 1.00 63.23 ? 58  PHE A HZ   1  
ATOM 913    N N    . VAL A 1 59  ? 6.443   -4.539  -16.057 1.00 74.03 ? 59  VAL A N    1  
ATOM 914    C CA   . VAL A 1 59  ? 6.695   -3.148  -15.584 1.00 50.23 ? 59  VAL A CA   1  
ATOM 915    C C    . VAL A 1 59  ? 6.084   -2.152  -16.569 1.00 51.24 ? 59  VAL A C    1  
ATOM 916    O O    . VAL A 1 59  ? 5.648   -1.082  -16.196 1.00 54.43 ? 59  VAL A O    1  
ATOM 917    C CB   . VAL A 1 59  ? 8.199   -2.900  -15.482 1.00 12.34 ? 59  VAL A CB   1  
ATOM 918    C CG1  . VAL A 1 59  ? 8.836   -3.969  -14.594 1.00 72.34 ? 59  VAL A CG1  1  
ATOM 919    C CG2  . VAL A 1 59  ? 8.825   -2.955  -16.877 1.00 4.45  ? 59  VAL A CG2  1  
ATOM 920    H H    . VAL A 1 59  ? 7.177   -5.187  -16.100 1.00 61.54 ? 59  VAL A H    1  
ATOM 921    H HA   . VAL A 1 59  ? 6.244   -3.015  -14.612 1.00 63.03 ? 59  VAL A HA   1  
ATOM 922    H HB   . VAL A 1 59  ? 8.365   -1.926  -15.050 1.00 44.30 ? 59  VAL A HB   1  
ATOM 923    H HG11 . VAL A 1 59  ? 8.695   -4.940  -15.043 1.00 24.44 ? 59  VAL A HG11 1  
ATOM 924    H HG12 . VAL A 1 59  ? 8.370   -3.952  -13.619 1.00 71.13 ? 59  VAL A HG12 1  
ATOM 925    H HG13 . VAL A 1 59  ? 9.892   -3.769  -14.492 1.00 1.34  ? 59  VAL A HG13 1  
ATOM 926    H HG21 . VAL A 1 59  ? 8.554   -2.067  -17.429 1.00 52.51 ? 59  VAL A HG21 1  
ATOM 927    H HG22 . VAL A 1 59  ? 8.464   -3.827  -17.398 1.00 45.01 ? 59  VAL A HG22 1  
ATOM 928    H HG23 . VAL A 1 59  ? 9.900   -3.008  -16.787 1.00 44.42 ? 59  VAL A HG23 1  
ATOM 929    N N    . SER A 1 60  ? 6.048   -2.493  -17.825 1.00 22.40 ? 60  SER A N    1  
ATOM 930    C CA   . SER A 1 60  ? 5.463   -1.564  -18.826 1.00 41.22 ? 60  SER A CA   1  
ATOM 931    C C    . SER A 1 60  ? 3.998   -1.307  -18.474 1.00 64.30 ? 60  SER A C    1  
ATOM 932    O O    . SER A 1 60  ? 3.564   -0.173  -18.348 1.00 1.32  ? 60  SER A O    1  
ATOM 933    C CB   . SER A 1 60  ? 5.552   -2.188  -20.219 1.00 50.04 ? 60  SER A CB   1  
ATOM 934    O OG   . SER A 1 60  ? 5.153   -1.230  -21.190 1.00 20.22 ? 60  SER A OG   1  
ATOM 935    H H    . SER A 1 60  ? 6.403   -3.359  -18.108 1.00 40.02 ? 60  SER A H    1  
ATOM 936    H HA   . SER A 1 60  ? 6.006   -0.630  -18.813 1.00 40.12 ? 60  SER A HA   1  
ATOM 937    H HB2  . SER A 1 60  ? 6.567   -2.491  -20.416 1.00 73.54 ? 60  SER A HB2  1  
ATOM 938    H HB3  . SER A 1 60  ? 4.905   -3.055  -20.266 1.00 40.23 ? 60  SER A HB3  1  
ATOM 939    H HG   . SER A 1 60  ? 5.942   -0.915  -21.637 1.00 72.13 ? 60  SER A HG   1  
ATOM 940    N N    . ARG A 1 61  ? 3.222   -2.345  -18.310 1.00 43.05 ? 61  ARG A N    1  
ATOM 941    C CA   . ARG A 1 61  ? 1.795   -2.121  -17.972 1.00 61.31 ? 61  ARG A CA   1  
ATOM 942    C C    . ARG A 1 61  ? 1.686   -1.528  -16.563 1.00 62.25 ? 61  ARG A C    1  
ATOM 943    O O    . ARG A 1 61  ? 0.751   -0.816  -16.258 1.00 53.34 ? 61  ARG A O    1  
ATOM 944    C CB   . ARG A 1 61  ? 0.996   -3.424  -18.049 1.00 62.53 ? 61  ARG A CB   1  
ATOM 945    C CG   . ARG A 1 61  ? 1.751   -4.544  -17.340 1.00 61.11 ? 61  ARG A CG   1  
ATOM 946    C CD   . ARG A 1 61  ? 0.885   -5.805  -17.310 1.00 20.41 ? 61  ARG A CD   1  
ATOM 947    N NE   . ARG A 1 61  ? 0.304   -6.042  -18.661 1.00 64.44 ? 61  ARG A NE   1  
ATOM 948    C CZ   . ARG A 1 61  ? 1.040   -6.558  -19.607 1.00 2.14  ? 61  ARG A CZ   1  
ATOM 949    N NH1  . ARG A 1 61  ? 2.286   -6.867  -19.370 1.00 52.42 ? 61  ARG A NH1  1  
ATOM 950    N NH2  . ARG A 1 61  ? 0.531   -6.764  -20.791 1.00 41.54 ? 61  ARG A NH2  1  
ATOM 951    H H    . ARG A 1 61  ? 3.575   -3.255  -18.412 1.00 63.45 ? 61  ARG A H    1  
ATOM 952    H HA   . ARG A 1 61  ? 1.390   -1.424  -18.681 1.00 64.53 ? 61  ARG A HA   1  
ATOM 953    H HB2  . ARG A 1 61  ? 0.035   -3.277  -17.575 1.00 44.23 ? 61  ARG A HB2  1  
ATOM 954    H HB3  . ARG A 1 61  ? 0.848   -3.692  -19.085 1.00 25.13 ? 61  ARG A HB3  1  
ATOM 955    H HG2  . ARG A 1 61  ? 2.665   -4.748  -17.876 1.00 51.34 ? 61  ARG A HG2  1  
ATOM 956    H HG3  . ARG A 1 61  ? 1.981   -4.243  -16.329 1.00 44.20 ? 61  ARG A HG3  1  
ATOM 957    H HD2  . ARG A 1 61  ? 1.492   -6.652  -17.026 1.00 20.23 ? 61  ARG A HD2  1  
ATOM 958    H HD3  . ARG A 1 61  ? 0.088   -5.677  -16.593 1.00 0.11  ? 61  ARG A HD3  1  
ATOM 959    H HE   . ARG A 1 61  ? -0.631  -5.811  -18.840 1.00 73.34 ? 61  ARG A HE   1  
ATOM 960    H HH11 . ARG A 1 61  ? 2.676   -6.709  -18.463 1.00 64.20 ? 61  ARG A HH11 1  
ATOM 961    H HH12 . ARG A 1 61  ? 2.850   -7.262  -20.095 1.00 35.30 ? 61  ARG A HH12 1  
ATOM 962    H HH21 . ARG A 1 61  ? -0.424  -6.528  -20.972 1.00 23.11 ? 61  ARG A HH21 1  
ATOM 963    H HH22 . ARG A 1 61  ? 1.095   -7.160  -21.516 1.00 50.15 ? 61  ARG A HH22 1  
ATOM 964    N N    . ILE A 1 62  ? 2.633   -1.802  -15.697 1.00 63.21 ? 62  ILE A N    1  
ATOM 965    C CA   . ILE A 1 62  ? 2.551   -1.225  -14.323 1.00 54.23 ? 62  ILE A CA   1  
ATOM 966    C C    . ILE A 1 62  ? 2.454   0.295   -14.443 1.00 62.20 ? 62  ILE A C    1  
ATOM 967    O O    . ILE A 1 62  ? 1.630   0.922   -13.811 1.00 12.24 ? 62  ILE A O    1  
ATOM 968    C CB   . ILE A 1 62  ? 3.799   -1.605  -13.508 1.00 12.45 ? 62  ILE A CB   1  
ATOM 969    C CG1  . ILE A 1 62  ? 3.806   -3.116  -13.197 1.00 13.14 ? 62  ILE A CG1  1  
ATOM 970    C CG2  . ILE A 1 62  ? 3.828   -0.812  -12.198 1.00 42.40 ? 62  ILE A CG2  1  
ATOM 971    C CD1  . ILE A 1 62  ? 2.534   -3.543  -12.445 1.00 3.12  ? 62  ILE A CD1  1  
ATOM 972    H H    . ILE A 1 62  ? 3.393   -2.371  -15.951 1.00 14.04 ? 62  ILE A H    1  
ATOM 973    H HA   . ILE A 1 62  ? 1.664   -1.594  -13.834 1.00 1.42  ? 62  ILE A HA   1  
ATOM 974    H HB   . ILE A 1 62  ? 4.679   -1.357  -14.082 1.00 15.43 ? 62  ILE A HB   1  
ATOM 975    H HG12 . ILE A 1 62  ? 3.869   -3.667  -14.120 1.00 72.11 ? 62  ILE A HG12 1  
ATOM 976    H HG13 . ILE A 1 62  ? 4.669   -3.347  -12.589 1.00 72.04 ? 62  ILE A HG13 1  
ATOM 977    H HG21 . ILE A 1 62  ? 4.553   -1.250  -11.528 1.00 31.21 ? 62  ILE A HG21 1  
ATOM 978    H HG22 . ILE A 1 62  ? 2.851   -0.839  -11.738 1.00 55.33 ? 62  ILE A HG22 1  
ATOM 979    H HG23 . ILE A 1 62  ? 4.102   0.213   -12.403 1.00 43.21 ? 62  ILE A HG23 1  
ATOM 980    H HD11 . ILE A 1 62  ? 2.762   -4.384  -11.806 1.00 10.21 ? 62  ILE A HD11 1  
ATOM 981    H HD12 . ILE A 1 62  ? 1.776   -3.833  -13.157 1.00 73.35 ? 62  ILE A HD12 1  
ATOM 982    H HD13 . ILE A 1 62  ? 2.164   -2.727  -11.842 1.00 23.42 ? 62  ILE A HD13 1  
ATOM 983    N N    . LYS A 1 63  ? 3.275   0.894   -15.262 1.00 2.54  ? 63  LYS A N    1  
ATOM 984    C CA   . LYS A 1 63  ? 3.196   2.372   -15.423 1.00 41.43 ? 63  LYS A CA   1  
ATOM 985    C C    . LYS A 1 63  ? 1.832   2.719   -16.020 1.00 72.24 ? 63  LYS A C    1  
ATOM 986    O O    . LYS A 1 63  ? 1.193   3.674   -15.625 1.00 55.11 ? 63  LYS A O    1  
ATOM 987    C CB   . LYS A 1 63  ? 4.310   2.856   -16.357 1.00 62.03 ? 63  LYS A CB   1  
ATOM 988    C CG   . LYS A 1 63  ? 5.681   2.663   -15.687 1.00 51.42 ? 63  LYS A CG   1  
ATOM 989    C CD   . LYS A 1 63  ? 5.832   3.609   -14.478 1.00 33.23 ? 63  LYS A CD   1  
ATOM 990    C CE   . LYS A 1 63  ? 7.315   3.904   -14.227 1.00 35.21 ? 63  LYS A CE   1  
ATOM 991    N NZ   . LYS A 1 63  ? 7.846   4.757   -15.328 1.00 74.42 ? 63  LYS A NZ   1  
ATOM 992    H H    . LYS A 1 63  ? 3.929   0.373   -15.778 1.00 2.24  ? 63  LYS A H    1  
ATOM 993    H HA   . LYS A 1 63  ? 3.295   2.846   -14.459 1.00 20.10 ? 63  LYS A HA   1  
ATOM 994    H HB2  . LYS A 1 63  ? 4.277   2.286   -17.274 1.00 31.41 ? 63  LYS A HB2  1  
ATOM 995    H HB3  . LYS A 1 63  ? 4.163   3.901   -16.580 1.00 4.53  ? 63  LYS A HB3  1  
ATOM 996    H HG2  . LYS A 1 63  ? 5.772   1.638   -15.354 1.00 4.33  ? 63  LYS A HG2  1  
ATOM 997    H HG3  . LYS A 1 63  ? 6.457   2.873   -16.408 1.00 1.01  ? 63  LYS A HG3  1  
ATOM 998    H HD2  . LYS A 1 63  ? 5.313   4.537   -14.670 1.00 32.31 ? 63  LYS A HD2  1  
ATOM 999    H HD3  . LYS A 1 63  ? 5.415   3.140   -13.599 1.00 31.03 ? 63  LYS A HD3  1  
ATOM 1000   H HE2  . LYS A 1 63  ? 7.424   4.423   -13.287 1.00 32.14 ? 63  LYS A HE2  1  
ATOM 1001   H HE3  . LYS A 1 63  ? 7.867   2.976   -14.193 1.00 71.20 ? 63  LYS A HE3  1  
ATOM 1002   H HZ1  . LYS A 1 63  ? 7.105   5.413   -15.647 1.00 63.13 ? 63  LYS A HZ1  1  
ATOM 1003   H HZ2  . LYS A 1 63  ? 8.141   4.154   -16.123 1.00 40.21 ? 63  LYS A HZ2  1  
ATOM 1004   H HZ3  . LYS A 1 63  ? 8.661   5.302   -14.983 1.00 50.53 ? 63  LYS A HZ3  1  
ATOM 1005   N N    . GLU A 1 64  ? 1.375   1.937   -16.961 1.00 0.35  ? 64  GLU A N    1  
ATOM 1006   C CA   . GLU A 1 64  ? 0.042   2.206   -17.577 1.00 5.40  ? 64  GLU A CA   1  
ATOM 1007   C C    . GLU A 1 64  ? -1.051  1.966   -16.537 1.00 70.32 ? 64  GLU A C    1  
ATOM 1008   O O    . GLU A 1 64  ? -1.922  2.787   -16.327 1.00 2.15  ? 64  GLU A O    1  
ATOM 1009   C CB   . GLU A 1 64  ? -0.162  1.243   -18.750 1.00 62.42 ? 64  GLU A CB   1  
ATOM 1010   C CG   . GLU A 1 64  ? -1.567  1.389   -19.341 1.00 35.13 ? 64  GLU A CG   1  
ATOM 1011   C CD   . GLU A 1 64  ? -1.803  2.839   -19.768 1.00 45.54 ? 64  GLU A CD   1  
ATOM 1012   O OE1  . GLU A 1 64  ? -0.837  3.500   -20.112 1.00 33.41 ? 64  GLU A OE1  1  
ATOM 1013   O OE2  . GLU A 1 64  ? -2.946  3.264   -19.743 1.00 14.11 ? 64  GLU A OE2  1  
ATOM 1014   H H    . GLU A 1 64  ? 1.907   1.164   -17.258 1.00 53.34 ? 64  GLU A H    1  
ATOM 1015   H HA   . GLU A 1 64  ? -0.001  3.223   -17.926 1.00 72.12 ? 64  GLU A HA   1  
ATOM 1016   H HB2  . GLU A 1 64  ? 0.572   1.443   -19.515 1.00 63.35 ? 64  GLU A HB2  1  
ATOM 1017   H HB3  . GLU A 1 64  ? -0.042  0.238   -18.393 1.00 4.34  ? 64  GLU A HB3  1  
ATOM 1018   H HG2  . GLU A 1 64  ? -1.654  0.740   -20.200 1.00 61.12 ? 64  GLU A HG2  1  
ATOM 1019   H HG3  . GLU A 1 64  ? -2.302  1.102   -18.606 1.00 74.55 ? 64  GLU A HG3  1  
ATOM 1020   N N    . LYS A 1 65  ? -1.015  0.832   -15.900 1.00 72.24 ? 65  LYS A N    1  
ATOM 1021   C CA   . LYS A 1 65  ? -2.052  0.503   -14.882 1.00 1.13  ? 65  LYS A CA   1  
ATOM 1022   C C    . LYS A 1 65  ? -1.752  1.234   -13.573 1.00 35.23 ? 65  LYS A C    1  
ATOM 1023   O O    . LYS A 1 65  ? -2.575  1.289   -12.680 1.00 32.33 ? 65  LYS A O    1  
ATOM 1024   C CB   . LYS A 1 65  ? -2.049  -1.008  -14.642 1.00 14.41 ? 65  LYS A CB   1  
ATOM 1025   C CG   . LYS A 1 65  ? -2.476  -1.726  -15.924 1.00 4.34  ? 65  LYS A CG   1  
ATOM 1026   C CD   . LYS A 1 65  ? -2.577  -3.230  -15.662 1.00 34.23 ? 65  LYS A CD   1  
ATOM 1027   C CE   . LYS A 1 65  ? -2.911  -3.954  -16.968 1.00 4.41  ? 65  LYS A CE   1  
ATOM 1028   N NZ   . LYS A 1 65  ? -2.660  -5.413  -16.806 1.00 75.22 ? 65  LYS A NZ   1  
ATOM 1029   H H    . LYS A 1 65  ? -0.307  0.186   -16.102 1.00 34.20 ? 65  LYS A H    1  
ATOM 1030   H HA   . LYS A 1 65  ? -3.021  0.806   -15.247 1.00 23.35 ? 65  LYS A HA   1  
ATOM 1031   H HB2  . LYS A 1 65  ? -1.054  -1.326  -14.365 1.00 22.31 ? 65  LYS A HB2  1  
ATOM 1032   H HB3  . LYS A 1 65  ? -2.737  -1.250  -13.851 1.00 44.42 ? 65  LYS A HB3  1  
ATOM 1033   H HG2  . LYS A 1 65  ? -3.438  -1.350  -16.243 1.00 62.15 ? 65  LYS A HG2  1  
ATOM 1034   H HG3  . LYS A 1 65  ? -1.745  -1.546  -16.698 1.00 11.51 ? 65  LYS A HG3  1  
ATOM 1035   H HD2  . LYS A 1 65  ? -1.634  -3.592  -15.279 1.00 2.32  ? 65  LYS A HD2  1  
ATOM 1036   H HD3  . LYS A 1 65  ? -3.357  -3.418  -14.939 1.00 73.11 ? 65  LYS A HD3  1  
ATOM 1037   H HE2  . LYS A 1 65  ? -3.950  -3.792  -17.213 1.00 30.33 ? 65  LYS A HE2  1  
ATOM 1038   H HE3  . LYS A 1 65  ? -2.290  -3.568  -17.763 1.00 52.40 ? 65  LYS A HE3  1  
ATOM 1039   H HZ1  . LYS A 1 65  ? -1.835  -5.557  -16.190 1.00 42.04 ? 65  LYS A HZ1  1  
ATOM 1040   H HZ2  . LYS A 1 65  ? -2.476  -5.838  -17.738 1.00 44.34 ? 65  LYS A HZ2  1  
ATOM 1041   H HZ3  . LYS A 1 65  ? -3.493  -5.863  -16.376 1.00 23.50 ? 65  LYS A HZ3  1  
ATOM 1042   N N    . HIS A 1 66  ? -0.584  1.797   -13.450 1.00 55.14 ? 66  HIS A N    1  
ATOM 1043   C CA   . HIS A 1 66  ? -0.233  2.526   -12.199 1.00 20.20 ? 66  HIS A CA   1  
ATOM 1044   C C    . HIS A 1 66  ? 0.887   3.523   -12.497 1.00 74.13 ? 66  HIS A C    1  
ATOM 1045   O O    . HIS A 1 66  ? 2.015   3.342   -12.091 1.00 2.34  ? 66  HIS A O    1  
ATOM 1046   C CB   . HIS A 1 66  ? 0.244   1.528   -11.141 1.00 52.12 ? 66  HIS A CB   1  
ATOM 1047   C CG   . HIS A 1 66  ? -0.849  0.535   -10.855 1.00 21.41 ? 66  HIS A CG   1  
ATOM 1048   N ND1  . HIS A 1 66  ? -1.997  0.879   -10.154 1.00 13.04 ? 66  HIS A ND1  1  
ATOM 1049   C CD2  . HIS A 1 66  ? -0.985  -0.796  -11.168 1.00 23.44 ? 66  HIS A CD2  1  
ATOM 1050   C CE1  . HIS A 1 66  ? -2.765  -0.223  -10.068 1.00 62.04 ? 66  HIS A CE1  1  
ATOM 1051   N NE2  . HIS A 1 66  ? -2.194  -1.268  -10.670 1.00 71.21 ? 66  HIS A NE2  1  
ATOM 1052   H H    . HIS A 1 66  ? 0.065   1.742   -14.183 1.00 52.42 ? 66  HIS A H    1  
ATOM 1053   H HA   . HIS A 1 66  ? -1.100  3.054   -11.832 1.00 12.35 ? 66  HIS A HA   1  
ATOM 1054   H HB2  . HIS A 1 66  ? 1.117   1.007   -11.506 1.00 63.33 ? 66  HIS A HB2  1  
ATOM 1055   H HB3  . HIS A 1 66  ? 0.494   2.057   -10.234 1.00 53.04 ? 66  HIS A HB3  1  
ATOM 1056   H HD1  . HIS A 1 66  ? -2.209  1.762   -9.787  1.00 3.20  ? 66  HIS A HD1  1  
ATOM 1057   H HD2  . HIS A 1 66  ? -0.264  -1.384  -11.716 1.00 13.01 ? 66  HIS A HD2  1  
ATOM 1058   H HE1  . HIS A 1 66  ? -3.725  -0.258  -9.574  1.00 63.03 ? 66  HIS A HE1  1  
ATOM 1059   H HE2  . HIS A 1 66  ? -2.551  -2.177  -10.745 1.00 0.00  ? 66  HIS A HE2  1  
ATOM 1060   N N    . SER A 1 67  ? 0.587   4.570   -13.213 1.00 70.00 ? 67  SER A N    1  
ATOM 1061   C CA   . SER A 1 67  ? 1.640   5.573   -13.543 1.00 45.40 ? 67  SER A CA   1  
ATOM 1062   C C    . SER A 1 67  ? 2.054   6.334   -12.279 1.00 73.24 ? 67  SER A C    1  
ATOM 1063   O O    . SER A 1 67  ? 3.140   6.872   -12.198 1.00 55.42 ? 67  SER A O    1  
ATOM 1064   C CB   . SER A 1 67  ? 1.093   6.561   -14.574 1.00 31.21 ? 67  SER A CB   1  
ATOM 1065   O OG   . SER A 1 67  ? 0.121   7.394   -13.957 1.00 42.53 ? 67  SER A OG   1  
ATOM 1066   H H    . SER A 1 67  ? -0.329  4.695   -13.539 1.00 21.23 ? 67  SER A H    1  
ATOM 1067   H HA   . SER A 1 67  ? 2.501   5.066   -13.954 1.00 35.50 ? 67  SER A HA   1  
ATOM 1068   H HB2  . SER A 1 67  ? 1.896   7.172   -14.951 1.00 61.31 ? 67  SER A HB2  1  
ATOM 1069   H HB3  . SER A 1 67  ? 0.646   6.013   -15.394 1.00 72.45 ? 67  SER A HB3  1  
ATOM 1070   H HG   . SER A 1 67  ? -0.002  8.168   -14.511 1.00 53.03 ? 67  SER A HG   1  
ATOM 1071   N N    . SER A 1 68  ? 1.196   6.391   -11.294 1.00 5.11  ? 68  SER A N    1  
ATOM 1072   C CA   . SER A 1 68  ? 1.539   7.128   -10.039 1.00 24.31 ? 68  SER A CA   1  
ATOM 1073   C C    . SER A 1 68  ? 2.198   6.178   -9.035  1.00 25.55 ? 68  SER A C    1  
ATOM 1074   O O    . SER A 1 68  ? 1.814   6.118   -7.883  1.00 61.01 ? 68  SER A O    1  
ATOM 1075   C CB   . SER A 1 68  ? 0.262   7.705   -9.426  1.00 2.45  ? 68  SER A CB   1  
ATOM 1076   O OG   . SER A 1 68  ? -0.540  6.643   -8.926  1.00 33.10 ? 68  SER A OG   1  
ATOM 1077   H H    . SER A 1 68  ? 0.322   5.956   -11.381 1.00 64.23 ? 68  SER A H    1  
ATOM 1078   H HA   . SER A 1 68  ? 2.220   7.937   -10.266 1.00 54.53 ? 68  SER A HA   1  
ATOM 1079   H HB2  . SER A 1 68  ? 0.517   8.368   -8.616  1.00 52.31 ? 68  SER A HB2  1  
ATOM 1080   H HB3  . SER A 1 68  ? -0.281  8.256   -10.182 1.00 71.44 ? 68  SER A HB3  1  
ATOM 1081   H HG   . SER A 1 68  ? -0.308  6.503   -8.005  1.00 71.42 ? 68  SER A HG   1  
ATOM 1082   N N    . ILE A 1 69  ? 3.191   5.437   -9.456  1.00 71.33 ? 69  ILE A N    1  
ATOM 1083   C CA   . ILE A 1 69  ? 3.879   4.491   -8.521  1.00 0.43  ? 69  ILE A CA   1  
ATOM 1084   C C    . ILE A 1 69  ? 5.378   4.460   -8.842  1.00 14.44 ? 69  ILE A C    1  
ATOM 1085   O O    . ILE A 1 69  ? 5.803   4.887   -9.897  1.00 32.23 ? 69  ILE A O    1  
ATOM 1086   C CB   . ILE A 1 69  ? 3.275   3.085   -8.682  1.00 63.34 ? 69  ILE A CB   1  
ATOM 1087   C CG1  . ILE A 1 69  ? 3.653   2.224   -7.470  1.00 1.33  ? 69  ILE A CG1  1  
ATOM 1088   C CG2  . ILE A 1 69  ? 3.794   2.420   -9.971  1.00 55.14 ? 69  ILE A CG2  1  
ATOM 1089   C CD1  . ILE A 1 69  ? 2.957   0.866   -7.574  1.00 23.31 ? 69  ILE A CD1  1  
ATOM 1090   H H    . ILE A 1 69  ? 3.487   5.502   -10.388 1.00 51.13 ? 69  ILE A H    1  
ATOM 1091   H HA   . ILE A 1 69  ? 3.745   4.826   -7.500  1.00 20.44 ? 69  ILE A HA   1  
ATOM 1092   H HB   . ILE A 1 69  ? 2.198   3.170   -8.737  1.00 52.11 ? 69  ILE A HB   1  
ATOM 1093   H HG12 . ILE A 1 69  ? 4.723   2.082   -7.450  1.00 12.21 ? 69  ILE A HG12 1  
ATOM 1094   H HG13 . ILE A 1 69  ? 3.337   2.719   -6.564  1.00 22.14 ? 69  ILE A HG13 1  
ATOM 1095   H HG21 . ILE A 1 69  ? 4.752   1.956   -9.782  1.00 51.15 ? 69  ILE A HG21 1  
ATOM 1096   H HG22 . ILE A 1 69  ? 3.907   3.166   -10.743 1.00 23.23 ? 69  ILE A HG22 1  
ATOM 1097   H HG23 . ILE A 1 69  ? 3.089   1.670   -10.298 1.00 61.24 ? 69  ILE A HG23 1  
ATOM 1098   H HD11 . ILE A 1 69  ? 1.895   1.013   -7.702  1.00 61.55 ? 69  ILE A HD11 1  
ATOM 1099   H HD12 . ILE A 1 69  ? 3.136   0.300   -6.672  1.00 54.42 ? 69  ILE A HD12 1  
ATOM 1100   H HD13 . ILE A 1 69  ? 3.350   0.324   -8.422  1.00 22.33 ? 69  ILE A HD13 1  
ATOM 1101   N N    . VAL A 1 70  ? 6.183   3.952   -7.945  1.00 24.03 ? 70  VAL A N    1  
ATOM 1102   C CA   . VAL A 1 70  ? 7.653   3.887   -8.207  1.00 72.13 ? 70  VAL A CA   1  
ATOM 1103   C C    . VAL A 1 70  ? 7.985   2.522   -8.815  1.00 62.02 ? 70  VAL A C    1  
ATOM 1104   O O    . VAL A 1 70  ? 7.419   1.518   -8.436  1.00 3.50  ? 70  VAL A O    1  
ATOM 1105   C CB   . VAL A 1 70  ? 8.407   4.066   -6.888  1.00 53.24 ? 70  VAL A CB   1  
ATOM 1106   C CG1  . VAL A 1 70  ? 9.915   4.086   -7.152  1.00 53.24 ? 70  VAL A CG1  1  
ATOM 1107   C CG2  . VAL A 1 70  ? 7.988   5.389   -6.244  1.00 63.33 ? 70  VAL A CG2  1  
ATOM 1108   H H    . VAL A 1 70  ? 5.821   3.606   -7.099  1.00 13.22 ? 70  VAL A H    1  
ATOM 1109   H HA   . VAL A 1 70  ? 7.941   4.669   -8.897  1.00 21.44 ? 70  VAL A HA   1  
ATOM 1110   H HB   . VAL A 1 70  ? 8.166   3.250   -6.224  1.00 73.02 ? 70  VAL A HB   1  
ATOM 1111   H HG11 . VAL A 1 70  ? 10.442  4.169   -6.213  1.00 54.43 ? 70  VAL A HG11 1  
ATOM 1112   H HG12 . VAL A 1 70  ? 10.159  4.932   -7.777  1.00 2.24  ? 70  VAL A HG12 1  
ATOM 1113   H HG13 . VAL A 1 70  ? 10.210  3.175   -7.650  1.00 55.42 ? 70  VAL A HG13 1  
ATOM 1114   H HG21 . VAL A 1 70  ? 8.003   6.172   -6.987  1.00 24.05 ? 70  VAL A HG21 1  
ATOM 1115   H HG22 . VAL A 1 70  ? 8.676   5.636   -5.449  1.00 43.12 ? 70  VAL A HG22 1  
ATOM 1116   H HG23 . VAL A 1 70  ? 6.991   5.293   -5.841  1.00 22.42 ? 70  VAL A HG23 1  
ATOM 1117   N N    . VAL A 1 71  ? 8.899   2.476   -9.758  1.00 33.43 ? 71  VAL A N    1  
ATOM 1118   C CA   . VAL A 1 71  ? 9.270   1.176   -10.403 1.00 12.11 ? 71  VAL A CA   1  
ATOM 1119   C C    . VAL A 1 71  ? 10.784  1.028   -10.405 1.00 52.45 ? 71  VAL A C    1  
ATOM 1120   O O    . VAL A 1 71  ? 11.504  1.866   -10.914 1.00 24.24 ? 71  VAL A O    1  
ATOM 1121   C CB   . VAL A 1 71  ? 8.757   1.150   -11.843 1.00 40.30 ? 71  VAL A CB   1  
ATOM 1122   C CG1  . VAL A 1 71  ? 8.853   -0.274  -12.392 1.00 54.21 ? 71  VAL A CG1  1  
ATOM 1123   C CG2  . VAL A 1 71  ? 7.298   1.611   -11.873 1.00 21.34 ? 71  VAL A CG2  1  
ATOM 1124   H H    . VAL A 1 71  ? 9.345   3.298   -10.041 1.00 12.42 ? 71  VAL A H    1  
ATOM 1125   H HA   . VAL A 1 71  ? 8.840   0.351   -9.856  1.00 41.03 ? 71  VAL A HA   1  
ATOM 1126   H HB   . VAL A 1 71  ? 9.360   1.808   -12.451 1.00 23.23 ? 71  VAL A HB   1  
ATOM 1127   H HG11 . VAL A 1 71  ? 9.817   -0.693  -12.142 1.00 53.05 ? 71  VAL A HG11 1  
ATOM 1128   H HG12 . VAL A 1 71  ? 8.739   -0.252  -13.465 1.00 45.24 ? 71  VAL A HG12 1  
ATOM 1129   H HG13 . VAL A 1 71  ? 8.072   -0.882  -11.959 1.00 1.25  ? 71  VAL A HG13 1  
ATOM 1130   H HG21 . VAL A 1 71  ? 6.749   1.119   -11.083 1.00 15.33 ? 71  VAL A HG21 1  
ATOM 1131   H HG22 . VAL A 1 71  ? 6.859   1.358   -12.827 1.00 12.23 ? 71  VAL A HG22 1  
ATOM 1132   H HG23 . VAL A 1 71  ? 7.255   2.680   -11.729 1.00 13.20 ? 71  VAL A HG23 1  
ATOM 1133   N N    . LEU A 1 72  ? 11.267  -0.039  -9.833  1.00 3.53  ? 72  LEU A N    1  
ATOM 1134   C CA   . LEU A 1 72  ? 12.738  -0.283  -9.770  1.00 50.24 ? 72  LEU A CA   1  
ATOM 1135   C C    . LEU A 1 72  ? 13.018  -1.701  -10.274 1.00 2.02  ? 72  LEU A C    1  
ATOM 1136   O O    . LEU A 1 72  ? 12.856  -2.679  -9.566  1.00 23.22 ? 72  LEU A O    1  
ATOM 1137   C CB   . LEU A 1 72  ? 13.187  -0.114  -8.300  1.00 13.41 ? 72  LEU A CB   1  
ATOM 1138   C CG   . LEU A 1 72  ? 13.887  1.246   -8.099  1.00 4.21  ? 72  LEU A CG   1  
ATOM 1139   C CD1  . LEU A 1 72  ? 13.859  1.627   -6.617  1.00 35.41 ? 72  LEU A CD1  1  
ATOM 1140   C CD2  . LEU A 1 72  ? 15.345  1.161   -8.562  1.00 20.43 ? 72  LEU A CD2  1  
ATOM 1141   H H    . LEU A 1 72  ? 10.652  -0.691  -9.431  1.00 72.22 ? 72  LEU A H    1  
ATOM 1142   H HA   . LEU A 1 72  ? 13.270  0.418   -10.405 1.00 11.05 ? 72  LEU A HA   1  
ATOM 1143   H HB2  . LEU A 1 72  ? 12.306  -0.151  -7.670  1.00 2.00  ? 72  LEU A HB2  1  
ATOM 1144   H HB3  . LEU A 1 72  ? 13.860  -0.912  -8.019  1.00 74.21 ? 72  LEU A HB3  1  
ATOM 1145   H HG   . LEU A 1 72  ? 13.369  2.002   -8.672  1.00 55.33 ? 72  LEU A HG   1  
ATOM 1146   H HD11 . LEU A 1 72  ? 12.837  1.659   -6.274  1.00 74.13 ? 72  LEU A HD11 1  
ATOM 1147   H HD12 . LEU A 1 72  ? 14.313  2.598   -6.487  1.00 62.20 ? 72  LEU A HD12 1  
ATOM 1148   H HD13 . LEU A 1 72  ? 14.408  0.893   -6.046  1.00 33.41 ? 72  LEU A HD13 1  
ATOM 1149   H HD21 . LEU A 1 72  ? 15.378  1.047   -9.635  1.00 13.54 ? 72  LEU A HD21 1  
ATOM 1150   H HD22 . LEU A 1 72  ? 15.824  0.316   -8.094  1.00 21.21 ? 72  LEU A HD22 1  
ATOM 1151   H HD23 . LEU A 1 72  ? 15.862  2.066   -8.282  1.00 43.34 ? 72  LEU A HD23 1  
ATOM 1152   N N    . VAL A 1 73  ? 13.441  -1.812  -11.502 1.00 42.53 ? 73  VAL A N    1  
ATOM 1153   C CA   . VAL A 1 73  ? 13.748  -3.153  -12.076 1.00 74.41 ? 73  VAL A CA   1  
ATOM 1154   C C    . VAL A 1 73  ? 15.246  -3.404  -11.937 1.00 3.21  ? 73  VAL A C    1  
ATOM 1155   O O    . VAL A 1 73  ? 16.021  -2.477  -11.877 1.00 43.12 ? 73  VAL A O    1  
ATOM 1156   C CB   . VAL A 1 73  ? 13.364  -3.173  -13.557 1.00 33.43 ? 73  VAL A CB   1  
ATOM 1157   C CG1  . VAL A 1 73  ? 14.221  -2.163  -14.323 1.00 21.31 ? 73  VAL A CG1  1  
ATOM 1158   C CG2  . VAL A 1 73  ? 13.599  -4.574  -14.126 1.00 1.53  ? 73  VAL A CG2  1  
ATOM 1159   H H    . VAL A 1 73  ? 13.562  -1.002  -12.049 1.00 12.14 ? 73  VAL A H    1  
ATOM 1160   H HA   . VAL A 1 73  ? 13.199  -3.921  -11.548 1.00 44.54 ? 73  VAL A HA   1  
ATOM 1161   H HB   . VAL A 1 73  ? 12.321  -2.911  -13.661 1.00 15.40 ? 73  VAL A HB   1  
ATOM 1162   H HG11 . VAL A 1 73  ? 14.235  -1.225  -13.788 1.00 41.54 ? 73  VAL A HG11 1  
ATOM 1163   H HG12 . VAL A 1 73  ? 13.804  -2.010  -15.307 1.00 11.12 ? 73  VAL A HG12 1  
ATOM 1164   H HG13 . VAL A 1 73  ? 15.229  -2.541  -14.413 1.00 13.45 ? 73  VAL A HG13 1  
ATOM 1165   H HG21 . VAL A 1 73  ? 14.661  -4.749  -14.222 1.00 73.23 ? 73  VAL A HG21 1  
ATOM 1166   H HG22 . VAL A 1 73  ? 13.132  -4.653  -15.096 1.00 13.31 ? 73  VAL A HG22 1  
ATOM 1167   H HG23 . VAL A 1 73  ? 13.172  -5.309  -13.459 1.00 41.04 ? 73  VAL A HG23 1  
ATOM 1168   N N    . SER A 1 74  ? 15.660  -4.645  -11.881 1.00 42.04 ? 74  SER A N    1  
ATOM 1169   C CA   . SER A 1 74  ? 17.121  -4.960  -11.746 1.00 12.54 ? 74  SER A CA   1  
ATOM 1170   C C    . SER A 1 74  ? 17.545  -5.845  -12.921 1.00 1.12  ? 74  SER A C    1  
ATOM 1171   O O    . SER A 1 74  ? 16.723  -6.291  -13.698 1.00 33.23 ? 74  SER A O    1  
ATOM 1172   C CB   . SER A 1 74  ? 17.366  -5.681  -10.415 1.00 40.12 ? 74  SER A CB   1  
ATOM 1173   O OG   . SER A 1 74  ? 17.598  -4.715  -9.399  1.00 72.31 ? 74  SER A OG   1  
ATOM 1174   H H    . SER A 1 74  ? 15.009  -5.376  -11.930 1.00 32.40 ? 74  SER A H    1  
ATOM 1175   H HA   . SER A 1 74  ? 17.700  -4.049  -11.769 1.00 31.40 ? 74  SER A HA   1  
ATOM 1176   H HB2  . SER A 1 74  ? 16.500  -6.260  -10.155 1.00 25.42 ? 74  SER A HB2  1  
ATOM 1177   H HB3  . SER A 1 74  ? 18.224  -6.338  -10.502 1.00 33.40 ? 74  SER A HB3  1  
ATOM 1178   H HG   . SER A 1 74  ? 18.164  -5.114  -8.733  1.00 64.34 ? 74  SER A HG   1  
ATOM 1179   N N    . SER A 1 75  ? 18.818  -6.096  -13.072 1.00 55.12 ? 75  SER A N    1  
ATOM 1180   C CA   . SER A 1 75  ? 19.263  -6.946  -14.222 1.00 43.21 ? 75  SER A CA   1  
ATOM 1181   C C    . SER A 1 75  ? 20.746  -7.291  -14.088 1.00 43.32 ? 75  SER A C    1  
ATOM 1182   O O    . SER A 1 75  ? 21.595  -6.426  -14.009 1.00 0.02  ? 75  SER A O    1  
ATOM 1183   C CB   . SER A 1 75  ? 19.036  -6.191  -15.533 1.00 64.54 ? 75  SER A CB   1  
ATOM 1184   O OG   . SER A 1 75  ? 20.152  -5.350  -15.790 1.00 55.33 ? 75  SER A OG   1  
ATOM 1185   H H    . SER A 1 75  ? 19.478  -5.721  -12.435 1.00 34.33 ? 75  SER A H    1  
ATOM 1186   H HA   . SER A 1 75  ? 18.685  -7.859  -14.232 1.00 31.14 ? 75  SER A HA   1  
ATOM 1187   H HB2  . SER A 1 75  ? 18.929  -6.894  -16.343 1.00 62.02 ? 75  SER A HB2  1  
ATOM 1188   H HB3  . SER A 1 75  ? 18.134  -5.597  -15.455 1.00 53.24 ? 75  SER A HB3  1  
ATOM 1189   H HG   . SER A 1 75  ? 20.761  -5.830  -16.355 1.00 32.11 ? 75  SER A HG   1  
ATOM 1190   N N    . ASP A 1 76  ? 21.058  -8.560  -14.049 1.00 62.04 ? 76  ASP A N    1  
ATOM 1191   C CA   . ASP A 1 76  ? 22.480  -8.985  -13.906 1.00 40.33 ? 76  ASP A CA   1  
ATOM 1192   C C    . ASP A 1 76  ? 23.245  -8.685  -15.197 1.00 54.11 ? 76  ASP A C    1  
ATOM 1193   O O    . ASP A 1 76  ? 24.382  -9.081  -15.359 1.00 43.10 ? 76  ASP A O    1  
ATOM 1194   C CB   . ASP A 1 76  ? 22.531  -10.489 -13.624 1.00 35.13 ? 76  ASP A CB   1  
ATOM 1195   C CG   . ASP A 1 76  ? 21.899  -11.251 -14.791 1.00 53.23 ? 76  ASP A CG   1  
ATOM 1196   O OD1  . ASP A 1 76  ? 21.577  -10.618 -15.783 1.00 74.13 ? 76  ASP A OD1  1  
ATOM 1197   O OD2  . ASP A 1 76  ? 21.748  -12.456 -14.672 1.00 13.33 ? 76  ASP A OD2  1  
ATOM 1198   H H    . ASP A 1 76  ? 20.352  -9.237  -14.106 1.00 63.53 ? 76  ASP A H    1  
ATOM 1199   H HA   . ASP A 1 76  ? 22.933  -8.453  -13.082 1.00 21.24 ? 76  ASP A HA   1  
ATOM 1200   H HB2  . ASP A 1 76  ? 23.560  -10.797 -13.507 1.00 33.43 ? 76  ASP A HB2  1  
ATOM 1201   H HB3  . ASP A 1 76  ? 21.985  -10.704 -12.718 1.00 61.23 ? 76  ASP A HB3  1  
ATOM 1202   N N    . ASN A 1 77  ? 22.629  -7.989  -16.120 1.00 1.40  ? 77  ASN A N    1  
ATOM 1203   C CA   . ASN A 1 77  ? 23.314  -7.659  -17.410 1.00 35.23 ? 77  ASN A CA   1  
ATOM 1204   C C    . ASN A 1 77  ? 23.012  -6.207  -17.792 1.00 72.55 ? 77  ASN A C    1  
ATOM 1205   O O    . ASN A 1 77  ? 22.223  -5.944  -18.677 1.00 32.12 ? 77  ASN A O    1  
ATOM 1206   C CB   . ASN A 1 77  ? 22.799  -8.590  -18.510 1.00 4.32  ? 77  ASN A CB   1  
ATOM 1207   C CG   . ASN A 1 77  ? 23.277  -10.017 -18.237 1.00 31.12 ? 77  ASN A CG   1  
ATOM 1208   O OD1  . ASN A 1 77  ? 22.544  -10.965 -18.441 1.00 73.34 ? 77  ASN A OD1  1  
ATOM 1209   N ND2  . ASN A 1 77  ? 24.483  -10.212 -17.779 1.00 24.21 ? 77  ASN A ND2  1  
ATOM 1210   H H    . ASN A 1 77  ? 21.711  -7.683  -15.966 1.00 54.43 ? 77  ASN A H    1  
ATOM 1211   H HA   . ASN A 1 77  ? 24.383  -7.784  -17.306 1.00 54.21 ? 77  ASN A HA   1  
ATOM 1212   H HB2  . ASN A 1 77  ? 21.719  -8.567  -18.524 1.00 32.45 ? 77  ASN A HB2  1  
ATOM 1213   H HB3  . ASN A 1 77  ? 23.179  -8.262  -19.466 1.00 0.02  ? 77  ASN A HB3  1  
ATOM 1214   H HD21 . ASN A 1 77  ? 25.074  -9.447  -17.615 1.00 14.03 ? 77  ASN A HD21 1  
ATOM 1215   H HD22 . ASN A 1 77  ? 24.798  -11.122 -17.600 1.00 12.01 ? 77  ASN A HD22 1  
ATOM 1216   N N    . PRO A 1 78  ? 23.641  -5.270  -17.129 1.00 23.12 ? 78  PRO A N    1  
ATOM 1217   C CA   . PRO A 1 78  ? 23.441  -3.822  -17.403 1.00 1.33  ? 78  PRO A CA   1  
ATOM 1218   C C    . PRO A 1 78  ? 23.973  -3.441  -18.786 1.00 44.23 ? 78  PRO A C    1  
ATOM 1219   O O    . PRO A 1 78  ? 25.066  -2.933  -18.941 1.00 54.40 ? 78  PRO A O    1  
ATOM 1220   C CB   . PRO A 1 78  ? 24.203  -3.099  -16.263 1.00 31.20 ? 78  PRO A CB   1  
ATOM 1221   C CG   . PRO A 1 78  ? 24.585  -4.170  -15.277 1.00 10.52 ? 78  PRO A CG   1  
ATOM 1222   C CD   . PRO A 1 78  ? 24.606  -5.489  -16.050 1.00 63.22 ? 78  PRO A CD   1  
ATOM 1223   H HA   . PRO A 1 78  ? 22.393  -3.583  -17.351 1.00 71.32 ? 78  PRO A HA   1  
ATOM 1224   H HB2  . PRO A 1 78  ? 25.086  -2.609  -16.645 1.00 24.22 ? 78  PRO A HB2  1  
ATOM 1225   H HB3  . PRO A 1 78  ? 23.561  -2.371  -15.785 1.00 23.41 ? 78  PRO A HB3  1  
ATOM 1226   H HG2  . PRO A 1 78  ? 25.565  -3.965  -14.862 1.00 10.44 ? 78  PRO A HG2  1  
ATOM 1227   H HG3  . PRO A 1 78  ? 23.855  -4.229  -14.482 1.00 30.55 ? 78  PRO A HG3  1  
ATOM 1228   H HD2  . PRO A 1 78  ? 25.592  -5.681  -16.451 1.00 51.42 ? 78  PRO A HD2  1  
ATOM 1229   H HD3  . PRO A 1 78  ? 24.282  -6.302  -15.426 1.00 12.45 ? 78  PRO A HD3  1  
ATOM 1230   N N    . THR A 1 79  ? 23.186  -3.695  -19.791 1.00 62.53 ? 79  THR A N    1  
ATOM 1231   C CA   . THR A 1 79  ? 23.590  -3.367  -21.189 1.00 33.53 ? 79  THR A CA   1  
ATOM 1232   C C    . THR A 1 79  ? 22.853  -2.103  -21.629 1.00 20.01 ? 79  THR A C    1  
ATOM 1233   O O    . THR A 1 79  ? 21.772  -1.808  -21.159 1.00 43.50 ? 79  THR A O    1  
ATOM 1234   C CB   . THR A 1 79  ? 23.209  -4.527  -22.113 1.00 23.20 ? 79  THR A CB   1  
ATOM 1235   O OG1  . THR A 1 79  ? 23.721  -5.740  -21.580 1.00 54.34 ? 79  THR A OG1  1  
ATOM 1236   C CG2  . THR A 1 79  ? 23.798  -4.290  -23.504 1.00 60.10 ? 79  THR A CG2  1  
ATOM 1237   H H    . THR A 1 79  ? 22.316  -4.105  -19.622 1.00 43.40 ? 79  THR A H    1  
ATOM 1238   H HA   . THR A 1 79  ? 24.658  -3.199  -21.241 1.00 3.44  ? 79  THR A HA   1  
ATOM 1239   H HB   . THR A 1 79  ? 22.135  -4.590  -22.187 1.00 51.53 ? 79  THR A HB   1  
ATOM 1240   H HG1  . THR A 1 79  ? 24.574  -5.552  -21.180 1.00 30.12 ? 79  THR A HG1  1  
ATOM 1241   H HG21 . THR A 1 79  ? 23.453  -3.339  -23.884 1.00 11.33 ? 79  THR A HG21 1  
ATOM 1242   H HG22 . THR A 1 79  ? 23.480  -5.079  -24.169 1.00 60.44 ? 79  THR A HG22 1  
ATOM 1243   H HG23 . THR A 1 79  ? 24.876  -4.284  -23.443 1.00 20.32 ? 79  THR A HG23 1  
ATOM 1244   N N    . SER A 1 80  ? 23.429  -1.353  -22.519 1.00 14.23 ? 80  SER A N    1  
ATOM 1245   C CA   . SER A 1 80  ? 22.765  -0.105  -22.982 1.00 73.44 ? 80  SER A CA   1  
ATOM 1246   C C    . SER A 1 80  ? 21.411  -0.442  -23.613 1.00 54.34 ? 80  SER A C    1  
ATOM 1247   O O    . SER A 1 80  ? 20.493  0.354   -23.594 1.00 3.24  ? 80  SER A O    1  
ATOM 1248   C CB   . SER A 1 80  ? 23.665  0.580   -24.013 1.00 35.41 ? 80  SER A CB   1  
ATOM 1249   O OG   . SER A 1 80  ? 23.268  0.195   -25.323 1.00 24.32 ? 80  SER A OG   1  
ATOM 1250   H H    . SER A 1 80  ? 24.303  -1.606  -22.882 1.00 30.53 ? 80  SER A H    1  
ATOM 1251   H HA   . SER A 1 80  ? 22.613  0.554   -22.140 1.00 74.14 ? 80  SER A HA   1  
ATOM 1252   H HB2  . SER A 1 80  ? 23.584  1.648   -23.917 1.00 13.33 ? 80  SER A HB2  1  
ATOM 1253   H HB3  . SER A 1 80  ? 24.690  0.282   -23.837 1.00 54.00 ? 80  SER A HB3  1  
ATOM 1254   H HG   . SER A 1 80  ? 22.647  0.851   -25.650 1.00 41.13 ? 80  SER A HG   1  
ATOM 1255   N N    . GLU A 1 81  ? 21.280  -1.612  -24.175 1.00 2.14  ? 81  GLU A N    1  
ATOM 1256   C CA   . GLU A 1 81  ? 19.985  -1.993  -24.808 1.00 61.54 ? 81  GLU A CA   1  
ATOM 1257   C C    . GLU A 1 81  ? 18.908  -2.159  -23.731 1.00 71.42 ? 81  GLU A C    1  
ATOM 1258   O O    . GLU A 1 81  ? 17.777  -1.747  -23.901 1.00 65.43 ? 81  GLU A O    1  
ATOM 1259   C CB   . GLU A 1 81  ? 20.159  -3.313  -25.562 1.00 60.53 ? 81  GLU A CB   1  
ATOM 1260   C CG   . GLU A 1 81  ? 18.885  -3.626  -26.349 1.00 42.25 ? 81  GLU A CG   1  
ATOM 1261   C CD   . GLU A 1 81  ? 19.047  -4.965  -27.071 1.00 24.42 ? 81  GLU A CD   1  
ATOM 1262   O OE1  . GLU A 1 81  ? 20.102  -5.564  -26.937 1.00 30.23 ? 81  GLU A OE1  1  
ATOM 1263   O OE2  . GLU A 1 81  ? 18.114  -5.369  -27.746 1.00 41.41 ? 81  GLU A OE2  1  
ATOM 1264   H H    . GLU A 1 81  ? 22.032  -2.239  -24.182 1.00 62.04 ? 81  GLU A H    1  
ATOM 1265   H HA   . GLU A 1 81  ? 19.684  -1.222  -25.501 1.00 2.40  ? 81  GLU A HA   1  
ATOM 1266   H HB2  . GLU A 1 81  ? 20.993  -3.230  -26.245 1.00 22.11 ? 81  GLU A HB2  1  
ATOM 1267   H HB3  . GLU A 1 81  ? 20.348  -4.109  -24.857 1.00 2.22  ? 81  GLU A HB3  1  
ATOM 1268   H HG2  . GLU A 1 81  ? 18.047  -3.682  -25.669 1.00 33.22 ? 81  GLU A HG2  1  
ATOM 1269   H HG3  . GLU A 1 81  ? 18.709  -2.847  -27.075 1.00 63.42 ? 81  GLU A HG3  1  
ATOM 1270   N N    . GLU A 1 82  ? 19.246  -2.764  -22.626 1.00 43.21 ? 82  GLU A N    1  
ATOM 1271   C CA   . GLU A 1 82  ? 18.236  -2.958  -21.547 1.00 54.52 ? 82  GLU A CA   1  
ATOM 1272   C C    . GLU A 1 82  ? 17.976  -1.629  -20.833 1.00 73.43 ? 82  GLU A C    1  
ATOM 1273   O O    . GLU A 1 82  ? 16.871  -1.345  -20.414 1.00 51.41 ? 82  GLU A O    1  
ATOM 1274   C CB   . GLU A 1 82  ? 18.754  -3.983  -20.537 1.00 73.21 ? 82  GLU A CB   1  
ATOM 1275   C CG   . GLU A 1 82  ? 17.627  -4.357  -19.572 1.00 11.24 ? 82  GLU A CG   1  
ATOM 1276   C CD   . GLU A 1 82  ? 18.154  -5.338  -18.524 1.00 53.12 ? 82  GLU A CD   1  
ATOM 1277   O OE1  . GLU A 1 82  ? 19.332  -5.651  -18.573 1.00 3.32  ? 82  GLU A OE1  1  
ATOM 1278   O OE2  . GLU A 1 82  ? 17.369  -5.761  -17.691 1.00 34.22 ? 82  GLU A OE2  1  
ATOM 1279   H H    . GLU A 1 82  ? 20.161  -3.094  -22.506 1.00 21.54 ? 82  GLU A H    1  
ATOM 1280   H HA   . GLU A 1 82  ? 17.314  -3.318  -21.980 1.00 61.32 ? 82  GLU A HA   1  
ATOM 1281   H HB2  . GLU A 1 82  ? 19.092  -4.866  -21.060 1.00 54.33 ? 82  GLU A HB2  1  
ATOM 1282   H HB3  . GLU A 1 82  ? 19.575  -3.557  -19.980 1.00 15.23 ? 82  GLU A HB3  1  
ATOM 1283   H HG2  . GLU A 1 82  ? 17.263  -3.466  -19.082 1.00 34.25 ? 82  GLU A HG2  1  
ATOM 1284   H HG3  . GLU A 1 82  ? 16.822  -4.820  -20.123 1.00 32.03 ? 82  GLU A HG3  1  
ATOM 1285   N N    . GLU A 1 83  ? 18.985  -0.817  -20.682 1.00 45.41 ? 83  GLU A N    1  
ATOM 1286   C CA   . GLU A 1 83  ? 18.794  0.487   -19.985 1.00 13.43 ? 83  GLU A CA   1  
ATOM 1287   C C    . GLU A 1 83  ? 17.761  1.333   -20.734 1.00 64.54 ? 83  GLU A C    1  
ATOM 1288   O O    . GLU A 1 83  ? 16.788  1.788   -20.164 1.00 2.12  ? 83  GLU A O    1  
ATOM 1289   C CB   . GLU A 1 83  ? 20.128  1.235   -19.936 1.00 64.01 ? 83  GLU A CB   1  
ATOM 1290   C CG   . GLU A 1 83  ? 19.978  2.492   -19.076 1.00 12.12 ? 83  GLU A CG   1  
ATOM 1291   C CD   . GLU A 1 83  ? 21.304  3.254   -19.049 1.00 15.41 ? 83  GLU A CD   1  
ATOM 1292   O OE1  . GLU A 1 83  ? 22.255  2.769   -19.640 1.00 74.22 ? 83  GLU A OE1  1  
ATOM 1293   O OE2  . GLU A 1 83  ? 21.346  4.308   -18.437 1.00 61.41 ? 83  GLU A OE2  1  
ATOM 1294   H H    . GLU A 1 83  ? 19.870  -1.066  -21.021 1.00 71.41 ? 83  GLU A H    1  
ATOM 1295   H HA   . GLU A 1 83  ? 18.448  0.307   -18.979 1.00 31.41 ? 83  GLU A HA   1  
ATOM 1296   H HB2  . GLU A 1 83  ? 20.884  0.593   -19.508 1.00 42.11 ? 83  GLU A HB2  1  
ATOM 1297   H HB3  . GLU A 1 83  ? 20.419  1.518   -20.936 1.00 23.03 ? 83  GLU A HB3  1  
ATOM 1298   H HG2  . GLU A 1 83  ? 19.207  3.123   -19.494 1.00 34.25 ? 83  GLU A HG2  1  
ATOM 1299   H HG3  . GLU A 1 83  ? 19.706  2.209   -18.070 1.00 32.03 ? 83  GLU A HG3  1  
ATOM 1300   N N    . VAL A 1 84  ? 17.960  1.552   -22.006 1.00 23.53 ? 84  VAL A N    1  
ATOM 1301   C CA   . VAL A 1 84  ? 16.984  2.373   -22.776 1.00 21.42 ? 84  VAL A CA   1  
ATOM 1302   C C    . VAL A 1 84  ? 15.618  1.685   -22.763 1.00 53.34 ? 84  VAL A C    1  
ATOM 1303   O O    . VAL A 1 84  ? 14.591  2.329   -22.672 1.00 73.20 ? 84  VAL A O    1  
ATOM 1304   C CB   . VAL A 1 84  ? 17.468  2.533   -24.219 1.00 54.40 ? 84  VAL A CB   1  
ATOM 1305   C CG1  . VAL A 1 84  ? 18.819  3.251   -24.226 1.00 5.11  ? 84  VAL A CG1  1  
ATOM 1306   C CG2  . VAL A 1 84  ? 17.623  1.155   -24.863 1.00 53.05 ? 84  VAL A CG2  1  
ATOM 1307   H H    . VAL A 1 84  ? 18.750  1.179   -22.451 1.00 14.11 ? 84  VAL A H    1  
ATOM 1308   H HA   . VAL A 1 84  ? 16.898  3.347   -22.317 1.00 13.34 ? 84  VAL A HA   1  
ATOM 1309   H HB   . VAL A 1 84  ? 16.749  3.115   -24.776 1.00 62.13 ? 84  VAL A HB   1  
ATOM 1310   H HG11 . VAL A 1 84  ? 19.507  2.729   -23.577 1.00 2.43  ? 84  VAL A HG11 1  
ATOM 1311   H HG12 . VAL A 1 84  ? 18.690  4.264   -23.875 1.00 5.34  ? 84  VAL A HG12 1  
ATOM 1312   H HG13 . VAL A 1 84  ? 19.213  3.265   -25.231 1.00 74.15 ? 84  VAL A HG13 1  
ATOM 1313   H HG21 . VAL A 1 84  ? 18.098  1.261   -25.828 1.00 22.14 ? 84  VAL A HG21 1  
ATOM 1314   H HG22 . VAL A 1 84  ? 16.650  0.704   -24.989 1.00 45.40 ? 84  VAL A HG22 1  
ATOM 1315   H HG23 . VAL A 1 84  ? 18.232  0.530   -24.229 1.00 2.41  ? 84  VAL A HG23 1  
ATOM 1316   N N    . HIS A 1 85  ? 15.593  0.383   -22.850 1.00 53.33 ? 85  HIS A N    1  
ATOM 1317   C CA   . HIS A 1 85  ? 14.288  -0.336  -22.837 1.00 32.22 ? 85  HIS A CA   1  
ATOM 1318   C C    . HIS A 1 85  ? 13.658  -0.220  -21.446 1.00 31.14 ? 85  HIS A C    1  
ATOM 1319   O O    . HIS A 1 85  ? 12.456  -0.286  -21.292 1.00 43.31 ? 85  HIS A O    1  
ATOM 1320   C CB   . HIS A 1 85  ? 14.511  -1.814  -23.179 1.00 31.13 ? 85  HIS A CB   1  
ATOM 1321   C CG   . HIS A 1 85  ? 14.726  -1.965  -24.662 1.00 3.12  ? 85  HIS A CG   1  
ATOM 1322   N ND1  . HIS A 1 85  ? 15.771  -2.714  -25.187 1.00 51.32 ? 85  HIS A ND1  1  
ATOM 1323   C CD2  . HIS A 1 85  ? 14.038  -1.471  -25.744 1.00 45.21 ? 85  HIS A CD2  1  
ATOM 1324   C CE1  . HIS A 1 85  ? 15.681  -2.650  -26.529 1.00 53.22 ? 85  HIS A CE1  1  
ATOM 1325   N NE2  . HIS A 1 85  ? 14.644  -1.906  -26.917 1.00 4.21  ? 85  HIS A NE2  1  
ATOM 1326   H H    . HIS A 1 85  ? 16.431  -0.122  -22.920 1.00 22.42 ? 85  HIS A H    1  
ATOM 1327   H HA   . HIS A 1 85  ? 13.626  0.109   -23.566 1.00 43.30 ? 85  HIS A HA   1  
ATOM 1328   H HB2  . HIS A 1 85  ? 15.380  -2.177  -22.652 1.00 34.40 ? 85  HIS A HB2  1  
ATOM 1329   H HB3  . HIS A 1 85  ? 13.645  -2.388  -22.883 1.00 72.54 ? 85  HIS A HB3  1  
ATOM 1330   H HD1  . HIS A 1 85  ? 16.449  -3.201  -24.675 1.00 53.55 ? 85  HIS A HD1  1  
ATOM 1331   H HD2  . HIS A 1 85  ? 13.161  -0.843  -25.691 1.00 71.41 ? 85  HIS A HD2  1  
ATOM 1332   H HE1  . HIS A 1 85  ? 16.363  -3.140  -27.208 1.00 23.51 ? 85  HIS A HE1  1  
ATOM 1333   H HE2  . HIS A 1 85  ? 14.367  -1.707  -27.835 1.00 0.00  ? 85  HIS A HE2  1  
ATOM 1334   N N    . ALA A 1 86  ? 14.460  -0.050  -20.431 1.00 0.13  ? 86  ALA A N    1  
ATOM 1335   C CA   . ALA A 1 86  ? 13.903  0.068   -19.053 1.00 22.42 ? 86  ALA A CA   1  
ATOM 1336   C C    . ALA A 1 86  ? 13.136  1.386   -18.919 1.00 64.11 ? 86  ALA A C    1  
ATOM 1337   O O    . ALA A 1 86  ? 12.047  1.432   -18.378 1.00 14.43 ? 86  ALA A O    1  
ATOM 1338   C CB   . ALA A 1 86  ? 15.046  0.038   -18.037 1.00 24.54 ? 86  ALA A CB   1  
ATOM 1339   H H    . ALA A 1 86  ? 15.428  -0.001  -20.574 1.00 4.30  ? 86  ALA A H    1  
ATOM 1340   H HA   . ALA A 1 86  ? 13.233  -0.758  -18.865 1.00 64.22 ? 86  ALA A HA   1  
ATOM 1341   H HB1  . ALA A 1 86  ? 15.663  0.916   -18.163 1.00 30.31 ? 86  ALA A HB1  1  
ATOM 1342   H HB2  . ALA A 1 86  ? 15.644  -0.847  -18.193 1.00 12.13 ? 86  ALA A HB2  1  
ATOM 1343   H HB3  . ALA A 1 86  ? 14.639  0.025   -17.037 1.00 41.52 ? 86  ALA A HB3  1  
ATOM 1344   N N    . PHE A 1 87  ? 13.692  2.460   -19.411 1.00 63.44 ? 87  PHE A N    1  
ATOM 1345   C CA   . PHE A 1 87  ? 12.991  3.770   -19.313 1.00 1.22  ? 87  PHE A CA   1  
ATOM 1346   C C    . PHE A 1 87  ? 11.928  3.850   -20.405 1.00 2.13  ? 87  PHE A C    1  
ATOM 1347   O O    . PHE A 1 87  ? 10.916  4.504   -20.255 1.00 24.23 ? 87  PHE A O    1  
ATOM 1348   C CB   . PHE A 1 87  ? 14.000  4.907   -19.494 1.00 45.30 ? 87  PHE A CB   1  
ATOM 1349   C CG   . PHE A 1 87  ? 14.911  4.966   -18.290 1.00 53.13 ? 87  PHE A CG   1  
ATOM 1350   C CD1  . PHE A 1 87  ? 14.467  5.568   -17.106 1.00 44.31 ? 87  PHE A CD1  1  
ATOM 1351   C CD2  . PHE A 1 87  ? 16.198  4.418   -18.357 1.00 70.24 ? 87  PHE A CD2  1  
ATOM 1352   C CE1  . PHE A 1 87  ? 15.310  5.622   -15.990 1.00 21.22 ? 87  PHE A CE1  1  
ATOM 1353   C CE2  . PHE A 1 87  ? 17.040  4.471   -17.240 1.00 74.34 ? 87  PHE A CE2  1  
ATOM 1354   C CZ   . PHE A 1 87  ? 16.597  5.073   -16.056 1.00 34.42 ? 87  PHE A CZ   1  
ATOM 1355   H H    . PHE A 1 87  ? 14.566  2.405   -19.849 1.00 42.32 ? 87  PHE A H    1  
ATOM 1356   H HA   . PHE A 1 87  ? 12.521  3.856   -18.344 1.00 73.23 ? 87  PHE A HA   1  
ATOM 1357   H HB2  . PHE A 1 87  ? 14.587  4.729   -20.383 1.00 15.11 ? 87  PHE A HB2  1  
ATOM 1358   H HB3  . PHE A 1 87  ? 13.472  5.844   -19.591 1.00 31.01 ? 87  PHE A HB3  1  
ATOM 1359   H HD1  . PHE A 1 87  ? 13.475  5.991   -17.055 1.00 2.31  ? 87  PHE A HD1  1  
ATOM 1360   H HD2  . PHE A 1 87  ? 16.540  3.954   -19.270 1.00 73.00 ? 87  PHE A HD2  1  
ATOM 1361   H HE1  . PHE A 1 87  ? 14.968  6.086   -15.076 1.00 23.02 ? 87  PHE A HE1  1  
ATOM 1362   H HE2  . PHE A 1 87  ? 18.033  4.048   -17.291 1.00 43.35 ? 87  PHE A HE2  1  
ATOM 1363   H HZ   . PHE A 1 87  ? 17.247  5.114   -15.195 1.00 53.04 ? 87  PHE A HZ   1  
ATOM 1364   N N    . GLU A 1 88  ? 12.152  3.186   -21.505 1.00 24.11 ? 88  GLU A N    1  
ATOM 1365   C CA   . GLU A 1 88  ? 11.156  3.222   -22.607 1.00 33.33 ? 88  GLU A CA   1  
ATOM 1366   C C    . GLU A 1 88  ? 9.961   2.342   -22.239 1.00 12.42 ? 88  GLU A C    1  
ATOM 1367   O O    . GLU A 1 88  ? 8.821   2.759   -22.308 1.00 74.14 ? 88  GLU A O    1  
ATOM 1368   C CB   . GLU A 1 88  ? 11.800  2.695   -23.893 1.00 74.42 ? 88  GLU A CB   1  
ATOM 1369   C CG   . GLU A 1 88  ? 10.957  3.112   -25.101 1.00 1.42  ? 88  GLU A CG   1  
ATOM 1370   C CD   . GLU A 1 88  ? 11.096  4.618   -25.325 1.00 73.01 ? 88  GLU A CD   1  
ATOM 1371   O OE1  . GLU A 1 88  ? 12.107  5.167   -24.919 1.00 72.33 ? 88  GLU A OE1  1  
ATOM 1372   O OE2  . GLU A 1 88  ? 10.188  5.198   -25.898 1.00 33.51 ? 88  GLU A OE2  1  
ATOM 1373   H H    . GLU A 1 88  ? 12.976  2.664   -21.604 1.00 23.32 ? 88  GLU A H    1  
ATOM 1374   H HA   . GLU A 1 88  ? 10.827  4.238   -22.756 1.00 22.41 ? 88  GLU A HA   1  
ATOM 1375   H HB2  . GLU A 1 88  ? 12.793  3.102   -23.987 1.00 21.43 ? 88  GLU A HB2  1  
ATOM 1376   H HB3  . GLU A 1 88  ? 11.858  1.617   -23.853 1.00 53.14 ? 88  GLU A HB3  1  
ATOM 1377   H HG2  . GLU A 1 88  ? 11.300  2.583   -25.978 1.00 62.11 ? 88  GLU A HG2  1  
ATOM 1378   H HG3  . GLU A 1 88  ? 9.921   2.871   -24.917 1.00 42.25 ? 88  GLU A HG3  1  
ATOM 1379   N N    . GLN A 1 89  ? 10.218  1.124   -21.853 1.00 23.14 ? 89  GLN A N    1  
ATOM 1380   C CA   . GLN A 1 89  ? 9.104   0.206   -21.483 1.00 70.41 ? 89  GLN A CA   1  
ATOM 1381   C C    . GLN A 1 89  ? 8.292   0.815   -20.339 1.00 21.43 ? 89  GLN A C    1  
ATOM 1382   O O    . GLN A 1 89  ? 7.082   0.898   -20.404 1.00 35.33 ? 89  GLN A O    1  
ATOM 1383   C CB   . GLN A 1 89  ? 9.677   -1.142  -21.041 1.00 34.11 ? 89  GLN A CB   1  
ATOM 1384   C CG   . GLN A 1 89  ? 10.286  -1.859  -22.248 1.00 12.52 ? 89  GLN A CG   1  
ATOM 1385   C CD   . GLN A 1 89  ? 9.167   -2.405  -23.136 1.00 33.33 ? 89  GLN A CD   1  
ATOM 1386   O OE1  . GLN A 1 89  ? 8.721   -1.740  -24.050 1.00 64.13 ? 89  GLN A OE1  1  
ATOM 1387   N NE2  . GLN A 1 89  ? 8.691   -3.598  -22.905 1.00 74.24 ? 89  GLN A NE2  1  
ATOM 1388   H H    . GLN A 1 89  ? 11.146  0.813   -21.812 1.00 44.14 ? 89  GLN A H    1  
ATOM 1389   H HA   . GLN A 1 89  ? 8.462   0.059   -22.339 1.00 62.52 ? 89  GLN A HA   1  
ATOM 1390   H HB2  . GLN A 1 89  ? 10.440  -0.980  -20.293 1.00 71.44 ? 89  GLN A HB2  1  
ATOM 1391   H HB3  . GLN A 1 89  ? 8.887   -1.749  -20.625 1.00 64.43 ? 89  GLN A HB3  1  
ATOM 1392   H HG2  . GLN A 1 89  ? 10.888  -1.162  -22.814 1.00 23.41 ? 89  GLN A HG2  1  
ATOM 1393   H HG3  . GLN A 1 89  ? 10.905  -2.675  -21.908 1.00 63.42 ? 89  GLN A HG3  1  
ATOM 1394   H HE21 . GLN A 1 89  ? 9.051   -4.135  -22.168 1.00 74.32 ? 89  GLN A HE21 1  
ATOM 1395   H HE22 . GLN A 1 89  ? 7.974   -3.957  -23.468 1.00 74.52 ? 89  GLN A HE22 1  
ATOM 1396   N N    . GLY A 1 90  ? 8.943   1.248   -19.290 1.00 61.32 ? 90  GLY A N    1  
ATOM 1397   C CA   . GLY A 1 90  ? 8.196   1.855   -18.146 1.00 51.44 ? 90  GLY A CA   1  
ATOM 1398   C C    . GLY A 1 90  ? 8.916   1.555   -16.829 1.00 61.51 ? 90  GLY A C    1  
ATOM 1399   O O    . GLY A 1 90  ? 8.427   0.808   -16.004 1.00 1.24  ? 90  GLY A O    1  
ATOM 1400   H H    . GLY A 1 90  ? 9.921   1.177   -19.254 1.00 74.21 ? 90  GLY A H    1  
ATOM 1401   H HA2  . GLY A 1 90  ? 8.137   2.925   -18.287 1.00 43.31 ? 90  GLY A HA2  1  
ATOM 1402   H HA3  . GLY A 1 90  ? 7.197   1.444   -18.104 1.00 20.55 ? 90  GLY A HA3  1  
ATOM 1403   N N    . ALA A 1 91  ? 10.070  2.139   -16.620 1.00 13.33 ? 91  ALA A N    1  
ATOM 1404   C CA   . ALA A 1 91  ? 10.829  1.903   -15.350 1.00 55.33 ? 91  ALA A CA   1  
ATOM 1405   C C    . ALA A 1 91  ? 11.326  3.246   -14.809 1.00 2.41  ? 91  ALA A C    1  
ATOM 1406   O O    . ALA A 1 91  ? 11.840  4.066   -15.542 1.00 24.55 ? 91  ALA A O    1  
ATOM 1407   C CB   . ALA A 1 91  ? 12.028  0.994   -15.633 1.00 34.31 ? 91  ALA A CB   1  
ATOM 1408   H H    . ALA A 1 91  ? 10.440  2.740   -17.301 1.00 64.10 ? 91  ALA A H    1  
ATOM 1409   H HA   . ALA A 1 91  ? 10.189  1.437   -14.612 1.00 14.40 ? 91  ALA A HA   1  
ATOM 1410   H HB1  . ALA A 1 91  ? 12.794  1.555   -16.147 1.00 4.22  ? 91  ALA A HB1  1  
ATOM 1411   H HB2  . ALA A 1 91  ? 11.713  0.166   -16.251 1.00 40.42 ? 91  ALA A HB2  1  
ATOM 1412   H HB3  . ALA A 1 91  ? 12.422  0.617   -14.701 1.00 33.41 ? 91  ALA A HB3  1  
ATOM 1413   N N    . ASP A 1 92  ? 11.180  3.480   -13.531 1.00 71.14 ? 92  ASP A N    1  
ATOM 1414   C CA   . ASP A 1 92  ? 11.650  4.772   -12.957 1.00 73.42 ? 92  ASP A CA   1  
ATOM 1415   C C    . ASP A 1 92  ? 13.161  4.704   -12.749 1.00 63.44 ? 92  ASP A C    1  
ATOM 1416   O O    . ASP A 1 92  ? 13.869  5.673   -12.939 1.00 11.14 ? 92  ASP A O    1  
ATOM 1417   C CB   . ASP A 1 92  ? 10.961  5.022   -11.614 1.00 3.52  ? 92  ASP A CB   1  
ATOM 1418   C CG   . ASP A 1 92  ? 9.456   5.189   -11.835 1.00 63.41 ? 92  ASP A CG   1  
ATOM 1419   O OD1  . ASP A 1 92  ? 9.087   5.980   -12.687 1.00 72.32 ? 92  ASP A OD1  1  
ATOM 1420   O OD2  . ASP A 1 92  ? 8.700   4.523   -11.148 1.00 20.14 ? 92  ASP A OD2  1  
ATOM 1421   H H    . ASP A 1 92  ? 10.767  2.806   -12.950 1.00 41.32 ? 92  ASP A H    1  
ATOM 1422   H HA   . ASP A 1 92  ? 11.416  5.576   -13.639 1.00 54.30 ? 92  ASP A HA   1  
ATOM 1423   H HB2  . ASP A 1 92  ? 11.139  4.185   -10.956 1.00 1.23  ? 92  ASP A HB2  1  
ATOM 1424   H HB3  . ASP A 1 92  ? 11.358  5.922   -11.169 1.00 11.01 ? 92  ASP A HB3  1  
ATOM 1425   N N    . ASP A 1 93  ? 13.661  3.562   -12.361 1.00 33.13 ? 93  ASP A N    1  
ATOM 1426   C CA   . ASP A 1 93  ? 15.127  3.423   -12.141 1.00 53.12 ? 93  ASP A CA   1  
ATOM 1427   C C    . ASP A 1 93  ? 15.541  1.964   -12.351 1.00 72.45 ? 93  ASP A C    1  
ATOM 1428   O O    . ASP A 1 93  ? 14.772  1.047   -12.125 1.00 75.04 ? 93  ASP A O    1  
ATOM 1429   C CB   . ASP A 1 93  ? 15.469  3.854   -10.713 1.00 74.33 ? 93  ASP A CB   1  
ATOM 1430   C CG   . ASP A 1 93  ? 16.951  3.590   -10.441 1.00 3.43  ? 93  ASP A CG   1  
ATOM 1431   O OD1  . ASP A 1 93  ? 17.282  2.460   -10.121 1.00 0.02  ? 93  ASP A OD1  1  
ATOM 1432   O OD2  . ASP A 1 93  ? 17.730  4.522   -10.558 1.00 70.32 ? 93  ASP A OD2  1  
ATOM 1433   H H    . ASP A 1 93  ? 13.069  2.794   -12.216 1.00 23.32 ? 93  ASP A H    1  
ATOM 1434   H HA   . ASP A 1 93  ? 15.661  4.049   -12.842 1.00 24.22 ? 93  ASP A HA   1  
ATOM 1435   H HB2  . ASP A 1 93  ? 15.264  4.909   -10.598 1.00 72.01 ? 93  ASP A HB2  1  
ATOM 1436   H HB3  . ASP A 1 93  ? 14.870  3.294   -10.013 1.00 61.31 ? 93  ASP A HB3  1  
ATOM 1437   N N    . TYR A 1 94  ? 16.760  1.750   -12.784 1.00 63.14 ? 94  TYR A N    1  
ATOM 1438   C CA   . TYR A 1 94  ? 17.266  0.361   -13.020 1.00 25.13 ? 94  TYR A CA   1  
ATOM 1439   C C    . TYR A 1 94  ? 18.549  0.158   -12.201 1.00 12.04 ? 94  TYR A C    1  
ATOM 1440   O O    . TYR A 1 94  ? 19.438  0.986   -12.221 1.00 21.44 ? 94  TYR A O    1  
ATOM 1441   C CB   . TYR A 1 94  ? 17.554  0.181   -14.529 1.00 44.23 ? 94  TYR A CB   1  
ATOM 1442   C CG   . TYR A 1 94  ? 18.649  -0.847  -14.737 1.00 2.34  ? 94  TYR A CG   1  
ATOM 1443   C CD1  . TYR A 1 94  ? 18.603  -2.053  -14.035 1.00 71.33 ? 94  TYR A CD1  1  
ATOM 1444   C CD2  . TYR A 1 94  ? 19.719  -0.582  -15.602 1.00 24.21 ? 94  TYR A CD2  1  
ATOM 1445   C CE1  . TYR A 1 94  ? 19.618  -2.996  -14.195 1.00 55.15 ? 94  TYR A CE1  1  
ATOM 1446   C CE2  . TYR A 1 94  ? 20.740  -1.527  -15.757 1.00 4.32  ? 94  TYR A CE2  1  
ATOM 1447   C CZ   . TYR A 1 94  ? 20.686  -2.736  -15.051 1.00 1.23  ? 94  TYR A CZ   1  
ATOM 1448   O OH   . TYR A 1 94  ? 21.690  -3.668  -15.188 1.00 52.23 ? 94  TYR A OH   1  
ATOM 1449   H H    . TYR A 1 94  ? 17.351  2.513   -12.954 1.00 32.22 ? 94  TYR A H    1  
ATOM 1450   H HA   . TYR A 1 94  ? 16.528  -0.363  -12.704 1.00 4.03  ? 94  TYR A HA   1  
ATOM 1451   H HB2  . TYR A 1 94  ? 16.655  -0.150  -15.029 1.00 33.32 ? 94  TYR A HB2  1  
ATOM 1452   H HB3  . TYR A 1 94  ? 17.867  1.127   -14.947 1.00 70.13 ? 94  TYR A HB3  1  
ATOM 1453   H HD1  . TYR A 1 94  ? 17.779  -2.259  -13.373 1.00 53.23 ? 94  TYR A HD1  1  
ATOM 1454   H HD2  . TYR A 1 94  ? 19.756  0.351   -16.146 1.00 3.54  ? 94  TYR A HD2  1  
ATOM 1455   H HE1  . TYR A 1 94  ? 19.579  -3.926  -13.654 1.00 33.42 ? 94  TYR A HE1  1  
ATOM 1456   H HE2  . TYR A 1 94  ? 21.566  -1.326  -16.424 1.00 31.32 ? 94  TYR A HE2  1  
ATOM 1457   H HH   . TYR A 1 94  ? 21.635  -4.274  -14.446 1.00 43.22 ? 94  TYR A HH   1  
ATOM 1458   N N    . ILE A 1 95  ? 18.648  -0.943  -11.487 1.00 64.53 ? 95  ILE A N    1  
ATOM 1459   C CA   . ILE A 1 95  ? 19.881  -1.212  -10.663 1.00 12.23 ? 95  ILE A CA   1  
ATOM 1460   C C    . ILE A 1 95  ? 20.562  -2.509  -11.139 1.00 24.44 ? 95  ILE A C    1  
ATOM 1461   O O    . ILE A 1 95  ? 19.921  -3.520  -11.373 1.00 53.34 ? 95  ILE A O    1  
ATOM 1462   C CB   . ILE A 1 95  ? 19.493  -1.352  -9.165  1.00 43.40 ? 95  ILE A CB   1  
ATOM 1463   C CG1  . ILE A 1 95  ? 18.118  -0.699  -8.920  1.00 15.34 ? 95  ILE A CG1  1  
ATOM 1464   C CG2  . ILE A 1 95  ? 20.550  -0.674  -8.278  1.00 71.13 ? 95  ILE A CG2  1  
ATOM 1465   C CD1  . ILE A 1 95  ? 16.985  -1.644  -9.364  1.00 15.23 ? 95  ILE A CD1  1  
ATOM 1466   H H    . ILE A 1 95  ? 17.907  -1.592  -11.489 1.00 25.40 ? 95  ILE A H    1  
ATOM 1467   H HA   . ILE A 1 95  ? 20.582  -0.394  -10.779 1.00 55.11 ? 95  ILE A HA   1  
ATOM 1468   H HB   . ILE A 1 95  ? 19.438  -2.400  -8.896  1.00 54.45 ? 95  ILE A HB   1  
ATOM 1469   H HG12 . ILE A 1 95  ? 18.005  -0.484  -7.868  1.00 13.12 ? 95  ILE A HG12 1  
ATOM 1470   H HG13 . ILE A 1 95  ? 18.052  0.223   -9.479  1.00 32.11 ? 95  ILE A HG13 1  
ATOM 1471   H HG21 . ILE A 1 95  ? 20.477  -1.058  -7.272  1.00 61.05 ? 95  ILE A HG21 1  
ATOM 1472   H HG22 . ILE A 1 95  ? 20.386  0.394   -8.269  1.00 54.10 ? 95  ILE A HG22 1  
ATOM 1473   H HG23 . ILE A 1 95  ? 21.535  -0.881  -8.670  1.00 73.12 ? 95  ILE A HG23 1  
ATOM 1474   H HD11 . ILE A 1 95  ? 17.378  -2.442  -9.979  1.00 64.14 ? 95  ILE A HD11 1  
ATOM 1475   H HD12 . ILE A 1 95  ? 16.256  -1.088  -9.931  1.00 74.51 ? 95  ILE A HD12 1  
ATOM 1476   H HD13 . ILE A 1 95  ? 16.511  -2.067  -8.490  1.00 14.00 ? 95  ILE A HD13 1  
ATOM 1477   N N    . ALA A 1 96  ? 21.864  -2.500  -11.248 1.00 30.40 ? 96  ALA A N    1  
ATOM 1478   C CA   . ALA A 1 96  ? 22.570  -3.741  -11.662 1.00 42.03 ? 96  ALA A CA   1  
ATOM 1479   C C    . ALA A 1 96  ? 22.235  -4.812  -10.622 1.00 64.32 ? 96  ALA A C    1  
ATOM 1480   O O    . ALA A 1 96  ? 22.491  -4.636  -9.448  1.00 54.13 ? 96  ALA A O    1  
ATOM 1481   C CB   . ALA A 1 96  ? 24.080  -3.494  -11.678 1.00 13.10 ? 96  ALA A CB   1  
ATOM 1482   H H    . ALA A 1 96  ? 22.373  -1.691  -11.030 1.00 40.31 ? 96  ALA A H    1  
ATOM 1483   H HA   . ALA A 1 96  ? 22.235  -4.050  -12.645 1.00 1.41  ? 96  ALA A HA   1  
ATOM 1484   H HB1  . ALA A 1 96  ? 24.434  -3.358  -10.667 1.00 21.14 ? 96  ALA A HB1  1  
ATOM 1485   H HB2  . ALA A 1 96  ? 24.294  -2.606  -12.256 1.00 21.23 ? 96  ALA A HB2  1  
ATOM 1486   H HB3  . ALA A 1 96  ? 24.580  -4.341  -12.123 1.00 52.20 ? 96  ALA A HB3  1  
ATOM 1487   N N    . LYS A 1 97  ? 21.633  -5.898  -11.027 1.00 62.20 ? 97  LYS A N    1  
ATOM 1488   C CA   . LYS A 1 97  ? 21.251  -6.950  -10.035 1.00 13.35 ? 97  LYS A CA   1  
ATOM 1489   C C    . LYS A 1 97  ? 22.350  -7.181  -8.999  1.00 22.33 ? 97  LYS A C    1  
ATOM 1490   O O    . LYS A 1 97  ? 22.079  -7.144  -7.818  1.00 22.10 ? 97  LYS A O    1  
ATOM 1491   C CB   . LYS A 1 97  ? 20.962  -8.296  -10.733 1.00 13.41 ? 97  LYS A CB   1  
ATOM 1492   C CG   . LYS A 1 97  ? 19.851  -9.084  -10.007 1.00 25.42 ? 97  LYS A CG   1  
ATOM 1493   C CD   . LYS A 1 97  ? 20.172  -9.272  -8.509  1.00 4.05  ? 97  LYS A CD   1  
ATOM 1494   C CE   . LYS A 1 97  ? 21.456  -10.113 -8.299  1.00 35.32 ? 97  LYS A CE   1  
ATOM 1495   N NZ   . LYS A 1 97  ? 21.170  -11.192 -7.311  1.00 2.00  ? 97  LYS A NZ   1  
ATOM 1496   H H    . LYS A 1 97  ? 21.407  -6.011  -11.974 1.00 2.30  ? 97  LYS A H    1  
ATOM 1497   H HA   . LYS A 1 97  ? 20.358  -6.617  -9.530  1.00 74.51 ? 97  LYS A HA   1  
ATOM 1498   H HB2  . LYS A 1 97  ? 20.651  -8.104  -11.724 1.00 24.12 ? 97  LYS A HB2  1  
ATOM 1499   H HB3  . LYS A 1 97  ? 21.851  -8.898  -10.767 1.00 21.32 ? 97  LYS A HB3  1  
ATOM 1500   H HG2  . LYS A 1 97  ? 18.919  -8.547  -10.102 1.00 2.22  ? 97  LYS A HG2  1  
ATOM 1501   H HG3  . LYS A 1 97  ? 19.748  -10.054 -10.470 1.00 70.04 ? 97  LYS A HG3  1  
ATOM 1502   H HD2  . LYS A 1 97  ? 20.273  -8.308  -8.038  1.00 23.01 ? 97  LYS A HD2  1  
ATOM 1503   H HD3  . LYS A 1 97  ? 19.354  -9.787  -8.046  1.00 35.32 ? 97  LYS A HD3  1  
ATOM 1504   H HE2  . LYS A 1 97  ? 21.771  -10.565 -9.227  1.00 22.53 ? 97  LYS A HE2  1  
ATOM 1505   H HE3  . LYS A 1 97  ? 22.248  -9.491  -7.916  1.00 60.54 ? 97  LYS A HE3  1  
ATOM 1506   H HZ1  . LYS A 1 97  ? 20.285  -11.672 -7.568  1.00 2.20  ? 97  LYS A HZ1  1  
ATOM 1507   H HZ2  . LYS A 1 97  ? 21.078  -10.777 -6.361  1.00 1.21  ? 97  LYS A HZ2  1  
ATOM 1508   H HZ3  . LYS A 1 97  ? 21.949  -11.881 -7.315  1.00 12.31 ? 97  LYS A HZ3  1  
ATOM 1509   N N    . PRO A 1 98  ? 23.562  -7.495  -9.398  1.00 70.01 ? 98  PRO A N    1  
ATOM 1510   C CA   . PRO A 1 98  ? 24.624  -7.814  -8.429  1.00 4.12  ? 98  PRO A CA   1  
ATOM 1511   C C    . PRO A 1 98  ? 24.592  -6.911  -7.181  1.00 13.34 ? 98  PRO A C    1  
ATOM 1512   O O    . PRO A 1 98  ? 25.237  -7.190  -6.191  1.00 21.24 ? 98  PRO A O    1  
ATOM 1513   C CB   . PRO A 1 98  ? 25.942  -7.660  -9.226  1.00 25.24 ? 98  PRO A CB   1  
ATOM 1514   C CG   . PRO A 1 98  ? 25.535  -7.137  -10.574 1.00 73.11 ? 98  PRO A CG   1  
ATOM 1515   C CD   . PRO A 1 98  ? 24.094  -7.587  -10.767 1.00 60.52 ? 98  PRO A CD   1  
ATOM 1516   H HA   . PRO A 1 98  ? 24.485  -8.842  -8.148  1.00 40.21 ? 98  PRO A HA   1  
ATOM 1517   H HB2  . PRO A 1 98  ? 26.611  -6.962  -8.733  1.00 33.14 ? 98  PRO A HB2  1  
ATOM 1518   H HB3  . PRO A 1 98  ? 26.426  -8.621  -9.335  1.00 63.30 ? 98  PRO A HB3  1  
ATOM 1519   H HG2  . PRO A 1 98  ? 25.594  -6.055  -10.592 1.00 11.10 ? 98  PRO A HG2  1  
ATOM 1520   H HG3  . PRO A 1 98  ? 26.155  -7.558  -11.351 1.00 52.34 ? 98  PRO A HG3  1  
ATOM 1521   H HD2  . PRO A 1 98  ? 23.585  -6.931  -11.448 1.00 2.21  ? 98  PRO A HD2  1  
ATOM 1522   H HD3  . PRO A 1 98  ? 24.071  -8.607  -11.110 1.00 2.01  ? 98  PRO A HD3  1  
ATOM 1523   N N    . TYR A 1 99  ? 23.834  -5.848  -7.232  1.00 25.14 ? 99  TYR A N    1  
ATOM 1524   C CA   . TYR A 1 99  ? 23.716  -4.919  -6.076  1.00 11.20 ? 99  TYR A CA   1  
ATOM 1525   C C    . TYR A 1 99  ? 25.092  -4.344  -5.729  1.00 44.43 ? 99  TYR A C    1  
ATOM 1526   O O    . TYR A 1 99  ? 26.059  -5.068  -5.599  1.00 13.34 ? 99  TYR A O    1  
ATOM 1527   C CB   . TYR A 1 99  ? 23.153  -5.650  -4.850  1.00 45.54 ? 99  TYR A CB   1  
ATOM 1528   C CG   . TYR A 1 99  ? 21.813  -6.269  -5.183  1.00 22.21 ? 99  TYR A CG   1  
ATOM 1529   C CD1  . TYR A 1 99  ? 20.730  -5.449  -5.528  1.00 42.31 ? 99  TYR A CD1  1  
ATOM 1530   C CD2  . TYR A 1 99  ? 21.648  -7.661  -5.138  1.00 65.22 ? 99  TYR A CD2  1  
ATOM 1531   C CE1  . TYR A 1 99  ? 19.487  -6.019  -5.827  1.00 4.20  ? 99  TYR A CE1  1  
ATOM 1532   C CE2  . TYR A 1 99  ? 20.405  -8.229  -5.438  1.00 64.15 ? 99  TYR A CE2  1  
ATOM 1533   C CZ   . TYR A 1 99  ? 19.324  -7.408  -5.782  1.00 25.21 ? 99  TYR A CZ   1  
ATOM 1534   O OH   . TYR A 1 99  ? 18.098  -7.969  -6.077  1.00 53.15 ? 99  TYR A OH   1  
ATOM 1535   H H    . TYR A 1 99  ? 23.324  -5.662  -8.047  1.00 30.21 ? 99  TYR A H    1  
ATOM 1536   H HA   . TYR A 1 99  ? 23.041  -4.125  -6.350  1.00 50.13 ? 99  TYR A HA   1  
ATOM 1537   H HB2  . TYR A 1 99  ? 23.841  -6.418  -4.534  1.00 35.42 ? 99  TYR A HB2  1  
ATOM 1538   H HB3  . TYR A 1 99  ? 23.024  -4.940  -4.046  1.00 32.10 ? 99  TYR A HB3  1  
ATOM 1539   H HD1  . TYR A 1 99  ? 20.854  -4.377  -5.563  1.00 72.54 ? 99  TYR A HD1  1  
ATOM 1540   H HD2  . TYR A 1 99  ? 22.481  -8.295  -4.872  1.00 32.24 ? 99  TYR A HD2  1  
ATOM 1541   H HE1  . TYR A 1 99  ? 18.653  -5.386  -6.092  1.00 12.44 ? 99  TYR A HE1  1  
ATOM 1542   H HE2  . TYR A 1 99  ? 20.279  -9.301  -5.403  1.00 50.12 ? 99  TYR A HE2  1  
ATOM 1543   H HH   . TYR A 1 99  ? 17.736  -8.334  -5.266  1.00 53.15 ? 99  TYR A HH   1  
ATOM 1544   N N    . ARG A 1 100 ? 25.199  -3.052  -5.571  1.00 31.21 ? 100 ARG A N    1  
ATOM 1545   C CA   . ARG A 1 100 ? 26.527  -2.469  -5.228  1.00 31.21 ? 100 ARG A CA   1  
ATOM 1546   C C    . ARG A 1 100 ? 26.859  -2.812  -3.773  1.00 34.40 ? 100 ARG A C    1  
ATOM 1547   O O    . ARG A 1 100 ? 27.982  -3.143  -3.450  1.00 61.10 ? 100 ARG A O    1  
ATOM 1548   C CB   . ARG A 1 100 ? 26.501  -0.934  -5.429  1.00 63.04 ? 100 ARG A CB   1  
ATOM 1549   C CG   . ARG A 1 100 ? 27.909  -0.404  -5.770  1.00 3.22  ? 100 ARG A CG   1  
ATOM 1550   C CD   . ARG A 1 100 ? 27.805  0.999   -6.384  1.00 55.21 ? 100 ARG A CD   1  
ATOM 1551   N NE   . ARG A 1 100 ? 26.927  0.955   -7.587  1.00 72.35 ? 100 ARG A NE   1  
ATOM 1552   C CZ   . ARG A 1 100 ? 27.376  0.450   -8.704  1.00 64.14 ? 100 ARG A CZ   1  
ATOM 1553   N NH1  . ARG A 1 100 ? 28.592  -0.018  -8.767  1.00 41.42 ? 100 ARG A NH1  1  
ATOM 1554   N NH2  . ARG A 1 100 ? 26.608  0.413   -9.758  1.00 71.02 ? 100 ARG A NH2  1  
ATOM 1555   H H    . ARG A 1 100 ? 24.415  -2.474  -5.674  1.00 45.24 ? 100 ARG A H    1  
ATOM 1556   H HA   . ARG A 1 100 ? 27.273  -2.911  -5.868  1.00 72.41 ? 100 ARG A HA   1  
ATOM 1557   H HB2  . ARG A 1 100 ? 25.826  -0.694  -6.231  1.00 62.22 ? 100 ARG A HB2  1  
ATOM 1558   H HB3  . ARG A 1 100 ? 26.154  -0.457  -4.523  1.00 55.22 ? 100 ARG A HB3  1  
ATOM 1559   H HG2  . ARG A 1 100 ? 28.502  -0.357  -4.870  1.00 51.04 ? 100 ARG A HG2  1  
ATOM 1560   H HG3  . ARG A 1 100 ? 28.388  -1.061  -6.481  1.00 1.40  ? 100 ARG A HG3  1  
ATOM 1561   H HD2  . ARG A 1 100 ? 27.391  1.683   -5.662  1.00 54.31 ? 100 ARG A HD2  1  
ATOM 1562   H HD3  . ARG A 1 100 ? 28.790  1.337   -6.672  1.00 23.13 ? 100 ARG A HD3  1  
ATOM 1563   H HE   . ARG A 1 100 ? 26.013  1.305   -7.540  1.00 74.54 ? 100 ARG A HE   1  
ATOM 1564   H HH11 . ARG A 1 100 ? 29.181  0.010   -7.959  1.00 53.11 ? 100 ARG A HH11 1  
ATOM 1565   H HH12 . ARG A 1 100 ? 28.935  -0.405  -9.623  1.00 21.13 ? 100 ARG A HH12 1  
ATOM 1566   H HH21 . ARG A 1 100 ? 25.675  0.772   -9.711  1.00 35.43 ? 100 ARG A HH21 1  
ATOM 1567   H HH22 . ARG A 1 100 ? 26.951  0.027   -10.614 1.00 25.10 ? 100 ARG A HH22 1  
ATOM 1568   N N    . SER A 1 101 ? 25.891  -2.744  -2.894  1.00 13.40 ? 101 SER A N    1  
ATOM 1569   C CA   . SER A 1 101 ? 26.159  -3.071  -1.462  1.00 1.41  ? 101 SER A CA   1  
ATOM 1570   C C    . SER A 1 101 ? 24.848  -3.053  -0.664  1.00 4.34  ? 101 SER A C    1  
ATOM 1571   O O    . SER A 1 101 ? 24.799  -2.525  0.424   1.00 63.11 ? 101 SER A O    1  
ATOM 1572   C CB   . SER A 1 101 ? 27.107  -2.025  -0.881  1.00 55.12 ? 101 SER A CB   1  
ATOM 1573   O OG   . SER A 1 101 ? 28.429  -2.264  -1.345  1.00 71.32 ? 101 SER A OG   1  
ATOM 1574   H H    . SER A 1 101 ? 24.990  -2.481  -3.176  1.00 13.34 ? 101 SER A H    1  
ATOM 1575   H HA   . SER A 1 101 ? 26.614  -4.044  -1.392  1.00 43.31 ? 101 SER A HA   1  
ATOM 1576   H HB2  . SER A 1 101 ? 26.789  -1.059  -1.201  1.00 40.31 ? 101 SER A HB2  1  
ATOM 1577   H HB3  . SER A 1 101 ? 27.083  -2.064  0.198   1.00 74.14 ? 101 SER A HB3  1  
ATOM 1578   H HG   . SER A 1 101 ? 28.433  -2.152  -2.298  1.00 33.03 ? 101 SER A HG   1  
ATOM 1579   N N    . ILE A 1 102 ? 23.794  -3.625  -1.193  1.00 2.23  ? 102 ILE A N    1  
ATOM 1580   C CA   . ILE A 1 102 ? 22.484  -3.643  -0.460  1.00 75.43 ? 102 ILE A CA   1  
ATOM 1581   C C    . ILE A 1 102 ? 22.154  -2.244  0.082   1.00 34.03 ? 102 ILE A C    1  
ATOM 1582   O O    . ILE A 1 102 ? 21.381  -1.516  -0.508  1.00 0.30  ? 102 ILE A O    1  
ATOM 1583   C CB   . ILE A 1 102 ? 22.556  -4.645  0.700   1.00 43.23 ? 102 ILE A CB   1  
ATOM 1584   C CG1  . ILE A 1 102 ? 23.233  -5.939  0.229   1.00 45.42 ? 102 ILE A CG1  1  
ATOM 1585   C CG2  . ILE A 1 102 ? 21.141  -4.963  1.193   1.00 31.15 ? 102 ILE A CG2  1  
ATOM 1586   C CD1  . ILE A 1 102 ? 22.587  -6.432  -1.070  1.00 24.21 ? 102 ILE A CD1  1  
ATOM 1587   H H    . ILE A 1 102 ? 23.863  -4.046  -2.075  1.00 62.23 ? 102 ILE A H    1  
ATOM 1588   H HA   . ILE A 1 102 ? 21.701  -3.946  -1.144  1.00 31.33 ? 102 ILE A HA   1  
ATOM 1589   H HB   . ILE A 1 102 ? 23.126  -4.218  1.511   1.00 11.32 ? 102 ILE A HB   1  
ATOM 1590   H HG12 . ILE A 1 102 ? 24.283  -5.751  0.058   1.00 61.14 ? 102 ILE A HG12 1  
ATOM 1591   H HG13 . ILE A 1 102 ? 23.125  -6.697  0.991   1.00 32.35 ? 102 ILE A HG13 1  
ATOM 1592   H HG21 . ILE A 1 102 ? 20.575  -5.420  0.394   1.00 42.35 ? 102 ILE A HG21 1  
ATOM 1593   H HG22 . ILE A 1 102 ? 20.653  -4.050  1.501   1.00 75.33 ? 102 ILE A HG22 1  
ATOM 1594   H HG23 . ILE A 1 102 ? 21.194  -5.642  2.031   1.00 4.42  ? 102 ILE A HG23 1  
ATOM 1595   H HD11 . ILE A 1 102 ? 22.984  -5.872  -1.902  1.00 0.42  ? 102 ILE A HD11 1  
ATOM 1596   H HD12 . ILE A 1 102 ? 21.518  -6.293  -1.019  1.00 44.45 ? 102 ILE A HD12 1  
ATOM 1597   H HD13 . ILE A 1 102 ? 22.808  -7.481  -1.205  1.00 21.40 ? 102 ILE A HD13 1  
ATOM 1598   N N    . LYS A 1 103 ? 22.735  -1.861  1.194   1.00 31.15 ? 103 LYS A N    1  
ATOM 1599   C CA   . LYS A 1 103 ? 22.463  -0.510  1.769   1.00 71.41 ? 103 LYS A CA   1  
ATOM 1600   C C    . LYS A 1 103 ? 22.486  0.529   0.646   1.00 63.41 ? 103 LYS A C    1  
ATOM 1601   O O    . LYS A 1 103 ? 21.753  1.496   0.667   1.00 12.13 ? 103 LYS A O    1  
ATOM 1602   C CB   . LYS A 1 103 ? 23.549  -0.174  2.799   1.00 21.52 ? 103 LYS A CB   1  
ATOM 1603   C CG   . LYS A 1 103 ? 23.179  1.105   3.572   1.00 54.15 ? 103 LYS A CG   1  
ATOM 1604   C CD   . LYS A 1 103 ? 22.224  0.777   4.728   1.00 43.44 ? 103 LYS A CD   1  
ATOM 1605   C CE   . LYS A 1 103 ? 22.059  2.013   5.614   1.00 5.42  ? 103 LYS A CE   1  
ATOM 1606   N NZ   . LYS A 1 103 ? 23.380  2.390   6.192   1.00 52.02 ? 103 LYS A NZ   1  
ATOM 1607   H H    . LYS A 1 103 ? 23.358  -2.462  1.650   1.00 13.51 ? 103 LYS A H    1  
ATOM 1608   H HA   . LYS A 1 103 ? 21.495  -0.508  2.245   1.00 31.35 ? 103 LYS A HA   1  
ATOM 1609   H HB2  . LYS A 1 103 ? 23.654  -1.000  3.488   1.00 63.35 ? 103 LYS A HB2  1  
ATOM 1610   H HB3  . LYS A 1 103 ? 24.486  -0.020  2.286   1.00 71.42 ? 103 LYS A HB3  1  
ATOM 1611   H HG2  . LYS A 1 103 ? 24.079  1.551   3.972   1.00 22.51 ? 103 LYS A HG2  1  
ATOM 1612   H HG3  . LYS A 1 103 ? 22.702  1.808   2.904   1.00 2.43  ? 103 LYS A HG3  1  
ATOM 1613   H HD2  . LYS A 1 103 ? 21.262  0.488   4.332   1.00 32.53 ? 103 LYS A HD2  1  
ATOM 1614   H HD3  . LYS A 1 103 ? 22.629  -0.031  5.318   1.00 41.33 ? 103 LYS A HD3  1  
ATOM 1615   H HE2  . LYS A 1 103 ? 21.678  2.832   5.023   1.00 25.00 ? 103 LYS A HE2  1  
ATOM 1616   H HE3  . LYS A 1 103 ? 21.367  1.793   6.413   1.00 50.24 ? 103 LYS A HE3  1  
ATOM 1617   H HZ1  . LYS A 1 103 ? 23.234  2.947   7.057   1.00 31.00 ? 103 LYS A HZ1  1  
ATOM 1618   H HZ2  . LYS A 1 103 ? 23.912  2.956   5.499   1.00 74.14 ? 103 LYS A HZ2  1  
ATOM 1619   H HZ3  . LYS A 1 103 ? 23.916  1.530   6.422   1.00 71.53 ? 103 LYS A HZ3  1  
ATOM 1620   N N    . ALA A 1 104 ? 23.312  0.324   -0.344  1.00 51.34 ? 104 ALA A N    1  
ATOM 1621   C CA   . ALA A 1 104 ? 23.361  1.291   -1.476  1.00 3.23  ? 104 ALA A CA   1  
ATOM 1622   C C    . ALA A 1 104 ? 21.997  1.295   -2.167  1.00 54.13 ? 104 ALA A C    1  
ATOM 1623   O O    . ALA A 1 104 ? 21.446  2.331   -2.485  1.00 63.24 ? 104 ALA A O    1  
ATOM 1624   C CB   . ALA A 1 104 ? 24.435  0.858   -2.474  1.00 24.52 ? 104 ALA A CB   1  
ATOM 1625   H H    . ALA A 1 104 ? 23.888  -0.473  -0.349  1.00 21.32 ? 104 ALA A H    1  
ATOM 1626   H HA   . ALA A 1 104 ? 23.587  2.280   -1.104  1.00 41.23 ? 104 ALA A HA   1  
ATOM 1627   H HB1  . ALA A 1 104 ? 24.625  1.662   -3.170  1.00 54.15 ? 104 ALA A HB1  1  
ATOM 1628   H HB2  . ALA A 1 104 ? 24.094  -0.013  -3.015  1.00 21.30 ? 104 ALA A HB2  1  
ATOM 1629   H HB3  . ALA A 1 104 ? 25.341  0.620   -1.943  1.00 50.23 ? 104 ALA A HB3  1  
ATOM 1630   N N    . LEU A 1 105 ? 21.450  0.132   -2.390  1.00 73.11 ? 105 LEU A N    1  
ATOM 1631   C CA   . LEU A 1 105 ? 20.119  0.037   -3.050  1.00 34.52 ? 105 LEU A CA   1  
ATOM 1632   C C    . LEU A 1 105 ? 19.055  0.642   -2.128  1.00 73.22 ? 105 LEU A C    1  
ATOM 1633   O O    . LEU A 1 105 ? 18.260  1.464   -2.537  1.00 13.44 ? 105 LEU A O    1  
ATOM 1634   C CB   . LEU A 1 105 ? 19.811  -1.443  -3.320  1.00 50.14 ? 105 LEU A CB   1  
ATOM 1635   C CG   . LEU A 1 105 ? 18.359  -1.618  -3.776  1.00 52.11 ? 105 LEU A CG   1  
ATOM 1636   C CD1  . LEU A 1 105 ? 18.050  -0.659  -4.932  1.00 2.40  ? 105 LEU A CD1  1  
ATOM 1637   C CD2  . LEU A 1 105 ? 18.154  -3.062  -4.245  1.00 43.22 ? 105 LEU A CD2  1  
ATOM 1638   H H    . LEU A 1 105 ? 21.916  -0.685  -2.116  1.00 52.13 ? 105 LEU A H    1  
ATOM 1639   H HA   . LEU A 1 105 ? 20.141  0.579   -3.984  1.00 0.12  ? 105 LEU A HA   1  
ATOM 1640   H HB2  . LEU A 1 105 ? 20.473  -1.809  -4.090  1.00 63.14 ? 105 LEU A HB2  1  
ATOM 1641   H HB3  . LEU A 1 105 ? 19.970  -2.010  -2.415  1.00 30.22 ? 105 LEU A HB3  1  
ATOM 1642   H HG   . LEU A 1 105 ? 17.697  -1.414  -2.949  1.00 41.14 ? 105 LEU A HG   1  
ATOM 1643   H HD11 . LEU A 1 105 ? 18.883  -0.639  -5.617  1.00 34.52 ? 105 LEU A HD11 1  
ATOM 1644   H HD12 . LEU A 1 105 ? 17.881  0.333   -4.543  1.00 73.10 ? 105 LEU A HD12 1  
ATOM 1645   H HD13 . LEU A 1 105 ? 17.164  -0.993  -5.454  1.00 45.12 ? 105 LEU A HD13 1  
ATOM 1646   H HD21 . LEU A 1 105 ? 18.762  -3.247  -5.118  1.00 0.42  ? 105 LEU A HD21 1  
ATOM 1647   H HD22 . LEU A 1 105 ? 17.113  -3.216  -4.492  1.00 14.03 ? 105 LEU A HD22 1  
ATOM 1648   H HD23 . LEU A 1 105 ? 18.441  -3.741  -3.456  1.00 53.23 ? 105 LEU A HD23 1  
ATOM 1649   N N    . VAL A 1 106 ? 19.039  0.249   -0.883  1.00 43.43 ? 106 VAL A N    1  
ATOM 1650   C CA   . VAL A 1 106 ? 18.029  0.811   0.059   1.00 13.30 ? 106 VAL A CA   1  
ATOM 1651   C C    . VAL A 1 106 ? 18.209  2.325   0.152   1.00 11.13 ? 106 VAL A C    1  
ATOM 1652   O O    . VAL A 1 106 ? 17.251  3.070   0.196   1.00 31.03 ? 106 VAL A O    1  
ATOM 1653   C CB   . VAL A 1 106 ? 18.218  0.191   1.443   1.00 60.11 ? 106 VAL A CB   1  
ATOM 1654   C CG1  . VAL A 1 106 ? 17.189  0.781   2.409   1.00 22.11 ? 106 VAL A CG1  1  
ATOM 1655   C CG2  . VAL A 1 106 ? 18.022  -1.325  1.354   1.00 13.32 ? 106 VAL A CG2  1  
ATOM 1656   H H    . VAL A 1 106 ? 19.692  -0.409  -0.567  1.00 33.23 ? 106 VAL A H    1  
ATOM 1657   H HA   . VAL A 1 106 ? 17.034  0.591   -0.302  1.00 24.41 ? 106 VAL A HA   1  
ATOM 1658   H HB   . VAL A 1 106 ? 19.214  0.407   1.802   1.00 74.54 ? 106 VAL A HB   1  
ATOM 1659   H HG11 . VAL A 1 106 ? 17.418  1.821   2.588   1.00 61.31 ? 106 VAL A HG11 1  
ATOM 1660   H HG12 . VAL A 1 106 ? 17.221  0.241   3.342   1.00 2.42  ? 106 VAL A HG12 1  
ATOM 1661   H HG13 . VAL A 1 106 ? 16.202  0.699   1.979   1.00 24.51 ? 106 VAL A HG13 1  
ATOM 1662   H HG21 . VAL A 1 106 ? 18.884  -1.772  0.882   1.00 13.05 ? 106 VAL A HG21 1  
ATOM 1663   H HG22 . VAL A 1 106 ? 17.140  -1.540  0.769   1.00 45.33 ? 106 VAL A HG22 1  
ATOM 1664   H HG23 . VAL A 1 106 ? 17.903  -1.732  2.347   1.00 34.02 ? 106 VAL A HG23 1  
ATOM 1665   N N    . ALA A 1 107 ? 19.427  2.791   0.179   1.00 53.54 ? 107 ALA A N    1  
ATOM 1666   C CA   . ALA A 1 107 ? 19.653  4.260   0.263   1.00 11.34 ? 107 ALA A CA   1  
ATOM 1667   C C    . ALA A 1 107 ? 18.923  4.939   -0.894  1.00 70.42 ? 107 ALA A C    1  
ATOM 1668   O O    . ALA A 1 107 ? 18.310  5.976   -0.734  1.00 14.32 ? 107 ALA A O    1  
ATOM 1669   C CB   . ALA A 1 107 ? 21.152  4.555   0.168   1.00 54.12 ? 107 ALA A CB   1  
ATOM 1670   H H    . ALA A 1 107 ? 20.189  2.177   0.140   1.00 3.10  ? 107 ALA A H    1  
ATOM 1671   H HA   . ALA A 1 107 ? 19.269  4.632   1.202   1.00 34.32 ? 107 ALA A HA   1  
ATOM 1672   H HB1  . ALA A 1 107 ? 21.530  4.196   -0.778  1.00 63.43 ? 107 ALA A HB1  1  
ATOM 1673   H HB2  . ALA A 1 107 ? 21.669  4.057   0.975   1.00 15.23 ? 107 ALA A HB2  1  
ATOM 1674   H HB3  . ALA A 1 107 ? 21.314  5.620   0.240   1.00 75.50 ? 107 ALA A HB3  1  
ATOM 1675   N N    . ARG A 1 108 ? 18.979  4.355   -2.060  1.00 73.53 ? 108 ARG A N    1  
ATOM 1676   C CA   . ARG A 1 108 ? 18.282  4.957   -3.230  1.00 52.41 ? 108 ARG A CA   1  
ATOM 1677   C C    . ARG A 1 108 ? 16.765  4.860   -3.013  1.00 71.42 ? 108 ARG A C    1  
ATOM 1678   O O    . ARG A 1 108 ? 16.012  5.726   -3.413  1.00 23.13 ? 108 ARG A O    1  
ATOM 1679   C CB   . ARG A 1 108 ? 18.689  4.190   -4.504  1.00 11.15 ? 108 ARG A CB   1  
ATOM 1680   C CG   . ARG A 1 108 ? 18.613  5.109   -5.737  1.00 4.10  ? 108 ARG A CG   1  
ATOM 1681   C CD   . ARG A 1 108 ? 17.164  5.562   -5.990  1.00 74.41 ? 108 ARG A CD   1  
ATOM 1682   N NE   . ARG A 1 108 ? 16.933  6.873   -5.317  1.00 62.42 ? 108 ARG A NE   1  
ATOM 1683   C CZ   . ARG A 1 108 ? 17.299  7.983   -5.900  1.00 72.34 ? 108 ARG A CZ   1  
ATOM 1684   N NH1  . ARG A 1 108 ? 17.868  7.948   -7.075  1.00 4.34  ? 108 ARG A NH1  1  
ATOM 1685   N NH2  . ARG A 1 108 ? 17.098  9.128   -5.308  1.00 63.04 ? 108 ARG A NH2  1  
ATOM 1686   H H    . ARG A 1 108 ? 19.476  3.516   -2.164  1.00 64.21 ? 108 ARG A H    1  
ATOM 1687   H HA   . ARG A 1 108 ? 18.567  5.995   -3.321  1.00 42.42 ? 108 ARG A HA   1  
ATOM 1688   H HB2  . ARG A 1 108 ? 19.702  3.833   -4.392  1.00 41.24 ? 108 ARG A HB2  1  
ATOM 1689   H HB3  . ARG A 1 108 ? 18.030  3.345   -4.649  1.00 31.04 ? 108 ARG A HB3  1  
ATOM 1690   H HG2  . ARG A 1 108 ? 19.234  5.978   -5.571  1.00 13.42 ? 108 ARG A HG2  1  
ATOM 1691   H HG3  . ARG A 1 108 ? 18.978  4.571   -6.601  1.00 53.40 ? 108 ARG A HG3  1  
ATOM 1692   H HD2  . ARG A 1 108 ? 16.999  5.672   -7.054  1.00 71.24 ? 108 ARG A HD2  1  
ATOM 1693   H HD3  . ARG A 1 108 ? 16.472  4.829   -5.599  1.00 23.12 ? 108 ARG A HD3  1  
ATOM 1694   H HE   . ARG A 1 108 ? 16.506  6.901   -4.436  1.00 3.01  ? 108 ARG A HE   1  
ATOM 1695   H HH11 . ARG A 1 108 ? 18.024  7.072   -7.529  1.00 3.41  ? 108 ARG A HH11 1  
ATOM 1696   H HH12 . ARG A 1 108 ? 18.144  8.799   -7.521  1.00 65.05 ? 108 ARG A HH12 1  
ATOM 1697   H HH21 . ARG A 1 108 ? 16.662  9.156   -4.408  1.00 30.24 ? 108 ARG A HH21 1  
ATOM 1698   H HH22 . ARG A 1 108 ? 17.379  9.978   -5.753  1.00 72.23 ? 108 ARG A HH22 1  
ATOM 1699   N N    . ILE A 1 109 ? 16.313  3.812   -2.375  1.00 33.02 ? 109 ILE A N    1  
ATOM 1700   C CA   . ILE A 1 109 ? 14.854  3.662   -2.131  1.00 2.21  ? 109 ILE A CA   1  
ATOM 1701   C C    . ILE A 1 109 ? 14.437  4.611   -1.012  1.00 55.23 ? 109 ILE A C    1  
ATOM 1702   O O    . ILE A 1 109 ? 13.316  5.077   -0.961  1.00 62.54 ? 109 ILE A O    1  
ATOM 1703   C CB   . ILE A 1 109 ? 14.542  2.218   -1.729  1.00 55.10 ? 109 ILE A CB   1  
ATOM 1704   C CG1  . ILE A 1 109 ? 14.953  1.278   -2.869  1.00 3.41  ? 109 ILE A CG1  1  
ATOM 1705   C CG2  . ILE A 1 109 ? 13.040  2.078   -1.465  1.00 1.43  ? 109 ILE A CG2  1  
ATOM 1706   C CD1  . ILE A 1 109 ? 14.800  -0.179  -2.424  1.00 44.34 ? 109 ILE A CD1  1  
ATOM 1707   H H    . ILE A 1 109 ? 16.933  3.130   -2.050  1.00 41.40 ? 109 ILE A H    1  
ATOM 1708   H HA   . ILE A 1 109 ? 14.315  3.907   -3.031  1.00 21.35 ? 109 ILE A HA   1  
ATOM 1709   H HB   . ILE A 1 109 ? 15.090  1.967   -0.834  1.00 32.23 ? 109 ILE A HB   1  
ATOM 1710   H HG12 . ILE A 1 109 ? 14.323  1.460   -3.727  1.00 14.24 ? 109 ILE A HG12 1  
ATOM 1711   H HG13 . ILE A 1 109 ? 15.983  1.465   -3.133  1.00 73.24 ? 109 ILE A HG13 1  
ATOM 1712   H HG21 . ILE A 1 109 ? 12.775  2.644   -0.584  1.00 14.22 ? 109 ILE A HG21 1  
ATOM 1713   H HG22 . ILE A 1 109 ? 12.794  1.038   -1.311  1.00 60.41 ? 109 ILE A HG22 1  
ATOM 1714   H HG23 . ILE A 1 109 ? 12.489  2.456   -2.314  1.00 14.13 ? 109 ILE A HG23 1  
ATOM 1715   H HD11 . ILE A 1 109 ? 15.358  -0.819  -3.093  1.00 31.31 ? 109 ILE A HD11 1  
ATOM 1716   H HD12 . ILE A 1 109 ? 13.757  -0.456  -2.450  1.00 21.22 ? 109 ILE A HD12 1  
ATOM 1717   H HD13 . ILE A 1 109 ? 15.178  -0.294  -1.419  1.00 13.32 ? 109 ILE A HD13 1  
ATOM 1718   N N    . GLU A 1 110 ? 15.335  4.900   -0.113  1.00 52.12 ? 110 GLU A N    1  
ATOM 1719   C CA   . GLU A 1 110 ? 14.995  5.818   1.003   1.00 4.11  ? 110 GLU A CA   1  
ATOM 1720   C C    . GLU A 1 110 ? 14.969  7.257   0.489   1.00 45.21 ? 110 GLU A C    1  
ATOM 1721   O O    . GLU A 1 110 ? 13.974  7.946   0.596   1.00 74.34 ? 110 GLU A O    1  
ATOM 1722   C CB   . GLU A 1 110 ? 16.042  5.685   2.111   1.00 1.51  ? 110 GLU A CB   1  
ATOM 1723   C CG   . GLU A 1 110 ? 15.756  6.700   3.219   1.00 51.31 ? 110 GLU A CG   1  
ATOM 1724   C CD   . GLU A 1 110 ? 16.653  6.405   4.423   1.00 2.21  ? 110 GLU A CD   1  
ATOM 1725   O OE1  . GLU A 1 110 ? 17.528  5.566   4.293   1.00 4.21  ? 110 GLU A OE1  1  
ATOM 1726   O OE2  . GLU A 1 110 ? 16.448  7.023   5.455   1.00 65.15 ? 110 GLU A OE2  1  
ATOM 1727   H H    . GLU A 1 110 ? 16.233  4.513   -0.174  1.00 3.43  ? 110 GLU A H    1  
ATOM 1728   H HA   . GLU A 1 110 ? 14.026  5.555   1.390   1.00 23.12 ? 110 GLU A HA   1  
ATOM 1729   H HB2  . GLU A 1 110 ? 16.004  4.689   2.521   1.00 3.05  ? 110 GLU A HB2  1  
ATOM 1730   H HB3  . GLU A 1 110 ? 17.024  5.869   1.702   1.00 21.33 ? 110 GLU A HB3  1  
ATOM 1731   H HG2  . GLU A 1 110 ? 15.961  7.697   2.855   1.00 54.15 ? 110 GLU A HG2  1  
ATOM 1732   H HG3  . GLU A 1 110 ? 14.721  6.629   3.516   1.00 41.55 ? 110 GLU A HG3  1  
ATOM 1733   N N    . ALA A 1 111 ? 16.054  7.715   -0.072  1.00 12.40 ? 111 ALA A N    1  
ATOM 1734   C CA   . ALA A 1 111 ? 16.092  9.110   -0.592  1.00 73.32 ? 111 ALA A CA   1  
ATOM 1735   C C    . ALA A 1 111 ? 14.866  9.356   -1.471  1.00 13.10 ? 111 ALA A C    1  
ATOM 1736   O O    . ALA A 1 111 ? 14.207  10.371  -1.365  1.00 10.33 ? 111 ALA A O    1  
ATOM 1737   C CB   . ALA A 1 111 ? 17.362  9.310   -1.421  1.00 24.12 ? 111 ALA A CB   1  
ATOM 1738   H H    . ALA A 1 111 ? 16.845  7.141   -0.151  1.00 72.42 ? 111 ALA A H    1  
ATOM 1739   H HA   . ALA A 1 111 ? 16.087  9.804   0.235   1.00 62.10 ? 111 ALA A HA   1  
ATOM 1740   H HB1  . ALA A 1 111 ? 17.451  8.511   -2.141  1.00 23.40 ? 111 ALA A HB1  1  
ATOM 1741   H HB2  . ALA A 1 111 ? 18.222  9.304   -0.768  1.00 41.12 ? 111 ALA A HB2  1  
ATOM 1742   H HB3  . ALA A 1 111 ? 17.309  10.257  -1.938  1.00 44.04 ? 111 ALA A HB3  1  
ATOM 1743   N N    . ARG A 1 112 ? 14.553  8.433   -2.338  1.00 41.13 ? 112 ARG A N    1  
ATOM 1744   C CA   . ARG A 1 112 ? 13.368  8.617   -3.218  1.00 12.40 ? 112 ARG A CA   1  
ATOM 1745   C C    . ARG A 1 112 ? 12.096  8.643   -2.366  1.00 40.03 ? 112 ARG A C    1  
ATOM 1746   O O    . ARG A 1 112 ? 11.149  9.338   -2.677  1.00 13.34 ? 112 ARG A O    1  
ATOM 1747   C CB   . ARG A 1 112 ? 13.291  7.463   -4.220  1.00 11.52 ? 112 ARG A CB   1  
ATOM 1748   C CG   . ARG A 1 112 ? 12.154  7.724   -5.210  1.00 3.54  ? 112 ARG A CG   1  
ATOM 1749   C CD   . ARG A 1 112 ? 12.197  6.677   -6.324  1.00 2.21  ? 112 ARG A CD   1  
ATOM 1750   N NE   . ARG A 1 112 ? 13.434  6.866   -7.133  1.00 52.41 ? 112 ARG A NE   1  
ATOM 1751   C CZ   . ARG A 1 112 ? 13.492  7.817   -8.025  1.00 41.24 ? 112 ARG A CZ   1  
ATOM 1752   N NH1  . ARG A 1 112 ? 12.465  8.602   -8.211  1.00 31.33 ? 112 ARG A NH1  1  
ATOM 1753   N NH2  . ARG A 1 112 ? 14.576  7.983   -8.732  1.00 31.12 ? 112 ARG A NH2  1  
ATOM 1754   H H    . ARG A 1 112 ? 15.097  7.619   -2.408  1.00 72.12 ? 112 ARG A H    1  
ATOM 1755   H HA   . ARG A 1 112 ? 13.461  9.550   -3.753  1.00 54.04 ? 112 ARG A HA   1  
ATOM 1756   H HB2  . ARG A 1 112 ? 14.226  7.388   -4.755  1.00 24.12 ? 112 ARG A HB2  1  
ATOM 1757   H HB3  . ARG A 1 112 ? 13.102  6.540   -3.693  1.00 55.12 ? 112 ARG A HB3  1  
ATOM 1758   H HG2  . ARG A 1 112 ? 11.207  7.663   -4.694  1.00 74.23 ? 112 ARG A HG2  1  
ATOM 1759   H HG3  . ARG A 1 112 ? 12.268  8.708   -5.638  1.00 2.42  ? 112 ARG A HG3  1  
ATOM 1760   H HD2  . ARG A 1 112 ? 12.199  5.689   -5.890  1.00 74.42 ? 112 ARG A HD2  1  
ATOM 1761   H HD3  . ARG A 1 112 ? 11.331  6.791   -6.959  1.00 2.42  ? 112 ARG A HD3  1  
ATOM 1762   H HE   . ARG A 1 112 ? 14.204  6.277   -6.995  1.00 52.15 ? 112 ARG A HE   1  
ATOM 1763   H HH11 . ARG A 1 112 ? 11.634  8.475   -7.669  1.00 72.53 ? 112 ARG A HH11 1  
ATOM 1764   H HH12 . ARG A 1 112 ? 12.510  9.330   -8.894  1.00 44.43 ? 112 ARG A HH12 1  
ATOM 1765   H HH21 . ARG A 1 112 ? 15.362  7.382   -8.590  1.00 51.11 ? 112 ARG A HH21 1  
ATOM 1766   H HH22 . ARG A 1 112 ? 14.621  8.712   -9.415  1.00 51.43 ? 112 ARG A HH22 1  
ATOM 1767   N N    . LEU A 1 113 ? 12.066  7.886   -1.293  1.00 54.11 ? 113 LEU A N    1  
ATOM 1768   C CA   . LEU A 1 113 ? 10.852  7.854   -0.412  1.00 25.25 ? 113 LEU A CA   1  
ATOM 1769   C C    . LEU A 1 113 ? 11.267  7.977   1.057   1.00 35.15 ? 113 LEU A C    1  
ATOM 1770   O O    . LEU A 1 113 ? 11.229  7.018   1.801   1.00 33.32 ? 113 LEU A O    1  
ATOM 1771   C CB   . LEU A 1 113 ? 10.115  6.524   -0.604  1.00 63.10 ? 113 LEU A CB   1  
ATOM 1772   C CG   . LEU A 1 113 ? 9.773   6.318   -2.084  1.00 13.51 ? 113 LEU A CG   1  
ATOM 1773   C CD1  . LEU A 1 113 ? 9.317   4.873   -2.298  1.00 65.24 ? 113 LEU A CD1  1  
ATOM 1774   C CD2  . LEU A 1 113 ? 8.648   7.275   -2.508  1.00 0.43  ? 113 LEU A CD2  1  
ATOM 1775   H H    . LEU A 1 113 ? 12.843  7.332   -1.068  1.00 53.03 ? 113 LEU A H    1  
ATOM 1776   H HA   . LEU A 1 113 ? 10.188  8.671   -0.660  1.00 45.31 ? 113 LEU A HA   1  
ATOM 1777   H HB2  . LEU A 1 113 ? 10.750  5.716   -0.269  1.00 3.24  ? 113 LEU A HB2  1  
ATOM 1778   H HB3  . LEU A 1 113 ? 9.207   6.529   -0.021  1.00 50.03 ? 113 LEU A HB3  1  
ATOM 1779   H HG   . LEU A 1 113 ? 10.652  6.506   -2.682  1.00 1.11  ? 113 LEU A HG   1  
ATOM 1780   H HD11 . LEU A 1 113 ? 8.595   4.608   -1.539  1.00 74.33 ? 113 LEU A HD11 1  
ATOM 1781   H HD12 . LEU A 1 113 ? 10.169  4.212   -2.230  1.00 22.42 ? 113 LEU A HD12 1  
ATOM 1782   H HD13 . LEU A 1 113 ? 8.865   4.778   -3.274  1.00 0.22  ? 113 LEU A HD13 1  
ATOM 1783   H HD21 . LEU A 1 113 ? 9.051   8.267   -2.644  1.00 73.42 ? 113 LEU A HD21 1  
ATOM 1784   H HD22 . LEU A 1 113 ? 7.883   7.299   -1.747  1.00 22.25 ? 113 LEU A HD22 1  
ATOM 1785   H HD23 . LEU A 1 113 ? 8.217   6.934   -3.438  1.00 31.12 ? 113 LEU A HD23 1  
ATOM 1786   N N    . ARG A 1 114 ? 11.645  9.151   1.487   1.00 32.33 ? 114 ARG A N    1  
ATOM 1787   C CA   . ARG A 1 114 ? 12.041  9.331   2.918   1.00 11.12 ? 114 ARG A CA   1  
ATOM 1788   C C    . ARG A 1 114 ? 10.778  9.600   3.743   1.00 23.33 ? 114 ARG A C    1  
ATOM 1789   O O    . ARG A 1 114 ? 10.272  8.729   4.422   1.00 51.35 ? 114 ARG A O    1  
ATOM 1790   C CB   . ARG A 1 114 ? 13.023  10.520  3.041   1.00 2.31  ? 114 ARG A CB   1  
ATOM 1791   C CG   . ARG A 1 114 ? 14.474  10.017  3.069   1.00 33.21 ? 114 ARG A CG   1  
ATOM 1792   C CD   . ARG A 1 114 ? 15.419  11.195  3.310   1.00 53.41 ? 114 ARG A CD   1  
ATOM 1793   N NE   . ARG A 1 114 ? 15.031  12.334  2.432   1.00 34.44 ? 114 ARG A NE   1  
ATOM 1794   C CZ   . ARG A 1 114 ? 15.620  13.491  2.568   1.00 55.14 ? 114 ARG A CZ   1  
ATOM 1795   N NH1  . ARG A 1 114 ? 16.547  13.648  3.473   1.00 42.03 ? 114 ARG A NH1  1  
ATOM 1796   N NH2  . ARG A 1 114 ? 15.281  14.489  1.800   1.00 64.45 ? 114 ARG A NH2  1  
ATOM 1797   H H    . ARG A 1 114 ? 11.656  9.916   0.875   1.00 41.23 ? 114 ARG A H    1  
ATOM 1798   H HA   . ARG A 1 114 ? 12.507  8.426   3.282   1.00 2.52  ? 114 ARG A HA   1  
ATOM 1799   H HB2  . ARG A 1 114 ? 12.893  11.177  2.193   1.00 13.14 ? 114 ARG A HB2  1  
ATOM 1800   H HB3  . ARG A 1 114 ? 12.826  11.072  3.950   1.00 64.13 ? 114 ARG A HB3  1  
ATOM 1801   H HG2  . ARG A 1 114 ? 14.589  9.298   3.867   1.00 53.02 ? 114 ARG A HG2  1  
ATOM 1802   H HG3  . ARG A 1 114 ? 14.716  9.550   2.126   1.00 74.44 ? 114 ARG A HG3  1  
ATOM 1803   H HD2  . ARG A 1 114 ? 15.356  11.501  4.344   1.00 63.50 ? 114 ARG A HD2  1  
ATOM 1804   H HD3  . ARG A 1 114 ? 16.432  10.896  3.085   1.00 72.11 ? 114 ARG A HD3  1  
ATOM 1805   H HE   . ARG A 1 114 ? 14.334  12.215  1.753   1.00 54.12 ? 114 ARG A HE   1  
ATOM 1806   H HH11 . ARG A 1 114 ? 16.806  12.882  4.062   1.00 31.44 ? 114 ARG A HH11 1  
ATOM 1807   H HH12 . ARG A 1 114 ? 16.998  14.534  3.578   1.00 12.44 ? 114 ARG A HH12 1  
ATOM 1808   H HH21 . ARG A 1 114 ? 14.571  14.368  1.106   1.00 60.24 ? 114 ARG A HH21 1  
ATOM 1809   H HH22 . ARG A 1 114 ? 15.732  15.376  1.904   1.00 34.13 ? 114 ARG A HH22 1  
ATOM 1810   N N    . PHE A 1 115 ? 10.265  10.800  3.690   1.00 13.22 ? 115 PHE A N    1  
ATOM 1811   C CA   . PHE A 1 115 ? 9.037   11.120  4.472   1.00 74.43 ? 115 PHE A CA   1  
ATOM 1812   C C    . PHE A 1 115 ? 7.799   10.723  3.663   1.00 2.51  ? 115 PHE A C    1  
ATOM 1813   O O    . PHE A 1 115 ? 6.916   10.049  4.154   1.00 10.13 ? 115 PHE A O    1  
ATOM 1814   C CB   . PHE A 1 115 ? 9.001   12.624  4.767   1.00 51.30 ? 115 PHE A CB   1  
ATOM 1815   C CG   . PHE A 1 115 ? 8.049   12.892  5.911   1.00 54.14 ? 115 PHE A CG   1  
ATOM 1816   C CD1  . PHE A 1 115 ? 8.354   12.415  7.191   1.00 12.33 ? 115 PHE A CD1  1  
ATOM 1817   C CD2  . PHE A 1 115 ? 6.868   13.614  5.695   1.00 33.22 ? 115 PHE A CD2  1  
ATOM 1818   C CE1  . PHE A 1 115 ? 7.479   12.659  8.256   1.00 14.52 ? 115 PHE A CE1  1  
ATOM 1819   C CE2  . PHE A 1 115 ? 5.994   13.858  6.761   1.00 44.30 ? 115 PHE A CE2  1  
ATOM 1820   C CZ   . PHE A 1 115 ? 6.299   13.381  8.041   1.00 72.10 ? 115 PHE A CZ   1  
ATOM 1821   H H    . PHE A 1 115 ? 10.687  11.489  3.136   1.00 14.13 ? 115 PHE A H    1  
ATOM 1822   H HA   . PHE A 1 115 ? 9.049   10.569  5.403   1.00 33.24 ? 115 PHE A HA   1  
ATOM 1823   H HB2  . PHE A 1 115 ? 9.992   12.958  5.039   1.00 25.10 ? 115 PHE A HB2  1  
ATOM 1824   H HB3  . PHE A 1 115 ? 8.671   13.159  3.887   1.00 61.02 ? 115 PHE A HB3  1  
ATOM 1825   H HD1  . PHE A 1 115 ? 9.265   11.856  7.355   1.00 12.25 ? 115 PHE A HD1  1  
ATOM 1826   H HD2  . PHE A 1 115 ? 6.633   13.981  4.707   1.00 32.15 ? 115 PHE A HD2  1  
ATOM 1827   H HE1  . PHE A 1 115 ? 7.715   12.291  9.244   1.00 53.30 ? 115 PHE A HE1  1  
ATOM 1828   H HE2  . PHE A 1 115 ? 5.083   14.415  6.595   1.00 20.23 ? 115 PHE A HE2  1  
ATOM 1829   H HZ   . PHE A 1 115 ? 5.624   13.570  8.863   1.00 33.23 ? 115 PHE A HZ   1  
ATOM 1830   N N    . TRP A 1 116 ? 7.732   11.134  2.425   1.00 74.42 ? 116 TRP A N    1  
ATOM 1831   C CA   . TRP A 1 116 ? 6.554   10.781  1.581   1.00 61.23 ? 116 TRP A CA   1  
ATOM 1832   C C    . TRP A 1 116 ? 5.263   11.110  2.335   1.00 61.21 ? 116 TRP A C    1  
ATOM 1833   O O    . TRP A 1 116 ? 4.799   10.344  3.155   1.00 72.01 ? 116 TRP A O    1  
ATOM 1834   C CB   . TRP A 1 116 ? 6.588   9.286   1.259   1.00 60.33 ? 116 TRP A CB   1  
ATOM 1835   C CG   . TRP A 1 116 ? 5.476   8.955   0.316   1.00 32.12 ? 116 TRP A CG   1  
ATOM 1836   C CD1  . TRP A 1 116 ? 4.275   8.449   0.678   1.00 24.14 ? 116 TRP A CD1  1  
ATOM 1837   C CD2  . TRP A 1 116 ? 5.440   9.098   -1.134  1.00 2.22  ? 116 TRP A CD2  1  
ATOM 1838   N NE1  . TRP A 1 116 ? 3.503   8.273   -0.457  1.00 12.35 ? 116 TRP A NE1  1  
ATOM 1839   C CE2  . TRP A 1 116 ? 4.178   8.658   -1.598  1.00 2.21  ? 116 TRP A CE2  1  
ATOM 1840   C CE3  . TRP A 1 116 ? 6.370   9.562   -2.082  1.00 35.34 ? 116 TRP A CE3  1  
ATOM 1841   C CZ2  . TRP A 1 116 ? 3.850   8.678   -2.955  1.00 30.21 ? 116 TRP A CZ2  1  
ATOM 1842   C CZ3  . TRP A 1 116 ? 6.044   9.583   -3.448  1.00 22.04 ? 116 TRP A CZ3  1  
ATOM 1843   C CH2  . TRP A 1 116 ? 4.786   9.143   -3.883  1.00 63.55 ? 116 TRP A CH2  1  
ATOM 1844   H H    . TRP A 1 116 ? 8.457   11.675  2.050   1.00 2.11  ? 116 TRP A H    1  
ATOM 1845   H HA   . TRP A 1 116 ? 6.588   11.347  0.662   1.00 13.44 ? 116 TRP A HA   1  
ATOM 1846   H HB2  . TRP A 1 116 ? 7.535   9.037   0.802   1.00 60.34 ? 116 TRP A HB2  1  
ATOM 1847   H HB3  . TRP A 1 116 ? 6.468   8.718   2.170   1.00 72.53 ? 116 TRP A HB3  1  
ATOM 1848   H HD1  . TRP A 1 116 ? 3.968   8.220   1.688   1.00 54.43 ? 116 TRP A HD1  1  
ATOM 1849   H HE1  . TRP A 1 116 ? 2.589   7.920   -0.470  1.00 62.51 ? 116 TRP A HE1  1  
ATOM 1850   H HE3  . TRP A 1 116 ? 7.342   9.903   -1.757  1.00 74.44 ? 116 TRP A HE3  1  
ATOM 1851   H HZ2  . TRP A 1 116 ? 2.880   8.338   -3.285  1.00 31.03 ? 116 TRP A HZ2  1  
ATOM 1852   H HZ3  . TRP A 1 116 ? 6.765   9.942   -4.167  1.00 11.22 ? 116 TRP A HZ3  1  
ATOM 1853   H HH2  . TRP A 1 116 ? 4.541   9.162   -4.935  1.00 62.12 ? 116 TRP A HH2  1  
ATOM 1854   N N    . GLY A 1 117 ? 4.677   12.244  2.062   1.00 75.04 ? 117 GLY A N    1  
ATOM 1855   C CA   . GLY A 1 117 ? 3.416   12.613  2.765   1.00 64.43 ? 117 GLY A CA   1  
ATOM 1856   C C    . GLY A 1 117 ? 3.073   14.073  2.471   1.00 70.14 ? 117 GLY A C    1  
ATOM 1857   O O    . GLY A 1 117 ? 3.766   14.981  2.884   1.00 25.31 ? 117 GLY A O    1  
ATOM 1858   H H    . GLY A 1 117 ? 5.063   12.849  1.395   1.00 55.02 ? 117 GLY A H    1  
ATOM 1859   H HA2  . GLY A 1 117 ? 2.613   11.977  2.420   1.00 64.23 ? 117 GLY A HA2  1  
ATOM 1860   H HA3  . GLY A 1 117 ? 3.546   12.485  3.828   1.00 13.31 ? 117 GLY A HA3  1  
ATOM 1861   N N    . SER A 1 118 ? 2.003   14.307  1.762   1.00 61.14 ? 118 SER A N    1  
ATOM 1862   C CA   . SER A 1 118 ? 1.610   15.709  1.445   1.00 34.53 ? 118 SER A CA   1  
ATOM 1863   C C    . SER A 1 118 ? 0.123   15.768  1.163   1.00 31.40 ? 118 SER A C    1  
ATOM 1864   O O    . SER A 1 118 ? -0.529  14.763  0.958   1.00 10.40 ? 118 SER A O    1  
ATOM 1865   C CB   . SER A 1 118 ? 2.392   16.209  0.230   1.00 22.51 ? 118 SER A CB   1  
ATOM 1866   O OG   . SER A 1 118 ? 3.785   16.077  0.481   1.00 2.43  ? 118 SER A OG   1  
ATOM 1867   H H    . SER A 1 118 ? 1.455   13.561  1.441   1.00 43.41 ? 118 SER A H    1  
ATOM 1868   H HA   . SER A 1 118 ? 1.810   16.344  2.293   1.00 2.40  ? 118 SER A HA   1  
ATOM 1869   H HB2  . SER A 1 118 ? 2.131   15.624  -0.636  1.00 34.15 ? 118 SER A HB2  1  
ATOM 1870   H HB3  . SER A 1 118 ? 2.146   17.247  0.047   1.00 63.01 ? 118 SER A HB3  1  
ATOM 1871   H HG   . SER A 1 118 ? 4.004   16.628  1.237   1.00 70.11 ? 118 SER A HG   1  
ATOM 1872   N N    . ASN A 1 119 ? -0.424  16.945  1.184   1.00 41.35 ? 119 ASN A N    1  
ATOM 1873   C CA   . ASN A 1 119 ? -1.879  17.090  0.953   1.00 54.22 ? 119 ASN A CA   1  
ATOM 1874   C C    . ASN A 1 119 ? -2.164  18.527  0.500   1.00 54.24 ? 119 ASN A C    1  
ATOM 1875   O O    . ASN A 1 119 ? -1.824  19.478  1.175   1.00 1.23  ? 119 ASN A O    1  
ATOM 1876   C CB   . ASN A 1 119 ? -2.633  16.763  2.270   1.00 65.24 ? 119 ASN A CB   1  
ATOM 1877   C CG   . ASN A 1 119 ? -1.655  16.296  3.354   1.00 53.14 ? 119 ASN A CG   1  
ATOM 1878   O OD1  . ASN A 1 119 ? -0.672  16.956  3.629   1.00 5.13  ? 119 ASN A OD1  1  
ATOM 1879   N ND2  . ASN A 1 119 ? -1.887  15.177  3.985   1.00 51.40 ? 119 ASN A ND2  1  
ATOM 1880   H H    . ASN A 1 119 ? 0.123   17.735  1.375   1.00 14.02 ? 119 ASN A H    1  
ATOM 1881   H HA   . ASN A 1 119 ? -2.189  16.405  0.174   1.00 33.51 ? 119 ASN A HA   1  
ATOM 1882   H HB2  . ASN A 1 119 ? -3.150  17.638  2.627   1.00 32.00 ? 119 ASN A HB2  1  
ATOM 1883   H HB3  . ASN A 1 119 ? -3.346  15.978  2.088   1.00 23.51 ? 119 ASN A HB3  1  
ATOM 1884   H HD21 . ASN A 1 119 ? -2.680  14.645  3.763   1.00 34.14 ? 119 ASN A HD21 1  
ATOM 1885   H HD22 . ASN A 1 119 ? -1.268  14.869  4.680   1.00 62.15 ? 119 ASN A HD22 1  
ATOM 1886   N N    . VAL A 1 120 ? -2.778  18.691  -0.640  1.00 73.11 ? 120 VAL A N    1  
ATOM 1887   C CA   . VAL A 1 120 ? -3.072  20.066  -1.132  1.00 31.12 ? 120 VAL A CA   1  
ATOM 1888   C C    . VAL A 1 120 ? -4.317  20.613  -0.429  1.00 61.20 ? 120 VAL A C    1  
ATOM 1889   O O    . VAL A 1 120 ? -4.456  21.806  -0.249  1.00 60.53 ? 120 VAL A O    1  
ATOM 1890   C CB   . VAL A 1 120 ? -3.308  20.031  -2.644  1.00 11.25 ? 120 VAL A CB   1  
ATOM 1891   C CG1  . VAL A 1 120 ? -3.526  21.455  -3.159  1.00 44.23 ? 120 VAL A CG1  1  
ATOM 1892   C CG2  . VAL A 1 120 ? -2.087  19.423  -3.336  1.00 40.14 ? 120 VAL A CG2  1  
ATOM 1893   H H    . VAL A 1 120 ? -3.041  17.912  -1.173  1.00 44.22 ? 120 VAL A H    1  
ATOM 1894   H HA   . VAL A 1 120 ? -2.232  20.710  -0.918  1.00 71.12 ? 120 VAL A HA   1  
ATOM 1895   H HB   . VAL A 1 120 ? -4.181  19.434  -2.860  1.00 13.45 ? 120 VAL A HB   1  
ATOM 1896   H HG11 . VAL A 1 120 ? -4.442  21.851  -2.747  1.00 35.54 ? 120 VAL A HG11 1  
ATOM 1897   H HG12 . VAL A 1 120 ? -3.592  21.442  -4.236  1.00 21.32 ? 120 VAL A HG12 1  
ATOM 1898   H HG13 . VAL A 1 120 ? -2.696  22.077  -2.857  1.00 24.44 ? 120 VAL A HG13 1  
ATOM 1899   H HG21 . VAL A 1 120 ? -1.816  18.500  -2.844  1.00 74.22 ? 120 VAL A HG21 1  
ATOM 1900   H HG22 . VAL A 1 120 ? -1.260  20.116  -3.282  1.00 5.10  ? 120 VAL A HG22 1  
ATOM 1901   H HG23 . VAL A 1 120 ? -2.322  19.223  -4.371  1.00 22.51 ? 120 VAL A HG23 1  
ATOM 1902   N N    . ILE A 1 121 ? -5.226  19.750  -0.029  1.00 55.10 ? 121 ILE A N    1  
ATOM 1903   C CA   . ILE A 1 121 ? -6.471  20.216  0.667   1.00 72.24 ? 121 ILE A CA   1  
ATOM 1904   C C    . ILE A 1 121 ? -6.490  19.653  2.088   1.00 71.45 ? 121 ILE A C    1  
ATOM 1905   O O    . ILE A 1 121 ? -6.108  18.522  2.326   1.00 22.42 ? 121 ILE A O    1  
ATOM 1906   C CB   . ILE A 1 121 ? -7.706  19.721  -0.098  1.00 25.21 ? 121 ILE A CB   1  
ATOM 1907   C CG1  . ILE A 1 121 ? -7.682  20.254  -1.552  1.00 10.42 ? 121 ILE A CG1  1  
ATOM 1908   C CG2  . ILE A 1 121 ? -8.973  20.217  0.611   1.00 43.01 ? 121 ILE A CG2  1  
ATOM 1909   C CD1  . ILE A 1 121 ? -6.959  19.265  -2.478  1.00 64.11 ? 121 ILE A CD1  1  
ATOM 1910   H H    . ILE A 1 121 ? -5.089  18.787  -0.187  1.00 74.42 ? 121 ILE A H    1  
ATOM 1911   H HA   . ILE A 1 121 ? -6.492  21.297  0.715   1.00 33.43 ? 121 ILE A HA   1  
ATOM 1912   H HB   . ILE A 1 121 ? -7.706  18.642  -0.106  1.00 3.33  ? 121 ILE A HB   1  
ATOM 1913   H HG12 . ILE A 1 121 ? -8.694  20.384  -1.906  1.00 71.10 ? 121 ILE A HG12 1  
ATOM 1914   H HG13 . ILE A 1 121 ? -7.172  21.207  -1.584  1.00 12.42 ? 121 ILE A HG13 1  
ATOM 1915   H HG21 . ILE A 1 121 ? -8.855  21.258  0.874   1.00 41.40 ? 121 ILE A HG21 1  
ATOM 1916   H HG22 . ILE A 1 121 ? -9.138  19.636  1.506   1.00 12.50 ? 121 ILE A HG22 1  
ATOM 1917   H HG23 . ILE A 1 121 ? -9.820  20.108  -0.051  1.00 22.51 ? 121 ILE A HG23 1  
ATOM 1918   H HD11 . ILE A 1 121 ? -7.672  18.553  -2.868  1.00 51.44 ? 121 ILE A HD11 1  
ATOM 1919   H HD12 . ILE A 1 121 ? -6.194  18.741  -1.930  1.00 33.52 ? 121 ILE A HD12 1  
ATOM 1920   H HD13 . ILE A 1 121 ? -6.508  19.804  -3.297  1.00 43.23 ? 121 ILE A HD13 1  
ATOM 1921   N N    . GLU A 1 122 ? -6.929  20.435  3.038   1.00 71.32 ? 122 GLU A N    1  
ATOM 1922   C CA   . GLU A 1 122 ? -6.971  19.956  4.447   1.00 41.41 ? 122 GLU A CA   1  
ATOM 1923   C C    . GLU A 1 122 ? -8.091  20.683  5.184   1.00 3.10  ? 122 GLU A C    1  
ATOM 1924   O O    . GLU A 1 122 ? -8.310  21.863  4.994   1.00 72.34 ? 122 GLU A O    1  
ATOM 1925   C CB   . GLU A 1 122 ? -5.633  20.256  5.128   1.00 41.52 ? 122 GLU A CB   1  
ATOM 1926   C CG   . GLU A 1 122 ? -5.411  21.770  5.180   1.00 33.25 ? 122 GLU A CG   1  
ATOM 1927   C CD   . GLU A 1 122 ? -3.977  22.061  5.626   1.00 43.42 ? 122 GLU A CD   1  
ATOM 1928   O OE1  . GLU A 1 122 ? -3.264  21.114  5.915   1.00 52.43 ? 122 GLU A OE1  1  
ATOM 1929   O OE2  . GLU A 1 122 ? -3.616  23.225  5.670   1.00 25.32 ? 122 GLU A OE2  1  
ATOM 1930   H H    . GLU A 1 122 ? -7.235  21.342  2.825   1.00 72.42 ? 122 GLU A H    1  
ATOM 1931   H HA   . GLU A 1 122 ? -7.158  18.892  4.468   1.00 43.35 ? 122 GLU A HA   1  
ATOM 1932   H HB2  . GLU A 1 122 ? -5.645  19.858  6.133   1.00 45.11 ? 122 GLU A HB2  1  
ATOM 1933   H HB3  . GLU A 1 122 ? -4.833  19.796  4.567   1.00 73.30 ? 122 GLU A HB3  1  
ATOM 1934   H HG2  . GLU A 1 122 ? -5.577  22.192  4.199   1.00 10.43 ? 122 GLU A HG2  1  
ATOM 1935   H HG3  . GLU A 1 122 ? -6.101  22.212  5.884   1.00 33.33 ? 122 GLU A HG3  1  
ATOM 1936   N N    . ILE A 1 123 ? -8.806  19.991  6.021   1.00 71.44 ? 123 ILE A N    1  
ATOM 1937   C CA   . ILE A 1 123 ? -9.914  20.646  6.766   1.00 61.34 ? 123 ILE A CA   1  
ATOM 1938   C C    . ILE A 1 123 ? -10.266 19.799  7.990   1.00 30.41 ? 123 ILE A C    1  
ATOM 1939   O O    . ILE A 1 123 ? -10.609 18.638  7.879   1.00 51.10 ? 123 ILE A O    1  
ATOM 1940   C CB   . ILE A 1 123 ? -11.130 20.783  5.838   1.00 53.23 ? 123 ILE A CB   1  
ATOM 1941   C CG1  . ILE A 1 123 ? -12.322 21.374  6.603   1.00 3.42  ? 123 ILE A CG1  1  
ATOM 1942   C CG2  . ILE A 1 123 ? -11.522 19.408  5.283   1.00 13.43 ? 123 ILE A CG2  1  
ATOM 1943   C CD1  . ILE A 1 123 ? -11.938 22.709  7.252   1.00 30.24 ? 123 ILE A CD1  1  
ATOM 1944   H H    . ILE A 1 123 ? -8.616  19.039  6.159   1.00 64.05 ? 123 ILE A H    1  
ATOM 1945   H HA   . ILE A 1 123 ? -9.593  21.625  7.088   1.00 75.34 ? 123 ILE A HA   1  
ATOM 1946   H HB   . ILE A 1 123 ? -10.875 21.436  5.016   1.00 44.23 ? 123 ILE A HB   1  
ATOM 1947   H HG12 . ILE A 1 123 ? -13.136 21.535  5.913   1.00 1.35  ? 123 ILE A HG12 1  
ATOM 1948   H HG13 . ILE A 1 123 ? -12.635 20.681  7.369   1.00 62.24 ? 123 ILE A HG13 1  
ATOM 1949   H HG21 . ILE A 1 123 ? -12.049 18.847  6.041   1.00 14.10 ? 123 ILE A HG21 1  
ATOM 1950   H HG22 . ILE A 1 123 ? -10.635 18.867  4.989   1.00 73.42 ? 123 ILE A HG22 1  
ATOM 1951   H HG23 . ILE A 1 123 ? -12.163 19.538  4.424   1.00 55.23 ? 123 ILE A HG23 1  
ATOM 1952   H HD11 . ILE A 1 123 ? -12.832 23.290  7.432   1.00 62.11 ? 123 ILE A HD11 1  
ATOM 1953   H HD12 . ILE A 1 123 ? -11.281 23.259  6.593   1.00 32.14 ? 123 ILE A HD12 1  
ATOM 1954   H HD13 . ILE A 1 123 ? -11.437 22.524  8.190   1.00 64.33 ? 123 ILE A HD13 1  
ATOM 1955   N N    . GLY A 1 124 ? -10.170 20.365  9.162   1.00 12.11 ? 124 GLY A N    1  
ATOM 1956   C CA   . GLY A 1 124 ? -10.487 19.586  10.391  1.00 60.10 ? 124 GLY A CA   1  
ATOM 1957   C C    . GLY A 1 124 ? -9.546  18.385  10.481  1.00 64.02 ? 124 GLY A C    1  
ATOM 1958   O O    . GLY A 1 124 ? -8.349  18.510  10.314  1.00 73.40 ? 124 GLY A O    1  
ATOM 1959   H H    . GLY A 1 124 ? -9.882  21.299  9.233   1.00 63.04 ? 124 GLY A H    1  
ATOM 1960   H HA2  . GLY A 1 124 ? -10.356 20.216  11.259  1.00 75.13 ? 124 GLY A HA2  1  
ATOM 1961   H HA3  . GLY A 1 124 ? -11.507 19.238  10.346  1.00 72.15 ? 124 GLY A HA3  1  
ATOM 1962   N N    . ASP A 1 125 ? -10.075 17.218  10.741  1.00 74.45 ? 125 ASP A N    1  
ATOM 1963   C CA   . ASP A 1 125 ? -9.212  16.001  10.840  1.00 1.40  ? 125 ASP A CA   1  
ATOM 1964   C C    . ASP A 1 125 ? -9.240  15.249  9.506   1.00 64.14 ? 125 ASP A C    1  
ATOM 1965   O O    . ASP A 1 125 ? -8.660  14.190  9.368   1.00 32.44 ? 125 ASP A O    1  
ATOM 1966   C CB   . ASP A 1 125 ? -9.749  15.090  11.945  1.00 15.21 ? 125 ASP A CB   1  
ATOM 1967   C CG   . ASP A 1 125 ? -9.932  15.900  13.231  1.00 71.55 ? 125 ASP A CG   1  
ATOM 1968   O OD1  . ASP A 1 125 ? -9.030  16.648  13.570  1.00 71.41 ? 125 ASP A OD1  1  
ATOM 1969   O OD2  . ASP A 1 125 ? -10.971 15.758  13.854  1.00 40.22 ? 125 ASP A OD2  1  
ATOM 1970   H H    . ASP A 1 125 ? -11.044 17.140  10.870  1.00 62.24 ? 125 ASP A H    1  
ATOM 1971   H HA   . ASP A 1 125 ? -8.195  16.286  11.072  1.00 3.22  ? 125 ASP A HA   1  
ATOM 1972   H HB2  . ASP A 1 125 ? -10.700 14.677  11.641  1.00 4.13  ? 125 ASP A HB2  1  
ATOM 1973   H HB3  . ASP A 1 125 ? -9.048  14.289  12.124  1.00 24.21 ? 125 ASP A HB3  1  
ATOM 1974   N N    . LEU A 1 126 ? -9.917  15.783  8.521   1.00 22.30 ? 126 LEU A N    1  
ATOM 1975   C CA   . LEU A 1 126 ? -9.990  15.096  7.194   1.00 22.43 ? 126 LEU A CA   1  
ATOM 1976   C C    . LEU A 1 126 ? -8.851  15.598  6.309   1.00 22.02 ? 126 LEU A C    1  
ATOM 1977   O O    . LEU A 1 126 ? -8.504  16.762  6.337   1.00 53.21 ? 126 LEU A O    1  
ATOM 1978   C CB   . LEU A 1 126 ? -11.341 15.403  6.509   1.00 32.02 ? 126 LEU A CB   1  
ATOM 1979   C CG   . LEU A 1 126 ? -12.411 15.684  7.562   1.00 54.21 ? 126 LEU A CG   1  
ATOM 1980   C CD1  . LEU A 1 126 ? -13.741 15.981  6.864   1.00 22.13 ? 126 LEU A CD1  1  
ATOM 1981   C CD2  . LEU A 1 126 ? -12.575 14.463  8.478   1.00 4.14  ? 126 LEU A CD2  1  
ATOM 1982   H H    . LEU A 1 126 ? -10.382 16.636  8.655   1.00 3.42  ? 126 LEU A H    1  
ATOM 1983   H HA   . LEU A 1 126 ? -9.892  14.027  7.333   1.00 50.42 ? 126 LEU A HA   1  
ATOM 1984   H HB2  . LEU A 1 126 ? -11.243 16.270  5.869   1.00 3.13  ? 126 LEU A HB2  1  
ATOM 1985   H HB3  . LEU A 1 126 ? -11.644 14.554  5.912   1.00 5.43  ? 126 LEU A HB3  1  
ATOM 1986   H HG   . LEU A 1 126 ? -12.114 16.542  8.143   1.00 33.23 ? 126 LEU A HG   1  
ATOM 1987   H HD11 . LEU A 1 126 ? -14.105 15.084  6.386   1.00 4.52  ? 126 LEU A HD11 1  
ATOM 1988   H HD12 . LEU A 1 126 ? -13.593 16.751  6.121   1.00 45.32 ? 126 LEU A HD12 1  
ATOM 1989   H HD13 . LEU A 1 126 ? -14.462 16.318  7.594   1.00 1.53  ? 126 LEU A HD13 1  
ATOM 1990   H HD21 . LEU A 1 126 ? -13.518 14.528  9.002   1.00 42.30 ? 126 LEU A HD21 1  
ATOM 1991   H HD22 . LEU A 1 126 ? -11.769 14.439  9.196   1.00 12.24 ? 126 LEU A HD22 1  
ATOM 1992   H HD23 . LEU A 1 126 ? -12.555 13.560  7.885   1.00 53.20 ? 126 LEU A HD23 1  
ATOM 1993   N N    . THR A 1 127 ? -8.277  14.732  5.516   1.00 54.13 ? 127 THR A N    1  
ATOM 1994   C CA   . THR A 1 127 ? -7.167  15.152  4.608   1.00 12.42 ? 127 THR A CA   1  
ATOM 1995   C C    . THR A 1 127 ? -7.457  14.624  3.198   1.00 54.50 ? 127 THR A C    1  
ATOM 1996   O O    . THR A 1 127 ? -7.939  13.521  3.030   1.00 2.41  ? 127 THR A O    1  
ATOM 1997   C CB   . THR A 1 127 ? -5.833  14.567  5.129   1.00 42.33 ? 127 THR A CB   1  
ATOM 1998   O OG1  . THR A 1 127 ? -6.108  13.463  5.980   1.00 22.45 ? 127 THR A OG1  1  
ATOM 1999   C CG2  . THR A 1 127 ? -5.053  15.627  5.919   1.00 34.35 ? 127 THR A CG2  1  
ATOM 2000   H H    . THR A 1 127 ? -8.585  13.801  5.508   1.00 61.43 ? 127 THR A H    1  
ATOM 2001   H HA   . THR A 1 127 ? -7.112  16.233  4.573   1.00 54.00 ? 127 THR A HA   1  
ATOM 2002   H HB   . THR A 1 127 ? -5.225  14.232  4.298   1.00 70.24 ? 127 THR A HB   1  
ATOM 2003   H HG1  . THR A 1 127 ? -7.039  13.247  5.894   1.00 1.04  ? 127 THR A HG1  1  
ATOM 2004   H HG21 . THR A 1 127 ? -5.729  16.163  6.570   1.00 33.51 ? 127 THR A HG21 1  
ATOM 2005   H HG22 . THR A 1 127 ? -4.592  16.320  5.231   1.00 12.55 ? 127 THR A HG22 1  
ATOM 2006   H HG23 . THR A 1 127 ? -4.289  15.145  6.510   1.00 52.21 ? 127 THR A HG23 1  
ATOM 2007   N N    . ILE A 1 128 ? -7.155  15.399  2.185   1.00 15.41 ? 128 ILE A N    1  
ATOM 2008   C CA   . ILE A 1 128 ? -7.397  14.941  0.779   1.00 11.11 ? 128 ILE A CA   1  
ATOM 2009   C C    . ILE A 1 128 ? -6.196  15.333  -0.091  1.00 41.11 ? 128 ILE A C    1  
ATOM 2010   O O    . ILE A 1 128 ? -5.799  16.487  -0.149  1.00 11.11 ? 128 ILE A O    1  
ATOM 2011   C CB   . ILE A 1 128 ? -8.685  15.580  0.243   1.00 43.12 ? 128 ILE A CB   1  
ATOM 2012   C CG1  . ILE A 1 128 ? -9.890  14.919  0.924   1.00 45.15 ? 128 ILE A CG1  1  
ATOM 2013   C CG2  . ILE A 1 128 ? -8.780  15.374  -1.274  1.00 40.40 ? 128 ILE A CG2  1  
ATOM 2014   C CD1  . ILE A 1 128 ? -11.173 15.679  0.575   1.00 2.20  ? 128 ILE A CD1  1  
ATOM 2015   H H    . ILE A 1 128 ? -6.759  16.282  2.348   1.00 31.03 ? 128 ILE A H    1  
ATOM 2016   H HA   . ILE A 1 128 ? -7.501  13.864  0.759   1.00 4.32  ? 128 ILE A HA   1  
ATOM 2017   H HB   . ILE A 1 128 ? -8.681  16.635  0.464   1.00 1.42  ? 128 ILE A HB   1  
ATOM 2018   H HG12 . ILE A 1 128 ? -9.974  13.897  0.586   1.00 72.43 ? 128 ILE A HG12 1  
ATOM 2019   H HG13 . ILE A 1 128 ? -9.748  14.932  1.994   1.00 32.12 ? 128 ILE A HG13 1  
ATOM 2020   H HG21 . ILE A 1 128 ? -8.073  16.023  -1.770  1.00 20.31 ? 128 ILE A HG21 1  
ATOM 2021   H HG22 . ILE A 1 128 ? -9.778  15.608  -1.612  1.00 52.12 ? 128 ILE A HG22 1  
ATOM 2022   H HG23 . ILE A 1 128 ? -8.551  14.346  -1.512  1.00 51.22 ? 128 ILE A HG23 1  
ATOM 2023   H HD11 . ILE A 1 128 ? -11.965 15.370  1.239   1.00 32.33 ? 128 ILE A HD11 1  
ATOM 2024   H HD12 . ILE A 1 128 ? -11.453 15.462  -0.445  1.00 53.21 ? 128 ILE A HD12 1  
ATOM 2025   H HD13 . ILE A 1 128 ? -11.006 16.740  0.683   1.00 62.45 ? 128 ILE A HD13 1  
ATOM 2026   N N    . SER A 1 129 ? -5.615  14.365  -0.760  1.00 11.01 ? 129 SER A N    1  
ATOM 2027   C CA   . SER A 1 129 ? -4.427  14.623  -1.634  1.00 34.34 ? 129 SER A CA   1  
ATOM 2028   C C    . SER A 1 129 ? -4.749  14.185  -3.076  1.00 64.40 ? 129 SER A C    1  
ATOM 2029   O O    . SER A 1 129 ? -4.621  13.021  -3.402  1.00 41.43 ? 129 SER A O    1  
ATOM 2030   C CB   . SER A 1 129 ? -3.250  13.792  -1.119  1.00 43.24 ? 129 SER A CB   1  
ATOM 2031   O OG   . SER A 1 129 ? -3.157  13.937  0.292   1.00 71.11 ? 129 SER A OG   1  
ATOM 2032   H H    . SER A 1 129 ? -5.962  13.451  -0.679  1.00 1.33  ? 129 SER A H    1  
ATOM 2033   H HA   . SER A 1 129 ? -4.160  15.665  -1.603  1.00 13.15 ? 129 SER A HA   1  
ATOM 2034   H HB2  . SER A 1 129 ? -3.407  12.753  -1.358  1.00 53.22 ? 129 SER A HB2  1  
ATOM 2035   H HB3  . SER A 1 129 ? -2.337  14.134  -1.588  1.00 11.43 ? 129 SER A HB3  1  
ATOM 2036   H HG   . SER A 1 129 ? -3.255  14.869  0.502   1.00 32.32 ? 129 SER A HG   1  
ATOM 2037   N N    . PRO A 1 130 ? -5.171  15.087  -3.939  1.00 41.33 ? 130 PRO A N    1  
ATOM 2038   C CA   . PRO A 1 130 ? -5.511  14.734  -5.348  1.00 22.01 ? 130 PRO A CA   1  
ATOM 2039   C C    . PRO A 1 130 ? -4.259  14.546  -6.214  1.00 44.13 ? 130 PRO A C    1  
ATOM 2040   O O    . PRO A 1 130 ? -4.231  13.724  -7.109  1.00 23.42 ? 130 PRO A O    1  
ATOM 2041   C CB   . PRO A 1 130 ? -6.343  15.931  -5.823  1.00 53.34 ? 130 PRO A CB   1  
ATOM 2042   C CG   . PRO A 1 130 ? -5.825  17.091  -5.037  1.00 40.02 ? 130 PRO A CG   1  
ATOM 2043   C CD   . PRO A 1 130 ? -5.370  16.528  -3.683  1.00 65.41 ? 130 PRO A CD   1  
ATOM 2044   H HA   . PRO A 1 130 ? -6.115  13.841  -5.373  1.00 52.43 ? 130 PRO A HA   1  
ATOM 2045   H HB2  . PRO A 1 130 ? -6.207  16.095  -6.886  1.00 75.14 ? 130 PRO A HB2  1  
ATOM 2046   H HB3  . PRO A 1 130 ? -7.387  15.774  -5.600  1.00 63.10 ? 130 PRO A HB3  1  
ATOM 2047   H HG2  . PRO A 1 130 ? -4.988  17.545  -5.556  1.00 72.24 ? 130 PRO A HG2  1  
ATOM 2048   H HG3  . PRO A 1 130 ? -6.605  17.823  -4.885  1.00 51.15 ? 130 PRO A HG3  1  
ATOM 2049   H HD2  . PRO A 1 130 ? -4.444  16.998  -3.379  1.00 12.34 ? 130 PRO A HD2  1  
ATOM 2050   H HD3  . PRO A 1 130 ? -6.134  16.667  -2.934  1.00 40.44 ? 130 PRO A HD3  1  
ATOM 2051   N N    . ASP A 1 131 ? -3.222  15.294  -5.949  1.00 11.43 ? 131 ASP A N    1  
ATOM 2052   C CA   . ASP A 1 131 ? -1.978  15.145  -6.753  1.00 21.11 ? 131 ASP A CA   1  
ATOM 2053   C C    . ASP A 1 131 ? -1.510  13.691  -6.681  1.00 40.33 ? 131 ASP A C    1  
ATOM 2054   O O    . ASP A 1 131 ? -1.178  13.083  -7.679  1.00 63.32 ? 131 ASP A O    1  
ATOM 2055   C CB   . ASP A 1 131 ? -0.889  16.060  -6.187  1.00 40.40 ? 131 ASP A CB   1  
ATOM 2056   C CG   . ASP A 1 131 ? 0.379   15.931  -7.034  1.00 32.33 ? 131 ASP A CG   1  
ATOM 2057   O OD1  . ASP A 1 131 ? 0.310   15.306  -8.079  1.00 1.45  ? 131 ASP A OD1  1  
ATOM 2058   O OD2  . ASP A 1 131 ? 1.398   16.462  -6.622  1.00 44.12 ? 131 ASP A OD2  1  
ATOM 2059   H H    . ASP A 1 131 ? -3.261  15.947  -5.219  1.00 44.14 ? 131 ASP A H    1  
ATOM 2060   H HA   . ASP A 1 131 ? -2.177  15.410  -7.781  1.00 60.43 ? 131 ASP A HA   1  
ATOM 2061   H HB2  . ASP A 1 131 ? -1.234  17.083  -6.206  1.00 41.24 ? 131 ASP A HB2  1  
ATOM 2062   H HB3  . ASP A 1 131 ? -0.670  15.772  -5.170  1.00 72.50 ? 131 ASP A HB3  1  
ATOM 2063   N N    . GLU A 1 132 ? -1.489  13.126  -5.503  1.00 40.41 ? 132 GLU A N    1  
ATOM 2064   C CA   . GLU A 1 132 ? -1.053  11.708  -5.357  1.00 72.42 ? 132 GLU A CA   1  
ATOM 2065   C C    . GLU A 1 132 ? -2.256  10.788  -5.567  1.00 45.11 ? 132 GLU A C    1  
ATOM 2066   O O    . GLU A 1 132 ? -2.155  9.582   -5.453  1.00 72.52 ? 132 GLU A O    1  
ATOM 2067   C CB   . GLU A 1 132 ? -0.483  11.492  -3.954  1.00 24.41 ? 132 GLU A CB   1  
ATOM 2068   C CG   . GLU A 1 132 ? 0.856   12.223  -3.830  1.00 61.30 ? 132 GLU A CG   1  
ATOM 2069   C CD   . GLU A 1 132 ? 1.914   11.498  -4.664  1.00 71.40 ? 132 GLU A CD   1  
ATOM 2070   O OE1  . GLU A 1 132 ? 1.674   10.358  -5.026  1.00 62.34 ? 132 GLU A OE1  1  
ATOM 2071   O OE2  . GLU A 1 132 ? 2.945   12.095  -4.925  1.00 14.24 ? 132 GLU A OE2  1  
ATOM 2072   H H    . GLU A 1 132 ? -1.767  13.635  -4.712  1.00 12.43 ? 132 GLU A H    1  
ATOM 2073   H HA   . GLU A 1 132 ? -0.294  11.482  -6.093  1.00 35.12 ? 132 GLU A HA   1  
ATOM 2074   H HB2  . GLU A 1 132 ? -1.175  11.881  -3.221  1.00 73.14 ? 132 GLU A HB2  1  
ATOM 2075   H HB3  . GLU A 1 132 ? -0.332  10.437  -3.784  1.00 40.14 ? 132 GLU A HB3  1  
ATOM 2076   H HG2  . GLU A 1 132 ? 0.746   13.237  -4.188  1.00 2.35  ? 132 GLU A HG2  1  
ATOM 2077   H HG3  . GLU A 1 132 ? 1.163   12.238  -2.795  1.00 3.32  ? 132 GLU A HG3  1  
ATOM 2078   N N    . GLU A 1 133 ? -3.394  11.348  -5.877  1.00 20.31 ? 133 GLU A N    1  
ATOM 2079   C CA   . GLU A 1 133 ? -4.607  10.510  -6.102  1.00 61.40 ? 133 GLU A CA   1  
ATOM 2080   C C    . GLU A 1 133 ? -4.859  9.621   -4.881  1.00 42.44 ? 133 GLU A C    1  
ATOM 2081   O O    . GLU A 1 133 ? -4.647  8.425   -4.920  1.00 75.33 ? 133 GLU A O    1  
ATOM 2082   C CB   . GLU A 1 133 ? -4.391  9.628   -7.334  1.00 24.23 ? 133 GLU A CB   1  
ATOM 2083   C CG   . GLU A 1 133 ? -5.712  8.964   -7.725  1.00 44.01 ? 133 GLU A CG   1  
ATOM 2084   C CD   . GLU A 1 133 ? -5.447  7.895   -8.787  1.00 32.34 ? 133 GLU A CD   1  
ATOM 2085   O OE1  . GLU A 1 133 ? -4.309  7.469   -8.899  1.00 3.30  ? 133 GLU A OE1  1  
ATOM 2086   O OE2  . GLU A 1 133 ? -6.384  7.524   -9.474  1.00 23.23 ? 133 GLU A OE2  1  
ATOM 2087   H H    . GLU A 1 133 ? -3.451  12.323  -5.967  1.00 42.52 ? 133 GLU A H    1  
ATOM 2088   H HA   . GLU A 1 133 ? -5.462  11.150  -6.264  1.00 5.31  ? 133 GLU A HA   1  
ATOM 2089   H HB2  . GLU A 1 133 ? -4.035  10.236  -8.153  1.00 72.41 ? 133 GLU A HB2  1  
ATOM 2090   H HB3  . GLU A 1 133 ? -3.660  8.866   -7.108  1.00 14.35 ? 133 GLU A HB3  1  
ATOM 2091   H HG2  . GLU A 1 133 ? -6.156  8.504   -6.854  1.00 40.31 ? 133 GLU A HG2  1  
ATOM 2092   H HG3  . GLU A 1 133 ? -6.386  9.707   -8.123  1.00 33.13 ? 133 GLU A HG3  1  
ATOM 2093   N N    . LYS A 1 134 ? -5.311  10.196  -3.799  1.00 23.41 ? 134 LYS A N    1  
ATOM 2094   C CA   . LYS A 1 134 ? -5.580  9.383   -2.576  1.00 43.00 ? 134 LYS A CA   1  
ATOM 2095   C C    . LYS A 1 134 ? -6.502  10.165  -1.640  1.00 62.00 ? 134 LYS A C    1  
ATOM 2096   O O    . LYS A 1 134 ? -6.394  11.370  -1.510  1.00 61.11 ? 134 LYS A O    1  
ATOM 2097   C CB   . LYS A 1 134 ? -4.259  9.083   -1.857  1.00 71.23 ? 134 LYS A CB   1  
ATOM 2098   C CG   . LYS A 1 134 ? -4.503  8.110   -0.696  1.00 22.44 ? 134 LYS A CG   1  
ATOM 2099   C CD   . LYS A 1 134 ? -3.255  8.038   0.188   1.00 45.33 ? 134 LYS A CD   1  
ATOM 2100   C CE   . LYS A 1 134 ? -2.069  7.511   -0.626  1.00 51.14 ? 134 LYS A CE   1  
ATOM 2101   N NZ   . LYS A 1 134 ? -1.018  7.004   0.301   1.00 10.22 ? 134 LYS A NZ   1  
ATOM 2102   H H    . LYS A 1 134 ? -5.479  11.162  -3.791  1.00 62.50 ? 134 LYS A H    1  
ATOM 2103   H HA   . LYS A 1 134 ? -6.057  8.455   -2.856  1.00 0.32  ? 134 LYS A HA   1  
ATOM 2104   H HB2  . LYS A 1 134 ? -3.564  8.641   -2.556  1.00 31.13 ? 134 LYS A HB2  1  
ATOM 2105   H HB3  . LYS A 1 134 ? -3.845  10.002  -1.471  1.00 62.41 ? 134 LYS A HB3  1  
ATOM 2106   H HG2  . LYS A 1 134 ? -5.340  8.451   -0.105  1.00 1.11  ? 134 LYS A HG2  1  
ATOM 2107   H HG3  . LYS A 1 134 ? -4.720  7.128   -1.086  1.00 61.10 ? 134 LYS A HG3  1  
ATOM 2108   H HD2  . LYS A 1 134 ? -3.023  9.023   0.564   1.00 1.34  ? 134 LYS A HD2  1  
ATOM 2109   H HD3  . LYS A 1 134 ? -3.441  7.372   1.018   1.00 21.52 ? 134 LYS A HD3  1  
ATOM 2110   H HE2  . LYS A 1 134 ? -2.398  6.708   -1.269  1.00 13.43 ? 134 LYS A HE2  1  
ATOM 2111   H HE3  . LYS A 1 134 ? -1.663  8.311   -1.227  1.00 71.13 ? 134 LYS A HE3  1  
ATOM 2112   H HZ1  . LYS A 1 134 ? -0.442  6.289   -0.185  1.00 20.12 ? 134 LYS A HZ1  1  
ATOM 2113   H HZ2  . LYS A 1 134 ? -1.469  6.577   1.137   1.00 34.00 ? 134 LYS A HZ2  1  
ATOM 2114   H HZ3  . LYS A 1 134 ? -0.409  7.792   0.600   1.00 24.12 ? 134 LYS A HZ3  1  
ATOM 2115   N N    . ILE A 1 135 ? -7.397  9.478   -0.970  1.00 43.40 ? 135 ILE A N    1  
ATOM 2116   C CA   . ILE A 1 135 ? -8.328  10.154  -0.013  1.00 64.23 ? 135 ILE A CA   1  
ATOM 2117   C C    . ILE A 1 135 ? -8.031  9.642   1.391   1.00 32.24 ? 135 ILE A C    1  
ATOM 2118   O O    . ILE A 1 135 ? -7.793  8.467   1.592   1.00 74.02 ? 135 ILE A O    1  
ATOM 2119   C CB   . ILE A 1 135 ? -9.776  9.820   -0.372  1.00 73.30 ? 135 ILE A CB   1  
ATOM 2120   C CG1  . ILE A 1 135 ? -10.716 10.532  0.608   1.00 25.51 ? 135 ILE A CG1  1  
ATOM 2121   C CG2  . ILE A 1 135 ? -9.987  8.307   -0.277  1.00 50.12 ? 135 ILE A CG2  1  
ATOM 2122   C CD1  . ILE A 1 135 ? -12.136 10.542  0.042   1.00 4.01  ? 135 ILE A CD1  1  
ATOM 2123   H H    . ILE A 1 135 ? -7.447  8.504   -1.088  1.00 63.45 ? 135 ILE A H    1  
ATOM 2124   H HA   . ILE A 1 135 ? -8.187  11.228  -0.038  1.00 53.43 ? 135 ILE A HA   1  
ATOM 2125   H HB   . ILE A 1 135 ? -9.984  10.150  -1.378  1.00 75.33 ? 135 ILE A HB   1  
ATOM 2126   H HG12 . ILE A 1 135 ? -10.709 10.012  1.556   1.00 21.34 ? 135 ILE A HG12 1  
ATOM 2127   H HG13 . ILE A 1 135 ? -10.383 11.549  0.754   1.00 23.41 ? 135 ILE A HG13 1  
ATOM 2128   H HG21 . ILE A 1 135 ? -10.943 8.048   -0.708  1.00 35.51 ? 135 ILE A HG21 1  
ATOM 2129   H HG22 . ILE A 1 135 ? -9.968  8.006   0.761   1.00 34.53 ? 135 ILE A HG22 1  
ATOM 2130   H HG23 . ILE A 1 135 ? -9.200  7.799   -0.813  1.00 2.43  ? 135 ILE A HG23 1  
ATOM 2131   H HD11 . ILE A 1 135 ? -12.499 9.529   -0.039  1.00 13.33 ? 135 ILE A HD11 1  
ATOM 2132   H HD12 . ILE A 1 135 ? -12.129 11.002  -0.935  1.00 35.13 ? 135 ILE A HD12 1  
ATOM 2133   H HD13 . ILE A 1 135 ? -12.781 11.105  0.700   1.00 72.41 ? 135 ILE A HD13 1  
ATOM 2134   N N    . ILE A 1 136 ? -8.031  10.518  2.361   1.00 54.21 ? 136 ILE A N    1  
ATOM 2135   C CA   . ILE A 1 136 ? -7.733  10.103  3.766   1.00 12.13 ? 136 ILE A CA   1  
ATOM 2136   C C    . ILE A 1 136 ? -8.863  10.589  4.682   1.00 31.23 ? 136 ILE A C    1  
ATOM 2137   O O    . ILE A 1 136 ? -9.221  11.750  4.674   1.00 45.51 ? 136 ILE A O    1  
ATOM 2138   C CB   . ILE A 1 136 ? -6.400  10.731  4.189   1.00 22.43 ? 136 ILE A CB   1  
ATOM 2139   C CG1  . ILE A 1 136 ? -5.376  10.567  3.057   1.00 60.23 ? 136 ILE A CG1  1  
ATOM 2140   C CG2  . ILE A 1 136 ? -5.880  10.028  5.443   1.00 32.34 ? 136 ILE A CG2  1  
ATOM 2141   C CD1  . ILE A 1 136 ? -4.036  11.174  3.480   1.00 14.41 ? 136 ILE A CD1  1  
ATOM 2142   H H    . ILE A 1 136 ? -8.218  11.459  2.164   1.00 70.23 ? 136 ILE A H    1  
ATOM 2143   H HA   . ILE A 1 136 ? -7.662  9.027   3.832   1.00 60.21 ? 136 ILE A HA   1  
ATOM 2144   H HB   . ILE A 1 136 ? -6.545  11.780  4.397   1.00 11.15 ? 136 ILE A HB   1  
ATOM 2145   H HG12 . ILE A 1 136 ? -5.243  9.516   2.842   1.00 71.11 ? 136 ILE A HG12 1  
ATOM 2146   H HG13 . ILE A 1 136 ? -5.730  11.073  2.172   1.00 34.01 ? 136 ILE A HG13 1  
ATOM 2147   H HG21 . ILE A 1 136 ? -6.685  9.922   6.156   1.00 70.11 ? 136 ILE A HG21 1  
ATOM 2148   H HG22 . ILE A 1 136 ? -5.085  10.614  5.879   1.00 11.21 ? 136 ILE A HG22 1  
ATOM 2149   H HG23 . ILE A 1 136 ? -5.504  9.051   5.176   1.00 23.35 ? 136 ILE A HG23 1  
ATOM 2150   H HD11 . ILE A 1 136 ? -3.609  10.585  4.278   1.00 62.33 ? 136 ILE A HD11 1  
ATOM 2151   H HD12 . ILE A 1 136 ? -4.191  12.185  3.822   1.00 25.41 ? 136 ILE A HD12 1  
ATOM 2152   H HD13 . ILE A 1 136 ? -3.362  11.179  2.636   1.00 20.15 ? 136 ILE A HD13 1  
ATOM 2153   N N    . TYR A 1 137 ? -9.439  9.701   5.460   1.00 55.04 ? 137 TYR A N    1  
ATOM 2154   C CA   . TYR A 1 137 ? -10.564 10.099  6.369   1.00 21.11 ? 137 TYR A CA   1  
ATOM 2155   C C    . TYR A 1 137 ? -10.392 9.459   7.753   1.00 62.32 ? 137 TYR A C    1  
ATOM 2156   O O    . TYR A 1 137 ? -10.088 8.290   7.879   1.00 52.31 ? 137 TYR A O    1  
ATOM 2157   C CB   . TYR A 1 137 ? -11.887 9.628   5.759   1.00 25.11 ? 137 TYR A CB   1  
ATOM 2158   C CG   . TYR A 1 137 ? -11.833 8.138   5.500   1.00 42.15 ? 137 TYR A CG   1  
ATOM 2159   C CD1  . TYR A 1 137 ? -12.201 7.237   6.507   1.00 24.43 ? 137 TYR A CD1  1  
ATOM 2160   C CD2  . TYR A 1 137 ? -11.424 7.659   4.249   1.00 52.45 ? 137 TYR A CD2  1  
ATOM 2161   C CE1  . TYR A 1 137 ? -12.162 5.857   6.262   1.00 54.53 ? 137 TYR A CE1  1  
ATOM 2162   C CE2  . TYR A 1 137 ? -11.383 6.281   4.006   1.00 20.55 ? 137 TYR A CE2  1  
ATOM 2163   C CZ   . TYR A 1 137 ? -11.752 5.380   5.011   1.00 2.02  ? 137 TYR A CZ   1  
ATOM 2164   O OH   . TYR A 1 137 ? -11.715 4.019   4.769   1.00 61.55 ? 137 TYR A OH   1  
ATOM 2165   H H    . TYR A 1 137 ? -9.139  8.769   5.438   1.00 12.21 ? 137 TYR A H    1  
ATOM 2166   H HA   . TYR A 1 137 ? -10.591 11.174  6.479   1.00 70.22 ? 137 TYR A HA   1  
ATOM 2167   H HB2  . TYR A 1 137 ? -12.695 9.844   6.442   1.00 32.14 ? 137 TYR A HB2  1  
ATOM 2168   H HB3  . TYR A 1 137 ? -12.056 10.148  4.827   1.00 31.32 ? 137 TYR A HB3  1  
ATOM 2169   H HD1  . TYR A 1 137 ? -12.516 7.605   7.472   1.00 50.54 ? 137 TYR A HD1  1  
ATOM 2170   H HD2  . TYR A 1 137 ? -11.140 8.353   3.471   1.00 55.32 ? 137 TYR A HD2  1  
ATOM 2171   H HE1  . TYR A 1 137 ? -12.447 5.162   7.037   1.00 61.44 ? 137 TYR A HE1  1  
ATOM 2172   H HE2  . TYR A 1 137 ? -11.067 5.914   3.041   1.00 74.14 ? 137 TYR A HE2  1  
ATOM 2173   H HH   . TYR A 1 137 ? -10.987 3.646   5.272   1.00 51.24 ? 137 TYR A HH   1  
ATOM 2174   N N    . LYS A 1 138 ? -10.604 10.226  8.791   1.00 65.40 ? 138 LYS A N    1  
ATOM 2175   C CA   . LYS A 1 138 ? -10.481 9.688   10.179  1.00 34.32 ? 138 LYS A CA   1  
ATOM 2176   C C    . LYS A 1 138 ? -9.098  9.067   10.400  1.00 75.40 ? 138 LYS A C    1  
ATOM 2177   O O    . LYS A 1 138 ? -8.944  8.149   11.180  1.00 54.52 ? 138 LYS A O    1  
ATOM 2178   C CB   . LYS A 1 138 ? -11.557 8.623   10.419  1.00 44.34 ? 138 LYS A CB   1  
ATOM 2179   C CG   . LYS A 1 138 ? -12.944 9.178   10.066  1.00 62.52 ? 138 LYS A CG   1  
ATOM 2180   C CD   . LYS A 1 138 ? -13.385 10.211  11.110  1.00 32.40 ? 138 LYS A CD   1  
ATOM 2181   C CE   . LYS A 1 138 ? -14.880 10.491  10.946  1.00 74.13 ? 138 LYS A CE   1  
ATOM 2182   N NZ   . LYS A 1 138 ? -15.662 9.329   11.457  1.00 22.13 ? 138 LYS A NZ   1  
ATOM 2183   H H    . LYS A 1 138 ? -10.860 11.162  8.657   1.00 72.15 ? 138 LYS A H    1  
ATOM 2184   H HA   . LYS A 1 138 ? -10.619 10.493  10.884  1.00 74.51 ? 138 LYS A HA   1  
ATOM 2185   H HB2  . LYS A 1 138 ? -11.349 7.764   9.802   1.00 73.42 ? 138 LYS A HB2  1  
ATOM 2186   H HB3  . LYS A 1 138 ? -11.543 8.328   11.457  1.00 33.31 ? 138 LYS A HB3  1  
ATOM 2187   H HG2  . LYS A 1 138 ? -12.908 9.644   9.093   1.00 71.22 ? 138 LYS A HG2  1  
ATOM 2188   H HG3  . LYS A 1 138 ? -13.657 8.367   10.048  1.00 44.43 ? 138 LYS A HG3  1  
ATOM 2189   H HD2  . LYS A 1 138 ? -13.199 9.828   12.103  1.00 21.01 ? 138 LYS A HD2  1  
ATOM 2190   H HD3  . LYS A 1 138 ? -12.835 11.130  10.969  1.00 5.03  ? 138 LYS A HD3  1  
ATOM 2191   H HE2  . LYS A 1 138 ? -15.143 11.378  11.505  1.00 73.14 ? 138 LYS A HE2  1  
ATOM 2192   H HE3  . LYS A 1 138 ? -15.104 10.645  9.901   1.00 23.44 ? 138 LYS A HE3  1  
ATOM 2193   H HZ1  . LYS A 1 138 ? -16.274 8.963   10.701  1.00 32.52 ? 138 LYS A HZ1  1  
ATOM 2194   H HZ2  . LYS A 1 138 ? -16.250 9.634   12.261  1.00 53.23 ? 138 LYS A HZ2  1  
ATOM 2195   H HZ3  . LYS A 1 138 ? -15.011 8.580   11.766  1.00 53.43 ? 138 LYS A HZ3  1  
ATOM 2196   N N    . GLY A 1 139 ? -8.086  9.569   9.749   1.00 10.11 ? 139 GLY A N    1  
ATOM 2197   C CA   . GLY A 1 139 ? -6.719  9.008   9.963   1.00 60.21 ? 139 GLY A CA   1  
ATOM 2198   C C    . GLY A 1 139 ? -6.541  7.699   9.197   1.00 3.42  ? 139 GLY A C    1  
ATOM 2199   O O    . GLY A 1 139 ? -5.636  6.936   9.473   1.00 72.24 ? 139 GLY A O    1  
ATOM 2200   H H    . GLY A 1 139 ? -8.219  10.323  9.137   1.00 13.43 ? 139 GLY A H    1  
ATOM 2201   H HA2  . GLY A 1 139 ? -5.988  9.717   9.619   1.00 61.24 ? 139 GLY A HA2  1  
ATOM 2202   H HA3  . GLY A 1 139 ? -6.570  8.823   11.016  1.00 61.03 ? 139 GLY A HA3  1  
ATOM 2203   N N    . ARG A 1 140 ? -7.392  7.427   8.244   1.00 24.10 ? 140 ARG A N    1  
ATOM 2204   C CA   . ARG A 1 140 ? -7.274  6.158   7.457   1.00 33.20 ? 140 ARG A CA   1  
ATOM 2205   C C    . ARG A 1 140 ? -6.892  6.485   6.013   1.00 55.41 ? 140 ARG A C    1  
ATOM 2206   O O    . ARG A 1 140 ? -7.544  7.267   5.356   1.00 51.25 ? 140 ARG A O    1  
ATOM 2207   C CB   . ARG A 1 140 ? -8.623  5.445   7.477   1.00 51.21 ? 140 ARG A CB   1  
ATOM 2208   C CG   . ARG A 1 140 ? -8.981  5.078   8.921   1.00 10.31 ? 140 ARG A CG   1  
ATOM 2209   C CD   . ARG A 1 140 ? -10.474 4.778   9.012   1.00 71.22 ? 140 ARG A CD   1  
ATOM 2210   N NE   . ARG A 1 140 ? -10.802 4.276   10.378  1.00 21.41 ? 140 ARG A NE   1  
ATOM 2211   C CZ   . ARG A 1 140 ? -10.452 3.069   10.732  1.00 35.21 ? 140 ARG A CZ   1  
ATOM 2212   N NH1  . ARG A 1 140 ? -9.814  2.304   9.889   1.00 21.40 ? 140 ARG A NH1  1  
ATOM 2213   N NH2  . ARG A 1 140 ? -10.742 2.629   11.929  1.00 44.42 ? 140 ARG A NH2  1  
ATOM 2214   H H    . ARG A 1 140 ? -8.115  8.059   8.042   1.00 51.45 ? 140 ARG A H    1  
ATOM 2215   H HA   . ARG A 1 140 ? -6.522  5.511   7.889   1.00 73.12 ? 140 ARG A HA   1  
ATOM 2216   H HB2  . ARG A 1 140 ? -9.379  6.101   7.068   1.00 21.15 ? 140 ARG A HB2  1  
ATOM 2217   H HB3  . ARG A 1 140 ? -8.564  4.546   6.883   1.00 41.42 ? 140 ARG A HB3  1  
ATOM 2218   H HG2  . ARG A 1 140 ? -8.420  4.206   9.222   1.00 53.33 ? 140 ARG A HG2  1  
ATOM 2219   H HG3  . ARG A 1 140 ? -8.744  5.904   9.576   1.00 71.42 ? 140 ARG A HG3  1  
ATOM 2220   H HD2  . ARG A 1 140 ? -11.027 5.684   8.818   1.00 20.50 ? 140 ARG A HD2  1  
ATOM 2221   H HD3  . ARG A 1 140 ? -10.735 4.032   8.279   1.00 51.41 ? 140 ARG A HD3  1  
ATOM 2222   H HE   . ARG A 1 140 ? -11.278 4.853   11.010  1.00 14.34 ? 140 ARG A HE   1  
ATOM 2223   H HH11 . ARG A 1 140 ? -9.593  2.645   8.975   1.00 1.52  ? 140 ARG A HH11 1  
ATOM 2224   H HH12 . ARG A 1 140 ? -9.546  1.379   10.157  1.00 31.45 ? 140 ARG A HH12 1  
ATOM 2225   H HH21 . ARG A 1 140 ? -11.231 3.219   12.573  1.00 2.05  ? 140 ARG A HH21 1  
ATOM 2226   H HH22 . ARG A 1 140 ? -10.474 1.705   12.203  1.00 51.04 ? 140 ARG A HH22 1  
ATOM 2227   N N    . GLU A 1 141 ? -5.836  5.888   5.517   1.00 22.05 ? 141 GLU A N    1  
ATOM 2228   C CA   . GLU A 1 141 ? -5.398  6.156   4.111   1.00 63.43 ? 141 GLU A CA   1  
ATOM 2229   C C    . GLU A 1 141 ? -5.999  5.104   3.176   1.00 24.52 ? 141 GLU A C    1  
ATOM 2230   O O    . GLU A 1 141 ? -5.875  3.917   3.402   1.00 71.42 ? 141 GLU A O    1  
ATOM 2231   C CB   . GLU A 1 141 ? -3.871  6.079   4.036   1.00 45.24 ? 141 GLU A CB   1  
ATOM 2232   C CG   . GLU A 1 141 ? -3.259  7.262   4.785   1.00 63.23 ? 141 GLU A CG   1  
ATOM 2233   C CD   . GLU A 1 141 ? -1.741  7.094   4.848   1.00 62.13 ? 141 GLU A CD   1  
ATOM 2234   O OE1  . GLU A 1 141 ? -1.213  6.354   4.034   1.00 54.03 ? 141 GLU A OE1  1  
ATOM 2235   O OE2  . GLU A 1 141 ? -1.132  7.704   5.711   1.00 63.23 ? 141 GLU A OE2  1  
ATOM 2236   H H    . GLU A 1 141 ? -5.328  5.261   6.072   1.00 10.13 ? 141 GLU A H    1  
ATOM 2237   H HA   . GLU A 1 141 ? -5.724  7.140   3.805   1.00 23.42 ? 141 GLU A HA   1  
ATOM 2238   H HB2  . GLU A 1 141 ? -3.537  5.156   4.487   1.00 2.25  ? 141 GLU A HB2  1  
ATOM 2239   H HB3  . GLU A 1 141 ? -3.559  6.108   3.002   1.00 72.32 ? 141 GLU A HB3  1  
ATOM 2240   H HG2  . GLU A 1 141 ? -3.499  8.179   4.265   1.00 62.24 ? 141 GLU A HG2  1  
ATOM 2241   H HG3  . GLU A 1 141 ? -3.658  7.301   5.787   1.00 71.13 ? 141 GLU A HG3  1  
ATOM 2242   N N    . VAL A 1 142 ? -6.647  5.533   2.122   1.00 52.42 ? 142 VAL A N    1  
ATOM 2243   C CA   . VAL A 1 142 ? -7.258  4.568   1.156   1.00 10.42 ? 142 VAL A CA   1  
ATOM 2244   C C    . VAL A 1 142 ? -7.023  5.071   -0.271  1.00 53.02 ? 142 VAL A C    1  
ATOM 2245   O O    . VAL A 1 142 ? -7.090  6.256   -0.540  1.00 40.32 ? 142 VAL A O    1  
ATOM 2246   C CB   . VAL A 1 142 ? -8.759  4.459   1.430   1.00 22.33 ? 142 VAL A CB   1  
ATOM 2247   C CG1  . VAL A 1 142 ? -9.362  3.368   0.542   1.00 41.23 ? 142 VAL A CG1  1  
ATOM 2248   C CG2  . VAL A 1 142 ? -8.977  4.100   2.902   1.00 33.45 ? 142 VAL A CG2  1  
ATOM 2249   H H    . VAL A 1 142 ? -6.727  6.496   1.960   1.00 13.11 ? 142 VAL A H    1  
ATOM 2250   H HA   . VAL A 1 142 ? -6.799  3.593   1.269   1.00 53.33 ? 142 VAL A HA   1  
ATOM 2251   H HB   . VAL A 1 142 ? -9.236  5.405   1.213   1.00 12.33 ? 142 VAL A HB   1  
ATOM 2252   H HG11 . VAL A 1 142 ? -10.361 3.136   0.881   1.00 54.41 ? 142 VAL A HG11 1  
ATOM 2253   H HG12 . VAL A 1 142 ? -8.748  2.481   0.596   1.00 53.32 ? 142 VAL A HG12 1  
ATOM 2254   H HG13 . VAL A 1 142 ? -9.400  3.717   -0.480  1.00 62.34 ? 142 VAL A HG13 1  
ATOM 2255   H HG21 . VAL A 1 142 ? -10.009 3.824   3.056   1.00 23.11 ? 142 VAL A HG21 1  
ATOM 2256   H HG22 . VAL A 1 142 ? -8.736  4.954   3.521   1.00 41.55 ? 142 VAL A HG22 1  
ATOM 2257   H HG23 . VAL A 1 142 ? -8.338  3.271   3.169   1.00 23.10 ? 142 VAL A HG23 1  
ATOM 2258   N N    . GLU A 1 143 ? -6.741  4.181   -1.189  1.00 12.41 ? 143 GLU A N    1  
ATOM 2259   C CA   . GLU A 1 143 ? -6.491  4.604   -2.602  1.00 21.34 ? 143 GLU A CA   1  
ATOM 2260   C C    . GLU A 1 143 ? -7.767  4.439   -3.429  1.00 32.23 ? 143 GLU A C    1  
ATOM 2261   O O    . GLU A 1 143 ? -8.525  3.508   -3.241  1.00 14.21 ? 143 GLU A O    1  
ATOM 2262   C CB   . GLU A 1 143 ? -5.392  3.731   -3.210  1.00 13.00 ? 143 GLU A CB   1  
ATOM 2263   C CG   . GLU A 1 143 ? -4.104  3.885   -2.398  1.00 41.11 ? 143 GLU A CG   1  
ATOM 2264   C CD   . GLU A 1 143 ? -4.237  3.132   -1.072  1.00 23.21 ? 143 GLU A CD   1  
ATOM 2265   O OE1  . GLU A 1 143 ? -5.155  2.340   -0.951  1.00 60.45 ? 143 GLU A OE1  1  
ATOM 2266   O OE2  . GLU A 1 143 ? -3.414  3.359   -0.200  1.00 54.31 ? 143 GLU A OE2  1  
ATOM 2267   H H    . GLU A 1 143 ? -6.686  3.232   -0.948  1.00 14.23 ? 143 GLU A H    1  
ATOM 2268   H HA   . GLU A 1 143 ? -6.178  5.640   -2.625  1.00 33.35 ? 143 GLU A HA   1  
ATOM 2269   H HB2  . GLU A 1 143 ? -5.705  2.697   -3.201  1.00 61.23 ? 143 GLU A HB2  1  
ATOM 2270   H HB3  . GLU A 1 143 ? -5.210  4.043   -4.226  1.00 40.31 ? 143 GLU A HB3  1  
ATOM 2271   H HG2  . GLU A 1 143 ? -3.275  3.481   -2.962  1.00 52.30 ? 143 GLU A HG2  1  
ATOM 2272   H HG3  . GLU A 1 143 ? -3.928  4.931   -2.198  1.00 35.41 ? 143 GLU A HG3  1  
ATOM 2273   N N    . VAL A 1 144 ? -8.003  5.334   -4.354  1.00 74.44 ? 144 VAL A N    1  
ATOM 2274   C CA   . VAL A 1 144 ? -9.224  5.235   -5.215  1.00 3.21  ? 144 VAL A CA   1  
ATOM 2275   C C    . VAL A 1 144 ? -8.865  5.642   -6.646  1.00 65.52 ? 144 VAL A C    1  
ATOM 2276   O O    . VAL A 1 144 ? -8.110  6.568   -6.869  1.00 71.02 ? 144 VAL A O    1  
ATOM 2277   C CB   . VAL A 1 144 ? -10.311 6.168   -4.680  1.00 24.44 ? 144 VAL A CB   1  
ATOM 2278   C CG1  . VAL A 1 144 ? -10.682 5.759   -3.252  1.00 52.30 ? 144 VAL A CG1  1  
ATOM 2279   C CG2  . VAL A 1 144 ? -9.796  7.610   -4.684  1.00 70.13 ? 144 VAL A CG2  1  
ATOM 2280   H H    . VAL A 1 144 ? -7.372  6.071   -4.489  1.00 62.21 ? 144 VAL A H    1  
ATOM 2281   H HA   . VAL A 1 144 ? -9.592  4.217   -5.216  1.00 34.33 ? 144 VAL A HA   1  
ATOM 2282   H HB   . VAL A 1 144 ? -11.187 6.096   -5.311  1.00 10.31 ? 144 VAL A HB   1  
ATOM 2283   H HG11 . VAL A 1 144 ? -10.768 4.684   -3.195  1.00 10.04 ? 144 VAL A HG11 1  
ATOM 2284   H HG12 . VAL A 1 144 ? -11.627 6.207   -2.983  1.00 12.42 ? 144 VAL A HG12 1  
ATOM 2285   H HG13 . VAL A 1 144 ? -9.914  6.097   -2.569  1.00 24.20 ? 144 VAL A HG13 1  
ATOM 2286   H HG21 . VAL A 1 144 ? -10.475 8.237   -4.128  1.00 21.43 ? 144 VAL A HG21 1  
ATOM 2287   H HG22 . VAL A 1 144 ? -9.730  7.966   -5.700  1.00 31.33 ? 144 VAL A HG22 1  
ATOM 2288   H HG23 . VAL A 1 144 ? -8.819  7.646   -4.228  1.00 34.22 ? 144 VAL A HG23 1  
ATOM 2289   N N    . LYS A 1 145 ? -9.400  4.958   -7.618  1.00 10.54 ? 145 LYS A N    1  
ATOM 2290   C CA   . LYS A 1 145 ? -9.092  5.302   -9.036  1.00 11.44 ? 145 LYS A CA   1  
ATOM 2291   C C    . LYS A 1 145 ? -10.255 4.843   -9.924  1.00 45.14 ? 145 LYS A C    1  
ATOM 2292   O O    . LYS A 1 145 ? -10.080 4.524   -11.084 1.00 2.54  ? 145 LYS A O    1  
ATOM 2293   C CB   . LYS A 1 145 ? -7.784  4.610   -9.465  1.00 62.42 ? 145 LYS A CB   1  
ATOM 2294   C CG   . LYS A 1 145 ? -7.636  3.268   -8.739  1.00 3.20  ? 145 LYS A CG   1  
ATOM 2295   C CD   . LYS A 1 145 ? -8.844  2.382   -9.045  1.00 45.54 ? 145 LYS A CD   1  
ATOM 2296   C CE   . LYS A 1 145 ? -8.541  0.946   -8.623  1.00 4.13  ? 145 LYS A CE   1  
ATOM 2297   N NZ   . LYS A 1 145 ? -8.094  0.929   -7.202  1.00 65.15 ? 145 LYS A NZ   1  
ATOM 2298   H H    . LYS A 1 145 ? -10.007 4.215   -7.416  1.00 75.42 ? 145 LYS A H    1  
ATOM 2299   H HA   . LYS A 1 145 ? -8.978  6.372   -9.129  1.00 32.14 ? 145 LYS A HA   1  
ATOM 2300   H HB2  . LYS A 1 145 ? -7.791  4.441   -10.532 1.00 52.32 ? 145 LYS A HB2  1  
ATOM 2301   H HB3  . LYS A 1 145 ? -6.947  5.242   -9.212  1.00 61.21 ? 145 LYS A HB3  1  
ATOM 2302   H HG2  . LYS A 1 145 ? -6.736  2.777   -9.080  1.00 21.51 ? 145 LYS A HG2  1  
ATOM 2303   H HG3  . LYS A 1 145 ? -7.571  3.435   -7.674  1.00 25.33 ? 145 LYS A HG3  1  
ATOM 2304   H HD2  . LYS A 1 145 ? -9.706  2.742   -8.501  1.00 63.54 ? 145 LYS A HD2  1  
ATOM 2305   H HD3  . LYS A 1 145 ? -9.049  2.406   -10.104 1.00 5.32  ? 145 LYS A HD3  1  
ATOM 2306   H HE2  . LYS A 1 145 ? -9.433  0.347   -8.725  1.00 25.33 ? 145 LYS A HE2  1  
ATOM 2307   H HE3  . LYS A 1 145 ? -7.762  0.542   -9.251  1.00 1.13  ? 145 LYS A HE3  1  
ATOM 2308   H HZ1  . LYS A 1 145 ? -8.520  0.115   -6.715  1.00 63.44 ? 145 LYS A HZ1  1  
ATOM 2309   H HZ2  . LYS A 1 145 ? -8.392  1.809   -6.736  1.00 53.52 ? 145 LYS A HZ2  1  
ATOM 2310   H HZ3  . LYS A 1 145 ? -7.058  0.849   -7.164  1.00 21.52 ? 145 LYS A HZ3  1  
ATOM 2311   N N    . GLY A 1 146 ? -11.444 4.808   -9.381  1.00 64.01 ? 146 GLY A N    1  
ATOM 2312   C CA   . GLY A 1 146 ? -12.624 4.369   -10.181 1.00 3.01  ? 146 GLY A CA   1  
ATOM 2313   C C    . GLY A 1 146 ? -13.220 5.562   -10.933 1.00 43.33 ? 146 GLY A C    1  
ATOM 2314   O O    . GLY A 1 146 ? -12.581 6.578   -11.120 1.00 73.34 ? 146 GLY A O    1  
ATOM 2315   H H    . GLY A 1 146 ? -11.561 5.068   -8.444  1.00 30.43 ? 146 GLY A H    1  
ATOM 2316   H HA2  . GLY A 1 146 ? -12.320 3.610   -10.891 1.00 41.03 ? 146 GLY A HA2  1  
ATOM 2317   H HA3  . GLY A 1 146 ? -13.373 3.959   -9.519  1.00 33.04 ? 146 GLY A HA3  1  
ATOM 2318   N N    . LYS A 1 147 ? -14.446 5.438   -11.365 1.00 71.31 ? 147 LYS A N    1  
ATOM 2319   C CA   . LYS A 1 147 ? -15.105 6.552   -12.111 1.00 52.52 ? 147 LYS A CA   1  
ATOM 2320   C C    . LYS A 1 147 ? -15.639 7.617   -11.135 1.00 44.11 ? 147 LYS A C    1  
ATOM 2321   O O    . LYS A 1 147 ? -15.586 8.796   -11.421 1.00 31.23 ? 147 LYS A O    1  
ATOM 2322   C CB   . LYS A 1 147 ? -16.268 5.995   -12.963 1.00 72.22 ? 147 LYS A CB   1  
ATOM 2323   C CG   . LYS A 1 147 ? -15.990 4.535   -13.333 1.00 5.31  ? 147 LYS A CG   1  
ATOM 2324   C CD   . LYS A 1 147 ? -17.080 4.025   -14.276 1.00 45.41 ? 147 LYS A CD   1  
ATOM 2325   C CE   . LYS A 1 147 ? -16.852 2.539   -14.553 1.00 43.24 ? 147 LYS A CE   1  
ATOM 2326   N NZ   . LYS A 1 147 ? -15.476 2.340   -15.089 1.00 21.22 ? 147 LYS A NZ   1  
ATOM 2327   H H    . LYS A 1 147 ? -14.937 4.608   -11.198 1.00 3.53  ? 147 LYS A H    1  
ATOM 2328   H HA   . LYS A 1 147 ? -14.377 7.014   -12.765 1.00 33.13 ? 147 LYS A HA   1  
ATOM 2329   H HB2  . LYS A 1 147 ? -17.196 6.050   -12.409 1.00 3.23  ? 147 LYS A HB2  1  
ATOM 2330   H HB3  . LYS A 1 147 ? -16.363 6.577   -13.869 1.00 54.33 ? 147 LYS A HB3  1  
ATOM 2331   H HG2  . LYS A 1 147 ? -15.029 4.463   -13.820 1.00 63.24 ? 147 LYS A HG2  1  
ATOM 2332   H HG3  . LYS A 1 147 ? -15.986 3.932   -12.438 1.00 43.15 ? 147 LYS A HG3  1  
ATOM 2333   H HD2  . LYS A 1 147 ? -18.048 4.163   -13.815 1.00 2.30  ? 147 LYS A HD2  1  
ATOM 2334   H HD3  . LYS A 1 147 ? -17.040 4.573   -15.204 1.00 55.52 ? 147 LYS A HD3  1  
ATOM 2335   H HE2  . LYS A 1 147 ? -16.963 1.981   -13.634 1.00 31.33 ? 147 LYS A HE2  1  
ATOM 2336   H HE3  . LYS A 1 147 ? -17.574 2.191   -15.275 1.00 11.30 ? 147 LYS A HE3  1  
ATOM 2337   H HZ1  . LYS A 1 147 ? -15.293 1.323   -15.204 1.00 22.35 ? 147 LYS A HZ1  1  
ATOM 2338   H HZ2  . LYS A 1 147 ? -14.784 2.745   -14.426 1.00 33.43 ? 147 LYS A HZ2  1  
ATOM 2339   H HZ3  . LYS A 1 147 ? -15.391 2.812   -16.011 1.00 42.55 ? 147 LYS A HZ3  1  
ATOM 2340   N N    . PRO A 1 148 ? -16.167 7.214   -10.002 1.00 20.33 ? 148 PRO A N    1  
ATOM 2341   C CA   . PRO A 1 148 ? -16.728 8.158   -9.005  1.00 52.51 ? 148 PRO A CA   1  
ATOM 2342   C C    . PRO A 1 148 ? -15.680 8.638   -7.992  1.00 62.44 ? 148 PRO A C    1  
ATOM 2343   O O    . PRO A 1 148 ? -16.011 9.112   -6.923  1.00 65.23 ? 148 PRO A O    1  
ATOM 2344   C CB   . PRO A 1 148 ? -17.816 7.321   -8.324  1.00 13.44 ? 148 PRO A CB   1  
ATOM 2345   C CG   . PRO A 1 148 ? -17.323 5.898   -8.389  1.00 2.50  ? 148 PRO A CG   1  
ATOM 2346   C CD   . PRO A 1 148 ? -16.290 5.822   -9.534  1.00 51.32 ? 148 PRO A CD   1  
ATOM 2347   H HA   . PRO A 1 148 ? -17.180 9.002   -9.502  1.00 61.14 ? 148 PRO A HA   1  
ATOM 2348   H HB2  . PRO A 1 148 ? -17.947 7.637   -7.295  1.00 34.12 ? 148 PRO A HB2  1  
ATOM 2349   H HB3  . PRO A 1 148 ? -18.749 7.414   -8.862  1.00 25.42 ? 148 PRO A HB3  1  
ATOM 2350   H HG2  . PRO A 1 148 ? -16.856 5.625   -7.447  1.00 44.40 ? 148 PRO A HG2  1  
ATOM 2351   H HG3  . PRO A 1 148 ? -18.145 5.225   -8.595  1.00 21.43 ? 148 PRO A HG3  1  
ATOM 2352   H HD2  . PRO A 1 148 ? -15.339 5.465   -9.160  1.00 54.41 ? 148 PRO A HD2  1  
ATOM 2353   H HD3  . PRO A 1 148 ? -16.644 5.190   -10.333 1.00 75.45 ? 148 PRO A HD3  1  
ATOM 2354   N N    . PHE A 1 149 ? -14.418 8.522   -8.320  1.00 60.11 ? 149 PHE A N    1  
ATOM 2355   C CA   . PHE A 1 149 ? -13.351 8.976   -7.377  1.00 32.32 ? 149 PHE A CA   1  
ATOM 2356   C C    . PHE A 1 149 ? -12.935 10.413  -7.730  1.00 52.53 ? 149 PHE A C    1  
ATOM 2357   O O    . PHE A 1 149 ? -12.976 11.304  -6.904  1.00 54.10 ? 149 PHE A O    1  
ATOM 2358   C CB   . PHE A 1 149 ? -12.142 8.021   -7.475  1.00 34.43 ? 149 PHE A CB   1  
ATOM 2359   C CG   . PHE A 1 149 ? -11.228 8.419   -8.620  1.00 10.24 ? 149 PHE A CG   1  
ATOM 2360   C CD1  . PHE A 1 149 ? -11.627 8.208   -9.945  1.00 55.42 ? 149 PHE A CD1  1  
ATOM 2361   C CD2  . PHE A 1 149 ? -9.984  9.007   -8.350  1.00 23.01 ? 149 PHE A CD2  1  
ATOM 2362   C CE1  . PHE A 1 149 ? -10.782 8.582   -10.998 1.00 42.21 ? 149 PHE A CE1  1  
ATOM 2363   C CE2  . PHE A 1 149 ? -9.142  9.381   -9.403  1.00 20.51 ? 149 PHE A CE2  1  
ATOM 2364   C CZ   . PHE A 1 149 ? -9.540  9.168   -10.726 1.00 1.24  ? 149 PHE A CZ   1  
ATOM 2365   H H    . PHE A 1 149 ? -14.173 8.139   -9.188  1.00 1.43  ? 149 PHE A H    1  
ATOM 2366   H HA   . PHE A 1 149 ? -13.732 8.959   -6.363  1.00 3.33  ? 149 PHE A HA   1  
ATOM 2367   H HB2  . PHE A 1 149 ? -11.586 8.055   -6.548  1.00 61.01 ? 149 PHE A HB2  1  
ATOM 2368   H HB3  . PHE A 1 149 ? -12.497 7.014   -7.639  1.00 52.04 ? 149 PHE A HB3  1  
ATOM 2369   H HD1  . PHE A 1 149 ? -12.585 7.754   -10.155 1.00 64.21 ? 149 PHE A HD1  1  
ATOM 2370   H HD2  . PHE A 1 149 ? -9.675  9.174   -7.329  1.00 64.14 ? 149 PHE A HD2  1  
ATOM 2371   H HE1  . PHE A 1 149 ? -11.088 8.417   -12.020 1.00 42.44 ? 149 PHE A HE1  1  
ATOM 2372   H HE2  . PHE A 1 149 ? -8.184  9.836   -9.193  1.00 65.24 ? 149 PHE A HE2  1  
ATOM 2373   H HZ   . PHE A 1 149 ? -8.891  9.459   -11.540 1.00 40.00 ? 149 PHE A HZ   1  
ATOM 2374   N N    . GLU A 1 150 ? -12.534 10.635  -8.952  1.00 3.01  ? 150 GLU A N    1  
ATOM 2375   C CA   . GLU A 1 150 ? -12.108 12.003  -9.369  1.00 22.00 ? 150 GLU A CA   1  
ATOM 2376   C C    . GLU A 1 150 ? -13.204 13.014  -9.030  1.00 32.12 ? 150 GLU A C    1  
ATOM 2377   O O    . GLU A 1 150 ? -12.930 14.147  -8.689  1.00 64.21 ? 150 GLU A O    1  
ATOM 2378   C CB   . GLU A 1 150 ? -11.840 12.019  -10.878 1.00 11.02 ? 150 GLU A CB   1  
ATOM 2379   C CG   . GLU A 1 150 ? -12.939 11.241  -11.606 1.00 4.10  ? 150 GLU A CG   1  
ATOM 2380   C CD   . GLU A 1 150 ? -12.736 11.370  -13.116 1.00 24.33 ? 150 GLU A CD   1  
ATOM 2381   O OE1  . GLU A 1 150 ? -12.442 12.465  -13.563 1.00 23.52 ? 150 GLU A OE1  1  
ATOM 2382   O OE2  . GLU A 1 150 ? -12.877 10.368  -13.799 1.00 1.11  ? 150 GLU A OE2  1  
ATOM 2383   H H    . GLU A 1 150 ? -12.508 9.899   -9.597  1.00 12.44 ? 150 GLU A H    1  
ATOM 2384   H HA   . GLU A 1 150 ? -11.205 12.268  -8.845  1.00 25.01 ? 150 GLU A HA   1  
ATOM 2385   H HB2  . GLU A 1 150 ? -11.825 13.040  -11.232 1.00 3.42  ? 150 GLU A HB2  1  
ATOM 2386   H HB3  . GLU A 1 150 ? -10.884 11.556  -11.077 1.00 72.52 ? 150 GLU A HB3  1  
ATOM 2387   H HG2  . GLU A 1 150 ? -12.890 10.200  -11.324 1.00 63.54 ? 150 GLU A HG2  1  
ATOM 2388   H HG3  . GLU A 1 150 ? -13.904 11.643  -11.339 1.00 35.54 ? 150 GLU A HG3  1  
ATOM 2389   N N    . VAL A 1 151 ? -14.444 12.622  -9.123  1.00 4.14  ? 151 VAL A N    1  
ATOM 2390   C CA   . VAL A 1 151 ? -15.544 13.574  -8.803  1.00 71.02 ? 151 VAL A CA   1  
ATOM 2391   C C    . VAL A 1 151 ? -15.448 13.982  -7.330  1.00 11.20 ? 151 VAL A C    1  
ATOM 2392   O O    . VAL A 1 151 ? -15.636 15.130  -6.980  1.00 72.02 ? 151 VAL A O    1  
ATOM 2393   C CB   . VAL A 1 151 ? -16.898 12.907  -9.072  1.00 10.31 ? 151 VAL A CB   1  
ATOM 2394   C CG1  . VAL A 1 151 ? -17.157 11.817  -8.029  1.00 24.11 ? 151 VAL A CG1  1  
ATOM 2395   C CG2  . VAL A 1 151 ? -18.008 13.960  -9.000  1.00 31.01 ? 151 VAL A CG2  1  
ATOM 2396   H H    . VAL A 1 151 ? -14.652 11.704  -9.402  1.00 32.52 ? 151 VAL A H    1  
ATOM 2397   H HA   . VAL A 1 151 ? -15.445 14.452  -9.424  1.00 24.04 ? 151 VAL A HA   1  
ATOM 2398   H HB   . VAL A 1 151 ? -16.887 12.463  -10.056 1.00 31.20 ? 151 VAL A HB   1  
ATOM 2399   H HG11 . VAL A 1 151 ? -17.446 12.273  -7.093  1.00 3.41  ? 151 VAL A HG11 1  
ATOM 2400   H HG12 . VAL A 1 151 ? -16.258 11.239  -7.883  1.00 34.32 ? 151 VAL A HG12 1  
ATOM 2401   H HG13 . VAL A 1 151 ? -17.950 11.168  -8.374  1.00 15.31 ? 151 VAL A HG13 1  
ATOM 2402   H HG21 . VAL A 1 151 ? -17.745 14.806  -9.618  1.00 74.21 ? 151 VAL A HG21 1  
ATOM 2403   H HG22 . VAL A 1 151 ? -18.132 14.285  -7.978  1.00 0.33  ? 151 VAL A HG22 1  
ATOM 2404   H HG23 . VAL A 1 151 ? -18.932 13.531  -9.355  1.00 63.34 ? 151 VAL A HG23 1  
ATOM 2405   N N    . LEU A 1 152 ? -15.159 13.047  -6.463  1.00 51.54 ? 152 LEU A N    1  
ATOM 2406   C CA   . LEU A 1 152 ? -15.051 13.383  -5.015  1.00 34.25 ? 152 LEU A CA   1  
ATOM 2407   C C    . LEU A 1 152 ? -13.887 14.362  -4.825  1.00 53.21 ? 152 LEU A C    1  
ATOM 2408   O O    . LEU A 1 152 ? -14.005 15.370  -4.158  1.00 55.15 ? 152 LEU A O    1  
ATOM 2409   C CB   . LEU A 1 152 ? -14.803 12.089  -4.211  1.00 73.31 ? 152 LEU A CB   1  
ATOM 2410   C CG   . LEU A 1 152 ? -15.341 12.221  -2.772  1.00 2.01  ? 152 LEU A CG   1  
ATOM 2411   C CD1  . LEU A 1 152 ? -14.789 13.497  -2.124  1.00 4.31  ? 152 LEU A CD1  1  
ATOM 2412   C CD2  . LEU A 1 152 ? -16.886 12.257  -2.767  1.00 22.13 ? 152 LEU A CD2  1  
ATOM 2413   H H    . LEU A 1 152 ? -15.013 12.125  -6.765  1.00 73.31 ? 152 LEU A H    1  
ATOM 2414   H HA   . LEU A 1 152 ? -15.969 13.847  -4.691  1.00 65.43 ? 152 LEU A HA   1  
ATOM 2415   H HB2  . LEU A 1 152 ? -15.298 11.265  -4.704  1.00 33.03 ? 152 LEU A HB2  1  
ATOM 2416   H HB3  . LEU A 1 152 ? -13.741 11.885  -4.173  1.00 15.33 ? 152 LEU A HB3  1  
ATOM 2417   H HG   . LEU A 1 152 ? -15.006 11.368  -2.198  1.00 11.22 ? 152 LEU A HG   1  
ATOM 2418   H HD11 . LEU A 1 152 ? -14.919 13.439  -1.053  1.00 72.32 ? 152 LEU A HD11 1  
ATOM 2419   H HD12 . LEU A 1 152 ? -15.322 14.354  -2.503  1.00 35.14 ? 152 LEU A HD12 1  
ATOM 2420   H HD13 . LEU A 1 152 ? -13.739 13.593  -2.353  1.00 41.40 ? 152 LEU A HD13 1  
ATOM 2421   H HD21 . LEU A 1 152 ? -17.235 13.276  -2.853  1.00 43.00 ? 152 LEU A HD21 1  
ATOM 2422   H HD22 . LEU A 1 152 ? -17.246 11.838  -1.839  1.00 42.20 ? 152 LEU A HD22 1  
ATOM 2423   H HD23 . LEU A 1 152 ? -17.272 11.674  -3.590  1.00 73.12 ? 152 LEU A HD23 1  
ATOM 2424   N N    . THR A 1 153 ? -12.762 14.074  -5.417  1.00 62.12 ? 153 THR A N    1  
ATOM 2425   C CA   . THR A 1 153 ? -11.597 14.988  -5.279  1.00 45.53 ? 153 THR A CA   1  
ATOM 2426   C C    . THR A 1 153 ? -11.904 16.303  -5.993  1.00 74.31 ? 153 THR A C    1  
ATOM 2427   O O    . THR A 1 153 ? -11.386 17.344  -5.645  1.00 21.34 ? 153 THR A O    1  
ATOM 2428   C CB   . THR A 1 153 ? -10.367 14.340  -5.918  1.00 12.24 ? 153 THR A CB   1  
ATOM 2429   O OG1  . THR A 1 153 ? -10.694 13.905  -7.230  1.00 2.31  ? 153 THR A OG1  1  
ATOM 2430   C CG2  . THR A 1 153 ? -9.915  13.143  -5.079  1.00 13.42 ? 153 THR A CG2  1  
ATOM 2431   H H    . THR A 1 153 ? -12.686 13.259  -5.956  1.00 43.43 ? 153 THR A H    1  
ATOM 2432   H HA   . THR A 1 153 ? -11.405 15.177  -4.233  1.00 22.03 ? 153 THR A HA   1  
ATOM 2433   H HB   . THR A 1 153 ? -9.569  15.061  -5.967  1.00 63.11 ? 153 THR A HB   1  
ATOM 2434   H HG1  . THR A 1 153 ? -9.973  14.154  -7.812  1.00 51.30 ? 153 THR A HG1  1  
ATOM 2435   H HG21 . THR A 1 153 ? -9.401  13.495  -4.197  1.00 54.12 ? 153 THR A HG21 1  
ATOM 2436   H HG22 . THR A 1 153 ? -9.246  12.529  -5.663  1.00 62.02 ? 153 THR A HG22 1  
ATOM 2437   H HG23 . THR A 1 153 ? -10.776 12.561  -4.786  1.00 24.20 ? 153 THR A HG23 1  
ATOM 2438   N N    . HIS A 1 154 ? -12.737 16.263  -6.996  1.00 52.21 ? 154 HIS A N    1  
ATOM 2439   C CA   . HIS A 1 154 ? -13.070 17.509  -7.741  1.00 50.23 ? 154 HIS A CA   1  
ATOM 2440   C C    . HIS A 1 154 ? -13.722 18.520  -6.796  1.00 1.54  ? 154 HIS A C    1  
ATOM 2441   O O    . HIS A 1 154 ? -13.285 19.647  -6.684  1.00 60.14 ? 154 HIS A O    1  
ATOM 2442   C CB   . HIS A 1 154 ? -14.035 17.180  -8.882  1.00 63.42 ? 154 HIS A CB   1  
ATOM 2443   C CG   . HIS A 1 154 ? -14.075 18.329  -9.852  1.00 34.53 ? 154 HIS A CG   1  
ATOM 2444   N ND1  . HIS A 1 154 ? -12.987 18.661  -10.649 1.00 4.00  ? 154 HIS A ND1  1  
ATOM 2445   C CD2  . HIS A 1 154 ? -15.057 19.236  -10.162 1.00 74.31 ? 154 HIS A CD2  1  
ATOM 2446   C CE1  . HIS A 1 154 ? -13.338 19.728  -11.390 1.00 53.24 ? 154 HIS A CE1  1  
ATOM 2447   N NE2  . HIS A 1 154 ? -14.588 20.114  -11.132 1.00 21.04 ? 154 HIS A NE2  1  
ATOM 2448   H H    . HIS A 1 154 ? -13.139 15.411  -7.264  1.00 35.34 ? 154 HIS A H    1  
ATOM 2449   H HA   . HIS A 1 154 ? -12.163 17.934  -8.147  1.00 15.13 ? 154 HIS A HA   1  
ATOM 2450   H HB2  . HIS A 1 154 ? -13.698 16.288  -9.392  1.00 71.23 ? 154 HIS A HB2  1  
ATOM 2451   H HB3  . HIS A 1 154 ? -15.024 17.014  -8.482  1.00 75.45 ? 154 HIS A HB3  1  
ATOM 2452   H HD1  . HIS A 1 154 ? -12.120 18.203  -10.667 1.00 55.23 ? 154 HIS A HD1  1  
ATOM 2453   H HD2  . HIS A 1 154 ? -16.043 19.262  -9.721  1.00 72.31 ? 154 HIS A HD2  1  
ATOM 2454   H HE1  . HIS A 1 154 ? -12.689 20.211  -12.107 1.00 22.52 ? 154 HIS A HE1  1  
ATOM 2455   H HE2  . HIS A 1 154 ? -15.073 20.861  -11.539 1.00 0.00  ? 154 HIS A HE2  1  
ATOM 2456   N N    . LEU A 1 155 ? -14.766 18.132  -6.114  1.00 30.23 ? 155 LEU A N    1  
ATOM 2457   C CA   . LEU A 1 155 ? -15.430 19.086  -5.184  1.00 52.32 ? 155 LEU A CA   1  
ATOM 2458   C C    . LEU A 1 155 ? -14.509 19.353  -3.993  1.00 61.31 ? 155 LEU A C    1  
ATOM 2459   O O    . LEU A 1 155 ? -14.631 20.356  -3.318  1.00 75.34 ? 155 LEU A O    1  
ATOM 2460   C CB   . LEU A 1 155 ? -16.782 18.527  -4.714  1.00 42.12 ? 155 LEU A CB   1  
ATOM 2461   C CG   . LEU A 1 155 ? -16.623 17.104  -4.134  1.00 13.15 ? 155 LEU A CG   1  
ATOM 2462   C CD1  . LEU A 1 155 ? -16.071 17.138  -2.685  1.00 64.45 ? 155 LEU A CD1  1  
ATOM 2463   C CD2  . LEU A 1 155 ? -17.993 16.405  -4.155  1.00 14.04 ? 155 LEU A CD2  1  
ATOM 2464   H H    . LEU A 1 155 ? -15.109 17.220  -6.214  1.00 2.44  ? 155 LEU A H    1  
ATOM 2465   H HA   . LEU A 1 155 ? -15.598 20.018  -5.707  1.00 44.15 ? 155 LEU A HA   1  
ATOM 2466   H HB2  . LEU A 1 155 ? -17.201 19.184  -3.968  1.00 24.33 ? 155 LEU A HB2  1  
ATOM 2467   H HB3  . LEU A 1 155 ? -17.452 18.491  -5.562  1.00 14.41 ? 155 LEU A HB3  1  
ATOM 2468   H HG   . LEU A 1 155 ? -15.939 16.547  -4.755  1.00 5.32  ? 155 LEU A HG   1  
ATOM 2469   H HD11 . LEU A 1 155 ? -15.018 16.913  -2.703  1.00 52.11 ? 155 LEU A HD11 1  
ATOM 2470   H HD12 . LEU A 1 155 ? -16.574 16.397  -2.078  1.00 73.53 ? 155 LEU A HD12 1  
ATOM 2471   H HD13 . LEU A 1 155 ? -16.219 18.113  -2.244  1.00 10.35 ? 155 LEU A HD13 1  
ATOM 2472   H HD21 . LEU A 1 155 ? -18.272 16.190  -5.176  1.00 65.20 ? 155 LEU A HD21 1  
ATOM 2473   H HD22 . LEU A 1 155 ? -18.734 17.053  -3.708  1.00 50.44 ? 155 LEU A HD22 1  
ATOM 2474   H HD23 . LEU A 1 155 ? -17.936 15.484  -3.595  1.00 42.24 ? 155 LEU A HD23 1  
ATOM 2475   N N    . ALA A 1 156 ? -13.579 18.473  -3.736  1.00 51.21 ? 156 ALA A N    1  
ATOM 2476   C CA   . ALA A 1 156 ? -12.647 18.697  -2.595  1.00 61.35 ? 156 ALA A CA   1  
ATOM 2477   C C    . ALA A 1 156 ? -11.796 19.935  -2.884  1.00 62.14 ? 156 ALA A C    1  
ATOM 2478   O O    . ALA A 1 156 ? -11.587 20.772  -2.028  1.00 11.42 ? 156 ALA A O    1  
ATOM 2479   C CB   . ALA A 1 156 ? -11.737 17.478  -2.425  1.00 14.42 ? 156 ALA A CB   1  
ATOM 2480   H H    . ALA A 1 156 ? -13.488 17.671  -4.297  1.00 43.13 ? 156 ALA A H    1  
ATOM 2481   H HA   . ALA A 1 156 ? -13.216 18.854  -1.691  1.00 14.41 ? 156 ALA A HA   1  
ATOM 2482   H HB1  . ALA A 1 156 ? -11.112 17.614  -1.555  1.00 51.11 ? 156 ALA A HB1  1  
ATOM 2483   H HB2  . ALA A 1 156 ? -11.115 17.367  -3.301  1.00 44.15 ? 156 ALA A HB2  1  
ATOM 2484   H HB3  . ALA A 1 156 ? -12.341 16.593  -2.300  1.00 15.14 ? 156 ALA A HB3  1  
ATOM 2485   N N    . ARG A 1 157 ? -11.312 20.064  -4.090  1.00 52.41 ? 157 ARG A N    1  
ATOM 2486   C CA   . ARG A 1 157 ? -10.483 21.252  -4.440  1.00 4.55  ? 157 ARG A CA   1  
ATOM 2487   C C    . ARG A 1 157 ? -11.395 22.451  -4.651  1.00 41.13 ? 157 ARG A C    1  
ATOM 2488   O O    . ARG A 1 157 ? -11.174 23.522  -4.123  1.00 55.30 ? 157 ARG A O    1  
ATOM 2489   C CB   . ARG A 1 157 ? -9.730  20.995  -5.743  1.00 54.14 ? 157 ARG A CB   1  
ATOM 2490   C CG   . ARG A 1 157 ? -8.974  19.671  -5.657  1.00 61.03 ? 157 ARG A CG   1  
ATOM 2491   C CD   . ARG A 1 157 ? -8.374  19.330  -7.027  1.00 33.13 ? 157 ARG A CD   1  
ATOM 2492   N NE   . ARG A 1 157 ? -9.394  18.623  -7.853  1.00 20.23 ? 157 ARG A NE   1  
ATOM 2493   C CZ   . ARG A 1 157 ? -9.178  18.420  -9.125  1.00 1.40  ? 157 ARG A CZ   1  
ATOM 2494   N NH1  . ARG A 1 157 ? -8.071  18.839  -9.675  1.00 43.04 ? 157 ARG A NH1  1  
ATOM 2495   N NH2  . ARG A 1 157 ? -10.069 17.799  -9.849  1.00 13.12 ? 157 ARG A NH2  1  
ATOM 2496   H H    . ARG A 1 157 ? -11.499 19.381  -4.768  1.00 71.51 ? 157 ARG A H    1  
ATOM 2497   H HA   . ARG A 1 157 ? -9.783  21.459  -3.647  1.00 51.04 ? 157 ARG A HA   1  
ATOM 2498   H HB2  . ARG A 1 157 ? -10.433 20.953  -6.562  1.00 12.33 ? 157 ARG A HB2  1  
ATOM 2499   H HB3  . ARG A 1 157 ? -9.027  21.796  -5.914  1.00 34.02 ? 157 ARG A HB3  1  
ATOM 2500   H HG2  . ARG A 1 157 ? -8.184  19.755  -4.925  1.00 14.04 ? 157 ARG A HG2  1  
ATOM 2501   H HG3  . ARG A 1 157 ? -9.656  18.891  -5.362  1.00 72.22 ? 157 ARG A HG3  1  
ATOM 2502   H HD2  . ARG A 1 157 ? -8.072  20.239  -7.530  1.00 44.32 ? 157 ARG A HD2  1  
ATOM 2503   H HD3  . ARG A 1 157 ? -7.514  18.691  -6.894  1.00 10.42 ? 157 ARG A HD3  1  
ATOM 2504   H HE   . ARG A 1 157 ? -10.226 18.309  -7.441  1.00 54.43 ? 157 ARG A HE   1  
ATOM 2505   H HH11 . ARG A 1 157 ? -7.388  19.317  -9.122  1.00 25.24 ? 157 ARG A HH11 1  
ATOM 2506   H HH12 . ARG A 1 157 ? -7.905  18.682  -10.649 1.00 50.04 ? 157 ARG A HH12 1  
ATOM 2507   H HH21 . ARG A 1 157 ? -10.919 17.479  -9.430  1.00 65.31 ? 157 ARG A HH21 1  
ATOM 2508   H HH22 . ARG A 1 157 ? -9.903  17.644  -10.823 1.00 70.21 ? 157 ARG A HH22 1  
ATOM 2509   N N    . HIS A 1 158 ? -12.416 22.274  -5.436  1.00 33.25 ? 158 HIS A N    1  
ATOM 2510   C CA   . HIS A 1 158 ? -13.348 23.398  -5.707  1.00 13.23 ? 158 HIS A CA   1  
ATOM 2511   C C    . HIS A 1 158 ? -14.187 23.675  -4.459  1.00 54.21 ? 158 HIS A C    1  
ATOM 2512   O O    . HIS A 1 158 ? -15.215 24.317  -4.520  1.00 21.11 ? 158 HIS A O    1  
ATOM 2513   C CB   . HIS A 1 158 ? -14.266 23.034  -6.875  1.00 2.21  ? 158 HIS A CB   1  
ATOM 2514   C CG   . HIS A 1 158 ? -13.466 23.019  -8.148  1.00 14.01 ? 158 HIS A CG   1  
ATOM 2515   N ND1  . HIS A 1 158 ? -12.231 23.643  -8.250  1.00 74.12 ? 158 HIS A ND1  1  
ATOM 2516   C CD2  . HIS A 1 158 ? -13.710 22.463  -9.380  1.00 62.13 ? 158 HIS A CD2  1  
ATOM 2517   C CE1  . HIS A 1 158 ? -11.782 23.451  -9.504  1.00 62.51 ? 158 HIS A CE1  1  
ATOM 2518   N NE2  . HIS A 1 158 ? -12.645 22.739  -10.230 1.00 1.33  ? 158 HIS A NE2  1  
ATOM 2519   H H    . HIS A 1 158 ? -12.562 21.398  -5.854  1.00 1.25  ? 158 HIS A H    1  
ATOM 2520   H HA   . HIS A 1 158 ? -12.775 24.276  -5.961  1.00 15.01 ? 158 HIS A HA   1  
ATOM 2521   H HB2  . HIS A 1 158 ? -14.695 22.057  -6.707  1.00 41.01 ? 158 HIS A HB2  1  
ATOM 2522   H HB3  . HIS A 1 158 ? -15.055 23.766  -6.955  1.00 64.12 ? 158 HIS A HB3  1  
ATOM 2523   H HD1  . HIS A 1 158 ? -11.770 24.135  -7.539  1.00 21.13 ? 158 HIS A HD1  1  
ATOM 2524   H HD2  . HIS A 1 158 ? -14.591 21.900  -9.647  1.00 1.11  ? 158 HIS A HD2  1  
ATOM 2525   H HE1  . HIS A 1 158 ? -10.839 23.826  -9.876  1.00 1.11  ? 158 HIS A HE1  1  
ATOM 2526   H HE2  . HIS A 1 158 ? -12.549 22.469  -11.168 1.00 0.00  ? 158 HIS A HE2  1  
ATOM 2527   N N    . ARG A 1 159 ? -13.755 23.195  -3.326  1.00 32.34 ? 159 ARG A N    1  
ATOM 2528   C CA   . ARG A 1 159 ? -14.526 23.434  -2.077  1.00 2.43  ? 159 ARG A CA   1  
ATOM 2529   C C    . ARG A 1 159 ? -14.802 24.932  -1.935  1.00 1.43  ? 159 ARG A C    1  
ATOM 2530   O O    . ARG A 1 159 ? -14.102 25.755  -2.491  1.00 50.04 ? 159 ARG A O    1  
ATOM 2531   C CB   . ARG A 1 159 ? -13.714 22.941  -0.877  1.00 70.32 ? 159 ARG A CB   1  
ATOM 2532   C CG   . ARG A 1 159 ? -12.448 23.788  -0.729  1.00 53.23 ? 159 ARG A CG   1  
ATOM 2533   C CD   . ARG A 1 159 ? -11.492 23.102  0.249   1.00 23.11 ? 159 ARG A CD   1  
ATOM 2534   N NE   . ARG A 1 159 ? -10.287 23.955  0.452   1.00 71.13 ? 159 ARG A NE   1  
ATOM 2535   C CZ   . ARG A 1 159 ? -9.354  23.995  -0.460  1.00 51.24 ? 159 ARG A CZ   1  
ATOM 2536   N NH1  . ARG A 1 159 ? -9.477  23.291  -1.553  1.00 44.03 ? 159 ARG A NH1  1  
ATOM 2537   N NH2  . ARG A 1 159 ? -8.297  24.739  -0.279  1.00 31.44 ? 159 ARG A NH2  1  
ATOM 2538   H H    . ARG A 1 159 ? -12.924 22.680  -3.296  1.00 20.13 ? 159 ARG A H    1  
ATOM 2539   H HA   . ARG A 1 159 ? -15.463 22.898  -2.124  1.00 61.44 ? 159 ARG A HA   1  
ATOM 2540   H HB2  . ARG A 1 159 ? -14.310 23.024  0.019   1.00 43.24 ? 159 ARG A HB2  1  
ATOM 2541   H HB3  . ARG A 1 159 ? -13.437 21.909  -1.030  1.00 14.01 ? 159 ARG A HB3  1  
ATOM 2542   H HG2  . ARG A 1 159 ? -11.969 23.891  -1.691  1.00 33.10 ? 159 ARG A HG2  1  
ATOM 2543   H HG3  . ARG A 1 159 ? -12.710 24.764  -0.349  1.00 22.15 ? 159 ARG A HG3  1  
ATOM 2544   H HD2  . ARG A 1 159 ? -11.991 22.955  1.196   1.00 12.42 ? 159 ARG A HD2  1  
ATOM 2545   H HD3  . ARG A 1 159 ? -11.193 22.145  -0.152  1.00 53.25 ? 159 ARG A HD3  1  
ATOM 2546   H HE   . ARG A 1 159 ? -10.195 24.485  1.270   1.00 2.50  ? 159 ARG A HE   1  
ATOM 2547   H HH11 . ARG A 1 159 ? -10.287 22.722  -1.692  1.00 14.13 ? 159 ARG A HH11 1  
ATOM 2548   H HH12 . ARG A 1 159 ? -8.761  23.322  -2.250  1.00 74.34 ? 159 ARG A HH12 1  
ATOM 2549   H HH21 . ARG A 1 159 ? -8.203  25.279  0.557   1.00 74.23 ? 159 ARG A HH21 1  
ATOM 2550   H HH22 . ARG A 1 159 ? -7.581  24.768  -0.976  1.00 74.24 ? 159 ARG A HH22 1  
ATOM 2551   N N    . ASP A 1 160 ? -15.819 25.289  -1.199  1.00 32.45 ? 160 ASP A N    1  
ATOM 2552   C CA   . ASP A 1 160 ? -16.147 26.733  -1.020  1.00 35.40 ? 160 ASP A CA   1  
ATOM 2553   C C    . ASP A 1 160 ? -16.324 27.395  -2.389  1.00 75.45 ? 160 ASP A C    1  
ATOM 2554   O O    . ASP A 1 160 ? -15.783 28.450  -2.653  1.00 11.13 ? 160 ASP A O    1  
ATOM 2555   C CB   . ASP A 1 160 ? -15.015 27.427  -0.257  1.00 64.13 ? 160 ASP A CB   1  
ATOM 2556   C CG   . ASP A 1 160 ? -14.750 26.685  1.054   1.00 42.33 ? 160 ASP A CG   1  
ATOM 2557   O OD1  . ASP A 1 160 ? -15.709 26.375  1.741   1.00 4.12  ? 160 ASP A OD1  1  
ATOM 2558   O OD2  . ASP A 1 160 ? -13.592 26.439  1.348   1.00 33.31 ? 160 ASP A OD2  1  
ATOM 2559   H H    . ASP A 1 160 ? -16.370 24.606  -0.765  1.00 31.45 ? 160 ASP A H    1  
ATOM 2560   H HA   . ASP A 1 160 ? -17.065 26.822  -0.458  1.00 51.44 ? 160 ASP A HA   1  
ATOM 2561   H HB2  . ASP A 1 160 ? -14.119 27.427  -0.860  1.00 72.30 ? 160 ASP A HB2  1  
ATOM 2562   H HB3  . ASP A 1 160 ? -15.301 28.445  -0.040  1.00 62.44 ? 160 ASP A HB3  1  
ATOM 2563   N N    . GLN A 1 161 ? -17.082 26.786  -3.263  1.00 62.45 ? 161 GLN A N    1  
ATOM 2564   C CA   . GLN A 1 161 ? -17.296 27.385  -4.615  1.00 64.00 ? 161 GLN A CA   1  
ATOM 2565   C C    . GLN A 1 161 ? -18.622 26.884  -5.192  1.00 3.33  ? 161 GLN A C    1  
ATOM 2566   O O    . GLN A 1 161 ? -19.079 25.802  -4.881  1.00 15.14 ? 161 GLN A O    1  
ATOM 2567   C CB   . GLN A 1 161 ? -16.149 26.979  -5.544  1.00 35.10 ? 161 GLN A CB   1  
ATOM 2568   C CG   . GLN A 1 161 ? -16.170 27.859  -6.796  1.00 14.25 ? 161 GLN A CG   1  
ATOM 2569   C CD   . GLN A 1 161 ? -15.008 27.474  -7.713  1.00 73.41 ? 161 GLN A CD   1  
ATOM 2570   O OE1  . GLN A 1 161 ? -14.955 27.890  -8.853  1.00 51.24 ? 161 GLN A OE1  1  
ATOM 2571   N NE2  . GLN A 1 161 ? -14.065 26.693  -7.260  1.00 42.43 ? 161 GLN A NE2  1  
ATOM 2572   H H    . GLN A 1 161 ? -17.512 25.937  -3.030  1.00 30.32 ? 161 GLN A H    1  
ATOM 2573   H HA   . GLN A 1 161 ? -17.327 28.462  -4.533  1.00 40.32 ? 161 GLN A HA   1  
ATOM 2574   H HB2  . GLN A 1 161 ? -15.208 27.104  -5.030  1.00 12.13 ? 161 GLN A HB2  1  
ATOM 2575   H HB3  . GLN A 1 161 ? -16.269 25.946  -5.833  1.00 23.22 ? 161 GLN A HB3  1  
ATOM 2576   H HG2  . GLN A 1 161 ? -17.105 27.717  -7.319  1.00 42.12 ? 161 GLN A HG2  1  
ATOM 2577   H HG3  . GLN A 1 161 ? -16.072 28.894  -6.509  1.00 10.45 ? 161 GLN A HG3  1  
ATOM 2578   H HE21 . GLN A 1 161 ? -14.106 26.359  -6.339  1.00 53.33 ? 161 GLN A HE21 1  
ATOM 2579   H HE22 . GLN A 1 161 ? -13.316 26.441  -7.840  1.00 43.40 ? 161 GLN A HE22 1  
ATOM 2580   N N    . ILE A 1 162 ? -19.246 27.667  -6.033  1.00 53.15 ? 162 ILE A N    1  
ATOM 2581   C CA   . ILE A 1 162 ? -20.545 27.246  -6.636  1.00 74.41 ? 162 ILE A CA   1  
ATOM 2582   C C    . ILE A 1 162 ? -20.280 26.478  -7.932  1.00 32.43 ? 162 ILE A C    1  
ATOM 2583   O O    . ILE A 1 162 ? -19.436 26.851  -8.722  1.00 73.33 ? 162 ILE A O    1  
ATOM 2584   C CB   . ILE A 1 162 ? -21.382 28.488  -6.949  1.00 65.14 ? 162 ILE A CB   1  
ATOM 2585   C CG1  . ILE A 1 162 ? -21.746 29.200  -5.645  1.00 53.14 ? 162 ILE A CG1  1  
ATOM 2586   C CG2  . ILE A 1 162 ? -22.659 28.072  -7.680  1.00 65.24 ? 162 ILE A CG2  1  
ATOM 2587   C CD1  . ILE A 1 162 ? -22.336 30.576  -5.960  1.00 43.10 ? 162 ILE A CD1  1  
ATOM 2588   H H    . ILE A 1 162 ? -18.858 28.536  -6.268  1.00 64.01 ? 162 ILE A H    1  
ATOM 2589   H HA   . ILE A 1 162 ? -21.083 26.613  -5.944  1.00 54.22 ? 162 ILE A HA   1  
ATOM 2590   H HB   . ILE A 1 162 ? -20.810 29.155  -7.578  1.00 15.33 ? 162 ILE A HB   1  
ATOM 2591   H HG12 . ILE A 1 162 ? -22.472 28.610  -5.103  1.00 1.55  ? 162 ILE A HG12 1  
ATOM 2592   H HG13 . ILE A 1 162 ? -20.858 29.321  -5.042  1.00 15.14 ? 162 ILE A HG13 1  
ATOM 2593   H HG21 . ILE A 1 162 ? -22.414 27.777  -8.689  1.00 32.14 ? 162 ILE A HG21 1  
ATOM 2594   H HG22 . ILE A 1 162 ? -23.348 28.903  -7.704  1.00 41.41 ? 162 ILE A HG22 1  
ATOM 2595   H HG23 . ILE A 1 162 ? -23.115 27.240  -7.163  1.00 23.12 ? 162 ILE A HG23 1  
ATOM 2596   H HD11 . ILE A 1 162 ? -22.831 30.964  -5.083  1.00 22.43 ? 162 ILE A HD11 1  
ATOM 2597   H HD12 . ILE A 1 162 ? -23.050 30.487  -6.766  1.00 41.31 ? 162 ILE A HD12 1  
ATOM 2598   H HD13 . ILE A 1 162 ? -21.544 31.248  -6.253  1.00 25.20 ? 162 ILE A HD13 1  
ATOM 2599   N N    . VAL A 1 163 ? -21.000 25.408  -8.159  1.00 44.30 ? 163 VAL A N    1  
ATOM 2600   C CA   . VAL A 1 163 ? -20.799 24.609  -9.408  1.00 33.44 ? 163 VAL A CA   1  
ATOM 2601   C C    . VAL A 1 163 ? -22.160 24.169  -9.952  1.00 4.20  ? 163 VAL A C    1  
ATOM 2602   O O    . VAL A 1 163 ? -22.989 23.649  -9.231  1.00 3.22  ? 163 VAL A O    1  
ATOM 2603   C CB   . VAL A 1 163 ? -19.952 23.377  -9.089  1.00 72.31 ? 163 VAL A CB   1  
ATOM 2604   C CG1  . VAL A 1 163 ? -19.654 22.613  -10.380 1.00 51.32 ? 163 VAL A CG1  1  
ATOM 2605   C CG2  . VAL A 1 163 ? -18.637 23.821  -8.443  1.00 45.34 ? 163 VAL A CG2  1  
ATOM 2606   H H    . VAL A 1 163 ? -21.678 25.128  -7.506  1.00 5.25  ? 163 VAL A H    1  
ATOM 2607   H HA   . VAL A 1 163 ? -20.296 25.209  -10.155 1.00 33.32 ? 163 VAL A HA   1  
ATOM 2608   H HB   . VAL A 1 163 ? -20.492 22.736  -8.407  1.00 31.40 ? 163 VAL A HB   1  
ATOM 2609   H HG11 . VAL A 1 163 ? -19.353 23.308  -11.150 1.00 43.21 ? 163 VAL A HG11 1  
ATOM 2610   H HG12 . VAL A 1 163 ? -20.542 22.087  -10.699 1.00 54.34 ? 163 VAL A HG12 1  
ATOM 2611   H HG13 . VAL A 1 163 ? -18.859 21.903  -10.204 1.00 32.45 ? 163 VAL A HG13 1  
ATOM 2612   H HG21 . VAL A 1 163 ? -18.825 24.138  -7.427  1.00 44.13 ? 163 VAL A HG21 1  
ATOM 2613   H HG22 . VAL A 1 163 ? -18.218 24.642  -9.004  1.00 40.21 ? 163 VAL A HG22 1  
ATOM 2614   H HG23 . VAL A 1 163 ? -17.941 22.995  -8.439  1.00 72.53 ? 163 VAL A HG23 1  
ATOM 2615   N N    . SER A 1 164 ? -22.398 24.374  -11.220 1.00 2.21  ? 164 SER A N    1  
ATOM 2616   C CA   . SER A 1 164 ? -23.707 23.969  -11.805 1.00 23.53 ? 164 SER A CA   1  
ATOM 2617   C C    . SER A 1 164 ? -23.717 22.459  -12.050 1.00 3.55  ? 164 SER A C    1  
ATOM 2618   O O    . SER A 1 164 ? -22.691 21.809  -12.037 1.00 0.45  ? 164 SER A O    1  
ATOM 2619   C CB   . SER A 1 164 ? -23.931 24.705  -13.127 1.00 74.12 ? 164 SER A CB   1  
ATOM 2620   O OG   . SER A 1 164 ? -25.266 24.489  -13.564 1.00 73.31 ? 164 SER A OG   1  
ATOM 2621   H H    . SER A 1 164 ? -21.717 24.795  -11.785 1.00 42.02 ? 164 SER A H    1  
ATOM 2622   H HA   . SER A 1 164 ? -24.500 24.223  -11.116 1.00 1.10  ? 164 SER A HA   1  
ATOM 2623   H HB2  . SER A 1 164 ? -23.771 25.762  -12.985 1.00 21.22 ? 164 SER A HB2  1  
ATOM 2624   H HB3  . SER A 1 164 ? -23.235 24.334  -13.866 1.00 41.13 ? 164 SER A HB3  1  
ATOM 2625   H HG   . SER A 1 164 ? -25.319 23.603  -13.930 1.00 63.31 ? 164 SER A HG   1  
ATOM 2626   N N    . LYS A 1 165 ? -24.875 21.899  -12.267 1.00 11.34 ? 165 LYS A N    1  
ATOM 2627   C CA   . LYS A 1 165 ? -24.965 20.432  -12.505 1.00 24.40 ? 165 LYS A CA   1  
ATOM 2628   C C    . LYS A 1 165 ? -24.219 20.066  -13.793 1.00 40.11 ? 165 LYS A C    1  
ATOM 2629   O O    . LYS A 1 165 ? -23.426 19.143  -13.826 1.00 13.41 ? 165 LYS A O    1  
ATOM 2630   C CB   . LYS A 1 165 ? -26.438 20.037  -12.650 1.00 31.24 ? 165 LYS A CB   1  
ATOM 2631   C CG   . LYS A 1 165 ? -27.261 20.682  -11.528 1.00 63.33 ? 165 LYS A CG   1  
ATOM 2632   C CD   . LYS A 1 165 ? -28.612 19.968  -11.413 1.00 43.42 ? 165 LYS A CD   1  
ATOM 2633   C CE   . LYS A 1 165 ? -29.537 20.756  -10.484 1.00 40.21 ? 165 LYS A CE   1  
ATOM 2634   N NZ   . LYS A 1 165 ? -30.850 20.057  -10.388 1.00 70.43 ? 165 LYS A NZ   1  
ATOM 2635   H H    . LYS A 1 165 ? -25.689 22.445  -12.267 1.00 53.32 ? 165 LYS A H    1  
ATOM 2636   H HA   . LYS A 1 165 ? -24.531 19.901  -11.671 1.00 33.23 ? 165 LYS A HA   1  
ATOM 2637   H HB2  . LYS A 1 165 ? -26.807 20.377  -13.607 1.00 14.42 ? 165 LYS A HB2  1  
ATOM 2638   H HB3  . LYS A 1 165 ? -26.529 18.964  -12.591 1.00 22.51 ? 165 LYS A HB3  1  
ATOM 2639   H HG2  . LYS A 1 165 ? -26.727 20.600  -10.592 1.00 52.34 ? 165 LYS A HG2  1  
ATOM 2640   H HG3  . LYS A 1 165 ? -27.427 21.724  -11.757 1.00 4.34  ? 165 LYS A HG3  1  
ATOM 2641   H HD2  . LYS A 1 165 ? -29.063 19.894  -12.392 1.00 22.33 ? 165 LYS A HD2  1  
ATOM 2642   H HD3  . LYS A 1 165 ? -28.461 18.977  -11.012 1.00 41.52 ? 165 LYS A HD3  1  
ATOM 2643   H HE2  . LYS A 1 165 ? -29.091 20.822  -9.503  1.00 31.42 ? 165 LYS A HE2  1  
ATOM 2644   H HE3  . LYS A 1 165 ? -29.685 21.749  -10.881 1.00 35.51 ? 165 LYS A HE3  1  
ATOM 2645   H HZ1  . LYS A 1 165 ? -31.612 20.715  -10.647 1.00 34.22 ? 165 LYS A HZ1  1  
ATOM 2646   H HZ2  . LYS A 1 165 ? -30.995 19.723  -9.413  1.00 12.43 ? 165 LYS A HZ2  1  
ATOM 2647   H HZ3  . LYS A 1 165 ? -30.860 19.246  -11.038 1.00 20.41 ? 165 LYS A HZ3  1  
ATOM 2648   N N    . GLU A 1 166 ? -24.476 20.777  -14.856 1.00 44.34 ? 166 GLU A N    1  
ATOM 2649   C CA   . GLU A 1 166 ? -23.797 20.465  -16.146 1.00 73.52 ? 166 GLU A CA   1  
ATOM 2650   C C    . GLU A 1 166 ? -22.279 20.521  -15.968 1.00 1.14  ? 166 GLU A C    1  
ATOM 2651   O O    . GLU A 1 166 ? -21.552 19.742  -16.552 1.00 35.53 ? 166 GLU A O    1  
ATOM 2652   C CB   . GLU A 1 166 ? -24.228 21.486  -17.205 1.00 33.24 ? 166 GLU A CB   1  
ATOM 2653   C CG   . GLU A 1 166 ? -23.834 20.991  -18.602 1.00 52.45 ? 166 GLU A CG   1  
ATOM 2654   C CD   . GLU A 1 166 ? -22.318 21.097  -18.776 1.00 51.10 ? 166 GLU A CD   1  
ATOM 2655   O OE1  . GLU A 1 166 ? -21.792 22.178  -18.568 1.00 61.31 ? 166 GLU A OE1  1  
ATOM 2656   O OE2  . GLU A 1 166 ? -21.708 20.095  -19.111 1.00 71.12 ? 166 GLU A OE2  1  
ATOM 2657   H H    . GLU A 1 166 ? -25.124 21.511  -14.810 1.00 60.02 ? 166 GLU A H    1  
ATOM 2658   H HA   . GLU A 1 166 ? -24.082 19.474  -16.465 1.00 72.33 ? 166 GLU A HA   1  
ATOM 2659   H HB2  . GLU A 1 166 ? -25.300 21.618  -17.160 1.00 44.05 ? 166 GLU A HB2  1  
ATOM 2660   H HB3  . GLU A 1 166 ? -23.742 22.430  -17.011 1.00 74.32 ? 166 GLU A HB3  1  
ATOM 2661   H HG2  . GLU A 1 166 ? -24.141 19.963  -18.724 1.00 4.34  ? 166 GLU A HG2  1  
ATOM 2662   H HG3  . GLU A 1 166 ? -24.322 21.602  -19.348 1.00 61.11 ? 166 GLU A HG3  1  
ATOM 2663   N N    . GLN A 1 167 ? -21.787 21.433  -15.177 1.00 51.31 ? 167 GLN A N    1  
ATOM 2664   C CA   . GLN A 1 167 ? -20.313 21.520  -14.987 1.00 24.42 ? 167 GLN A CA   1  
ATOM 2665   C C    . GLN A 1 167 ? -19.774 20.155  -14.555 1.00 74.52 ? 167 GLN A C    1  
ATOM 2666   O O    . GLN A 1 167 ? -18.801 19.665  -15.092 1.00 21.42 ? 167 GLN A O    1  
ATOM 2667   C CB   . GLN A 1 167 ? -19.990 22.563  -13.915 1.00 45.03 ? 167 GLN A CB   1  
ATOM 2668   C CG   . GLN A 1 167 ? -20.218 23.967  -14.481 1.00 23.44 ? 167 GLN A CG   1  
ATOM 2669   C CD   . GLN A 1 167 ? -19.133 24.286  -15.513 1.00 33.52 ? 167 GLN A CD   1  
ATOM 2670   O OE1  . GLN A 1 167 ? -17.964 24.070  -15.268 1.00 54.35 ? 167 GLN A OE1  1  
ATOM 2671   N NE2  . GLN A 1 167 ? -19.474 24.794  -16.666 1.00 23.03 ? 167 GLN A NE2  1  
ATOM 2672   H H    . GLN A 1 167 ? -22.383 22.058  -14.714 1.00 2.14  ? 167 GLN A H    1  
ATOM 2673   H HA   . GLN A 1 167 ? -19.849 21.808  -15.918 1.00 42.34 ? 167 GLN A HA   1  
ATOM 2674   H HB2  . GLN A 1 167 ? -20.631 22.410  -13.059 1.00 14.31 ? 167 GLN A HB2  1  
ATOM 2675   H HB3  . GLN A 1 167 ? -18.958 22.462  -13.615 1.00 64.54 ? 167 GLN A HB3  1  
ATOM 2676   H HG2  . GLN A 1 167 ? -21.189 24.012  -14.953 1.00 13.20 ? 167 GLN A HG2  1  
ATOM 2677   H HG3  . GLN A 1 167 ? -20.173 24.690  -13.680 1.00 11.22 ? 167 GLN A HG3  1  
ATOM 2678   H HE21 . GLN A 1 167 ? -20.417 24.968  -16.865 1.00 24.21 ? 167 GLN A HE21 1  
ATOM 2679   H HE22 . GLN A 1 167 ? -18.786 25.001  -17.333 1.00 14.44 ? 167 GLN A HE22 1  
ATOM 2680   N N    . LEU A 1 168 ? -20.399 19.531  -13.595 1.00 2.33  ? 168 LEU A N    1  
ATOM 2681   C CA   . LEU A 1 168 ? -19.918 18.197  -13.140 1.00 25.13 ? 168 LEU A CA   1  
ATOM 2682   C C    . LEU A 1 168 ? -19.966 17.209  -14.310 1.00 32.34 ? 168 LEU A C    1  
ATOM 2683   O O    . LEU A 1 168 ? -19.050 16.437  -14.524 1.00 72.31 ? 168 LEU A O    1  
ATOM 2684   C CB   . LEU A 1 168 ? -20.821 17.686  -12.014 1.00 2.33  ? 168 LEU A CB   1  
ATOM 2685   C CG   . LEU A 1 168 ? -20.875 18.713  -10.876 1.00 1.13  ? 168 LEU A CG   1  
ATOM 2686   C CD1  . LEU A 1 168 ? -21.956 18.297  -9.873  1.00 60.04 ? 168 LEU A CD1  1  
ATOM 2687   C CD2  . LEU A 1 168 ? -19.515 18.782  -10.164 1.00 4.14  ? 168 LEU A CD2  1  
ATOM 2688   H H    . LEU A 1 168 ? -21.186 19.939  -13.176 1.00 22.02 ? 168 LEU A H    1  
ATOM 2689   H HA   . LEU A 1 168 ? -18.904 18.280  -12.783 1.00 55.11 ? 168 LEU A HA   1  
ATOM 2690   H HB2  . LEU A 1 168 ? -21.818 17.531  -12.401 1.00 30.22 ? 168 LEU A HB2  1  
ATOM 2691   H HB3  . LEU A 1 168 ? -20.435 16.751  -11.639 1.00 41.11 ? 168 LEU A HB3  1  
ATOM 2692   H HG   . LEU A 1 168 ? -21.120 19.684  -11.282 1.00 54.43 ? 168 LEU A HG   1  
ATOM 2693   H HD11 . LEU A 1 168 ? -22.923 18.332  -10.352 1.00 22.24 ? 168 LEU A HD11 1  
ATOM 2694   H HD12 . LEU A 1 168 ? -21.946 18.973  -9.031  1.00 73.32 ? 168 LEU A HD12 1  
ATOM 2695   H HD13 . LEU A 1 168 ? -21.760 17.292  -9.529  1.00 33.33 ? 168 LEU A HD13 1  
ATOM 2696   H HD21 . LEU A 1 168 ? -19.640 19.229  -9.188  1.00 33.33 ? 168 LEU A HD21 1  
ATOM 2697   H HD22 . LEU A 1 168 ? -18.835 19.385  -10.746 1.00 53.43 ? 168 LEU A HD22 1  
ATOM 2698   H HD23 . LEU A 1 168 ? -19.110 17.787  -10.052 1.00 74.41 ? 168 LEU A HD23 1  
ATOM 2699   N N    . LEU A 1 169 ? -21.034 17.222  -15.062 1.00 10.34 ? 169 LEU A N    1  
ATOM 2700   C CA   . LEU A 1 169 ? -21.152 16.277  -16.212 1.00 14.54 ? 169 LEU A CA   1  
ATOM 2701   C C    . LEU A 1 169 ? -19.942 16.425  -17.145 1.00 34.33 ? 169 LEU A C    1  
ATOM 2702   O O    . LEU A 1 169 ? -19.301 15.454  -17.500 1.00 0.13  ? 169 LEU A O    1  
ATOM 2703   C CB   . LEU A 1 169 ? -22.441 16.583  -16.993 1.00 53.33 ? 169 LEU A CB   1  
ATOM 2704   C CG   . LEU A 1 169 ? -22.743 15.446  -17.998 1.00 4.32  ? 169 LEU A CG   1  
ATOM 2705   C CD1  . LEU A 1 169 ? -23.555 14.334  -17.317 1.00 2.11  ? 169 LEU A CD1  1  
ATOM 2706   C CD2  . LEU A 1 169 ? -23.541 16.001  -19.190 1.00 23.20 ? 169 LEU A CD2  1  
ATOM 2707   H H    . LEU A 1 169 ? -21.763 17.849  -14.865 1.00 61.44 ? 169 LEU A H    1  
ATOM 2708   H HA   . LEU A 1 169 ? -21.191 15.265  -15.838 1.00 73.24 ? 169 LEU A HA   1  
ATOM 2709   H HB2  . LEU A 1 169 ? -23.264 16.684  -16.299 1.00 5.54  ? 169 LEU A HB2  1  
ATOM 2710   H HB3  . LEU A 1 169 ? -22.313 17.513  -17.529 1.00 60.33 ? 169 LEU A HB3  1  
ATOM 2711   H HG   . LEU A 1 169 ? -21.816 15.028  -18.357 1.00 73.32 ? 169 LEU A HG   1  
ATOM 2712   H HD11 . LEU A 1 169 ? -24.596 14.618  -17.276 1.00 72.42 ? 169 LEU A HD11 1  
ATOM 2713   H HD12 . LEU A 1 169 ? -23.186 14.176  -16.315 1.00 44.54 ? 169 LEU A HD12 1  
ATOM 2714   H HD13 . LEU A 1 169 ? -23.454 13.420  -17.883 1.00 75.14 ? 169 LEU A HD13 1  
ATOM 2715   H HD21 . LEU A 1 169 ? -22.874 16.528  -19.856 1.00 33.14 ? 169 LEU A HD21 1  
ATOM 2716   H HD22 . LEU A 1 169 ? -24.299 16.680  -18.830 1.00 14.23 ? 169 LEU A HD22 1  
ATOM 2717   H HD23 . LEU A 1 169 ? -24.011 15.186  -19.724 1.00 13.30 ? 169 LEU A HD23 1  
ATOM 2718   N N    . ASP A 1 170 ? -19.631 17.627  -17.554 1.00 42.53 ? 170 ASP A N    1  
ATOM 2719   C CA   . ASP A 1 170 ? -18.473 17.827  -18.478 1.00 14.54 ? 170 ASP A CA   1  
ATOM 2720   C C    . ASP A 1 170 ? -17.153 17.842  -17.697 1.00 44.41 ? 170 ASP A C    1  
ATOM 2721   O O    . ASP A 1 170 ? -16.085 17.786  -18.276 1.00 31.43 ? 170 ASP A O    1  
ATOM 2722   C CB   . ASP A 1 170 ? -18.640 19.157  -19.221 1.00 62.44 ? 170 ASP A CB   1  
ATOM 2723   C CG   . ASP A 1 170 ? -18.724 20.307  -18.215 1.00 3.30  ? 170 ASP A CG   1  
ATOM 2724   O OD1  . ASP A 1 170 ? -17.973 20.287  -17.254 1.00 60.11 ? 170 ASP A OD1  1  
ATOM 2725   O OD2  . ASP A 1 170 ? -19.540 21.191  -18.423 1.00 32.10 ? 170 ASP A OD2  1  
ATOM 2726   H H    . ASP A 1 170 ? -20.164 18.396  -17.265 1.00 54.21 ? 170 ASP A H    1  
ATOM 2727   H HA   . ASP A 1 170 ? -18.449 17.022  -19.198 1.00 65.03 ? 170 ASP A HA   1  
ATOM 2728   H HB2  . ASP A 1 170 ? -17.794 19.312  -19.875 1.00 2.44  ? 170 ASP A HB2  1  
ATOM 2729   H HB3  . ASP A 1 170 ? -19.546 19.129  -19.808 1.00 44.41 ? 170 ASP A HB3  1  
ATOM 2730   N N    . ALA A 1 171 ? -17.204 17.923  -16.396 1.00 12.52 ? 171 ALA A N    1  
ATOM 2731   C CA   . ALA A 1 171 ? -15.934 17.947  -15.609 1.00 15.21 ? 171 ALA A CA   1  
ATOM 2732   C C    . ALA A 1 171 ? -15.264 16.574  -15.657 1.00 60.21 ? 171 ALA A C    1  
ATOM 2733   O O    . ALA A 1 171 ? -14.103 16.453  -15.994 1.00 1.43  ? 171 ALA A O    1  
ATOM 2734   C CB   . ALA A 1 171 ? -16.229 18.310  -14.153 1.00 34.12 ? 171 ALA A CB   1  
ATOM 2735   H H    . ALA A 1 171 ? -18.069 17.972  -15.938 1.00 61.11 ? 171 ALA A H    1  
ATOM 2736   H HA   . ALA A 1 171 ? -15.268 18.684  -16.032 1.00 70.21 ? 171 ALA A HA   1  
ATOM 2737   H HB1  . ALA A 1 171 ? -16.885 17.568  -13.723 1.00 61.42 ? 171 ALA A HB1  1  
ATOM 2738   H HB2  . ALA A 1 171 ? -16.702 19.279  -14.111 1.00 3.11  ? 171 ALA A HB2  1  
ATOM 2739   H HB3  . ALA A 1 171 ? -15.304 18.337  -13.596 1.00 62.12 ? 171 ALA A HB3  1  
ATOM 2740   N N    . ILE A 1 172 ? -15.981 15.536  -15.319 1.00 32.11 ? 172 ILE A N    1  
ATOM 2741   C CA   . ILE A 1 172 ? -15.375 14.173  -15.342 1.00 21.54 ? 172 ILE A CA   1  
ATOM 2742   C C    . ILE A 1 172 ? -15.480 13.603  -16.758 1.00 1.41  ? 172 ILE A C    1  
ATOM 2743   O O    . ILE A 1 172 ? -14.592 12.920  -17.228 1.00 22.31 ? 172 ILE A O    1  
ATOM 2744   C CB   . ILE A 1 172 ? -16.119 13.271  -14.348 1.00 12.32 ? 172 ILE A CB   1  
ATOM 2745   C CG1  . ILE A 1 172 ? -15.710 13.645  -12.917 1.00 22.21 ? 172 ILE A CG1  1  
ATOM 2746   C CG2  . ILE A 1 172 ? -15.763 11.801  -14.602 1.00 24.15 ? 172 ILE A CG2  1  
ATOM 2747   C CD1  . ILE A 1 172 ? -16.113 15.092  -12.613 1.00 75.32 ? 172 ILE A CD1  1  
ATOM 2748   H H    . ILE A 1 172 ? -16.917 15.652  -15.049 1.00 41.30 ? 172 ILE A H    1  
ATOM 2749   H HA   . ILE A 1 172 ? -14.333 14.235  -15.058 1.00 45.20 ? 172 ILE A HA   1  
ATOM 2750   H HB   . ILE A 1 172 ? -17.184 13.408  -14.466 1.00 54.31 ? 172 ILE A HB   1  
ATOM 2751   H HG12 . ILE A 1 172 ? -16.203 12.983  -12.222 1.00 51.04 ? 172 ILE A HG12 1  
ATOM 2752   H HG13 . ILE A 1 172 ? -14.640 13.543  -12.813 1.00 32.50 ? 172 ILE A HG13 1  
ATOM 2753   H HG21 . ILE A 1 172 ? -14.701 11.714  -14.774 1.00 21.45 ? 172 ILE A HG21 1  
ATOM 2754   H HG22 . ILE A 1 172 ? -16.297 11.447  -15.471 1.00 23.03 ? 172 ILE A HG22 1  
ATOM 2755   H HG23 . ILE A 1 172 ? -16.039 11.207  -13.743 1.00 71.22 ? 172 ILE A HG23 1  
ATOM 2756   H HD11 . ILE A 1 172 ? -15.369 15.764  -13.011 1.00 44.25 ? 172 ILE A HD11 1  
ATOM 2757   H HD12 . ILE A 1 172 ? -16.181 15.226  -11.544 1.00 73.54 ? 172 ILE A HD12 1  
ATOM 2758   H HD13 . ILE A 1 172 ? -17.072 15.307  -13.063 1.00 64.45 ? 172 ILE A HD13 1  
ATOM 2759   N N    . TRP A 1 173 ? -16.563 13.881  -17.440 1.00 31.23 ? 173 TRP A N    1  
ATOM 2760   C CA   . TRP A 1 173 ? -16.745 13.363  -18.832 1.00 61.20 ? 173 TRP A CA   1  
ATOM 2761   C C    . TRP A 1 173 ? -16.622 14.522  -19.825 1.00 25.45 ? 173 TRP A C    1  
ATOM 2762   O O    . TRP A 1 173 ? -17.600 14.995  -20.370 1.00 50.42 ? 173 TRP A O    1  
ATOM 2763   C CB   . TRP A 1 173 ? -18.132 12.732  -18.949 1.00 55.43 ? 173 TRP A CB   1  
ATOM 2764   C CG   . TRP A 1 173 ? -18.229 11.570  -18.011 1.00 53.02 ? 173 TRP A CG   1  
ATOM 2765   C CD1  . TRP A 1 173 ? -17.640 10.367  -18.201 1.00 41.44 ? 173 TRP A CD1  1  
ATOM 2766   C CD2  . TRP A 1 173 ? -18.944 11.480  -16.745 1.00 42.35 ? 173 TRP A CD2  1  
ATOM 2767   N NE1  . TRP A 1 173 ? -17.951 9.543   -17.134 1.00 64.11 ? 173 TRP A NE1  1  
ATOM 2768   C CE2  . TRP A 1 173 ? -18.752 10.184  -16.210 1.00 70.14 ? 173 TRP A CE2  1  
ATOM 2769   C CE3  . TRP A 1 173 ? -19.732 12.388  -16.014 1.00 43.04 ? 173 TRP A CE3  1  
ATOM 2770   C CZ2  . TRP A 1 173 ? -19.325 9.801   -14.996 1.00 5.32  ? 173 TRP A CZ2  1  
ATOM 2771   C CZ3  . TRP A 1 173 ? -20.309 12.007  -14.792 1.00 73.14 ? 173 TRP A CZ3  1  
ATOM 2772   C CH2  . TRP A 1 173 ? -20.105 10.716  -14.284 1.00 4.42  ? 173 TRP A CH2  1  
ATOM 2773   H H    . TRP A 1 173 ? -17.263 14.436  -17.034 1.00 33.40 ? 173 TRP A H    1  
ATOM 2774   H HA   . TRP A 1 173 ? -15.995 12.618  -19.057 1.00 0.31  ? 173 TRP A HA   1  
ATOM 2775   H HB2  . TRP A 1 173 ? -18.884 13.464  -18.695 1.00 25.21 ? 173 TRP A HB2  1  
ATOM 2776   H HB3  . TRP A 1 173 ? -18.287 12.392  -19.959 1.00 52.51 ? 173 TRP A HB3  1  
ATOM 2777   H HD1  . TRP A 1 173 ? -17.027 10.095  -19.047 1.00 13.43 ? 173 TRP A HD1  1  
ATOM 2778   H HE1  . TRP A 1 173 ? -17.650 8.617   -17.029 1.00 40.24 ? 173 TRP A HE1  1  
ATOM 2779   H HE3  . TRP A 1 173 ? -19.894 13.386  -16.397 1.00 71.14 ? 173 TRP A HE3  1  
ATOM 2780   H HZ2  . TRP A 1 173 ? -19.165 8.805   -14.610 1.00 43.42 ? 173 TRP A HZ2  1  
ATOM 2781   H HZ3  . TRP A 1 173 ? -20.912 12.712  -14.240 1.00 61.31 ? 173 TRP A HZ3  1  
ATOM 2782   H HH2  . TRP A 1 173 ? -20.551 10.428  -13.344 1.00 63.02 ? 173 TRP A HH2  1  
ATOM 2783   N N    . GLU A 1 174 ? -15.422 14.987  -20.058 1.00 4.33  ? 174 GLU A N    1  
ATOM 2784   C CA   . GLU A 1 174 ? -15.221 16.118  -21.011 1.00 64.43 ? 174 GLU A CA   1  
ATOM 2785   C C    . GLU A 1 174 ? -15.080 15.575  -22.438 1.00 41.00 ? 174 GLU A C    1  
ATOM 2786   O O    . GLU A 1 174 ? -15.518 16.190  -23.391 1.00 42.25 ? 174 GLU A O    1  
ATOM 2787   C CB   . GLU A 1 174 ? -13.947 16.879  -20.625 1.00 32.52 ? 174 GLU A CB   1  
ATOM 2788   C CG   . GLU A 1 174 ? -13.792 18.123  -21.507 1.00 60.44 ? 174 GLU A CG   1  
ATOM 2789   C CD   . GLU A 1 174 ? -12.436 18.772  -21.233 1.00 73.24 ? 174 GLU A CD   1  
ATOM 2790   O OE1  . GLU A 1 174 ? -11.898 18.545  -20.162 1.00 14.03 ? 174 GLU A OE1  1  
ATOM 2791   O OE2  . GLU A 1 174 ? -11.957 19.483  -22.101 1.00 70.44 ? 174 GLU A OE2  1  
ATOM 2792   H H    . GLU A 1 174 ? -14.651 14.590  -19.604 1.00 13.31 ? 174 GLU A H    1  
ATOM 2793   H HA   . GLU A 1 174 ? -16.068 16.789  -20.962 1.00 5.41  ? 174 GLU A HA   1  
ATOM 2794   H HB2  . GLU A 1 174 ? -14.008 17.180  -19.589 1.00 50.54 ? 174 GLU A HB2  1  
ATOM 2795   H HB3  . GLU A 1 174 ? -13.090 16.237  -20.761 1.00 51.23 ? 174 GLU A HB3  1  
ATOM 2796   H HG2  . GLU A 1 174 ? -13.851 17.841  -22.547 1.00 10.22 ? 174 GLU A HG2  1  
ATOM 2797   H HG3  . GLU A 1 174 ? -14.578 18.827  -21.279 1.00 63.41 ? 174 GLU A HG3  1  
ATOM 2798   N N    . GLU A 1 175 ? -14.460 14.435  -22.595 1.00 25.42 ? 175 GLU A N    1  
ATOM 2799   C CA   . GLU A 1 175 ? -14.280 13.869  -23.964 1.00 0.51  ? 175 GLU A CA   1  
ATOM 2800   C C    . GLU A 1 175 ? -15.616 13.289  -24.469 1.00 5.33  ? 175 GLU A C    1  
ATOM 2801   O O    . GLU A 1 175 ? -16.389 12.766  -23.692 1.00 13.13 ? 175 GLU A O    1  
ATOM 2802   C CB   . GLU A 1 175 ? -13.233 12.753  -23.914 1.00 34.25 ? 175 GLU A CB   1  
ATOM 2803   C CG   . GLU A 1 175 ? -11.893 13.329  -23.452 1.00 42.44 ? 175 GLU A CG   1  
ATOM 2804   C CD   . GLU A 1 175 ? -10.781 12.315  -23.730 1.00 4.24  ? 175 GLU A CD   1  
ATOM 2805   O OE1  . GLU A 1 175 ? -10.570 11.454  -22.893 1.00 44.43 ? 175 GLU A OE1  1  
ATOM 2806   O OE2  . GLU A 1 175 ? -10.164 12.415  -24.778 1.00 23.51 ? 175 GLU A OE2  1  
ATOM 2807   H H    . GLU A 1 175 ? -14.103 13.959  -21.817 1.00 11.35 ? 175 GLU A H    1  
ATOM 2808   H HA   . GLU A 1 175 ? -13.936 14.650  -24.618 1.00 63.33 ? 175 GLU A HA   1  
ATOM 2809   H HB2  . GLU A 1 175 ? -13.555 11.989  -23.222 1.00 32.11 ? 175 GLU A HB2  1  
ATOM 2810   H HB3  . GLU A 1 175 ? -13.118 12.324  -24.898 1.00 43.01 ? 175 GLU A HB3  1  
ATOM 2811   H HG2  . GLU A 1 175 ? -11.691 14.244  -23.989 1.00 61.15 ? 175 GLU A HG2  1  
ATOM 2812   H HG3  . GLU A 1 175 ? -11.935 13.532  -22.393 1.00 11.55 ? 175 GLU A HG3  1  
ATOM 2813   N N    . PRO A 1 176 ? -15.893 13.365  -25.757 1.00 12.25 ? 176 PRO A N    1  
ATOM 2814   C CA   . PRO A 1 176 ? -17.159 12.817  -26.330 1.00 52.13 ? 176 PRO A CA   1  
ATOM 2815   C C    . PRO A 1 176 ? -17.524 11.440  -25.754 1.00 40.40 ? 176 PRO A C    1  
ATOM 2816   O O    . PRO A 1 176 ? -16.885 10.448  -26.047 1.00 72.51 ? 176 PRO A O    1  
ATOM 2817   C CB   . PRO A 1 176 ? -16.854 12.700  -27.829 1.00 2.54  ? 176 PRO A CB   1  
ATOM 2818   C CG   . PRO A 1 176 ? -15.850 13.775  -28.108 1.00 31.35 ? 176 PRO A CG   1  
ATOM 2819   C CD   . PRO A 1 176 ? -15.050 13.979  -26.809 1.00 53.33 ? 176 PRO A CD   1  
ATOM 2820   H HA   . PRO A 1 176 ? -17.968 13.512  -26.179 1.00 70.21 ? 176 PRO A HA   1  
ATOM 2821   H HB2  . PRO A 1 176 ? -16.436 11.724  -28.055 1.00 5.33  ? 176 PRO A HB2  1  
ATOM 2822   H HB3  . PRO A 1 176 ? -17.750 12.866  -28.409 1.00 42.31 ? 176 PRO A HB3  1  
ATOM 2823   H HG2  . PRO A 1 176 ? -15.191 13.468  -28.913 1.00 23.43 ? 176 PRO A HG2  1  
ATOM 2824   H HG3  . PRO A 1 176 ? -16.352 14.695  -28.375 1.00 2.43  ? 176 PRO A HG3  1  
ATOM 2825   H HD2  . PRO A 1 176 ? -14.090 13.481  -26.869 1.00 14.22 ? 176 PRO A HD2  1  
ATOM 2826   H HD3  . PRO A 1 176 ? -14.919 15.034  -26.615 1.00 62.52 ? 176 PRO A HD3  1  
ATOM 2827   N N    . GLU A 1 177 ? -18.555 11.369  -24.954 1.00 2.21  ? 177 GLU A N    1  
ATOM 2828   C CA   . GLU A 1 177 ? -18.969 10.055  -24.374 1.00 63.11 ? 177 GLU A CA   1  
ATOM 2829   C C    . GLU A 1 177 ? -20.475 10.073  -24.098 1.00 60.35 ? 177 GLU A C    1  
ATOM 2830   O O    . GLU A 1 177 ? -21.097 11.117  -24.061 1.00 2.53  ? 177 GLU A O    1  
ATOM 2831   C CB   . GLU A 1 177 ? -18.207 9.795   -23.071 1.00 40.51 ? 177 GLU A CB   1  
ATOM 2832   C CG   . GLU A 1 177 ? -16.755 9.421   -23.388 1.00 23.24 ? 177 GLU A CG   1  
ATOM 2833   C CD   . GLU A 1 177 ? -16.045 8.976   -22.108 1.00 63.24 ? 177 GLU A CD   1  
ATOM 2834   O OE1  . GLU A 1 177 ? -16.690 8.947   -21.074 1.00 24.12 ? 177 GLU A OE1  1  
ATOM 2835   O OE2  . GLU A 1 177 ? -14.866 8.668   -22.186 1.00 23.43 ? 177 GLU A OE2  1  
ATOM 2836   H H    . GLU A 1 177 ? -19.065 12.179  -24.742 1.00 23.20 ? 177 GLU A H    1  
ATOM 2837   H HA   . GLU A 1 177 ? -18.751 9.265   -25.079 1.00 75.34 ? 177 GLU A HA   1  
ATOM 2838   H HB2  . GLU A 1 177 ? -18.224 10.688  -22.462 1.00 34.53 ? 177 GLU A HB2  1  
ATOM 2839   H HB3  . GLU A 1 177 ? -18.676 8.985   -22.535 1.00 12.24 ? 177 GLU A HB3  1  
ATOM 2840   H HG2  . GLU A 1 177 ? -16.739 8.614   -24.106 1.00 11.04 ? 177 GLU A HG2  1  
ATOM 2841   H HG3  . GLU A 1 177 ? -16.243 10.278  -23.800 1.00 11.23 ? 177 GLU A HG3  1  
ATOM 2842   N N    . MET A 1 178 ? -21.068 8.925   -23.917 1.00 44.31 ? 178 MET A N    1  
ATOM 2843   C CA   . MET A 1 178 ? -22.536 8.871   -23.657 1.00 73.50 ? 178 MET A CA   1  
ATOM 2844   C C    . MET A 1 178 ? -22.861 9.556   -22.328 1.00 54.02 ? 178 MET A C    1  
ATOM 2845   O O    . MET A 1 178 ? -23.233 8.917   -21.364 1.00 41.41 ? 178 MET A O    1  
ATOM 2846   C CB   . MET A 1 178 ? -22.988 7.409   -23.604 1.00 63.53 ? 178 MET A CB   1  
ATOM 2847   C CG   . MET A 1 178 ? -23.008 6.827   -25.020 1.00 32.54 ? 178 MET A CG   1  
ATOM 2848   S SD   . MET A 1 178 ? -23.710 5.156   -24.983 1.00 12.21 ? 178 MET A SD   1  
ATOM 2849   C CE   . MET A 1 178 ? -22.308 4.318   -24.200 1.00 43.30 ? 178 MET A CE   1  
ATOM 2850   H H    . MET A 1 178 ? -20.550 8.095   -23.962 1.00 21.21 ? 178 MET A H    1  
ATOM 2851   H HA   . MET A 1 178 ? -23.058 9.378   -24.455 1.00 62.01 ? 178 MET A HA   1  
ATOM 2852   H HB2  . MET A 1 178 ? -22.301 6.845   -22.991 1.00 61.20 ? 178 MET A HB2  1  
ATOM 2853   H HB3  . MET A 1 178 ? -23.979 7.353   -23.180 1.00 52.41 ? 178 MET A HB3  1  
ATOM 2854   H HG2  . MET A 1 178 ? -23.614 7.455   -25.656 1.00 63.13 ? 178 MET A HG2  1  
ATOM 2855   H HG3  . MET A 1 178 ? -22.001 6.789   -25.409 1.00 44.32 ? 178 MET A HG3  1  
ATOM 2856   H HE1  . MET A 1 178 ? -22.389 3.252   -24.365 1.00 2.24  ? 178 MET A HE1  1  
ATOM 2857   H HE2  . MET A 1 178 ? -22.315 4.514   -23.140 1.00 4.22  ? 178 MET A HE2  1  
ATOM 2858   H HE3  . MET A 1 178 ? -21.385 4.683   -24.627 1.00 74.51 ? 178 MET A HE3  1  
ATOM 2859   N N    . VAL A 1 179 ? -22.735 10.854  -22.270 1.00 65.22 ? 179 VAL A N    1  
ATOM 2860   C CA   . VAL A 1 179 ? -23.048 11.580  -21.007 1.00 11.44 ? 179 VAL A CA   1  
ATOM 2861   C C    . VAL A 1 179 ? -24.549 11.870  -20.952 1.00 53.11 ? 179 VAL A C    1  
ATOM 2862   O O    . VAL A 1 179 ? -25.182 11.715  -19.928 1.00 31.03 ? 179 VAL A O    1  
ATOM 2863   C CB   . VAL A 1 179 ? -22.266 12.894  -20.969 1.00 33.12 ? 179 VAL A CB   1  
ATOM 2864   C CG1  . VAL A 1 179 ? -20.770 12.593  -21.075 1.00 34.33 ? 179 VAL A CG1  1  
ATOM 2865   C CG2  . VAL A 1 179 ? -22.695 13.779  -22.143 1.00 12.23 ? 179 VAL A CG2  1  
ATOM 2866   H H    . VAL A 1 179 ? -22.443 11.353  -23.062 1.00 11.10 ? 179 VAL A H    1  
ATOM 2867   H HA   . VAL A 1 179 ? -22.768 10.970  -20.159 1.00 15.43 ? 179 VAL A HA   1  
ATOM 2868   H HB   . VAL A 1 179 ? -22.466 13.404  -20.038 1.00 0.43  ? 179 VAL A HB   1  
ATOM 2869   H HG11 . VAL A 1 179 ? -20.513 11.805  -20.382 1.00 62.33 ? 179 VAL A HG11 1  
ATOM 2870   H HG12 . VAL A 1 179 ? -20.205 13.482  -20.836 1.00 44.53 ? 179 VAL A HG12 1  
ATOM 2871   H HG13 . VAL A 1 179 ? -20.538 12.279  -22.083 1.00 21.51 ? 179 VAL A HG13 1  
ATOM 2872   H HG21 . VAL A 1 179 ? -23.659 14.211  -21.932 1.00 25.01 ? 179 VAL A HG21 1  
ATOM 2873   H HG22 . VAL A 1 179 ? -22.757 13.182  -23.042 1.00 20.32 ? 179 VAL A HG22 1  
ATOM 2874   H HG23 . VAL A 1 179 ? -21.971 14.568  -22.284 1.00 32.23 ? 179 VAL A HG23 1  
ATOM 2875   N N    . THR A 1 180 ? -25.128 12.282  -22.050 1.00 32.13 ? 180 THR A N    1  
ATOM 2876   C CA   . THR A 1 180 ? -26.591 12.572  -22.057 1.00 51.13 ? 180 THR A CA   1  
ATOM 2877   C C    . THR A 1 180 ? -26.943 13.443  -20.841 1.00 2.04  ? 180 THR A C    1  
ATOM 2878   O O    . THR A 1 180 ? -27.209 12.927  -19.776 1.00 2.44  ? 180 THR A O    1  
ATOM 2879   C CB   . THR A 1 180 ? -27.361 11.253  -21.968 1.00 14.54 ? 180 THR A CB   1  
ATOM 2880   O OG1  . THR A 1 180 ? -26.978 10.411  -23.047 1.00 13.35 ? 180 THR A OG1  1  
ATOM 2881   C CG2  . THR A 1 180 ? -28.864 11.528  -22.044 1.00 71.42 ? 180 THR A CG2  1  
ATOM 2882   H H    . THR A 1 180 ? -24.601 12.395  -22.869 1.00 55.41 ? 180 THR A H    1  
ATOM 2883   H HA   . THR A 1 180 ? -26.857 13.076  -22.972 1.00 73.10 ? 180 THR A HA   1  
ATOM 2884   H HB   . THR A 1 180 ? -27.136 10.765  -21.031 1.00 61.32 ? 180 THR A HB   1  
ATOM 2885   H HG1  . THR A 1 180 ? -27.763 9.956   -23.361 1.00 20.32 ? 180 THR A HG1  1  
ATOM 2886   H HG21 . THR A 1 180 ? -29.397 10.592  -22.111 1.00 73.22 ? 180 THR A HG21 1  
ATOM 2887   H HG22 . THR A 1 180 ? -29.077 12.127  -22.916 1.00 64.35 ? 180 THR A HG22 1  
ATOM 2888   H HG23 . THR A 1 180 ? -29.178 12.058  -21.157 1.00 71.51 ? 180 THR A HG23 1  
ATOM 2889   N N    . PRO A 1 181 ? -26.937 14.750  -20.987 1.00 13.01 ? 181 PRO A N    1  
ATOM 2890   C CA   . PRO A 1 181 ? -27.254 15.686  -19.861 1.00 14.30 ? 181 PRO A CA   1  
ATOM 2891   C C    . PRO A 1 181 ? -28.523 15.284  -19.092 1.00 14.21 ? 181 PRO A C    1  
ATOM 2892   O O    . PRO A 1 181 ? -29.574 15.873  -19.252 1.00 21.20 ? 181 PRO A O    1  
ATOM 2893   C CB   . PRO A 1 181 ? -27.436 17.038  -20.561 1.00 32.45 ? 181 PRO A CB   1  
ATOM 2894   C CG   . PRO A 1 181 ? -26.571 16.950  -21.777 1.00 41.22 ? 181 PRO A CG   1  
ATOM 2895   C CD   . PRO A 1 181 ? -26.629 15.487  -22.227 1.00 13.02 ? 181 PRO A CD   1  
ATOM 2896   H HA   . PRO A 1 181 ? -26.417 15.744  -19.185 1.00 62.43 ? 181 PRO A HA   1  
ATOM 2897   H HB2  . PRO A 1 181 ? -28.472 17.183  -20.843 1.00 1.54  ? 181 PRO A HB2  1  
ATOM 2898   H HB3  . PRO A 1 181 ? -27.103 17.844  -19.924 1.00 2.14  ? 181 PRO A HB3  1  
ATOM 2899   H HG2  . PRO A 1 181 ? -26.952 17.601  -22.554 1.00 24.14 ? 181 PRO A HG2  1  
ATOM 2900   H HG3  . PRO A 1 181 ? -25.553 17.216  -21.534 1.00 32.23 ? 181 PRO A HG3  1  
ATOM 2901   H HD2  . PRO A 1 181 ? -27.416 15.349  -22.958 1.00 4.13  ? 181 PRO A HD2  1  
ATOM 2902   H HD3  . PRO A 1 181 ? -25.678 15.168  -22.625 1.00 31.32 ? 181 PRO A HD3  1  
ATOM 2903   N N    . ASN A 1 182 ? -28.424 14.287  -18.254 1.00 23.21 ? 182 ASN A N    1  
ATOM 2904   C CA   . ASN A 1 182 ? -29.607 13.837  -17.467 1.00 3.52  ? 182 ASN A CA   1  
ATOM 2905   C C    . ASN A 1 182 ? -29.158 12.764  -16.472 1.00 24.32 ? 182 ASN A C    1  
ATOM 2906   O O    . ASN A 1 182 ? -29.822 12.489  -15.492 1.00 4.41  ? 182 ASN A O    1  
ATOM 2907   C CB   . ASN A 1 182 ? -30.665 13.248  -18.413 1.00 41.42 ? 182 ASN A CB   1  
ATOM 2908   C CG   . ASN A 1 182 ? -32.033 13.248  -17.725 1.00 64.54 ? 182 ASN A CG   1  
ATOM 2909   O OD1  . ASN A 1 182 ? -32.631 12.208  -17.535 1.00 61.04 ? 182 ASN A OD1  1  
ATOM 2910   N ND2  . ASN A 1 182 ? -32.555 14.380  -17.339 1.00 15.42 ? 182 ASN A ND2  1  
ATOM 2911   H H    . ASN A 1 182 ? -27.563 13.832  -18.141 1.00 45.30 ? 182 ASN A H    1  
ATOM 2912   H HA   . ASN A 1 182 ? -30.023 14.678  -16.930 1.00 24.23 ? 182 ASN A HA   1  
ATOM 2913   H HB2  . ASN A 1 182 ? -30.717 13.843  -19.312 1.00 50.24 ? 182 ASN A HB2  1  
ATOM 2914   H HB3  . ASN A 1 182 ? -30.398 12.234  -18.674 1.00 3.34  ? 182 ASN A HB3  1  
ATOM 2915   H HD21 . ASN A 1 182 ? -32.072 15.219  -17.491 1.00 73.13 ? 182 ASN A HD21 1  
ATOM 2916   H HD22 . ASN A 1 182 ? -33.430 14.391  -16.899 1.00 4.33  ? 182 ASN A HD22 1  
ATOM 2917   N N    . VAL A 1 183 ? -28.035 12.150  -16.725 1.00 64.22 ? 183 VAL A N    1  
ATOM 2918   C CA   . VAL A 1 183 ? -27.539 11.090  -15.805 1.00 52.03 ? 183 VAL A CA   1  
ATOM 2919   C C    . VAL A 1 183 ? -26.978 11.730  -14.536 1.00 33.22 ? 183 VAL A C    1  
ATOM 2920   O O    . VAL A 1 183 ? -26.760 11.067  -13.541 1.00 35.32 ? 183 VAL A O    1  
ATOM 2921   C CB   . VAL A 1 183 ? -26.439 10.285  -16.499 1.00 14.22 ? 183 VAL A CB   1  
ATOM 2922   C CG1  . VAL A 1 183 ? -27.019 9.572   -17.721 1.00 74.02 ? 183 VAL A CG1  1  
ATOM 2923   C CG2  . VAL A 1 183 ? -25.319 11.225  -16.949 1.00 5.02  ? 183 VAL A CG2  1  
ATOM 2924   H H    . VAL A 1 183 ? -27.518 12.386  -17.524 1.00 44.53 ? 183 VAL A H    1  
ATOM 2925   H HA   . VAL A 1 183 ? -28.355 10.432  -15.544 1.00 72.43 ? 183 VAL A HA   1  
ATOM 2926   H HB   . VAL A 1 183 ? -26.042 9.552   -15.811 1.00 12.10 ? 183 VAL A HB   1  
ATOM 2927   H HG11 . VAL A 1 183 ? -26.251 8.975   -18.187 1.00 65.34 ? 183 VAL A HG11 1  
ATOM 2928   H HG12 . VAL A 1 183 ? -27.383 10.306  -18.425 1.00 50.43 ? 183 VAL A HG12 1  
ATOM 2929   H HG13 . VAL A 1 183 ? -27.834 8.934   -17.413 1.00 0.11  ? 183 VAL A HG13 1  
ATOM 2930   H HG21 . VAL A 1 183 ? -25.738 12.033  -17.530 1.00 30.12 ? 183 VAL A HG21 1  
ATOM 2931   H HG22 . VAL A 1 183 ? -24.612 10.677  -17.554 1.00 73.13 ? 183 VAL A HG22 1  
ATOM 2932   H HG23 . VAL A 1 183 ? -24.815 11.627  -16.083 1.00 50.01 ? 183 VAL A HG23 1  
ATOM 2933   N N    . ILE A 1 184 ? -26.734 13.012  -14.560 1.00 61.22 ? 184 ILE A N    1  
ATOM 2934   C CA   . ILE A 1 184 ? -26.176 13.680  -13.348 1.00 72.33 ? 184 ILE A CA   1  
ATOM 2935   C C    . ILE A 1 184 ? -26.993 13.279  -12.118 1.00 51.22 ? 184 ILE A C    1  
ATOM 2936   O O    . ILE A 1 184 ? -26.452 12.996  -11.069 1.00 22.32 ? 184 ILE A O    1  
ATOM 2937   C CB   . ILE A 1 184 ? -26.242 15.202  -13.498 1.00 64.41 ? 184 ILE A CB   1  
ATOM 2938   C CG1  . ILE A 1 184 ? -25.663 15.627  -14.852 1.00 32.32 ? 184 ILE A CG1  1  
ATOM 2939   C CG2  . ILE A 1 184 ? -25.425 15.840  -12.372 1.00 50.11 ? 184 ILE A CG2  1  
ATOM 2940   C CD1  . ILE A 1 184 ? -25.840 17.136  -15.036 1.00 64.01 ? 184 ILE A CD1  1  
ATOM 2941   H H    . ILE A 1 184 ? -26.906 13.528  -15.374 1.00 33.23 ? 184 ILE A H    1  
ATOM 2942   H HA   . ILE A 1 184 ? -25.149 13.376  -13.213 1.00 23.22 ? 184 ILE A HA   1  
ATOM 2943   H HB   . ILE A 1 184 ? -27.270 15.526  -13.424 1.00 4.33  ? 184 ILE A HB   1  
ATOM 2944   H HG12 . ILE A 1 184 ? -24.612 15.380  -14.889 1.00 11.24 ? 184 ILE A HG12 1  
ATOM 2945   H HG13 . ILE A 1 184 ? -26.181 15.112  -15.644 1.00 65.14 ? 184 ILE A HG13 1  
ATOM 2946   H HG21 . ILE A 1 184 ? -24.409 15.475  -12.416 1.00 30.54 ? 184 ILE A HG21 1  
ATOM 2947   H HG22 . ILE A 1 184 ? -25.860 15.576  -11.419 1.00 2.33  ? 184 ILE A HG22 1  
ATOM 2948   H HG23 . ILE A 1 184 ? -25.427 16.912  -12.483 1.00 65.32 ? 184 ILE A HG23 1  
ATOM 2949   H HD11 . ILE A 1 184 ? -25.634 17.401  -16.062 1.00 63.22 ? 184 ILE A HD11 1  
ATOM 2950   H HD12 . ILE A 1 184 ? -25.158 17.661  -14.385 1.00 22.33 ? 184 ILE A HD12 1  
ATOM 2951   H HD13 . ILE A 1 184 ? -26.855 17.413  -14.791 1.00 34.44 ? 184 ILE A HD13 1  
ATOM 2952   N N    . GLU A 1 185 ? -28.292 13.257  -12.234 1.00 24.32 ? 185 GLU A N    1  
ATOM 2953   C CA   . GLU A 1 185 ? -29.138 12.882  -11.065 1.00 73.31 ? 185 GLU A CA   1  
ATOM 2954   C C    . GLU A 1 185 ? -28.668 11.540  -10.506 1.00 14.11 ? 185 GLU A C    1  
ATOM 2955   O O    . GLU A 1 185 ? -28.732 11.290  -9.319  1.00 74.40 ? 185 GLU A O    1  
ATOM 2956   C CB   . GLU A 1 185 ? -30.602 12.753  -11.504 1.00 61.24 ? 185 GLU A CB   1  
ATOM 2957   C CG   . GLU A 1 185 ? -30.974 13.911  -12.431 1.00 12.43 ? 185 GLU A CG   1  
ATOM 2958   C CD   . GLU A 1 185 ? -30.586 15.243  -11.784 1.00 2.44  ? 185 GLU A CD   1  
ATOM 2959   O OE1  . GLU A 1 185 ? -31.056 15.507  -10.689 1.00 24.14 ? 185 GLU A OE1  1  
ATOM 2960   O OE2  . GLU A 1 185 ? -29.824 15.975  -12.394 1.00 23.53 ? 185 GLU A OE2  1  
ATOM 2961   H H    . GLU A 1 185 ? -28.710 13.492  -13.088 1.00 41.52 ? 185 GLU A H    1  
ATOM 2962   H HA   . GLU A 1 185 ? -29.056 13.642  -10.301 1.00 50.14 ? 185 GLU A HA   1  
ATOM 2963   H HB2  . GLU A 1 185 ? -30.741 11.818  -12.029 1.00 55.33 ? 185 GLU A HB2  1  
ATOM 2964   H HB3  . GLU A 1 185 ? -31.239 12.774  -10.634 1.00 10.15 ? 185 GLU A HB3  1  
ATOM 2965   H HG2  . GLU A 1 185 ? -30.454 13.798  -13.370 1.00 14.40 ? 185 GLU A HG2  1  
ATOM 2966   H HG3  . GLU A 1 185 ? -32.039 13.896  -12.608 1.00 53.40 ? 185 GLU A HG3  1  
ATOM 2967   N N    . VAL A 1 186 ? -28.214 10.670  -11.360 1.00 70.42 ? 186 VAL A N    1  
ATOM 2968   C CA   . VAL A 1 186 ? -27.757 9.336   -10.894 1.00 32.41 ? 186 VAL A CA   1  
ATOM 2969   C C    . VAL A 1 186 ? -26.356 9.442   -10.278 1.00 11.14 ? 186 VAL A C    1  
ATOM 2970   O O    . VAL A 1 186 ? -26.108 8.949   -9.198  1.00 41.10 ? 186 VAL A O    1  
ATOM 2971   C CB   . VAL A 1 186 ? -27.730 8.379   -12.090 1.00 25.24 ? 186 VAL A CB   1  
ATOM 2972   C CG1  . VAL A 1 186 ? -27.713 6.935   -11.593 1.00 42.23 ? 186 VAL A CG1  1  
ATOM 2973   C CG2  . VAL A 1 186 ? -28.979 8.604   -12.947 1.00 60.34 ? 186 VAL A CG2  1  
ATOM 2974   H H    . VAL A 1 186 ? -28.186 10.891  -12.314 1.00 74.32 ? 186 VAL A H    1  
ATOM 2975   H HA   . VAL A 1 186 ? -28.447 8.962   -10.151 1.00 53.31 ? 186 VAL A HA   1  
ATOM 2976   H HB   . VAL A 1 186 ? -26.847 8.566   -12.683 1.00 40.15 ? 186 VAL A HB   1  
ATOM 2977   H HG11 . VAL A 1 186 ? -26.810 6.760   -11.027 1.00 61.42 ? 186 VAL A HG11 1  
ATOM 2978   H HG12 . VAL A 1 186 ? -27.745 6.264   -12.439 1.00 31.43 ? 186 VAL A HG12 1  
ATOM 2979   H HG13 . VAL A 1 186 ? -28.573 6.763   -10.964 1.00 1.40  ? 186 VAL A HG13 1  
ATOM 2980   H HG21 . VAL A 1 186 ? -28.916 9.567   -13.433 1.00 0.24  ? 186 VAL A HG21 1  
ATOM 2981   H HG22 . VAL A 1 186 ? -29.857 8.575   -12.319 1.00 54.10 ? 186 VAL A HG22 1  
ATOM 2982   H HG23 . VAL A 1 186 ? -29.047 7.828   -13.696 1.00 74.11 ? 186 VAL A HG23 1  
ATOM 2983   N N    . ALA A 1 187 ? -25.438 10.076  -10.954 1.00 22.21 ? 187 ALA A N    1  
ATOM 2984   C CA   . ALA A 1 187 ? -24.057 10.199  -10.400 1.00 23.22 ? 187 ALA A CA   1  
ATOM 2985   C C    . ALA A 1 187 ? -24.080 11.006  -9.102  1.00 52.11 ? 187 ALA A C    1  
ATOM 2986   O O    . ALA A 1 187 ? -23.438 10.651  -8.135  1.00 30.13 ? 187 ALA A O    1  
ATOM 2987   C CB   . ALA A 1 187 ? -23.159 10.901  -11.421 1.00 31.51 ? 187 ALA A CB   1  
ATOM 2988   H H    . ALA A 1 187 ? -25.653 10.467  -11.827 1.00 22.24 ? 187 ALA A H    1  
ATOM 2989   H HA   . ALA A 1 187 ? -23.662 9.214   -10.194 1.00 73.23 ? 187 ALA A HA   1  
ATOM 2990   H HB1  . ALA A 1 187 ? -23.504 11.914  -11.568 1.00 53.22 ? 187 ALA A HB1  1  
ATOM 2991   H HB2  . ALA A 1 187 ? -23.197 10.369  -12.361 1.00 32.01 ? 187 ALA A HB2  1  
ATOM 2992   H HB3  . ALA A 1 187 ? -22.143 10.915  -11.056 1.00 30.52 ? 187 ALA A HB3  1  
ATOM 2993   N N    . ILE A 1 188 ? -24.803 12.089  -9.065  1.00 0.31  ? 188 ILE A N    1  
ATOM 2994   C CA   . ILE A 1 188 ? -24.839 12.900  -7.818  1.00 24.14 ? 188 ILE A CA   1  
ATOM 2995   C C    . ILE A 1 188 ? -25.522 12.103  -6.704  1.00 15.34 ? 188 ILE A C    1  
ATOM 2996   O O    . ILE A 1 188 ? -25.077 12.095  -5.574  1.00 64.54 ? 188 ILE A O    1  
ATOM 2997   C CB   . ILE A 1 188 ? -25.603 14.208  -8.070  1.00 65.34 ? 188 ILE A CB   1  
ATOM 2998   C CG1  . ILE A 1 188 ? -25.407 15.162  -6.880  1.00 13.51 ? 188 ILE A CG1  1  
ATOM 2999   C CG2  . ILE A 1 188 ? -27.099 13.914  -8.239  1.00 71.40 ? 188 ILE A CG2  1  
ATOM 3000   C CD1  . ILE A 1 188 ? -23.942 15.617  -6.780  1.00 30.42 ? 188 ILE A CD1  1  
ATOM 3001   H H    . ILE A 1 188 ? -25.313 12.370  -9.853  1.00 24.25 ? 188 ILE A H    1  
ATOM 3002   H HA   . ILE A 1 188 ? -23.829 13.125  -7.520  1.00 61.44 ? 188 ILE A HA   1  
ATOM 3003   H HB   . ILE A 1 188 ? -25.229 14.672  -8.971  1.00 52.44 ? 188 ILE A HB   1  
ATOM 3004   H HG12 . ILE A 1 188 ? -26.040 16.027  -7.011  1.00 74.31 ? 188 ILE A HG12 1  
ATOM 3005   H HG13 . ILE A 1 188 ? -25.683 14.653  -5.968  1.00 22.42 ? 188 ILE A HG13 1  
ATOM 3006   H HG21 . ILE A 1 188 ? -27.580 14.757  -8.711  1.00 70.25 ? 188 ILE A HG21 1  
ATOM 3007   H HG22 . ILE A 1 188 ? -27.546 13.741  -7.270  1.00 24.24 ? 188 ILE A HG22 1  
ATOM 3008   H HG23 . ILE A 1 188 ? -27.227 13.036  -8.853  1.00 65.22 ? 188 ILE A HG23 1  
ATOM 3009   H HD11 . ILE A 1 188 ? -23.400 14.945  -6.131  1.00 5.23  ? 188 ILE A HD11 1  
ATOM 3010   H HD12 . ILE A 1 188 ? -23.907 16.615  -6.367  1.00 4.35  ? 188 ILE A HD12 1  
ATOM 3011   H HD13 . ILE A 1 188 ? -23.485 15.621  -7.759  1.00 73.11 ? 188 ILE A HD13 1  
ATOM 3012   N N    . ASN A 1 189 ? -26.597 11.433  -7.011  1.00 15.11 ? 189 ASN A N    1  
ATOM 3013   C CA   . ASN A 1 189 ? -27.297 10.640  -5.963  1.00 73.14 ? 189 ASN A CA   1  
ATOM 3014   C C    . ASN A 1 189 ? -26.367 9.538   -5.456  1.00 54.43 ? 189 ASN A C    1  
ATOM 3015   O O    . ASN A 1 189 ? -26.272 9.287   -4.271  1.00 73.44 ? 189 ASN A O    1  
ATOM 3016   C CB   . ASN A 1 189 ? -28.560 10.007  -6.551  1.00 43.13 ? 189 ASN A CB   1  
ATOM 3017   C CG   . ASN A 1 189 ? -29.337 9.301   -5.439  1.00 40.55 ? 189 ASN A CG   1  
ATOM 3018   O OD1  . ASN A 1 189 ? -29.868 9.940   -4.553  1.00 13.22 ? 189 ASN A OD1  1  
ATOM 3019   N ND2  . ASN A 1 189 ? -29.424 7.999   -5.447  1.00 21.02 ? 189 ASN A ND2  1  
ATOM 3020   H H    . ASN A 1 189 ? -26.942 11.448  -7.928  1.00 44.12 ? 189 ASN A H    1  
ATOM 3021   H HA   . ASN A 1 189 ? -27.568 11.288  -5.143  1.00 60.31 ? 189 ASN A HA   1  
ATOM 3022   H HB2  . ASN A 1 189 ? -29.177 10.777  -6.992  1.00 50.04 ? 189 ASN A HB2  1  
ATOM 3023   H HB3  . ASN A 1 189 ? -28.284 9.288   -7.308  1.00 63.41 ? 189 ASN A HB3  1  
ATOM 3024   H HD21 . ASN A 1 189 ? -28.993 7.483   -6.160  1.00 15.14 ? 189 ASN A HD21 1  
ATOM 3025   H HD22 . ASN A 1 189 ? -29.918 7.536   -4.738  1.00 55.23 ? 189 ASN A HD22 1  
ATOM 3026   N N    . GLN A 1 190 ? -25.678 8.881   -6.346  1.00 42.25 ? 190 GLN A N    1  
ATOM 3027   C CA   . GLN A 1 190 ? -24.752 7.796   -5.922  1.00 32.32 ? 190 GLN A CA   1  
ATOM 3028   C C    . GLN A 1 190 ? -23.612 8.389   -5.093  1.00 10.04 ? 190 GLN A C    1  
ATOM 3029   O O    . GLN A 1 190 ? -23.185 7.817   -4.110  1.00 61.14 ? 190 GLN A O    1  
ATOM 3030   C CB   . GLN A 1 190 ? -24.176 7.113   -7.165  1.00 2.23  ? 190 GLN A CB   1  
ATOM 3031   C CG   . GLN A 1 190 ? -25.296 6.387   -7.923  1.00 71.42 ? 190 GLN A CG   1  
ATOM 3032   C CD   . GLN A 1 190 ? -25.595 5.043   -7.251  1.00 44.03 ? 190 GLN A CD   1  
ATOM 3033   O OE1  . GLN A 1 190 ? -24.788 4.532   -6.501  1.00 11.43 ? 190 GLN A OE1  1  
ATOM 3034   N NE2  . GLN A 1 190 ? -26.728 4.445   -7.493  1.00 20.41 ? 190 GLN A NE2  1  
ATOM 3035   H H    . GLN A 1 190 ? -25.771 9.102   -7.296  1.00 14.22 ? 190 GLN A H    1  
ATOM 3036   H HA   . GLN A 1 190 ? -25.291 7.071   -5.331  1.00 33.33 ? 190 GLN A HA   1  
ATOM 3037   H HB2  . GLN A 1 190 ? -23.731 7.858   -7.809  1.00 3.22  ? 190 GLN A HB2  1  
ATOM 3038   H HB3  . GLN A 1 190 ? -23.421 6.401   -6.868  1.00 63.20 ? 190 GLN A HB3  1  
ATOM 3039   H HG2  . GLN A 1 190 ? -26.189 6.997   -7.919  1.00 11.50 ? 190 GLN A HG2  1  
ATOM 3040   H HG3  . GLN A 1 190 ? -24.985 6.216   -8.942  1.00 62.52 ? 190 GLN A HG3  1  
ATOM 3041   H HE21 . GLN A 1 190 ? -27.379 4.855   -8.099  1.00 63.52 ? 190 GLN A HE21 1  
ATOM 3042   H HE22 . GLN A 1 190 ? -26.928 3.584   -7.068  1.00 11.40 ? 190 GLN A HE22 1  
ATOM 3043   N N    . ILE A 1 191 ? -23.111 9.528   -5.484  1.00 44.14 ? 191 ILE A N    1  
ATOM 3044   C CA   . ILE A 1 191 ? -21.995 10.149  -4.719  1.00 61.55 ? 191 ILE A CA   1  
ATOM 3045   C C    . ILE A 1 191 ? -22.485 10.556  -3.324  1.00 21.15 ? 191 ILE A C    1  
ATOM 3046   O O    . ILE A 1 191 ? -21.822 10.325  -2.335  1.00 22.45 ? 191 ILE A O    1  
ATOM 3047   C CB   . ILE A 1 191 ? -21.483 11.380  -5.473  1.00 43.21 ? 191 ILE A CB   1  
ATOM 3048   C CG1  . ILE A 1 191 ? -20.762 10.924  -6.748  1.00 50.42 ? 191 ILE A CG1  1  
ATOM 3049   C CG2  . ILE A 1 191 ? -20.507 12.164  -4.588  1.00 20.45 ? 191 ILE A CG2  1  
ATOM 3050   C CD1  . ILE A 1 191 ? -20.600 12.106  -7.706  1.00 4.50  ? 191 ILE A CD1  1  
ATOM 3051   H H    . ILE A 1 191 ? -23.465 9.973   -6.282  1.00 62.22 ? 191 ILE A H    1  
ATOM 3052   H HA   . ILE A 1 191 ? -21.194 9.432   -4.625  1.00 15.13 ? 191 ILE A HA   1  
ATOM 3053   H HB   . ILE A 1 191 ? -22.320 12.012  -5.733  1.00 21.13 ? 191 ILE A HB   1  
ATOM 3054   H HG12 . ILE A 1 191 ? -19.787 10.537  -6.490  1.00 64.02 ? 191 ILE A HG12 1  
ATOM 3055   H HG13 . ILE A 1 191 ? -21.337 10.149  -7.232  1.00 12.42 ? 191 ILE A HG13 1  
ATOM 3056   H HG21 . ILE A 1 191 ? -19.956 12.868  -5.195  1.00 72.44 ? 191 ILE A HG21 1  
ATOM 3057   H HG22 . ILE A 1 191 ? -19.819 11.479  -4.117  1.00 61.22 ? 191 ILE A HG22 1  
ATOM 3058   H HG23 . ILE A 1 191 ? -21.059 12.698  -3.829  1.00 12.04 ? 191 ILE A HG23 1  
ATOM 3059   H HD11 . ILE A 1 191 ? -21.550 12.604  -7.835  1.00 53.12 ? 191 ILE A HD11 1  
ATOM 3060   H HD12 . ILE A 1 191 ? -20.253 11.744  -8.662  1.00 12.21 ? 191 ILE A HD12 1  
ATOM 3061   H HD13 . ILE A 1 191 ? -19.880 12.801  -7.300  1.00 0.33  ? 191 ILE A HD13 1  
ATOM 3062   N N    . ARG A 1 192 ? -23.636 11.165  -3.238  1.00 62.31 ? 192 ARG A N    1  
ATOM 3063   C CA   . ARG A 1 192 ? -24.156 11.588  -1.905  1.00 54.22 ? 192 ARG A CA   1  
ATOM 3064   C C    . ARG A 1 192 ? -24.290 10.367  -0.992  1.00 60.22 ? 192 ARG A C    1  
ATOM 3065   O O    . ARG A 1 192 ? -24.019 10.432  0.190   1.00 14.32 ? 192 ARG A O    1  
ATOM 3066   C CB   . ARG A 1 192 ? -25.527 12.248  -2.076  1.00 15.03 ? 192 ARG A CB   1  
ATOM 3067   C CG   . ARG A 1 192 ? -25.364 13.597  -2.782  1.00 53.03 ? 192 ARG A CG   1  
ATOM 3068   C CD   . ARG A 1 192 ? -26.742 14.154  -3.145  1.00 11.51 ? 192 ARG A CD   1  
ATOM 3069   N NE   . ARG A 1 192 ? -27.479 14.515  -1.900  1.00 63.34 ? 192 ARG A NE   1  
ATOM 3070   C CZ   . ARG A 1 192 ? -28.577 15.217  -1.973  1.00 25.53 ? 192 ARG A CZ   1  
ATOM 3071   N NH1  . ARG A 1 192 ? -29.023 15.614  -3.133  1.00 55.31 ? 192 ARG A NH1  1  
ATOM 3072   N NH2  . ARG A 1 192 ? -29.228 15.523  -0.884  1.00 40.32 ? 192 ARG A NH2  1  
ATOM 3073   H H    . ARG A 1 192 ? -24.155 11.349  -4.048  1.00 3.52  ? 192 ARG A H    1  
ATOM 3074   H HA   . ARG A 1 192 ? -23.472 12.294  -1.461  1.00 31.02 ? 192 ARG A HA   1  
ATOM 3075   H HB2  . ARG A 1 192 ? -26.164 11.606  -2.666  1.00 52.53 ? 192 ARG A HB2  1  
ATOM 3076   H HB3  . ARG A 1 192 ? -25.973 12.405  -1.106  1.00 41.40 ? 192 ARG A HB3  1  
ATOM 3077   H HG2  . ARG A 1 192 ? -24.857 14.288  -2.124  1.00 35.42 ? 192 ARG A HG2  1  
ATOM 3078   H HG3  . ARG A 1 192 ? -24.783 13.464  -3.682  1.00 21.02 ? 192 ARG A HG3  1  
ATOM 3079   H HD2  . ARG A 1 192 ? -26.624 15.034  -3.760  1.00 60.25 ? 192 ARG A HD2  1  
ATOM 3080   H HD3  . ARG A 1 192 ? -27.301 13.407  -3.689  1.00 64.22 ? 192 ARG A HD3  1  
ATOM 3081   H HE   . ARG A 1 192 ? -27.141 14.221  -1.028  1.00 45.23 ? 192 ARG A HE   1  
ATOM 3082   H HH11 . ARG A 1 192 ? -28.523 15.381  -3.967  1.00 54.40 ? 192 ARG A HH11 1  
ATOM 3083   H HH12 . ARG A 1 192 ? -29.864 16.152  -3.188  1.00 15.24 ? 192 ARG A HH12 1  
ATOM 3084   H HH21 . ARG A 1 192 ? -28.887 15.219  0.005   1.00 1.34  ? 192 ARG A HH21 1  
ATOM 3085   H HH22 . ARG A 1 192 ? -30.069 16.062  -0.940  1.00 44.30 ? 192 ARG A HH22 1  
ATOM 3086   N N    . GLN A 1 193 ? -24.717 9.257   -1.525  1.00 35.22 ? 193 GLN A N    1  
ATOM 3087   C CA   . GLN A 1 193 ? -24.877 8.039   -0.682  1.00 24.03 ? 193 GLN A CA   1  
ATOM 3088   C C    . GLN A 1 193 ? -23.518 7.368   -0.452  1.00 11.33 ? 193 GLN A C    1  
ATOM 3089   O O    . GLN A 1 193 ? -23.322 6.666   0.520   1.00 52.02 ? 193 GLN A O    1  
ATOM 3090   C CB   . GLN A 1 193 ? -25.816 7.057   -1.385  1.00 52.21 ? 193 GLN A CB   1  
ATOM 3091   C CG   . GLN A 1 193 ? -27.197 7.697   -1.543  1.00 12.43 ? 193 GLN A CG   1  
ATOM 3092   C CD   . GLN A 1 193 ? -28.136 6.721   -2.253  1.00 50.15 ? 193 GLN A CD   1  
ATOM 3093   O OE1  . GLN A 1 193 ? -27.700 5.907   -3.043  1.00 61.24 ? 193 GLN A OE1  1  
ATOM 3094   N NE2  . GLN A 1 193 ? -29.416 6.768   -2.004  1.00 4.02  ? 193 GLN A NE2  1  
ATOM 3095   H H    . GLN A 1 193 ? -24.939 9.225   -2.479  1.00 15.42 ? 193 GLN A H    1  
ATOM 3096   H HA   . GLN A 1 193 ? -25.303 8.317   0.271   1.00 22.34 ? 193 GLN A HA   1  
ATOM 3097   H HB2  . GLN A 1 193 ? -25.417 6.812   -2.359  1.00 12.42 ? 193 GLN A HB2  1  
ATOM 3098   H HB3  . GLN A 1 193 ? -25.904 6.157   -0.794  1.00 32.53 ? 193 GLN A HB3  1  
ATOM 3099   H HG2  . GLN A 1 193 ? -27.595 7.936   -0.567  1.00 74.32 ? 193 GLN A HG2  1  
ATOM 3100   H HG3  . GLN A 1 193 ? -27.110 8.600   -2.128  1.00 21.02 ? 193 GLN A HG3  1  
ATOM 3101   H HE21 . GLN A 1 193 ? -29.767 7.424   -1.367  1.00 64.30 ? 193 GLN A HE21 1  
ATOM 3102   H HE22 . GLN A 1 193 ? -30.026 6.146   -2.453  1.00 10.52 ? 193 GLN A HE22 1  
ATOM 3103   N N    . LYS A 1 194 ? -22.582 7.556   -1.346  1.00 63.35 ? 194 LYS A N    1  
ATOM 3104   C CA   . LYS A 1 194 ? -21.244 6.906   -1.183  1.00 2.12  ? 194 LYS A CA   1  
ATOM 3105   C C    . LYS A 1 194 ? -20.282 7.823   -0.418  1.00 64.14 ? 194 LYS A C    1  
ATOM 3106   O O    . LYS A 1 194 ? -19.259 7.385   0.070   1.00 21.31 ? 194 LYS A O    1  
ATOM 3107   C CB   . LYS A 1 194 ? -20.656 6.608   -2.565  1.00 75.13 ? 194 LYS A CB   1  
ATOM 3108   C CG   . LYS A 1 194 ? -21.499 5.537   -3.265  1.00 73.44 ? 194 LYS A CG   1  
ATOM 3109   C CD   . LYS A 1 194 ? -21.185 5.525   -4.765  1.00 74.42 ? 194 LYS A CD   1  
ATOM 3110   C CE   . LYS A 1 194 ? -19.720 5.141   -4.991  1.00 70.24 ? 194 LYS A CE   1  
ATOM 3111   N NZ   . LYS A 1 194 ? -19.387 3.933   -4.183  1.00 43.44 ? 194 LYS A NZ   1  
ATOM 3112   H H    . LYS A 1 194 ? -22.763 8.112   -2.132  1.00 10.31 ? 194 LYS A H    1  
ATOM 3113   H HA   . LYS A 1 194 ? -21.356 5.978   -0.641  1.00 14.25 ? 194 LYS A HA   1  
ATOM 3114   H HB2  . LYS A 1 194 ? -20.655 7.512   -3.158  1.00 34.44 ? 194 LYS A HB2  1  
ATOM 3115   H HB3  . LYS A 1 194 ? -19.645 6.250   -2.453  1.00 53.40 ? 194 LYS A HB3  1  
ATOM 3116   H HG2  . LYS A 1 194 ? -21.273 4.570   -2.841  1.00 52.14 ? 194 LYS A HG2  1  
ATOM 3117   H HG3  . LYS A 1 194 ? -22.547 5.754   -3.122  1.00 24.24 ? 194 LYS A HG3  1  
ATOM 3118   H HD2  . LYS A 1 194 ? -21.825 4.807   -5.259  1.00 73.34 ? 194 LYS A HD2  1  
ATOM 3119   H HD3  . LYS A 1 194 ? -21.365 6.507   -5.177  1.00 10.21 ? 194 LYS A HD3  1  
ATOM 3120   H HE2  . LYS A 1 194 ? -19.563 4.926   -6.038  1.00 31.52 ? 194 LYS A HE2  1  
ATOM 3121   H HE3  . LYS A 1 194 ? -19.083 5.960   -4.695  1.00 2.14  ? 194 LYS A HE3  1  
ATOM 3122   H HZ1  . LYS A 1 194 ? -18.983 4.226   -3.271  1.00 63.22 ? 194 LYS A HZ1  1  
ATOM 3123   H HZ2  . LYS A 1 194 ? -18.694 3.351   -4.699  1.00 73.53 ? 194 LYS A HZ2  1  
ATOM 3124   H HZ3  . LYS A 1 194 ? -20.250 3.379   -4.015  1.00 75.31 ? 194 LYS A HZ3  1  
ATOM 3125   N N    . MET A 1 195 ? -20.580 9.092   -0.317  1.00 3.10  ? 195 MET A N    1  
ATOM 3126   C CA   . MET A 1 195 ? -19.658 10.023  0.406   1.00 34.00 ? 195 MET A CA   1  
ATOM 3127   C C    . MET A 1 195 ? -20.053 10.127  1.883   1.00 35.10 ? 195 MET A C    1  
ATOM 3128   O O    . MET A 1 195 ? -19.210 10.143  2.757   1.00 62.12 ? 195 MET A O    1  
ATOM 3129   C CB   . MET A 1 195 ? -19.723 11.412  -0.244  1.00 41.31 ? 195 MET A CB   1  
ATOM 3130   C CG   . MET A 1 195 ? -21.083 12.067  0.032   1.00 0.33  ? 195 MET A CG   1  
ATOM 3131   S SD   . MET A 1 195 ? -21.030 12.915  1.632   1.00 74.02 ? 195 MET A SD   1  
ATOM 3132   C CE   . MET A 1 195 ? -20.678 14.577  1.005   1.00 4.22  ? 195 MET A CE   1  
ATOM 3133   H H    . MET A 1 195 ? -21.402 9.436   -0.725  1.00 65.43 ? 195 MET A H    1  
ATOM 3134   H HA   . MET A 1 195 ? -18.644 9.652   0.338   1.00 60.24 ? 195 MET A HA   1  
ATOM 3135   H HB2  . MET A 1 195 ? -18.939 12.034  0.164   1.00 15.13 ? 195 MET A HB2  1  
ATOM 3136   H HB3  . MET A 1 195 ? -19.583 11.314  -1.311  1.00 10.20 ? 195 MET A HB3  1  
ATOM 3137   H HG2  . MET A 1 195 ? -21.302 12.782  -0.749  1.00 23.42 ? 195 MET A HG2  1  
ATOM 3138   H HG3  . MET A 1 195 ? -21.854 11.313  0.049   1.00 4.31  ? 195 MET A HG3  1  
ATOM 3139   H HE1  . MET A 1 195 ? -21.456 14.871  0.313   1.00 55.23 ? 195 MET A HE1  1  
ATOM 3140   H HE2  . MET A 1 195 ? -19.728 14.578  0.495   1.00 20.40 ? 195 MET A HE2  1  
ATOM 3141   H HE3  . MET A 1 195 ? -20.642 15.273  1.832   1.00 24.31 ? 195 MET A HE3  1  
ATOM 3142   N N    . ASP A 1 196 ? -21.323 10.209  2.174   1.00 71.53 ? 196 ASP A N    1  
ATOM 3143   C CA   . ASP A 1 196 ? -21.751 10.322  3.598   1.00 5.54  ? 196 ASP A CA   1  
ATOM 3144   C C    . ASP A 1 196 ? -21.426 9.027   4.350   1.00 60.10 ? 196 ASP A C    1  
ATOM 3145   O O    . ASP A 1 196 ? -21.047 9.053   5.503   1.00 41.22 ? 196 ASP A O    1  
ATOM 3146   C CB   . ASP A 1 196 ? -23.255 10.596  3.661   1.00 22.31 ? 196 ASP A CB   1  
ATOM 3147   C CG   . ASP A 1 196 ? -23.717 10.597  5.120   1.00 74.02 ? 196 ASP A CG   1  
ATOM 3148   O OD1  . ASP A 1 196 ? -23.443 11.567  5.807   1.00 24.54 ? 196 ASP A OD1  1  
ATOM 3149   O OD2  . ASP A 1 196 ? -24.342 9.630   5.523   1.00 3.53  ? 196 ASP A OD2  1  
ATOM 3150   H H    . ASP A 1 196 ? -21.993 10.201  1.459   1.00 63.52 ? 196 ASP A H    1  
ATOM 3151   H HA   . ASP A 1 196 ? -21.222 11.142  4.061   1.00 14.31 ? 196 ASP A HA   1  
ATOM 3152   H HB2  . ASP A 1 196 ? -23.461 11.561  3.220   1.00 61.32 ? 196 ASP A HB2  1  
ATOM 3153   H HB3  . ASP A 1 196 ? -23.786 9.830   3.117   1.00 44.33 ? 196 ASP A HB3  1  
ATOM 3154   N N    . LYS A 1 197 ? -21.567 7.894   3.714   1.00 10.23 ? 197 LYS A N    1  
ATOM 3155   C CA   . LYS A 1 197 ? -21.257 6.613   4.413   1.00 31.04 ? 197 LYS A CA   1  
ATOM 3156   C C    . LYS A 1 197 ? -19.865 6.712   5.052   1.00 73.21 ? 197 LYS A C    1  
ATOM 3157   O O    . LYS A 1 197 ? -19.741 6.665   6.260   1.00 63.23 ? 197 LYS A O    1  
ATOM 3158   C CB   . LYS A 1 197 ? -21.328 5.437   3.408   1.00 75.43 ? 197 LYS A CB   1  
ATOM 3159   C CG   . LYS A 1 197 ? -22.667 4.687   3.542   1.00 33.54 ? 197 LYS A CG   1  
ATOM 3160   C CD   . LYS A 1 197 ? -23.845 5.681   3.474   1.00 20.41 ? 197 LYS A CD   1  
ATOM 3161   C CE   . LYS A 1 197 ? -25.084 4.990   2.893   1.00 10.41 ? 197 LYS A CE   1  
ATOM 3162   N NZ   . LYS A 1 197 ? -24.905 4.797   1.427   1.00 1.11  ? 197 LYS A NZ   1  
ATOM 3163   H H    . LYS A 1 197 ? -21.872 7.886   2.782   1.00 53.53 ? 197 LYS A H    1  
ATOM 3164   H HA   . LYS A 1 197 ? -21.976 6.464   5.204   1.00 13.12 ? 197 LYS A HA   1  
ATOM 3165   H HB2  . LYS A 1 197 ? -21.247 5.825   2.404   1.00 3.10  ? 197 LYS A HB2  1  
ATOM 3166   H HB3  . LYS A 1 197 ? -20.519 4.743   3.591   1.00 41.05 ? 197 LYS A HB3  1  
ATOM 3167   H HG2  . LYS A 1 197 ? -22.749 3.967   2.738   1.00 41.54 ? 197 LYS A HG2  1  
ATOM 3168   H HG3  . LYS A 1 197 ? -22.691 4.166   4.489   1.00 53.11 ? 197 LYS A HG3  1  
ATOM 3169   H HD2  . LYS A 1 197 ? -24.075 6.036   4.468   1.00 41.32 ? 197 LYS A HD2  1  
ATOM 3170   H HD3  . LYS A 1 197 ? -23.578 6.520   2.849   1.00 43.11 ? 197 LYS A HD3  1  
ATOM 3171   H HE2  . LYS A 1 197 ? -25.217 4.030   3.369   1.00 40.22 ? 197 LYS A HE2  1  
ATOM 3172   H HE3  . LYS A 1 197 ? -25.956 5.603   3.072   1.00 14.22 ? 197 LYS A HE3  1  
ATOM 3173   H HZ1  . LYS A 1 197 ? -25.820 4.916   0.947   1.00 61.21 ? 197 LYS A HZ1  1  
ATOM 3174   H HZ2  . LYS A 1 197 ? -24.539 3.840   1.246   1.00 52.10 ? 197 LYS A HZ2  1  
ATOM 3175   H HZ3  . LYS A 1 197 ? -24.232 5.501   1.064   1.00 20.52 ? 197 LYS A HZ3  1  
ATOM 3176   N N    . PRO A 1 198 ? -18.822 6.861   4.272   1.00 15.12 ? 198 PRO A N    1  
ATOM 3177   C CA   . PRO A 1 198 ? -17.445 6.979   4.827   1.00 21.22 ? 198 PRO A CA   1  
ATOM 3178   C C    . PRO A 1 198 ? -17.284 8.269   5.641   1.00 5.35  ? 198 PRO A C    1  
ATOM 3179   O O    . PRO A 1 198 ? -16.971 8.240   6.814   1.00 72.32 ? 198 PRO A O    1  
ATOM 3180   C CB   . PRO A 1 198 ? -16.541 6.988   3.582   1.00 21.14 ? 198 PRO A CB   1  
ATOM 3181   C CG   . PRO A 1 198 ? -17.425 7.468   2.477   1.00 13.33 ? 198 PRO A CG   1  
ATOM 3182   C CD   . PRO A 1 198 ? -18.819 6.931   2.799   1.00 13.13 ? 198 PRO A CD   1  
ATOM 3183   H HA   . PRO A 1 198 ? -17.223 6.121   5.437   1.00 12.00 ? 198 PRO A HA   1  
ATOM 3184   H HB2  . PRO A 1 198 ? -15.701 7.659   3.721   1.00 64.23 ? 198 PRO A HB2  1  
ATOM 3185   H HB3  . PRO A 1 198 ? -16.190 5.989   3.366   1.00 1.24  ? 198 PRO A HB3  1  
ATOM 3186   H HG2  . PRO A 1 198 ? -17.435 8.551   2.453   1.00 34.13 ? 198 PRO A HG2  1  
ATOM 3187   H HG3  . PRO A 1 198 ? -17.091 7.077   1.528   1.00 21.43 ? 198 PRO A HG3  1  
ATOM 3188   H HD2  . PRO A 1 198 ? -19.579 7.609   2.438   1.00 5.23  ? 198 PRO A HD2  1  
ATOM 3189   H HD3  . PRO A 1 198 ? -18.947 5.947   2.378   1.00 15.45 ? 198 PRO A HD3  1  
ATOM 3190   N N    . LEU A 1 199 ? -17.514 9.399   5.027   1.00 42.44 ? 199 LEU A N    1  
ATOM 3191   C CA   . LEU A 1 199 ? -17.397 10.691  5.764   1.00 10.14 ? 199 LEU A CA   1  
ATOM 3192   C C    . LEU A 1 199 ? -18.737 10.975  6.453   1.00 45.30 ? 199 LEU A C    1  
ATOM 3193   O O    . LEU A 1 199 ? -19.632 11.557  5.873   1.00 52.21 ? 199 LEU A O    1  
ATOM 3194   C CB   . LEU A 1 199 ? -17.078 11.819  4.770   1.00 14.11 ? 199 LEU A CB   1  
ATOM 3195   C CG   . LEU A 1 199 ? -15.571 11.849  4.456   1.00 74.54 ? 199 LEU A CG   1  
ATOM 3196   C CD1  . LEU A 1 199 ? -14.762 12.338  5.676   1.00 41.35 ? 199 LEU A CD1  1  
ATOM 3197   C CD2  . LEU A 1 199 ? -15.106 10.444  4.053   1.00 11.32 ? 199 LEU A CD2  1  
ATOM 3198   H H    . LEU A 1 199 ? -17.780 9.398   4.082   1.00 32.04 ? 199 LEU A H    1  
ATOM 3199   H HA   . LEU A 1 199 ? -16.614 10.622  6.506   1.00 64.11 ? 199 LEU A HA   1  
ATOM 3200   H HB2  . LEU A 1 199 ? -17.626 11.647  3.854   1.00 3.12  ? 199 LEU A HB2  1  
ATOM 3201   H HB3  . LEU A 1 199 ? -17.376 12.769  5.188   1.00 30.13 ? 199 LEU A HB3  1  
ATOM 3202   H HG   . LEU A 1 199 ? -15.400 12.525  3.631   1.00 23.50 ? 199 LEU A HG   1  
ATOM 3203   H HD11 . LEU A 1 199 ? -15.352 13.031  6.258   1.00 31.12 ? 199 LEU A HD11 1  
ATOM 3204   H HD12 . LEU A 1 199 ? -13.869 12.839  5.332   1.00 74.32 ? 199 LEU A HD12 1  
ATOM 3205   H HD13 . LEU A 1 199 ? -14.480 11.498  6.297   1.00 32.34 ? 199 LEU A HD13 1  
ATOM 3206   H HD21 . LEU A 1 199 ? -14.118 10.502  3.623   1.00 32.33 ? 199 LEU A HD21 1  
ATOM 3207   H HD22 . LEU A 1 199 ? -15.792 10.032  3.327   1.00 2.24  ? 199 LEU A HD22 1  
ATOM 3208   H HD23 . LEU A 1 199 ? -15.082 9.808   4.926   1.00 44.40 ? 199 LEU A HD23 1  
ATOM 3209   N N    . GLY A 1 200 ? -18.886 10.560  7.681   1.00 61.51 ? 200 GLY A N    1  
ATOM 3210   C CA   . GLY A 1 200 ? -20.172 10.797  8.400   1.00 12.10 ? 200 GLY A CA   1  
ATOM 3211   C C    . GLY A 1 200 ? -20.461 12.298  8.473   1.00 50.01 ? 200 GLY A C    1  
ATOM 3212   O O    . GLY A 1 200 ? -21.465 12.716  9.015   1.00 43.40 ? 200 GLY A O    1  
ATOM 3213   H H    . GLY A 1 200 ? -18.154 10.086  8.129   1.00 24.32 ? 200 GLY A H    1  
ATOM 3214   H HA2  . GLY A 1 200 ? -20.973 10.302  7.870   1.00 20.51 ? 200 GLY A HA2  1  
ATOM 3215   H HA3  . GLY A 1 200 ? -20.103 10.398  9.401   1.00 52.20 ? 200 GLY A HA3  1  
ATOM 3216   N N    . ILE A 1 201 ? -19.589 13.112  7.931   1.00 61.22 ? 201 ILE A N    1  
ATOM 3217   C CA   . ILE A 1 201 ? -19.801 14.594  7.962   1.00 11.40 ? 201 ILE A CA   1  
ATOM 3218   C C    . ILE A 1 201 ? -20.157 15.084  6.558   1.00 1.15  ? 201 ILE A C    1  
ATOM 3219   O O    . ILE A 1 201 ? -19.485 14.776  5.594   1.00 22.41 ? 201 ILE A O    1  
ATOM 3220   C CB   . ILE A 1 201 ? -18.510 15.283  8.420   1.00 40.21 ? 201 ILE A CB   1  
ATOM 3221   C CG1  . ILE A 1 201 ? -17.999 14.626  9.710   1.00 35.35 ? 201 ILE A CG1  1  
ATOM 3222   C CG2  . ILE A 1 201 ? -18.783 16.769  8.672   1.00 43.35 ? 201 ILE A CG2  1  
ATOM 3223   C CD1  . ILE A 1 201 ? -19.119 14.563  10.755  1.00 53.34 ? 201 ILE A CD1  1  
ATOM 3224   H H    . ILE A 1 201 ? -18.790 12.747  7.500   1.00 74.25 ? 201 ILE A H    1  
ATOM 3225   H HA   . ILE A 1 201 ? -20.603 14.846  8.642   1.00 61.02 ? 201 ILE A HA   1  
ATOM 3226   H HB   . ILE A 1 201 ? -17.762 15.185  7.646   1.00 23.05 ? 201 ILE A HB   1  
ATOM 3227   H HG12 . ILE A 1 201 ? -17.659 13.624  9.490   1.00 65.10 ? 201 ILE A HG12 1  
ATOM 3228   H HG13 . ILE A 1 201 ? -17.176 15.203  10.104  1.00 61.00 ? 201 ILE A HG13 1  
ATOM 3229   H HG21 . ILE A 1 201 ? -19.408 16.877  9.546   1.00 1.42  ? 201 ILE A HG21 1  
ATOM 3230   H HG22 . ILE A 1 201 ? -19.285 17.195  7.816   1.00 4.12  ? 201 ILE A HG22 1  
ATOM 3231   H HG23 . ILE A 1 201 ? -17.848 17.285  8.833   1.00 21.24 ? 201 ILE A HG23 1  
ATOM 3232   H HD11 . ILE A 1 201 ? -19.689 15.479  10.734  1.00 2.22  ? 201 ILE A HD11 1  
ATOM 3233   H HD12 . ILE A 1 201 ? -18.687 14.433  11.737  1.00 33.00 ? 201 ILE A HD12 1  
ATOM 3234   H HD13 . ILE A 1 201 ? -19.769 13.729  10.536  1.00 11.20 ? 201 ILE A HD13 1  
ATOM 3235   N N    . SER A 1 202 ? -21.208 15.849  6.435   1.00 40.44 ? 202 SER A N    1  
ATOM 3236   C CA   . SER A 1 202 ? -21.602 16.362  5.094   1.00 72.00 ? 202 SER A CA   1  
ATOM 3237   C C    . SER A 1 202 ? -20.675 17.514  4.701   1.00 32.24 ? 202 SER A C    1  
ATOM 3238   O O    . SER A 1 202 ? -20.225 18.273  5.537   1.00 11.15 ? 202 SER A O    1  
ATOM 3239   C CB   . SER A 1 202 ? -23.046 16.864  5.144   1.00 71.14 ? 202 SER A CB   1  
ATOM 3240   O OG   . SER A 1 202 ? -23.912 15.776  5.439   1.00 14.40 ? 202 SER A OG   1  
ATOM 3241   H H    . SER A 1 202 ? -21.735 16.088  7.225   1.00 15.34 ? 202 SER A H    1  
ATOM 3242   H HA   . SER A 1 202 ? -21.521 15.569  4.366   1.00 30.11 ? 202 SER A HA   1  
ATOM 3243   H HB2  . SER A 1 202 ? -23.143 17.612  5.913   1.00 24.23 ? 202 SER A HB2  1  
ATOM 3244   H HB3  . SER A 1 202 ? -23.309 17.298  4.188   1.00 0.53  ? 202 SER A HB3  1  
ATOM 3245   H HG   . SER A 1 202 ? -24.275 15.453  4.611   1.00 62.44 ? 202 SER A HG   1  
ATOM 3246   N N    . THR A 1 203 ? -20.384 17.647  3.433   1.00 11.35 ? 203 THR A N    1  
ATOM 3247   C CA   . THR A 1 203 ? -19.481 18.747  2.969   1.00 61.41 ? 203 THR A CA   1  
ATOM 3248   C C    . THR A 1 203 ? -20.023 19.331  1.664   1.00 64.45 ? 203 THR A C    1  
ATOM 3249   O O    . THR A 1 203 ? -19.405 20.183  1.056   1.00 3.03  ? 203 THR A O    1  
ATOM 3250   C CB   . THR A 1 203 ? -18.079 18.184  2.725   1.00 74.44 ? 203 THR A CB   1  
ATOM 3251   O OG1  . THR A 1 203 ? -18.073 17.446  1.511   1.00 11.12 ? 203 THR A OG1  1  
ATOM 3252   C CG2  . THR A 1 203 ? -17.684 17.268  3.884   1.00 65.22 ? 203 THR A CG2  1  
ATOM 3253   H H    . THR A 1 203 ? -20.758 17.019  2.780   1.00 0.23  ? 203 THR A H    1  
ATOM 3254   H HA   . THR A 1 203 ? -19.432 19.527  3.716   1.00 63.51 ? 203 THR A HA   1  
ATOM 3255   H HB   . THR A 1 203 ? -17.372 18.997  2.657   1.00 22.04 ? 203 THR A HB   1  
ATOM 3256   H HG1  . THR A 1 203 ? -17.177 17.136  1.357   1.00 3.24  ? 203 THR A HG1  1  
ATOM 3257   H HG21 . THR A 1 203 ? -17.925 17.748  4.821   1.00 71.42 ? 203 THR A HG21 1  
ATOM 3258   H HG22 . THR A 1 203 ? -16.622 17.073  3.842   1.00 43.33 ? 203 THR A HG22 1  
ATOM 3259   H HG23 . THR A 1 203 ? -18.225 16.336  3.807   1.00 74.01 ? 203 THR A HG23 1  
ATOM 3260   N N    . VAL A 1 204 ? -21.173 18.874  1.229   1.00 64.35 ? 204 VAL A N    1  
ATOM 3261   C CA   . VAL A 1 204 ? -21.773 19.390  -0.045  1.00 64.12 ? 204 VAL A CA   1  
ATOM 3262   C C    . VAL A 1 204 ? -23.145 20.004  0.247   1.00 24.34 ? 204 VAL A C    1  
ATOM 3263   O O    . VAL A 1 204 ? -23.972 19.412  0.913   1.00 10.42 ? 204 VAL A O    1  
ATOM 3264   C CB   . VAL A 1 204 ? -21.932 18.229  -1.035  1.00 2.34  ? 204 VAL A CB   1  
ATOM 3265   C CG1  . VAL A 1 204 ? -20.606 17.474  -1.151  1.00 51.22 ? 204 VAL A CG1  1  
ATOM 3266   C CG2  . VAL A 1 204 ? -23.019 17.266  -0.543  1.00 55.01 ? 204 VAL A CG2  1  
ATOM 3267   H H    . VAL A 1 204 ? -21.646 18.186  1.741   1.00 65.11 ? 204 VAL A H    1  
ATOM 3268   H HA   . VAL A 1 204 ? -21.134 20.145  -0.482  1.00 1.32  ? 204 VAL A HA   1  
ATOM 3269   H HB   . VAL A 1 204 ? -22.207 18.620  -2.005  1.00 71.13 ? 204 VAL A HB   1  
ATOM 3270   H HG11 . VAL A 1 204 ? -20.645 16.808  -2.001  1.00 2.10  ? 204 VAL A HG11 1  
ATOM 3271   H HG12 . VAL A 1 204 ? -20.440 16.901  -0.252  1.00 1.33  ? 204 VAL A HG12 1  
ATOM 3272   H HG13 . VAL A 1 204 ? -19.800 18.178  -1.282  1.00 23.52 ? 204 VAL A HG13 1  
ATOM 3273   H HG21 . VAL A 1 204 ? -22.950 16.335  -1.088  1.00 43.44 ? 204 VAL A HG21 1  
ATOM 3274   H HG22 . VAL A 1 204 ? -23.992 17.707  -0.708  1.00 53.01 ? 204 VAL A HG22 1  
ATOM 3275   H HG23 . VAL A 1 204 ? -22.883 17.077  0.512   1.00 24.42 ? 204 VAL A HG23 1  
ATOM 3276   N N    . GLU A 1 205 ? -23.395 21.185  -0.257  1.00 11.43 ? 205 GLU A N    1  
ATOM 3277   C CA   . GLU A 1 205 ? -24.715 21.850  -0.029  1.00 63.31 ? 205 GLU A CA   1  
ATOM 3278   C C    . GLU A 1 205 ? -25.553 21.738  -1.303  1.00 12.14 ? 205 GLU A C    1  
ATOM 3279   O O    . GLU A 1 205 ? -25.180 22.236  -2.346  1.00 54.30 ? 205 GLU A O    1  
ATOM 3280   C CB   . GLU A 1 205 ? -24.488 23.326  0.300   1.00 51.41 ? 205 GLU A CB   1  
ATOM 3281   C CG   . GLU A 1 205 ? -23.635 23.439  1.566   1.00 71.41 ? 205 GLU A CG   1  
ATOM 3282   C CD   . GLU A 1 205 ? -24.410 22.878  2.760   1.00 21.20 ? 205 GLU A CD   1  
ATOM 3283   O OE1  . GLU A 1 205 ? -25.627 22.840  2.687   1.00 31.43 ? 205 GLU A OE1  1  
ATOM 3284   O OE2  . GLU A 1 205 ? -23.772 22.496  3.728   1.00 4.43  ? 205 GLU A OE2  1  
ATOM 3285   H H    . GLU A 1 205 ? -22.711 21.637  -0.796  1.00 23.14 ? 205 GLU A H    1  
ATOM 3286   H HA   . GLU A 1 205 ? -25.239 21.375  0.790   1.00 1.34  ? 205 GLU A HA   1  
ATOM 3287   H HB2  . GLU A 1 205 ? -23.977 23.802  -0.524  1.00 45.45 ? 205 GLU A HB2  1  
ATOM 3288   H HB3  . GLU A 1 205 ? -25.439 23.810  0.464   1.00 33.14 ? 205 GLU A HB3  1  
ATOM 3289   H HG2  . GLU A 1 205 ? -22.720 22.879  1.433   1.00 73.51 ? 205 GLU A HG2  1  
ATOM 3290   H HG3  . GLU A 1 205 ? -23.398 24.477  1.748   1.00 72.12 ? 205 GLU A HG3  1  
ATOM 3291   N N    . THR A 1 206 ? -26.682 21.083  -1.230  1.00 63.03 ? 206 THR A N    1  
ATOM 3292   C CA   . THR A 1 206 ? -27.543 20.933  -2.441  1.00 73.52 ? 206 THR A CA   1  
ATOM 3293   C C    . THR A 1 206 ? -28.591 22.045  -2.465  1.00 24.45 ? 206 THR A C    1  
ATOM 3294   O O    . THR A 1 206 ? -29.288 22.278  -1.497  1.00 1.11  ? 206 THR A O    1  
ATOM 3295   C CB   . THR A 1 206 ? -28.249 19.573  -2.403  1.00 35.35 ? 206 THR A CB   1  
ATOM 3296   O OG1  . THR A 1 206 ? -29.452 19.646  -3.156  1.00 10.41 ? 206 THR A OG1  1  
ATOM 3297   C CG2  . THR A 1 206 ? -28.576 19.205  -0.955  1.00 21.42 ? 206 THR A CG2  1  
ATOM 3298   H H    . THR A 1 206 ? -26.962 20.686  -0.379  1.00 60.33 ? 206 THR A H    1  
ATOM 3299   H HA   . THR A 1 206 ? -26.936 20.997  -3.333  1.00 21.11 ? 206 THR A HA   1  
ATOM 3300   H HB   . THR A 1 206 ? -27.604 18.817  -2.825  1.00 70.41 ? 206 THR A HB   1  
ATOM 3301   H HG1  . THR A 1 206 ? -29.218 19.690  -4.086  1.00 33.33 ? 206 THR A HG1  1  
ATOM 3302   H HG21 . THR A 1 206 ? -29.303 18.407  -0.943  1.00 61.31 ? 206 THR A HG21 1  
ATOM 3303   H HG22 . THR A 1 206 ? -28.981 20.067  -0.445  1.00 71.32 ? 206 THR A HG22 1  
ATOM 3304   H HG23 . THR A 1 206 ? -27.677 18.880  -0.453  1.00 2.12  ? 206 THR A HG23 1  
ATOM 3305   N N    . VAL A 1 207 ? -28.708 22.730  -3.570  1.00 71.02 ? 207 VAL A N    1  
ATOM 3306   C CA   . VAL A 1 207 ? -29.712 23.830  -3.677  1.00 3.25  ? 207 VAL A CA   1  
ATOM 3307   C C    . VAL A 1 207 ? -30.273 23.854  -5.101  1.00 2.25  ? 207 VAL A C    1  
ATOM 3308   O O    . VAL A 1 207 ? -29.538 23.822  -6.067  1.00 32.44 ? 207 VAL A O    1  
ATOM 3309   C CB   . VAL A 1 207 ? -29.034 25.165  -3.362  1.00 12.00 ? 207 VAL A CB   1  
ATOM 3310   C CG1  . VAL A 1 207 ? -30.091 26.265  -3.252  1.00 41.33 ? 207 VAL A CG1  1  
ATOM 3311   C CG2  . VAL A 1 207 ? -28.282 25.049  -2.034  1.00 21.05 ? 207 VAL A CG2  1  
ATOM 3312   H H    . VAL A 1 207 ? -28.136 22.519  -4.337  1.00 64.44 ? 207 VAL A H    1  
ATOM 3313   H HA   . VAL A 1 207 ? -30.519 23.661  -2.977  1.00 3.40  ? 207 VAL A HA   1  
ATOM 3314   H HB   . VAL A 1 207 ? -28.339 25.411  -4.152  1.00 61.22 ? 207 VAL A HB   1  
ATOM 3315   H HG11 . VAL A 1 207 ? -30.840 25.973  -2.531  1.00 52.22 ? 207 VAL A HG11 1  
ATOM 3316   H HG12 . VAL A 1 207 ? -30.556 26.414  -4.214  1.00 25.53 ? 207 VAL A HG12 1  
ATOM 3317   H HG13 . VAL A 1 207 ? -29.622 27.184  -2.933  1.00 72.15 ? 207 VAL A HG13 1  
ATOM 3318   H HG21 . VAL A 1 207 ? -27.409 24.427  -2.168  1.00 30.33 ? 207 VAL A HG21 1  
ATOM 3319   H HG22 . VAL A 1 207 ? -28.929 24.605  -1.292  1.00 54.43 ? 207 VAL A HG22 1  
ATOM 3320   H HG23 . VAL A 1 207 ? -27.978 26.031  -1.705  1.00 55.33 ? 207 VAL A HG23 1  
ATOM 3321   N N    . ARG A 1 208 ? -31.569 23.900  -5.239  1.00 32.10 ? 208 ARG A N    1  
ATOM 3322   C CA   . ARG A 1 208 ? -32.173 23.913  -6.602  1.00 44.20 ? 208 ARG A CA   1  
ATOM 3323   C C    . ARG A 1 208 ? -31.617 25.094  -7.401  1.00 51.41 ? 208 ARG A C    1  
ATOM 3324   O O    . ARG A 1 208 ? -31.477 25.029  -8.606  1.00 32.02 ? 208 ARG A O    1  
ATOM 3325   C CB   . ARG A 1 208 ? -33.692 24.046  -6.483  1.00 54.43 ? 208 ARG A CB   1  
ATOM 3326   C CG   . ARG A 1 208 ? -34.240 22.881  -5.655  1.00 63.14 ? 208 ARG A CG   1  
ATOM 3327   C CD   . ARG A 1 208 ? -35.770 22.905  -5.682  1.00 33.15 ? 208 ARG A CD   1  
ATOM 3328   N NE   . ARG A 1 208 ? -36.298 22.031  -4.597  1.00 20.15 ? 208 ARG A NE   1  
ATOM 3329   C CZ   . ARG A 1 208 ? -36.241 20.732  -4.718  1.00 72.12 ? 208 ARG A CZ   1  
ATOM 3330   N NH1  . ARG A 1 208 ? -35.729 20.198  -5.792  1.00 4.45  ? 208 ARG A NH1  1  
ATOM 3331   N NH2  . ARG A 1 208 ? -36.697 19.966  -3.763  1.00 2.25  ? 208 ARG A NH2  1  
ATOM 3332   H H    . ARG A 1 208 ? -32.146 23.917  -4.447  1.00 72.34 ? 208 ARG A H    1  
ATOM 3333   H HA   . ARG A 1 208 ? -31.932 22.992  -7.110  1.00 3.13  ? 208 ARG A HA   1  
ATOM 3334   H HB2  . ARG A 1 208 ? -33.935 24.981  -5.998  1.00 62.52 ? 208 ARG A HB2  1  
ATOM 3335   H HB3  . ARG A 1 208 ? -34.134 24.025  -7.468  1.00 15.24 ? 208 ARG A HB3  1  
ATOM 3336   H HG2  . ARG A 1 208 ? -33.887 21.949  -6.071  1.00 64.00 ? 208 ARG A HG2  1  
ATOM 3337   H HG3  . ARG A 1 208 ? -33.899 22.973  -4.635  1.00 72.40 ? 208 ARG A HG3  1  
ATOM 3338   H HD2  . ARG A 1 208 ? -36.118 23.917  -5.531  1.00 14.01 ? 208 ARG A HD2  1  
ATOM 3339   H HD3  . ARG A 1 208 ? -36.118 22.543  -6.638  1.00 64.24 ? 208 ARG A HD3  1  
ATOM 3340   H HE   . ARG A 1 208 ? -36.685 22.431  -3.791  1.00 14.32 ? 208 ARG A HE   1  
ATOM 3341   H HH11 . ARG A 1 208 ? -35.380 20.783  -6.524  1.00 61.32 ? 208 ARG A HH11 1  
ATOM 3342   H HH12 . ARG A 1 208 ? -35.685 19.203  -5.885  1.00 12.42 ? 208 ARG A HH12 1  
ATOM 3343   H HH21 . ARG A 1 208 ? -37.090 20.375  -2.939  1.00 43.12 ? 208 ARG A HH21 1  
ATOM 3344   H HH22 . ARG A 1 208 ? -36.653 18.971  -3.856  1.00 23.12 ? 208 ARG A HH22 1  
ATOM 3345   N N    . ARG A 1 209 ? -31.302 26.173  -6.741  1.00 34.24 ? 209 ARG A N    1  
ATOM 3346   C CA   . ARG A 1 209 ? -30.759 27.359  -7.462  1.00 53.00 ? 209 ARG A CA   1  
ATOM 3347   C C    . ARG A 1 209 ? -29.414 27.006  -8.102  1.00 34.05 ? 209 ARG A C    1  
ATOM 3348   O O    . ARG A 1 209 ? -28.581 26.360  -7.499  1.00 33.43 ? 209 ARG A O    1  
ATOM 3349   C CB   . ARG A 1 209 ? -30.561 28.506  -6.469  1.00 31.14 ? 209 ARG A CB   1  
ATOM 3350   C CG   . ARG A 1 209 ? -31.919 28.945  -5.920  1.00 55.05 ? 209 ARG A CG   1  
ATOM 3351   C CD   . ARG A 1 209 ? -31.709 29.975  -4.809  1.00 3.25  ? 209 ARG A CD   1  
ATOM 3352   N NE   . ARG A 1 209 ? -33.018 30.290  -4.172  1.00 64.41 ? 209 ARG A NE   1  
ATOM 3353   C CZ   . ARG A 1 209 ? -33.596 29.412  -3.399  1.00 43.21 ? 209 ARG A CZ   1  
ATOM 3354   N NH1  . ARG A 1 209 ? -33.030 28.256  -3.184  1.00 12.45 ? 209 ARG A NH1  1  
ATOM 3355   N NH2  . ARG A 1 209 ? -34.743 29.690  -2.843  1.00 3.24  ? 209 ARG A NH2  1  
ATOM 3356   H H    . ARG A 1 209 ? -31.426 26.205  -5.770  1.00 34.03 ? 209 ARG A H    1  
ATOM 3357   H HA   . ARG A 1 209 ? -31.455 27.664  -8.229  1.00 60.20 ? 209 ARG A HA   1  
ATOM 3358   H HB2  . ARG A 1 209 ? -29.934 28.172  -5.655  1.00 11.31 ? 209 ARG A HB2  1  
ATOM 3359   H HB3  . ARG A 1 209 ? -30.091 29.338  -6.970  1.00 62.32 ? 209 ARG A HB3  1  
ATOM 3360   H HG2  . ARG A 1 209 ? -32.503 29.385  -6.715  1.00 14.23 ? 209 ARG A HG2  1  
ATOM 3361   H HG3  . ARG A 1 209 ? -32.440 28.089  -5.520  1.00 50.30 ? 209 ARG A HG3  1  
ATOM 3362   H HD2  . ARG A 1 209 ? -31.034 29.573  -4.068  1.00 23.11 ? 209 ARG A HD2  1  
ATOM 3363   H HD3  . ARG A 1 209 ? -31.287 30.876  -5.229  1.00 31.54 ? 209 ARG A HD3  1  
ATOM 3364   H HE   . ARG A 1 209 ? -33.445 31.157  -4.333  1.00 71.35 ? 209 ARG A HE   1  
ATOM 3365   H HH11 . ARG A 1 209 ? -32.152 28.042  -3.612  1.00 12.54 ? 209 ARG A HH11 1  
ATOM 3366   H HH12 . ARG A 1 209 ? -33.474 27.585  -2.591  1.00 53.42 ? 209 ARG A HH12 1  
ATOM 3367   H HH21 . ARG A 1 209 ? -35.177 30.575  -3.009  1.00 72.14 ? 209 ARG A HH21 1  
ATOM 3368   H HH22 . ARG A 1 209 ? -35.187 29.019  -2.249  1.00 73.31 ? 209 ARG A HH22 1  
ATOM 3369   N N    . ARG A 1 210 ? -29.196 27.436  -9.317  1.00 62.12 ? 210 ARG A N    1  
ATOM 3370   C CA   . ARG A 1 210 ? -27.905 27.139  -10.003 1.00 71.54 ? 210 ARG A CA   1  
ATOM 3371   C C    . ARG A 1 210 ? -27.683 25.623  -10.071 1.00 1.31  ? 210 ARG A C    1  
ATOM 3372   O O    . ARG A 1 210 ? -27.896 25.004  -11.094 1.00 4.44  ? 210 ARG A O    1  
ATOM 3373   C CB   . ARG A 1 210 ? -26.755 27.800  -9.231  1.00 44.33 ? 210 ARG A CB   1  
ATOM 3374   C CG   . ARG A 1 210 ? -25.482 27.837  -10.100 1.00 4.34  ? 210 ARG A CG   1  
ATOM 3375   C CD   . ARG A 1 210 ? -25.462 29.107  -10.960 1.00 42.43 ? 210 ARG A CD   1  
ATOM 3376   N NE   . ARG A 1 210 ? -25.024 30.262  -10.125 1.00 12.24 ? 210 ARG A NE   1  
ATOM 3377   C CZ   . ARG A 1 210 ? -24.581 31.350  -10.696 1.00 55.34 ? 210 ARG A CZ   1  
ATOM 3378   N NH1  . ARG A 1 210 ? -24.515 31.424  -11.997 1.00 61.10 ? 210 ARG A NH1  1  
ATOM 3379   N NH2  . ARG A 1 210 ? -24.203 32.363  -9.965  1.00 1.53  ? 210 ARG A NH2  1  
ATOM 3380   H H    . ARG A 1 210 ? -29.882 27.961  -9.778  1.00 41.41 ? 210 ARG A H    1  
ATOM 3381   H HA   . ARG A 1 210 ? -27.937 27.537  -11.006 1.00 33.12 ? 210 ARG A HA   1  
ATOM 3382   H HB2  . ARG A 1 210 ? -27.041 28.807  -8.958  1.00 34.11 ? 210 ARG A HB2  1  
ATOM 3383   H HB3  . ARG A 1 210 ? -26.557 27.235  -8.333  1.00 43.44 ? 210 ARG A HB3  1  
ATOM 3384   H HG2  . ARG A 1 210 ? -24.614 27.832  -9.458  1.00 50.11 ? 210 ARG A HG2  1  
ATOM 3385   H HG3  . ARG A 1 210 ? -25.452 26.970  -10.744 1.00 35.14 ? 210 ARG A HG3  1  
ATOM 3386   H HD2  . ARG A 1 210 ? -24.773 28.974  -11.780 1.00 41.04 ? 210 ARG A HD2  1  
ATOM 3387   H HD3  . ARG A 1 210 ? -26.451 29.298  -11.348 1.00 33.32 ? 210 ARG A HD3  1  
ATOM 3388   H HE   . ARG A 1 210 ? -25.070 30.206  -9.148  1.00 4.05  ? 210 ARG A HE   1  
ATOM 3389   H HH11 . ARG A 1 210 ? -24.804 30.648  -12.557 1.00 41.12 ? 210 ARG A HH11 1  
ATOM 3390   H HH12 . ARG A 1 210 ? -24.174 32.257  -12.434 1.00 61.34 ? 210 ARG A HH12 1  
ATOM 3391   H HH21 . ARG A 1 210 ? -24.252 32.307  -8.968  1.00 70.45 ? 210 ARG A HH21 1  
ATOM 3392   H HH22 . ARG A 1 210 ? -23.864 33.196  -10.403 1.00 20.34 ? 210 ARG A HH22 1  
ATOM 3393   N N    . GLY A 1 211 ? -27.257 25.020  -8.994  1.00 70.25 ? 211 GLY A N    1  
ATOM 3394   C CA   . GLY A 1 211 ? -27.024 23.548  -9.006  1.00 50.11 ? 211 GLY A CA   1  
ATOM 3395   C C    . GLY A 1 211 ? -26.589 23.094  -7.612  1.00 42.11 ? 211 GLY A C    1  
ATOM 3396   O O    . GLY A 1 211 ? -27.342 23.182  -6.663  1.00 72.03 ? 211 GLY A O    1  
ATOM 3397   H H    . GLY A 1 211 ? -27.091 25.533  -8.177  1.00 74.45 ? 211 GLY A H    1  
ATOM 3398   H HA2  . GLY A 1 211 ? -27.937 23.042  -9.285  1.00 11.50 ? 211 GLY A HA2  1  
ATOM 3399   H HA3  . GLY A 1 211 ? -26.247 23.311  -9.717  1.00 4.15  ? 211 GLY A HA3  1  
ATOM 3400   N N    . TYR A 1 212 ? -25.375 22.613  -7.480  1.00 2.30  ? 212 TYR A N    1  
ATOM 3401   C CA   . TYR A 1 212 ? -24.873 22.153  -6.144  1.00 51.34 ? 212 TYR A CA   1  
ATOM 3402   C C    . TYR A 1 212 ? -23.746 23.081  -5.680  1.00 40.43 ? 212 TYR A C    1  
ATOM 3403   O O    . TYR A 1 212 ? -22.859 23.423  -6.439  1.00 11.34 ? 212 TYR A O    1  
ATOM 3404   C CB   . TYR A 1 212 ? -24.330 20.723  -6.261  1.00 75.54 ? 212 TYR A CB   1  
ATOM 3405   C CG   . TYR A 1 212 ? -25.363 19.832  -6.914  1.00 64.21 ? 212 TYR A CG   1  
ATOM 3406   C CD1  . TYR A 1 212 ? -26.424 19.316  -6.158  1.00 73.20 ? 212 TYR A CD1  1  
ATOM 3407   C CD2  . TYR A 1 212 ? -25.257 19.516  -8.274  1.00 3.44  ? 212 TYR A CD2  1  
ATOM 3408   C CE1  . TYR A 1 212 ? -27.377 18.487  -6.762  1.00 51.53 ? 212 TYR A CE1  1  
ATOM 3409   C CE2  . TYR A 1 212 ? -26.211 18.687  -8.878  1.00 43.34 ? 212 TYR A CE2  1  
ATOM 3410   C CZ   . TYR A 1 212 ? -27.271 18.173  -8.121  1.00 50.15 ? 212 TYR A CZ   1  
ATOM 3411   O OH   . TYR A 1 212 ? -28.211 17.356  -8.717  1.00 61.34 ? 212 TYR A OH   1  
ATOM 3412   H H    . TYR A 1 212 ? -24.788 22.559  -8.264  1.00 0.53  ? 212 TYR A H    1  
ATOM 3413   H HA   . TYR A 1 212 ? -25.671 22.172  -5.415  1.00 21.22 ? 212 TYR A HA   1  
ATOM 3414   H HB2  . TYR A 1 212 ? -23.429 20.727  -6.855  1.00 65.13 ? 212 TYR A HB2  1  
ATOM 3415   H HB3  . TYR A 1 212 ? -24.107 20.345  -5.274  1.00 24.23 ? 212 TYR A HB3  1  
ATOM 3416   H HD1  . TYR A 1 212 ? -26.506 19.557  -5.110  1.00 13.45 ? 212 TYR A HD1  1  
ATOM 3417   H HD2  . TYR A 1 212 ? -24.440 19.913  -8.859  1.00 43.40 ? 212 TYR A HD2  1  
ATOM 3418   H HE1  . TYR A 1 212 ? -28.195 18.090  -6.178  1.00 65.31 ? 212 TYR A HE1  1  
ATOM 3419   H HE2  . TYR A 1 212 ? -26.128 18.443  -9.926  1.00 4.34  ? 212 TYR A HE2  1  
ATOM 3420   H HH   . TYR A 1 212 ? -28.165 16.495  -8.296  1.00 44.45 ? 212 TYR A HH   1  
ATOM 3421   N N    . ARG A 1 213 ? -23.775 23.485  -4.434  1.00 13.20 ? 213 ARG A N    1  
ATOM 3422   C CA   . ARG A 1 213 ? -22.710 24.391  -3.892  1.00 41.11 ? 213 ARG A CA   1  
ATOM 3423   C C    . ARG A 1 213 ? -21.839 23.602  -2.910  1.00 11.22 ? 213 ARG A C    1  
ATOM 3424   O O    . ARG A 1 213 ? -22.332 22.806  -2.136  1.00 75.31 ? 213 ARG A O    1  
ATOM 3425   C CB   . ARG A 1 213 ? -23.369 25.567  -3.163  1.00 21.20 ? 213 ARG A CB   1  
ATOM 3426   C CG   . ARG A 1 213 ? -22.291 26.434  -2.507  1.00 43.00 ? 213 ARG A CG   1  
ATOM 3427   C CD   . ARG A 1 213 ? -22.917 27.732  -1.989  1.00 11.31 ? 213 ARG A CD   1  
ATOM 3428   N NE   . ARG A 1 213 ? -23.810 27.427  -0.830  1.00 11.25 ? 213 ARG A NE   1  
ATOM 3429   C CZ   . ARG A 1 213 ? -25.076 27.151  -1.018  1.00 43.55 ? 213 ARG A CZ   1  
ATOM 3430   N NH1  . ARG A 1 213 ? -25.578 27.135  -2.223  1.00 13.25 ? 213 ARG A NH1  1  
ATOM 3431   N NH2  . ARG A 1 213 ? -25.841 26.888  0.006   1.00 15.41 ? 213 ARG A NH2  1  
ATOM 3432   H H    . ARG A 1 213 ? -24.502 23.189  -3.847  1.00 73.54 ? 213 ARG A H    1  
ATOM 3433   H HA   . ARG A 1 213 ? -22.093 24.767  -4.696  1.00 60.32 ? 213 ARG A HA   1  
ATOM 3434   H HB2  . ARG A 1 213 ? -23.926 26.161  -3.873  1.00 3.10  ? 213 ARG A HB2  1  
ATOM 3435   H HB3  . ARG A 1 213 ? -24.039 25.192  -2.405  1.00 25.30 ? 213 ARG A HB3  1  
ATOM 3436   H HG2  . ARG A 1 213 ? -21.849 25.895  -1.681  1.00 11.52 ? 213 ARG A HG2  1  
ATOM 3437   H HG3  . ARG A 1 213 ? -21.528 26.670  -3.232  1.00 75.24 ? 213 ARG A HG3  1  
ATOM 3438   H HD2  . ARG A 1 213 ? -22.133 28.402  -1.668  1.00 23.54 ? 213 ARG A HD2  1  
ATOM 3439   H HD3  . ARG A 1 213 ? -23.486 28.200  -2.777  1.00 70.13 ? 213 ARG A HD3  1  
ATOM 3440   H HE   . ARG A 1 213 ? -23.445 27.434  0.079   1.00 72.31 ? 213 ARG A HE   1  
ATOM 3441   H HH11 . ARG A 1 213 ? -24.998 27.333  -3.011  1.00 4.11  ? 213 ARG A HH11 1  
ATOM 3442   H HH12 . ARG A 1 213 ? -26.546 26.926  -2.357  1.00 32.52 ? 213 ARG A HH12 1  
ATOM 3443   H HH21 . ARG A 1 213 ? -25.460 26.897  0.931   1.00 63.34 ? 213 ARG A HH21 1  
ATOM 3444   H HH22 . ARG A 1 213 ? -26.809 26.676  -0.134  1.00 42.43 ? 213 ARG A HH22 1  
ATOM 3445   N N    . PHE A 1 214 ? -20.545 23.813  -2.942  1.00 53.44 ? 214 PHE A N    1  
ATOM 3446   C CA   . PHE A 1 214 ? -19.626 23.073  -2.017  1.00 4.21  ? 214 PHE A CA   1  
ATOM 3447   C C    . PHE A 1 214 ? -19.104 24.019  -0.933  1.00 11.51 ? 214 PHE A C    1  
ATOM 3448   O O    . PHE A 1 214 ? -18.692 25.129  -1.206  1.00 74.00 ? 214 PHE A O    1  
ATOM 3449   C CB   . PHE A 1 214 ? -18.442 22.522  -2.816  1.00 64.21 ? 214 PHE A CB   1  
ATOM 3450   C CG   . PHE A 1 214 ? -18.945 21.584  -3.893  1.00 60.21 ? 214 PHE A CG   1  
ATOM 3451   C CD1  . PHE A 1 214 ? -19.610 20.404  -3.537  1.00 43.32 ? 214 PHE A CD1  1  
ATOM 3452   C CD2  . PHE A 1 214 ? -18.745 21.891  -5.246  1.00 75.41 ? 214 PHE A CD2  1  
ATOM 3453   C CE1  . PHE A 1 214 ? -20.074 19.533  -4.531  1.00 15.02 ? 214 PHE A CE1  1  
ATOM 3454   C CE2  . PHE A 1 214 ? -19.209 21.019  -6.239  1.00 42.31 ? 214 PHE A CE2  1  
ATOM 3455   C CZ   . PHE A 1 214 ? -19.873 19.840  -5.881  1.00 54.32 ? 214 PHE A CZ   1  
ATOM 3456   H H    . PHE A 1 214 ? -20.174 24.458  -3.580  1.00 73.11 ? 214 PHE A H    1  
ATOM 3457   H HA   . PHE A 1 214 ? -20.151 22.253  -1.548  1.00 3.42  ? 214 PHE A HA   1  
ATOM 3458   H HB2  . PHE A 1 214 ? -17.903 23.342  -3.269  1.00 60.23 ? 214 PHE A HB2  1  
ATOM 3459   H HB3  . PHE A 1 214 ? -17.781 21.984  -2.153  1.00 32.12 ? 214 PHE A HB3  1  
ATOM 3460   H HD1  . PHE A 1 214 ? -19.765 20.165  -2.497  1.00 74.22 ? 214 PHE A HD1  1  
ATOM 3461   H HD2  . PHE A 1 214 ? -18.233 22.800  -5.524  1.00 2.44  ? 214 PHE A HD2  1  
ATOM 3462   H HE1  . PHE A 1 214 ? -20.586 18.623  -4.255  1.00 51.34 ? 214 PHE A HE1  1  
ATOM 3463   H HE2  . PHE A 1 214 ? -19.055 21.256  -7.281  1.00 34.52 ? 214 PHE A HE2  1  
ATOM 3464   H HZ   . PHE A 1 214 ? -20.231 19.168  -6.646  1.00 43.13 ? 214 PHE A HZ   1  
ATOM 3465   N N    . CYS A 1 215 ? -19.114 23.578  0.298   1.00 2.24  ? 215 CYS A N    1  
ATOM 3466   C CA   . CYS A 1 215 ? -18.616 24.436  1.411   1.00 32.42 ? 215 CYS A CA   1  
ATOM 3467   C C    . CYS A 1 215 ? -18.154 23.545  2.568   1.00 34.01 ? 215 CYS A C    1  
ATOM 3468   O O    . CYS A 1 215 ? -18.583 22.416  2.703   1.00 34.11 ? 215 CYS A O    1  
ATOM 3469   C CB   . CYS A 1 215 ? -19.743 25.354  1.890   1.00 22.41 ? 215 CYS A CB   1  
ATOM 3470   S SG   . CYS A 1 215 ? -20.101 26.585  0.613   1.00 74.14 ? 215 CYS A SG   1  
ATOM 3471   H H    . CYS A 1 215 ? -19.447 22.677  0.489   1.00 34.53 ? 215 CYS A H    1  
ATOM 3472   H HA   . CYS A 1 215 ? -17.786 25.035  1.065   1.00 62.12 ? 215 CYS A HA   1  
ATOM 3473   H HB2  . CYS A 1 215 ? -20.628 24.766  2.083   1.00 64.40 ? 215 CYS A HB2  1  
ATOM 3474   H HB3  . CYS A 1 215 ? -19.438 25.855  2.797   1.00 43.43 ? 215 CYS A HB3  1  
ATOM 3475   H HG   . CYS A 1 215 ? -20.069 27.453  1.020   1.00 73.41 ? 215 CYS A HG   1  
ATOM 3476   N N    . TYR A 1 216 ? -17.280 24.040  3.401   1.00 52.43 ? 216 TYR A N    1  
ATOM 3477   C CA   . TYR A 1 216 ? -16.789 23.218  4.545   1.00 41.13 ? 216 TYR A CA   1  
ATOM 3478   C C    . TYR A 1 216 ? -17.959 22.929  5.503   1.00 13.42 ? 216 TYR A C    1  
ATOM 3479   O O    . TYR A 1 216 ? -18.911 23.681  5.559   1.00 52.15 ? 216 TYR A O    1  
ATOM 3480   C CB   . TYR A 1 216 ? -15.684 23.991  5.283   1.00 50.23 ? 216 TYR A CB   1  
ATOM 3481   C CG   . TYR A 1 216 ? -15.995 25.471  5.252   1.00 53.33 ? 216 TYR A CG   1  
ATOM 3482   C CD1  . TYR A 1 216 ? -17.000 25.991  6.076   1.00 64.22 ? 216 TYR A CD1  1  
ATOM 3483   C CD2  . TYR A 1 216 ? -15.279 26.322  4.400   1.00 75.32 ? 216 TYR A CD2  1  
ATOM 3484   C CE1  . TYR A 1 216 ? -17.290 27.360  6.048   1.00 4.33  ? 216 TYR A CE1  1  
ATOM 3485   C CE2  . TYR A 1 216 ? -15.569 27.692  4.373   1.00 33.12 ? 216 TYR A CE2  1  
ATOM 3486   C CZ   . TYR A 1 216 ? -16.575 28.211  5.197   1.00 51.31 ? 216 TYR A CZ   1  
ATOM 3487   O OH   . TYR A 1 216 ? -16.860 29.561  5.170   1.00 23.24 ? 216 TYR A OH   1  
ATOM 3488   H H    . TYR A 1 216 ? -16.944 24.951  3.274   1.00 24.21 ? 216 TYR A H    1  
ATOM 3489   H HA   . TYR A 1 216 ? -16.388 22.292  4.164   1.00 20.42 ? 216 TYR A HA   1  
ATOM 3490   H HB2  . TYR A 1 216 ? -15.625 23.659  6.310   1.00 64.33 ? 216 TYR A HB2  1  
ATOM 3491   H HB3  . TYR A 1 216 ? -14.735 23.815  4.796   1.00 53.34 ? 216 TYR A HB3  1  
ATOM 3492   H HD1  . TYR A 1 216 ? -17.553 25.335  6.733   1.00 3.13  ? 216 TYR A HD1  1  
ATOM 3493   H HD2  . TYR A 1 216 ? -14.503 25.922  3.763   1.00 75.13 ? 216 TYR A HD2  1  
ATOM 3494   H HE1  . TYR A 1 216 ? -18.066 27.760  6.684   1.00 60.14 ? 216 TYR A HE1  1  
ATOM 3495   H HE2  . TYR A 1 216 ? -15.017 28.348  3.716   1.00 3.11  ? 216 TYR A HE2  1  
ATOM 3496   H HH   . TYR A 1 216 ? -17.091 29.833  6.061   1.00 53.04 ? 216 TYR A HH   1  
ATOM 3497   N N    . PRO A 1 217 ? -17.894 21.852  6.255   1.00 14.15 ? 217 PRO A N    1  
ATOM 3498   C CA   . PRO A 1 217 ? -18.974 21.487  7.217   1.00 42.12 ? 217 PRO A CA   1  
ATOM 3499   C C    . PRO A 1 217 ? -19.541 22.720  7.939   1.00 63.54 ? 217 PRO A C    1  
ATOM 3500   O O    . PRO A 1 217 ? -18.862 23.713  8.113   1.00 35.11 ? 217 PRO A O    1  
ATOM 3501   C CB   . PRO A 1 217 ? -18.268 20.545  8.199   1.00 44.32 ? 217 PRO A CB   1  
ATOM 3502   C CG   . PRO A 1 217 ? -17.185 19.885  7.398   1.00 73.11 ? 217 PRO A CG   1  
ATOM 3503   C CD   . PRO A 1 217 ? -16.795 20.865  6.277   1.00 22.15 ? 217 PRO A CD   1  
ATOM 3504   H HA   . PRO A 1 217 ? -19.762 20.956  6.709   1.00 25.11 ? 217 PRO A HA   1  
ATOM 3505   H HB2  . PRO A 1 217 ? -17.843 21.109  9.022   1.00 32.42 ? 217 PRO A HB2  1  
ATOM 3506   H HB3  . PRO A 1 217 ? -18.959 19.802  8.572   1.00 44.05 ? 217 PRO A HB3  1  
ATOM 3507   H HG2  . PRO A 1 217 ? -16.329 19.676  8.031   1.00 63.23 ? 217 PRO A HG2  1  
ATOM 3508   H HG3  . PRO A 1 217 ? -17.552 18.964  6.964   1.00 11.44 ? 217 PRO A HG3  1  
ATOM 3509   H HD2  . PRO A 1 217 ? -15.854 21.348  6.504   1.00 12.43 ? 217 PRO A HD2  1  
ATOM 3510   H HD3  . PRO A 1 217 ? -16.738 20.351  5.328   1.00 10.34 ? 217 PRO A HD3  1  
ATOM 3511   N N    . LYS A 1 218 ? -20.781 22.670  8.348   1.00 64.34 ? 218 LYS A N    1  
ATOM 3512   C CA   . LYS A 1 218 ? -21.386 23.847  9.041   1.00 13.34 ? 218 LYS A CA   1  
ATOM 3513   C C    . LYS A 1 218 ? -20.810 24.003  10.461  1.00 0.13  ? 218 LYS A C    1  
ATOM 3514   O O    . LYS A 1 218 ? -20.581 25.107  10.913  1.00 22.14 ? 218 LYS A O    1  
ATOM 3515   C CB   . LYS A 1 218 ? -22.921 23.689  9.108   1.00 24.12 ? 218 LYS A CB   1  
ATOM 3516   C CG   . LYS A 1 218 ? -23.403 22.831  7.934   1.00 75.25 ? 218 LYS A CG   1  
ATOM 3517   C CD   . LYS A 1 218 ? -24.916 22.995  7.765   1.00 64.50 ? 218 LYS A CD   1  
ATOM 3518   C CE   . LYS A 1 218 ? -25.449 21.910  6.829   1.00 71.15 ? 218 LYS A CE   1  
ATOM 3519   N NZ   . LYS A 1 218 ? -26.839 22.251  6.413   1.00 35.23 ? 218 LYS A NZ   1  
ATOM 3520   H H    . LYS A 1 218 ? -21.318 21.865  8.190   1.00 2.54  ? 218 LYS A H    1  
ATOM 3521   H HA   . LYS A 1 218 ? -21.150 24.737  8.474   1.00 61.52 ? 218 LYS A HA   1  
ATOM 3522   H HB2  . LYS A 1 218 ? -23.206 23.215  10.037  1.00 45.24 ? 218 LYS A HB2  1  
ATOM 3523   H HB3  . LYS A 1 218 ? -23.386 24.663  9.051   1.00 62.04 ? 218 LYS A HB3  1  
ATOM 3524   H HG2  . LYS A 1 218 ? -22.903 23.146  7.029   1.00 40.22 ? 218 LYS A HG2  1  
ATOM 3525   H HG3  . LYS A 1 218 ? -23.176 21.794  8.128   1.00 75.20 ? 218 LYS A HG3  1  
ATOM 3526   H HD2  . LYS A 1 218 ? -25.397 22.908  8.729   1.00 52.21 ? 218 LYS A HD2  1  
ATOM 3527   H HD3  . LYS A 1 218 ? -25.128 23.967  7.344   1.00 73.21 ? 218 LYS A HD3  1  
ATOM 3528   H HE2  . LYS A 1 218 ? -24.817 21.846  5.955   1.00 30.25 ? 218 LYS A HE2  1  
ATOM 3529   H HE3  . LYS A 1 218 ? -25.450 20.960  7.342   1.00 20.43 ? 218 LYS A HE3  1  
ATOM 3530   H HZ1  . LYS A 1 218 ? -27.503 21.569  6.830   1.00 11.02 ? 218 LYS A HZ1  1  
ATOM 3531   H HZ2  . LYS A 1 218 ? -26.908 22.215  5.375   1.00 14.31 ? 218 LYS A HZ2  1  
ATOM 3532   H HZ3  . LYS A 1 218 ? -27.075 23.208  6.744   1.00 22.20 ? 218 LYS A HZ3  1  
ATOM 3533   N N    . PRO A 1 219 ? -20.587 22.920  11.170  1.00 22.01 ? 219 PRO A N    1  
ATOM 3534   C CA   . PRO A 1 219 ? -20.048 22.971  12.554  1.00 4.44  ? 219 PRO A CA   1  
ATOM 3535   C C    . PRO A 1 219 ? -18.514 22.950  12.587  1.00 75.10 ? 219 PRO A C    1  
ATOM 3536   O O    . PRO A 1 219 ? -17.911 22.723  13.617  1.00 54.14 ? 219 PRO A O    1  
ATOM 3537   C CB   . PRO A 1 219 ? -20.632 21.706  13.187  1.00 73.13 ? 219 PRO A CB   1  
ATOM 3538   C CG   . PRO A 1 219 ? -20.730 20.715  12.060  1.00 22.41 ? 219 PRO A CG   1  
ATOM 3539   C CD   . PRO A 1 219 ? -20.814 21.527  10.748  1.00 34.50 ? 219 PRO A CD   1  
ATOM 3540   H HA   . PRO A 1 219 ? -20.422 23.840  13.071  1.00 21.45 ? 219 PRO A HA   1  
ATOM 3541   H HB2  . PRO A 1 219 ? -19.978 21.337  13.970  1.00 34.41 ? 219 PRO A HB2  1  
ATOM 3542   H HB3  . PRO A 1 219 ? -21.615 21.910  13.588  1.00 61.42 ? 219 PRO A HB3  1  
ATOM 3543   H HG2  . PRO A 1 219 ? -19.851 20.079  12.051  1.00 55.43 ? 219 PRO A HG2  1  
ATOM 3544   H HG3  . PRO A 1 219 ? -21.618 20.107  12.171  1.00 71.32 ? 219 PRO A HG3  1  
ATOM 3545   H HD2  . PRO A 1 219 ? -20.042 21.210  10.062  1.00 61.23 ? 219 PRO A HD2  1  
ATOM 3546   H HD3  . PRO A 1 219 ? -21.787 21.425  10.295  1.00 50.33 ? 219 PRO A HD3  1  
ATOM 3547   N N    . ALA A 1 220 ? -17.879 23.188  11.472  1.00 71.14 ? 220 ALA A N    1  
ATOM 3548   C CA   . ALA A 1 220 ? -16.389 23.182  11.453  1.00 22.54 ? 220 ALA A CA   1  
ATOM 3549   C C    . ALA A 1 220 ? -15.869 24.197  12.472  1.00 22.13 ? 220 ALA A C    1  
ATOM 3550   O O    . ALA A 1 220 ? -14.859 23.986  13.114  1.00 51.50 ? 220 ALA A O    1  
ATOM 3551   C CB   . ALA A 1 220 ? -15.894 23.562  10.056  1.00 4.05  ? 220 ALA A CB   1  
ATOM 3552   H H    . ALA A 1 220 ? -18.381 23.371  10.650  1.00 44.43 ? 220 ALA A H    1  
ATOM 3553   H HA   . ALA A 1 220 ? -16.029 22.196  11.708  1.00 44.31 ? 220 ALA A HA   1  
ATOM 3554   H HB1  . ALA A 1 220 ? -16.445 24.420  9.699   1.00 22.25 ? 220 ALA A HB1  1  
ATOM 3555   H HB2  . ALA A 1 220 ? -16.044 22.732  9.382   1.00 50.14 ? 220 ALA A HB2  1  
ATOM 3556   H HB3  . ALA A 1 220 ? -14.842 23.804  10.100  1.00 44.43 ? 220 ALA A HB3  1  
ATOM 3557   N N    . CYS A 1 221 ? -16.555 25.296  12.630  1.00 52.13 ? 221 CYS A N    1  
ATOM 3558   C CA   . CYS A 1 221 ? -16.106 26.324  13.611  1.00 5.20  ? 221 CYS A CA   1  
ATOM 3559   C C    . CYS A 1 221 ? -16.562 25.919  15.014  1.00 71.13 ? 221 CYS A C    1  
ATOM 3560   O O    . CYS A 1 221 ? -17.662 25.441  15.205  1.00 54.02 ? 221 CYS A O    1  
ATOM 3561   C CB   . CYS A 1 221 ? -16.718 27.678  13.247  1.00 31.14 ? 221 CYS A CB   1  
ATOM 3562   S SG   . CYS A 1 221 ? -18.479 27.467  12.886  1.00 43.24 ? 221 CYS A SG   1  
ATOM 3563   H H    . CYS A 1 221 ? -17.369 25.444  12.104  1.00 31.41 ? 221 CYS A H    1  
ATOM 3564   H HA   . CYS A 1 221 ? -15.028 26.398  13.589  1.00 54.12 ? 221 CYS A HA   1  
ATOM 3565   H HB2  . CYS A 1 221 ? -16.600 28.361  14.075  1.00 11.21 ? 221 CYS A HB2  1  
ATOM 3566   H HB3  . CYS A 1 221 ? -16.218 28.078  12.377  1.00 51.23 ? 221 CYS A HB3  1  
ATOM 3567   H HG   . CYS A 1 221 ? -18.852 28.334  12.710  1.00 3.24  ? 221 CYS A HG   1  
ATOM 3568   N N    . GLU A 1 222 ? -15.723 26.102  15.997  1.00 12.42 ? 222 GLU A N    1  
ATOM 3569   C CA   . GLU A 1 222 ? -16.107 25.725  17.387  1.00 75.35 ? 222 GLU A CA   1  
ATOM 3570   C C    . GLU A 1 222 ? -17.231 26.641  17.878  1.00 64.11 ? 222 GLU A C    1  
ATOM 3571   O O    . GLU A 1 222 ? -18.021 26.268  18.722  1.00 53.15 ? 222 GLU A O    1  
ATOM 3572   C CB   . GLU A 1 222 ? -14.893 25.867  18.306  1.00 2.11  ? 222 GLU A CB   1  
ATOM 3573   C CG   . GLU A 1 222 ? -13.826 24.846  17.904  1.00 34.21 ? 222 GLU A CG   1  
ATOM 3574   C CD   . GLU A 1 222 ? -13.176 25.273  16.586  1.00 64.34 ? 222 GLU A CD   1  
ATOM 3575   O OE1  . GLU A 1 222 ? -13.229 26.451  16.275  1.00 62.53 ? 222 GLU A OE1  1  
ATOM 3576   O OE2  . GLU A 1 222 ? -12.635 24.413  15.910  1.00 4.33  ? 222 GLU A OE2  1  
ATOM 3577   H H    . GLU A 1 222 ? -14.840 26.487  15.820  1.00 42.41 ? 222 GLU A H    1  
ATOM 3578   H HA   . GLU A 1 222 ? -16.449 24.701  17.399  1.00 15.52 ? 222 GLU A HA   1  
ATOM 3579   H HB2  . GLU A 1 222 ? -14.489 26.866  18.218  1.00 1.32  ? 222 GLU A HB2  1  
ATOM 3580   H HB3  . GLU A 1 222 ? -15.192 25.689  19.328  1.00 73.23 ? 222 GLU A HB3  1  
ATOM 3581   H HG2  . GLU A 1 222 ? -13.073 24.789  18.676  1.00 65.45 ? 222 GLU A HG2  1  
ATOM 3582   H HG3  . GLU A 1 222 ? -14.286 23.877  17.778  1.00 61.13 ? 222 GLU A HG3  1  
ATOM 3583   N N    . GLU A 1 223 ? -17.308 27.836  17.359  1.00 73.41 ? 223 GLU A N    1  
ATOM 3584   C CA   . GLU A 1 223 ? -18.381 28.772  17.800  1.00 52.04 ? 223 GLU A CA   1  
ATOM 3585   C C    . GLU A 1 223 ? -18.368 28.880  19.326  1.00 1.53  ? 223 GLU A C    1  
ATOM 3586   O O    . GLU A 1 223 ? -19.397 29.225  19.884  1.00 50.41 ? 223 GLU A O    1  
ATOM 3587   C CB   . GLU A 1 223 ? -19.740 28.243  17.337  1.00 33.00 ? 223 GLU A CB   1  
ATOM 3588   C CG   . GLU A 1 223 ? -19.733 28.080  15.817  1.00 63.43 ? 223 GLU A CG   1  
ATOM 3589   C CD   . GLU A 1 223 ? -21.093 27.558  15.353  1.00 31.23 ? 223 GLU A CD   1  
ATOM 3590   O OE1  . GLU A 1 223 ? -21.861 27.131  16.200  1.00 14.42 ? 223 GLU A OE1  1  
ATOM 3591   O OE2  . GLU A 1 223 ? -21.344 27.595  14.160  1.00 11.11 ? 223 GLU A OE2  1  
ATOM 3592   O OXT  . GLU A 1 223 ? -17.330 28.617  19.911  1.00 0.00  ? 223 GLU A OXT  1  
ATOM 3593   H H    . GLU A 1 223 ? -16.660 28.119  16.680  1.00 42.24 ? 223 GLU A H    1  
ATOM 3594   H HA   . GLU A 1 223 ? -18.209 29.747  17.368  1.00 1.41  ? 223 GLU A HA   1  
ATOM 3595   H HB2  . GLU A 1 223 ? -19.932 27.286  17.802  1.00 40.15 ? 223 GLU A HB2  1  
ATOM 3596   H HB3  . GLU A 1 223 ? -20.513 28.941  17.619  1.00 33.30 ? 223 GLU A HB3  1  
ATOM 3597   H HG2  . GLU A 1 223 ? -19.536 29.037  15.354  1.00 13.32 ? 223 GLU A HG2  1  
ATOM 3598   H HG3  . GLU A 1 223 ? -18.964 27.378  15.533  1.00 12.35 ? 223 GLU A HG3  1  
ATOM 3599   N N    . MET B 1 1   ? 16.393  25.579  -22.679 1.00 44.41 ? 1   MET B N    1  
ATOM 3600   C CA   . MET B 1 1   ? 17.131  24.658  -21.769 1.00 11.23 ? 1   MET B CA   1  
ATOM 3601   C C    . MET B 1 1   ? 18.540  24.423  -22.316 1.00 1.11  ? 1   MET B C    1  
ATOM 3602   O O    . MET B 1 1   ? 18.748  24.353  -23.511 1.00 71.14 ? 1   MET B O    1  
ATOM 3603   C CB   . MET B 1 1   ? 16.389  23.322  -21.683 1.00 33.15 ? 1   MET B CB   1  
ATOM 3604   C CG   . MET B 1 1   ? 16.272  22.713  -23.082 1.00 32.41 ? 1   MET B CG   1  
ATOM 3605   S SD   . MET B 1 1   ? 15.159  21.286  -23.029 1.00 32.40 ? 1   MET B SD   1  
ATOM 3606   C CE   . MET B 1 1   ? 13.604  22.191  -23.230 1.00 44.52 ? 1   MET B CE   1  
ATOM 3607   H H1   . MET B 1 1   ? 16.733  25.452  -23.653 1.00 0.00  ? 1   MET B H1   1  
ATOM 3608   H H2   . MET B 1 1   ? 16.554  26.563  -22.379 1.00 0.00  ? 1   MET B H2   1  
ATOM 3609   H H3   . MET B 1 1   ? 15.376  25.366  -22.638 1.00 0.00  ? 1   MET B H3   1  
ATOM 3610   H HA   . MET B 1 1   ? 17.196  25.098  -20.785 1.00 61.22 ? 1   MET B HA   1  
ATOM 3611   H HB2  . MET B 1 1   ? 16.937  22.648  -21.040 1.00 62.01 ? 1   MET B HB2  1  
ATOM 3612   H HB3  . MET B 1 1   ? 15.402  23.484  -21.279 1.00 55.24 ? 1   MET B HB3  1  
ATOM 3613   H HG2  . MET B 1 1   ? 15.880  23.452  -23.765 1.00 75.24 ? 1   MET B HG2  1  
ATOM 3614   H HG3  . MET B 1 1   ? 17.248  22.395  -23.418 1.00 40.44 ? 1   MET B HG3  1  
ATOM 3615   H HE1  . MET B 1 1   ? 12.791  21.486  -23.337 1.00 70.12 ? 1   MET B HE1  1  
ATOM 3616   H HE2  . MET B 1 1   ? 13.657  22.811  -24.110 1.00 34.05 ? 1   MET B HE2  1  
ATOM 3617   H HE3  . MET B 1 1   ? 13.436  22.813  -22.362 1.00 35.03 ? 1   MET B HE3  1  
ATOM 3618   N N    . ARG B 1 2   ? 19.512  24.302  -21.446 1.00 73.23 ? 2   ARG B N    1  
ATOM 3619   C CA   . ARG B 1 2   ? 20.920  24.072  -21.899 1.00 64.32 ? 2   ARG B CA   1  
ATOM 3620   C C    . ARG B 1 2   ? 21.562  22.997  -21.019 1.00 12.34 ? 2   ARG B C    1  
ATOM 3621   O O    . ARG B 1 2   ? 21.187  22.815  -19.875 1.00 73.05 ? 2   ARG B O    1  
ATOM 3622   C CB   . ARG B 1 2   ? 21.713  25.373  -21.767 1.00 63.20 ? 2   ARG B CB   1  
ATOM 3623   C CG   . ARG B 1 2   ? 21.065  26.459  -22.628 1.00 72.32 ? 2   ARG B CG   1  
ATOM 3624   C CD   . ARG B 1 2   ? 21.793  27.786  -22.408 1.00 12.14 ? 2   ARG B CD   1  
ATOM 3625   N NE   . ARG B 1 2   ? 21.075  28.873  -23.131 1.00 14.32 ? 2   ARG B NE   1  
ATOM 3626   C CZ   . ARG B 1 2   ? 21.253  29.033  -24.414 1.00 4.14  ? 2   ARG B CZ   1  
ATOM 3627   N NH1  . ARG B 1 2   ? 22.060  28.240  -25.065 1.00 5.51  ? 2   ARG B NH1  1  
ATOM 3628   N NH2  . ARG B 1 2   ? 20.623  29.986  -25.046 1.00 70.23 ? 2   ARG B NH2  1  
ATOM 3629   H H    . ARG B 1 2   ? 19.314  24.364  -20.488 1.00 73.52 ? 2   ARG B H    1  
ATOM 3630   H HA   . ARG B 1 2   ? 20.933  23.744  -22.930 1.00 60.10 ? 2   ARG B HA   1  
ATOM 3631   H HB2  . ARG B 1 2   ? 21.718  25.688  -20.733 1.00 11.03 ? 2   ARG B HB2  1  
ATOM 3632   H HB3  . ARG B 1 2   ? 22.728  25.211  -22.099 1.00 64.14 ? 2   ARG B HB3  1  
ATOM 3633   H HG2  . ARG B 1 2   ? 21.131  26.179  -23.670 1.00 63.42 ? 2   ARG B HG2  1  
ATOM 3634   H HG3  . ARG B 1 2   ? 20.028  26.569  -22.349 1.00 54.24 ? 2   ARG B HG3  1  
ATOM 3635   H HD2  . ARG B 1 2   ? 21.817  28.011  -21.352 1.00 1.35  ? 2   ARG B HD2  1  
ATOM 3636   H HD3  . ARG B 1 2   ? 22.803  27.709  -22.782 1.00 51.04 ? 2   ARG B HD3  1  
ATOM 3637   H HE   . ARG B 1 2   ? 20.468  29.468  -22.643 1.00 31.13 ? 2   ARG B HE   1  
ATOM 3638   H HH11 . ARG B 1 2   ? 22.542  27.510  -24.581 1.00 33.42 ? 2   ARG B HH11 1  
ATOM 3639   H HH12 . ARG B 1 2   ? 22.196  28.364  -26.048 1.00 72.31 ? 2   ARG B HH12 1  
ATOM 3640   H HH21 . ARG B 1 2   ? 20.005  30.593  -24.547 1.00 32.45 ? 2   ARG B HH21 1  
ATOM 3641   H HH22 . ARG B 1 2   ? 20.760  30.109  -26.029 1.00 73.32 ? 2   ARG B HH22 1  
ATOM 3642   N N    . VAL B 1 3   ? 22.529  22.283  -21.546 1.00 72.24 ? 3   VAL B N    1  
ATOM 3643   C CA   . VAL B 1 3   ? 23.214  21.210  -20.755 1.00 24.25 ? 3   VAL B CA   1  
ATOM 3644   C C    . VAL B 1 3   ? 24.651  21.639  -20.445 1.00 34.51 ? 3   VAL B C    1  
ATOM 3645   O O    . VAL B 1 3   ? 25.369  22.113  -21.305 1.00 55.33 ? 3   VAL B O    1  
ATOM 3646   C CB   . VAL B 1 3   ? 23.229  19.912  -21.568 1.00 1.23  ? 3   VAL B CB   1  
ATOM 3647   C CG1  . VAL B 1 3   ? 24.021  18.844  -20.811 1.00 0.21  ? 3   VAL B CG1  1  
ATOM 3648   C CG2  . VAL B 1 3   ? 21.789  19.426  -21.783 1.00 33.31 ? 3   VAL B CG2  1  
ATOM 3649   H H    . VAL B 1 3   ? 22.808  22.455  -22.470 1.00 43.44 ? 3   VAL B H    1  
ATOM 3650   H HA   . VAL B 1 3   ? 22.690  21.043  -19.826 1.00 12.11 ? 3   VAL B HA   1  
ATOM 3651   H HB   . VAL B 1 3   ? 23.695  20.093  -22.524 1.00 43.12 ? 3   VAL B HB   1  
ATOM 3652   H HG11 . VAL B 1 3   ? 23.715  18.831  -19.776 1.00 11.45 ? 3   VAL B HG11 1  
ATOM 3653   H HG12 . VAL B 1 3   ? 25.074  19.070  -20.870 1.00 53.53 ? 3   VAL B HG12 1  
ATOM 3654   H HG13 . VAL B 1 3   ? 23.836  17.876  -21.253 1.00 71.13 ? 3   VAL B HG13 1  
ATOM 3655   H HG21 . VAL B 1 3   ? 21.226  19.539  -20.868 1.00 61.43 ? 3   VAL B HG21 1  
ATOM 3656   H HG22 . VAL B 1 3   ? 21.797  18.385  -22.071 1.00 5.14  ? 3   VAL B HG22 1  
ATOM 3657   H HG23 . VAL B 1 3   ? 21.326  20.010  -22.564 1.00 64.53 ? 3   VAL B HG23 1  
ATOM 3658   N N    . LEU B 1 4   ? 25.067  21.483  -19.212 1.00 51.44 ? 4   LEU B N    1  
ATOM 3659   C CA   . LEU B 1 4   ? 26.454  21.888  -18.808 1.00 31.34 ? 4   LEU B CA   1  
ATOM 3660   C C    . LEU B 1 4   ? 27.324  20.637  -18.620 1.00 21.40 ? 4   LEU B C    1  
ATOM 3661   O O    . LEU B 1 4   ? 27.067  19.816  -17.764 1.00 5.24  ? 4   LEU B O    1  
ATOM 3662   C CB   . LEU B 1 4   ? 26.345  22.697  -17.495 1.00 44.25 ? 4   LEU B CB   1  
ATOM 3663   C CG   . LEU B 1 4   ? 27.627  22.615  -16.642 1.00 54.33 ? 4   LEU B CG   1  
ATOM 3664   C CD1  . LEU B 1 4   ? 28.842  23.092  -17.460 1.00 21.41 ? 4   LEU B CD1  1  
ATOM 3665   C CD2  . LEU B 1 4   ? 27.452  23.515  -15.413 1.00 33.12 ? 4   LEU B CD2  1  
ATOM 3666   H H    . LEU B 1 4   ? 24.457  21.105  -18.540 1.00 14.40 ? 4   LEU B H    1  
ATOM 3667   H HA   . LEU B 1 4   ? 26.894  22.512  -19.575 1.00 4.53  ? 4   LEU B HA   1  
ATOM 3668   H HB2  . LEU B 1 4   ? 26.155  23.733  -17.735 1.00 24.44 ? 4   LEU B HB2  1  
ATOM 3669   H HB3  . LEU B 1 4   ? 25.516  22.319  -16.923 1.00 21.34 ? 4   LEU B HB3  1  
ATOM 3670   H HG   . LEU B 1 4   ? 27.782  21.591  -16.312 1.00 61.33 ? 4   LEU B HG   1  
ATOM 3671   H HD11 . LEU B 1 4   ? 29.606  23.470  -16.794 1.00 2.03  ? 4   LEU B HD11 1  
ATOM 3672   H HD12 . LEU B 1 4   ? 28.542  23.877  -18.138 1.00 52.21 ? 4   LEU B HD12 1  
ATOM 3673   H HD13 . LEU B 1 4   ? 29.244  22.266  -18.025 1.00 25.50 ? 4   LEU B HD13 1  
ATOM 3674   H HD21 . LEU B 1 4   ? 26.509  23.295  -14.936 1.00 3.51  ? 4   LEU B HD21 1  
ATOM 3675   H HD22 . LEU B 1 4   ? 27.467  24.550  -15.720 1.00 73.34 ? 4   LEU B HD22 1  
ATOM 3676   H HD23 . LEU B 1 4   ? 28.259  23.335  -14.717 1.00 41.54 ? 4   LEU B HD23 1  
ATOM 3677   N N    . LEU B 1 5   ? 28.370  20.509  -19.402 1.00 63.53 ? 5   LEU B N    1  
ATOM 3678   C CA   . LEU B 1 5   ? 29.293  19.334  -19.276 1.00 33.24 ? 5   LEU B CA   1  
ATOM 3679   C C    . LEU B 1 5   ? 30.652  19.829  -18.786 1.00 14.22 ? 5   LEU B C    1  
ATOM 3680   O O    . LEU B 1 5   ? 31.449  20.334  -19.552 1.00 42.42 ? 5   LEU B O    1  
ATOM 3681   C CB   . LEU B 1 5   ? 29.483  18.674  -20.648 1.00 64.33 ? 5   LEU B CB   1  
ATOM 3682   C CG   . LEU B 1 5   ? 28.122  18.283  -21.248 1.00 4.24  ? 5   LEU B CG   1  
ATOM 3683   C CD1  . LEU B 1 5   ? 28.253  18.129  -22.767 1.00 74.35 ? 5   LEU B CD1  1  
ATOM 3684   C CD2  . LEU B 1 5   ? 27.652  16.951  -20.653 1.00 43.14 ? 5   LEU B CD2  1  
ATOM 3685   H H    . LEU B 1 5   ? 28.559  21.201  -20.070 1.00 31.35 ? 5   LEU B H    1  
ATOM 3686   H HA   . LEU B 1 5   ? 28.900  18.611  -18.573 1.00 31.31 ? 5   LEU B HA   1  
ATOM 3687   H HB2  . LEU B 1 5   ? 29.982  19.372  -21.306 1.00 15.15 ? 5   LEU B HB2  1  
ATOM 3688   H HB3  . LEU B 1 5   ? 30.096  17.791  -20.538 1.00 43.41 ? 5   LEU B HB3  1  
ATOM 3689   H HG   . LEU B 1 5   ? 27.398  19.052  -21.029 1.00 14.24 ? 5   LEU B HG   1  
ATOM 3690   H HD11 . LEU B 1 5   ? 27.283  17.915  -23.191 1.00 15.13 ? 5   LEU B HD11 1  
ATOM 3691   H HD12 . LEU B 1 5   ? 28.930  17.319  -22.990 1.00 3.42  ? 5   LEU B HD12 1  
ATOM 3692   H HD13 . LEU B 1 5   ? 28.636  19.046  -23.190 1.00 24.03 ? 5   LEU B HD13 1  
ATOM 3693   H HD21 . LEU B 1 5   ? 28.405  16.195  -20.824 1.00 52.33 ? 5   LEU B HD21 1  
ATOM 3694   H HD22 . LEU B 1 5   ? 26.729  16.652  -21.127 1.00 74.35 ? 5   LEU B HD22 1  
ATOM 3695   H HD23 . LEU B 1 5   ? 27.491  17.065  -19.594 1.00 52.20 ? 5   LEU B HD23 1  
ATOM 3696   N N    . ILE B 1 6   ? 30.933  19.687  -17.520 1.00 15.24 ? 6   ILE B N    1  
ATOM 3697   C CA   . ILE B 1 6   ? 32.252  20.149  -16.999 1.00 42.55 ? 6   ILE B CA   1  
ATOM 3698   C C    . ILE B 1 6   ? 33.275  19.025  -17.166 1.00 15.41 ? 6   ILE B C    1  
ATOM 3699   O O    . ILE B 1 6   ? 33.329  18.095  -16.383 1.00 30.00 ? 6   ILE B O    1  
ATOM 3700   C CB   . ILE B 1 6   ? 32.125  20.519  -15.522 1.00 35.42 ? 6   ILE B CB   1  
ATOM 3701   C CG1  . ILE B 1 6   ? 31.105  21.656  -15.364 1.00 12.24 ? 6   ILE B CG1  1  
ATOM 3702   C CG2  . ILE B 1 6   ? 33.485  20.977  -14.992 1.00 31.11 ? 6   ILE B CG2  1  
ATOM 3703   C CD1  . ILE B 1 6   ? 30.782  21.903  -13.878 1.00 12.33 ? 6   ILE B CD1  1  
ATOM 3704   H H    . ILE B 1 6   ? 30.281  19.274  -16.916 1.00 2.51  ? 6   ILE B H    1  
ATOM 3705   H HA   . ILE B 1 6   ? 32.578  21.015  -17.555 1.00 43.33 ? 6   ILE B HA   1  
ATOM 3706   H HB   . ILE B 1 6   ? 31.796  19.660  -14.967 1.00 1.41  ? 6   ILE B HB   1  
ATOM 3707   H HG12 . ILE B 1 6   ? 31.512  22.559  -15.793 1.00 63.33 ? 6   ILE B HG12 1  
ATOM 3708   H HG13 . ILE B 1 6   ? 30.197  21.392  -15.885 1.00 51.12 ? 6   ILE B HG13 1  
ATOM 3709   H HG21 . ILE B 1 6   ? 33.359  21.428  -14.019 1.00 44.33 ? 6   ILE B HG21 1  
ATOM 3710   H HG22 . ILE B 1 6   ? 33.911  21.699  -15.672 1.00 54.50 ? 6   ILE B HG22 1  
ATOM 3711   H HG23 . ILE B 1 6   ? 34.144  20.125  -14.912 1.00 41.34 ? 6   ILE B HG23 1  
ATOM 3712   H HD11 . ILE B 1 6   ? 31.385  21.265  -13.246 1.00 63.44 ? 6   ILE B HD11 1  
ATOM 3713   H HD12 . ILE B 1 6   ? 29.738  21.695  -13.700 1.00 30.33 ? 6   ILE B HD12 1  
ATOM 3714   H HD13 . ILE B 1 6   ? 30.984  22.937  -13.637 1.00 41.33 ? 6   ILE B HD13 1  
ATOM 3715   N N    . GLU B 1 7   ? 34.082  19.101  -18.192 1.00 74.52 ? 7   GLU B N    1  
ATOM 3716   C CA   . GLU B 1 7   ? 35.106  18.044  -18.439 1.00 34.13 ? 7   GLU B CA   1  
ATOM 3717   C C    . GLU B 1 7   ? 36.345  18.690  -19.066 1.00 65.54 ? 7   GLU B C    1  
ATOM 3718   O O    . GLU B 1 7   ? 36.242  19.530  -19.938 1.00 53.01 ? 7   GLU B O    1  
ATOM 3719   C CB   . GLU B 1 7   ? 34.522  17.003  -19.402 1.00 24.14 ? 7   GLU B CB   1  
ATOM 3720   C CG   . GLU B 1 7   ? 35.503  15.840  -19.590 1.00 35.25 ? 7   GLU B CG   1  
ATOM 3721   C CD   . GLU B 1 7   ? 35.542  14.987  -18.322 1.00 30.22 ? 7   GLU B CD   1  
ATOM 3722   O OE1  . GLU B 1 7   ? 36.226  15.375  -17.389 1.00 71.20 ? 7   GLU B OE1  1  
ATOM 3723   O OE2  . GLU B 1 7   ? 34.889  13.956  -18.306 1.00 41.30 ? 7   GLU B OE2  1  
ATOM 3724   H H    . GLU B 1 7   ? 34.009  19.857  -18.811 1.00 10.42 ? 7   GLU B H    1  
ATOM 3725   H HA   . GLU B 1 7   ? 35.378  17.567  -17.508 1.00 22.42 ? 7   GLU B HA   1  
ATOM 3726   H HB2  . GLU B 1 7   ? 33.594  16.626  -18.999 1.00 30.51 ? 7   GLU B HB2  1  
ATOM 3727   H HB3  . GLU B 1 7   ? 34.334  17.467  -20.358 1.00 21.40 ? 7   GLU B HB3  1  
ATOM 3728   H HG2  . GLU B 1 7   ? 35.176  15.233  -20.420 1.00 42.32 ? 7   GLU B HG2  1  
ATOM 3729   H HG3  . GLU B 1 7   ? 36.489  16.223  -19.794 1.00 42.05 ? 7   GLU B HG3  1  
ATOM 3730   N N    . LYS B 1 8   ? 37.515  18.305  -18.634 1.00 50.14 ? 8   LYS B N    1  
ATOM 3731   C CA   . LYS B 1 8   ? 38.753  18.899  -19.214 1.00 62.55 ? 8   LYS B CA   1  
ATOM 3732   C C    . LYS B 1 8   ? 39.035  18.244  -20.571 1.00 22.42 ? 8   LYS B C    1  
ATOM 3733   O O    . LYS B 1 8   ? 39.566  18.862  -21.472 1.00 22.14 ? 8   LYS B O    1  
ATOM 3734   C CB   . LYS B 1 8   ? 39.938  18.661  -18.261 1.00 30.12 ? 8   LYS B CB   1  
ATOM 3735   C CG   . LYS B 1 8   ? 39.825  17.266  -17.602 1.00 24.41 ? 8   LYS B CG   1  
ATOM 3736   C CD   . LYS B 1 8   ? 39.048  17.358  -16.272 1.00 23.51 ? 8   LYS B CD   1  
ATOM 3737   C CE   . LYS B 1 8   ? 40.000  17.737  -15.132 1.00 13.41 ? 8   LYS B CE   1  
ATOM 3738   N NZ   . LYS B 1 8   ? 40.830  16.555  -14.763 1.00 51.11 ? 8   LYS B NZ   1  
ATOM 3739   H H    . LYS B 1 8   ? 37.579  17.623  -17.934 1.00 2.32  ? 8   LYS B H    1  
ATOM 3740   H HA   . LYS B 1 8   ? 38.610  19.961  -19.352 1.00 1.03  ? 8   LYS B HA   1  
ATOM 3741   H HB2  . LYS B 1 8   ? 40.864  18.722  -18.818 1.00 73.50 ? 8   LYS B HB2  1  
ATOM 3742   H HB3  . LYS B 1 8   ? 39.937  19.424  -17.496 1.00 32.54 ? 8   LYS B HB3  1  
ATOM 3743   H HG2  . LYS B 1 8   ? 39.309  16.590  -18.271 1.00 33.54 ? 8   LYS B HG2  1  
ATOM 3744   H HG3  . LYS B 1 8   ? 40.817  16.880  -17.411 1.00 62.21 ? 8   LYS B HG3  1  
ATOM 3745   H HD2  . LYS B 1 8   ? 38.274  18.107  -16.355 1.00 10.14 ? 8   LYS B HD2  1  
ATOM 3746   H HD3  . LYS B 1 8   ? 38.597  16.401  -16.054 1.00 73.42 ? 8   LYS B HD3  1  
ATOM 3747   H HE2  . LYS B 1 8   ? 40.645  18.542  -15.451 1.00 52.15 ? 8   LYS B HE2  1  
ATOM 3748   H HE3  . LYS B 1 8   ? 39.426  18.055  -14.274 1.00 3.45  ? 8   LYS B HE3  1  
ATOM 3749   H HZ1  . LYS B 1 8   ? 41.536  16.381  -15.505 1.00 14.01 ? 8   LYS B HZ1  1  
ATOM 3750   H HZ2  . LYS B 1 8   ? 40.217  15.720  -14.664 1.00 24.04 ? 8   LYS B HZ2  1  
ATOM 3751   H HZ3  . LYS B 1 8   ? 41.315  16.738  -13.862 1.00 74.13 ? 8   LYS B HZ3  1  
ATOM 3752   N N    . ASN B 1 9   ? 38.680  16.997  -20.721 1.00 4.40  ? 9   ASN B N    1  
ATOM 3753   C CA   . ASN B 1 9   ? 38.923  16.300  -22.016 1.00 53.04 ? 9   ASN B CA   1  
ATOM 3754   C C    . ASN B 1 9   ? 37.902  16.774  -23.052 1.00 40.50 ? 9   ASN B C    1  
ATOM 3755   O O    . ASN B 1 9   ? 36.731  16.458  -22.974 1.00 0.04  ? 9   ASN B O    1  
ATOM 3756   C CB   . ASN B 1 9   ? 38.779  14.790  -21.813 1.00 4.21  ? 9   ASN B CB   1  
ATOM 3757   C CG   . ASN B 1 9   ? 40.014  14.251  -21.087 1.00 42.11 ? 9   ASN B CG   1  
ATOM 3758   O OD1  . ASN B 1 9   ? 41.053  14.881  -21.082 1.00 53.42 ? 9   ASN B OD1  1  
ATOM 3759   N ND2  . ASN B 1 9   ? 39.944  13.104  -20.470 1.00 73.11 ? 9   ASN B ND2  1  
ATOM 3760   H H    . ASN B 1 9   ? 38.253  16.519  -19.981 1.00 22.21 ? 9   ASN B H    1  
ATOM 3761   H HA   . ASN B 1 9   ? 39.921  16.524  -22.365 1.00 4.43  ? 9   ASN B HA   1  
ATOM 3762   H HB2  . ASN B 1 9   ? 37.898  14.593  -21.220 1.00 45.32 ? 9   ASN B HB2  1  
ATOM 3763   H HB3  . ASN B 1 9   ? 38.685  14.302  -22.772 1.00 45.23 ? 9   ASN B HB3  1  
ATOM 3764   H HD21 . ASN B 1 9   ? 39.106  12.596  -20.474 1.00 34.11 ? 9   ASN B HD21 1  
ATOM 3765   H HD22 . ASN B 1 9   ? 40.729  12.750  -20.003 1.00 74.23 ? 9   ASN B HD22 1  
ATOM 3766   N N    . SER B 1 10  ? 38.336  17.531  -24.022 1.00 32.34 ? 10  SER B N    1  
ATOM 3767   C CA   . SER B 1 10  ? 37.392  18.024  -25.063 1.00 65.54 ? 10  SER B CA   1  
ATOM 3768   C C    . SER B 1 10  ? 36.895  16.847  -25.907 1.00 3.02  ? 10  SER B C    1  
ATOM 3769   O O    . SER B 1 10  ? 35.811  16.878  -26.453 1.00 33.42 ? 10  SER B O    1  
ATOM 3770   C CB   . SER B 1 10  ? 38.109  19.030  -25.964 1.00 60.01 ? 10  SER B CB   1  
ATOM 3771   O OG   . SER B 1 10  ? 38.648  20.074  -25.165 1.00 1.04  ? 10  SER B OG   1  
ATOM 3772   H H    . SER B 1 10  ? 39.284  17.774  -24.066 1.00 52.51 ? 10  SER B H    1  
ATOM 3773   H HA   . SER B 1 10  ? 36.550  18.505  -24.587 1.00 43.20 ? 10  SER B HA   1  
ATOM 3774   H HB2  . SER B 1 10  ? 38.909  18.538  -26.491 1.00 51.44 ? 10  SER B HB2  1  
ATOM 3775   H HB3  . SER B 1 10  ? 37.406  19.436  -26.680 1.00 35.42 ? 10  SER B HB3  1  
ATOM 3776   H HG   . SER B 1 10  ? 37.916  20.576  -24.799 1.00 0.53  ? 10  SER B HG   1  
ATOM 3777   N N    . VAL B 1 11  ? 37.681  15.811  -26.021 1.00 31.21 ? 11  VAL B N    1  
ATOM 3778   C CA   . VAL B 1 11  ? 37.252  14.637  -26.835 1.00 73.23 ? 11  VAL B CA   1  
ATOM 3779   C C    . VAL B 1 11  ? 35.947  14.069  -26.272 1.00 13.33 ? 11  VAL B C    1  
ATOM 3780   O O    . VAL B 1 11  ? 34.979  13.890  -26.985 1.00 60.42 ? 11  VAL B O    1  
ATOM 3781   C CB   . VAL B 1 11  ? 38.340  13.561  -26.789 1.00 54.31 ? 11  VAL B CB   1  
ATOM 3782   C CG1  . VAL B 1 11  ? 37.844  12.299  -27.499 1.00 24.22 ? 11  VAL B CG1  1  
ATOM 3783   C CG2  . VAL B 1 11  ? 39.596  14.079  -27.493 1.00 75.55 ? 11  VAL B CG2  1  
ATOM 3784   H H    . VAL B 1 11  ? 38.554  15.805  -25.576 1.00 63.21 ? 11  VAL B H    1  
ATOM 3785   H HA   . VAL B 1 11  ? 37.097  14.947  -27.858 1.00 44.11 ? 11  VAL B HA   1  
ATOM 3786   H HB   . VAL B 1 11  ? 38.571  13.328  -25.760 1.00 62.42 ? 11  VAL B HB   1  
ATOM 3787   H HG11 . VAL B 1 11  ? 37.377  12.571  -28.433 1.00 1.45  ? 11  VAL B HG11 1  
ATOM 3788   H HG12 . VAL B 1 11  ? 37.125  11.792  -26.871 1.00 1.45  ? 11  VAL B HG12 1  
ATOM 3789   H HG13 . VAL B 1 11  ? 38.679  11.642  -27.692 1.00 35.12 ? 11  VAL B HG13 1  
ATOM 3790   H HG21 . VAL B 1 11  ? 39.913  15.002  -27.030 1.00 64.22 ? 11  VAL B HG21 1  
ATOM 3791   H HG22 . VAL B 1 11  ? 39.378  14.256  -28.536 1.00 44.41 ? 11  VAL B HG22 1  
ATOM 3792   H HG23 . VAL B 1 11  ? 40.384  13.345  -27.409 1.00 44.02 ? 11  VAL B HG23 1  
ATOM 3793   N N    . LEU B 1 12  ? 35.910  13.784  -24.999 1.00 70.14 ? 12  LEU B N    1  
ATOM 3794   C CA   . LEU B 1 12  ? 34.665  13.228  -24.398 1.00 45.20 ? 12  LEU B CA   1  
ATOM 3795   C C    . LEU B 1 12  ? 33.539  14.258  -24.517 1.00 44.23 ? 12  LEU B C    1  
ATOM 3796   O O    . LEU B 1 12  ? 32.393  13.916  -24.729 1.00 11.32 ? 12  LEU B O    1  
ATOM 3797   C CB   . LEU B 1 12  ? 34.905  12.908  -22.919 1.00 54.02 ? 12  LEU B CB   1  
ATOM 3798   C CG   . LEU B 1 12  ? 36.007  11.847  -22.775 1.00 13.35 ? 12  LEU B CG   1  
ATOM 3799   C CD1  . LEU B 1 12  ? 36.327  11.657  -21.288 1.00 34.21 ? 12  LEU B CD1  1  
ATOM 3800   C CD2  . LEU B 1 12  ? 35.540  10.507  -23.376 1.00 61.43 ? 12  LEU B CD2  1  
ATOM 3801   H H    . LEU B 1 12  ? 36.700  13.935  -24.439 1.00 20.30 ? 12  LEU B H    1  
ATOM 3802   H HA   . LEU B 1 12  ? 34.380  12.329  -24.922 1.00 41.32 ? 12  LEU B HA   1  
ATOM 3803   H HB2  . LEU B 1 12  ? 35.207  13.808  -22.404 1.00 22.14 ? 12  LEU B HB2  1  
ATOM 3804   H HB3  . LEU B 1 12  ? 33.992  12.537  -22.480 1.00 51.51 ? 12  LEU B HB3  1  
ATOM 3805   H HG   . LEU B 1 12  ? 36.895  12.185  -23.290 1.00 61.22 ? 12  LEU B HG   1  
ATOM 3806   H HD11 . LEU B 1 12  ? 35.407  11.597  -20.725 1.00 23.31 ? 12  LEU B HD11 1  
ATOM 3807   H HD12 . LEU B 1 12  ? 36.910  12.494  -20.935 1.00 14.55 ? 12  LEU B HD12 1  
ATOM 3808   H HD13 . LEU B 1 12  ? 36.890  10.745  -21.154 1.00 33.20 ? 12  LEU B HD13 1  
ATOM 3809   H HD21 . LEU B 1 12  ? 36.098  9.695   -22.930 1.00 30.40 ? 12  LEU B HD21 1  
ATOM 3810   H HD22 . LEU B 1 12  ? 35.713  10.510  -24.441 1.00 50.14 ? 12  LEU B HD22 1  
ATOM 3811   H HD23 . LEU B 1 12  ? 34.486  10.366  -23.182 1.00 63.31 ? 12  LEU B HD23 1  
ATOM 3812   N N    . GLY B 1 13  ? 33.853  15.518  -24.392 1.00 33.23 ? 13  GLY B N    1  
ATOM 3813   C CA   . GLY B 1 13  ? 32.795  16.557  -24.506 1.00 11.15 ? 13  GLY B CA   1  
ATOM 3814   C C    . GLY B 1 13  ? 32.357  16.655  -25.962 1.00 75.40 ? 13  GLY B C    1  
ATOM 3815   O O    . GLY B 1 13  ? 31.256  17.064  -26.266 1.00 53.25 ? 13  GLY B O    1  
ATOM 3816   H H    . GLY B 1 13  ? 34.781  15.780  -24.235 1.00 72.22 ? 13  GLY B H    1  
ATOM 3817   H HA2  . GLY B 1 13  ? 31.951  16.283  -23.888 1.00 41.23 ? 13  GLY B HA2  1  
ATOM 3818   H HA3  . GLY B 1 13  ? 33.187  17.510  -24.185 1.00 70.13 ? 13  GLY B HA3  1  
ATOM 3819   N N    . GLY B 1 14  ? 33.218  16.281  -26.865 1.00 23.52 ? 14  GLY B N    1  
ATOM 3820   C CA   . GLY B 1 14  ? 32.863  16.351  -28.305 1.00 55.01 ? 14  GLY B CA   1  
ATOM 3821   C C    . GLY B 1 14  ? 31.774  15.324  -28.619 1.00 20.23 ? 14  GLY B C    1  
ATOM 3822   O O    . GLY B 1 14  ? 30.747  15.646  -29.182 1.00 65.44 ? 14  GLY B O    1  
ATOM 3823   H H    . GLY B 1 14  ? 34.101  15.955  -26.594 1.00 42.31 ? 14  GLY B H    1  
ATOM 3824   H HA2  . GLY B 1 14  ? 32.506  17.341  -28.532 1.00 15.22 ? 14  GLY B HA2  1  
ATOM 3825   H HA3  . GLY B 1 14  ? 33.736  16.135  -28.902 1.00 61.12 ? 14  GLY B HA3  1  
ATOM 3826   N N    . GLU B 1 15  ? 31.996  14.088  -28.267 1.00 33.24 ? 15  GLU B N    1  
ATOM 3827   C CA   . GLU B 1 15  ? 30.978  13.038  -28.553 1.00 2.30  ? 15  GLU B CA   1  
ATOM 3828   C C    . GLU B 1 15  ? 29.652  13.396  -27.874 1.00 12.11 ? 15  GLU B C    1  
ATOM 3829   O O    . GLU B 1 15  ? 28.603  13.343  -28.485 1.00 4.21  ? 15  GLU B O    1  
ATOM 3830   C CB   . GLU B 1 15  ? 31.479  11.677  -28.054 1.00 0.03  ? 15  GLU B CB   1  
ATOM 3831   C CG   . GLU B 1 15  ? 32.020  11.798  -26.629 1.00 30.42 ? 15  GLU B CG   1  
ATOM 3832   C CD   . GLU B 1 15  ? 32.612  10.455  -26.195 1.00 60.21 ? 15  GLU B CD   1  
ATOM 3833   O OE1  . GLU B 1 15  ? 32.589  9.534   -26.996 1.00 52.44 ? 15  GLU B OE1  1  
ATOM 3834   O OE2  . GLU B 1 15  ? 33.076  10.370  -25.071 1.00 2.53  ? 15  GLU B OE2  1  
ATOM 3835   H H    . GLU B 1 15  ? 32.835  13.850  -27.822 1.00 43.34 ? 15  GLU B H    1  
ATOM 3836   H HA   . GLU B 1 15  ? 30.821  12.985  -29.621 1.00 14.14 ? 15  GLU B HA   1  
ATOM 3837   H HB2  . GLU B 1 15  ? 30.666  10.969  -28.066 1.00 31.13 ? 15  GLU B HB2  1  
ATOM 3838   H HB3  . GLU B 1 15  ? 32.267  11.328  -28.705 1.00 72.20 ? 15  GLU B HB3  1  
ATOM 3839   H HG2  . GLU B 1 15  ? 32.787  12.554  -26.598 1.00 0.22  ? 15  GLU B HG2  1  
ATOM 3840   H HG3  . GLU B 1 15  ? 31.220  12.066  -25.959 1.00 15.24 ? 15  GLU B HG3  1  
ATOM 3841   N N    . ILE B 1 16  ? 29.678  13.773  -26.622 1.00 13.24 ? 16  ILE B N    1  
ATOM 3842   C CA   . ILE B 1 16  ? 28.401  14.138  -25.944 1.00 41.04 ? 16  ILE B CA   1  
ATOM 3843   C C    . ILE B 1 16  ? 27.786  15.339  -26.664 1.00 60.13 ? 16  ILE B C    1  
ATOM 3844   O O    . ILE B 1 16  ? 26.589  15.417  -26.846 1.00 55.35 ? 16  ILE B O    1  
ATOM 3845   C CB   . ILE B 1 16  ? 28.663  14.509  -24.478 1.00 75.15 ? 16  ILE B CB   1  
ATOM 3846   C CG1  . ILE B 1 16  ? 29.300  13.327  -23.725 1.00 45.21 ? 16  ILE B CG1  1  
ATOM 3847   C CG2  . ILE B 1 16  ? 27.343  14.891  -23.805 1.00 30.11 ? 16  ILE B CG2  1  
ATOM 3848   C CD1  . ILE B 1 16  ? 28.461  12.054  -23.890 1.00 73.31 ? 16  ILE B CD1  1  
ATOM 3849   H H    . ILE B 1 16  ? 30.530  13.822  -26.136 1.00 33.32 ? 16  ILE B H    1  
ATOM 3850   H HA   . ILE B 1 16  ? 27.712  13.309  -25.996 1.00 45.43 ? 16  ILE B HA   1  
ATOM 3851   H HB   . ILE B 1 16  ? 29.333  15.356  -24.444 1.00 64.51 ? 16  ILE B HB   1  
ATOM 3852   H HG12 . ILE B 1 16  ? 30.289  13.151  -24.111 1.00 33.43 ? 16  ILE B HG12 1  
ATOM 3853   H HG13 . ILE B 1 16  ? 29.368  13.572  -22.675 1.00 5.02  ? 16  ILE B HG13 1  
ATOM 3854   H HG21 . ILE B 1 16  ? 26.611  14.117  -23.983 1.00 44.11 ? 16  ILE B HG21 1  
ATOM 3855   H HG22 . ILE B 1 16  ? 26.987  15.824  -24.215 1.00 13.42 ? 16  ILE B HG22 1  
ATOM 3856   H HG23 . ILE B 1 16  ? 27.500  15.001  -22.742 1.00 52.25 ? 16  ILE B HG23 1  
ATOM 3857   H HD11 . ILE B 1 16  ? 28.723  11.571  -24.819 1.00 54.44 ? 16  ILE B HD11 1  
ATOM 3858   H HD12 . ILE B 1 16  ? 27.411  12.303  -23.897 1.00 5.24  ? 16  ILE B HD12 1  
ATOM 3859   H HD13 . ILE B 1 16  ? 28.665  11.382  -23.069 1.00 11.22 ? 16  ILE B HD13 1  
ATOM 3860   N N    . GLU B 1 17  ? 28.598  16.273  -27.078 1.00 33.35 ? 17  GLU B N    1  
ATOM 3861   C CA   . GLU B 1 17  ? 28.057  17.467  -27.787 1.00 43.31 ? 17  GLU B CA   1  
ATOM 3862   C C    . GLU B 1 17  ? 27.224  17.013  -28.987 1.00 62.21 ? 17  GLU B C    1  
ATOM 3863   O O    . GLU B 1 17  ? 26.161  17.537  -29.247 1.00 73.01 ? 17  GLU B O    1  
ATOM 3864   C CB   . GLU B 1 17  ? 29.216  18.342  -28.272 1.00 55.34 ? 17  GLU B CB   1  
ATOM 3865   C CG   . GLU B 1 17  ? 28.668  19.658  -28.829 1.00 44.02 ? 17  GLU B CG   1  
ATOM 3866   C CD   . GLU B 1 17  ? 29.815  20.476  -29.425 1.00 2.43  ? 17  GLU B CD   1  
ATOM 3867   O OE1  . GLU B 1 17  ? 30.935  19.994  -29.403 1.00 63.20 ? 17  GLU B OE1  1  
ATOM 3868   O OE2  . GLU B 1 17  ? 29.553  21.572  -29.894 1.00 64.22 ? 17  GLU B OE2  1  
ATOM 3869   H H    . GLU B 1 17  ? 29.562  16.190  -26.924 1.00 64.32 ? 17  GLU B H    1  
ATOM 3870   H HA   . GLU B 1 17  ? 27.433  18.034  -27.111 1.00 30.12 ? 17  GLU B HA   1  
ATOM 3871   H HB2  . GLU B 1 17  ? 29.881  18.549  -27.446 1.00 11.03 ? 17  GLU B HB2  1  
ATOM 3872   H HB3  . GLU B 1 17  ? 29.757  17.823  -29.049 1.00 52.43 ? 17  GLU B HB3  1  
ATOM 3873   H HG2  . GLU B 1 17  ? 27.938  19.448  -29.597 1.00 41.21 ? 17  GLU B HG2  1  
ATOM 3874   H HG3  . GLU B 1 17  ? 28.203  20.220  -28.034 1.00 50.11 ? 17  GLU B HG3  1  
ATOM 3875   N N    . LYS B 1 18  ? 27.696  16.040  -29.721 1.00 44.03 ? 18  LYS B N    1  
ATOM 3876   C CA   . LYS B 1 18  ? 26.925  15.553  -30.904 1.00 30.51 ? 18  LYS B CA   1  
ATOM 3877   C C    . LYS B 1 18  ? 25.950  14.471  -30.461 1.00 62.10 ? 18  LYS B C    1  
ATOM 3878   O O    . LYS B 1 18  ? 25.175  13.958  -31.243 1.00 3.33  ? 18  LYS B O    1  
ATOM 3879   C CB   . LYS B 1 18  ? 27.888  14.979  -31.946 1.00 74.30 ? 18  LYS B CB   1  
ATOM 3880   C CG   . LYS B 1 18  ? 28.824  16.082  -32.443 1.00 14.32 ? 18  LYS B CG   1  
ATOM 3881   C CD   . LYS B 1 18  ? 29.731  15.524  -33.542 1.00 32.31 ? 18  LYS B CD   1  
ATOM 3882   C CE   . LYS B 1 18  ? 30.744  16.591  -33.961 1.00 63.44 ? 18  LYS B CE   1  
ATOM 3883   N NZ   . LYS B 1 18  ? 31.781  15.975  -34.836 1.00 13.34 ? 18  LYS B NZ   1  
ATOM 3884   H H    . LYS B 1 18  ? 28.556  15.629  -29.495 1.00 41.15 ? 18  LYS B H    1  
ATOM 3885   H HA   . LYS B 1 18  ? 26.369  16.366  -31.334 1.00 33.45 ? 18  LYS B HA   1  
ATOM 3886   H HB2  . LYS B 1 18  ? 28.470  14.187  -31.498 1.00 53.03 ? 18  LYS B HB2  1  
ATOM 3887   H HB3  . LYS B 1 18  ? 27.325  14.585  -32.778 1.00 4.22  ? 18  LYS B HB3  1  
ATOM 3888   H HG2  . LYS B 1 18  ? 28.239  16.900  -32.838 1.00 24.25 ? 18  LYS B HG2  1  
ATOM 3889   H HG3  . LYS B 1 18  ? 29.432  16.436  -31.624 1.00 62.10 ? 18  LYS B HG3  1  
ATOM 3890   H HD2  . LYS B 1 18  ? 30.255  14.656  -33.170 1.00 30.13 ? 18  LYS B HD2  1  
ATOM 3891   H HD3  . LYS B 1 18  ? 29.132  15.245  -34.396 1.00 2.45  ? 18  LYS B HD3  1  
ATOM 3892   H HE2  . LYS B 1 18  ? 30.237  17.377  -34.502 1.00 44.12 ? 18  LYS B HE2  1  
ATOM 3893   H HE3  . LYS B 1 18  ? 31.215  17.006  -33.082 1.00 12.41 ? 18  LYS B HE3  1  
ATOM 3894   H HZ1  . LYS B 1 18  ? 31.363  15.184  -35.366 1.00 32.23 ? 18  LYS B HZ1  1  
ATOM 3895   H HZ2  . LYS B 1 18  ? 32.565  15.623  -34.249 1.00 3.02  ? 18  LYS B HZ2  1  
ATOM 3896   H HZ3  . LYS B 1 18  ? 32.139  16.686  -35.504 1.00 72.43 ? 18  LYS B HZ3  1  
ATOM 3897   N N    . GLY B 1 19  ? 25.983  14.122  -29.211 1.00 61.24 ? 19  GLY B N    1  
ATOM 3898   C CA   . GLY B 1 19  ? 25.062  13.073  -28.706 1.00 70.54 ? 19  GLY B CA   1  
ATOM 3899   C C    . GLY B 1 19  ? 23.711  13.695  -28.346 1.00 5.52  ? 19  GLY B C    1  
ATOM 3900   O O    . GLY B 1 19  ? 22.674  13.255  -28.802 1.00 2.14  ? 19  GLY B O    1  
ATOM 3901   H H    . GLY B 1 19  ? 26.619  14.550  -28.600 1.00 50.42 ? 19  GLY B H    1  
ATOM 3902   H HA2  . GLY B 1 19  ? 24.923  12.313  -29.464 1.00 44.01 ? 19  GLY B HA2  1  
ATOM 3903   H HA3  . GLY B 1 19  ? 25.492  12.630  -27.830 1.00 55.20 ? 19  GLY B HA3  1  
ATOM 3904   N N    . LEU B 1 20  ? 23.713  14.710  -27.525 1.00 31.00 ? 20  LEU B N    1  
ATOM 3905   C CA   . LEU B 1 20  ? 22.427  15.352  -27.130 1.00 52.21 ? 20  LEU B CA   1  
ATOM 3906   C C    . LEU B 1 20  ? 21.882  16.196  -28.292 1.00 11.15 ? 20  LEU B C    1  
ATOM 3907   O O    . LEU B 1 20  ? 20.711  16.518  -28.338 1.00 12.51 ? 20  LEU B O    1  
ATOM 3908   C CB   . LEU B 1 20  ? 22.649  16.210  -25.859 1.00 55.12 ? 20  LEU B CB   1  
ATOM 3909   C CG   . LEU B 1 20  ? 23.147  17.634  -26.180 1.00 52.13 ? 20  LEU B CG   1  
ATOM 3910   C CD1  . LEU B 1 20  ? 23.253  18.421  -24.874 1.00 71.34 ? 20  LEU B CD1  1  
ATOM 3911   C CD2  . LEU B 1 20  ? 24.531  17.577  -26.833 1.00 11.34 ? 20  LEU B CD2  1  
ATOM 3912   H H    . LEU B 1 20  ? 24.560  15.046  -27.164 1.00 52.52 ? 20  LEU B H    1  
ATOM 3913   H HA   . LEU B 1 20  ? 21.710  14.574  -26.903 1.00 33.40 ? 20  LEU B HA   1  
ATOM 3914   H HB2  . LEU B 1 20  ? 21.718  16.282  -25.316 1.00 21.35 ? 20  LEU B HB2  1  
ATOM 3915   H HB3  . LEU B 1 20  ? 23.381  15.718  -25.234 1.00 13.05 ? 20  LEU B HB3  1  
ATOM 3916   H HG   . LEU B 1 20  ? 22.451  18.138  -26.833 1.00 50.51 ? 20  LEU B HG   1  
ATOM 3917   H HD11 . LEU B 1 20  ? 24.031  17.995  -24.258 1.00 72.02 ? 20  LEU B HD11 1  
ATOM 3918   H HD12 . LEU B 1 20  ? 22.312  18.370  -24.348 1.00 72.35 ? 20  LEU B HD12 1  
ATOM 3919   H HD13 . LEU B 1 20  ? 23.488  19.452  -25.091 1.00 23.02 ? 20  LEU B HD13 1  
ATOM 3920   H HD21 . LEU B 1 20  ? 25.246  17.191  -26.122 1.00 75.43 ? 20  LEU B HD21 1  
ATOM 3921   H HD22 . LEU B 1 20  ? 24.826  18.571  -27.136 1.00 43.33 ? 20  LEU B HD22 1  
ATOM 3922   H HD23 . LEU B 1 20  ? 24.501  16.937  -27.696 1.00 74.33 ? 20  LEU B HD23 1  
ATOM 3923   N N    . ASN B 1 21  ? 22.719  16.562  -29.225 1.00 33.33 ? 21  ASN B N    1  
ATOM 3924   C CA   . ASN B 1 21  ? 22.248  17.386  -30.370 1.00 33.35 ? 21  ASN B CA   1  
ATOM 3925   C C    . ASN B 1 21  ? 21.041  16.711  -31.023 1.00 63.33 ? 21  ASN B C    1  
ATOM 3926   O O    . ASN B 1 21  ? 20.152  17.365  -31.532 1.00 62.12 ? 21  ASN B O    1  
ATOM 3927   C CB   . ASN B 1 21  ? 23.381  17.523  -31.390 1.00 61.41 ? 21  ASN B CB   1  
ATOM 3928   C CG   . ASN B 1 21  ? 24.399  18.553  -30.893 1.00 33.35 ? 21  ASN B CG   1  
ATOM 3929   O OD1  . ASN B 1 21  ? 24.133  19.288  -29.964 1.00 64.41 ? 21  ASN B OD1  1  
ATOM 3930   N ND2  . ASN B 1 21  ? 25.563  18.636  -31.478 1.00 62.31 ? 21  ASN B ND2  1  
ATOM 3931   H H    . ASN B 1 21  ? 23.660  16.299  -29.172 1.00 72.11 ? 21  ASN B H    1  
ATOM 3932   H HA   . ASN B 1 21  ? 21.962  18.365  -30.015 1.00 41.35 ? 21  ASN B HA   1  
ATOM 3933   H HB2  . ASN B 1 21  ? 23.868  16.567  -31.515 1.00 14.44 ? 21  ASN B HB2  1  
ATOM 3934   H HB3  . ASN B 1 21  ? 22.979  17.847  -32.334 1.00 14.02 ? 21  ASN B HB3  1  
ATOM 3935   H HD21 . ASN B 1 21  ? 25.778  18.044  -32.228 1.00 73.20 ? 21  ASN B HD21 1  
ATOM 3936   H HD22 . ASN B 1 21  ? 26.222  19.292  -31.167 1.00 32.34 ? 21  ASN B HD22 1  
ATOM 3937   N N    . VAL B 1 22  ? 20.999  15.409  -31.010 1.00 33.33 ? 22  VAL B N    1  
ATOM 3938   C CA   . VAL B 1 22  ? 19.845  14.698  -31.627 1.00 3.21  ? 22  VAL B CA   1  
ATOM 3939   C C    . VAL B 1 22  ? 18.564  15.086  -30.889 1.00 43.45 ? 22  VAL B C    1  
ATOM 3940   O O    . VAL B 1 22  ? 17.500  15.170  -31.469 1.00 63.14 ? 22  VAL B O    1  
ATOM 3941   C CB   . VAL B 1 22  ? 20.060  13.187  -31.520 1.00 74.23 ? 22  VAL B CB   1  
ATOM 3942   C CG1  . VAL B 1 22  ? 18.833  12.456  -32.068 1.00 23.20 ? 22  VAL B CG1  1  
ATOM 3943   C CG2  . VAL B 1 22  ? 21.295  12.790  -32.333 1.00 35.11 ? 22  VAL B CG2  1  
ATOM 3944   H H    . VAL B 1 22  ? 21.724  14.899  -30.592 1.00 24.44 ? 22  VAL B H    1  
ATOM 3945   H HA   . VAL B 1 22  ? 19.762  14.978  -32.667 1.00 0.23  ? 22  VAL B HA   1  
ATOM 3946   H HB   . VAL B 1 22  ? 20.207  12.917  -30.484 1.00 43.42 ? 22  VAL B HB   1  
ATOM 3947   H HG11 . VAL B 1 22  ? 19.057  11.404  -32.171 1.00 65.12 ? 22  VAL B HG11 1  
ATOM 3948   H HG12 . VAL B 1 22  ? 18.572  12.864  -33.033 1.00 31.43 ? 22  VAL B HG12 1  
ATOM 3949   H HG13 . VAL B 1 22  ? 18.005  12.582  -31.387 1.00 53.13 ? 22  VAL B HG13 1  
ATOM 3950   H HG21 . VAL B 1 22  ? 21.165  13.100  -33.359 1.00 50.30 ? 22  VAL B HG21 1  
ATOM 3951   H HG22 . VAL B 1 22  ? 21.422  11.718  -32.294 1.00 61.34 ? 22  VAL B HG22 1  
ATOM 3952   H HG23 . VAL B 1 22  ? 22.168  13.272  -31.919 1.00 42.14 ? 22  VAL B HG23 1  
ATOM 3953   N N    . LYS B 1 23  ? 18.660  15.324  -29.609 1.00 63.42 ? 23  LYS B N    1  
ATOM 3954   C CA   . LYS B 1 23  ? 17.452  15.707  -28.824 1.00 53.01 ? 23  LYS B CA   1  
ATOM 3955   C C    . LYS B 1 23  ? 17.188  17.200  -29.006 1.00 53.15 ? 23  LYS B C    1  
ATOM 3956   O O    . LYS B 1 23  ? 16.196  17.733  -28.550 1.00 60.22 ? 23  LYS B O    1  
ATOM 3957   C CB   . LYS B 1 23  ? 17.694  15.393  -27.342 1.00 1.14  ? 23  LYS B CB   1  
ATOM 3958   C CG   . LYS B 1 23  ? 18.416  14.043  -27.203 1.00 1.01  ? 23  LYS B CG   1  
ATOM 3959   C CD   . LYS B 1 23  ? 17.729  12.980  -28.078 1.00 32.34 ? 23  LYS B CD   1  
ATOM 3960   C CE   . LYS B 1 23  ? 18.026  11.579  -27.532 1.00 22.13 ? 23  LYS B CE   1  
ATOM 3961   N NZ   . LYS B 1 23  ? 17.350  11.404  -26.215 1.00 42.24 ? 23  LYS B NZ   1  
ATOM 3962   H H    . LYS B 1 23  ? 19.529  15.250  -29.162 1.00 32.23 ? 23  LYS B H    1  
ATOM 3963   H HA   . LYS B 1 23  ? 16.598  15.152  -29.179 1.00 52.43 ? 23  LYS B HA   1  
ATOM 3964   H HB2  . LYS B 1 23  ? 18.305  16.170  -26.904 1.00 54.14 ? 23  LYS B HB2  1  
ATOM 3965   H HB3  . LYS B 1 23  ? 16.749  15.346  -26.825 1.00 62.11 ? 23  LYS B HB3  1  
ATOM 3966   H HG2  . LYS B 1 23  ? 19.444  14.155  -27.515 1.00 22.25 ? 23  LYS B HG2  1  
ATOM 3967   H HG3  . LYS B 1 23  ? 18.388  13.733  -26.168 1.00 4.10  ? 23  LYS B HG3  1  
ATOM 3968   H HD2  . LYS B 1 23  ? 16.665  13.147  -28.078 1.00 4.00  ? 23  LYS B HD2  1  
ATOM 3969   H HD3  . LYS B 1 23  ? 18.102  13.052  -29.088 1.00 72.11 ? 23  LYS B HD3  1  
ATOM 3970   H HE2  . LYS B 1 23  ? 17.659  10.837  -28.226 1.00 2.42  ? 23  LYS B HE2  1  
ATOM 3971   H HE3  . LYS B 1 23  ? 19.092  11.459  -27.408 1.00 3.15  ? 23  LYS B HE3  1  
ATOM 3972   H HZ1  . LYS B 1 23  ? 17.347  12.309  -25.704 1.00 1.30  ? 23  LYS B HZ1  1  
ATOM 3973   H HZ2  . LYS B 1 23  ? 17.860  10.690  -25.656 1.00 73.52 ? 23  LYS B HZ2  1  
ATOM 3974   H HZ3  . LYS B 1 23  ? 16.370  11.092  -26.367 1.00 62.30 ? 23  LYS B HZ3  1  
ATOM 3975   N N    . GLY B 1 24  ? 18.072  17.870  -29.681 1.00 44.23 ? 24  GLY B N    1  
ATOM 3976   C CA   . GLY B 1 24  ? 17.891  19.332  -29.917 1.00 53.43 ? 24  GLY B CA   1  
ATOM 3977   C C    . GLY B 1 24  ? 18.311  20.118  -28.673 1.00 2.43  ? 24  GLY B C    1  
ATOM 3978   O O    . GLY B 1 24  ? 17.936  21.260  -28.495 1.00 3.31  ? 24  GLY B O    1  
ATOM 3979   H H    . GLY B 1 24  ? 18.856  17.404  -30.040 1.00 35.13 ? 24  GLY B H    1  
ATOM 3980   H HA2  . GLY B 1 24  ? 18.498  19.639  -30.757 1.00 32.22 ? 24  GLY B HA2  1  
ATOM 3981   H HA3  . GLY B 1 24  ? 16.853  19.535  -30.131 1.00 33.14 ? 24  GLY B HA3  1  
ATOM 3982   N N    . PHE B 1 25  ? 19.090  19.520  -27.811 1.00 45.32 ? 25  PHE B N    1  
ATOM 3983   C CA   . PHE B 1 25  ? 19.538  20.235  -26.578 1.00 5.43  ? 25  PHE B CA   1  
ATOM 3984   C C    . PHE B 1 25  ? 20.882  20.917  -26.858 1.00 13.14 ? 25  PHE B C    1  
ATOM 3985   O O    . PHE B 1 25  ? 21.593  20.556  -27.774 1.00 55.32 ? 25  PHE B O    1  
ATOM 3986   C CB   . PHE B 1 25  ? 19.695  19.226  -25.428 1.00 31.22 ? 25  PHE B CB   1  
ATOM 3987   C CG   . PHE B 1 25  ? 18.347  18.953  -24.786 1.00 34.23 ? 25  PHE B CG   1  
ATOM 3988   C CD1  . PHE B 1 25  ? 17.280  18.481  -25.563 1.00 71.12 ? 25  PHE B CD1  1  
ATOM 3989   C CD2  . PHE B 1 25  ? 18.164  19.172  -23.412 1.00 43.21 ? 25  PHE B CD2  1  
ATOM 3990   C CE1  . PHE B 1 25  ? 16.037  18.229  -24.969 1.00 11.51 ? 25  PHE B CE1  1  
ATOM 3991   C CE2  . PHE B 1 25  ? 16.921  18.920  -22.821 1.00 22.51 ? 25  PHE B CE2  1  
ATOM 3992   C CZ   . PHE B 1 25  ? 15.858  18.448  -23.599 1.00 14.34 ? 25  PHE B CZ   1  
ATOM 3993   H H    . PHE B 1 25  ? 19.383  18.599  -27.975 1.00 43.25 ? 25  PHE B H    1  
ATOM 3994   H HA   . PHE B 1 25  ? 18.808  20.987  -26.304 1.00 24.42 ? 25  PHE B HA   1  
ATOM 3995   H HB2  . PHE B 1 25  ? 20.098  18.302  -25.817 1.00 51.12 ? 25  PHE B HB2  1  
ATOM 3996   H HB3  . PHE B 1 25  ? 20.371  19.626  -24.686 1.00 30.41 ? 25  PHE B HB3  1  
ATOM 3997   H HD1  . PHE B 1 25  ? 17.415  18.311  -26.619 1.00 43.53 ? 25  PHE B HD1  1  
ATOM 3998   H HD2  . PHE B 1 25  ? 18.983  19.536  -22.809 1.00 35.01 ? 25  PHE B HD2  1  
ATOM 3999   H HE1  . PHE B 1 25  ? 15.217  17.864  -25.569 1.00 53.23 ? 25  PHE B HE1  1  
ATOM 4000   H HE2  . PHE B 1 25  ? 16.782  19.089  -21.763 1.00 12.33 ? 25  PHE B HE2  1  
ATOM 4001   H HZ   . PHE B 1 25  ? 14.899  18.253  -23.142 1.00 31.53 ? 25  PHE B HZ   1  
ATOM 4002   N N    . MET B 1 26  ? 21.235  21.903  -26.071 1.00 30.45 ? 26  MET B N    1  
ATOM 4003   C CA   . MET B 1 26  ? 22.530  22.618  -26.278 1.00 75.24 ? 26  MET B CA   1  
ATOM 4004   C C    . MET B 1 26  ? 23.546  22.093  -25.267 1.00 34.14 ? 26  MET B C    1  
ATOM 4005   O O    . MET B 1 26  ? 23.225  21.875  -24.116 1.00 12.43 ? 26  MET B O    1  
ATOM 4006   C CB   . MET B 1 26  ? 22.315  24.116  -26.061 1.00 63.34 ? 26  MET B CB   1  
ATOM 4007   C CG   . MET B 1 26  ? 21.129  24.579  -26.907 1.00 73.15 ? 26  MET B CG   1  
ATOM 4008   S SD   . MET B 1 26  ? 21.069  26.387  -26.939 1.00 22.30 ? 26  MET B SD   1  
ATOM 4009   C CE   . MET B 1 26  ? 19.713  26.542  -28.127 1.00 71.21 ? 26  MET B CE   1  
ATOM 4010   H H    . MET B 1 26  ? 20.647  22.172  -25.336 1.00 22.03 ? 26  MET B H    1  
ATOM 4011   H HA   . MET B 1 26  ? 22.895  22.447  -27.282 1.00 72.22 ? 26  MET B HA   1  
ATOM 4012   H HB2  . MET B 1 26  ? 22.112  24.305  -25.017 1.00 24.04 ? 26  MET B HB2  1  
ATOM 4013   H HB3  . MET B 1 26  ? 23.201  24.656  -26.360 1.00 4.52  ? 26  MET B HB3  1  
ATOM 4014   H HG2  . MET B 1 26  ? 21.238  24.206  -27.914 1.00 13.01 ? 26  MET B HG2  1  
ATOM 4015   H HG3  . MET B 1 26  ? 20.213  24.197  -26.480 1.00 52.12 ? 26  MET B HG3  1  
ATOM 4016   H HE1  . MET B 1 26  ? 20.116  26.574  -29.130 1.00 43.54 ? 26  MET B HE1  1  
ATOM 4017   H HE2  . MET B 1 26  ? 19.164  27.449  -27.933 1.00 25.42 ? 26  MET B HE2  1  
ATOM 4018   H HE3  . MET B 1 26  ? 19.049  25.694  -28.027 1.00 10.34 ? 26  MET B HE3  1  
ATOM 4019   N N    . ALA B 1 27  ? 24.767  21.874  -25.691 1.00 72.12 ? 27  ALA B N    1  
ATOM 4020   C CA   . ALA B 1 27  ? 25.815  21.344  -24.761 1.00 20.23 ? 27  ALA B CA   1  
ATOM 4021   C C    . ALA B 1 27  ? 26.910  22.394  -24.549 1.00 51.22 ? 27  ALA B C    1  
ATOM 4022   O O    . ALA B 1 27  ? 27.236  23.159  -25.435 1.00 25.14 ? 27  ALA B O    1  
ATOM 4023   C CB   . ALA B 1 27  ? 26.431  20.078  -25.375 1.00 53.33 ? 27  ALA B CB   1  
ATOM 4024   H H    . ALA B 1 27  ? 24.994  22.050  -26.628 1.00 12.50 ? 27  ALA B H    1  
ATOM 4025   H HA   . ALA B 1 27  ? 25.373  21.096  -23.806 1.00 43.53 ? 27  ALA B HA   1  
ATOM 4026   H HB1  . ALA B 1 27  ? 27.429  19.929  -24.989 1.00 64.41 ? 27  ALA B HB1  1  
ATOM 4027   H HB2  . ALA B 1 27  ? 26.474  20.185  -26.449 1.00 73.25 ? 27  ALA B HB2  1  
ATOM 4028   H HB3  . ALA B 1 27  ? 25.820  19.225  -25.125 1.00 4.23  ? 27  ALA B HB3  1  
ATOM 4029   N N    . ASP B 1 28  ? 27.489  22.414  -23.375 1.00 72.31 ? 28  ASP B N    1  
ATOM 4030   C CA   . ASP B 1 28  ? 28.585  23.385  -23.069 1.00 51.32 ? 28  ASP B CA   1  
ATOM 4031   C C    . ASP B 1 28  ? 29.744  22.620  -22.427 1.00 34.51 ? 28  ASP B C    1  
ATOM 4032   O O    . ASP B 1 28  ? 29.543  21.805  -21.548 1.00 4.20  ? 28  ASP B O    1  
ATOM 4033   C CB   . ASP B 1 28  ? 28.072  24.448  -22.096 1.00 34.20 ? 28  ASP B CB   1  
ATOM 4034   C CG   . ASP B 1 28  ? 29.173  25.479  -21.841 1.00 42.14 ? 28  ASP B CG   1  
ATOM 4035   O OD1  . ASP B 1 28  ? 29.285  26.404  -22.629 1.00 41.45 ? 28  ASP B OD1  1  
ATOM 4036   O OD2  . ASP B 1 28  ? 29.886  25.326  -20.863 1.00 51.14 ? 28  ASP B OD2  1  
ATOM 4037   H H    . ASP B 1 28  ? 27.208  21.773  -22.688 1.00 11.34 ? 28  ASP B H    1  
ATOM 4038   H HA   . ASP B 1 28  ? 28.929  23.860  -23.978 1.00 31.42 ? 28  ASP B HA   1  
ATOM 4039   H HB2  . ASP B 1 28  ? 27.209  24.939  -22.522 1.00 31.14 ? 28  ASP B HB2  1  
ATOM 4040   H HB3  . ASP B 1 28  ? 27.797  23.980  -21.163 1.00 33.32 ? 28  ASP B HB3  1  
ATOM 4041   N N    . VAL B 1 29  ? 30.954  22.867  -22.864 1.00 64.43 ? 29  VAL B N    1  
ATOM 4042   C CA   . VAL B 1 29  ? 32.134  22.154  -22.297 1.00 33.40 ? 29  VAL B CA   1  
ATOM 4043   C C    . VAL B 1 29  ? 32.963  23.138  -21.471 1.00 42.30 ? 29  VAL B C    1  
ATOM 4044   O O    . VAL B 1 29  ? 33.227  24.246  -21.893 1.00 44.44 ? 29  VAL B O    1  
ATOM 4045   C CB   . VAL B 1 29  ? 32.982  21.616  -23.454 1.00 0.31  ? 29  VAL B CB   1  
ATOM 4046   C CG1  . VAL B 1 29  ? 32.354  20.331  -24.001 1.00 62.30 ? 29  VAL B CG1  1  
ATOM 4047   C CG2  . VAL B 1 29  ? 33.043  22.663  -24.569 1.00 62.32 ? 29  VAL B CG2  1  
ATOM 4048   H H    . VAL B 1 29  ? 31.091  23.523  -23.575 1.00 62.14 ? 29  VAL B H    1  
ATOM 4049   H HA   . VAL B 1 29  ? 31.816  21.333  -21.668 1.00 33.10 ? 29  VAL B HA   1  
ATOM 4050   H HB   . VAL B 1 29  ? 33.978  21.406  -23.103 1.00 3.20  ? 29  VAL B HB   1  
ATOM 4051   H HG11 . VAL B 1 29  ? 32.401  19.558  -23.249 1.00 2.11  ? 29  VAL B HG11 1  
ATOM 4052   H HG12 . VAL B 1 29  ? 32.896  20.012  -24.879 1.00 11.24 ? 29  VAL B HG12 1  
ATOM 4053   H HG13 . VAL B 1 29  ? 31.323  20.517  -24.263 1.00 61.35 ? 29  VAL B HG13 1  
ATOM 4054   H HG21 . VAL B 1 29  ? 33.363  23.608  -24.158 1.00 72.14 ? 29  VAL B HG21 1  
ATOM 4055   H HG22 . VAL B 1 29  ? 32.064  22.775  -25.011 1.00 11.24 ? 29  VAL B HG22 1  
ATOM 4056   H HG23 . VAL B 1 29  ? 33.744  22.342  -25.325 1.00 3.03  ? 29  VAL B HG23 1  
ATOM 4057   N N    . THR B 1 30  ? 33.378  22.737  -20.297 1.00 31.42 ? 30  THR B N    1  
ATOM 4058   C CA   . THR B 1 30  ? 34.198  23.640  -19.432 1.00 11.53 ? 30  THR B CA   1  
ATOM 4059   C C    . THR B 1 30  ? 35.340  22.837  -18.808 1.00 62.11 ? 30  THR B C    1  
ATOM 4060   O O    . THR B 1 30  ? 35.375  21.625  -18.890 1.00 60.44 ? 30  THR B O    1  
ATOM 4061   C CB   . THR B 1 30  ? 33.324  24.222  -18.320 1.00 61.23 ? 30  THR B CB   1  
ATOM 4062   O OG1  . THR B 1 30  ? 33.193  23.269  -17.276 1.00 34.04 ? 30  THR B OG1  1  
ATOM 4063   C CG2  . THR B 1 30  ? 31.942  24.564  -18.878 1.00 65.41 ? 30  THR B CG2  1  
ATOM 4064   H H    . THR B 1 30  ? 33.151  21.837  -19.982 1.00 13.31 ? 30  THR B H    1  
ATOM 4065   H HA   . THR B 1 30  ? 34.609  24.446  -20.026 1.00 31.21 ? 30  THR B HA   1  
ATOM 4066   H HB   . THR B 1 30  ? 33.783  25.118  -17.934 1.00 70.14 ? 30  THR B HB   1  
ATOM 4067   H HG1  . THR B 1 30  ? 33.858  23.465  -16.611 1.00 74.53 ? 30  THR B HG1  1  
ATOM 4068   H HG21 . THR B 1 30  ? 32.052  25.118  -19.799 1.00 41.43 ? 30  THR B HG21 1  
ATOM 4069   H HG22 . THR B 1 30  ? 31.402  25.164  -18.161 1.00 63.10 ? 30  THR B HG22 1  
ATOM 4070   H HG23 . THR B 1 30  ? 31.395  23.652  -19.070 1.00 43.34 ? 30  THR B HG23 1  
ATOM 4071   N N    . GLU B 1 31  ? 36.279  23.501  -18.186 1.00 64.11 ? 31  GLU B N    1  
ATOM 4072   C CA   . GLU B 1 31  ? 37.424  22.777  -17.556 1.00 40.43 ? 31  GLU B CA   1  
ATOM 4073   C C    . GLU B 1 31  ? 37.108  22.494  -16.082 1.00 44.12 ? 31  GLU B C    1  
ATOM 4074   O O    . GLU B 1 31  ? 36.298  21.645  -15.763 1.00 3.21  ? 31  GLU B O    1  
ATOM 4075   C CB   . GLU B 1 31  ? 38.688  23.641  -17.659 1.00 71.02 ? 31  GLU B CB   1  
ATOM 4076   C CG   . GLU B 1 31  ? 38.326  25.109  -17.423 1.00 24.03 ? 31  GLU B CG   1  
ATOM 4077   C CD   . GLU B 1 31  ? 39.606  25.939  -17.307 1.00 12.54 ? 31  GLU B CD   1  
ATOM 4078   O OE1  . GLU B 1 31  ? 40.663  25.345  -17.169 1.00 54.51 ? 31  GLU B OE1  1  
ATOM 4079   O OE2  . GLU B 1 31  ? 39.507  27.154  -17.357 1.00 62.22 ? 31  GLU B OE2  1  
ATOM 4080   H H    . GLU B 1 31  ? 36.231  24.478  -18.133 1.00 62.12 ? 31  GLU B H    1  
ATOM 4081   H HA   . GLU B 1 31  ? 37.590  21.841  -18.071 1.00 63.51 ? 31  GLU B HA   1  
ATOM 4082   H HB2  . GLU B 1 31  ? 39.410  23.323  -16.920 1.00 23.32 ? 31  GLU B HB2  1  
ATOM 4083   H HB3  . GLU B 1 31  ? 39.114  23.534  -18.645 1.00 43.41 ? 31  GLU B HB3  1  
ATOM 4084   H HG2  . GLU B 1 31  ? 37.736  25.471  -18.253 1.00 32.53 ? 31  GLU B HG2  1  
ATOM 4085   H HG3  . GLU B 1 31  ? 37.757  25.198  -16.511 1.00 53.42 ? 31  GLU B HG3  1  
ATOM 4086   N N    . SER B 1 32  ? 37.745  23.194  -15.183 1.00 22.21 ? 32  SER B N    1  
ATOM 4087   C CA   . SER B 1 32  ? 37.490  22.963  -13.731 1.00 51.11 ? 32  SER B CA   1  
ATOM 4088   C C    . SER B 1 32  ? 36.189  23.650  -13.315 1.00 34.54 ? 32  SER B C    1  
ATOM 4089   O O    . SER B 1 32  ? 35.625  24.440  -14.046 1.00 22.13 ? 32  SER B O    1  
ATOM 4090   C CB   . SER B 1 32  ? 38.649  23.535  -12.914 1.00 34.33 ? 32  SER B CB   1  
ATOM 4091   O OG   . SER B 1 32  ? 38.600  24.955  -12.960 1.00 10.21 ? 32  SER B OG   1  
ATOM 4092   H H    . SER B 1 32  ? 38.397  23.870  -15.462 1.00 20.34 ? 32  SER B H    1  
ATOM 4093   H HA   . SER B 1 32  ? 37.408  21.902  -13.541 1.00 44.01 ? 32  SER B HA   1  
ATOM 4094   H HB2  . SER B 1 32  ? 38.565  23.210  -11.891 1.00 31.24 ? 32  SER B HB2  1  
ATOM 4095   H HB3  . SER B 1 32  ? 39.586  23.183  -13.325 1.00 71.40 ? 32  SER B HB3  1  
ATOM 4096   H HG   . SER B 1 32  ? 39.236  25.294  -12.326 1.00 32.43 ? 32  SER B HG   1  
ATOM 4097   N N    . LEU B 1 33  ? 35.715  23.347  -12.140 1.00 22.22 ? 33  LEU B N    1  
ATOM 4098   C CA   . LEU B 1 33  ? 34.451  23.964  -11.652 1.00 70.14 ? 33  LEU B CA   1  
ATOM 4099   C C    . LEU B 1 33  ? 34.527  25.486  -11.790 1.00 21.22 ? 33  LEU B C    1  
ATOM 4100   O O    . LEU B 1 33  ? 33.527  26.150  -11.979 1.00 12.34 ? 33  LEU B O    1  
ATOM 4101   C CB   . LEU B 1 33  ? 34.262  23.602  -10.177 1.00 32.11 ? 33  LEU B CB   1  
ATOM 4102   C CG   . LEU B 1 33  ? 34.283  22.078  -10.002 1.00 70.01 ? 33  LEU B CG   1  
ATOM 4103   C CD1  . LEU B 1 33  ? 34.353  21.741  -8.508  1.00 11.52 ? 33  LEU B CD1  1  
ATOM 4104   C CD2  . LEU B 1 33  ? 33.015  21.458  -10.611 1.00 71.24 ? 33  LEU B CD2  1  
ATOM 4105   H H    . LEU B 1 33  ? 36.192  22.705  -11.574 1.00 63.43 ? 33  LEU B H    1  
ATOM 4106   H HA   . LEU B 1 33  ? 33.618  23.591  -12.226 1.00 12.33 ? 33  LEU B HA   1  
ATOM 4107   H HB2  . LEU B 1 33  ? 35.068  24.036  -9.603  1.00 14.32 ? 33  LEU B HB2  1  
ATOM 4108   H HB3  . LEU B 1 33  ? 33.320  23.995  -9.826  1.00 43.00 ? 33  LEU B HB3  1  
ATOM 4109   H HG   . LEU B 1 33  ? 35.154  21.674  -10.498 1.00 63.02 ? 33  LEU B HG   1  
ATOM 4110   H HD11 . LEU B 1 33  ? 35.357  21.909  -8.149  1.00 30.00 ? 33  LEU B HD11 1  
ATOM 4111   H HD12 . LEU B 1 33  ? 34.088  20.704  -8.359  1.00 45.15 ? 33  LEU B HD12 1  
ATOM 4112   H HD13 . LEU B 1 33  ? 33.666  22.370  -7.962  1.00 45.42 ? 33  LEU B HD13 1  
ATOM 4113   H HD21 . LEU B 1 33  ? 33.127  21.390  -11.682 1.00 65.03 ? 33  LEU B HD21 1  
ATOM 4114   H HD22 . LEU B 1 33  ? 32.159  22.071  -10.377 1.00 32.11 ? 33  LEU B HD22 1  
ATOM 4115   H HD23 . LEU B 1 33  ? 32.866  20.467  -10.205 1.00 71.11 ? 33  LEU B HD23 1  
ATOM 4116   N N    . GLU B 1 34  ? 35.700  26.048  -11.690 1.00 74.32 ? 34  GLU B N    1  
ATOM 4117   C CA   . GLU B 1 34  ? 35.827  27.528  -11.806 1.00 51.22 ? 34  GLU B CA   1  
ATOM 4118   C C    . GLU B 1 34  ? 35.154  28.006  -13.095 1.00 32.12 ? 34  GLU B C    1  
ATOM 4119   O O    . GLU B 1 34  ? 34.342  28.909  -13.081 1.00 11.53 ? 34  GLU B O    1  
ATOM 4120   C CB   . GLU B 1 34  ? 37.306  27.916  -11.835 1.00 0.31  ? 34  GLU B CB   1  
ATOM 4121   C CG   . GLU B 1 34  ? 37.968  27.519  -10.514 1.00 71.45 ? 34  GLU B CG   1  
ATOM 4122   C CD   . GLU B 1 34  ? 37.388  28.362  -9.376  1.00 70.40 ? 34  GLU B CD   1  
ATOM 4123   O OE1  . GLU B 1 34  ? 36.775  29.375  -9.669  1.00 3.10  ? 34  GLU B OE1  1  
ATOM 4124   O OE2  . GLU B 1 34  ? 37.568  27.981  -8.231  1.00 24.34 ? 34  GLU B OE2  1  
ATOM 4125   H H    . GLU B 1 34  ? 36.496  25.498  -11.530 1.00 41.24 ? 34  GLU B H    1  
ATOM 4126   H HA   . GLU B 1 34  ? 35.349  27.997  -10.959 1.00 50.41 ? 34  GLU B HA   1  
ATOM 4127   H HB2  . GLU B 1 34  ? 37.795  27.404  -12.652 1.00 73.32 ? 34  GLU B HB2  1  
ATOM 4128   H HB3  . GLU B 1 34  ? 37.394  28.983  -11.974 1.00 41.14 ? 34  GLU B HB3  1  
ATOM 4129   H HG2  . GLU B 1 34  ? 37.782  26.473  -10.318 1.00 44.32 ? 34  GLU B HG2  1  
ATOM 4130   H HG3  . GLU B 1 34  ? 39.032  27.690  -10.579 1.00 60.24 ? 34  GLU B HG3  1  
ATOM 4131   N N    . ASP B 1 35  ? 35.483  27.412  -14.208 1.00 4.22  ? 35  ASP B N    1  
ATOM 4132   C CA   . ASP B 1 35  ? 34.857  27.843  -15.489 1.00 1.43  ? 35  ASP B CA   1  
ATOM 4133   C C    . ASP B 1 35  ? 33.353  27.571  -15.437 1.00 51.11 ? 35  ASP B C    1  
ATOM 4134   O O    . ASP B 1 35  ? 32.555  28.356  -15.906 1.00 43.13 ? 35  ASP B O    1  
ATOM 4135   C CB   . ASP B 1 35  ? 35.479  27.068  -16.653 1.00 35.04 ? 35  ASP B CB   1  
ATOM 4136   C CG   . ASP B 1 35  ? 36.879  27.616  -16.941 1.00 62.15 ? 35  ASP B CG   1  
ATOM 4137   O OD1  . ASP B 1 35  ? 37.597  27.880  -15.990 1.00 23.35 ? 35  ASP B OD1  1  
ATOM 4138   O OD2  . ASP B 1 35  ? 37.208  27.763  -18.106 1.00 73.03 ? 35  ASP B OD2  1  
ATOM 4139   H H    . ASP B 1 35  ? 36.141  26.685  -14.202 1.00 51.54 ? 35  ASP B H    1  
ATOM 4140   H HA   . ASP B 1 35  ? 35.024  28.901  -15.631 1.00 45.32 ? 35  ASP B HA   1  
ATOM 4141   H HB2  . ASP B 1 35  ? 35.547  26.022  -16.394 1.00 72.11 ? 35  ASP B HB2  1  
ATOM 4142   H HB3  . ASP B 1 35  ? 34.863  27.182  -17.533 1.00 13.32 ? 35  ASP B HB3  1  
ATOM 4143   N N    . GLY B 1 36  ? 32.958  26.466  -14.867 1.00 24.00 ? 36  GLY B N    1  
ATOM 4144   C CA   . GLY B 1 36  ? 31.505  26.149  -14.785 1.00 15.32 ? 36  GLY B CA   1  
ATOM 4145   C C    . GLY B 1 36  ? 30.826  27.108  -13.805 1.00 4.13  ? 36  GLY B C    1  
ATOM 4146   O O    . GLY B 1 36  ? 29.721  27.560  -14.030 1.00 30.21 ? 36  GLY B O    1  
ATOM 4147   H H    . GLY B 1 36  ? 33.617  25.845  -14.493 1.00 43.22 ? 36  GLY B H    1  
ATOM 4148   H HA2  . GLY B 1 36  ? 31.058  26.256  -15.764 1.00 22.44 ? 36  GLY B HA2  1  
ATOM 4149   H HA3  . GLY B 1 36  ? 31.376  25.136  -14.438 1.00 60.43 ? 36  GLY B HA3  1  
ATOM 4150   N N    . GLU B 1 37  ? 31.477  27.419  -12.717 1.00 74.11 ? 37  GLU B N    1  
ATOM 4151   C CA   . GLU B 1 37  ? 30.868  28.345  -11.720 1.00 54.43 ? 37  GLU B CA   1  
ATOM 4152   C C    . GLU B 1 37  ? 30.794  29.760  -12.301 1.00 34.23 ? 37  GLU B C    1  
ATOM 4153   O O    . GLU B 1 37  ? 29.844  30.482  -12.078 1.00 3.24  ? 37  GLU B O    1  
ATOM 4154   C CB   . GLU B 1 37  ? 31.724  28.360  -10.451 1.00 21.52 ? 37  GLU B CB   1  
ATOM 4155   C CG   . GLU B 1 37  ? 31.009  29.159  -9.359  1.00 31.20 ? 37  GLU B CG   1  
ATOM 4156   C CD   . GLU B 1 37  ? 31.903  29.246  -8.121  1.00 5.55  ? 37  GLU B CD   1  
ATOM 4157   O OE1  . GLU B 1 37  ? 33.002  28.718  -8.170  1.00 31.41 ? 37  GLU B OE1  1  
ATOM 4158   O OE2  . GLU B 1 37  ? 31.474  29.840  -7.146  1.00 74.42 ? 37  GLU B OE2  1  
ATOM 4159   H H    . GLU B 1 37  ? 32.366  27.041  -12.555 1.00 33.53 ? 37  GLU B H    1  
ATOM 4160   H HA   . GLU B 1 37  ? 29.872  28.005  -11.476 1.00 21.04 ? 37  GLU B HA   1  
ATOM 4161   H HB2  . GLU B 1 37  ? 31.882  27.347  -10.112 1.00 4.42  ? 37  GLU B HB2  1  
ATOM 4162   H HB3  . GLU B 1 37  ? 32.677  28.821  -10.665 1.00 73.03 ? 37  GLU B HB3  1  
ATOM 4163   H HG2  . GLU B 1 37  ? 30.797  30.155  -9.722  1.00 74.43 ? 37  GLU B HG2  1  
ATOM 4164   H HG3  . GLU B 1 37  ? 30.085  28.666  -9.099  1.00 61.14 ? 37  GLU B HG3  1  
ATOM 4165   N N    . TYR B 1 38  ? 31.792  30.167  -13.037 1.00 70.35 ? 38  TYR B N    1  
ATOM 4166   C CA   . TYR B 1 38  ? 31.774  31.539  -13.621 1.00 22.53 ? 38  TYR B CA   1  
ATOM 4167   C C    . TYR B 1 38  ? 30.908  31.557  -14.885 1.00 53.35 ? 38  TYR B C    1  
ATOM 4168   O O    . TYR B 1 38  ? 30.196  32.506  -15.147 1.00 73.34 ? 38  TYR B O    1  
ATOM 4169   C CB   . TYR B 1 38  ? 33.203  31.957  -13.978 1.00 32.14 ? 38  TYR B CB   1  
ATOM 4170   C CG   . TYR B 1 38  ? 33.208  33.396  -14.432 1.00 52.33 ? 38  TYR B CG   1  
ATOM 4171   C CD1  . TYR B 1 38  ? 33.251  34.428  -13.487 1.00 11.31 ? 38  TYR B CD1  1  
ATOM 4172   C CD2  . TYR B 1 38  ? 33.171  33.700  -15.798 1.00 34.41 ? 38  TYR B CD2  1  
ATOM 4173   C CE1  . TYR B 1 38  ? 33.257  35.763  -13.907 1.00 74.42 ? 38  TYR B CE1  1  
ATOM 4174   C CE2  . TYR B 1 38  ? 33.177  35.035  -16.219 1.00 64.52 ? 38  TYR B CE2  1  
ATOM 4175   C CZ   . TYR B 1 38  ? 33.220  36.067  -15.273 1.00 20.35 ? 38  TYR B CZ   1  
ATOM 4176   O OH   . TYR B 1 38  ? 33.225  37.383  -15.688 1.00 20.42 ? 38  TYR B OH   1  
ATOM 4177   H H    . TYR B 1 38  ? 32.556  29.574  -13.200 1.00 41.45 ? 38  TYR B H    1  
ATOM 4178   H HA   . TYR B 1 38  ? 31.369  32.233  -12.899 1.00 72.32 ? 38  TYR B HA   1  
ATOM 4179   H HB2  . TYR B 1 38  ? 33.836  31.850  -13.110 1.00 43.22 ? 38  TYR B HB2  1  
ATOM 4180   H HB3  . TYR B 1 38  ? 33.573  31.328  -14.774 1.00 31.31 ? 38  TYR B HB3  1  
ATOM 4181   H HD1  . TYR B 1 38  ? 33.280  34.194  -12.433 1.00 24.44 ? 38  TYR B HD1  1  
ATOM 4182   H HD2  . TYR B 1 38  ? 33.138  32.904  -16.528 1.00 52.13 ? 38  TYR B HD2  1  
ATOM 4183   H HE1  . TYR B 1 38  ? 33.290  36.559  -13.178 1.00 12.03 ? 38  TYR B HE1  1  
ATOM 4184   H HE2  . TYR B 1 38  ? 33.148  35.270  -17.273 1.00 65.45 ? 38  TYR B HE2  1  
ATOM 4185   H HH   . TYR B 1 38  ? 33.268  37.940  -14.907 1.00 21.13 ? 38  TYR B HH   1  
ATOM 4186   N N    . LEU B 1 39  ? 30.974  30.522  -15.677 1.00 40.24 ? 39  LEU B N    1  
ATOM 4187   C CA   . LEU B 1 39  ? 30.166  30.485  -16.931 1.00 64.22 ? 39  LEU B CA   1  
ATOM 4188   C C    . LEU B 1 39  ? 28.676  30.355  -16.595 1.00 45.12 ? 39  LEU B C    1  
ATOM 4189   O O    . LEU B 1 39  ? 27.841  31.011  -17.184 1.00 20.33 ? 39  LEU B O    1  
ATOM 4190   C CB   . LEU B 1 39  ? 30.608  29.283  -17.778 1.00 75.41 ? 39  LEU B CB   1  
ATOM 4191   C CG   . LEU B 1 39  ? 29.956  29.339  -19.177 1.00 74.22 ? 39  LEU B CG   1  
ATOM 4192   C CD1  . LEU B 1 39  ? 30.761  30.258  -20.105 1.00 73.23 ? 39  LEU B CD1  1  
ATOM 4193   C CD2  . LEU B 1 39  ? 29.921  27.931  -19.783 1.00 21.25 ? 39  LEU B CD2  1  
ATOM 4194   H H    . LEU B 1 39  ? 31.562  29.772  -15.452 1.00 62.32 ? 39  LEU B H    1  
ATOM 4195   H HA   . LEU B 1 39  ? 30.329  31.395  -17.485 1.00 60.34 ? 39  LEU B HA   1  
ATOM 4196   H HB2  . LEU B 1 39  ? 31.684  29.295  -17.879 1.00 43.12 ? 39  LEU B HB2  1  
ATOM 4197   H HB3  . LEU B 1 39  ? 30.309  28.372  -17.279 1.00 32.24 ? 39  LEU B HB3  1  
ATOM 4198   H HG   . LEU B 1 39  ? 28.947  29.715  -19.092 1.00 42.35 ? 39  LEU B HG   1  
ATOM 4199   H HD11 . LEU B 1 39  ? 30.680  31.279  -19.767 1.00 64.30 ? 39  LEU B HD11 1  
ATOM 4200   H HD12 . LEU B 1 39  ? 30.370  30.183  -21.109 1.00 11.55 ? 39  LEU B HD12 1  
ATOM 4201   H HD13 . LEU B 1 39  ? 31.799  29.958  -20.102 1.00 54.42 ? 39  LEU B HD13 1  
ATOM 4202   H HD21 . LEU B 1 39  ? 29.245  27.311  -19.214 1.00 51.15 ? 39  LEU B HD21 1  
ATOM 4203   H HD22 . LEU B 1 39  ? 30.912  27.503  -19.754 1.00 34.54 ? 39  LEU B HD22 1  
ATOM 4204   H HD23 . LEU B 1 39  ? 29.583  27.989  -20.807 1.00 1.33  ? 39  LEU B HD23 1  
ATOM 4205   N N    . MET B 1 40  ? 28.332  29.509  -15.664 1.00 53.40 ? 40  MET B N    1  
ATOM 4206   C CA   . MET B 1 40  ? 26.893  29.339  -15.311 1.00 34.22 ? 40  MET B CA   1  
ATOM 4207   C C    . MET B 1 40  ? 26.357  30.624  -14.673 1.00 24.14 ? 40  MET B C    1  
ATOM 4208   O O    . MET B 1 40  ? 25.172  30.891  -14.697 1.00 31.14 ? 40  MET B O    1  
ATOM 4209   C CB   . MET B 1 40  ? 26.738  28.170  -14.329 1.00 23.32 ? 40  MET B CB   1  
ATOM 4210   C CG   . MET B 1 40  ? 27.355  28.531  -12.971 1.00 43.32 ? 40  MET B CG   1  
ATOM 4211   S SD   . MET B 1 40  ? 26.144  29.441  -11.978 1.00 60.41 ? 40  MET B SD   1  
ATOM 4212   C CE   . MET B 1 40  ? 25.434  28.017  -11.116 1.00 43.22 ? 40  MET B CE   1  
ATOM 4213   H H    . MET B 1 40  ? 29.017  28.980  -15.203 1.00 22.25 ? 40  MET B H    1  
ATOM 4214   H HA   . MET B 1 40  ? 26.331  29.126  -16.208 1.00 33.43 ? 40  MET B HA   1  
ATOM 4215   H HB2  . MET B 1 40  ? 25.688  27.950  -14.198 1.00 44.14 ? 40  MET B HB2  1  
ATOM 4216   H HB3  . MET B 1 40  ? 27.238  27.300  -14.729 1.00 52.23 ? 40  MET B HB3  1  
ATOM 4217   H HG2  . MET B 1 40  ? 27.636  27.626  -12.452 1.00 13.25 ? 40  MET B HG2  1  
ATOM 4218   H HG3  . MET B 1 40  ? 28.232  29.143  -13.120 1.00 34.51 ? 40  MET B HG3  1  
ATOM 4219   H HE1  . MET B 1 40  ? 24.529  28.320  -10.608 1.00 25.32 ? 40  MET B HE1  1  
ATOM 4220   H HE2  . MET B 1 40  ? 26.141  27.643  -10.394 1.00 61.44 ? 40  MET B HE2  1  
ATOM 4221   H HE3  . MET B 1 40  ? 25.208  27.240  -11.833 1.00 31.10 ? 40  MET B HE3  1  
ATOM 4222   N N    . ASP B 1 41  ? 27.215  31.418  -14.095 1.00 1.30  ? 41  ASP B N    1  
ATOM 4223   C CA   . ASP B 1 41  ? 26.747  32.678  -13.451 1.00 30.34 ? 41  ASP B CA   1  
ATOM 4224   C C    . ASP B 1 41  ? 26.094  33.591  -14.493 1.00 34.13 ? 41  ASP B C    1  
ATOM 4225   O O    . ASP B 1 41  ? 25.087  34.220  -14.233 1.00 34.33 ? 41  ASP B O    1  
ATOM 4226   C CB   . ASP B 1 41  ? 27.939  33.401  -12.822 1.00 43.40 ? 41  ASP B CB   1  
ATOM 4227   C CG   . ASP B 1 41  ? 28.417  32.626  -11.593 1.00 53.23 ? 41  ASP B CG   1  
ATOM 4228   O OD1  . ASP B 1 41  ? 27.722  31.707  -11.190 1.00 51.54 ? 41  ASP B OD1  1  
ATOM 4229   O OD2  . ASP B 1 41  ? 29.469  32.964  -11.075 1.00 45.43 ? 41  ASP B OD2  1  
ATOM 4230   H H    . ASP B 1 41  ? 28.166  31.183  -14.080 1.00 23.24 ? 41  ASP B H    1  
ATOM 4231   H HA   . ASP B 1 41  ? 26.027  32.441  -12.682 1.00 74.32 ? 41  ASP B HA   1  
ATOM 4232   H HB2  . ASP B 1 41  ? 28.742  33.466  -13.542 1.00 41.31 ? 41  ASP B HB2  1  
ATOM 4233   H HB3  . ASP B 1 41  ? 27.642  34.396  -12.524 1.00 11.32 ? 41  ASP B HB3  1  
ATOM 4234   N N    . ILE B 1 42  ? 26.661  33.681  -15.666 1.00 21.30 ? 42  ILE B N    1  
ATOM 4235   C CA   . ILE B 1 42  ? 26.072  34.567  -16.713 1.00 62.44 ? 42  ILE B CA   1  
ATOM 4236   C C    . ILE B 1 42  ? 24.908  33.858  -17.414 1.00 44.23 ? 42  ILE B C    1  
ATOM 4237   O O    . ILE B 1 42  ? 23.973  34.491  -17.862 1.00 14.10 ? 42  ILE B O    1  
ATOM 4238   C CB   . ILE B 1 42  ? 27.146  34.924  -17.742 1.00 71.23 ? 42  ILE B CB   1  
ATOM 4239   C CG1  . ILE B 1 42  ? 27.868  33.652  -18.193 1.00 30.12 ? 42  ILE B CG1  1  
ATOM 4240   C CG2  . ILE B 1 42  ? 28.156  35.884  -17.113 1.00 43.40 ? 42  ILE B CG2  1  
ATOM 4241   C CD1  . ILE B 1 42  ? 28.769  33.970  -19.388 1.00 44.21 ? 42  ILE B CD1  1  
ATOM 4242   H H    . ILE B 1 42  ? 27.477  33.173  -15.856 1.00 63.31 ? 42  ILE B H    1  
ATOM 4243   H HA   . ILE B 1 42  ? 25.709  35.473  -16.251 1.00 40.22 ? 42  ILE B HA   1  
ATOM 4244   H HB   . ILE B 1 42  ? 26.682  35.399  -18.595 1.00 15.01 ? 42  ILE B HB   1  
ATOM 4245   H HG12 . ILE B 1 42  ? 28.470  33.274  -17.379 1.00 55.03 ? 42  ILE B HG12 1  
ATOM 4246   H HG13 . ILE B 1 42  ? 27.142  32.907  -18.480 1.00 3.43  ? 42  ILE B HG13 1  
ATOM 4247   H HG21 . ILE B 1 42  ? 28.575  35.435  -16.225 1.00 60.20 ? 42  ILE B HG21 1  
ATOM 4248   H HG22 . ILE B 1 42  ? 27.660  36.807  -16.850 1.00 35.42 ? 42  ILE B HG22 1  
ATOM 4249   H HG23 . ILE B 1 42  ? 28.947  36.089  -17.820 1.00 14.33 ? 42  ILE B HG23 1  
ATOM 4250   H HD11 . ILE B 1 42  ? 29.598  34.581  -19.061 1.00 25.42 ? 42  ILE B HD11 1  
ATOM 4251   H HD12 . ILE B 1 42  ? 28.201  34.505  -20.136 1.00 14.33 ? 42  ILE B HD12 1  
ATOM 4252   H HD13 . ILE B 1 42  ? 29.144  33.050  -19.811 1.00 0.44  ? 42  ILE B HD13 1  
ATOM 4253   N N    . ARG B 1 43  ? 24.960  32.551  -17.516 1.00 60.02 ? 43  ARG B N    1  
ATOM 4254   C CA   . ARG B 1 43  ? 23.858  31.791  -18.195 1.00 24.22 ? 43  ARG B CA   1  
ATOM 4255   C C    . ARG B 1 43  ? 23.398  30.641  -17.297 1.00 72.22 ? 43  ARG B C    1  
ATOM 4256   O O    . ARG B 1 43  ? 24.192  29.990  -16.650 1.00 15.01 ? 43  ARG B O    1  
ATOM 4257   C CB   . ARG B 1 43  ? 24.376  31.222  -19.518 1.00 62.21 ? 43  ARG B CB   1  
ATOM 4258   C CG   . ARG B 1 43  ? 24.654  32.367  -20.494 1.00 51.45 ? 43  ARG B CG   1  
ATOM 4259   C CD   . ARG B 1 43  ? 25.048  31.792  -21.855 1.00 62.01 ? 43  ARG B CD   1  
ATOM 4260   N NE   . ARG B 1 43  ? 25.487  32.898  -22.754 1.00 31.43 ? 43  ARG B NE   1  
ATOM 4261   C CZ   . ARG B 1 43  ? 26.702  33.367  -22.668 1.00 22.21 ? 43  ARG B CZ   1  
ATOM 4262   N NH1  . ARG B 1 43  ? 27.533  32.871  -21.793 1.00 52.24 ? 43  ARG B NH1  1  
ATOM 4263   N NH2  . ARG B 1 43  ? 27.086  34.333  -23.457 1.00 40.00 ? 43  ARG B NH2  1  
ATOM 4264   H H    . ARG B 1 43  ? 25.729  32.066  -17.149 1.00 52.13 ? 43  ARG B H    1  
ATOM 4265   H HA   . ARG B 1 43  ? 23.018  32.444  -18.391 1.00 60.14 ? 43  ARG B HA   1  
ATOM 4266   H HB2  . ARG B 1 43  ? 25.288  30.670  -19.339 1.00 55.32 ? 43  ARG B HB2  1  
ATOM 4267   H HB3  . ARG B 1 43  ? 23.633  30.564  -19.942 1.00 14.21 ? 43  ARG B HB3  1  
ATOM 4268   H HG2  . ARG B 1 43  ? 23.766  32.973  -20.601 1.00 73.41 ? 43  ARG B HG2  1  
ATOM 4269   H HG3  . ARG B 1 43  ? 25.462  32.976  -20.115 1.00 52.23 ? 43  ARG B HG3  1  
ATOM 4270   H HD2  . ARG B 1 43  ? 25.856  31.087  -21.729 1.00 53.35 ? 43  ARG B HD2  1  
ATOM 4271   H HD3  . ARG B 1 43  ? 24.198  31.290  -22.293 1.00 25.52 ? 43  ARG B HD3  1  
ATOM 4272   H HE   . ARG B 1 43  ? 24.864  33.272  -23.411 1.00 24.21 ? 43  ARG B HE   1  
ATOM 4273   H HH11 . ARG B 1 43  ? 27.239  32.131  -21.188 1.00 12.22 ? 43  ARG B HH11 1  
ATOM 4274   H HH12 . ARG B 1 43  ? 28.464  33.230  -21.727 1.00 62.01 ? 43  ARG B HH12 1  
ATOM 4275   H HH21 . ARG B 1 43  ? 26.449  34.714  -24.128 1.00 42.30 ? 43  ARG B HH21 1  
ATOM 4276   H HH22 . ARG B 1 43  ? 28.017  34.693  -23.392 1.00 62.03 ? 43  ARG B HH22 1  
ATOM 4277   N N    . ASN B 1 44  ? 22.117  30.382  -17.259 1.00 52.43 ? 44  ASN B N    1  
ATOM 4278   C CA   . ASN B 1 44  ? 21.593  29.270  -16.410 1.00 44.15 ? 44  ASN B CA   1  
ATOM 4279   C C    . ASN B 1 44  ? 21.399  28.023  -17.274 1.00 43.22 ? 44  ASN B C    1  
ATOM 4280   O O    . ASN B 1 44  ? 21.081  28.115  -18.444 1.00 23.32 ? 44  ASN B O    1  
ATOM 4281   C CB   . ASN B 1 44  ? 20.248  29.684  -15.808 1.00 63.54 ? 44  ASN B CB   1  
ATOM 4282   C CG   . ASN B 1 44  ? 20.450  30.889  -14.887 1.00 30.03 ? 44  ASN B CG   1  
ATOM 4283   O OD1  . ASN B 1 44  ? 21.535  31.112  -14.389 1.00 63.11 ? 44  ASN B OD1  1  
ATOM 4284   N ND2  . ASN B 1 44  ? 19.443  31.682  -14.640 1.00 0.32  ? 44  ASN B ND2  1  
ATOM 4285   H H    . ASN B 1 44  ? 21.496  30.920  -17.795 1.00 25.44 ? 44  ASN B H    1  
ATOM 4286   H HA   . ASN B 1 44  ? 22.291  29.052  -15.613 1.00 24.25 ? 44  ASN B HA   1  
ATOM 4287   H HB2  . ASN B 1 44  ? 19.565  29.948  -16.603 1.00 30.12 ? 44  ASN B HB2  1  
ATOM 4288   H HB3  . ASN B 1 44  ? 19.840  28.863  -15.239 1.00 44.24 ? 44  ASN B HB3  1  
ATOM 4289   H HD21 . ASN B 1 44  ? 18.568  31.503  -15.043 1.00 45.42 ? 44  ASN B HD21 1  
ATOM 4290   H HD22 . ASN B 1 44  ? 19.562  32.456  -14.051 1.00 5.12  ? 44  ASN B HD22 1  
ATOM 4291   N N    . TYR B 1 45  ? 21.590  26.857  -16.705 1.00 53.24 ? 45  TYR B N    1  
ATOM 4292   C CA   . TYR B 1 45  ? 21.422  25.584  -17.479 1.00 40.31 ? 45  TYR B CA   1  
ATOM 4293   C C    . TYR B 1 45  ? 20.394  24.694  -16.776 1.00 62.24 ? 45  TYR B C    1  
ATOM 4294   O O    . TYR B 1 45  ? 20.297  24.679  -15.566 1.00 2.12  ? 45  TYR B O    1  
ATOM 4295   C CB   . TYR B 1 45  ? 22.765  24.853  -17.544 1.00 33.10 ? 45  TYR B CB   1  
ATOM 4296   C CG   . TYR B 1 45  ? 23.725  25.642  -18.405 1.00 25.01 ? 45  TYR B CG   1  
ATOM 4297   C CD1  . TYR B 1 45  ? 24.279  26.833  -17.922 1.00 64.35 ? 45  TYR B CD1  1  
ATOM 4298   C CD2  . TYR B 1 45  ? 24.060  25.184  -19.687 1.00 62.40 ? 45  TYR B CD2  1  
ATOM 4299   C CE1  . TYR B 1 45  ? 25.167  27.567  -18.718 1.00 31.30 ? 45  TYR B CE1  1  
ATOM 4300   C CE2  . TYR B 1 45  ? 24.948  25.918  -20.482 1.00 13.11 ? 45  TYR B CE2  1  
ATOM 4301   C CZ   . TYR B 1 45  ? 25.502  27.109  -19.998 1.00 14.11 ? 45  TYR B CZ   1  
ATOM 4302   O OH   . TYR B 1 45  ? 26.377  27.832  -20.783 1.00 5.54  ? 45  TYR B OH   1  
ATOM 4303   H H    . TYR B 1 45  ? 21.846  26.817  -15.760 1.00 64.32 ? 45  TYR B H    1  
ATOM 4304   H HA   . TYR B 1 45  ? 21.081  25.796  -18.483 1.00 34.12 ? 45  TYR B HA   1  
ATOM 4305   H HB2  . TYR B 1 45  ? 23.171  24.758  -16.546 1.00 73.11 ? 45  TYR B HB2  1  
ATOM 4306   H HB3  . TYR B 1 45  ? 22.621  23.871  -17.969 1.00 11.53 ? 45  TYR B HB3  1  
ATOM 4307   H HD1  . TYR B 1 45  ? 24.022  27.187  -16.935 1.00 0.45  ? 45  TYR B HD1  1  
ATOM 4308   H HD2  . TYR B 1 45  ? 23.633  24.265  -20.060 1.00 32.13 ? 45  TYR B HD2  1  
ATOM 4309   H HE1  . TYR B 1 45  ? 25.595  28.486  -18.345 1.00 21.40 ? 45  TYR B HE1  1  
ATOM 4310   H HE2  . TYR B 1 45  ? 25.206  25.564  -21.470 1.00 24.13 ? 45  TYR B HE2  1  
ATOM 4311   H HH   . TYR B 1 45  ? 26.154  28.762  -20.697 1.00 51.33 ? 45  TYR B HH   1  
ATOM 4312   N N    . ASP B 1 46  ? 19.625  23.952  -17.526 1.00 35.42 ? 46  ASP B N    1  
ATOM 4313   C CA   . ASP B 1 46  ? 18.605  23.064  -16.897 1.00 14.21 ? 46  ASP B CA   1  
ATOM 4314   C C    . ASP B 1 46  ? 19.285  21.793  -16.387 1.00 55.24 ? 46  ASP B C    1  
ATOM 4315   O O    . ASP B 1 46  ? 19.003  21.316  -15.302 1.00 12.24 ? 46  ASP B O    1  
ATOM 4316   C CB   . ASP B 1 46  ? 17.543  22.693  -17.936 1.00 54.02 ? 46  ASP B CB   1  
ATOM 4317   C CG   . ASP B 1 46  ? 16.343  22.055  -17.235 1.00 31.33 ? 46  ASP B CG   1  
ATOM 4318   O OD1  . ASP B 1 46  ? 16.371  21.967  -16.018 1.00 34.12 ? 46  ASP B OD1  1  
ATOM 4319   O OD2  . ASP B 1 46  ? 15.416  21.666  -17.926 1.00 62.22 ? 46  ASP B OD2  1  
ATOM 4320   H H    . ASP B 1 46  ? 19.719  23.977  -18.502 1.00 11.13 ? 46  ASP B H    1  
ATOM 4321   H HA   . ASP B 1 46  ? 18.137  23.580  -16.072 1.00 54.11 ? 46  ASP B HA   1  
ATOM 4322   H HB2  . ASP B 1 46  ? 17.225  23.584  -18.458 1.00 42.42 ? 46  ASP B HB2  1  
ATOM 4323   H HB3  . ASP B 1 46  ? 17.960  21.991  -18.642 1.00 1.43  ? 46  ASP B HB3  1  
ATOM 4324   N N    . LEU B 1 47  ? 20.185  21.243  -17.166 1.00 64.41 ? 47  LEU B N    1  
ATOM 4325   C CA   . LEU B 1 47  ? 20.903  19.999  -16.748 1.00 73.12 ? 47  LEU B CA   1  
ATOM 4326   C C    . LEU B 1 47  ? 22.320  20.369  -16.312 1.00 24.15 ? 47  LEU B C    1  
ATOM 4327   O O    . LEU B 1 47  ? 23.126  20.819  -17.103 1.00 2.54  ? 47  LEU B O    1  
ATOM 4328   C CB   . LEU B 1 47  ? 20.958  19.028  -17.942 1.00 33.04 ? 47  LEU B CB   1  
ATOM 4329   C CG   . LEU B 1 47  ? 21.196  17.577  -17.476 1.00 43.53 ? 47  LEU B CG   1  
ATOM 4330   C CD1  . LEU B 1 47  ? 22.473  17.493  -16.633 1.00 33.33 ? 47  LEU B CD1  1  
ATOM 4331   C CD2  . LEU B 1 47  ? 19.992  17.063  -16.658 1.00 62.34 ? 47  LEU B CD2  1  
ATOM 4332   H H    . LEU B 1 47  ? 20.391  21.653  -18.033 1.00 21.31 ? 47  LEU B H    1  
ATOM 4333   H HA   . LEU B 1 47  ? 20.390  19.532  -15.926 1.00 41.45 ? 47  LEU B HA   1  
ATOM 4334   H HB2  . LEU B 1 47  ? 20.024  19.078  -18.481 1.00 51.42 ? 47  LEU B HB2  1  
ATOM 4335   H HB3  . LEU B 1 47  ? 21.758  19.319  -18.601 1.00 41.24 ? 47  LEU B HB3  1  
ATOM 4336   H HG   . LEU B 1 47  ? 21.321  16.952  -18.349 1.00 33.32 ? 47  LEU B HG   1  
ATOM 4337   H HD11 . LEU B 1 47  ? 23.251  18.084  -17.093 1.00 54.23 ? 47  LEU B HD11 1  
ATOM 4338   H HD12 . LEU B 1 47  ? 22.794  16.463  -16.574 1.00 3.35  ? 47  LEU B HD12 1  
ATOM 4339   H HD13 . LEU B 1 47  ? 22.276  17.862  -15.638 1.00 41.23 ? 47  LEU B HD13 1  
ATOM 4340   H HD21 . LEU B 1 47  ? 19.889  15.998  -16.811 1.00 25.13 ? 47  LEU B HD21 1  
ATOM 4341   H HD22 . LEU B 1 47  ? 19.086  17.555  -16.983 1.00 32.11 ? 47  LEU B HD22 1  
ATOM 4342   H HD23 . LEU B 1 47  ? 20.147  17.257  -15.606 1.00 33.41 ? 47  LEU B HD23 1  
ATOM 4343   N N    . VAL B 1 48  ? 22.635  20.166  -15.059 1.00 65.11 ? 48  VAL B N    1  
ATOM 4344   C CA   . VAL B 1 48  ? 24.006  20.486  -14.564 1.00 42.20 ? 48  VAL B CA   1  
ATOM 4345   C C    . VAL B 1 48  ? 24.800  19.188  -14.508 1.00 61.43 ? 48  VAL B C    1  
ATOM 4346   O O    . VAL B 1 48  ? 24.690  18.427  -13.568 1.00 42.23 ? 48  VAL B O    1  
ATOM 4347   C CB   . VAL B 1 48  ? 23.912  21.102  -13.166 1.00 21.03 ? 48  VAL B CB   1  
ATOM 4348   C CG1  . VAL B 1 48  ? 25.316  21.247  -12.572 1.00 61.03 ? 48  VAL B CG1  1  
ATOM 4349   C CG2  . VAL B 1 48  ? 23.256  22.481  -13.267 1.00 23.24 ? 48  VAL B CG2  1  
ATOM 4350   H H    . VAL B 1 48  ? 21.971  19.786  -14.446 1.00 12.14 ? 48  VAL B H    1  
ATOM 4351   H HA   . VAL B 1 48  ? 24.492  21.178  -15.230 1.00 10.35 ? 48  VAL B HA   1  
ATOM 4352   H HB   . VAL B 1 48  ? 23.317  20.465  -12.530 1.00 42.31 ? 48  VAL B HB   1  
ATOM 4353   H HG11 . VAL B 1 48  ? 25.273  21.881  -11.698 1.00 1.23  ? 48  VAL B HG11 1  
ATOM 4354   H HG12 . VAL B 1 48  ? 25.973  21.690  -13.306 1.00 15.15 ? 48  VAL B HG12 1  
ATOM 4355   H HG13 . VAL B 1 48  ? 25.691  20.274  -12.293 1.00 51.12 ? 48  VAL B HG13 1  
ATOM 4356   H HG21 . VAL B 1 48  ? 22.395  22.423  -13.918 1.00 63.14 ? 48  VAL B HG21 1  
ATOM 4357   H HG22 . VAL B 1 48  ? 23.964  23.190  -13.671 1.00 74.11 ? 48  VAL B HG22 1  
ATOM 4358   H HG23 . VAL B 1 48  ? 22.943  22.804  -12.286 1.00 10.34 ? 48  VAL B HG23 1  
ATOM 4359   N N    . MET B 1 49  ? 25.584  18.918  -15.524 1.00 55.21 ? 49  MET B N    1  
ATOM 4360   C CA   . MET B 1 49  ? 26.374  17.649  -15.556 1.00 41.15 ? 49  MET B CA   1  
ATOM 4361   C C    . MET B 1 49  ? 27.865  17.940  -15.387 1.00 13.35 ? 49  MET B C    1  
ATOM 4362   O O    . MET B 1 49  ? 28.416  18.824  -16.012 1.00 73.44 ? 49  MET B O    1  
ATOM 4363   C CB   . MET B 1 49  ? 26.124  16.936  -16.890 1.00 11.23 ? 49  MET B CB   1  
ATOM 4364   C CG   . MET B 1 49  ? 27.097  15.762  -17.048 1.00 21.12 ? 49  MET B CG   1  
ATOM 4365   S SD   . MET B 1 49  ? 26.505  14.653  -18.350 1.00 65.10 ? 49  MET B SD   1  
ATOM 4366   C CE   . MET B 1 49  ? 27.807  13.405  -18.196 1.00 15.33 ? 49  MET B CE   1  
ATOM 4367   H H    . MET B 1 49  ? 25.639  19.544  -16.276 1.00 2.13  ? 49  MET B H    1  
ATOM 4368   H HA   . MET B 1 49  ? 26.060  17.010  -14.756 1.00 73.10 ? 49  MET B HA   1  
ATOM 4369   H HB2  . MET B 1 49  ? 25.110  16.567  -16.913 1.00 73.04 ? 49  MET B HB2  1  
ATOM 4370   H HB3  . MET B 1 49  ? 26.264  17.629  -17.698 1.00 44.14 ? 49  MET B HB3  1  
ATOM 4371   H HG2  . MET B 1 49  ? 28.073  16.139  -17.313 1.00 61.33 ? 49  MET B HG2  1  
ATOM 4372   H HG3  . MET B 1 49  ? 27.161  15.221  -16.115 1.00 3.42  ? 49  MET B HG3  1  
ATOM 4373   H HE1  . MET B 1 49  ? 28.617  13.646  -18.870 1.00 41.33 ? 49  MET B HE1  1  
ATOM 4374   H HE2  . MET B 1 49  ? 27.410  12.435  -18.447 1.00 65.50 ? 49  MET B HE2  1  
ATOM 4375   H HE3  . MET B 1 49  ? 28.172  13.389  -17.178 1.00 25.12 ? 49  MET B HE3  1  
ATOM 4376   N N    . VAL B 1 50  ? 28.520  17.185  -14.541 1.00 1.40  ? 50  VAL B N    1  
ATOM 4377   C CA   . VAL B 1 50  ? 29.981  17.391  -14.314 1.00 24.51 ? 50  VAL B CA   1  
ATOM 4378   C C    . VAL B 1 50  ? 30.645  16.040  -14.015 1.00 34.50 ? 50  VAL B C    1  
ATOM 4379   O O    . VAL B 1 50  ? 30.167  15.259  -13.212 1.00 0.13  ? 50  VAL B O    1  
ATOM 4380   C CB   . VAL B 1 50  ? 30.174  18.365  -13.139 1.00 5.52  ? 50  VAL B CB   1  
ATOM 4381   C CG1  . VAL B 1 50  ? 29.148  18.054  -12.047 1.00 23.02 ? 50  VAL B CG1  1  
ATOM 4382   C CG2  . VAL B 1 50  ? 31.594  18.242  -12.557 1.00 31.31 ? 50  VAL B CG2  1  
ATOM 4383   H H    . VAL B 1 50  ? 28.045  16.475  -14.055 1.00 64.12 ? 50  VAL B H    1  
ATOM 4384   H HA   . VAL B 1 50  ? 30.427  17.810  -15.204 1.00 64.34 ? 50  VAL B HA   1  
ATOM 4385   H HB   . VAL B 1 50  ? 30.019  19.376  -13.493 1.00 12.33 ? 50  VAL B HB   1  
ATOM 4386   H HG11 . VAL B 1 50  ? 29.424  18.568  -11.137 1.00 52.31 ? 50  VAL B HG11 1  
ATOM 4387   H HG12 . VAL B 1 50  ? 29.125  16.990  -11.866 1.00 73.40 ? 50  VAL B HG12 1  
ATOM 4388   H HG13 . VAL B 1 50  ? 28.171  18.387  -12.366 1.00 35.54 ? 50  VAL B HG13 1  
ATOM 4389   H HG21 . VAL B 1 50  ? 31.839  19.143  -12.014 1.00 70.13 ? 50  VAL B HG21 1  
ATOM 4390   H HG22 . VAL B 1 50  ? 32.303  18.102  -13.358 1.00 54.24 ? 50  VAL B HG22 1  
ATOM 4391   H HG23 . VAL B 1 50  ? 31.641  17.396  -11.888 1.00 4.12  ? 50  VAL B HG23 1  
ATOM 4392   N N    . SER B 1 51  ? 31.749  15.764  -14.663 1.00 53.01 ? 51  SER B N    1  
ATOM 4393   C CA   . SER B 1 51  ? 32.466  14.469  -14.433 1.00 34.22 ? 51  SER B CA   1  
ATOM 4394   C C    . SER B 1 51  ? 33.679  14.701  -13.526 1.00 30.34 ? 51  SER B C    1  
ATOM 4395   O O    . SER B 1 51  ? 34.532  13.847  -13.387 1.00 23.24 ? 51  SER B O    1  
ATOM 4396   C CB   . SER B 1 51  ? 32.942  13.912  -15.774 1.00 41.34 ? 51  SER B CB   1  
ATOM 4397   O OG   . SER B 1 51  ? 34.152  14.559  -16.144 1.00 73.21 ? 51  SER B OG   1  
ATOM 4398   H H    . SER B 1 51  ? 32.108  16.414  -15.308 1.00 12.15 ? 51  SER B H    1  
ATOM 4399   H HA   . SER B 1 51  ? 31.802  13.755  -13.966 1.00 31.15 ? 51  SER B HA   1  
ATOM 4400   H HB2  . SER B 1 51  ? 33.119  12.853  -15.686 1.00 34.42 ? 51  SER B HB2  1  
ATOM 4401   H HB3  . SER B 1 51  ? 32.183  14.087  -16.526 1.00 11.22 ? 51  SER B HB3  1  
ATOM 4402   H HG   . SER B 1 51  ? 34.036  15.503  -16.011 1.00 13.34 ? 51  SER B HG   1  
ATOM 4403   N N    . ASP B 1 52  ? 33.767  15.850  -12.912 1.00 42.34 ? 52  ASP B N    1  
ATOM 4404   C CA   . ASP B 1 52  ? 34.929  16.133  -12.020 1.00 24.15 ? 52  ASP B CA   1  
ATOM 4405   C C    . ASP B 1 52  ? 34.739  15.410  -10.684 1.00 33.13 ? 52  ASP B C    1  
ATOM 4406   O O    . ASP B 1 52  ? 33.640  15.297  -10.179 1.00 70.41 ? 52  ASP B O    1  
ATOM 4407   C CB   . ASP B 1 52  ? 35.031  17.641  -11.777 1.00 34.35 ? 52  ASP B CB   1  
ATOM 4408   C CG   . ASP B 1 52  ? 35.381  18.346  -13.089 1.00 54.02 ? 52  ASP B CG   1  
ATOM 4409   O OD1  . ASP B 1 52  ? 35.523  17.661  -14.088 1.00 24.24 ? 52  ASP B OD1  1  
ATOM 4410   O OD2  . ASP B 1 52  ? 35.500  19.560  -13.071 1.00 22.55 ? 52  ASP B OD2  1  
ATOM 4411   H H    . ASP B 1 52  ? 33.071  16.526  -13.039 1.00 14.11 ? 52  ASP B H    1  
ATOM 4412   H HA   . ASP B 1 52  ? 35.836  15.783  -12.491 1.00 52.12 ? 52  ASP B HA   1  
ATOM 4413   H HB2  . ASP B 1 52  ? 34.086  18.011  -11.409 1.00 22.22 ? 52  ASP B HB2  1  
ATOM 4414   H HB3  . ASP B 1 52  ? 35.804  17.839  -11.049 1.00 60.42 ? 52  ASP B HB3  1  
ATOM 4415   N N    . LYS B 1 53  ? 35.802  14.919  -10.108 1.00 43.42 ? 53  LYS B N    1  
ATOM 4416   C CA   . LYS B 1 53  ? 35.684  14.203  -8.806  1.00 32.41 ? 53  LYS B CA   1  
ATOM 4417   C C    . LYS B 1 53  ? 35.189  15.168  -7.726  1.00 33.33 ? 53  LYS B C    1  
ATOM 4418   O O    . LYS B 1 53  ? 34.417  14.805  -6.861  1.00 22.21 ? 53  LYS B O    1  
ATOM 4419   C CB   . LYS B 1 53  ? 37.053  13.652  -8.402  1.00 11.42 ? 53  LYS B CB   1  
ATOM 4420   C CG   . LYS B 1 53  ? 37.504  12.604  -9.420  1.00 35.30 ? 53  LYS B CG   1  
ATOM 4421   C CD   . LYS B 1 53  ? 38.795  11.943  -8.934  1.00 65.00 ? 53  LYS B CD   1  
ATOM 4422   C CE   . LYS B 1 53  ? 39.294  10.957  -9.991  1.00 25.04 ? 53  LYS B CE   1  
ATOM 4423   N NZ   . LYS B 1 53  ? 40.427  10.165  -9.434  1.00 14.13 ? 53  LYS B NZ   1  
ATOM 4424   H H    . LYS B 1 53  ? 36.680  15.020  -10.533 1.00 51.32 ? 53  LYS B H    1  
ATOM 4425   H HA   . LYS B 1 53  ? 34.985  13.386  -8.906  1.00 32.24 ? 53  LYS B HA   1  
ATOM 4426   H HB2  . LYS B 1 53  ? 37.771  14.459  -8.374  1.00 24.42 ? 53  LYS B HB2  1  
ATOM 4427   H HB3  . LYS B 1 53  ? 36.985  13.197  -7.426  1.00 50.25 ? 53  LYS B HB3  1  
ATOM 4428   H HG2  . LYS B 1 53  ? 36.733  11.854  -9.530  1.00 4.13  ? 53  LYS B HG2  1  
ATOM 4429   H HG3  . LYS B 1 53  ? 37.682  13.079  -10.373 1.00 34.23 ? 53  LYS B HG3  1  
ATOM 4430   H HD2  . LYS B 1 53  ? 39.545  12.702  -8.764  1.00 61.34 ? 53  LYS B HD2  1  
ATOM 4431   H HD3  . LYS B 1 53  ? 38.603  11.413  -8.013  1.00 31.34 ? 53  LYS B HD3  1  
ATOM 4432   H HE2  . LYS B 1 53  ? 38.492  10.291  -10.270 1.00 34.12 ? 53  LYS B HE2  1  
ATOM 4433   H HE3  . LYS B 1 53  ? 39.629  11.502  -10.861 1.00 25.31 ? 53  LYS B HE3  1  
ATOM 4434   H HZ1  . LYS B 1 53  ? 41.303  10.722  -9.494  1.00 5.11  ? 53  LYS B HZ1  1  
ATOM 4435   H HZ2  . LYS B 1 53  ? 40.536  9.286   -9.981  1.00 0.30  ? 53  LYS B HZ2  1  
ATOM 4436   H HZ3  . LYS B 1 53  ? 40.233  9.934   -8.440  1.00 73.13 ? 53  LYS B HZ3  1  
ATOM 4437   N N    . ASN B 1 54  ? 35.630  16.396  -7.767  1.00 31.44 ? 54  ASN B N    1  
ATOM 4438   C CA   . ASN B 1 54  ? 35.188  17.383  -6.740  1.00 42.11 ? 54  ASN B CA   1  
ATOM 4439   C C    . ASN B 1 54  ? 33.726  17.759  -6.984  1.00 21.22 ? 54  ASN B C    1  
ATOM 4440   O O    . ASN B 1 54  ? 33.234  18.744  -6.470  1.00 32.13 ? 54  ASN B O    1  
ATOM 4441   C CB   . ASN B 1 54  ? 36.060  18.637  -6.832  1.00 45.24 ? 54  ASN B CB   1  
ATOM 4442   C CG   . ASN B 1 54  ? 35.681  19.606  -5.710  1.00 72.14 ? 54  ASN B CG   1  
ATOM 4443   O OD1  . ASN B 1 54  ? 35.073  20.629  -5.954  1.00 52.34 ? 54  ASN B OD1  1  
ATOM 4444   N ND2  . ASN B 1 54  ? 36.017  19.324  -4.481  1.00 75.21 ? 54  ASN B ND2  1  
ATOM 4445   H H    . ASN B 1 54  ? 36.255  16.669  -8.471  1.00 70.21 ? 54  ASN B H    1  
ATOM 4446   H HA   . ASN B 1 54  ? 35.288  16.947  -5.757  1.00 62.41 ? 54  ASN B HA   1  
ATOM 4447   H HB2  . ASN B 1 54  ? 37.100  18.361  -6.734  1.00 5.51  ? 54  ASN B HB2  1  
ATOM 4448   H HB3  . ASN B 1 54  ? 35.902  19.116  -7.786  1.00 23.30 ? 54  ASN B HB3  1  
ATOM 4449   H HD21 . ASN B 1 54  ? 36.507  18.499  -4.283  1.00 34.45 ? 54  ASN B HD21 1  
ATOM 4450   H HD22 . ASN B 1 54  ? 35.779  19.938  -3.755  1.00 74.14 ? 54  ASN B HD22 1  
ATOM 4451   N N    . ALA B 1 55  ? 33.026  16.984  -7.766  1.00 4.35  ? 55  ALA B N    1  
ATOM 4452   C CA   . ALA B 1 55  ? 31.597  17.301  -8.044  1.00 50.54 ? 55  ALA B CA   1  
ATOM 4453   C C    . ALA B 1 55  ? 30.818  17.379  -6.730  1.00 2.12  ? 55  ALA B C    1  
ATOM 4454   O O    . ALA B 1 55  ? 29.969  18.228  -6.554  1.00 25.32 ? 55  ALA B O    1  
ATOM 4455   C CB   . ALA B 1 55  ? 30.994  16.204  -8.923  1.00 55.33 ? 55  ALA B CB   1  
ATOM 4456   H H    . ALA B 1 55  ? 33.441  16.195  -8.173  1.00 52.30 ? 55  ALA B H    1  
ATOM 4457   H HA   . ALA B 1 55  ? 31.532  18.248  -8.558  1.00 52.51 ? 55  ALA B HA   1  
ATOM 4458   H HB1  . ALA B 1 55  ? 31.486  16.200  -9.883  1.00 2.24  ? 55  ALA B HB1  1  
ATOM 4459   H HB2  . ALA B 1 55  ? 29.939  16.391  -9.060  1.00 15.42 ? 55  ALA B HB2  1  
ATOM 4460   H HB3  . ALA B 1 55  ? 31.130  15.245  -8.445  1.00 15.22 ? 55  ALA B HB3  1  
ATOM 4461   N N    . LEU B 1 56  ? 31.096  16.500  -5.806  1.00 35.24 ? 56  LEU B N    1  
ATOM 4462   C CA   . LEU B 1 56  ? 30.361  16.525  -4.506  1.00 22.33 ? 56  LEU B CA   1  
ATOM 4463   C C    . LEU B 1 56  ? 30.313  17.959  -3.966  1.00 41.43 ? 56  LEU B C    1  
ATOM 4464   O O    . LEU B 1 56  ? 29.299  18.411  -3.470  1.00 63.14 ? 56  LEU B O    1  
ATOM 4465   C CB   . LEU B 1 56  ? 31.076  15.613  -3.497  1.00 32.35 ? 56  LEU B CB   1  
ATOM 4466   C CG   . LEU B 1 56  ? 30.686  14.151  -3.745  1.00 10.22 ? 56  LEU B CG   1  
ATOM 4467   C CD1  . LEU B 1 56  ? 31.163  13.715  -5.131  1.00 25.01 ? 56  LEU B CD1  1  
ATOM 4468   C CD2  . LEU B 1 56  ? 31.338  13.264  -2.682  1.00 22.34 ? 56  LEU B CD2  1  
ATOM 4469   H H    . LEU B 1 56  ? 31.783  15.821  -5.967  1.00 24.32 ? 56  LEU B H    1  
ATOM 4470   H HA   . LEU B 1 56  ? 29.351  16.170  -4.661  1.00 51.32 ? 56  LEU B HA   1  
ATOM 4471   H HB2  . LEU B 1 56  ? 32.145  15.723  -3.611  1.00 51.11 ? 56  LEU B HB2  1  
ATOM 4472   H HB3  . LEU B 1 56  ? 30.792  15.890  -2.492  1.00 14.25 ? 56  LEU B HB3  1  
ATOM 4473   H HG   . LEU B 1 56  ? 29.612  14.051  -3.688  1.00 72.42 ? 56  LEU B HG   1  
ATOM 4474   H HD11 . LEU B 1 56  ? 32.182  14.038  -5.280  1.00 42.32 ? 56  LEU B HD11 1  
ATOM 4475   H HD12 . LEU B 1 56  ? 30.530  14.158  -5.886  1.00 64.13 ? 56  LEU B HD12 1  
ATOM 4476   H HD13 . LEU B 1 56  ? 31.112  12.638  -5.207  1.00 2.13  ? 56  LEU B HD13 1  
ATOM 4477   H HD21 . LEU B 1 56  ? 30.890  13.466  -1.720  1.00 54.21 ? 56  LEU B HD21 1  
ATOM 4478   H HD22 . LEU B 1 56  ? 32.397  13.475  -2.637  1.00 52.30 ? 56  LEU B HD22 1  
ATOM 4479   H HD23 . LEU B 1 56  ? 31.188  12.226  -2.938  1.00 31.44 ? 56  LEU B HD23 1  
ATOM 4480   N N    . SER B 1 57  ? 31.396  18.679  -4.055  1.00 15.01 ? 57  SER B N    1  
ATOM 4481   C CA   . SER B 1 57  ? 31.400  20.079  -3.544  1.00 34.22 ? 57  SER B CA   1  
ATOM 4482   C C    . SER B 1 57  ? 30.587  20.973  -4.485  1.00 25.52 ? 57  SER B C    1  
ATOM 4483   O O    . SER B 1 57  ? 29.816  21.809  -4.054  1.00 63.50 ? 57  SER B O    1  
ATOM 4484   C CB   . SER B 1 57  ? 32.838  20.592  -3.474  1.00 13.33 ? 57  SER B CB   1  
ATOM 4485   O OG   . SER B 1 57  ? 33.629  19.672  -2.732  1.00 54.30 ? 57  SER B OG   1  
ATOM 4486   H H    . SER B 1 57  ? 32.206  18.300  -4.457  1.00 61.24 ? 57  SER B H    1  
ATOM 4487   H HA   . SER B 1 57  ? 30.961  20.103  -2.558  1.00 73.04 ? 57  SER B HA   1  
ATOM 4488   H HB2  . SER B 1 57  ? 33.239  20.682  -4.469  1.00 20.23 ? 57  SER B HB2  1  
ATOM 4489   H HB3  . SER B 1 57  ? 32.850  21.562  -2.994  1.00 24.05 ? 57  SER B HB3  1  
ATOM 4490   H HG   . SER B 1 57  ? 34.184  19.193  -3.351  1.00 63.43 ? 57  SER B HG   1  
ATOM 4491   N N    . PHE B 1 58  ? 30.759  20.807  -5.768  1.00 72.33 ? 58  PHE B N    1  
ATOM 4492   C CA   . PHE B 1 58  ? 30.005  21.651  -6.739  1.00 55.54 ? 58  PHE B CA   1  
ATOM 4493   C C    . PHE B 1 58  ? 28.508  21.366  -6.625  1.00 64.24 ? 58  PHE B C    1  
ATOM 4494   O O    . PHE B 1 58  ? 27.718  22.248  -6.374  1.00 63.14 ? 58  PHE B O    1  
ATOM 4495   C CB   . PHE B 1 58  ? 30.477  21.335  -8.159  1.00 1.55  ? 58  PHE B CB   1  
ATOM 4496   C CG   . PHE B 1 58  ? 29.885  22.339  -9.124  1.00 14.34 ? 58  PHE B CG   1  
ATOM 4497   C CD1  . PHE B 1 58  ? 30.282  23.680  -9.065  1.00 21.45 ? 58  PHE B CD1  1  
ATOM 4498   C CD2  . PHE B 1 58  ? 28.944  21.930  -10.079 1.00 1.12  ? 58  PHE B CD2  1  
ATOM 4499   C CE1  . PHE B 1 58  ? 29.740  24.612  -9.958  1.00 1.33  ? 58  PHE B CE1  1  
ATOM 4500   C CE2  . PHE B 1 58  ? 28.402  22.862  -10.972 1.00 64.11 ? 58  PHE B CE2  1  
ATOM 4501   C CZ   . PHE B 1 58  ? 28.800  24.203  -10.911 1.00 71.22 ? 58  PHE B CZ   1  
ATOM 4502   H H    . PHE B 1 58  ? 31.389  20.131  -6.095  1.00 72.31 ? 58  PHE B H    1  
ATOM 4503   H HA   . PHE B 1 58  ? 30.186  22.696  -6.524  1.00 21.42 ? 58  PHE B HA   1  
ATOM 4504   H HB2  . PHE B 1 58  ? 31.555  21.390  -8.199  1.00 3.43  ? 58  PHE B HB2  1  
ATOM 4505   H HB3  . PHE B 1 58  ? 30.158  20.340  -8.431  1.00 14.30 ? 58  PHE B HB3  1  
ATOM 4506   H HD1  . PHE B 1 58  ? 31.007  23.996  -8.330  1.00 64.33 ? 58  PHE B HD1  1  
ATOM 4507   H HD2  . PHE B 1 58  ? 28.637  20.895  -10.126 1.00 4.12  ? 58  PHE B HD2  1  
ATOM 4508   H HE1  . PHE B 1 58  ? 30.047  25.646  -9.912  1.00 64.34 ? 58  PHE B HE1  1  
ATOM 4509   H HE2  . PHE B 1 58  ? 27.677  22.547  -11.707 1.00 52.52 ? 58  PHE B HE2  1  
ATOM 4510   H HZ   . PHE B 1 58  ? 28.382  24.922  -11.600 1.00 54.34 ? 58  PHE B HZ   1  
ATOM 4511   N N    . VAL B 1 59  ? 28.098  20.146  -6.813  1.00 31.33 ? 59  VAL B N    1  
ATOM 4512   C CA   . VAL B 1 59  ? 26.645  19.851  -6.716  1.00 74.54 ? 59  VAL B CA   1  
ATOM 4513   C C    . VAL B 1 59  ? 26.104  20.370  -5.384  1.00 44.41 ? 59  VAL B C    1  
ATOM 4514   O O    . VAL B 1 59  ? 24.993  20.854  -5.301  1.00 2.43  ? 59  VAL B O    1  
ATOM 4515   C CB   . VAL B 1 59  ? 26.403  18.347  -6.810  1.00 65.20 ? 59  VAL B CB   1  
ATOM 4516   C CG1  . VAL B 1 59  ? 27.067  17.791  -8.075  1.00 43.41 ? 59  VAL B CG1  1  
ATOM 4517   C CG2  . VAL B 1 59  ? 26.982  17.650  -5.574  1.00 30.21 ? 59  VAL B CG2  1  
ATOM 4518   H H    . VAL B 1 59  ? 28.737  19.434  -7.022  1.00 24.24 ? 59  VAL B H    1  
ATOM 4519   H HA   . VAL B 1 59  ? 26.130  20.343  -7.526  1.00 1.24  ? 59  VAL B HA   1  
ATOM 4520   H HB   . VAL B 1 59  ? 25.340  18.172  -6.854  1.00 32.42 ? 59  VAL B HB   1  
ATOM 4521   H HG11 . VAL B 1 59  ? 28.128  17.678  -7.908  1.00 25.02 ? 59  VAL B HG11 1  
ATOM 4522   H HG12 . VAL B 1 59  ? 26.905  18.470  -8.899  1.00 3.22  ? 59  VAL B HG12 1  
ATOM 4523   H HG13 . VAL B 1 59  ? 26.638  16.829  -8.313  1.00 63.41 ? 59  VAL B HG13 1  
ATOM 4524   H HG21 . VAL B 1 59  ? 27.060  16.588  -5.761  1.00 52.02 ? 59  VAL B HG21 1  
ATOM 4525   H HG22 . VAL B 1 59  ? 26.333  17.818  -4.728  1.00 43.24 ? 59  VAL B HG22 1  
ATOM 4526   H HG23 . VAL B 1 59  ? 27.961  18.050  -5.361  1.00 44.24 ? 59  VAL B HG23 1  
ATOM 4527   N N    . SER B 1 60  ? 26.878  20.269  -4.339  1.00 64.01 ? 60  SER B N    1  
ATOM 4528   C CA   . SER B 1 60  ? 26.400  20.754  -3.016  1.00 12.13 ? 60  SER B CA   1  
ATOM 4529   C C    . SER B 1 60  ? 25.965  22.217  -3.132  1.00 54.35 ? 60  SER B C    1  
ATOM 4530   O O    . SER B 1 60  ? 24.871  22.580  -2.741  1.00 51.32 ? 60  SER B O    1  
ATOM 4531   C CB   . SER B 1 60  ? 27.530  20.639  -1.992  1.00 71.24 ? 60  SER B CB   1  
ATOM 4532   O OG   . SER B 1 60  ? 27.022  20.938  -0.699  1.00 32.51 ? 60  SER B OG   1  
ATOM 4533   H H    . SER B 1 60  ? 27.771  19.872  -4.424  1.00 21.35 ? 60  SER B H    1  
ATOM 4534   H HA   . SER B 1 60  ? 25.562  20.154  -2.695  1.00 61.13 ? 60  SER B HA   1  
ATOM 4535   H HB2  . SER B 1 60  ? 27.921  19.636  -1.997  1.00 24.01 ? 60  SER B HB2  1  
ATOM 4536   H HB3  . SER B 1 60  ? 28.319  21.332  -2.250  1.00 41.43 ? 60  SER B HB3  1  
ATOM 4537   H HG   . SER B 1 60  ? 26.589  20.150  -0.361  1.00 12.40 ? 60  SER B HG   1  
ATOM 4538   N N    . ARG B 1 61  ? 26.809  23.064  -3.659  1.00 73.05 ? 61  ARG B N    1  
ATOM 4539   C CA   . ARG B 1 61  ? 26.424  24.498  -3.780  1.00 32.25 ? 61  ARG B CA   1  
ATOM 4540   C C    . ARG B 1 61  ? 25.327  24.667  -4.836  1.00 74.31 ? 61  ARG B C    1  
ATOM 4541   O O    . ARG B 1 61  ? 24.471  25.512  -4.705  1.00 3.31  ? 61  ARG B O    1  
ATOM 4542   C CB   . ARG B 1 61  ? 27.638  25.359  -4.161  1.00 0.32  ? 61  ARG B CB   1  
ATOM 4543   C CG   . ARG B 1 61  ? 28.428  24.697  -5.288  1.00 2.03  ? 61  ARG B CG   1  
ATOM 4544   C CD   . ARG B 1 61  ? 29.601  25.598  -5.681  1.00 53.44 ? 61  ARG B CD   1  
ATOM 4545   N NE   . ARG B 1 61  ? 30.338  26.017  -4.456  1.00 20.31 ? 61  ARG B NE   1  
ATOM 4546   C CZ   . ARG B 1 61  ? 31.069  25.153  -3.806  1.00 4.54  ? 61  ARG B CZ   1  
ATOM 4547   N NH1  . ARG B 1 61  ? 31.153  23.921  -4.228  1.00 45.23 ? 61  ARG B NH1  1  
ATOM 4548   N NH2  . ARG B 1 61  ? 31.717  25.521  -2.734  1.00 63.43 ? 61  ARG B NH2  1  
ATOM 4549   H H    . ARG B 1 61  ? 27.688  22.758  -3.965  1.00 5.12  ? 61  ARG B H    1  
ATOM 4550   H HA   . ARG B 1 61  ? 26.046  24.835  -2.827  1.00 63.15 ? 61  ARG B HA   1  
ATOM 4551   H HB2  . ARG B 1 61  ? 27.295  26.330  -4.492  1.00 40.42 ? 61  ARG B HB2  1  
ATOM 4552   H HB3  . ARG B 1 61  ? 28.277  25.479  -3.299  1.00 30.32 ? 61  ARG B HB3  1  
ATOM 4553   H HG2  . ARG B 1 61  ? 28.805  23.744  -4.952  1.00 61.03 ? 61  ARG B HG2  1  
ATOM 4554   H HG3  . ARG B 1 61  ? 27.785  24.557  -6.143  1.00 64.25 ? 61  ARG B HG3  1  
ATOM 4555   H HD2  . ARG B 1 61  ? 30.268  25.055  -6.335  1.00 43.33 ? 61  ARG B HD2  1  
ATOM 4556   H HD3  . ARG B 1 61  ? 29.228  26.472  -6.194  1.00 32.24 ? 61  ARG B HD3  1  
ATOM 4557   H HE   . ARG B 1 61  ? 30.274  26.942  -4.138  1.00 54.21 ? 61  ARG B HE   1  
ATOM 4558   H HH11 . ARG B 1 61  ? 30.657  23.638  -5.049  1.00 21.24 ? 61  ARG B HH11 1  
ATOM 4559   H HH12 . ARG B 1 61  ? 31.714  23.259  -3.730  1.00 10.25 ? 61  ARG B HH12 1  
ATOM 4560   H HH21 . ARG B 1 61  ? 31.652  26.464  -2.411  1.00 63.05 ? 61  ARG B HH21 1  
ATOM 4561   H HH22 . ARG B 1 61  ? 32.277  24.858  -2.237  1.00 34.02 ? 61  ARG B HH22 1  
ATOM 4562   N N    . ILE B 1 62  ? 25.337  23.882  -5.881  1.00 54.22 ? 62  ILE B N    1  
ATOM 4563   C CA   . ILE B 1 62  ? 24.280  24.043  -6.924  1.00 30.31 ? 62  ILE B CA   1  
ATOM 4564   C C    . ILE B 1 62  ? 22.929  23.589  -6.371  1.00 13.45 ? 62  ILE B C    1  
ATOM 4565   O O    . ILE B 1 62  ? 21.896  24.132  -6.709  1.00 72.14 ? 62  ILE B O    1  
ATOM 4566   C CB   . ILE B 1 62  ? 24.632  23.199  -8.154  1.00 50.41 ? 62  ILE B CB   1  
ATOM 4567   C CG1  . ILE B 1 62  ? 25.955  23.682  -8.781  1.00 10.51 ? 62  ILE B CG1  1  
ATOM 4568   C CG2  . ILE B 1 62  ? 23.505  23.293  -9.184  1.00 52.15 ? 62  ILE B CG2  1  
ATOM 4569   C CD1  . ILE B 1 62  ? 25.894  25.177  -9.130  1.00 3.24  ? 62  ILE B CD1  1  
ATOM 4570   H H    . ILE B 1 62  ? 26.031  23.192  -5.984  1.00 14.25 ? 62  ILE B H    1  
ATOM 4571   H HA   . ILE B 1 62  ? 24.210  25.082  -7.205  1.00 43.35 ? 62  ILE B HA   1  
ATOM 4572   H HB   . ILE B 1 62  ? 24.738  22.170  -7.849  1.00 22.55 ? 62  ILE B HB   1  
ATOM 4573   H HG12 . ILE B 1 62  ? 26.759  23.516  -8.083  1.00 32.21 ? 62  ILE B HG12 1  
ATOM 4574   H HG13 . ILE B 1 62  ? 26.146  23.116  -9.681  1.00 70.11 ? 62  ILE B HG13 1  
ATOM 4575   H HG21 . ILE B 1 62  ? 23.861  22.941  -10.140 1.00 75.42 ? 62  ILE B HG21 1  
ATOM 4576   H HG22 . ILE B 1 62  ? 23.182  24.319  -9.275  1.00 5.02  ? 62  ILE B HG22 1  
ATOM 4577   H HG23 . ILE B 1 62  ? 22.676  22.681  -8.862  1.00 0.34  ? 62  ILE B HG23 1  
ATOM 4578   H HD11 . ILE B 1 62  ? 26.179  25.759  -8.266  1.00 2.31  ? 62  ILE B HD11 1  
ATOM 4579   H HD12 . ILE B 1 62  ? 24.892  25.447  -9.430  1.00 34.12 ? 62  ILE B HD12 1  
ATOM 4580   H HD13 . ILE B 1 62  ? 26.577  25.382  -9.940  1.00 33.42 ? 62  ILE B HD13 1  
ATOM 4581   N N    . LYS B 1 63  ? 22.923  22.592  -5.535  1.00 10.31 ? 63  LYS B N    1  
ATOM 4582   C CA   . LYS B 1 63  ? 21.635  22.099  -4.974  1.00 1.40  ? 63  LYS B CA   1  
ATOM 4583   C C    . LYS B 1 63  ? 21.026  23.151  -4.042  1.00 73.32 ? 63  LYS B C    1  
ATOM 4584   O O    . LYS B 1 63  ? 19.841  23.415  -4.088  1.00 3.12  ? 63  LYS B O    1  
ATOM 4585   C CB   . LYS B 1 63  ? 21.891  20.801  -4.198  1.00 60.03 ? 63  LYS B CB   1  
ATOM 4586   C CG   . LYS B 1 63  ? 22.128  19.621  -5.184  1.00 4.32  ? 63  LYS B CG   1  
ATOM 4587   C CD   . LYS B 1 63  ? 20.920  18.671  -5.200  1.00 23.42 ? 63  LYS B CD   1  
ATOM 4588   C CE   . LYS B 1 63  ? 19.718  19.377  -5.830  1.00 20.10 ? 63  LYS B CE   1  
ATOM 4589   N NZ   . LYS B 1 63  ? 20.088  19.877  -7.184  1.00 21.30 ? 63  LYS B NZ   1  
ATOM 4590   H H    . LYS B 1 63  ? 23.765  22.161  -5.281  1.00 63.01 ? 63  LYS B H    1  
ATOM 4591   H HA   . LYS B 1 63  ? 20.948  21.900  -5.783  1.00 13.22 ? 63  LYS B HA   1  
ATOM 4592   H HB2  . LYS B 1 63  ? 22.767  20.935  -3.575  1.00 22.52 ? 63  LYS B HB2  1  
ATOM 4593   H HB3  . LYS B 1 63  ? 21.040  20.590  -3.566  1.00 5.51  ? 63  LYS B HB3  1  
ATOM 4594   H HG2  . LYS B 1 63  ? 22.288  19.999  -6.184  1.00 3.51  ? 63  LYS B HG2  1  
ATOM 4595   H HG3  . LYS B 1 63  ? 23.004  19.070  -4.880  1.00 23.41 ? 63  LYS B HG3  1  
ATOM 4596   H HD2  . LYS B 1 63  ? 21.164  17.792  -5.780  1.00 31.42 ? 63  LYS B HD2  1  
ATOM 4597   H HD3  . LYS B 1 63  ? 20.676  18.377  -4.190  1.00 63.42 ? 63  LYS B HD3  1  
ATOM 4598   H HE2  . LYS B 1 63  ? 18.896  18.681  -5.916  1.00 15.11 ? 63  LYS B HE2  1  
ATOM 4599   H HE3  . LYS B 1 63  ? 19.420  20.209  -5.208  1.00 52.15 ? 63  LYS B HE3  1  
ATOM 4600   H HZ1  . LYS B 1 63  ? 20.278  20.898  -7.137  1.00 53.34 ? 63  LYS B HZ1  1  
ATOM 4601   H HZ2  . LYS B 1 63  ? 19.305  19.699  -7.846  1.00 31.03 ? 63  LYS B HZ2  1  
ATOM 4602   H HZ3  . LYS B 1 63  ? 20.941  19.384  -7.515  1.00 61.42 ? 63  LYS B HZ3  1  
ATOM 4603   N N    . GLU B 1 64  ? 21.815  23.750  -3.190  1.00 73.12 ? 64  GLU B N    1  
ATOM 4604   C CA   . GLU B 1 64  ? 21.254  24.773  -2.257  1.00 41.24 ? 64  GLU B CA   1  
ATOM 4605   C C    . GLU B 1 64  ? 21.074  26.113  -2.980  1.00 34.42 ? 64  GLU B C    1  
ATOM 4606   O O    . GLU B 1 64  ? 20.055  26.763  -2.856  1.00 5.22  ? 64  GLU B O    1  
ATOM 4607   C CB   . GLU B 1 64  ? 22.199  24.948  -1.061  1.00 0.54  ? 64  GLU B CB   1  
ATOM 4608   C CG   . GLU B 1 64  ? 23.467  25.684  -1.503  1.00 3.20  ? 64  GLU B CG   1  
ATOM 4609   C CD   . GLU B 1 64  ? 24.559  25.511  -0.444  1.00 50.10 ? 64  GLU B CD   1  
ATOM 4610   O OE1  . GLU B 1 64  ? 24.738  24.396  0.016   1.00 5.14  ? 64  GLU B OE1  1  
ATOM 4611   O OE2  . GLU B 1 64  ? 25.196  26.497  -0.113  1.00 43.05 ? 64  GLU B OE2  1  
ATOM 4612   H H    . GLU B 1 64  ? 22.769  23.522  -3.157  1.00 42.34 ? 64  GLU B H    1  
ATOM 4613   H HA   . GLU B 1 64  ? 20.294  24.437  -1.900  1.00 54.31 ? 64  GLU B HA   1  
ATOM 4614   H HB2  . GLU B 1 64  ? 21.701  25.520  -0.292  1.00 20.21 ? 64  GLU B HB2  1  
ATOM 4615   H HB3  . GLU B 1 64  ? 22.466  23.977  -0.671  1.00 73.31 ? 64  GLU B HB3  1  
ATOM 4616   H HG2  . GLU B 1 64  ? 23.807  25.278  -2.443  1.00 30.41 ? 64  GLU B HG2  1  
ATOM 4617   H HG3  . GLU B 1 64  ? 23.249  26.735  -1.623  1.00 54.53 ? 64  GLU B HG3  1  
ATOM 4618   N N    . LYS B 1 65  ? 22.057  26.534  -3.726  1.00 62.31 ? 65  LYS B N    1  
ATOM 4619   C CA   . LYS B 1 65  ? 21.943  27.836  -4.446  1.00 72.44 ? 65  LYS B CA   1  
ATOM 4620   C C    . LYS B 1 65  ? 20.862  27.740  -5.526  1.00 43.43 ? 65  LYS B C    1  
ATOM 4621   O O    . LYS B 1 65  ? 20.281  28.731  -5.922  1.00 40.31 ? 65  LYS B O    1  
ATOM 4622   C CB   . LYS B 1 65  ? 23.287  28.190  -5.091  1.00 11.32 ? 65  LYS B CB   1  
ATOM 4623   C CG   . LYS B 1 65  ? 24.334  28.417  -3.997  1.00 1.42  ? 65  LYS B CG   1  
ATOM 4624   C CD   . LYS B 1 65  ? 25.647  28.876  -4.633  1.00 62.24 ? 65  LYS B CD   1  
ATOM 4625   C CE   . LYS B 1 65  ? 26.697  29.088  -3.541  1.00 62.14 ? 65  LYS B CE   1  
ATOM 4626   N NZ   . LYS B 1 65  ? 26.791  27.863  -2.698  1.00 1.22  ? 65  LYS B NZ   1  
ATOM 4627   H H    . LYS B 1 65  ? 22.871  25.997  -3.807  1.00 21.41 ? 65  LYS B H    1  
ATOM 4628   H HA   . LYS B 1 65  ? 21.671  28.608  -3.742  1.00 22.11 ? 65  LYS B HA   1  
ATOM 4629   H HB2  . LYS B 1 65  ? 23.602  27.385  -5.736  1.00 23.11 ? 65  LYS B HB2  1  
ATOM 4630   H HB3  . LYS B 1 65  ? 23.183  29.090  -5.672  1.00 14.55 ? 65  LYS B HB3  1  
ATOM 4631   H HG2  . LYS B 1 65  ? 23.980  29.175  -3.314  1.00 11.31 ? 65  LYS B HG2  1  
ATOM 4632   H HG3  . LYS B 1 65  ? 24.499  27.497  -3.458  1.00 40.11 ? 65  LYS B HG3  1  
ATOM 4633   H HD2  . LYS B 1 65  ? 25.994  28.123  -5.327  1.00 72.43 ? 65  LYS B HD2  1  
ATOM 4634   H HD3  . LYS B 1 65  ? 25.487  29.804  -5.160  1.00 30.42 ? 65  LYS B HD3  1  
ATOM 4635   H HE2  . LYS B 1 65  ? 27.656  29.286  -3.997  1.00 40.41 ? 65  LYS B HE2  1  
ATOM 4636   H HE3  . LYS B 1 65  ? 26.411  29.927  -2.925  1.00 1.04  ? 65  LYS B HE3  1  
ATOM 4637   H HZ1  . LYS B 1 65  ? 27.786  27.572  -2.618  1.00 2.21  ? 65  LYS B HZ1  1  
ATOM 4638   H HZ2  . LYS B 1 65  ? 26.240  27.097  -3.138  1.00 44.31 ? 65  LYS B HZ2  1  
ATOM 4639   H HZ3  . LYS B 1 65  ? 26.413  28.063  -1.751  1.00 63.43 ? 65  LYS B HZ3  1  
ATOM 4640   N N    . HIS B 1 66  ? 20.584  26.558  -6.005  1.00 41.12 ? 66  HIS B N    1  
ATOM 4641   C CA   . HIS B 1 66  ? 19.537  26.407  -7.059  1.00 42.15 ? 66  HIS B CA   1  
ATOM 4642   C C    . HIS B 1 66  ? 18.967  24.989  -7.015  1.00 63.31 ? 66  HIS B C    1  
ATOM 4643   O O    . HIS B 1 66  ? 19.114  24.224  -7.945  1.00 43.14 ? 66  HIS B O    1  
ATOM 4644   C CB   . HIS B 1 66  ? 20.156  26.663  -8.435  1.00 63.30 ? 66  HIS B CB   1  
ATOM 4645   C CG   . HIS B 1 66  ? 20.548  28.109  -8.549  1.00 41.13 ? 66  HIS B CG   1  
ATOM 4646   N ND1  . HIS B 1 66  ? 19.646  29.140  -8.326  1.00 44.44 ? 66  HIS B ND1  1  
ATOM 4647   C CD2  . HIS B 1 66  ? 21.741  28.715  -8.863  1.00 12.53 ? 66  HIS B CD2  1  
ATOM 4648   C CE1  . HIS B 1 66  ? 20.304  30.301  -8.506  1.00 35.10 ? 66  HIS B CE1  1  
ATOM 4649   N NE2  . HIS B 1 66  ? 21.581  30.095  -8.834  1.00 52.51 ? 66  HIS B NE2  1  
ATOM 4650   H H    . HIS B 1 66  ? 21.062  25.769  -5.673  1.00 51.14 ? 66  HIS B H    1  
ATOM 4651   H HA   . HIS B 1 66  ? 18.743  27.119  -6.885  1.00 2.43  ? 66  HIS B HA   1  
ATOM 4652   H HB2  . HIS B 1 66  ? 21.032  26.042  -8.556  1.00 2.12  ? 66  HIS B HB2  1  
ATOM 4653   H HB3  . HIS B 1 66  ? 19.436  26.424  -9.203  1.00 61.15 ? 66  HIS B HB3  1  
ATOM 4654   H HD1  . HIS B 1 66  ? 18.702  29.041  -8.082  1.00 65.21 ? 66  HIS B HD1  1  
ATOM 4655   H HD2  . HIS B 1 66  ? 22.660  28.198  -9.097  1.00 35.53 ? 66  HIS B HD2  1  
ATOM 4656   H HE1  . HIS B 1 66  ? 19.854  31.277  -8.399  1.00 24.31 ? 66  HIS B HE1  1  
ATOM 4657   H HE2  . HIS B 1 66  ? 22.263  30.775  -9.017  1.00 0.00  ? 66  HIS B HE2  1  
ATOM 4658   N N    . SER B 1 67  ? 18.318  24.631  -5.942  1.00 73.10 ? 67  SER B N    1  
ATOM 4659   C CA   . SER B 1 67  ? 17.741  23.259  -5.839  1.00 3.21  ? 67  SER B CA   1  
ATOM 4660   C C    . SER B 1 67  ? 16.802  23.000  -7.022  1.00 0.34  ? 67  SER B C    1  
ATOM 4661   O O    . SER B 1 67  ? 16.693  21.892  -7.508  1.00 52.21 ? 67  SER B O    1  
ATOM 4662   C CB   . SER B 1 67  ? 16.956  23.132  -4.532  1.00 14.54 ? 67  SER B CB   1  
ATOM 4663   O OG   . SER B 1 67  ? 16.715  21.758  -4.262  1.00 31.42 ? 67  SER B OG   1  
ATOM 4664   H H    . SER B 1 67  ? 18.212  25.264  -5.201  1.00 32.04 ? 67  SER B H    1  
ATOM 4665   H HA   . SER B 1 67  ? 18.540  22.532  -5.850  1.00 61.44 ? 67  SER B HA   1  
ATOM 4666   H HB2  . SER B 1 67  ? 17.526  23.558  -3.723  1.00 20.43 ? 67  SER B HB2  1  
ATOM 4667   H HB3  . SER B 1 67  ? 16.017  23.662  -4.624  1.00 64.14 ? 67  SER B HB3  1  
ATOM 4668   H HG   . SER B 1 67  ? 17.143  21.241  -4.948  1.00 31.04 ? 67  SER B HG   1  
ATOM 4669   N N    . SER B 1 68  ? 16.117  24.011  -7.483  1.00 13.35 ? 68  SER B N    1  
ATOM 4670   C CA   . SER B 1 68  ? 15.180  23.818  -8.627  1.00 52.01 ? 68  SER B CA   1  
ATOM 4671   C C    . SER B 1 68  ? 15.971  23.560  -9.911  1.00 23.54 ? 68  SER B C    1  
ATOM 4672   O O    . SER B 1 68  ? 15.711  24.153  -10.939 1.00 51.32 ? 68  SER B O    1  
ATOM 4673   C CB   . SER B 1 68  ? 14.327  25.075  -8.801  1.00 63.21 ? 68  SER B CB   1  
ATOM 4674   O OG   . SER B 1 68  ? 13.458  24.902  -9.912  1.00 71.53 ? 68  SER B OG   1  
ATOM 4675   H H    . SER B 1 68  ? 16.215  24.896  -7.074  1.00 35.13 ? 68  SER B H    1  
ATOM 4676   H HA   . SER B 1 68  ? 14.537  22.974  -8.425  1.00 32.23 ? 68  SER B HA   1  
ATOM 4677   H HB2  . SER B 1 68  ? 13.739  25.239  -7.913  1.00 0.40  ? 68  SER B HB2  1  
ATOM 4678   H HB3  . SER B 1 68  ? 14.974  25.927  -8.964  1.00 51.32 ? 68  SER B HB3  1  
ATOM 4679   H HG   . SER B 1 68  ? 13.862  25.326  -10.673 1.00 10.22 ? 68  SER B HG   1  
ATOM 4680   N N    . ILE B 1 69  ? 16.935  22.678  -9.865  1.00 74.40 ? 69  ILE B N    1  
ATOM 4681   C CA   . ILE B 1 69  ? 17.744  22.382  -11.088 1.00 34.13 ? 69  ILE B CA   1  
ATOM 4682   C C    . ILE B 1 69  ? 18.128  20.896  -11.091 1.00 35.11 ? 69  ILE B C    1  
ATOM 4683   O O    . ILE B 1 69  ? 18.169  20.258  -10.058 1.00 30.00 ? 69  ILE B O    1  
ATOM 4684   C CB   . ILE B 1 69  ? 19.004  23.267  -11.074 1.00 1.13  ? 69  ILE B CB   1  
ATOM 4685   C CG1  . ILE B 1 69  ? 19.628  23.324  -12.476 1.00 63.41 ? 69  ILE B CG1  1  
ATOM 4686   C CG2  . ILE B 1 69  ? 20.036  22.715  -10.075 1.00 2.21  ? 69  ILE B CG2  1  
ATOM 4687   C CD1  . ILE B 1 69  ? 20.658  24.455  -12.519 1.00 41.31 ? 69  ILE B CD1  1  
ATOM 4688   H H    . ILE B 1 69  ? 17.130  22.211  -9.026  1.00 24.14 ? 69  ILE B H    1  
ATOM 4689   H HA   . ILE B 1 69  ? 17.158  22.598  -11.971 1.00 22.10 ? 69  ILE B HA   1  
ATOM 4690   H HB   . ILE B 1 69  ? 18.724  24.267  -10.771 1.00 61.15 ? 69  ILE B HB   1  
ATOM 4691   H HG12 . ILE B 1 69  ? 20.115  22.384  -12.693 1.00 24.01 ? 69  ILE B HG12 1  
ATOM 4692   H HG13 . ILE B 1 69  ? 18.862  23.513  -13.212 1.00 31.31 ? 69  ILE B HG13 1  
ATOM 4693   H HG21 . ILE B 1 69  ? 19.527  22.308  -9.214  1.00 63.31 ? 69  ILE B HG21 1  
ATOM 4694   H HG22 . ILE B 1 69  ? 20.691  23.513  -9.760  1.00 10.14 ? 69  ILE B HG22 1  
ATOM 4695   H HG23 . ILE B 1 69  ? 20.621  21.936  -10.546 1.00 71.42 ? 69  ILE B HG23 1  
ATOM 4696   H HD11 . ILE B 1 69  ? 20.148  25.407  -12.490 1.00 14.11 ? 69  ILE B HD11 1  
ATOM 4697   H HD12 . ILE B 1 69  ? 21.234  24.385  -13.429 1.00 60.41 ? 69  ILE B HD12 1  
ATOM 4698   H HD13 . ILE B 1 69  ? 21.317  24.375  -11.668 1.00 62.15 ? 69  ILE B HD13 1  
ATOM 4699   N N    . VAL B 1 70  ? 18.407  20.338  -12.241 1.00 65.40 ? 70  VAL B N    1  
ATOM 4700   C CA   . VAL B 1 70  ? 18.784  18.892  -12.301 1.00 15.10 ? 70  VAL B CA   1  
ATOM 4701   C C    . VAL B 1 70  ? 20.308  18.764  -12.255 1.00 31.04 ? 70  VAL B C    1  
ATOM 4702   O O    . VAL B 1 70  ? 21.022  19.595  -12.781 1.00 30.31 ? 70  VAL B O    1  
ATOM 4703   C CB   . VAL B 1 70  ? 18.256  18.286  -13.603 1.00 40.15 ? 70  VAL B CB   1  
ATOM 4704   C CG1  . VAL B 1 70  ? 18.504  16.775  -13.607 1.00 4.20  ? 70  VAL B CG1  1  
ATOM 4705   C CG2  . VAL B 1 70  ? 16.752  18.552  -13.712 1.00 75.12 ? 70  VAL B CG2  1  
ATOM 4706   H H    . VAL B 1 70  ? 18.368  20.868  -13.068 1.00 70.45 ? 70  VAL B H    1  
ATOM 4707   H HA   . VAL B 1 70  ? 18.354  18.364  -11.460 1.00 4.24  ? 70  VAL B HA   1  
ATOM 4708   H HB   . VAL B 1 70  ? 18.764  18.737  -14.441 1.00 54.22 ? 70  VAL B HB   1  
ATOM 4709   H HG11 . VAL B 1 70  ? 18.207  16.365  -14.560 1.00 61.21 ? 70  VAL B HG11 1  
ATOM 4710   H HG12 . VAL B 1 70  ? 17.925  16.313  -12.821 1.00 10.33 ? 70  VAL B HG12 1  
ATOM 4711   H HG13 . VAL B 1 70  ? 19.553  16.580  -13.443 1.00 12.20 ? 70  VAL B HG13 1  
ATOM 4712   H HG21 . VAL B 1 70  ? 16.357  18.038  -14.575 1.00 54.24 ? 70  VAL B HG21 1  
ATOM 4713   H HG22 . VAL B 1 70  ? 16.581  19.613  -13.815 1.00 0.00  ? 70  VAL B HG22 1  
ATOM 4714   H HG23 . VAL B 1 70  ? 16.258  18.193  -12.821 1.00 51.13 ? 70  VAL B HG23 1  
ATOM 4715   N N    . VAL B 1 71  ? 20.812  17.731  -11.620 1.00 0.44  ? 71  VAL B N    1  
ATOM 4716   C CA   . VAL B 1 71  ? 22.296  17.539  -11.524 1.00 23.53 ? 71  VAL B CA   1  
ATOM 4717   C C    . VAL B 1 71  ? 22.664  16.103  -11.906 1.00 21.32 ? 71  VAL B C    1  
ATOM 4718   O O    . VAL B 1 71  ? 22.158  15.150  -11.346 1.00 73.20 ? 71  VAL B O    1  
ATOM 4719   C CB   . VAL B 1 71  ? 22.747  17.814  -10.089 1.00 4.35  ? 71  VAL B CB   1  
ATOM 4720   C CG1  . VAL B 1 71  ? 24.274  17.785  -10.020 1.00 44.53 ? 71  VAL B CG1  1  
ATOM 4721   C CG2  . VAL B 1 71  ? 22.246  19.193  -9.653  1.00 42.30 ? 71  VAL B CG2  1  
ATOM 4722   H H    . VAL B 1 71  ? 20.212  17.080  -11.201 1.00 42.32 ? 71  VAL B H    1  
ATOM 4723   H HA   . VAL B 1 71  ? 22.801  18.219  -12.192 1.00 31.11 ? 71  VAL B HA   1  
ATOM 4724   H HB   . VAL B 1 71  ? 22.343  17.057  -9.432  1.00 34.33 ? 71  VAL B HB   1  
ATOM 4725   H HG11 . VAL B 1 71  ? 24.620  16.768  -10.137 1.00 35.42 ? 71  VAL B HG11 1  
ATOM 4726   H HG12 . VAL B 1 71  ? 24.596  18.167  -9.065  1.00 42.14 ? 71  VAL B HG12 1  
ATOM 4727   H HG13 . VAL B 1 71  ? 24.683  18.398  -10.810 1.00 14.31 ? 71  VAL B HG13 1  
ATOM 4728   H HG21 . VAL B 1 71  ? 21.174  19.239  -9.769  1.00 64.43 ? 71  VAL B HG21 1  
ATOM 4729   H HG22 . VAL B 1 71  ? 22.708  19.954  -10.264 1.00 64.24 ? 71  VAL B HG22 1  
ATOM 4730   H HG23 . VAL B 1 71  ? 22.503  19.358  -8.617  1.00 2.14  ? 71  VAL B HG23 1  
ATOM 4731   N N    . LEU B 1 72  ? 23.552  15.950  -12.857 1.00 60.24 ? 72  LEU B N    1  
ATOM 4732   C CA   . LEU B 1 72  ? 23.985  14.588  -13.307 1.00 12.11 ? 72  LEU B CA   1  
ATOM 4733   C C    . LEU B 1 72  ? 25.496  14.464  -13.122 1.00 54.42 ? 72  LEU B C    1  
ATOM 4734   O O    . LEU B 1 72  ? 26.278  14.896  -13.944 1.00 33.33 ? 72  LEU B O    1  
ATOM 4735   C CB   . LEU B 1 72  ? 23.630  14.434  -14.789 1.00 30.32 ? 72  LEU B CB   1  
ATOM 4736   C CG   . LEU B 1 72  ? 23.732  12.961  -15.223 1.00 63.20 ? 72  LEU B CG   1  
ATOM 4737   C CD1  . LEU B 1 72  ? 23.048  12.796  -16.584 1.00 61.35 ? 72  LEU B CD1  1  
ATOM 4738   C CD2  . LEU B 1 72  ? 25.210  12.526  -15.329 1.00 73.34 ? 72  LEU B CD2  1  
ATOM 4739   H H    . LEU B 1 72  ? 23.941  16.742  -13.283 1.00 13.21 ? 72  LEU B H    1  
ATOM 4740   H HA   . LEU B 1 72  ? 23.492  13.817  -12.730 1.00 61.51 ? 72  LEU B HA   1  
ATOM 4741   H HB2  . LEU B 1 72  ? 22.619  14.785  -14.945 1.00 12.13 ? 72  LEU B HB2  1  
ATOM 4742   H HB3  . LEU B 1 72  ? 24.304  15.032  -15.379 1.00 61.24 ? 72  LEU B HB3  1  
ATOM 4743   H HG   . LEU B 1 72  ? 23.226  12.340  -14.498 1.00 52.34 ? 72  LEU B HG   1  
ATOM 4744   H HD11 . LEU B 1 72  ? 23.579  13.374  -17.326 1.00 52.53 ? 72  LEU B HD11 1  
ATOM 4745   H HD12 . LEU B 1 72  ? 22.028  13.145  -16.519 1.00 51.14 ? 72  LEU B HD12 1  
ATOM 4746   H HD13 . LEU B 1 72  ? 23.055  11.754  -16.866 1.00 13.30 ? 72  LEU B HD13 1  
ATOM 4747   H HD21 . LEU B 1 72  ? 25.554  12.191  -14.362 1.00 21.03 ? 72  LEU B HD21 1  
ATOM 4748   H HD22 . LEU B 1 72  ? 25.820  13.352  -15.659 1.00 54.22 ? 72  LEU B HD22 1  
ATOM 4749   H HD23 . LEU B 1 72  ? 25.302  11.714  -16.037 1.00 45.54 ? 72  LEU B HD23 1  
ATOM 4750   N N    . VAL B 1 73  ? 25.919  13.863  -12.049 1.00 20.15 ? 73  VAL B N    1  
ATOM 4751   C CA   . VAL B 1 73  ? 27.381  13.703  -11.817 1.00 73.50 ? 73  VAL B CA   1  
ATOM 4752   C C    . VAL B 1 73  ? 27.832  12.384  -12.432 1.00 2.04  ? 73  VAL B C    1  
ATOM 4753   O O    . VAL B 1 73  ? 27.043  11.481  -12.608 1.00 50.12 ? 73  VAL B O    1  
ATOM 4754   C CB   . VAL B 1 73  ? 27.660  13.684  -10.313 1.00 72.14 ? 73  VAL B CB   1  
ATOM 4755   C CG1  . VAL B 1 73  ? 26.934  12.499  -9.674  1.00 40.53 ? 73  VAL B CG1  1  
ATOM 4756   C CG2  . VAL B 1 73  ? 29.165  13.547  -10.076 1.00 63.10 ? 73  VAL B CG2  1  
ATOM 4757   H H    . VAL B 1 73  ? 25.275  13.508  -11.398 1.00 23.54 ? 73  VAL B H    1  
ATOM 4758   H HA   . VAL B 1 73  ? 27.922  14.521  -12.275 1.00 62.44 ? 73  VAL B HA   1  
ATOM 4759   H HB   . VAL B 1 73  ? 27.306  14.604  -9.870  1.00 71.10 ? 73  VAL B HB   1  
ATOM 4760   H HG11 . VAL B 1 73  ? 26.928  12.617  -8.600  1.00 3.23  ? 73  VAL B HG11 1  
ATOM 4761   H HG12 . VAL B 1 73  ? 27.444  11.583  -9.932  1.00 64.24 ? 73  VAL B HG12 1  
ATOM 4762   H HG13 . VAL B 1 73  ? 25.918  12.461  -10.038 1.00 22.41 ? 73  VAL B HG13 1  
ATOM 4763   H HG21 . VAL B 1 73  ? 29.380  13.695  -9.027  1.00 23.32 ? 73  VAL B HG21 1  
ATOM 4764   H HG22 . VAL B 1 73  ? 29.691  14.289  -10.659 1.00 61.24 ? 73  VAL B HG22 1  
ATOM 4765   H HG23 . VAL B 1 73  ? 29.488  12.560  -10.373 1.00 34.43 ? 73  VAL B HG23 1  
ATOM 4766   N N    . SER B 1 74  ? 29.092  12.263  -12.760 1.00 31.20 ? 74  SER B N    1  
ATOM 4767   C CA   . SER B 1 74  ? 29.606  10.988  -13.357 1.00 64.34 ? 74  SER B CA   1  
ATOM 4768   C C    . SER B 1 74  ? 30.846  10.555  -12.575 1.00 3.00  ? 74  SER B C    1  
ATOM 4769   O O    . SER B 1 74  ? 31.359  11.297  -11.761 1.00 54.14 ? 74  SER B O    1  
ATOM 4770   C CB   . SER B 1 74  ? 29.947  11.202  -14.831 1.00 21.32 ? 74  SER B CB   1  
ATOM 4771   O OG   . SER B 1 74  ? 28.751  11.153  -15.598 1.00 3.42  ? 74  SER B OG   1  
ATOM 4772   H H    . SER B 1 74  ? 29.709  13.013  -12.607 1.00 71.32 ? 74  SER B H    1  
ATOM 4773   H HA   . SER B 1 74  ? 28.857  10.215  -13.274 1.00 64.13 ? 74  SER B HA   1  
ATOM 4774   H HB2  . SER B 1 74  ? 30.406  12.162  -14.959 1.00 21.40 ? 74  SER B HB2  1  
ATOM 4775   H HB3  . SER B 1 74  ? 30.628  10.429  -15.161 1.00 21.41 ? 74  SER B HB3  1  
ATOM 4776   H HG   . SER B 1 74  ? 28.156  10.527  -15.180 1.00 0.32  ? 74  SER B HG   1  
ATOM 4777   N N    . SER B 1 75  ? 31.324  9.359   -12.788 1.00 70.14 ? 75  SER B N    1  
ATOM 4778   C CA   . SER B 1 75  ? 32.522  8.903   -12.010 1.00 63.54 ? 75  SER B CA   1  
ATOM 4779   C C    . SER B 1 75  ? 33.024  7.562   -12.541 1.00 10.33 ? 75  SER B C    1  
ATOM 4780   O O    . SER B 1 75  ? 32.287  6.601   -12.641 1.00 74.53 ? 75  SER B O    1  
ATOM 4781   C CB   . SER B 1 75  ? 32.146  8.748   -10.535 1.00 22.24 ? 75  SER B CB   1  
ATOM 4782   O OG   . SER B 1 75  ? 33.258  8.223   -9.821  1.00 21.41 ? 75  SER B OG   1  
ATOM 4783   H H    . SER B 1 75  ? 30.888  8.759   -13.447 1.00 53.42 ? 75  SER B H    1  
ATOM 4784   H HA   . SER B 1 75  ? 33.307  9.639   -12.101 1.00 31.41 ? 75  SER B HA   1  
ATOM 4785   H HB2  . SER B 1 75  ? 31.884  9.708   -10.123 1.00 23.44 ? 75  SER B HB2  1  
ATOM 4786   H HB3  . SER B 1 75  ? 31.302  8.078   -10.448 1.00 14.34 ? 75  SER B HB3  1  
ATOM 4787   H HG   . SER B 1 75  ? 33.873  8.942   -9.658  1.00 74.52 ? 75  SER B HG   1  
ATOM 4788   N N    . ASP B 1 76  ? 34.279  7.503   -12.901 1.00 51.42 ? 76  ASP B N    1  
ATOM 4789   C CA   . ASP B 1 76  ? 34.848  6.241   -13.449 1.00 13.44 ? 76  ASP B CA   1  
ATOM 4790   C C    . ASP B 1 76  ? 35.089  5.243   -12.311 1.00 64.50 ? 76  ASP B C    1  
ATOM 4791   O O    . ASP B 1 76  ? 35.888  4.336   -12.431 1.00 22.31 ? 76  ASP B O    1  
ATOM 4792   C CB   . ASP B 1 76  ? 36.178  6.549   -14.140 1.00 41.35 ? 76  ASP B CB   1  
ATOM 4793   C CG   . ASP B 1 76  ? 37.148  7.168   -13.132 1.00 35.14 ? 76  ASP B CG   1  
ATOM 4794   O OD1  . ASP B 1 76  ? 36.825  7.174   -11.955 1.00 15.32 ? 76  ASP B OD1  1  
ATOM 4795   O OD2  . ASP B 1 76  ? 38.198  7.626   -13.553 1.00 60.41 ? 76  ASP B OD2  1  
ATOM 4796   H H    . ASP B 1 76  ? 34.846  8.298   -12.822 1.00 3.14  ? 76  ASP B H    1  
ATOM 4797   H HA   . ASP B 1 76  ? 34.162  5.821   -14.171 1.00 40.21 ? 76  ASP B HA   1  
ATOM 4798   H HB2  . ASP B 1 76  ? 36.600  5.635   -14.533 1.00 25.13 ? 76  ASP B HB2  1  
ATOM 4799   H HB3  . ASP B 1 76  ? 36.011  7.245   -14.949 1.00 44.03 ? 76  ASP B HB3  1  
ATOM 4800   N N    . ASN B 1 77  ? 34.415  5.409   -11.201 1.00 31.12 ? 77  ASN B N    1  
ATOM 4801   C CA   . ASN B 1 77  ? 34.621  4.476   -10.049 1.00 74.25 ? 77  ASN B CA   1  
ATOM 4802   C C    . ASN B 1 77  ? 33.306  4.294   -9.280  1.00 10.01 ? 77  ASN B C    1  
ATOM 4803   O O    . ASN B 1 77  ? 33.232  4.577   -8.101  1.00 72.32 ? 77  ASN B O    1  
ATOM 4804   C CB   . ASN B 1 77  ? 35.672  5.071   -9.110  1.00 65.32 ? 77  ASN B CB   1  
ATOM 4805   C CG   . ASN B 1 77  ? 36.153  3.998   -8.131  1.00 0.02  ? 77  ASN B CG   1  
ATOM 4806   O OD1  . ASN B 1 77  ? 35.821  2.837   -8.273  1.00 10.03 ? 77  ASN B OD1  1  
ATOM 4807   N ND2  . ASN B 1 77  ? 36.927  4.338   -7.138  1.00 45.33 ? 77  ASN B ND2  1  
ATOM 4808   H H    . ASN B 1 77  ? 33.783  6.153   -11.120 1.00 4.14  ? 77  ASN B H    1  
ATOM 4809   H HA   . ASN B 1 77  ? 34.968  3.517   -10.406 1.00 31.24 ? 77  ASN B HA   1  
ATOM 4810   H HB2  . ASN B 1 77  ? 36.508  5.430   -9.691  1.00 22.43 ? 77  ASN B HB2  1  
ATOM 4811   H HB3  . ASN B 1 77  ? 35.239  5.891   -8.557  1.00 45.02 ? 77  ASN B HB3  1  
ATOM 4812   H HD21 . ASN B 1 77  ? 37.194  5.274   -7.023  1.00 44.35 ? 77  ASN B HD21 1  
ATOM 4813   H HD22 . ASN B 1 77  ? 37.240  3.658   -6.506  1.00 65.45 ? 77  ASN B HD22 1  
ATOM 4814   N N    . PRO B 1 78  ? 32.275  3.826   -9.937  1.00 21.31 ? 78  PRO B N    1  
ATOM 4815   C CA   . PRO B 1 78  ? 30.947  3.608   -9.291  1.00 25.01 ? 78  PRO B CA   1  
ATOM 4816   C C    . PRO B 1 78  ? 31.038  2.653   -8.101  1.00 11.43 ? 78  PRO B C    1  
ATOM 4817   O O    . PRO B 1 78  ? 30.770  1.473   -8.205  1.00 25.41 ? 78  PRO B O    1  
ATOM 4818   C CB   . PRO B 1 78  ? 30.058  3.036   -10.417 1.00 74.43 ? 78  PRO B CB   1  
ATOM 4819   C CG   . PRO B 1 78  ? 31.008  2.581   -11.485 1.00 43.40 ? 78  PRO B CG   1  
ATOM 4820   C CD   . PRO B 1 78  ? 32.254  3.459   -11.359 1.00 43.35 ? 78  PRO B CD   1  
ATOM 4821   H HA   . PRO B 1 78  ? 30.545  4.548   -8.954  1.00 21.30 ? 78  PRO B HA   1  
ATOM 4822   H HB2  . PRO B 1 78  ? 29.467  2.204   -10.052 1.00 21.42 ? 78  PRO B HB2  1  
ATOM 4823   H HB3  . PRO B 1 78  ? 29.406  3.805   -10.808 1.00 31.20 ? 78  PRO B HB3  1  
ATOM 4824   H HG2  . PRO B 1 78  ? 31.267  1.541   -11.333 1.00 71.44 ? 78  PRO B HG2  1  
ATOM 4825   H HG3  . PRO B 1 78  ? 30.568  2.713   -12.463 1.00 12.23 ? 78  PRO B HG3  1  
ATOM 4826   H HD2  . PRO B 1 78  ? 33.137  2.899   -11.629 1.00 60.31 ? 78  PRO B HD2  1  
ATOM 4827   H HD3  . PRO B 1 78  ? 32.163  4.344   -11.965 1.00 4.44  ? 78  PRO B HD3  1  
ATOM 4828   N N    . THR B 1 79  ? 31.403  3.180   -6.965  1.00 22.22 ? 79  THR B N    1  
ATOM 4829   C CA   . THR B 1 79  ? 31.510  2.354   -5.727  1.00 53.42 ? 79  THR B CA   1  
ATOM 4830   C C    . THR B 1 79  ? 30.349  2.716   -4.804  1.00 14.41 ? 79  THR B C    1  
ATOM 4831   O O    . THR B 1 79  ? 29.734  3.754   -4.946  1.00 73.12 ? 79  THR B O    1  
ATOM 4832   C CB   . THR B 1 79  ? 32.836  2.658   -5.024  1.00 52.55 ? 79  THR B CB   1  
ATOM 4833   O OG1  . THR B 1 79  ? 32.911  4.047   -4.738  1.00 44.45 ? 79  THR B OG1  1  
ATOM 4834   C CG2  . THR B 1 79  ? 34.000  2.257   -5.930  1.00 63.14 ? 79  THR B CG2  1  
ATOM 4835   H H    . THR B 1 79  ? 31.596  4.139   -6.923  1.00 15.44 ? 79  THR B H    1  
ATOM 4836   H HA   . THR B 1 79  ? 31.463  1.301   -5.973  1.00 44.34 ? 79  THR B HA   1  
ATOM 4837   H HB   . THR B 1 79  ? 32.892  2.097   -4.104  1.00 71.01 ? 79  THR B HB   1  
ATOM 4838   H HG1  . THR B 1 79  ? 33.058  4.513   -5.564  1.00 32.15 ? 79  THR B HG1  1  
ATOM 4839   H HG21 . THR B 1 79  ? 33.815  2.612   -6.933  1.00 64.24 ? 79  THR B HG21 1  
ATOM 4840   H HG22 . THR B 1 79  ? 34.093  1.181   -5.942  1.00 3.41  ? 79  THR B HG22 1  
ATOM 4841   H HG23 . THR B 1 79  ? 34.915  2.693   -5.556  1.00 3.22  ? 79  THR B HG23 1  
ATOM 4842   N N    . SER B 1 80  ? 30.038  1.872   -3.867  1.00 54.32 ? 80  SER B N    1  
ATOM 4843   C CA   . SER B 1 80  ? 28.909  2.172   -2.947  1.00 11.02 ? 80  SER B CA   1  
ATOM 4844   C C    . SER B 1 80  ? 29.224  3.431   -2.133  1.00 52.41 ? 80  SER B C    1  
ATOM 4845   O O    . SER B 1 80  ? 28.337  4.097   -1.638  1.00 61.42 ? 80  SER B O    1  
ATOM 4846   C CB   . SER B 1 80  ? 28.699  0.981   -2.011  1.00 71.01 ? 80  SER B CB   1  
ATOM 4847   O OG   . SER B 1 80  ? 29.401  1.200   -0.794  1.00 32.52 ? 80  SER B OG   1  
ATOM 4848   H H    . SER B 1 80  ? 30.541  1.037   -3.771  1.00 2.45  ? 80  SER B H    1  
ATOM 4849   H HA   . SER B 1 80  ? 28.010  2.341   -3.523  1.00 22.30 ? 80  SER B HA   1  
ATOM 4850   H HB2  . SER B 1 80  ? 27.652  0.868   -1.802  1.00 32.24 ? 80  SER B HB2  1  
ATOM 4851   H HB3  . SER B 1 80  ? 29.064  0.082   -2.492  1.00 53.00 ? 80  SER B HB3  1  
ATOM 4852   H HG   . SER B 1 80  ? 30.326  0.988   -0.943  1.00 75.41 ? 80  SER B HG   1  
ATOM 4853   N N    . GLU B 1 81  ? 30.477  3.766   -1.992  1.00 63.20 ? 81  GLU B N    1  
ATOM 4854   C CA   . GLU B 1 81  ? 30.836  4.984   -1.213  1.00 33.30 ? 81  GLU B CA   1  
ATOM 4855   C C    . GLU B 1 81  ? 30.395  6.231   -1.985  1.00 14.31 ? 81  GLU B C    1  
ATOM 4856   O O    . GLU B 1 81  ? 29.797  7.136   -1.435  1.00 50.13 ? 81  GLU B O    1  
ATOM 4857   C CB   . GLU B 1 81  ? 32.350  5.025   -0.998  1.00 34.32 ? 81  GLU B CB   1  
ATOM 4858   C CG   . GLU B 1 81  ? 32.774  3.833   -0.137  1.00 11.54 ? 81  GLU B CG   1  
ATOM 4859   C CD   . GLU B 1 81  ? 34.280  3.902   0.126   1.00 41.15 ? 81  GLU B CD   1  
ATOM 4860   O OE1  . GLU B 1 81  ? 34.925  4.755   -0.462  1.00 44.01 ? 81  GLU B OE1  1  
ATOM 4861   O OE2  . GLU B 1 81  ? 34.761  3.101   0.910   1.00 33.22 ? 81  GLU B OE2  1  
ATOM 4862   H H    . GLU B 1 81  ? 31.181  3.219   -2.401  1.00 41.40 ? 81  GLU B H    1  
ATOM 4863   H HA   . GLU B 1 81  ? 30.337  4.959   -0.255  1.00 44.11 ? 81  GLU B HA   1  
ATOM 4864   H HB2  . GLU B 1 81  ? 32.850  4.976   -1.954  1.00 31.03 ? 81  GLU B HB2  1  
ATOM 4865   H HB3  . GLU B 1 81  ? 32.619  5.942   -0.497  1.00 72.24 ? 81  GLU B HB3  1  
ATOM 4866   H HG2  . GLU B 1 81  ? 32.242  3.862   0.803   1.00 1.21  ? 81  GLU B HG2  1  
ATOM 4867   H HG3  . GLU B 1 81  ? 32.543  2.914   -0.654  1.00 42.10 ? 81  GLU B HG3  1  
ATOM 4868   N N    . GLU B 1 82  ? 30.684  6.285   -3.257  1.00 41.04 ? 82  GLU B N    1  
ATOM 4869   C CA   . GLU B 1 82  ? 30.280  7.471   -4.065  1.00 11.15 ? 82  GLU B CA   1  
ATOM 4870   C C    . GLU B 1 82  ? 28.768  7.443   -4.296  1.00 33.33 ? 82  GLU B C    1  
ATOM 4871   O O    . GLU B 1 82  ? 28.135  8.466   -4.466  1.00 73.22 ? 82  GLU B O    1  
ATOM 4872   C CB   . GLU B 1 82  ? 31.002  7.440   -5.414  1.00 4.15  ? 82  GLU B CB   1  
ATOM 4873   C CG   . GLU B 1 82  ? 32.490  7.723   -5.203  1.00 22.25 ? 82  GLU B CG   1  
ATOM 4874   C CD   . GLU B 1 82  ? 33.206  7.728   -6.555  1.00 12.12 ? 82  GLU B CD   1  
ATOM 4875   O OE1  . GLU B 1 82  ? 32.570  7.390   -7.540  1.00 15.30 ? 82  GLU B OE1  1  
ATOM 4876   O OE2  . GLU B 1 82  ? 34.377  8.069   -6.582  1.00 63.53 ? 82  GLU B OE2  1  
ATOM 4877   H H    . GLU B 1 82  ? 31.166  5.545   -3.681  1.00 23.10 ? 82  GLU B H    1  
ATOM 4878   H HA   . GLU B 1 82  ? 30.547  8.373   -3.537  1.00 71.11 ? 82  GLU B HA   1  
ATOM 4879   H HB2  . GLU B 1 82  ? 30.880  6.466   -5.865  1.00 72.52 ? 82  GLU B HB2  1  
ATOM 4880   H HB3  . GLU B 1 82  ? 30.583  8.193   -6.064  1.00 13.01 ? 82  GLU B HB3  1  
ATOM 4881   H HG2  . GLU B 1 82  ? 32.609  8.686   -4.727  1.00 21.00 ? 82  GLU B HG2  1  
ATOM 4882   H HG3  . GLU B 1 82  ? 32.917  6.956   -4.574  1.00 34.33 ? 82  GLU B HG3  1  
ATOM 4883   N N    . GLU B 1 83  ? 28.185  6.275   -4.311  1.00 1.31  ? 83  GLU B N    1  
ATOM 4884   C CA   . GLU B 1 83  ? 26.716  6.173   -4.540  1.00 42.14 ? 83  GLU B CA   1  
ATOM 4885   C C    . GLU B 1 83  ? 25.962  6.892   -3.416  1.00 32.21 ? 83  GLU B C    1  
ATOM 4886   O O    . GLU B 1 83  ? 25.135  7.751   -3.659  1.00 74.30 ? 83  GLU B O    1  
ATOM 4887   C CB   . GLU B 1 83  ? 26.313  4.696   -4.558  1.00 73.22 ? 83  GLU B CB   1  
ATOM 4888   C CG   . GLU B 1 83  ? 24.910  4.551   -5.153  1.00 33.43 ? 83  GLU B CG   1  
ATOM 4889   C CD   . GLU B 1 83  ? 24.967  4.783   -6.665  1.00 34.22 ? 83  GLU B CD   1  
ATOM 4890   O OE1  . GLU B 1 83  ? 26.050  4.694   -7.220  1.00 62.44 ? 83  GLU B OE1  1  
ATOM 4891   O OE2  . GLU B 1 83  ? 23.925  5.044   -7.243  1.00 12.32 ? 83  GLU B OE2  1  
ATOM 4892   H H    . GLU B 1 83  ? 28.716  5.463   -4.178  1.00 20.31 ? 83  GLU B H    1  
ATOM 4893   H HA   . GLU B 1 83  ? 26.466  6.625   -5.488  1.00 0.21  ? 83  GLU B HA   1  
ATOM 4894   H HB2  . GLU B 1 83  ? 27.019  4.139   -5.155  1.00 31.40 ? 83  GLU B HB2  1  
ATOM 4895   H HB3  . GLU B 1 83  ? 26.314  4.311   -3.549  1.00 41.33 ? 83  GLU B HB3  1  
ATOM 4896   H HG2  . GLU B 1 83  ? 24.537  3.557   -4.954  1.00 33.03 ? 83  GLU B HG2  1  
ATOM 4897   H HG3  . GLU B 1 83  ? 24.252  5.280   -4.704  1.00 2.34  ? 83  GLU B HG3  1  
ATOM 4898   N N    . VAL B 1 84  ? 26.235  6.544   -2.189  1.00 15.43 ? 84  VAL B N    1  
ATOM 4899   C CA   . VAL B 1 84  ? 25.528  7.199   -1.053  1.00 32.22 ? 84  VAL B CA   1  
ATOM 4900   C C    . VAL B 1 84  ? 25.914  8.679   -0.983  1.00 73.31 ? 84  VAL B C    1  
ATOM 4901   O O    . VAL B 1 84  ? 25.095  9.527   -0.690  1.00 64.32 ? 84  VAL B O    1  
ATOM 4902   C CB   . VAL B 1 84  ? 25.914  6.507   0.256   1.00 12.13 ? 84  VAL B CB   1  
ATOM 4903   C CG1  . VAL B 1 84  ? 25.428  5.056   0.229   1.00 20.22 ? 84  VAL B CG1  1  
ATOM 4904   C CG2  . VAL B 1 84  ? 27.435  6.528   0.418   1.00 65.32 ? 84  VAL B CG2  1  
ATOM 4905   H H    . VAL B 1 84  ? 26.901  5.847   -2.014  1.00 64.41 ? 84  VAL B H    1  
ATOM 4906   H HA   . VAL B 1 84  ? 24.462  7.115   -1.201  1.00 3.32  ? 84  VAL B HA   1  
ATOM 4907   H HB   . VAL B 1 84  ? 25.454  7.025   1.086   1.00 34.13 ? 84  VAL B HB   1  
ATOM 4908   H HG11 . VAL B 1 84  ? 25.573  4.610   1.201   1.00 42.24 ? 84  VAL B HG11 1  
ATOM 4909   H HG12 . VAL B 1 84  ? 25.990  4.503   -0.509  1.00 5.04  ? 84  VAL B HG12 1  
ATOM 4910   H HG13 . VAL B 1 84  ? 24.379  5.033   -0.025  1.00 4.54  ? 84  VAL B HG13 1  
ATOM 4911   H HG21 . VAL B 1 84  ? 27.767  7.544   0.573   1.00 62.21 ? 84  VAL B HG21 1  
ATOM 4912   H HG22 . VAL B 1 84  ? 27.897  6.130   -0.473  1.00 0.52  ? 84  VAL B HG22 1  
ATOM 4913   H HG23 . VAL B 1 84  ? 27.715  5.925   1.269   1.00 41.12 ? 84  VAL B HG23 1  
ATOM 4914   N N    . HIS B 1 85  ? 27.151  9.000   -1.247  1.00 21.10 ? 85  HIS B N    1  
ATOM 4915   C CA   . HIS B 1 85  ? 27.575  10.428  -1.189  1.00 5.40  ? 85  HIS B CA   1  
ATOM 4916   C C    . HIS B 1 85  ? 26.889  11.218  -2.307  1.00 2.12  ? 85  HIS B C    1  
ATOM 4917   O O    . HIS B 1 85  ? 26.549  12.370  -2.143  1.00 73.24 ? 85  HIS B O    1  
ATOM 4918   C CB   . HIS B 1 85  ? 29.096  10.520  -1.355  1.00 61.12 ? 85  HIS B CB   1  
ATOM 4919   C CG   . HIS B 1 85  ? 29.772  10.144  -0.065  1.00 55.40 ? 85  HIS B CG   1  
ATOM 4920   N ND1  . HIS B 1 85  ? 30.412  8.925   0.111   1.00 50.45 ? 85  HIS B ND1  1  
ATOM 4921   C CD2  . HIS B 1 85  ? 29.914  10.818  1.123   1.00 13.42 ? 85  HIS B CD2  1  
ATOM 4922   C CE1  . HIS B 1 85  ? 30.907  8.904   1.363   1.00 23.12 ? 85  HIS B CE1  1  
ATOM 4923   N NE2  . HIS B 1 85  ? 30.630  10.033  2.018   1.00 63.41 ? 85  HIS B NE2  1  
ATOM 4924   H H    . HIS B 1 85  ? 27.800  8.303   -1.479  1.00 65.11 ? 85  HIS B H    1  
ATOM 4925   H HA   . HIS B 1 85  ? 27.291  10.846  -0.234  1.00 4.43  ? 85  HIS B HA   1  
ATOM 4926   H HB2  . HIS B 1 85  ? 29.412  9.847   -2.136  1.00 12.54 ? 85  HIS B HB2  1  
ATOM 4927   H HB3  . HIS B 1 85  ? 29.371  11.531  -1.621  1.00 24.42 ? 85  HIS B HB3  1  
ATOM 4928   H HD1  . HIS B 1 85  ? 30.491  8.211   -0.555  1.00 14.52 ? 85  HIS B HD1  1  
ATOM 4929   H HD2  . HIS B 1 85  ? 29.529  11.806  1.328   1.00 71.25 ? 85  HIS B HD2  1  
ATOM 4930   H HE1  . HIS B 1 85  ? 31.458  8.077   1.784   1.00 12.21 ? 85  HIS B HE1  1  
ATOM 4931   H HE2  . HIS B 1 85  ? 30.879  10.260  2.939   1.00 0.00  ? 85  HIS B HE2  1  
ATOM 4932   N N    . ALA B 1 86  ? 26.691  10.616  -3.446  1.00 1.43  ? 86  ALA B N    1  
ATOM 4933   C CA   . ALA B 1 86  ? 26.038  11.349  -4.567  1.00 40.42 ? 86  ALA B CA   1  
ATOM 4934   C C    . ALA B 1 86  ? 24.592  11.696  -4.196  1.00 22.22 ? 86  ALA B C    1  
ATOM 4935   O O    . ALA B 1 86  ? 24.119  12.787  -4.458  1.00 45.34 ? 86  ALA B O    1  
ATOM 4936   C CB   . ALA B 1 86  ? 26.049  10.474  -5.821  1.00 55.33 ? 86  ALA B CB   1  
ATOM 4937   H H    . ALA B 1 86  ? 26.978  9.687   -3.567  1.00 20.31 ? 86  ALA B H    1  
ATOM 4938   H HA   . ALA B 1 86  ? 26.584  12.260  -4.763  1.00 50.05 ? 86  ALA B HA   1  
ATOM 4939   H HB1  . ALA B 1 86  ? 25.470  10.950  -6.598  1.00 30.12 ? 86  ALA B HB1  1  
ATOM 4940   H HB2  . ALA B 1 86  ? 25.619  9.510   -5.591  1.00 2.32  ? 86  ALA B HB2  1  
ATOM 4941   H HB3  . ALA B 1 86  ? 27.067  10.343  -6.159  1.00 22.15 ? 86  ALA B HB3  1  
ATOM 4942   N N    . PHE B 1 87  ? 23.883  10.782  -3.587  1.00 51.22 ? 87  PHE B N    1  
ATOM 4943   C CA   . PHE B 1 87  ? 22.472  11.069  -3.207  1.00 61.13 ? 87  PHE B CA   1  
ATOM 4944   C C    . PHE B 1 87  ? 22.448  11.853  -1.897  1.00 61.54 ? 87  PHE B C    1  
ATOM 4945   O O    . PHE B 1 87  ? 21.616  12.714  -1.693  1.00 74.14 ? 87  PHE B O    1  
ATOM 4946   C CB   . PHE B 1 87  ? 21.711  9.754   -3.026  1.00 33.54 ? 87  PHE B CB   1  
ATOM 4947   C CG   . PHE B 1 87  ? 21.451  9.130   -4.378  1.00 24.04 ? 87  PHE B CG   1  
ATOM 4948   C CD1  . PHE B 1 87  ? 20.597  9.766   -5.287  1.00 54.35 ? 87  PHE B CD1  1  
ATOM 4949   C CD2  . PHE B 1 87  ? 22.060  7.916   -4.725  1.00 43.33 ? 87  PHE B CD2  1  
ATOM 4950   C CE1  . PHE B 1 87  ? 20.352  9.191   -6.540  1.00 2.33  ? 87  PHE B CE1  1  
ATOM 4951   C CE2  . PHE B 1 87  ? 21.815  7.341   -5.977  1.00 21.13 ? 87  PHE B CE2  1  
ATOM 4952   C CZ   . PHE B 1 87  ? 20.961  7.979   -6.885  1.00 33.55 ? 87  PHE B CZ   1  
ATOM 4953   H H    . PHE B 1 87  ? 24.278  9.910   -3.378  1.00 24.14 ? 87  PHE B H    1  
ATOM 4954   H HA   . PHE B 1 87  ? 22.000  11.653  -3.984  1.00 24.00 ? 87  PHE B HA   1  
ATOM 4955   H HB2  . PHE B 1 87  ? 22.299  9.080   -2.419  1.00 21.23 ? 87  PHE B HB2  1  
ATOM 4956   H HB3  . PHE B 1 87  ? 20.769  9.949   -2.534  1.00 52.30 ? 87  PHE B HB3  1  
ATOM 4957   H HD1  . PHE B 1 87  ? 20.126  10.701  -5.022  1.00 54.23 ? 87  PHE B HD1  1  
ATOM 4958   H HD2  . PHE B 1 87  ? 22.719  7.423   -4.025  1.00 22.12 ? 87  PHE B HD2  1  
ATOM 4959   H HE1  . PHE B 1 87  ? 19.694  9.683   -7.240  1.00 35.11 ? 87  PHE B HE1  1  
ATOM 4960   H HE2  . PHE B 1 87  ? 22.284  6.406   -6.244  1.00 33.02 ? 87  PHE B HE2  1  
ATOM 4961   H HZ   . PHE B 1 87  ? 20.772  7.536   -7.851  1.00 74.45 ? 87  PHE B HZ   1  
ATOM 4962   N N    . GLU B 1 88  ? 23.350  11.558  -1.004  1.00 34.51 ? 88  GLU B N    1  
ATOM 4963   C CA   . GLU B 1 88  ? 23.368  12.285  0.292   1.00 33.31 ? 88  GLU B CA   1  
ATOM 4964   C C    . GLU B 1 88  ? 23.840  13.724  0.072   1.00 53.50 ? 88  GLU B C    1  
ATOM 4965   O O    . GLU B 1 88  ? 23.260  14.661  0.585   1.00 44.04 ? 88  GLU B O    1  
ATOM 4966   C CB   . GLU B 1 88  ? 24.313  11.579  1.267   1.00 44.13 ? 88  GLU B CB   1  
ATOM 4967   C CG   . GLU B 1 88  ? 23.682  10.265  1.734   1.00 32.41 ? 88  GLU B CG   1  
ATOM 4968   C CD   . GLU B 1 88  ? 22.492  10.564  2.648   1.00 64.04 ? 88  GLU B CD   1  
ATOM 4969   O OE1  . GLU B 1 88  ? 22.331  11.715  3.020   1.00 25.34 ? 88  GLU B OE1  1  
ATOM 4970   O OE2  . GLU B 1 88  ? 21.764  9.637   2.963   1.00 53.43 ? 88  GLU B OE2  1  
ATOM 4971   H H    . GLU B 1 88  ? 24.010  10.857  -1.185  1.00 31.11 ? 88  GLU B H    1  
ATOM 4972   H HA   . GLU B 1 88  ? 22.372  12.294  0.702   1.00 14.53 ? 88  GLU B HA   1  
ATOM 4973   H HB2  . GLU B 1 88  ? 25.250  11.372  0.772   1.00 42.23 ? 88  GLU B HB2  1  
ATOM 4974   H HB3  . GLU B 1 88  ? 24.489  12.214  2.121   1.00 34.13 ? 88  GLU B HB3  1  
ATOM 4975   H HG2  . GLU B 1 88  ? 23.343  9.703   0.875   1.00 24.12 ? 88  GLU B HG2  1  
ATOM 4976   H HG3  . GLU B 1 88  ? 24.414  9.686   2.277   1.00 3.25  ? 88  GLU B HG3  1  
ATOM 4977   N N    . GLN B 1 89  ? 24.887  13.912  -0.685  1.00 1.31  ? 89  GLN B N    1  
ATOM 4978   C CA   . GLN B 1 89  ? 25.385  15.295  -0.929  1.00 21.52 ? 89  GLN B CA   1  
ATOM 4979   C C    . GLN B 1 89  ? 24.325  16.091  -1.690  1.00 64.31 ? 89  GLN B C    1  
ATOM 4980   O O    . GLN B 1 89  ? 23.964  17.184  -1.300  1.00 5.14  ? 89  GLN B O    1  
ATOM 4981   C CB   . GLN B 1 89  ? 26.674  15.245  -1.752  1.00 24.33 ? 89  GLN B CB   1  
ATOM 4982   C CG   . GLN B 1 89  ? 27.790  14.610  -0.918  1.00 15.02 ? 89  GLN B CG   1  
ATOM 4983   C CD   . GLN B 1 89  ? 28.268  15.607  0.139   1.00 72.35 ? 89  GLN B CD   1  
ATOM 4984   O OE1  . GLN B 1 89  ? 28.476  16.768  -0.153  1.00 34.21 ? 89  GLN B OE1  1  
ATOM 4985   N NE2  . GLN B 1 89  ? 28.453  15.200  1.366   1.00 23.55 ? 89  GLN B NE2  1  
ATOM 4986   H H    . GLN B 1 89  ? 25.344  13.146  -1.090  1.00 75.13 ? 89  GLN B H    1  
ATOM 4987   H HA   . GLN B 1 89  ? 25.583  15.776  0.017   1.00 21.03 ? 89  GLN B HA   1  
ATOM 4988   H HB2  . GLN B 1 89  ? 26.510  14.658  -2.644  1.00 31.31 ? 89  GLN B HB2  1  
ATOM 4989   H HB3  . GLN B 1 89  ? 26.962  16.248  -2.030  1.00 72.33 ? 89  GLN B HB3  1  
ATOM 4990   H HG2  . GLN B 1 89  ? 27.414  13.723  -0.431  1.00 21.11 ? 89  GLN B HG2  1  
ATOM 4991   H HG3  . GLN B 1 89  ? 28.616  14.346  -1.561  1.00 14.02 ? 89  GLN B HG3  1  
ATOM 4992   H HE21 . GLN B 1 89  ? 28.285  14.264  1.602   1.00 42.42 ? 89  GLN B HE21 1  
ATOM 4993   H HE22 . GLN B 1 89  ? 28.759  15.831  2.050   1.00 44.23 ? 89  GLN B HE22 1  
ATOM 4994   N N    . GLY B 1 90  ? 23.815  15.554  -2.772  1.00 65.20 ? 90  GLY B N    1  
ATOM 4995   C CA   . GLY B 1 90  ? 22.770  16.285  -3.554  1.00 33.21 ? 90  GLY B CA   1  
ATOM 4996   C C    . GLY B 1 90  ? 22.978  16.057  -5.054  1.00 32.51 ? 90  GLY B C    1  
ATOM 4997   O O    . GLY B 1 90  ? 23.407  16.940  -5.769  1.00 31.34 ? 90  GLY B O    1  
ATOM 4998   H H    . GLY B 1 90  ? 24.117  14.668  -3.069  1.00 63.11 ? 90  GLY B H    1  
ATOM 4999   H HA2  . GLY B 1 90  ? 21.793  15.923  -3.271  1.00 52.40 ? 90  GLY B HA2  1  
ATOM 5000   H HA3  . GLY B 1 90  ? 22.830  17.343  -3.346  1.00 75.42 ? 90  GLY B HA3  1  
ATOM 5001   N N    . ALA B 1 91  ? 22.666  14.880  -5.536  1.00 45.22 ? 91  ALA B N    1  
ATOM 5002   C CA   . ALA B 1 91  ? 22.826  14.578  -6.996  1.00 14.33 ? 91  ALA B CA   1  
ATOM 5003   C C    . ALA B 1 91  ? 21.507  14.017  -7.531  1.00 30.44 ? 91  ALA B C    1  
ATOM 5004   O O    . ALA B 1 91  ? 20.921  13.130  -6.943  1.00 52.23 ? 91  ALA B O    1  
ATOM 5005   C CB   . ALA B 1 91  ? 23.932  13.537  -7.181  1.00 50.20 ? 91  ALA B CB   1  
ATOM 5006   H H    . ALA B 1 91  ? 22.316  14.188  -4.935  1.00 20.31 ? 91  ALA B H    1  
ATOM 5007   H HA   . ALA B 1 91  ? 23.080  15.477  -7.542  1.00 34.50 ? 91  ALA B HA   1  
ATOM 5008   H HB1  . ALA B 1 91  ? 23.612  12.594  -6.763  1.00 30.04 ? 91  ALA B HB1  1  
ATOM 5009   H HB2  . ALA B 1 91  ? 24.827  13.869  -6.676  1.00 73.42 ? 91  ALA B HB2  1  
ATOM 5010   H HB3  . ALA B 1 91  ? 24.137  13.413  -8.234  1.00 70.00 ? 91  ALA B HB3  1  
ATOM 5011   N N    . ASP B 1 92  ? 21.030  14.519  -8.640  1.00 5.24  ? 92  ASP B N    1  
ATOM 5012   C CA   . ASP B 1 92  ? 19.749  13.992  -9.188  1.00 32.22 ? 92  ASP B CA   1  
ATOM 5013   C C    . ASP B 1 92  ? 19.981  12.575  -9.709  1.00 65.24 ? 92  ASP B C    1  
ATOM 5014   O O    . ASP B 1 92  ? 19.189  11.681  -9.487  1.00 63.11 ? 92  ASP B O    1  
ATOM 5015   C CB   . ASP B 1 92  ? 19.265  14.889  -10.331 1.00 35.44 ? 92  ASP B CB   1  
ATOM 5016   C CG   . ASP B 1 92  ? 17.798  14.579  -10.637 1.00 73.32 ? 92  ASP B CG   1  
ATOM 5017   O OD1  . ASP B 1 92  ? 17.553  13.638  -11.374 1.00 0.33  ? 92  ASP B OD1  1  
ATOM 5018   O OD2  . ASP B 1 92  ? 16.945  15.287  -10.128 1.00 31.33 ? 92  ASP B OD2  1  
ATOM 5019   H H    . ASP B 1 92  ? 21.514  15.233  -9.111  1.00 32.41 ? 92  ASP B H    1  
ATOM 5020   H HA   . ASP B 1 92  ? 19.005  13.971  -8.405  1.00 34.10 ? 92  ASP B HA   1  
ATOM 5021   H HB2  . ASP B 1 92  ? 19.362  15.925  -10.041 1.00 20.43 ? 92  ASP B HB2  1  
ATOM 5022   H HB3  . ASP B 1 92  ? 19.860  14.704  -11.212 1.00 54.52 ? 92  ASP B HB3  1  
ATOM 5023   N N    . ASP B 1 93  ? 21.071  12.366  -10.394 1.00 54.54 ? 93  ASP B N    1  
ATOM 5024   C CA   . ASP B 1 93  ? 21.378  11.010  -10.928 1.00 64.40 ? 93  ASP B CA   1  
ATOM 5025   C C    . ASP B 1 93  ? 22.892  10.869  -11.092 1.00 11.12 ? 93  ASP B C    1  
ATOM 5026   O O    . ASP B 1 93  ? 23.601  11.845  -11.263 1.00 51.34 ? 93  ASP B O    1  
ATOM 5027   C CB   . ASP B 1 93  ? 20.689  10.817  -12.283 1.00 72.22 ? 93  ASP B CB   1  
ATOM 5028   C CG   . ASP B 1 93  ? 20.986  12.009  -13.197 1.00 11.24 ? 93  ASP B CG   1  
ATOM 5029   O OD1  . ASP B 1 93  ? 21.261  13.078  -12.679 1.00 33.12 ? 93  ASP B OD1  1  
ATOM 5030   O OD2  . ASP B 1 93  ? 20.931  11.831  -14.403 1.00 64.41 ? 93  ASP B OD2  1  
ATOM 5031   H H    . ASP B 1 93  ? 21.696  13.105  -10.552 1.00 73.04 ? 93  ASP B H    1  
ATOM 5032   H HA   . ASP B 1 93  ? 21.024  10.260  -10.235 1.00 62.34 ? 93  ASP B HA   1  
ATOM 5033   H HB2  . ASP B 1 93  ? 21.054  9.911   -12.744 1.00 33.12 ? 93  ASP B HB2  1  
ATOM 5034   H HB3  . ASP B 1 93  ? 19.622  10.739  -12.134 1.00 14.53 ? 93  ASP B HB3  1  
ATOM 5035   N N    . TYR B 1 94  ? 23.393  9.657   -11.037 1.00 64.42 ? 94  TYR B N    1  
ATOM 5036   C CA   . TYR B 1 94  ? 24.866  9.426   -11.184 1.00 25.15 ? 94  TYR B CA   1  
ATOM 5037   C C    . TYR B 1 94  ? 25.102  8.375   -12.279 1.00 62.12 ? 94  TYR B C    1  
ATOM 5038   O O    . TYR B 1 94  ? 24.568  7.285   -12.221 1.00 13.31 ? 94  TYR B O    1  
ATOM 5039   C CB   . TYR B 1 94  ? 25.433  8.931   -9.832  1.00 14.01 ? 94  TYR B CB   1  
ATOM 5040   C CG   . TYR B 1 94  ? 26.717  8.146   -10.039 1.00 1.23  ? 94  TYR B CG   1  
ATOM 5041   C CD1  . TYR B 1 94  ? 27.640  8.561   -11.002 1.00 60.11 ? 94  TYR B CD1  1  
ATOM 5042   C CD2  . TYR B 1 94  ? 26.972  6.996   -9.279  1.00 43.42 ? 94  TYR B CD2  1  
ATOM 5043   C CE1  . TYR B 1 94  ? 28.810  7.837   -11.209 1.00 62.13 ? 94  TYR B CE1  1  
ATOM 5044   C CE2  . TYR B 1 94  ? 28.152  6.268   -9.490  1.00 1.04  ? 94  TYR B CE2  1  
ATOM 5045   C CZ   . TYR B 1 94  ? 29.070  6.694   -10.461 1.00 23.10 ? 94  TYR B CZ   1  
ATOM 5046   O OH   . TYR B 1 94  ? 30.233  5.990   -10.683 1.00 2.14  ? 94  TYR B OH   1  
ATOM 5047   H H    . TYR B 1 94  ? 22.796  8.893   -10.895 1.00 15.33 ? 94  TYR B H    1  
ATOM 5048   H HA   . TYR B 1 94  ? 25.356  10.347  -11.462 1.00 41.34 ? 94  TYR B HA   1  
ATOM 5049   H HB2  . TYR B 1 94  ? 25.636  9.782   -9.199  1.00 64.04 ? 94  TYR B HB2  1  
ATOM 5050   H HB3  . TYR B 1 94  ? 24.701  8.298   -9.351  1.00 65.35 ? 94  TYR B HB3  1  
ATOM 5051   H HD1  . TYR B 1 94  ? 27.451  9.442   -11.583 1.00 74.31 ? 94  TYR B HD1  1  
ATOM 5052   H HD2  . TYR B 1 94  ? 26.262  6.672   -8.533  1.00 22.23 ? 94  TYR B HD2  1  
ATOM 5053   H HE1  . TYR B 1 94  ? 29.511  8.158   -11.955 1.00 12.25 ? 94  TYR B HE1  1  
ATOM 5054   H HE2  . TYR B 1 94  ? 28.352  5.381   -8.907  1.00 24.12 ? 94  TYR B HE2  1  
ATOM 5055   H HH   . TYR B 1 94  ? 30.262  5.752   -11.613 1.00 4.41  ? 94  TYR B HH   1  
ATOM 5056   N N    . ILE B 1 95  ? 25.911  8.692   -13.271 1.00 31.41 ? 95  ILE B N    1  
ATOM 5057   C CA   . ILE B 1 95  ? 26.196  7.703   -14.369 1.00 3.14  ? 95  ILE B CA   1  
ATOM 5058   C C    . ILE B 1 95  ? 27.673  7.279   -14.336 1.00 72.23 ? 95  ILE B C    1  
ATOM 5059   O O    . ILE B 1 95  ? 28.569  8.079   -14.114 1.00 24.31 ? 95  ILE B O    1  
ATOM 5060   C CB   . ILE B 1 95  ? 25.901  8.337   -15.736 1.00 5.41  ? 95  ILE B CB   1  
ATOM 5061   C CG1  . ILE B 1 95  ? 24.475  8.909   -15.768 1.00 14.41 ? 95  ILE B CG1  1  
ATOM 5062   C CG2  . ILE B 1 95  ? 26.048  7.276   -16.830 1.00 52.24 ? 95  ILE B CG2  1  
ATOM 5063   C CD1  . ILE B 1 95  ? 23.467  7.855   -15.303 1.00 42.31 ? 95  ILE B CD1  1  
ATOM 5064   H H    . ILE B 1 95  ? 26.336  9.583   -13.290 1.00 13.41 ? 95  ILE B H    1  
ATOM 5065   H HA   . ILE B 1 95  ? 25.582  6.822   -14.245 1.00 30.21 ? 95  ILE B HA   1  
ATOM 5066   H HB   . ILE B 1 95  ? 26.611  9.132   -15.919 1.00 3.54  ? 95  ILE B HB   1  
ATOM 5067   H HG12 . ILE B 1 95  ? 24.419  9.768   -15.119 1.00 21.11 ? 95  ILE B HG12 1  
ATOM 5068   H HG13 . ILE B 1 95  ? 24.234  9.208   -16.776 1.00 2.24  ? 95  ILE B HG13 1  
ATOM 5069   H HG21 . ILE B 1 95  ? 25.620  7.644   -17.750 1.00 22.25 ? 95  ILE B HG21 1  
ATOM 5070   H HG22 . ILE B 1 95  ? 25.534  6.374   -16.532 1.00 75.34 ? 95  ILE B HG22 1  
ATOM 5071   H HG23 . ILE B 1 95  ? 27.095  7.059   -16.983 1.00 62.51 ? 95  ILE B HG23 1  
ATOM 5072   H HD11 . ILE B 1 95  ? 23.460  7.815   -14.225 1.00 51.41 ? 95  ILE B HD11 1  
ATOM 5073   H HD12 . ILE B 1 95  ? 23.742  6.888   -15.697 1.00 12.34 ? 95  ILE B HD12 1  
ATOM 5074   H HD13 . ILE B 1 95  ? 22.482  8.120   -15.658 1.00 72.33 ? 95  ILE B HD13 1  
ATOM 5075   N N    . ALA B 1 96  ? 27.938  6.024   -14.585 1.00 23.45 ? 96  ALA B N    1  
ATOM 5076   C CA   . ALA B 1 96  ? 29.350  5.560   -14.601 1.00 23.02 ? 96  ALA B CA   1  
ATOM 5077   C C    . ALA B 1 96  ? 30.070  6.330   -15.708 1.00 3.11  ? 96  ALA B C    1  
ATOM 5078   O O    . ALA B 1 96  ? 29.653  6.315   -16.849 1.00 24.01 ? 96  ALA B O    1  
ATOM 5079   C CB   . ALA B 1 96  ? 29.397  4.060   -14.901 1.00 25.24 ? 96  ALA B CB   1  
ATOM 5080   H H    . ALA B 1 96  ? 27.211  5.396   -14.782 1.00 0.50  ? 96  ALA B H    1  
ATOM 5081   H HA   . ALA B 1 96  ? 29.815  5.758   -13.643 1.00 55.33 ? 96  ALA B HA   1  
ATOM 5082   H HB1  . ALA B 1 96  ? 28.709  3.541   -14.249 1.00 51.42 ? 96  ALA B HB1  1  
ATOM 5083   H HB2  . ALA B 1 96  ? 30.398  3.690   -14.735 1.00 70.10 ? 96  ALA B HB2  1  
ATOM 5084   H HB3  . ALA B 1 96  ? 29.116  3.889   -15.930 1.00 3.21  ? 96  ALA B HB3  1  
ATOM 5085   N N    . LYS B 1 97  ? 31.124  7.025   -15.385 1.00 13.31 ? 97  LYS B N    1  
ATOM 5086   C CA   . LYS B 1 97  ? 31.835  7.818   -16.429 1.00 60.54 ? 97  LYS B CA   1  
ATOM 5087   C C    . LYS B 1 97  ? 31.997  7.032   -17.729 1.00 4.42  ? 97  LYS B C    1  
ATOM 5088   O O    . LYS B 1 97  ? 31.655  7.529   -18.780 1.00 63.15 ? 97  LYS B O    1  
ATOM 5089   C CB   . LYS B 1 97  ? 33.241  8.233   -15.948 1.00 3.24  ? 97  LYS B CB   1  
ATOM 5090   C CG   . LYS B 1 97  ? 33.645  9.613   -16.498 1.00 55.12 ? 97  LYS B CG   1  
ATOM 5091   C CD   . LYS B 1 97  ? 33.530  9.667   -18.034 1.00 22.24 ? 97  LYS B CD   1  
ATOM 5092   C CE   . LYS B 1 97  ? 34.503  8.673   -18.715 1.00 2.25  ? 97  LYS B CE   1  
ATOM 5093   N NZ   . LYS B 1 97  ? 35.247  9.385   -19.791 1.00 64.32 ? 97  LYS B NZ   1  
ATOM 5094   H H    . LYS B 1 97  ? 31.434  7.045   -14.456 1.00 65.43 ? 97  LYS B H    1  
ATOM 5095   H HA   . LYS B 1 97  ? 31.252  8.704   -16.624 1.00 22.54 ? 97  LYS B HA   1  
ATOM 5096   H HB2  . LYS B 1 97  ? 33.235  8.279   -14.896 1.00 43.21 ? 97  LYS B HB2  1  
ATOM 5097   H HB3  . LYS B 1 97  ? 33.971  7.507   -16.254 1.00 22.24 ? 97  LYS B HB3  1  
ATOM 5098   H HG2  . LYS B 1 97  ? 33.000  10.362  -16.068 1.00 13.40 ? 97  LYS B HG2  1  
ATOM 5099   H HG3  . LYS B 1 97  ? 34.666  9.821   -16.212 1.00 14.22 ? 97  LYS B HG3  1  
ATOM 5100   H HD2  . LYS B 1 97  ? 32.514  9.458   -18.326 1.00 43.45 ? 97  LYS B HD2  1  
ATOM 5101   H HD3  . LYS B 1 97  ? 33.776  10.657  -18.362 1.00 11.11 ? 97  LYS B HD3  1  
ATOM 5102   H HE2  . LYS B 1 97  ? 35.212  8.284   -17.998 1.00 43.42 ? 97  LYS B HE2  1  
ATOM 5103   H HE3  . LYS B 1 97  ? 33.953  7.856   -19.153 1.00 10.43 ? 97  LYS B HE3  1  
ATOM 5104   H HZ1  . LYS B 1 97  ? 34.585  9.960   -20.349 1.00 3.20  ? 97  LYS B HZ1  1  
ATOM 5105   H HZ2  . LYS B 1 97  ? 35.711  8.689   -20.410 1.00 5.20  ? 97  LYS B HZ2  1  
ATOM 5106   H HZ3  . LYS B 1 97  ? 35.966  10.004  -19.365 1.00 35.03 ? 97  LYS B HZ3  1  
ATOM 5107   N N    . PRO B 1 98  ? 32.585  5.857   -17.706 1.00 63.33 ? 98  PRO B N    1  
ATOM 5108   C CA   . PRO B 1 98  ? 32.848  5.115   -18.950 1.00 2.22  ? 98  PRO B CA   1  
ATOM 5109   C C    . PRO B 1 98  ? 31.690  5.198   -19.963 1.00 33.00 ? 98  PRO B C    1  
ATOM 5110   O O    . PRO B 1 98  ? 31.827  4.810   -21.105 1.00 24.52 ? 98  PRO B O    1  
ATOM 5111   C CB   . PRO B 1 98  ? 33.117  3.660   -18.494 1.00 13.34 ? 98  PRO B CB   1  
ATOM 5112   C CG   . PRO B 1 98  ? 32.844  3.648   -17.018 1.00 13.42 ? 98  PRO B CG   1  
ATOM 5113   C CD   . PRO B 1 98  ? 33.062  5.080   -16.550 1.00 32.34 ? 98  PRO B CD   1  
ATOM 5114   H HA   . PRO B 1 98  ? 33.743  5.534   -19.373 1.00 13.05 ? 98  PRO B HA   1  
ATOM 5115   H HB2  . PRO B 1 98  ? 32.460  2.967   -19.009 1.00 62.04 ? 98  PRO B HB2  1  
ATOM 5116   H HB3  . PRO B 1 98  ? 34.150  3.397   -18.679 1.00 43.11 ? 98  PRO B HB3  1  
ATOM 5117   H HG2  . PRO B 1 98  ? 31.821  3.344   -16.827 1.00 2.51  ? 98  PRO B HG2  1  
ATOM 5118   H HG3  . PRO B 1 98  ? 33.531  2.989   -16.507 1.00 63.52 ? 98  PRO B HG3  1  
ATOM 5119   H HD2  . PRO B 1 98  ? 32.487  5.273   -15.665 1.00 52.23 ? 98  PRO B HD2  1  
ATOM 5120   H HD3  . PRO B 1 98  ? 34.111  5.257   -16.385 1.00 31.10 ? 98  PRO B HD3  1  
ATOM 5121   N N    . TYR B 1 99  ? 30.565  5.712   -19.545 1.00 44.10 ? 99  TYR B N    1  
ATOM 5122   C CA   . TYR B 1 99  ? 29.394  5.850   -20.450 1.00 10.44 ? 99  TYR B CA   1  
ATOM 5123   C C    . TYR B 1 99  ? 28.993  4.472   -20.982 1.00 73.42 ? 99  TYR B C    1  
ATOM 5124   O O    . TYR B 1 99  ? 29.763  3.813   -21.650 1.00 75.13 ? 99  TYR B O    1  
ATOM 5125   C CB   . TYR B 1 99  ? 29.731  6.762   -21.636 1.00 4.23  ? 99  TYR B CB   1  
ATOM 5126   C CG   . TYR B 1 99  ? 30.254  8.096   -21.145 1.00 22.11 ? 99  TYR B CG   1  
ATOM 5127   C CD1  . TYR B 1 99  ? 29.439  8.924   -20.362 1.00 62.34 ? 99  TYR B CD1  1  
ATOM 5128   C CD2  . TYR B 1 99  ? 31.549  8.512   -21.485 1.00 32.34 ? 99  TYR B CD2  1  
ATOM 5129   C CE1  . TYR B 1 99  ? 29.917  10.164  -19.921 1.00 21.23 ? 99  TYR B CE1  1  
ATOM 5130   C CE2  . TYR B 1 99  ? 32.026  9.751   -21.042 1.00 1.02  ? 99  TYR B CE2  1  
ATOM 5131   C CZ   . TYR B 1 99  ? 31.210  10.577  -20.261 1.00 32.11 ? 99  TYR B CZ   1  
ATOM 5132   O OH   . TYR B 1 99  ? 31.681  11.799  -19.825 1.00 22.40 ? 99  TYR B OH   1  
ATOM 5133   H H    . TYR B 1 99  ? 30.492  6.020   -18.620 1.00 24.53 ? 99  TYR B H    1  
ATOM 5134   H HA   . TYR B 1 99  ? 28.583  6.285   -19.890 1.00 31.14 ? 99  TYR B HA   1  
ATOM 5135   H HB2  . TYR B 1 99  ? 30.472  6.288   -22.260 1.00 65.34 ? 99  TYR B HB2  1  
ATOM 5136   H HB3  . TYR B 1 99  ? 28.835  6.927   -22.215 1.00 23.33 ? 99  TYR B HB3  1  
ATOM 5137   H HD1  . TYR B 1 99  ? 28.441  8.607   -20.099 1.00 34.23 ? 99  TYR B HD1  1  
ATOM 5138   H HD2  . TYR B 1 99  ? 32.181  7.876   -22.088 1.00 41.11 ? 99  TYR B HD2  1  
ATOM 5139   H HE1  . TYR B 1 99  ? 29.290  10.801  -19.316 1.00 44.44 ? 99  TYR B HE1  1  
ATOM 5140   H HE2  . TYR B 1 99  ? 33.024  10.071  -21.304 1.00 11.03 ? 99  TYR B HE2  1  
ATOM 5141   H HH   . TYR B 1 99  ? 30.935  12.400  -19.766 1.00 24.03 ? 99  TYR B HH   1  
ATOM 5142   N N    . ARG B 1 100 ? 27.800  4.023   -20.701 1.00 1.42  ? 100 ARG B N    1  
ATOM 5143   C CA   . ARG B 1 100 ? 27.392  2.685   -21.213 1.00 0.02  ? 100 ARG B CA   1  
ATOM 5144   C C    . ARG B 1 100 ? 27.334  2.738   -22.745 1.00 34.13 ? 100 ARG B C    1  
ATOM 5145   O O    . ARG B 1 100 ? 27.767  1.824   -23.417 1.00 50.02 ? 100 ARG B O    1  
ATOM 5146   C CB   . ARG B 1 100 ? 26.020  2.289   -20.628 1.00 23.53 ? 100 ARG B CB   1  
ATOM 5147   C CG   . ARG B 1 100 ? 25.862  0.755   -20.619 1.00 3.43  ? 100 ARG B CG   1  
ATOM 5148   C CD   . ARG B 1 100 ? 24.694  0.349   -19.710 1.00 11.21 ? 100 ARG B CD   1  
ATOM 5149   N NE   . ARG B 1 100 ? 24.885  0.939   -18.354 1.00 51.53 ? 100 ARG B NE   1  
ATOM 5150   C CZ   . ARG B 1 100 ? 23.889  0.981   -17.513 1.00 44.24 ? 100 ARG B CZ   1  
ATOM 5151   N NH1  . ARG B 1 100 ? 22.723  0.506   -17.857 1.00 74.23 ? 100 ARG B NH1  1  
ATOM 5152   N NH2  . ARG B 1 100 ? 24.058  1.498   -16.327 1.00 71.15 ? 100 ARG B NH2  1  
ATOM 5153   H H    . ARG B 1 100 ? 27.181  4.559   -20.163 1.00 2.14  ? 100 ARG B H    1  
ATOM 5154   H HA   . ARG B 1 100 ? 28.139  1.963   -20.916 1.00 3.42  ? 100 ARG B HA   1  
ATOM 5155   H HB2  . ARG B 1 100 ? 25.945  2.663   -19.619 1.00 14.20 ? 100 ARG B HB2  1  
ATOM 5156   H HB3  . ARG B 1 100 ? 25.232  2.724   -21.227 1.00 0.44  ? 100 ARG B HB3  1  
ATOM 5157   H HG2  . ARG B 1 100 ? 25.668  0.410   -21.624 1.00 31.34 ? 100 ARG B HG2  1  
ATOM 5158   H HG3  . ARG B 1 100 ? 26.767  0.295   -20.253 1.00 65.35 ? 100 ARG B HG3  1  
ATOM 5159   H HD2  . ARG B 1 100 ? 23.765  0.700   -20.128 1.00 64.00 ? 100 ARG B HD2  1  
ATOM 5160   H HD3  . ARG B 1 100 ? 24.663  -0.727  -19.629 1.00 1.11  ? 100 ARG B HD3  1  
ATOM 5161   H HE   . ARG B 1 100 ? 25.760  1.295   -18.094 1.00 0.40  ? 100 ARG B HE   1  
ATOM 5162   H HH11 . ARG B 1 100 ? 22.593  0.110   -18.766 1.00 33.42 ? 100 ARG B HH11 1  
ATOM 5163   H HH12 . ARG B 1 100 ? 21.959  0.539   -17.212 1.00 5.23  ? 100 ARG B HH12 1  
ATOM 5164   H HH21 . ARG B 1 100 ? 24.952  1.862   -16.063 1.00 22.34 ? 100 ARG B HH21 1  
ATOM 5165   H HH22 . ARG B 1 100 ? 23.295  1.531   -15.681 1.00 44.22 ? 100 ARG B HH22 1  
ATOM 5166   N N    . SER B 1 101 ? 26.822  3.808   -23.303 1.00 61.02 ? 101 SER B N    1  
ATOM 5167   C CA   . SER B 1 101 ? 26.762  3.912   -24.793 1.00 44.11 ? 101 SER B CA   1  
ATOM 5168   C C    . SER B 1 101 ? 26.272  5.293   -25.219 1.00 14.35 ? 101 SER B C    1  
ATOM 5169   O O    . SER B 1 101 ? 25.447  5.390   -26.094 1.00 63.34 ? 101 SER B O    1  
ATOM 5170   C CB   . SER B 1 101 ? 25.793  2.873   -25.356 1.00 62.11 ? 101 SER B CB   1  
ATOM 5171   O OG   . SER B 1 101 ? 26.028  2.719   -26.750 1.00 61.33 ? 101 SER B OG   1  
ATOM 5172   H H    . SER B 1 101 ? 26.491  4.543   -22.746 1.00 35.25 ? 101 SER B H    1  
ATOM 5173   H HA   . SER B 1 101 ? 27.746  3.740   -25.203 1.00 64.51 ? 101 SER B HA   1  
ATOM 5174   H HB2  . SER B 1 101 ? 25.948  1.937   -24.870 1.00 52.52 ? 101 SER B HB2  1  
ATOM 5175   H HB3  . SER B 1 101 ? 24.774  3.197   -25.188 1.00 2.13  ? 101 SER B HB3  1  
ATOM 5176   H HG   . SER B 1 101 ? 26.942  2.450   -26.869 1.00 63.55 ? 101 SER B HG   1  
ATOM 5177   N N    . ILE B 1 102 ? 26.770  6.348   -24.625 1.00 11.43 ? 102 ILE B N    1  
ATOM 5178   C CA   . ILE B 1 102 ? 26.324  7.725   -25.022 1.00 22.34 ? 102 ILE B CA   1  
ATOM 5179   C C    . ILE B 1 102 ? 24.793  7.805   -25.061 1.00 43.43 ? 102 ILE B C    1  
ATOM 5180   O O    . ILE B 1 102 ? 24.175  8.439   -24.229 1.00 72.43 ? 102 ILE B O    1  
ATOM 5181   C CB   . ILE B 1 102 ? 26.878  8.057   -26.412 1.00 43.45 ? 102 ILE B CB   1  
ATOM 5182   C CG1  . ILE B 1 102 ? 28.355  7.652   -26.498 1.00 74.44 ? 102 ILE B CG1  1  
ATOM 5183   C CG2  . ILE B 1 102 ? 26.745  9.559   -26.672 1.00 64.01 ? 102 ILE B CG2  1  
ATOM 5184   C CD1  . ILE B 1 102 ? 29.128  8.231   -25.311 1.00 51.41 ? 102 ILE B CD1  1  
ATOM 5185   H H    . ILE B 1 102 ? 27.444  6.238   -23.922 1.00 62.31 ? 102 ILE B H    1  
ATOM 5186   H HA   . ILE B 1 102 ? 26.698  8.445   -24.305 1.00 74.32 ? 102 ILE B HA   1  
ATOM 5187   H HB   . ILE B 1 102 ? 26.313  7.516   -27.159 1.00 23.21 ? 102 ILE B HB   1  
ATOM 5188   H HG12 . ILE B 1 102 ? 28.432  6.575   -26.486 1.00 64.22 ? 102 ILE B HG12 1  
ATOM 5189   H HG13 . ILE B 1 102 ? 28.777  8.031   -27.417 1.00 53.13 ? 102 ILE B HG13 1  
ATOM 5190   H HG21 . ILE B 1 102 ? 27.225  10.106  -25.875 1.00 62.22 ? 102 ILE B HG21 1  
ATOM 5191   H HG22 . ILE B 1 102 ? 25.699  9.826   -26.714 1.00 54.52 ? 102 ILE B HG22 1  
ATOM 5192   H HG23 . ILE B 1 102 ? 27.216  9.804   -27.612 1.00 4.45  ? 102 ILE B HG23 1  
ATOM 5193   H HD11 . ILE B 1 102 ? 28.915  7.650   -24.427 1.00 62.35 ? 102 ILE B HD11 1  
ATOM 5194   H HD12 . ILE B 1 102 ? 28.830  9.255   -25.148 1.00 73.05 ? 102 ILE B HD12 1  
ATOM 5195   H HD13 . ILE B 1 102 ? 30.188  8.193   -25.518 1.00 64.22 ? 102 ILE B HD13 1  
ATOM 5196   N N    . LYS B 1 103 ? 24.175  7.157   -26.013 1.00 32.30 ? 103 LYS B N    1  
ATOM 5197   C CA   . LYS B 1 103 ? 22.693  7.184   -26.096 1.00 22.43 ? 103 LYS B CA   1  
ATOM 5198   C C    . LYS B 1 103 ? 22.140  6.762   -24.741 1.00 10.24 ? 103 LYS B C    1  
ATOM 5199   O O    . LYS B 1 103 ? 21.079  7.183   -24.330 1.00 35.14 ? 103 LYS B O    1  
ATOM 5200   C CB   . LYS B 1 103 ? 22.218  6.210   -27.182 1.00 43.45 ? 103 LYS B CB   1  
ATOM 5201   C CG   . LYS B 1 103 ? 22.370  6.859   -28.562 1.00 64.42 ? 103 LYS B CG   1  
ATOM 5202   C CD   . LYS B 1 103 ? 23.850  7.126   -28.845 1.00 64.53 ? 103 LYS B CD   1  
ATOM 5203   C CE   . LYS B 1 103 ? 24.042  7.415   -30.335 1.00 42.33 ? 103 LYS B CE   1  
ATOM 5204   N NZ   . LYS B 1 103 ? 23.720  6.193   -31.124 1.00 71.11 ? 103 LYS B NZ   1  
ATOM 5205   H H    . LYS B 1 103 ? 24.694  6.633   -26.664 1.00 32.20 ? 103 LYS B H    1  
ATOM 5206   H HA   . LYS B 1 103 ? 22.359  8.186   -26.328 1.00 61.22 ? 103 LYS B HA   1  
ATOM 5207   H HB2  . LYS B 1 103 ? 22.813  5.309   -27.140 1.00 54.24 ? 103 LYS B HB2  1  
ATOM 5208   H HB3  . LYS B 1 103 ? 21.179  5.963   -27.018 1.00 44.14 ? 103 LYS B HB3  1  
ATOM 5209   H HG2  . LYS B 1 103 ? 21.973  6.195   -29.316 1.00 13.24 ? 103 LYS B HG2  1  
ATOM 5210   H HG3  . LYS B 1 103 ? 21.828  7.792   -28.582 1.00 21.22 ? 103 LYS B HG3  1  
ATOM 5211   H HD2  . LYS B 1 103 ? 24.178  7.979   -28.269 1.00 32.30 ? 103 LYS B HD2  1  
ATOM 5212   H HD3  . LYS B 1 103 ? 24.433  6.260   -28.571 1.00 31.23 ? 103 LYS B HD3  1  
ATOM 5213   H HE2  . LYS B 1 103 ? 23.385  8.219   -30.633 1.00 62.03 ? 103 LYS B HE2  1  
ATOM 5214   H HE3  . LYS B 1 103 ? 25.067  7.702   -30.518 1.00 61.11 ? 103 LYS B HE3  1  
ATOM 5215   H HZ1  . LYS B 1 103 ? 23.043  6.432   -31.875 1.00 44.12 ? 103 LYS B HZ1  1  
ATOM 5216   H HZ2  . LYS B 1 103 ? 23.302  5.476   -30.495 1.00 72.30 ? 103 LYS B HZ2  1  
ATOM 5217   H HZ3  . LYS B 1 103 ? 24.589  5.816   -31.551 1.00 11.32 ? 103 LYS B HZ3  1  
ATOM 5218   N N    . ALA B 1 104 ? 22.868  5.943   -24.034 1.00 24.42 ? 104 ALA B N    1  
ATOM 5219   C CA   . ALA B 1 104 ? 22.393  5.515   -22.689 1.00 40.54 ? 104 ALA B CA   1  
ATOM 5220   C C    . ALA B 1 104 ? 22.417  6.734   -21.764 1.00 44.33 ? 104 ALA B C    1  
ATOM 5221   O O    . ALA B 1 104 ? 21.529  6.942   -20.960 1.00 71.45 ? 104 ALA B O    1  
ATOM 5222   C CB   . ALA B 1 104 ? 23.320  4.426   -22.139 1.00 53.44 ? 104 ALA B CB   1  
ATOM 5223   H H    . ALA B 1 104 ? 23.734  5.625   -24.382 1.00 22.00 ? 104 ALA B H    1  
ATOM 5224   H HA   . ALA B 1 104 ? 21.385  5.135   -22.764 1.00 0.01  ? 104 ALA B HA   1  
ATOM 5225   H HB1  . ALA B 1 104 ? 24.342  4.658   -22.398 1.00 24.30 ? 104 ALA B HB1  1  
ATOM 5226   H HB2  . ALA B 1 104 ? 23.047  3.474   -22.567 1.00 1.21  ? 104 ALA B HB2  1  
ATOM 5227   H HB3  . ALA B 1 104 ? 23.224  4.376   -21.063 1.00 74.31 ? 104 ALA B HB3  1  
ATOM 5228   N N    . LEU B 1 105 ? 23.433  7.544   -21.886 1.00 24.23 ? 105 LEU B N    1  
ATOM 5229   C CA   . LEU B 1 105 ? 23.537  8.761   -21.034 1.00 0.32  ? 105 LEU B CA   1  
ATOM 5230   C C    . LEU B 1 105 ? 22.433  9.748   -21.433 1.00 51.31 ? 105 LEU B C    1  
ATOM 5231   O O    . LEU B 1 105 ? 21.631  10.160  -20.618 1.00 32.44 ? 105 LEU B O    1  
ATOM 5232   C CB   . LEU B 1 105 ? 24.925  9.389   -21.252 1.00 5.55  ? 105 LEU B CB   1  
ATOM 5233   C CG   . LEU B 1 105 ? 25.033  10.759  -20.567 1.00 21.33 ? 105 LEU B CG   1  
ATOM 5234   C CD1  . LEU B 1 105 ? 24.848  10.607  -19.056 1.00 32.43 ? 105 LEU B CD1  1  
ATOM 5235   C CD2  . LEU B 1 105 ? 26.417  11.346  -20.850 1.00 5.31  ? 105 LEU B CD2  1  
ATOM 5236   H H    . LEU B 1 105 ? 24.130  7.354   -22.547 1.00 43.53 ? 105 LEU B H    1  
ATOM 5237   H HA   . LEU B 1 105 ? 23.421  8.486   -19.997 1.00 62.02 ? 105 LEU B HA   1  
ATOM 5238   H HB2  . LEU B 1 105 ? 25.678  8.731   -20.841 1.00 72.22 ? 105 LEU B HB2  1  
ATOM 5239   H HB3  . LEU B 1 105 ? 25.098  9.507   -22.311 1.00 41.15 ? 105 LEU B HB3  1  
ATOM 5240   H HG   . LEU B 1 105 ? 24.281  11.422  -20.957 1.00 32.33 ? 105 LEU B HG   1  
ATOM 5241   H HD11 . LEU B 1 105 ? 23.802  10.460  -18.832 1.00 43.54 ? 105 LEU B HD11 1  
ATOM 5242   H HD12 . LEU B 1 105 ? 25.199  11.499  -18.558 1.00 34.20 ? 105 LEU B HD12 1  
ATOM 5243   H HD13 . LEU B 1 105 ? 25.414  9.756   -18.711 1.00 33.01 ? 105 LEU B HD13 1  
ATOM 5244   H HD21 . LEU B 1 105 ? 26.429  12.390  -20.576 1.00 13.52 ? 105 LEU B HD21 1  
ATOM 5245   H HD22 . LEU B 1 105 ? 26.641  11.248  -21.901 1.00 73.54 ? 105 LEU B HD22 1  
ATOM 5246   H HD23 . LEU B 1 105 ? 27.158  10.814  -20.273 1.00 22.24 ? 105 LEU B HD23 1  
ATOM 5247   N N    . VAL B 1 106 ? 22.386  10.129  -22.682 1.00 43.10 ? 106 VAL B N    1  
ATOM 5248   C CA   . VAL B 1 106 ? 21.336  11.088  -23.133 1.00 1.52  ? 106 VAL B CA   1  
ATOM 5249   C C    . VAL B 1 106 ? 19.953  10.479  -22.903 1.00 65.23 ? 106 VAL B C    1  
ATOM 5250   O O    . VAL B 1 106 ? 19.033  11.152  -22.485 1.00 4.23  ? 106 VAL B O    1  
ATOM 5251   C CB   . VAL B 1 106 ? 21.522  11.383  -24.623 1.00 14.54 ? 106 VAL B CB   1  
ATOM 5252   C CG1  . VAL B 1 106 ? 20.405  12.311  -25.105 1.00 43.43 ? 106 VAL B CG1  1  
ATOM 5253   C CG2  . VAL B 1 106 ? 22.876  12.061  -24.842 1.00 22.43 ? 106 VAL B CG2  1  
ATOM 5254   H H    . VAL B 1 106 ? 23.042  9.784   -23.323 1.00 5.22  ? 106 VAL B H    1  
ATOM 5255   H HA   . VAL B 1 106 ? 21.419  12.007  -22.571 1.00 32.44 ? 106 VAL B HA   1  
ATOM 5256   H HB   . VAL B 1 106 ? 21.486  10.457  -25.179 1.00 53.03 ? 106 VAL B HB   1  
ATOM 5257   H HG11 . VAL B 1 106 ? 20.329  13.159  -24.441 1.00 42.11 ? 106 VAL B HG11 1  
ATOM 5258   H HG12 . VAL B 1 106 ? 19.468  11.774  -25.113 1.00 44.42 ? 106 VAL B HG12 1  
ATOM 5259   H HG13 . VAL B 1 106 ? 20.631  12.655  -26.103 1.00 31.11 ? 106 VAL B HG13 1  
ATOM 5260   H HG21 . VAL B 1 106 ? 23.669  11.370  -24.594 1.00 0.34  ? 106 VAL B HG21 1  
ATOM 5261   H HG22 . VAL B 1 106 ? 22.948  12.933  -24.210 1.00 72.03 ? 106 VAL B HG22 1  
ATOM 5262   H HG23 . VAL B 1 106 ? 22.967  12.357  -25.877 1.00 31.40 ? 106 VAL B HG23 1  
ATOM 5263   N N    . ALA B 1 107 ? 19.796  9.212   -23.168 1.00 24.32 ? 107 ALA B N    1  
ATOM 5264   C CA   . ALA B 1 107 ? 18.468  8.573   -22.958 1.00 11.03 ? 107 ALA B CA   1  
ATOM 5265   C C    . ALA B 1 107 ? 17.995  8.870   -21.535 1.00 13.31 ? 107 ALA B C    1  
ATOM 5266   O O    . ALA B 1 107 ? 16.854  9.218   -21.308 1.00 3.51  ? 107 ALA B O    1  
ATOM 5267   C CB   . ALA B 1 107 ? 18.589  7.061   -23.153 1.00 15.22 ? 107 ALA B CB   1  
ATOM 5268   H H    . ALA B 1 107 ? 20.549  8.683   -23.503 1.00 11.24 ? 107 ALA B H    1  
ATOM 5269   H HA   . ALA B 1 107 ? 17.758  8.974   -23.666 1.00 64.22 ? 107 ALA B HA   1  
ATOM 5270   H HB1  . ALA B 1 107 ? 17.701  6.577   -22.775 1.00 4.40  ? 107 ALA B HB1  1  
ATOM 5271   H HB2  . ALA B 1 107 ? 19.454  6.697   -22.618 1.00 61.34 ? 107 ALA B HB2  1  
ATOM 5272   H HB3  . ALA B 1 107 ? 18.699  6.841   -24.205 1.00 42.52 ? 107 ALA B HB3  1  
ATOM 5273   N N    . ARG B 1 108 ? 18.869  8.742   -20.575 1.00 0.41  ? 108 ARG B N    1  
ATOM 5274   C CA   . ARG B 1 108 ? 18.475  9.026   -19.168 1.00 64.41 ? 108 ARG B CA   1  
ATOM 5275   C C    . ARG B 1 108 ? 18.119  10.509  -19.037 1.00 75.31 ? 108 ARG B C    1  
ATOM 5276   O O    . ARG B 1 108 ? 17.236  10.881  -18.289 1.00 31.22 ? 108 ARG B O    1  
ATOM 5277   C CB   . ARG B 1 108 ? 19.644  8.690   -18.233 1.00 42.25 ? 108 ARG B CB   1  
ATOM 5278   C CG   . ARG B 1 108 ? 19.200  8.780   -16.760 1.00 14.20 ? 108 ARG B CG   1  
ATOM 5279   C CD   . ARG B 1 108 ? 18.524  7.474   -16.326 1.00 74.33 ? 108 ARG B CD   1  
ATOM 5280   N NE   . ARG B 1 108 ? 18.225  7.534   -14.867 1.00 2.33  ? 108 ARG B NE   1  
ATOM 5281   C CZ   . ARG B 1 108 ? 17.273  8.311   -14.428 1.00 74.31 ? 108 ARG B CZ   1  
ATOM 5282   N NH1  . ARG B 1 108 ? 16.582  9.034   -15.266 1.00 2.34  ? 108 ARG B NH1  1  
ATOM 5283   N NH2  . ARG B 1 108 ? 17.012  8.365   -13.150 1.00 3.32  ? 108 ARG B NH2  1  
ATOM 5284   H H    . ARG B 1 108 ? 19.788  8.466   -20.781 1.00 52.01 ? 108 ARG B H    1  
ATOM 5285   H HA   . ARG B 1 108 ? 17.617  8.426   -18.909 1.00 11.14 ? 108 ARG B HA   1  
ATOM 5286   H HB2  . ARG B 1 108 ? 19.996  7.691   -18.446 1.00 12.44 ? 108 ARG B HB2  1  
ATOM 5287   H HB3  . ARG B 1 108 ? 20.447  9.393   -18.405 1.00 4.12  ? 108 ARG B HB3  1  
ATOM 5288   H HG2  . ARG B 1 108 ? 20.066  8.955   -16.138 1.00 53.44 ? 108 ARG B HG2  1  
ATOM 5289   H HG3  . ARG B 1 108 ? 18.506  9.598   -16.638 1.00 64.15 ? 108 ARG B HG3  1  
ATOM 5290   H HD2  . ARG B 1 108 ? 17.604  7.341   -16.873 1.00 13.41 ? 108 ARG B HD2  1  
ATOM 5291   H HD3  . ARG B 1 108 ? 19.184  6.642   -16.523 1.00 62.21 ? 108 ARG B HD3  1  
ATOM 5292   H HE   . ARG B 1 108 ? 18.743  6.990   -14.238 1.00 74.42 ? 108 ARG B HE   1  
ATOM 5293   H HH11 . ARG B 1 108 ? 16.781  8.992   -16.245 1.00 4.11  ? 108 ARG B HH11 1  
ATOM 5294   H HH12 . ARG B 1 108 ? 15.852  9.630   -14.929 1.00 0.52  ? 108 ARG B HH12 1  
ATOM 5295   H HH21 . ARG B 1 108 ? 17.541  7.810   -12.508 1.00 42.21 ? 108 ARG B HH21 1  
ATOM 5296   H HH22 . ARG B 1 108 ? 16.283  8.960   -12.814 1.00 62.15 ? 108 ARG B HH22 1  
ATOM 5297   N N    . ILE B 1 109 ? 18.795  11.360  -19.763 1.00 51.43 ? 109 ILE B N    1  
ATOM 5298   C CA   . ILE B 1 109 ? 18.487  12.811  -19.679 1.00 21.42 ? 109 ILE B CA   1  
ATOM 5299   C C    . ILE B 1 109 ? 17.169  13.075  -20.400 1.00 12.23 ? 109 ILE B C    1  
ATOM 5300   O O    . ILE B 1 109 ? 16.423  13.971  -20.052 1.00 43.23 ? 109 ILE B O    1  
ATOM 5301   C CB   . ILE B 1 109 ? 19.613  13.618  -20.334 1.00 23.31 ? 109 ILE B CB   1  
ATOM 5302   C CG1  . ILE B 1 109 ? 20.935  13.301  -19.627 1.00 3.12  ? 109 ILE B CG1  1  
ATOM 5303   C CG2  . ILE B 1 109 ? 19.312  15.114  -20.207 1.00 54.24 ? 109 ILE B CG2  1  
ATOM 5304   C CD1  . ILE B 1 109 ? 22.091  14.020  -20.329 1.00 43.44 ? 109 ILE B CD1  1  
ATOM 5305   H H    . ILE B 1 109 ? 19.496  11.043  -20.367 1.00 53.04 ? 109 ILE B H    1  
ATOM 5306   H HA   . ILE B 1 109 ? 18.397  13.098  -18.644 1.00 52.12 ? 109 ILE B HA   1  
ATOM 5307   H HB   . ILE B 1 109 ? 19.687  13.352  -21.379 1.00 3.21  ? 109 ILE B HB   1  
ATOM 5308   H HG12 . ILE B 1 109 ? 20.879  13.631  -18.599 1.00 5.11  ? 109 ILE B HG12 1  
ATOM 5309   H HG13 . ILE B 1 109 ? 21.109  12.237  -19.652 1.00 53.23 ? 109 ILE B HG13 1  
ATOM 5310   H HG21 . ILE B 1 109 ? 20.120  15.684  -20.642 1.00 52.54 ? 109 ILE B HG21 1  
ATOM 5311   H HG22 . ILE B 1 109 ? 19.212  15.373  -19.163 1.00 55.44 ? 109 ILE B HG22 1  
ATOM 5312   H HG23 . ILE B 1 109 ? 18.393  15.344  -20.724 1.00 23.51 ? 109 ILE B HG23 1  
ATOM 5313   H HD11 . ILE B 1 109 ? 22.102  15.058  -20.031 1.00 42.31 ? 109 ILE B HD11 1  
ATOM 5314   H HD12 . ILE B 1 109 ? 21.962  13.955  -21.399 1.00 24.13 ? 109 ILE B HD12 1  
ATOM 5315   H HD13 . ILE B 1 109 ? 23.025  13.556  -20.051 1.00 10.12 ? 109 ILE B HD13 1  
ATOM 5316   N N    . GLU B 1 110 ? 16.875  12.296  -21.403 1.00 65.31 ? 110 GLU B N    1  
ATOM 5317   C CA   . GLU B 1 110 ? 15.608  12.498  -22.147 1.00 51.34 ? 110 GLU B CA   1  
ATOM 5318   C C    . GLU B 1 110 ? 14.428  12.159  -21.237 1.00 31.50 ? 110 GLU B C    1  
ATOM 5319   O O    . GLU B 1 110 ? 13.575  12.984  -20.979 1.00 42.22 ? 110 GLU B O    1  
ATOM 5320   C CB   . GLU B 1 110 ? 15.587  11.586  -23.377 1.00 41.51 ? 110 GLU B CB   1  
ATOM 5321   C CG   . GLU B 1 110 ? 14.314  11.836  -24.189 1.00 44.14 ? 110 GLU B CG   1  
ATOM 5322   C CD   . GLU B 1 110 ? 14.312  10.933  -25.424 1.00 43.01 ? 110 GLU B CD   1  
ATOM 5323   O OE1  . GLU B 1 110 ? 15.267  10.193  -25.593 1.00 4.42  ? 110 GLU B OE1  1  
ATOM 5324   O OE2  . GLU B 1 110 ? 13.356  10.996  -26.178 1.00 4.25  ? 110 GLU B OE2  1  
ATOM 5325   H H    . GLU B 1 110 ? 17.490  11.579  -21.664 1.00 25.02 ? 110 GLU B H    1  
ATOM 5326   H HA   . GLU B 1 110 ? 15.542  13.526  -22.459 1.00 34.45 ? 110 GLU B HA   1  
ATOM 5327   H HB2  . GLU B 1 110 ? 16.450  11.794  -23.990 1.00 45.23 ? 110 GLU B HB2  1  
ATOM 5328   H HB3  . GLU B 1 110 ? 15.611  10.554  -23.059 1.00 21.15 ? 110 GLU B HB3  1  
ATOM 5329   H HG2  . GLU B 1 110 ? 13.449  11.616  -23.581 1.00 63.12 ? 110 GLU B HG2  1  
ATOM 5330   H HG3  . GLU B 1 110 ? 14.282  12.869  -24.501 1.00 11.32 ? 110 GLU B HG3  1  
ATOM 5331   N N    . ALA B 1 111 ? 14.376  10.954  -20.742 1.00 1.22  ? 111 ALA B N    1  
ATOM 5332   C CA   . ALA B 1 111 ? 13.252  10.568  -19.846 1.00 72.24 ? 111 ALA B CA   1  
ATOM 5333   C C    . ALA B 1 111 ? 13.192  11.542  -18.671 1.00 31.24 ? 111 ALA B C    1  
ATOM 5334   O O    . ALA B 1 111 ? 12.137  11.822  -18.137 1.00 15.25 ? 111 ALA B O    1  
ATOM 5335   C CB   . ALA B 1 111 ? 13.477  9.148   -19.324 1.00 55.34 ? 111 ALA B CB   1  
ATOM 5336   H H    . ALA B 1 111 ? 15.078  10.304  -20.957 1.00 3.12  ? 111 ALA B H    1  
ATOM 5337   H HA   . ALA B 1 111 ? 12.323  10.609  -20.396 1.00 24.51 ? 111 ALA B HA   1  
ATOM 5338   H HB1  . ALA B 1 111 ? 13.569  8.468   -20.158 1.00 74.52 ? 111 ALA B HB1  1  
ATOM 5339   H HB2  . ALA B 1 111 ? 12.638  8.853   -18.710 1.00 62.35 ? 111 ALA B HB2  1  
ATOM 5340   H HB3  . ALA B 1 111 ? 14.381  9.119   -18.735 1.00 44.33 ? 111 ALA B HB3  1  
ATOM 5341   N N    . ARG B 1 112 ? 14.316  12.064  -18.264 1.00 33.02 ? 112 ARG B N    1  
ATOM 5342   C CA   . ARG B 1 112 ? 14.320  13.022  -17.125 1.00 12.33 ? 112 ARG B CA   1  
ATOM 5343   C C    . ARG B 1 112 ? 13.438  14.226  -17.476 1.00 4.03  ? 112 ARG B C    1  
ATOM 5344   O O    . ARG B 1 112 ? 12.608  14.645  -16.693 1.00 72.04 ? 112 ARG B O    1  
ATOM 5345   C CB   . ARG B 1 112 ? 15.757  13.485  -16.854 1.00 3.34  ? 112 ARG B CB   1  
ATOM 5346   C CG   . ARG B 1 112 ? 15.855  14.148  -15.460 1.00 20.23 ? 112 ARG B CG   1  
ATOM 5347   C CD   . ARG B 1 112 ? 16.255  13.112  -14.399 1.00 13.11 ? 112 ARG B CD   1  
ATOM 5348   N NE   . ARG B 1 112 ? 15.182  12.087  -14.266 1.00 41.53 ? 112 ARG B NE   1  
ATOM 5349   C CZ   . ARG B 1 112 ? 14.081  12.373  -13.627 1.00 60.14 ? 112 ARG B CZ   1  
ATOM 5350   N NH1  . ARG B 1 112 ? 13.918  13.559  -13.106 1.00 32.33 ? 112 ARG B NH1  1  
ATOM 5351   N NH2  . ARG B 1 112 ? 13.142  11.474  -13.510 1.00 33.05 ? 112 ARG B NH2  1  
ATOM 5352   H H    . ARG B 1 112 ? 15.158  11.827  -18.709 1.00 14.41 ? 112 ARG B H    1  
ATOM 5353   H HA   . ARG B 1 112 ? 13.925  12.534  -16.248 1.00 24.34 ? 112 ARG B HA   1  
ATOM 5354   H HB2  . ARG B 1 112 ? 16.420  12.632  -16.904 1.00 5.42  ? 112 ARG B HB2  1  
ATOM 5355   H HB3  . ARG B 1 112 ? 16.047  14.199  -17.612 1.00 33.22 ? 112 ARG B HB3  1  
ATOM 5356   H HG2  . ARG B 1 112 ? 16.602  14.928  -15.487 1.00 4.24  ? 112 ARG B HG2  1  
ATOM 5357   H HG3  . ARG B 1 112 ? 14.902  14.581  -15.191 1.00 52.52 ? 112 ARG B HG3  1  
ATOM 5358   H HD2  . ARG B 1 112 ? 17.176  12.631  -14.693 1.00 2.31  ? 112 ARG B HD2  1  
ATOM 5359   H HD3  . ARG B 1 112 ? 16.397  13.608  -13.450 1.00 54.13 ? 112 ARG B HD3  1  
ATOM 5360   H HE   . ARG B 1 112 ? 15.303  11.197  -14.658 1.00 14.01 ? 112 ARG B HE   1  
ATOM 5361   H HH11 . ARG B 1 112 ? 14.637  14.248  -13.196 1.00 5.11  ? 112 ARG B HH11 1  
ATOM 5362   H HH12 . ARG B 1 112 ? 13.074  13.778  -12.617 1.00 71.30 ? 112 ARG B HH12 1  
ATOM 5363   H HH21 . ARG B 1 112 ? 13.267  10.566  -13.910 1.00 40.14 ? 112 ARG B HH21 1  
ATOM 5364   H HH22 . ARG B 1 112 ? 12.299  11.693  -13.020 1.00 71.32 ? 112 ARG B HH22 1  
ATOM 5365   N N    . LEU B 1 113 ? 13.599  14.781  -18.652 1.00 70.53 ? 113 LEU B N    1  
ATOM 5366   C CA   . LEU B 1 113 ? 12.753  15.950  -19.052 1.00 72.03 ? 113 LEU B CA   1  
ATOM 5367   C C    . LEU B 1 113 ? 12.622  15.991  -20.579 1.00 12.54 ? 113 LEU B C    1  
ATOM 5368   O O    . LEU B 1 113 ? 13.510  16.441  -21.275 1.00 33.21 ? 113 LEU B O    1  
ATOM 5369   C CB   . LEU B 1 113 ? 13.392  17.263  -18.559 1.00 12.24 ? 113 LEU B CB   1  
ATOM 5370   C CG   . LEU B 1 113 ? 14.933  17.234  -18.767 1.00 55.15 ? 113 LEU B CG   1  
ATOM 5371   C CD1  . LEU B 1 113 ? 15.426  18.599  -19.273 1.00 2.21  ? 113 LEU B CD1  1  
ATOM 5372   C CD2  . LEU B 1 113 ? 15.644  16.906  -17.440 1.00 75.35 ? 113 LEU B CD2  1  
ATOM 5373   H H    . LEU B 1 113 ? 14.268  14.423  -19.275 1.00 63.42 ? 113 LEU B H    1  
ATOM 5374   H HA   . LEU B 1 113 ? 11.769  15.846  -18.616 1.00 2.23  ? 113 LEU B HA   1  
ATOM 5375   H HB2  . LEU B 1 113 ? 12.960  18.089  -19.111 1.00 72.13 ? 113 LEU B HB2  1  
ATOM 5376   H HB3  . LEU B 1 113 ? 13.166  17.392  -17.510 1.00 51.44 ? 113 LEU B HB3  1  
ATOM 5377   H HG   . LEU B 1 113 ? 15.189  16.481  -19.502 1.00 72.42 ? 113 LEU B HG   1  
ATOM 5378   H HD11 . LEU B 1 113 ? 15.177  19.362  -18.550 1.00 40.44 ? 113 LEU B HD11 1  
ATOM 5379   H HD12 . LEU B 1 113 ? 14.950  18.827  -20.215 1.00 64.53 ? 113 LEU B HD12 1  
ATOM 5380   H HD13 . LEU B 1 113 ? 16.497  18.567  -19.409 1.00 74.54 ? 113 LEU B HD13 1  
ATOM 5381   H HD21 . LEU B 1 113 ? 15.066  16.178  -16.893 1.00 44.13 ? 113 LEU B HD21 1  
ATOM 5382   H HD22 . LEU B 1 113 ? 15.741  17.803  -16.845 1.00 43.42 ? 113 LEU B HD22 1  
ATOM 5383   H HD23 . LEU B 1 113 ? 16.624  16.504  -17.648 1.00 44.41 ? 113 LEU B HD23 1  
ATOM 5384   N N    . ARG B 1 114 ? 11.514  15.534  -21.103 1.00 64.13 ? 114 ARG B N    1  
ATOM 5385   C CA   . ARG B 1 114 ? 11.313  15.555  -22.585 1.00 60.20 ? 114 ARG B CA   1  
ATOM 5386   C C    . ARG B 1 114 ? 10.639  16.877  -22.979 1.00 62.45 ? 114 ARG B C    1  
ATOM 5387   O O    . ARG B 1 114 ? 11.257  17.754  -23.550 1.00 44.24 ? 114 ARG B O    1  
ATOM 5388   C CB   . ARG B 1 114 ? 10.416  14.367  -22.995 1.00 33.02 ? 114 ARG B CB   1  
ATOM 5389   C CG   . ARG B 1 114 ? 11.271  13.135  -23.327 1.00 12.34 ? 114 ARG B CG   1  
ATOM 5390   C CD   . ARG B 1 114 ? 10.377  12.023  -23.884 1.00 11.44 ? 114 ARG B CD   1  
ATOM 5391   N NE   . ARG B 1 114 ? 9.516   11.470  -22.794 1.00 75.50 ? 114 ARG B NE   1  
ATOM 5392   C CZ   . ARG B 1 114 ? 8.337   11.984  -22.548 1.00 3.32  ? 114 ARG B CZ   1  
ATOM 5393   N NH1  . ARG B 1 114 ? 7.905   13.007  -23.238 1.00 15.42 ? 114 ARG B NH1  1  
ATOM 5394   N NH2  . ARG B 1 114 ? 7.591   11.477  -21.605 1.00 1.14  ? 114 ARG B NH2  1  
ATOM 5395   H H    . ARG B 1 114 ? 10.808  15.183  -20.521 1.00 20.44 ? 114 ARG B H    1  
ATOM 5396   H HA   . ARG B 1 114 ? 12.271  15.484  -23.083 1.00 22.12 ? 114 ARG B HA   1  
ATOM 5397   H HB2  . ARG B 1 114 ? 9.755   14.128  -22.176 1.00 21.40 ? 114 ARG B HB2  1  
ATOM 5398   H HB3  . ARG B 1 114 ? 9.827   14.631  -23.863 1.00 4.23  ? 114 ARG B HB3  1  
ATOM 5399   H HG2  . ARG B 1 114 ? 12.012  13.400  -24.066 1.00 44.20 ? 114 ARG B HG2  1  
ATOM 5400   H HG3  . ARG B 1 114 ? 11.762  12.784  -22.434 1.00 22.15 ? 114 ARG B HG3  1  
ATOM 5401   H HD2  . ARG B 1 114 ? 9.757   12.420  -24.674 1.00 42.23 ? 114 ARG B HD2  1  
ATOM 5402   H HD3  . ARG B 1 114 ? 10.999  11.234  -24.283 1.00 4.25  ? 114 ARG B HD3  1  
ATOM 5403   H HE   . ARG B 1 114 ? 9.834   10.711  -22.262 1.00 12.11 ? 114 ARG B HE   1  
ATOM 5404   H HH11 . ARG B 1 114 ? 8.475   13.403  -23.957 1.00 64.03 ? 114 ARG B HH11 1  
ATOM 5405   H HH12 . ARG B 1 114 ? 7.004   13.394  -23.046 1.00 51.33 ? 114 ARG B HH12 1  
ATOM 5406   H HH21 . ARG B 1 114 ? 7.920   10.698  -21.072 1.00 14.41 ? 114 ARG B HH21 1  
ATOM 5407   H HH22 . ARG B 1 114 ? 6.690   11.867  -21.415 1.00 11.30 ? 114 ARG B HH22 1  
ATOM 5408   N N    . PHE B 1 115 ? 9.376   17.020  -22.685 1.00 64.01 ? 115 PHE B N    1  
ATOM 5409   C CA   . PHE B 1 115 ? 8.660   18.277  -23.047 1.00 32.45 ? 115 PHE B CA   1  
ATOM 5410   C C    . PHE B 1 115 ? 9.184   19.439  -22.199 1.00 4.55  ? 115 PHE B C    1  
ATOM 5411   O O    . PHE B 1 115 ? 9.280   20.559  -22.659 1.00 53.54 ? 115 PHE B O    1  
ATOM 5412   C CB   . PHE B 1 115 ? 7.161   18.099  -22.799 1.00 24.13 ? 115 PHE B CB   1  
ATOM 5413   C CG   . PHE B 1 115 ? 6.593   17.152  -23.829 1.00 65.33 ? 115 PHE B CG   1  
ATOM 5414   C CD1  . PHE B 1 115 ? 6.276   17.621  -25.110 1.00 31.34 ? 115 PHE B CD1  1  
ATOM 5415   C CD2  . PHE B 1 115 ? 6.384   15.806  -23.506 1.00 32.22 ? 115 PHE B CD2  1  
ATOM 5416   C CE1  . PHE B 1 115 ? 5.751   16.745  -26.067 1.00 61.51 ? 115 PHE B CE1  1  
ATOM 5417   C CE2  . PHE B 1 115 ? 5.859   14.929  -24.463 1.00 61.21 ? 115 PHE B CE2  1  
ATOM 5418   C CZ   . PHE B 1 115 ? 5.543   15.399  -25.743 1.00 34.52 ? 115 PHE B CZ   1  
ATOM 5419   H H    . PHE B 1 115 ? 8.895   16.298  -22.228 1.00 1.23  ? 115 PHE B H    1  
ATOM 5420   H HA   . PHE B 1 115 ? 8.826   18.495  -24.092 1.00 62.24 ? 115 PHE B HA   1  
ATOM 5421   H HB2  . PHE B 1 115 ? 7.006   17.692  -21.810 1.00 3.42  ? 115 PHE B HB2  1  
ATOM 5422   H HB3  . PHE B 1 115 ? 6.666   19.055  -22.878 1.00 72.04 ? 115 PHE B HB3  1  
ATOM 5423   H HD1  . PHE B 1 115 ? 6.437   18.660  -25.360 1.00 53.00 ? 115 PHE B HD1  1  
ATOM 5424   H HD2  . PHE B 1 115 ? 6.628   15.444  -22.518 1.00 73.04 ? 115 PHE B HD2  1  
ATOM 5425   H HE1  . PHE B 1 115 ? 5.507   17.107  -27.055 1.00 40.02 ? 115 PHE B HE1  1  
ATOM 5426   H HE2  . PHE B 1 115 ? 5.699   13.891  -24.214 1.00 34.24 ? 115 PHE B HE2  1  
ATOM 5427   H HZ   . PHE B 1 115 ? 5.138   14.722  -26.482 1.00 52.03 ? 115 PHE B HZ   1  
ATOM 5428   N N    . TRP B 1 116 ? 9.521   19.184  -20.965 1.00 3.04  ? 116 TRP B N    1  
ATOM 5429   C CA   . TRP B 1 116 ? 10.034  20.280  -20.095 1.00 62.13 ? 116 TRP B CA   1  
ATOM 5430   C C    . TRP B 1 116 ? 9.059   21.459  -20.131 1.00 22.32 ? 116 TRP B C    1  
ATOM 5431   O O    . TRP B 1 116 ? 9.227   22.391  -20.892 1.00 54.11 ? 116 TRP B O    1  
ATOM 5432   C CB   . TRP B 1 116 ? 11.403  20.736  -20.605 1.00 62.23 ? 116 TRP B CB   1  
ATOM 5433   C CG   . TRP B 1 116 ? 12.014  21.678  -19.618 1.00 72.40 ? 116 TRP B CG   1  
ATOM 5434   C CD1  . TRP B 1 116 ? 12.613  21.309  -18.463 1.00 45.12 ? 116 TRP B CD1  1  
ATOM 5435   C CD2  . TRP B 1 116 ? 12.098  23.132  -19.676 1.00 74.45 ? 116 TRP B CD2  1  
ATOM 5436   N NE1  . TRP B 1 116 ? 13.057  22.443  -17.807 1.00 2.45  ? 116 TRP B NE1  1  
ATOM 5437   C CE2  . TRP B 1 116 ? 12.764  23.591  -18.515 1.00 54.55 ? 116 TRP B CE2  1  
ATOM 5438   C CE3  . TRP B 1 116 ? 11.665  24.087  -20.614 1.00 30.05 ? 116 TRP B CE3  1  
ATOM 5439   C CZ2  . TRP B 1 116 ? 12.992  24.949  -18.292 1.00 13.34 ? 116 TRP B CZ2  1  
ATOM 5440   C CZ3  . TRP B 1 116 ? 11.893  25.455  -20.393 1.00 52.12 ? 116 TRP B CZ3  1  
ATOM 5441   C CH2  . TRP B 1 116 ? 12.555  25.885  -19.234 1.00 62.34 ? 116 TRP B CH2  1  
ATOM 5442   H H    . TRP B 1 116 ? 9.435   18.275  -20.610 1.00 13.24 ? 116 TRP B H    1  
ATOM 5443   H HA   . TRP B 1 116 ? 10.129  19.921  -19.081 1.00 4.35  ? 116 TRP B HA   1  
ATOM 5444   H HB2  . TRP B 1 116 ? 12.046  19.877  -20.729 1.00 64.33 ? 116 TRP B HB2  1  
ATOM 5445   H HB3  . TRP B 1 116 ? 11.284  21.237  -21.554 1.00 1.43  ? 116 TRP B HB3  1  
ATOM 5446   H HD1  . TRP B 1 116 ? 12.724  20.295  -18.110 1.00 41.23 ? 116 TRP B HD1  1  
ATOM 5447   H HE1  . TRP B 1 116 ? 13.525  22.451  -16.946 1.00 61.01 ? 116 TRP B HE1  1  
ATOM 5448   H HE3  . TRP B 1 116 ? 11.154  23.766  -21.510 1.00 12.54 ? 116 TRP B HE3  1  
ATOM 5449   H HZ2  . TRP B 1 116 ? 13.503  25.275  -17.398 1.00 13.12 ? 116 TRP B HZ2  1  
ATOM 5450   H HZ3  . TRP B 1 116 ? 11.557  26.180  -21.119 1.00 63.11 ? 116 TRP B HZ3  1  
ATOM 5451   H HH2  . TRP B 1 116 ? 12.728  26.938  -19.069 1.00 14.11 ? 116 TRP B HH2  1  
ATOM 5452   N N    . GLY B 1 117 ? 8.041   21.428  -19.313 1.00 41.04 ? 117 GLY B N    1  
ATOM 5453   C CA   . GLY B 1 117 ? 7.060   22.552  -19.304 1.00 44.21 ? 117 GLY B CA   1  
ATOM 5454   C C    . GLY B 1 117 ? 5.727   22.069  -18.729 1.00 5.23  ? 117 GLY B C    1  
ATOM 5455   O O    . GLY B 1 117 ? 5.201   21.048  -19.125 1.00 23.44 ? 117 GLY B O    1  
ATOM 5456   H H    . GLY B 1 117 ? 7.923   20.669  -18.705 1.00 53.12 ? 117 GLY B H    1  
ATOM 5457   H HA2  . GLY B 1 117 ? 7.444   23.358  -18.696 1.00 64.21 ? 117 GLY B HA2  1  
ATOM 5458   H HA3  . GLY B 1 117 ? 6.904   22.904  -20.313 1.00 1.33  ? 117 GLY B HA3  1  
ATOM 5459   N N    . SER B 1 118 ? 5.175   22.801  -17.801 1.00 71.40 ? 118 SER B N    1  
ATOM 5460   C CA   . SER B 1 118 ? 3.874   22.392  -17.202 1.00 45.40 ? 118 SER B CA   1  
ATOM 5461   C C    . SER B 1 118 ? 3.269   23.567  -16.462 1.00 60.31 ? 118 SER B C    1  
ATOM 5462   O O    . SER B 1 118 ? 3.896   24.590  -16.270 1.00 24.24 ? 118 SER B O    1  
ATOM 5463   C CB   . SER B 1 118 ? 4.087   21.222  -16.240 1.00 15.35 ? 118 SER B CB   1  
ATOM 5464   O OG   . SER B 1 118 ? 2.824   20.760  -15.776 1.00 22.31 ? 118 SER B OG   1  
ATOM 5465   H H    . SER B 1 118 ? 5.616   23.622  -17.499 1.00 51.04 ? 118 SER B H    1  
ATOM 5466   H HA   . SER B 1 118 ? 3.189   22.103  -17.982 1.00 32.45 ? 118 SER B HA   1  
ATOM 5467   H HB2  . SER B 1 118 ? 4.591   20.419  -16.751 1.00 31.25 ? 118 SER B HB2  1  
ATOM 5468   H HB3  . SER B 1 118 ? 4.691   21.549  -15.404 1.00 32.11 ? 118 SER B HB3  1  
ATOM 5469   H HG   . SER B 1 118 ? 2.940   20.426  -14.883 1.00 44.42 ? 118 SER B HG   1  
ATOM 5470   N N    . ASN B 1 119 ? 2.037   23.440  -16.072 1.00 11.50 ? 119 ASN B N    1  
ATOM 5471   C CA   . ASN B 1 119 ? 1.365   24.563  -15.375 1.00 72.32 ? 119 ASN B CA   1  
ATOM 5472   C C    . ASN B 1 119 ? 0.202   24.010  -14.541 1.00 41.24 ? 119 ASN B C    1  
ATOM 5473   O O    . ASN B 1 119 ? -0.516  23.128  -14.971 1.00 61.24 ? 119 ASN B O    1  
ATOM 5474   C CB   . ASN B 1 119 ? 0.854   25.577  -16.432 1.00 34.40 ? 119 ASN B CB   1  
ATOM 5475   C CG   . ASN B 1 119 ? 1.337   25.185  -17.835 1.00 50.20 ? 119 ASN B CG   1  
ATOM 5476   O OD1  . ASN B 1 119 ? 2.419   25.557  -18.244 1.00 34.51 ? 119 ASN B OD1  1  
ATOM 5477   N ND2  . ASN B 1 119 ? 0.573   24.446  -18.591 1.00 25.23 ? 119 ASN B ND2  1  
ATOM 5478   H H    . ASN B 1 119 ? 1.545   22.614  -16.260 1.00 22.33 ? 119 ASN B H    1  
ATOM 5479   H HA   . ASN B 1 119 ? 2.072   25.050  -14.714 1.00 5.31  ? 119 ASN B HA   1  
ATOM 5480   H HB2  . ASN B 1 119 ? -0.223  25.601  -16.433 1.00 21.21 ? 119 ASN B HB2  1  
ATOM 5481   H HB3  . ASN B 1 119 ? 1.233   26.556  -16.200 1.00 3.20  ? 119 ASN B HB3  1  
ATOM 5482   H HD21 . ASN B 1 119 ? -0.300  24.146  -18.262 1.00 53.25 ? 119 ASN B HD21 1  
ATOM 5483   H HD22 . ASN B 1 119 ? 0.872   24.191  -19.489 1.00 74.21 ? 119 ASN B HD22 1  
ATOM 5484   N N    . VAL B 1 120 ? 0.020   24.519  -13.348 1.00 75.02 ? 120 VAL B N    1  
ATOM 5485   C CA   . VAL B 1 120 ? -1.086  24.028  -12.468 1.00 12.30 ? 120 VAL B CA   1  
ATOM 5486   C C    . VAL B 1 120 ? -2.220  25.058  -12.421 1.00 42.31 ? 120 VAL B C    1  
ATOM 5487   O O    . VAL B 1 120 ? -3.381  24.714  -12.520 1.00 40.34 ? 120 VAL B O    1  
ATOM 5488   C CB   . VAL B 1 120 ? -0.542  23.812  -11.055 1.00 51.34 ? 120 VAL B CB   1  
ATOM 5489   C CG1  . VAL B 1 120 ? -1.579  23.065  -10.213 1.00 72.11 ? 120 VAL B CG1  1  
ATOM 5490   C CG2  . VAL B 1 120 ? 0.743   22.982  -11.125 1.00 41.15 ? 120 VAL B CG2  1  
ATOM 5491   H H    . VAL B 1 120 ? 0.618   25.225  -13.026 1.00 64.12 ? 120 VAL B H    1  
ATOM 5492   H HA   . VAL B 1 120 ? -1.473  23.090  -12.844 1.00 22.10 ? 120 VAL B HA   1  
ATOM 5493   H HB   . VAL B 1 120 ? -0.330  24.770  -10.600 1.00 41.14 ? 120 VAL B HB   1  
ATOM 5494   H HG11 . VAL B 1 120 ? -1.302  23.117  -9.171  1.00 11.31 ? 120 VAL B HG11 1  
ATOM 5495   H HG12 . VAL B 1 120 ? -1.618  22.032  -10.525 1.00 32.34 ? 120 VAL B HG12 1  
ATOM 5496   H HG13 . VAL B 1 120 ? -2.550  23.519  -10.350 1.00 10.15 ? 120 VAL B HG13 1  
ATOM 5497   H HG21 . VAL B 1 120 ? 1.127   22.830  -10.127 1.00 74.03 ? 120 VAL B HG21 1  
ATOM 5498   H HG22 . VAL B 1 120 ? 1.478   23.504  -11.719 1.00 62.32 ? 120 VAL B HG22 1  
ATOM 5499   H HG23 . VAL B 1 120 ? 0.528   22.025  -11.578 1.00 2.32  ? 120 VAL B HG23 1  
ATOM 5500   N N    . ILE B 1 121 ? -1.899  26.320  -12.252 1.00 42.30 ? 121 ILE B N    1  
ATOM 5501   C CA   . ILE B 1 121 ? -2.969  27.370  -12.179 1.00 44.54 ? 121 ILE B CA   1  
ATOM 5502   C C    . ILE B 1 121 ? -3.092  28.082  -13.531 1.00 23.11 ? 121 ILE B C    1  
ATOM 5503   O O    . ILE B 1 121 ? -2.108  28.362  -14.188 1.00 0.22  ? 121 ILE B O    1  
ATOM 5504   C CB   . ILE B 1 121 ? -2.594  28.395  -11.101 1.00 23.32 ? 121 ILE B CB   1  
ATOM 5505   C CG1  . ILE B 1 121 ? -2.003  27.675  -9.881  1.00 50.14 ? 121 ILE B CG1  1  
ATOM 5506   C CG2  . ILE B 1 121 ? -3.831  29.202  -10.684 1.00 12.33 ? 121 ILE B CG2  1  
ATOM 5507   C CD1  . ILE B 1 121 ? -2.974  26.608  -9.364  1.00 51.41 ? 121 ILE B CD1  1  
ATOM 5508   H H    . ILE B 1 121 ? -0.953  26.579  -12.164 1.00 12.34 ? 121 ILE B H    1  
ATOM 5509   H HA   . ILE B 1 121 ? -3.918  26.915  -11.926 1.00 11.45 ? 121 ILE B HA   1  
ATOM 5510   H HB   . ILE B 1 121 ? -1.857  29.072  -11.501 1.00 11.23 ? 121 ILE B HB   1  
ATOM 5511   H HG12 . ILE B 1 121 ? -1.072  27.204  -10.161 1.00 61.33 ? 121 ILE B HG12 1  
ATOM 5512   H HG13 . ILE B 1 121 ? -1.815  28.395  -9.101  1.00 23.44 ? 121 ILE B HG13 1  
ATOM 5513   H HG21 . ILE B 1 121 ? -4.398  29.468  -11.562 1.00 15.02 ? 121 ILE B HG21 1  
ATOM 5514   H HG22 . ILE B 1 121 ? -3.518  30.101  -10.173 1.00 41.21 ? 121 ILE B HG22 1  
ATOM 5515   H HG23 . ILE B 1 121 ? -4.449  28.613  -10.024 1.00 34.41 ? 121 ILE B HG23 1  
ATOM 5516   H HD11 . ILE B 1 121 ? -3.028  25.795  -10.070 1.00 74.24 ? 121 ILE B HD11 1  
ATOM 5517   H HD12 . ILE B 1 121 ? -3.955  27.040  -9.239  1.00 73.34 ? 121 ILE B HD12 1  
ATOM 5518   H HD13 . ILE B 1 121 ? -2.623  26.234  -8.413  1.00 31.12 ? 121 ILE B HD13 1  
ATOM 5519   N N    . GLU B 1 122 ? -4.294  28.388  -13.946 1.00 22.43 ? 122 GLU B N    1  
ATOM 5520   C CA   . GLU B 1 122 ? -4.486  29.094  -15.249 1.00 35.44 ? 122 GLU B CA   1  
ATOM 5521   C C    . GLU B 1 122 ? -5.729  29.988  -15.164 1.00 35.23 ? 122 GLU B C    1  
ATOM 5522   O O    . GLU B 1 122 ? -6.837  29.511  -15.023 1.00 54.12 ? 122 GLU B O    1  
ATOM 5523   C CB   . GLU B 1 122 ? -4.666  28.061  -16.371 1.00 13.13 ? 122 GLU B CB   1  
ATOM 5524   C CG   . GLU B 1 122 ? -5.475  26.871  -15.848 1.00 60.34 ? 122 GLU B CG   1  
ATOM 5525   C CD   . GLU B 1 122 ? -5.946  26.010  -17.023 1.00 0.52  ? 122 GLU B CD   1  
ATOM 5526   O OE1  . GLU B 1 122 ? -5.878  26.482  -18.145 1.00 61.14 ? 122 GLU B OE1  1  
ATOM 5527   O OE2  . GLU B 1 122 ? -6.369  24.892  -16.778 1.00 71.53 ? 122 GLU B OE2  1  
ATOM 5528   H H    . GLU B 1 122 ? -5.073  28.161  -13.395 1.00 70.13 ? 122 GLU B H    1  
ATOM 5529   H HA   . GLU B 1 122 ? -3.620  29.707  -15.462 1.00 73.33 ? 122 GLU B HA   1  
ATOM 5530   H HB2  . GLU B 1 122 ? -5.186  28.515  -17.204 1.00 3.40  ? 122 GLU B HB2  1  
ATOM 5531   H HB3  . GLU B 1 122 ? -3.697  27.716  -16.700 1.00 42.21 ? 122 GLU B HB3  1  
ATOM 5532   H HG2  . GLU B 1 122 ? -4.854  26.277  -15.192 1.00 60.32 ? 122 GLU B HG2  1  
ATOM 5533   H HG3  . GLU B 1 122 ? -6.333  27.231  -15.302 1.00 45.12 ? 122 GLU B HG3  1  
ATOM 5534   N N    . ILE B 1 123 ? -5.548  31.283  -15.257 1.00 54.13 ? 123 ILE B N    1  
ATOM 5535   C CA   . ILE B 1 123 ? -6.710  32.225  -15.191 1.00 65.42 ? 123 ILE B CA   1  
ATOM 5536   C C    . ILE B 1 123 ? -6.569  33.256  -16.316 1.00 23.42 ? 123 ILE B C    1  
ATOM 5537   O O    . ILE B 1 123 ? -5.600  33.984  -16.386 1.00 72.43 ? 123 ILE B O    1  
ATOM 5538   C CB   . ILE B 1 123 ? -6.734  32.949  -13.828 1.00 64.11 ? 123 ILE B CB   1  
ATOM 5539   C CG1  . ILE B 1 123 ? -5.294  33.328  -13.392 1.00 51.24 ? 123 ILE B CG1  1  
ATOM 5540   C CG2  . ILE B 1 123 ? -7.402  32.054  -12.773 1.00 61.33 ? 123 ILE B CG2  1  
ATOM 5541   C CD1  . ILE B 1 123 ? -4.615  32.188  -12.612 1.00 51.31 ? 123 ILE B CD1  1  
ATOM 5542   H H    . ILE B 1 123 ? -4.642  31.638  -15.374 1.00 13.12 ? 123 ILE B H    1  
ATOM 5543   H HA   . ILE B 1 123 ? -7.637  31.682  -15.328 1.00 42.42 ? 123 ILE B HA   1  
ATOM 5544   H HB   . ILE B 1 123 ? -7.322  33.854  -13.925 1.00 52.52 ? 123 ILE B HB   1  
ATOM 5545   H HG12 . ILE B 1 123 ? -4.703  33.555  -14.265 1.00 2.24  ? 123 ILE B HG12 1  
ATOM 5546   H HG13 . ILE B 1 123 ? -5.337  34.205  -12.761 1.00 25.04 ? 123 ILE B HG13 1  
ATOM 5547   H HG21 . ILE B 1 123 ? -7.147  32.411  -11.785 1.00 74.22 ? 123 ILE B HG21 1  
ATOM 5548   H HG22 . ILE B 1 123 ? -7.055  31.038  -12.889 1.00 63.33 ? 123 ILE B HG22 1  
ATOM 5549   H HG23 . ILE B 1 123 ? -8.474  32.085  -12.901 1.00 30.13 ? 123 ILE B HG23 1  
ATOM 5550   H HD11 . ILE B 1 123 ? -4.860  32.275  -11.564 1.00 73.12 ? 123 ILE B HD11 1  
ATOM 5551   H HD12 . ILE B 1 123 ? -3.545  32.256  -12.737 1.00 11.04 ? 123 ILE B HD12 1  
ATOM 5552   H HD13 . ILE B 1 123 ? -4.956  31.235  -12.981 1.00 35.45 ? 123 ILE B HD13 1  
ATOM 5553   N N    . GLY B 1 124 ? -7.527  33.321  -17.197 1.00 43.01 ? 124 GLY B N    1  
ATOM 5554   C CA   . GLY B 1 124 ? -7.440  34.304  -18.313 1.00 51.23 ? 124 GLY B CA   1  
ATOM 5555   C C    . GLY B 1 124 ? -6.179  34.028  -19.136 1.00 22.23 ? 124 GLY B C    1  
ATOM 5556   O O    . GLY B 1 124 ? -5.832  32.892  -19.394 1.00 23.11 ? 124 GLY B O    1  
ATOM 5557   H H    . GLY B 1 124 ? -8.301  32.724  -17.127 1.00 34.14 ? 124 GLY B H    1  
ATOM 5558   H HA2  . GLY B 1 124 ? -8.313  34.210  -18.944 1.00 13.11 ? 124 GLY B HA2  1  
ATOM 5559   H HA3  . GLY B 1 124 ? -7.391  35.303  -17.910 1.00 72.41 ? 124 GLY B HA3  1  
ATOM 5560   N N    . ASP B 1 125 ? -5.487  35.058  -19.549 1.00 65.23 ? 125 ASP B N    1  
ATOM 5561   C CA   . ASP B 1 125 ? -4.245  34.856  -20.354 1.00 0.22  ? 125 ASP B CA   1  
ATOM 5562   C C    . ASP B 1 125 ? -3.045  34.714  -19.415 1.00 11.54 ? 125 ASP B C    1  
ATOM 5563   O O    . ASP B 1 125 ? -1.915  34.620  -19.850 1.00 51.01 ? 125 ASP B O    1  
ATOM 5564   C CB   . ASP B 1 125 ? -4.032  36.061  -21.273 1.00 72.42 ? 125 ASP B CB   1  
ATOM 5565   C CG   . ASP B 1 125 ? -4.017  37.344  -20.439 1.00 74.20 ? 125 ASP B CG   1  
ATOM 5566   O OD1  . ASP B 1 125 ? -4.914  37.511  -19.630 1.00 61.44 ? 125 ASP B OD1  1  
ATOM 5567   O OD2  . ASP B 1 125 ? -3.110  38.139  -20.626 1.00 51.31 ? 125 ASP B OD2  1  
ATOM 5568   H H    . ASP B 1 125 ? -5.783  35.966  -19.328 1.00 62.24 ? 125 ASP B H    1  
ATOM 5569   H HA   . ASP B 1 125 ? -4.341  33.961  -20.953 1.00 25.45 ? 125 ASP B HA   1  
ATOM 5570   H HB2  . ASP B 1 125 ? -3.089  35.956  -21.791 1.00 45.22 ? 125 ASP B HB2  1  
ATOM 5571   H HB3  . ASP B 1 125 ? -4.834  36.112  -21.993 1.00 75.12 ? 125 ASP B HB3  1  
ATOM 5572   N N    . LEU B 1 126 ? -3.279  34.697  -18.128 1.00 4.42  ? 126 LEU B N    1  
ATOM 5573   C CA   . LEU B 1 126 ? -2.148  34.561  -17.157 1.00 74.10 ? 126 LEU B CA   1  
ATOM 5574   C C    . LEU B 1 126 ? -1.986  33.082  -16.801 1.00 75.42 ? 126 LEU B C    1  
ATOM 5575   O O    . LEU B 1 126 ? -2.955  32.395  -16.545 1.00 54.43 ? 126 LEU B O    1  
ATOM 5576   C CB   . LEU B 1 126 ? -2.442  35.374  -15.871 1.00 3.30  ? 126 LEU B CB   1  
ATOM 5577   C CG   . LEU B 1 126 ? -3.429  36.505  -16.165 1.00 13.45 ? 126 LEU B CG   1  
ATOM 5578   C CD1  . LEU B 1 126 ? -3.749  37.243  -14.865 1.00 52.14 ? 126 LEU B CD1  1  
ATOM 5579   C CD2  . LEU B 1 126 ? -2.809  37.489  -17.162 1.00 33.14 ? 126 LEU B CD2  1  
ATOM 5580   H H    . LEU B 1 126 ? -4.199  34.773  -17.798 1.00 5.35  ? 126 LEU B H    1  
ATOM 5581   H HA   . LEU B 1 126 ? -1.233  34.921  -17.612 1.00 32.25 ? 126 LEU B HA   1  
ATOM 5582   H HB2  . LEU B 1 126 ? -2.868  34.729  -15.115 1.00 30.54 ? 126 LEU B HB2  1  
ATOM 5583   H HB3  . LEU B 1 126 ? -1.522  35.798  -15.496 1.00 42.21 ? 126 LEU B HB3  1  
ATOM 5584   H HG   . LEU B 1 126 ? -4.339  36.092  -16.572 1.00 41.05 ? 126 LEU B HG   1  
ATOM 5585   H HD11 . LEU B 1 126 ? -4.395  38.082  -15.076 1.00 24.32 ? 126 LEU B HD11 1  
ATOM 5586   H HD12 . LEU B 1 126 ? -2.833  37.599  -14.418 1.00 11.43 ? 126 LEU B HD12 1  
ATOM 5587   H HD13 . LEU B 1 126 ? -4.245  36.570  -14.181 1.00 31.11 ? 126 LEU B HD13 1  
ATOM 5588   H HD21 . LEU B 1 126 ? -2.621  36.988  -18.099 1.00 72.01 ? 126 LEU B HD21 1  
ATOM 5589   H HD22 . LEU B 1 126 ? -1.879  37.866  -16.763 1.00 1.44  ? 126 LEU B HD22 1  
ATOM 5590   H HD23 . LEU B 1 126 ? -3.490  38.312  -17.324 1.00 32.20 ? 126 LEU B HD23 1  
ATOM 5591   N N    . THR B 1 127 ? -0.773  32.589  -16.776 1.00 10.14 ? 127 THR B N    1  
ATOM 5592   C CA   . THR B 1 127 ? -0.549  31.151  -16.423 1.00 5.32  ? 127 THR B CA   1  
ATOM 5593   C C    . THR B 1 127 ? 0.580   31.056  -15.395 1.00 74.22 ? 127 THR B C    1  
ATOM 5594   O O    . THR B 1 127 ? 1.681   31.510  -15.635 1.00 72.42 ? 127 THR B O    1  
ATOM 5595   C CB   . THR B 1 127 ? -0.161  30.371  -17.684 1.00 3.45  ? 127 THR B CB   1  
ATOM 5596   O OG1  . THR B 1 127 ? -1.003  30.763  -18.758 1.00 1.23  ? 127 THR B OG1  1  
ATOM 5597   C CG2  . THR B 1 127 ? -0.323  28.872  -17.429 1.00 1.55  ? 127 THR B CG2  1  
ATOM 5598   H H    . THR B 1 127 ? -0.006  33.167  -16.980 1.00 50.41 ? 127 THR B H    1  
ATOM 5599   H HA   . THR B 1 127 ? -1.451  30.730  -16.000 1.00 13.22 ? 127 THR B HA   1  
ATOM 5600   H HB   . THR B 1 127 ? 0.868   30.580  -17.937 1.00 55.41 ? 127 THR B HB   1  
ATOM 5601   H HG1  . THR B 1 127 ? -1.856  31.006  -18.391 1.00 4.05  ? 127 THR B HG1  1  
ATOM 5602   H HG21 . THR B 1 127 ? 0.148   28.613  -16.493 1.00 71.14 ? 127 THR B HG21 1  
ATOM 5603   H HG22 . THR B 1 127 ? 0.142   28.318  -18.231 1.00 44.02 ? 127 THR B HG22 1  
ATOM 5604   H HG23 . THR B 1 127 ? -1.374  28.626  -17.384 1.00 24.21 ? 127 THR B HG23 1  
ATOM 5605   N N    . ILE B 1 128 ? 0.318   30.466  -14.251 1.00 0.53  ? 128 ILE B N    1  
ATOM 5606   C CA   . ILE B 1 128 ? 1.377   30.336  -13.196 1.00 60.33 ? 128 ILE B CA   1  
ATOM 5607   C C    . ILE B 1 128 ? 1.721   28.858  -12.992 1.00 53.24 ? 128 ILE B C    1  
ATOM 5608   O O    . ILE B 1 128 ? 0.860   28.035  -12.732 1.00 3.40  ? 128 ILE B O    1  
ATOM 5609   C CB   . ILE B 1 128 ? 0.862   30.921  -11.871 1.00 54.02 ? 128 ILE B CB   1  
ATOM 5610   C CG1  . ILE B 1 128 ? 0.287   32.327  -12.131 1.00 31.00 ? 128 ILE B CG1  1  
ATOM 5611   C CG2  . ILE B 1 128 ? 2.007   30.988  -10.818 1.00 34.03 ? 128 ILE B CG2  1  
ATOM 5612   C CD1  . ILE B 1 128 ? 1.333   33.213  -12.816 1.00 12.32 ? 128 ILE B CD1  1  
ATOM 5613   H H    . ILE B 1 128 ? -0.579  30.106  -14.084 1.00 43.23 ? 128 ILE B H    1  
ATOM 5614   H HA   . ILE B 1 128 ? 2.270   30.869  -13.497 1.00 35.04 ? 128 ILE B HA   1  
ATOM 5615   H HB   . ILE B 1 128 ? 0.076   30.286  -11.497 1.00 32.13 ? 128 ILE B HB   1  
ATOM 5616   H HG12 . ILE B 1 128 ? -0.583  32.244  -12.766 1.00 3.15  ? 128 ILE B HG12 1  
ATOM 5617   H HG13 . ILE B 1 128 ? 0.001   32.774  -11.191 1.00 1.22  ? 128 ILE B HG13 1  
ATOM 5618   H HG21 . ILE B 1 128 ? 1.829   30.254  -10.042 1.00 53.10 ? 128 ILE B HG21 1  
ATOM 5619   H HG22 . ILE B 1 128 ? 2.044   31.971  -10.369 1.00 23.50 ? 128 ILE B HG22 1  
ATOM 5620   H HG23 . ILE B 1 128 ? 2.960   30.782  -11.285 1.00 13.02 ? 128 ILE B HG23 1  
ATOM 5621   H HD11 . ILE B 1 128 ? 1.108   34.250  -12.617 1.00 33.41 ? 128 ILE B HD11 1  
ATOM 5622   H HD12 . ILE B 1 128 ? 1.313   33.039  -13.880 1.00 5.21  ? 128 ILE B HD12 1  
ATOM 5623   H HD13 . ILE B 1 128 ? 2.314   32.981  -12.433 1.00 51.43 ? 128 ILE B HD13 1  
ATOM 5624   N N    . SER B 1 129 ? 2.983   28.523  -13.104 1.00 50.53 ? 129 SER B N    1  
ATOM 5625   C CA   . SER B 1 129 ? 3.428   27.108  -12.917 1.00 14.01 ? 129 SER B CA   1  
ATOM 5626   C C    . SER B 1 129 ? 4.260   27.015  -11.628 1.00 32.01 ? 129 SER B C    1  
ATOM 5627   O O    . SER B 1 129 ? 5.461   27.197  -11.662 1.00 53.32 ? 129 SER B O    1  
ATOM 5628   C CB   . SER B 1 129 ? 4.307   26.704  -14.101 1.00 72.31 ? 129 SER B CB   1  
ATOM 5629   O OG   . SER B 1 129 ? 3.550   26.797  -15.301 1.00 40.52 ? 129 SER B OG   1  
ATOM 5630   H H    . SER B 1 129 ? 3.648   29.213  -13.309 1.00 21.12 ? 129 SER B H    1  
ATOM 5631   H HA   . SER B 1 129 ? 2.577   26.449  -12.866 1.00 44.21 ? 129 SER B HA   1  
ATOM 5632   H HB2  . SER B 1 129 ? 5.154   27.364  -14.164 1.00 53.42 ? 129 SER B HB2  1  
ATOM 5633   H HB3  . SER B 1 129 ? 4.654   25.688  -13.960 1.00 12.43 ? 129 SER B HB3  1  
ATOM 5634   H HG   . SER B 1 129 ? 2.840   27.427  -15.156 1.00 21.22 ? 129 SER B HG   1  
ATOM 5635   N N    . PRO B 1 130 ? 3.646   26.752  -10.495 1.00 62.20 ? 130 PRO B N    1  
ATOM 5636   C CA   . PRO B 1 130 ? 4.388   26.663  -9.205  1.00 13.31 ? 130 PRO B CA   1  
ATOM 5637   C C    . PRO B 1 130 ? 5.187   25.360  -9.093  1.00 51.52 ? 130 PRO B C    1  
ATOM 5638   O O    . PRO B 1 130 ? 6.220   25.309  -8.455  1.00 75.13 ? 130 PRO B O    1  
ATOM 5639   C CB   . PRO B 1 130 ? 3.282   26.740  -8.142  1.00 61.54 ? 130 PRO B CB   1  
ATOM 5640   C CG   . PRO B 1 130 ? 2.062   26.188  -8.811  1.00 33.00 ? 130 PRO B CG   1  
ATOM 5641   C CD   . PRO B 1 130 ? 2.200   26.506  -10.309 1.00 63.44 ? 130 PRO B CD   1  
ATOM 5642   H HA   . PRO B 1 130 ? 5.048   27.509  -9.100  1.00 21.34 ? 130 PRO B HA   1  
ATOM 5643   H HB2  . PRO B 1 130 ? 3.546   26.148  -7.273  1.00 63.11 ? 130 PRO B HB2  1  
ATOM 5644   H HB3  . PRO B 1 130 ? 3.112   27.768  -7.853  1.00 22.04 ? 130 PRO B HB3  1  
ATOM 5645   H HG2  . PRO B 1 130 ? 2.011   25.116  -8.658  1.00 70.34 ? 130 PRO B HG2  1  
ATOM 5646   H HG3  . PRO B 1 130 ? 1.172   26.658  -8.418  1.00 24.22 ? 130 PRO B HG3  1  
ATOM 5647   H HD2  . PRO B 1 130 ? 1.874   25.658  -10.895 1.00 14.53 ? 130 PRO B HD2  1  
ATOM 5648   H HD3  . PRO B 1 130 ? 1.635   27.389  -10.568 1.00 15.33 ? 130 PRO B HD3  1  
ATOM 5649   N N    . ASP B 1 131 ? 4.727   24.311  -9.719  1.00 75.23 ? 131 ASP B N    1  
ATOM 5650   C CA   . ASP B 1 131 ? 5.474   23.025  -9.654  1.00 34.53 ? 131 ASP B CA   1  
ATOM 5651   C C    . ASP B 1 131 ? 6.830   23.205  -10.340 1.00 43.32 ? 131 ASP B C    1  
ATOM 5652   O O    . ASP B 1 131 ? 7.851   22.769  -9.847  1.00 14.23 ? 131 ASP B O    1  
ATOM 5653   C CB   . ASP B 1 131 ? 4.678   21.932  -10.370 1.00 72.24 ? 131 ASP B CB   1  
ATOM 5654   C CG   . ASP B 1 131 ? 5.464   20.619  -10.334 1.00 5.33  ? 131 ASP B CG   1  
ATOM 5655   O OD1  . ASP B 1 131 ? 6.446   20.559  -9.613  1.00 42.14 ? 131 ASP B OD1  1  
ATOM 5656   O OD2  . ASP B 1 131 ? 5.070   19.697  -11.030 1.00 72.52 ? 131 ASP B OD2  1  
ATOM 5657   H H    . ASP B 1 131 ? 3.898   24.373  -10.238 1.00 33.24 ? 131 ASP B H    1  
ATOM 5658   H HA   . ASP B 1 131 ? 5.626   22.746  -8.622  1.00 24.44 ? 131 ASP B HA   1  
ATOM 5659   H HB2  . ASP B 1 131 ? 3.727   21.796  -9.874  1.00 64.45 ? 131 ASP B HB2  1  
ATOM 5660   H HB3  . ASP B 1 131 ? 4.510   22.221  -11.396 1.00 53.34 ? 131 ASP B HB3  1  
ATOM 5661   N N    . GLU B 1 132 ? 6.846   23.856  -11.474 1.00 34.10 ? 132 GLU B N    1  
ATOM 5662   C CA   . GLU B 1 132 ? 8.131   24.083  -12.200 1.00 15.22 ? 132 GLU B CA   1  
ATOM 5663   C C    . GLU B 1 132 ? 8.733   25.417  -11.753 1.00 1.22  ? 132 GLU B C    1  
ATOM 5664   O O    . GLU B 1 132 ? 9.701   25.892  -12.313 1.00 72.43 ? 132 GLU B O    1  
ATOM 5665   C CB   . GLU B 1 132 ? 7.862   24.130  -13.707 1.00 41.11 ? 132 GLU B CB   1  
ATOM 5666   C CG   . GLU B 1 132 ? 7.407   22.752  -14.191 1.00 65.34 ? 132 GLU B CG   1  
ATOM 5667   C CD   . GLU B 1 132 ? 7.140   22.803  -15.697 1.00 1.11  ? 132 GLU B CD   1  
ATOM 5668   O OE1  . GLU B 1 132 ? 7.036   23.898  -16.224 1.00 21.21 ? 132 GLU B OE1  1  
ATOM 5669   O OE2  . GLU B 1 132 ? 7.045   21.745  -16.297 1.00 1.05  ? 132 GLU B OE2  1  
ATOM 5670   H H    . GLU B 1 132 ? 6.009   24.203  -11.847 1.00 5.41  ? 132 GLU B H    1  
ATOM 5671   H HA   . GLU B 1 132 ? 8.824   23.281  -11.983 1.00 0.03  ? 132 GLU B HA   1  
ATOM 5672   H HB2  . GLU B 1 132 ? 7.089   24.857  -13.911 1.00 11.34 ? 132 GLU B HB2  1  
ATOM 5673   H HB3  . GLU B 1 132 ? 8.766   24.411  -14.225 1.00 64.15 ? 132 GLU B HB3  1  
ATOM 5674   H HG2  . GLU B 1 132 ? 8.179   22.025  -13.985 1.00 3.31  ? 132 GLU B HG2  1  
ATOM 5675   H HG3  . GLU B 1 132 ? 6.501   22.471  -13.676 1.00 75.12 ? 132 GLU B HG3  1  
ATOM 5676   N N    . GLU B 1 133 ? 8.163   26.028  -10.749 1.00 4.01  ? 133 GLU B N    1  
ATOM 5677   C CA   . GLU B 1 133 ? 8.694   27.335  -10.267 1.00 45.44 ? 133 GLU B CA   1  
ATOM 5678   C C    . GLU B 1 133 ? 8.873   28.284  -11.453 1.00 20.42 ? 133 GLU B C    1  
ATOM 5679   O O    . GLU B 1 133 ? 9.968   28.716  -11.755 1.00 62.25 ? 133 GLU B O    1  
ATOM 5680   C CB   . GLU B 1 133 ? 10.044  27.124  -9.575  1.00 14.30 ? 133 GLU B CB   1  
ATOM 5681   C CG   . GLU B 1 133 ? 9.841   26.327  -8.284  1.00 22.43 ? 133 GLU B CG   1  
ATOM 5682   C CD   . GLU B 1 133 ? 11.112  26.396  -7.433  1.00 40.45 ? 133 GLU B CD   1  
ATOM 5683   O OE1  . GLU B 1 133 ? 11.974  27.198  -7.752  1.00 12.54 ? 133 GLU B OE1  1  
ATOM 5684   O OE2  . GLU B 1 133 ? 11.200  25.647  -6.474  1.00 75.13 ? 133 GLU B OE2  1  
ATOM 5685   H H    . GLU B 1 133 ? 7.380   25.628  -10.315 1.00 42.31 ? 133 GLU B H    1  
ATOM 5686   H HA   . GLU B 1 133 ? 7.995   27.769  -9.567  1.00 10.45 ? 133 GLU B HA   1  
ATOM 5687   H HB2  . GLU B 1 133 ? 10.705  26.579  -10.235 1.00 30.51 ? 133 GLU B HB2  1  
ATOM 5688   H HB3  . GLU B 1 133 ? 10.481  28.082  -9.340  1.00 33.21 ? 133 GLU B HB3  1  
ATOM 5689   H HG2  . GLU B 1 133 ? 9.013   26.744  -7.730  1.00 43.31 ? 133 GLU B HG2  1  
ATOM 5690   H HG3  . GLU B 1 133 ? 9.629   25.297  -8.527  1.00 1.44  ? 133 GLU B HG3  1  
ATOM 5691   N N    . LYS B 1 134 ? 7.804   28.616  -12.128 1.00 13.44 ? 134 LYS B N    1  
ATOM 5692   C CA   . LYS B 1 134 ? 7.910   29.540  -13.296 1.00 3.20  ? 134 LYS B CA   1  
ATOM 5693   C C    . LYS B 1 134 ? 6.612   30.341  -13.430 1.00 61.55 ? 134 LYS B C    1  
ATOM 5694   O O    . LYS B 1 134 ? 5.529   29.791  -13.421 1.00 34.54 ? 134 LYS B O    1  
ATOM 5695   C CB   . LYS B 1 134 ? 8.147   28.725  -14.568 1.00 53.13 ? 134 LYS B CB   1  
ATOM 5696   C CG   . LYS B 1 134 ? 8.200   29.664  -15.775 1.00 73.22 ? 134 LYS B CG   1  
ATOM 5697   C CD   . LYS B 1 134 ? 8.795   28.925  -16.975 1.00 31.22 ? 134 LYS B CD   1  
ATOM 5698   C CE   . LYS B 1 134 ? 7.982   27.659  -17.253 1.00 2.43  ? 134 LYS B CE   1  
ATOM 5699   N NZ   . LYS B 1 134 ? 6.529   27.964  -17.126 1.00 52.35 ? 134 LYS B NZ   1  
ATOM 5700   H H    . LYS B 1 134 ? 6.931   28.257  -11.867 1.00 34.13 ? 134 LYS B H    1  
ATOM 5701   H HA   . LYS B 1 134 ? 8.734   30.224  -13.144 1.00 3.04  ? 134 LYS B HA   1  
ATOM 5702   H HB2  . LYS B 1 134 ? 9.083   28.191  -14.483 1.00 4.02  ? 134 LYS B HB2  1  
ATOM 5703   H HB3  . LYS B 1 134 ? 7.341   28.020  -14.698 1.00 52.51 ? 134 LYS B HB3  1  
ATOM 5704   H HG2  . LYS B 1 134 ? 7.200   29.995  -16.016 1.00 3.41  ? 134 LYS B HG2  1  
ATOM 5705   H HG3  . LYS B 1 134 ? 8.815   30.519  -15.541 1.00 34.25 ? 134 LYS B HG3  1  
ATOM 5706   H HD2  . LYS B 1 134 ? 8.767   29.568  -17.843 1.00 71.23 ? 134 LYS B HD2  1  
ATOM 5707   H HD3  . LYS B 1 134 ? 9.818   28.654  -16.760 1.00 65.42 ? 134 LYS B HD3  1  
ATOM 5708   H HE2  . LYS B 1 134 ? 8.191   27.309  -18.253 1.00 32.12 ? 134 LYS B HE2  1  
ATOM 5709   H HE3  . LYS B 1 134 ? 8.253   26.893  -16.541 1.00 51.24 ? 134 LYS B HE3  1  
ATOM 5710   H HZ1  . LYS B 1 134 ? 5.981   27.289  -17.694 1.00 35.10 ? 134 LYS B HZ1  1  
ATOM 5711   H HZ2  . LYS B 1 134 ? 6.349   28.932  -17.465 1.00 75.11 ? 134 LYS B HZ2  1  
ATOM 5712   H HZ3  . LYS B 1 134 ? 6.244   27.887  -16.129 1.00 74.11 ? 134 LYS B HZ3  1  
ATOM 5713   N N    . ILE B 1 135 ? 6.719   31.642  -13.550 1.00 44.23 ? 135 ILE B N    1  
ATOM 5714   C CA   . ILE B 1 135 ? 5.503   32.509  -13.680 1.00 15.41 ? 135 ILE B CA   1  
ATOM 5715   C C    . ILE B 1 135 ? 5.423   33.050  -15.115 1.00 64.14 ? 135 ILE B C    1  
ATOM 5716   O O    . ILE B 1 135 ? 6.427   33.380  -15.713 1.00 54.01 ? 135 ILE B O    1  
ATOM 5717   C CB   . ILE B 1 135 ? 5.620   33.669  -12.674 1.00 2.41  ? 135 ILE B CB   1  
ATOM 5718   C CG1  . ILE B 1 135 ? 5.286   33.156  -11.260 1.00 63.30 ? 135 ILE B CG1  1  
ATOM 5719   C CG2  . ILE B 1 135 ? 4.657   34.813  -13.049 1.00 4.42  ? 135 ILE B CG2  1  
ATOM 5720   C CD1  . ILE B 1 135 ? 6.314   32.111  -10.801 1.00 4.11  ? 135 ILE B CD1  1  
ATOM 5721   H H    . ILE B 1 135 ? 7.610   32.057  -13.552 1.00 21.22 ? 135 ILE B H    1  
ATOM 5722   H HA   . ILE B 1 135 ? 4.611   31.935  -13.464 1.00 42.02 ? 135 ILE B HA   1  
ATOM 5723   H HB   . ILE B 1 135 ? 6.635   34.044  -12.684 1.00 52.22 ? 135 ILE B HB   1  
ATOM 5724   H HG12 . ILE B 1 135 ? 5.293   33.987  -10.570 1.00 42.53 ? 135 ILE B HG12 1  
ATOM 5725   H HG13 . ILE B 1 135 ? 4.305   32.708  -11.265 1.00 1.12  ? 135 ILE B HG13 1  
ATOM 5726   H HG21 . ILE B 1 135 ? 4.376   35.360  -12.160 1.00 70.32 ? 135 ILE B HG21 1  
ATOM 5727   H HG22 . ILE B 1 135 ? 3.771   34.409  -13.515 1.00 4.11  ? 135 ILE B HG22 1  
ATOM 5728   H HG23 . ILE B 1 135 ? 5.148   35.482  -13.741 1.00 23.11 ? 135 ILE B HG23 1  
ATOM 5729   H HD11 . ILE B 1 135 ? 6.444   32.186  -9.731  1.00 31.31 ? 135 ILE B HD11 1  
ATOM 5730   H HD12 . ILE B 1 135 ? 7.264   32.281  -11.288 1.00 32.13 ? 135 ILE B HD12 1  
ATOM 5731   H HD13 . ILE B 1 135 ? 5.955   31.123  -11.046 1.00 15.34 ? 135 ILE B HD13 1  
ATOM 5732   N N    . ILE B 1 136 ? 4.233   33.130  -15.676 1.00 32.50 ? 136 ILE B N    1  
ATOM 5733   C CA   . ILE B 1 136 ? 4.082   33.640  -17.082 1.00 40.53 ? 136 ILE B CA   1  
ATOM 5734   C C    . ILE B 1 136 ? 2.981   34.710  -17.155 1.00 14.14 ? 136 ILE B C    1  
ATOM 5735   O O    . ILE B 1 136 ? 1.886   34.523  -16.658 1.00 4.11  ? 136 ILE B O    1  
ATOM 5736   C CB   . ILE B 1 136 ? 3.707   32.477  -18.004 1.00 71.22 ? 136 ILE B CB   1  
ATOM 5737   C CG1  . ILE B 1 136 ? 4.650   31.298  -17.754 1.00 32.32 ? 136 ILE B CG1  1  
ATOM 5738   C CG2  . ILE B 1 136 ? 3.832   32.922  -19.463 1.00 45.41 ? 136 ILE B CG2  1  
ATOM 5739   C CD1  . ILE B 1 136 ? 4.265   30.134  -18.670 1.00 34.02 ? 136 ILE B CD1  1  
ATOM 5740   H H    . ILE B 1 136 ? 3.440   32.848  -15.175 1.00 54.22 ? 136 ILE B H    1  
ATOM 5741   H HA   . ILE B 1 136 ? 5.011   34.071  -17.418 1.00 74.12 ? 136 ILE B HA   1  
ATOM 5742   H HB   . ILE B 1 136 ? 2.688   32.176  -17.806 1.00 14.43 ? 136 ILE B HB   1  
ATOM 5743   H HG12 . ILE B 1 136 ? 5.666   31.600  -17.960 1.00 72.12 ? 136 ILE B HG12 1  
ATOM 5744   H HG13 . ILE B 1 136 ? 4.568   30.985  -16.724 1.00 72.15 ? 136 ILE B HG13 1  
ATOM 5745   H HG21 . ILE B 1 136 ? 4.875   33.036  -19.716 1.00 73.11 ? 136 ILE B HG21 1  
ATOM 5746   H HG22 . ILE B 1 136 ? 3.324   33.865  -19.598 1.00 42.50 ? 136 ILE B HG22 1  
ATOM 5747   H HG23 . ILE B 1 136 ? 3.385   32.178  -20.106 1.00 61.42 ? 136 ILE B HG23 1  
ATOM 5748   H HD11 . ILE B 1 136 ? 3.211   29.926  -18.564 1.00 24.44 ? 136 ILE B HD11 1  
ATOM 5749   H HD12 . ILE B 1 136 ? 4.835   29.258  -18.398 1.00 61.13 ? 136 ILE B HD12 1  
ATOM 5750   H HD13 . ILE B 1 136 ? 4.478   30.398  -19.695 1.00 4.54  ? 136 ILE B HD13 1  
ATOM 5751   N N    . TYR B 1 137 ? 3.261   35.822  -17.800 1.00 23.52 ? 137 TYR B N    1  
ATOM 5752   C CA   . TYR B 1 137 ? 2.237   36.909  -17.946 1.00 62.24 ? 137 TYR B CA   1  
ATOM 5753   C C    . TYR B 1 137 ? 2.234   37.416  -19.392 1.00 14.12 ? 137 TYR B C    1  
ATOM 5754   O O    . TYR B 1 137 ? 3.269   37.696  -19.963 1.00 63.15 ? 137 TYR B O    1  
ATOM 5755   C CB   . TYR B 1 137 ? 2.576   38.095  -17.033 1.00 14.24 ? 137 TYR B CB   1  
ATOM 5756   C CG   . TYR B 1 137 ? 2.492   37.703  -15.571 1.00 24.24 ? 137 TYR B CG   1  
ATOM 5757   C CD1  . TYR B 1 137 ? 1.288   37.220  -15.033 1.00 32.24 ? 137 TYR B CD1  1  
ATOM 5758   C CD2  . TYR B 1 137 ? 3.617   37.841  -14.745 1.00 4.53  ? 137 TYR B CD2  1  
ATOM 5759   C CE1  . TYR B 1 137 ? 1.216   36.875  -13.678 1.00 31.22 ? 137 TYR B CE1  1  
ATOM 5760   C CE2  . TYR B 1 137 ? 3.541   37.496  -13.393 1.00 64.22 ? 137 TYR B CE2  1  
ATOM 5761   C CZ   . TYR B 1 137 ? 2.342   37.013  -12.858 1.00 52.02 ? 137 TYR B CZ   1  
ATOM 5762   O OH   . TYR B 1 137 ? 2.270   36.670  -11.524 1.00 40.13 ? 137 TYR B OH   1  
ATOM 5763   H H    . TYR B 1 137 ? 4.145   35.934  -18.208 1.00 25.22 ? 137 TYR B H    1  
ATOM 5764   H HA   . TYR B 1 137 ? 1.256   36.530  -17.703 1.00 71.13 ? 137 TYR B HA   1  
ATOM 5765   H HB2  . TYR B 1 137 ? 3.576   38.437  -17.258 1.00 3.10  ? 137 TYR B HB2  1  
ATOM 5766   H HB3  . TYR B 1 137 ? 1.879   38.897  -17.226 1.00 74.23 ? 137 TYR B HB3  1  
ATOM 5767   H HD1  . TYR B 1 137 ? 0.416   37.115  -15.659 1.00 74.23 ? 137 TYR B HD1  1  
ATOM 5768   H HD2  . TYR B 1 137 ? 4.545   38.213  -15.153 1.00 5.34  ? 137 TYR B HD2  1  
ATOM 5769   H HE1  . TYR B 1 137 ? 0.290   36.503  -13.264 1.00 23.04 ? 137 TYR B HE1  1  
ATOM 5770   H HE2  . TYR B 1 137 ? 4.409   37.605  -12.760 1.00 44.42 ? 137 TYR B HE2  1  
ATOM 5771   H HH   . TYR B 1 137 ? 2.460   35.732  -11.448 1.00 12.22 ? 137 TYR B HH   1  
ATOM 5772   N N    . LYS B 1 138 ? 1.077   37.559  -19.979 1.00 30.43 ? 138 LYS B N    1  
ATOM 5773   C CA   . LYS B 1 138 ? 1.002   38.071  -21.378 1.00 13.51 ? 138 LYS B CA   1  
ATOM 5774   C C    . LYS B 1 138 ? 1.865   37.210  -22.305 1.00 44.20 ? 138 LYS B C    1  
ATOM 5775   O O    . LYS B 1 138 ? 2.315   37.660  -23.340 1.00 62.42 ? 138 LYS B O    1  
ATOM 5776   C CB   . LYS B 1 138 ? 1.507   39.516  -21.413 1.00 72.02 ? 138 LYS B CB   1  
ATOM 5777   C CG   . LYS B 1 138 ? 0.927   40.292  -20.229 1.00 71.02 ? 138 LYS B CG   1  
ATOM 5778   C CD   . LYS B 1 138 ? 1.300   41.770  -20.357 1.00 4.33  ? 138 LYS B CD   1  
ATOM 5779   C CE   . LYS B 1 138 ? 1.013   42.490  -19.034 1.00 24.14 ? 138 LYS B CE   1  
ATOM 5780   N NZ   . LYS B 1 138 ? -0.175  41.874  -18.379 1.00 22.55 ? 138 LYS B NZ   1  
ATOM 5781   H H    . LYS B 1 138 ? 0.254   37.344  -19.493 1.00 43.25 ? 138 LYS B H    1  
ATOM 5782   H HA   . LYS B 1 138 ? -0.024  38.044  -21.715 1.00 15.25 ? 138 LYS B HA   1  
ATOM 5783   H HB2  . LYS B 1 138 ? 2.586   39.522  -21.353 1.00 42.32 ? 138 LYS B HB2  1  
ATOM 5784   H HB3  . LYS B 1 138 ? 1.195   39.984  -22.335 1.00 34.11 ? 138 LYS B HB3  1  
ATOM 5785   H HG2  . LYS B 1 138 ? -0.149  40.190  -20.224 1.00 1.40  ? 138 LYS B HG2  1  
ATOM 5786   H HG3  . LYS B 1 138 ? 1.331   39.899  -19.308 1.00 13.15 ? 138 LYS B HG3  1  
ATOM 5787   H HD2  . LYS B 1 138 ? 2.351   41.855  -20.597 1.00 44.25 ? 138 LYS B HD2  1  
ATOM 5788   H HD3  . LYS B 1 138 ? 0.714   42.220  -21.146 1.00 2.10  ? 138 LYS B HD3  1  
ATOM 5789   H HE2  . LYS B 1 138 ? 1.869   42.401  -18.381 1.00 42.31 ? 138 LYS B HE2  1  
ATOM 5790   H HE3  . LYS B 1 138 ? 0.816   43.535  -19.227 1.00 42.21 ? 138 LYS B HE3  1  
ATOM 5791   H HZ1  . LYS B 1 138 ? 0.130   41.077  -17.785 1.00 74.22 ? 138 LYS B HZ1  1  
ATOM 5792   H HZ2  . LYS B 1 138 ? -0.835  41.532  -19.108 1.00 32.53 ? 138 LYS B HZ2  1  
ATOM 5793   H HZ3  . LYS B 1 138 ? -0.651  42.583  -17.785 1.00 60.41 ? 138 LYS B HZ3  1  
ATOM 5794   N N    . GLY B 1 139 ? 2.098   35.978  -21.950 1.00 21.31 ? 139 GLY B N    1  
ATOM 5795   C CA   . GLY B 1 139 ? 2.928   35.096  -22.822 1.00 74.32 ? 139 GLY B CA   1  
ATOM 5796   C C    . GLY B 1 139 ? 4.414   35.364  -22.572 1.00 60.51 ? 139 GLY B C    1  
ATOM 5797   O O    . GLY B 1 139 ? 5.265   34.938  -23.326 1.00 42.51 ? 139 GLY B O    1  
ATOM 5798   H H    . GLY B 1 139 ? 1.724   35.629  -21.114 1.00 10.14 ? 139 GLY B H    1  
ATOM 5799   H HA2  . GLY B 1 139 ? 2.709   34.066  -22.595 1.00 44.42 ? 139 GLY B HA2  1  
ATOM 5800   H HA3  . GLY B 1 139 ? 2.700   35.293  -23.859 1.00 50.44 ? 139 GLY B HA3  1  
ATOM 5801   N N    . ARG B 1 140 ? 4.732   36.063  -21.515 1.00 74.31 ? 140 ARG B N    1  
ATOM 5802   C CA   . ARG B 1 140 ? 6.164   36.359  -21.202 1.00 64.21 ? 140 ARG B CA   1  
ATOM 5803   C C    . ARG B 1 140 ? 6.647   35.383  -20.130 1.00 35.50 ? 140 ARG B C    1  
ATOM 5804   O O    . ARG B 1 140 ? 6.067   35.284  -19.072 1.00 75.34 ? 140 ARG B O    1  
ATOM 5805   C CB   . ARG B 1 140 ? 6.272   37.788  -20.669 1.00 0.22  ? 140 ARG B CB   1  
ATOM 5806   C CG   . ARG B 1 140 ? 5.767   38.773  -21.731 1.00 63.31 ? 140 ARG B CG   1  
ATOM 5807   C CD   . ARG B 1 140 ? 5.403   40.102  -21.067 1.00 31.24 ? 140 ARG B CD   1  
ATOM 5808   N NE   . ARG B 1 140 ? 6.616   40.690  -20.432 1.00 60.21 ? 140 ARG B NE   1  
ATOM 5809   C CZ   . ARG B 1 140 ? 6.514   41.767  -19.702 1.00 63.25 ? 140 ARG B CZ   1  
ATOM 5810   N NH1  . ARG B 1 140 ? 5.350   42.333  -19.531 1.00 11.54 ? 140 ARG B NH1  1  
ATOM 5811   N NH2  . ARG B 1 140 ? 7.576   42.278  -19.143 1.00 73.02 ? 140 ARG B NH2  1  
ATOM 5812   H H    . ARG B 1 140 ? 4.026   36.391  -20.920 1.00 5.42  ? 140 ARG B H    1  
ATOM 5813   H HA   . ARG B 1 140 ? 6.772   36.255  -22.090 1.00 71.21 ? 140 ARG B HA   1  
ATOM 5814   H HB2  . ARG B 1 140 ? 5.676   37.881  -19.772 1.00 73.22 ? 140 ARG B HB2  1  
ATOM 5815   H HB3  . ARG B 1 140 ? 7.304   38.008  -20.439 1.00 23.14 ? 140 ARG B HB3  1  
ATOM 5816   H HG2  . ARG B 1 140 ? 6.542   38.938  -22.465 1.00 64.01 ? 140 ARG B HG2  1  
ATOM 5817   H HG3  . ARG B 1 140 ? 4.891   38.367  -22.217 1.00 4.44  ? 140 ARG B HG3  1  
ATOM 5818   H HD2  . ARG B 1 140 ? 5.019   40.782  -21.812 1.00 72.03 ? 140 ARG B HD2  1  
ATOM 5819   H HD3  . ARG B 1 140 ? 4.649   39.929  -20.314 1.00 12.52 ? 140 ARG B HD3  1  
ATOM 5820   H HE   . ARG B 1 140 ? 7.491   40.266  -20.560 1.00 51.01 ? 140 ARG B HE   1  
ATOM 5821   H HH11 . ARG B 1 140 ? 4.535   41.941  -19.958 1.00 70.33 ? 140 ARG B HH11 1  
ATOM 5822   H HH12 . ARG B 1 140 ? 5.273   43.160  -18.973 1.00 52.14 ? 140 ARG B HH12 1  
ATOM 5823   H HH21 . ARG B 1 140 ? 8.467   41.843  -19.273 1.00 64.15 ? 140 ARG B HH21 1  
ATOM 5824   H HH22 . ARG B 1 140 ? 7.499   43.104  -18.584 1.00 2.14  ? 140 ARG B HH22 1  
ATOM 5825   N N    . GLU B 1 141 ? 7.700   34.657  -20.393 1.00 44.24 ? 141 GLU B N    1  
ATOM 5826   C CA   . GLU B 1 141 ? 8.207   33.681  -19.382 1.00 31.05 ? 141 GLU B CA   1  
ATOM 5827   C C    . GLU B 1 141 ? 9.203   34.370  -18.446 1.00 43.42 ? 141 GLU B C    1  
ATOM 5828   O O    . GLU B 1 141 ? 10.112  35.047  -18.883 1.00 60.43 ? 141 GLU B O    1  
ATOM 5829   C CB   . GLU B 1 141 ? 8.903   32.527  -20.104 1.00 31.31 ? 141 GLU B CB   1  
ATOM 5830   C CG   . GLU B 1 141 ? 7.896   31.815  -21.010 1.00 70.12 ? 141 GLU B CG   1  
ATOM 5831   C CD   . GLU B 1 141 ? 8.588   30.655  -21.728 1.00 53.43 ? 141 GLU B CD   1  
ATOM 5832   O OE1  . GLU B 1 141 ? 9.807   30.643  -21.754 1.00 54.13 ? 141 GLU B OE1  1  
ATOM 5833   O OE2  . GLU B 1 141 ? 7.886   29.799  -22.241 1.00 71.23 ? 141 GLU B OE2  1  
ATOM 5834   H H    . GLU B 1 141 ? 8.155   34.749  -21.256 1.00 61.33 ? 141 GLU B H    1  
ATOM 5835   H HA   . GLU B 1 141 ? 7.380   33.293  -18.803 1.00 55.24 ? 141 GLU B HA   1  
ATOM 5836   H HB2  . GLU B 1 141 ? 9.716   32.914  -20.701 1.00 61.33 ? 141 GLU B HB2  1  
ATOM 5837   H HB3  . GLU B 1 141 ? 9.289   31.827  -19.378 1.00 23.43 ? 141 GLU B HB3  1  
ATOM 5838   H HG2  . GLU B 1 141 ? 7.080   31.435  -20.413 1.00 11.02 ? 141 GLU B HG2  1  
ATOM 5839   H HG3  . GLU B 1 141 ? 7.514   32.512  -21.741 1.00 43.34 ? 141 GLU B HG3  1  
ATOM 5840   N N    . VAL B 1 142 ? 9.038   34.196  -17.158 1.00 70.43 ? 142 VAL B N    1  
ATOM 5841   C CA   . VAL B 1 142 ? 9.972   34.829  -16.175 1.00 11.42 ? 142 VAL B CA   1  
ATOM 5842   C C    . VAL B 1 142 ? 10.308  33.819  -15.073 1.00 30.23 ? 142 VAL B C    1  
ATOM 5843   O O    . VAL B 1 142 ? 9.448   33.117  -14.574 1.00 51.43 ? 142 VAL B O    1  
ATOM 5844   C CB   . VAL B 1 142 ? 9.305   36.063  -15.555 1.00 24.23 ? 142 VAL B CB   1  
ATOM 5845   C CG1  . VAL B 1 142 ? 9.343   37.222  -16.553 1.00 62.05 ? 142 VAL B CG1  1  
ATOM 5846   C CG2  . VAL B 1 142 ? 7.850   35.739  -15.211 1.00 32.14 ? 142 VAL B CG2  1  
ATOM 5847   H H    . VAL B 1 142 ? 8.298   33.641  -16.835 1.00 4.15  ? 142 VAL B H    1  
ATOM 5848   H HA   . VAL B 1 142 ? 10.886  35.127  -16.671 1.00 53.11 ? 142 VAL B HA   1  
ATOM 5849   H HB   . VAL B 1 142 ? 9.835   36.346  -14.656 1.00 21.54 ? 142 VAL B HB   1  
ATOM 5850   H HG11 . VAL B 1 142 ? 10.362  37.561  -16.673 1.00 63.21 ? 142 VAL B HG11 1  
ATOM 5851   H HG12 . VAL B 1 142 ? 8.735   38.035  -16.183 1.00 41.14 ? 142 VAL B HG12 1  
ATOM 5852   H HG13 . VAL B 1 142 ? 8.959   36.890  -17.506 1.00 62.01 ? 142 VAL B HG13 1  
ATOM 5853   H HG21 . VAL B 1 142 ? 7.307   35.520  -16.118 1.00 2.03  ? 142 VAL B HG21 1  
ATOM 5854   H HG22 . VAL B 1 142 ? 7.400   36.588  -14.718 1.00 65.10 ? 142 VAL B HG22 1  
ATOM 5855   H HG23 . VAL B 1 142 ? 7.817   34.883  -14.555 1.00 65.21 ? 142 VAL B HG23 1  
ATOM 5856   N N    . GLU B 1 143 ? 11.556  33.743  -14.690 1.00 31.51 ? 143 GLU B N    1  
ATOM 5857   C CA   . GLU B 1 143 ? 11.960  32.784  -13.621 1.00 33.20 ? 143 GLU B CA   1  
ATOM 5858   C C    . GLU B 1 143 ? 11.759  33.442  -12.254 1.00 3.44  ? 143 GLU B C    1  
ATOM 5859   O O    . GLU B 1 143 ? 11.666  34.649  -12.148 1.00 52.23 ? 143 GLU B O    1  
ATOM 5860   C CB   . GLU B 1 143 ? 13.436  32.415  -13.797 1.00 34.45 ? 143 GLU B CB   1  
ATOM 5861   C CG   . GLU B 1 143 ? 13.667  31.888  -15.215 1.00 72.43 ? 143 GLU B CG   1  
ATOM 5862   C CD   . GLU B 1 143 ? 15.126  31.457  -15.370 1.00 64.10 ? 143 GLU B CD   1  
ATOM 5863   O OE1  . GLU B 1 143 ? 15.929  31.840  -14.535 1.00 22.23 ? 143 GLU B OE1  1  
ATOM 5864   O OE2  . GLU B 1 143 ? 15.417  30.750  -16.321 1.00 63.11 ? 143 GLU B OE2  1  
ATOM 5865   H H    . GLU B 1 143 ? 12.230  34.320  -15.107 1.00 34.51 ? 143 GLU B H    1  
ATOM 5866   H HA   . GLU B 1 143 ? 11.354  31.891  -13.684 1.00 4.55  ? 143 GLU B HA   1  
ATOM 5867   H HB2  . GLU B 1 143 ? 14.048  33.290  -13.633 1.00 54.45 ? 143 GLU B HB2  1  
ATOM 5868   H HB3  . GLU B 1 143 ? 13.703  31.650  -13.084 1.00 51.00 ? 143 GLU B HB3  1  
ATOM 5869   H HG2  . GLU B 1 143 ? 13.019  31.043  -15.395 1.00 13.42 ? 143 GLU B HG2  1  
ATOM 5870   H HG3  . GLU B 1 143 ? 13.447  32.668  -15.929 1.00 52.21 ? 143 GLU B HG3  1  
ATOM 5871   N N    . VAL B 1 144 ? 11.686  32.659  -11.207 1.00 63.13 ? 144 VAL B N    1  
ATOM 5872   C CA   . VAL B 1 144 ? 11.484  33.234  -9.840  1.00 1.33  ? 144 VAL B CA   1  
ATOM 5873   C C    . VAL B 1 144 ? 12.382  32.507  -8.837  1.00 52.20 ? 144 VAL B C    1  
ATOM 5874   O O    . VAL B 1 144 ? 12.645  31.328  -8.966  1.00 44.40 ? 144 VAL B O    1  
ATOM 5875   C CB   . VAL B 1 144 ? 10.023  33.054  -9.430  1.00 70.10 ? 144 VAL B CB   1  
ATOM 5876   C CG1  . VAL B 1 144 ? 9.146   34.019  -10.229 1.00 21.13 ? 144 VAL B CG1  1  
ATOM 5877   C CG2  . VAL B 1 144 ? 9.590   31.615  -9.720  1.00 72.13 ? 144 VAL B CG2  1  
ATOM 5878   H H    . VAL B 1 144 ? 11.760  31.689  -11.320 1.00 33.33 ? 144 VAL B H    1  
ATOM 5879   H HA   . VAL B 1 144 ? 11.729  34.287  -9.839  1.00 20.35 ? 144 VAL B HA   1  
ATOM 5880   H HB   . VAL B 1 144 ? 9.917   33.259  -8.375  1.00 32.34 ? 144 VAL B HB   1  
ATOM 5881   H HG11 . VAL B 1 144 ? 9.181   33.755  -11.276 1.00 53.20 ? 144 VAL B HG11 1  
ATOM 5882   H HG12 . VAL B 1 144 ? 9.510   35.028  -10.099 1.00 35.24 ? 144 VAL B HG12 1  
ATOM 5883   H HG13 . VAL B 1 144 ? 8.127   33.956  -9.876  1.00 2.22  ? 144 VAL B HG13 1  
ATOM 5884   H HG21 . VAL B 1 144 ? 10.347  30.932  -9.362  1.00 35.42 ? 144 VAL B HG21 1  
ATOM 5885   H HG22 . VAL B 1 144 ? 9.462   31.485  -10.784 1.00 4.12  ? 144 VAL B HG22 1  
ATOM 5886   H HG23 . VAL B 1 144 ? 8.656   31.412  -9.218  1.00 53.22 ? 144 VAL B HG23 1  
ATOM 5887   N N    . LYS B 1 145 ? 12.849  33.200  -7.833  1.00 1.41  ? 145 LYS B N    1  
ATOM 5888   C CA   . LYS B 1 145 ? 13.725  32.545  -6.820  1.00 25.11 ? 145 LYS B CA   1  
ATOM 5889   C C    . LYS B 1 145 ? 14.060  33.537  -5.702  1.00 2.34  ? 145 LYS B C    1  
ATOM 5890   O O    . LYS B 1 145 ? 15.183  33.984  -5.575  1.00 65.44 ? 145 LYS B O    1  
ATOM 5891   C CB   . LYS B 1 145 ? 15.018  32.079  -7.492  1.00 72.02 ? 145 LYS B CB   1  
ATOM 5892   C CG   . LYS B 1 145 ? 15.535  33.181  -8.415  1.00 42.53 ? 145 LYS B CG   1  
ATOM 5893   C CD   . LYS B 1 145 ? 16.967  32.862  -8.841  1.00 42.21 ? 145 LYS B CD   1  
ATOM 5894   C CE   . LYS B 1 145 ? 17.445  33.928  -9.823  1.00 1.02  ? 145 LYS B CE   1  
ATOM 5895   N NZ   . LYS B 1 145 ? 18.898  33.740  -10.097 1.00 53.50 ? 145 LYS B NZ   1  
ATOM 5896   H H    . LYS B 1 145 ? 12.622  34.150  -7.744  1.00 0.23  ? 145 LYS B H    1  
ATOM 5897   H HA   . LYS B 1 145 ? 13.213  31.694  -6.403  1.00 42.34 ? 145 LYS B HA   1  
ATOM 5898   H HB2  . LYS B 1 145 ? 15.761  31.862  -6.737  1.00 63.24 ? 145 LYS B HB2  1  
ATOM 5899   H HB3  . LYS B 1 145 ? 14.823  31.191  -8.072  1.00 74.50 ? 145 LYS B HB3  1  
ATOM 5900   H HG2  . LYS B 1 145 ? 14.904  33.242  -9.290  1.00 32.15 ? 145 LYS B HG2  1  
ATOM 5901   H HG3  . LYS B 1 145 ? 15.519  34.127  -7.894  1.00 72.11 ? 145 LYS B HG3  1  
ATOM 5902   H HD2  . LYS B 1 145 ? 17.609  32.854  -7.972  1.00 64.24 ? 145 LYS B HD2  1  
ATOM 5903   H HD3  . LYS B 1 145 ? 16.994  31.895  -9.321  1.00 54.42 ? 145 LYS B HD3  1  
ATOM 5904   H HE2  . LYS B 1 145 ? 16.888  33.839  -10.742 1.00 34.02 ? 145 LYS B HE2  1  
ATOM 5905   H HE3  . LYS B 1 145 ? 17.283  34.908  -9.398  1.00 5.54  ? 145 LYS B HE3  1  
ATOM 5906   H HZ1  . LYS B 1 145 ? 19.109  32.725  -10.169 1.00 42.51 ? 145 LYS B HZ1  1  
ATOM 5907   H HZ2  . LYS B 1 145 ? 19.453  34.156  -9.321  1.00 2.23  ? 145 LYS B HZ2  1  
ATOM 5908   H HZ3  . LYS B 1 145 ? 19.147  34.208  -10.991 1.00 61.21 ? 145 LYS B HZ3  1  
ATOM 5909   N N    . GLY B 1 146 ? 13.102  33.884  -4.885  1.00 10.43 ? 146 GLY B N    1  
ATOM 5910   C CA   . GLY B 1 146 ? 13.389  34.844  -3.781  1.00 22.41 ? 146 GLY B CA   1  
ATOM 5911   C C    . GLY B 1 146 ? 12.122  35.097  -2.962  1.00 22.24 ? 146 GLY B C    1  
ATOM 5912   O O    . GLY B 1 146 ? 11.062  34.583  -3.260  1.00 42.23 ? 146 GLY B O    1  
ATOM 5913   H H    . GLY B 1 146 ? 12.202  33.514  -4.995  1.00 31.54 ? 146 GLY B H    1  
ATOM 5914   H HA2  . GLY B 1 146 ? 14.155  34.432  -3.139  1.00 22.24 ? 146 GLY B HA2  1  
ATOM 5915   H HA3  . GLY B 1 146 ? 13.735  35.778  -4.197  1.00 15.34 ? 146 GLY B HA3  1  
ATOM 5916   N N    . LYS B 1 147 ? 12.229  35.886  -1.926  1.00 73.30 ? 147 LYS B N    1  
ATOM 5917   C CA   . LYS B 1 147 ? 11.038  36.176  -1.079  1.00 43.15 ? 147 LYS B CA   1  
ATOM 5918   C C    . LYS B 1 147 ? 10.039  37.063  -1.844  1.00 44.14 ? 147 LYS B C    1  
ATOM 5919   O O    . LYS B 1 147 ? 8.844   36.895  -1.713  1.00 52.41 ? 147 LYS B O    1  
ATOM 5920   C CB   . LYS B 1 147 ? 11.482  36.872  0.224   1.00 51.51 ? 147 LYS B CB   1  
ATOM 5921   C CG   . LYS B 1 147 ? 12.890  36.400  0.605   1.00 70.14 ? 147 LYS B CG   1  
ATOM 5922   C CD   . LYS B 1 147 ? 13.169  36.713  2.080   1.00 71.11 ? 147 LYS B CD   1  
ATOM 5923   C CE   . LYS B 1 147 ? 12.934  38.201  2.357   1.00 2.32  ? 147 LYS B CE   1  
ATOM 5924   N NZ   . LYS B 1 147 ? 13.624  39.018  1.320   1.00 13.44 ? 147 LYS B NZ   1  
ATOM 5925   H H    . LYS B 1 147 ? 13.096  36.287  -1.705  1.00 53.43 ? 147 LYS B H    1  
ATOM 5926   H HA   . LYS B 1 147 ? 10.554  35.241  -0.833  1.00 44.02 ? 147 LYS B HA   1  
ATOM 5927   H HB2  . LYS B 1 147 ? 11.487  37.944  0.086   1.00 3.52  ? 147 LYS B HB2  1  
ATOM 5928   H HB3  . LYS B 1 147 ? 10.794  36.618  1.019   1.00 73.22 ? 147 LYS B HB3  1  
ATOM 5929   H HG2  . LYS B 1 147 ? 12.966  35.333  0.447   1.00 32.03 ? 147 LYS B HG2  1  
ATOM 5930   H HG3  . LYS B 1 147 ? 13.618  36.905  -0.012  1.00 53.31 ? 147 LYS B HG3  1  
ATOM 5931   H HD2  . LYS B 1 147 ? 12.511  36.125  2.702   1.00 12.51 ? 147 LYS B HD2  1  
ATOM 5932   H HD3  . LYS B 1 147 ? 14.195  36.466  2.310   1.00 43.31 ? 147 LYS B HD3  1  
ATOM 5933   H HE2  . LYS B 1 147 ? 11.875  38.410  2.335   1.00 34.10 ? 147 LYS B HE2  1  
ATOM 5934   H HE3  . LYS B 1 147 ? 13.327  38.450  3.331   1.00 4.42  ? 147 LYS B HE3  1  
ATOM 5935   H HZ1  . LYS B 1 147 ? 12.918  39.461  0.700   1.00 21.13 ? 147 LYS B HZ1  1  
ATOM 5936   H HZ2  . LYS B 1 147 ? 14.249  38.406  0.756   1.00 2.34  ? 147 LYS B HZ2  1  
ATOM 5937   H HZ3  . LYS B 1 147 ? 14.189  39.759  1.782   1.00 32.23 ? 147 LYS B HZ3  1  
ATOM 5938   N N    . PRO B 1 148 ? 10.511  38.003  -2.634  1.00 71.33 ? 148 PRO B N    1  
ATOM 5939   C CA   . PRO B 1 148 ? 9.613   38.910  -3.413  1.00 2.25  ? 148 PRO B CA   1  
ATOM 5940   C C    . PRO B 1 148 ? 8.680   38.128  -4.346  1.00 25.10 ? 148 PRO B C    1  
ATOM 5941   O O    . PRO B 1 148 ? 7.520   38.454  -4.499  1.00 3.20  ? 148 PRO B O    1  
ATOM 5942   C CB   . PRO B 1 148 ? 10.585  39.796  -4.217  1.00 10.02 ? 148 PRO B CB   1  
ATOM 5943   C CG   . PRO B 1 148 ? 11.880  39.718  -3.473  1.00 61.13 ? 148 PRO B CG   1  
ATOM 5944   C CD   . PRO B 1 148 ? 11.930  38.313  -2.880  1.00 2.12  ? 148 PRO B CD   1  
ATOM 5945   H HA   . PRO B 1 148 ? 9.035   39.525  -2.741  1.00 22.35 ? 148 PRO B HA   1  
ATOM 5946   H HB2  . PRO B 1 148 ? 10.706  39.412  -5.224  1.00 23.34 ? 148 PRO B HB2  1  
ATOM 5947   H HB3  . PRO B 1 148 ? 10.234  40.818  -4.247  1.00 12.43 ? 148 PRO B HB3  1  
ATOM 5948   H HG2  . PRO B 1 148 ? 12.712  39.873  -4.149  1.00 13.22 ? 148 PRO B HG2  1  
ATOM 5949   H HG3  . PRO B 1 148 ? 11.902  40.449  -2.678  1.00 23.11 ? 148 PRO B HG3  1  
ATOM 5950   H HD2  . PRO B 1 148 ? 12.357  37.620  -3.592  1.00 14.34 ? 148 PRO B HD2  1  
ATOM 5951   H HD3  . PRO B 1 148 ? 12.485  38.305  -1.958  1.00 43.41 ? 148 PRO B HD3  1  
ATOM 5952   N N    . PHE B 1 149 ? 9.183   37.096  -4.970  1.00 62.44 ? 149 PHE B N    1  
ATOM 5953   C CA   . PHE B 1 149 ? 8.335   36.286  -5.892  1.00 54.02 ? 149 PHE B CA   1  
ATOM 5954   C C    . PHE B 1 149 ? 7.615   35.195  -5.096  1.00 53.24 ? 149 PHE B C    1  
ATOM 5955   O O    . PHE B 1 149 ? 6.596   34.680  -5.510  1.00 3.12  ? 149 PHE B O    1  
ATOM 5956   C CB   . PHE B 1 149 ? 9.220   35.641  -6.958  1.00 22.11 ? 149 PHE B CB   1  
ATOM 5957   C CG   . PHE B 1 149 ? 9.930   36.721  -7.740  1.00 63.22 ? 149 PHE B CG   1  
ATOM 5958   C CD1  . PHE B 1 149 ? 9.291   37.334  -8.825  1.00 40.13 ? 149 PHE B CD1  1  
ATOM 5959   C CD2  . PHE B 1 149 ? 11.225  37.112  -7.379  1.00 2.34  ? 149 PHE B CD2  1  
ATOM 5960   C CE1  . PHE B 1 149 ? 9.948   38.336  -9.549  1.00 74.23 ? 149 PHE B CE1  1  
ATOM 5961   C CE2  . PHE B 1 149 ? 11.881  38.114  -8.102  1.00 60.45 ? 149 PHE B CE2  1  
ATOM 5962   C CZ   . PHE B 1 149 ? 11.243  38.726  -9.188  1.00 62.12 ? 149 PHE B CZ   1  
ATOM 5963   H H    . PHE B 1 149 ? 10.122  36.852  -4.830  1.00 13.14 ? 149 PHE B H    1  
ATOM 5964   H HA   . PHE B 1 149 ? 7.604   36.924  -6.369  1.00 43.40 ? 149 PHE B HA   1  
ATOM 5965   H HB2  . PHE B 1 149 ? 9.949   35.001  -6.483  1.00 51.12 ? 149 PHE B HB2  1  
ATOM 5966   H HB3  . PHE B 1 149 ? 8.608   35.056  -7.628  1.00 33.34 ? 149 PHE B HB3  1  
ATOM 5967   H HD1  . PHE B 1 149 ? 8.292   37.033  -9.104  1.00 44.25 ? 149 PHE B HD1  1  
ATOM 5968   H HD2  . PHE B 1 149 ? 11.717  36.639  -6.541  1.00 52.21 ? 149 PHE B HD2  1  
ATOM 5969   H HE1  . PHE B 1 149 ? 9.456   38.808  -10.387 1.00 13.10 ? 149 PHE B HE1  1  
ATOM 5970   H HE2  . PHE B 1 149 ? 12.880  38.415  -7.824  1.00 34.52 ? 149 PHE B HE2  1  
ATOM 5971   H HZ   . PHE B 1 149 ? 11.750  39.500  -9.746  1.00 15.21 ? 149 PHE B HZ   1  
ATOM 5972   N N    . GLU B 1 150 ? 8.141   34.838  -3.956  1.00 2.32  ? 150 GLU B N    1  
ATOM 5973   C CA   . GLU B 1 150 ? 7.491   33.783  -3.130  1.00 34.54 ? 150 GLU B CA   1  
ATOM 5974   C C    . GLU B 1 150 ? 6.020   34.143  -2.913  1.00 35.12 ? 150 GLU B C    1  
ATOM 5975   O O    . GLU B 1 150 ? 5.128   33.360  -3.181  1.00 71.24 ? 150 GLU B O    1  
ATOM 5976   C CB   . GLU B 1 150 ? 8.205   33.699  -1.780  1.00 31.02 ? 150 GLU B CB   1  
ATOM 5977   C CG   . GLU B 1 150 ? 7.714   32.473  -1.010  1.00 72.34 ? 150 GLU B CG   1  
ATOM 5978   C CD   . GLU B 1 150 ? 8.218   32.549  0.432   1.00 53.34 ? 150 GLU B CD   1  
ATOM 5979   O OE1  . GLU B 1 150 ? 8.833   33.547  0.771   1.00 53.42 ? 150 GLU B OE1  1  
ATOM 5980   O OE2  . GLU B 1 150 ? 7.980   31.609  1.172   1.00 31.31 ? 150 GLU B OE2  1  
ATOM 5981   H H    . GLU B 1 150 ? 8.964   35.267  -3.642  1.00 34.22 ? 150 GLU B H    1  
ATOM 5982   H HA   . GLU B 1 150 ? 7.559   32.831  -3.634  1.00 5.12  ? 150 GLU B HA   1  
ATOM 5983   H HB2  . GLU B 1 150 ? 9.270   33.618  -1.942  1.00 62.43 ? 150 GLU B HB2  1  
ATOM 5984   H HB3  . GLU B 1 150 ? 7.995   34.589  -1.206  1.00 51.24 ? 150 GLU B HB3  1  
ATOM 5985   H HG2  . GLU B 1 150 ? 6.633   32.452  -1.016  1.00 24.35 ? 150 GLU B HG2  1  
ATOM 5986   H HG3  . GLU B 1 150 ? 8.096   31.579  -1.477  1.00 21.22 ? 150 GLU B HG3  1  
ATOM 5987   N N    . VAL B 1 151 ? 5.759   35.327  -2.434  1.00 55.55 ? 151 VAL B N    1  
ATOM 5988   C CA   . VAL B 1 151 ? 4.348   35.742  -2.204  1.00 12.31 ? 151 VAL B CA   1  
ATOM 5989   C C    . VAL B 1 151 ? 3.593   35.737  -3.536  1.00 60.14 ? 151 VAL B C    1  
ATOM 5990   O O    . VAL B 1 151 ? 2.440   35.352  -3.603  1.00 73.35 ? 151 VAL B O    1  
ATOM 5991   C CB   . VAL B 1 151 ? 4.328   37.147  -1.598  1.00 15.02 ? 151 VAL B CB   1  
ATOM 5992   C CG1  . VAL B 1 151 ? 5.020   38.130  -2.548  1.00 62.21 ? 151 VAL B CG1  1  
ATOM 5993   C CG2  . VAL B 1 151 ? 2.877   37.584  -1.376  1.00 70.04 ? 151 VAL B CG2  1  
ATOM 5994   H H    . VAL B 1 151 ? 6.491   35.944  -2.228  1.00 22.12 ? 151 VAL B H    1  
ATOM 5995   H HA   . VAL B 1 151 ? 3.877   35.051  -1.523  1.00 73.14 ? 151 VAL B HA   1  
ATOM 5996   H HB   . VAL B 1 151 ? 4.850   37.133  -0.651  1.00 15.15 ? 151 VAL B HB   1  
ATOM 5997   H HG11 . VAL B 1 151 ? 4.350   38.387  -3.356  1.00 54.12 ? 151 VAL B HG11 1  
ATOM 5998   H HG12 . VAL B 1 151 ? 5.914   37.676  -2.952  1.00 54.41 ? 151 VAL B HG12 1  
ATOM 5999   H HG13 . VAL B 1 151 ? 5.288   39.025  -2.006  1.00 44.31 ? 151 VAL B HG13 1  
ATOM 6000   H HG21 . VAL B 1 151 ? 2.331   36.787  -0.893  1.00 31.33 ? 151 VAL B HG21 1  
ATOM 6001   H HG22 . VAL B 1 151 ? 2.419   37.809  -2.328  1.00 22.44 ? 151 VAL B HG22 1  
ATOM 6002   H HG23 . VAL B 1 151 ? 2.859   38.463  -0.750  1.00 63.31 ? 151 VAL B HG23 1  
ATOM 6003   N N    . LEU B 1 152 ? 4.232   36.148  -4.599  1.00 3.02  ? 152 LEU B N    1  
ATOM 6004   C CA   . LEU B 1 152 ? 3.542   36.151  -5.920  1.00 43.50 ? 152 LEU B CA   1  
ATOM 6005   C C    . LEU B 1 152 ? 3.037   34.735  -6.210  1.00 45.40 ? 152 LEU B C    1  
ATOM 6006   O O    . LEU B 1 152 ? 1.979   34.533  -6.775  1.00 10.24 ? 152 LEU B O    1  
ATOM 6007   C CB   . LEU B 1 152 ? 4.530   36.585  -7.014  1.00 21.04 ? 152 LEU B CB   1  
ATOM 6008   C CG   . LEU B 1 152 ? 3.810   36.724  -8.367  1.00 55.24 ? 152 LEU B CG   1  
ATOM 6009   C CD1  . LEU B 1 152 ? 2.859   37.933  -8.351  1.00 34.22 ? 152 LEU B CD1  1  
ATOM 6010   C CD2  . LEU B 1 152 ? 4.858   36.914  -9.471  1.00 13.05 ? 152 LEU B CD2  1  
ATOM 6011   H H    . LEU B 1 152 ? 5.162   36.448  -4.529  1.00 32.51 ? 152 LEU B H    1  
ATOM 6012   H HA   . LEU B 1 152 ? 2.711   36.835  -5.886  1.00 74.43 ? 152 LEU B HA   1  
ATOM 6013   H HB2  . LEU B 1 152 ? 4.973   37.531  -6.742  1.00 62.53 ? 152 LEU B HB2  1  
ATOM 6014   H HB3  . LEU B 1 152 ? 5.309   35.842  -7.105  1.00 65.24 ? 152 LEU B HB3  1  
ATOM 6015   H HG   . LEU B 1 152 ? 3.242   35.826  -8.565  1.00 72.54 ? 152 LEU B HG   1  
ATOM 6016   H HD11 . LEU B 1 152 ? 3.306   38.744  -7.795  1.00 43.40 ? 152 LEU B HD11 1  
ATOM 6017   H HD12 . LEU B 1 152 ? 1.925   37.652  -7.890  1.00 74.12 ? 152 LEU B HD12 1  
ATOM 6018   H HD13 . LEU B 1 152 ? 2.667   38.259  -9.365  1.00 53.20 ? 152 LEU B HD13 1  
ATOM 6019   H HD21 . LEU B 1 152 ? 5.392   37.838  -9.304  1.00 41.41 ? 152 LEU B HD21 1  
ATOM 6020   H HD22 . LEU B 1 152 ? 4.366   36.952  -10.432 1.00 22.10 ? 152 LEU B HD22 1  
ATOM 6021   H HD23 . LEU B 1 152 ? 5.553   36.088  -9.455  1.00 62.41 ? 152 LEU B HD23 1  
ATOM 6022   N N    . THR B 1 153 ? 3.788   33.747  -5.824  1.00 65.23 ? 153 THR B N    1  
ATOM 6023   C CA   . THR B 1 153 ? 3.354   32.348  -6.075  1.00 60.24 ? 153 THR B CA   1  
ATOM 6024   C C    . THR B 1 153 ? 2.301   31.946  -5.030  1.00 70.01 ? 153 THR B C    1  
ATOM 6025   O O    . THR B 1 153 ? 1.539   31.018  -5.227  1.00 53.13 ? 153 THR B O    1  
ATOM 6026   C CB   . THR B 1 153 ? 4.581   31.419  -5.980  1.00 42.03 ? 153 THR B CB   1  
ATOM 6027   O OG1  . THR B 1 153 ? 5.740   32.142  -6.370  1.00 51.14 ? 153 THR B OG1  1  
ATOM 6028   C CG2  . THR B 1 153 ? 4.409   30.207  -6.905  1.00 23.20 ? 153 THR B CG2  1  
ATOM 6029   H H    . THR B 1 153 ? 4.638   33.924  -5.368  1.00 54.41 ? 153 THR B H    1  
ATOM 6030   H HA   . THR B 1 153 ? 2.924   32.282  -7.064  1.00 5.31  ? 153 THR B HA   1  
ATOM 6031   H HB   . THR B 1 153 ? 4.703   31.075  -4.962  1.00 33.22 ? 153 THR B HB   1  
ATOM 6032   H HG1  . THR B 1 153 ? 6.459   31.515  -6.473  1.00 10.01 ? 153 THR B HG1  1  
ATOM 6033   H HG21 . THR B 1 153 ? 3.379   29.881  -6.886  1.00 75.21 ? 153 THR B HG21 1  
ATOM 6034   H HG22 . THR B 1 153 ? 5.047   29.403  -6.569  1.00 32.42 ? 153 THR B HG22 1  
ATOM 6035   H HG23 . THR B 1 153 ? 4.681   30.483  -7.915  1.00 55.32 ? 153 THR B HG23 1  
ATOM 6036   N N    . HIS B 1 154 ? 2.249   32.635  -3.918  1.00 21.22 ? 154 HIS B N    1  
ATOM 6037   C CA   . HIS B 1 154 ? 1.252   32.270  -2.873  1.00 4.22  ? 154 HIS B CA   1  
ATOM 6038   C C    . HIS B 1 154 ? -0.154  32.577  -3.378  1.00 61.34 ? 154 HIS B C    1  
ATOM 6039   O O    . HIS B 1 154 ? -0.985  31.698  -3.503  1.00 5.21  ? 154 HIS B O    1  
ATOM 6040   C CB   . HIS B 1 154 ? 1.519   33.064  -1.592  1.00 21.15 ? 154 HIS B CB   1  
ATOM 6041   C CG   . HIS B 1 154 ? 0.529   32.652  -0.534  1.00 40.42 ? 154 HIS B CG   1  
ATOM 6042   N ND1  . HIS B 1 154 ? 0.096   33.524  0.455   1.00 31.51 ? 154 HIS B ND1  1  
ATOM 6043   C CD2  . HIS B 1 154 ? -0.127  31.466  -0.301  1.00 23.41 ? 154 HIS B CD2  1  
ATOM 6044   C CE1  . HIS B 1 154 ? -0.782  32.857  1.229   1.00 65.32 ? 154 HIS B CE1  1  
ATOM 6045   N NE2  . HIS B 1 154 ? -0.949  31.602  0.811   1.00 54.01 ? 154 HIS B NE2  1  
ATOM 6046   H H    . HIS B 1 154 ? 2.862   33.388  -3.773  1.00 45.01 ? 154 HIS B H    1  
ATOM 6047   H HA   . HIS B 1 154 ? 1.334   31.214  -2.663  1.00 51.42 ? 154 HIS B HA   1  
ATOM 6048   H HB2  . HIS B 1 154 ? 2.522   32.864  -1.244  1.00 34.04 ? 154 HIS B HB2  1  
ATOM 6049   H HB3  . HIS B 1 154 ? 1.411   34.119  -1.793  1.00 42.01 ? 154 HIS B HB3  1  
ATOM 6050   H HD1  . HIS B 1 154 ? 0.377   34.456  0.570   1.00 32.25 ? 154 HIS B HD1  1  
ATOM 6051   H HD2  . HIS B 1 154 ? -0.023  30.568  -0.890  1.00 73.04 ? 154 HIS B HD2  1  
ATOM 6052   H HE1  . HIS B 1 154 ? -1.288  33.286  2.082   1.00 60.31 ? 154 HIS B HE1  1  
ATOM 6053   H HE2  . HIS B 1 154 ? -1.527  30.917  1.207   1.00 0.00  ? 154 HIS B HE2  1  
ATOM 6054   N N    . LEU B 1 155 ? -0.429  33.815  -3.681  1.00 54.20 ? 155 LEU B N    1  
ATOM 6055   C CA   . LEU B 1 155 ? -1.783  34.162  -4.189  1.00 71.54 ? 155 LEU B CA   1  
ATOM 6056   C C    . LEU B 1 155 ? -1.994  33.482  -5.535  1.00 42.50 ? 155 LEU B C    1  
ATOM 6057   O O    . LEU B 1 155 ? -3.110  33.211  -5.932  1.00 0.42  ? 155 LEU B O    1  
ATOM 6058   C CB   . LEU B 1 155 ? -1.951  35.701  -4.266  1.00 14.21 ? 155 LEU B CB   1  
ATOM 6059   C CG   . LEU B 1 155 ? -1.561  36.303  -5.643  1.00 35.43 ? 155 LEU B CG   1  
ATOM 6060   C CD1  . LEU B 1 155 ? -0.157  35.854  -6.097  1.00 4.44  ? 155 LEU B CD1  1  
ATOM 6061   C CD2  . LEU B 1 155 ? -2.628  35.978  -6.728  1.00 23.42 ? 155 LEU B CD2  1  
ATOM 6062   H H    . LEU B 1 155 ? 0.257   34.511  -3.582  1.00 73.03 ? 155 LEU B H    1  
ATOM 6063   H HA   . LEU B 1 155 ? -2.515  33.765  -3.503  1.00 10.12 ? 155 LEU B HA   1  
ATOM 6064   H HB2  . LEU B 1 155 ? -2.982  35.957  -4.055  1.00 54.44 ? 155 LEU B HB2  1  
ATOM 6065   H HB3  . LEU B 1 155 ? -1.327  36.148  -3.505  1.00 73.43 ? 155 LEU B HB3  1  
ATOM 6066   H HG   . LEU B 1 155 ? -1.521  37.370  -5.519  1.00 13.54 ? 155 LEU B HG   1  
ATOM 6067   H HD11 . LEU B 1 155 ? -0.223  35.282  -7.012  1.00 30.54 ? 155 LEU B HD11 1  
ATOM 6068   H HD12 . LEU B 1 155 ? 0.313   35.259  -5.334  1.00 70.53 ? 155 LEU B HD12 1  
ATOM 6069   H HD13 . LEU B 1 155 ? 0.443   36.731  -6.277  1.00 14.14 ? 155 LEU B HD13 1  
ATOM 6070   H HD21 . LEU B 1 155 ? -2.252  35.225  -7.404  1.00 44.34 ? 155 LEU B HD21 1  
ATOM 6071   H HD22 . LEU B 1 155 ? -2.841  36.873  -7.290  1.00 61.12 ? 155 LEU B HD22 1  
ATOM 6072   H HD23 . LEU B 1 155 ? -3.538  35.623  -6.267  1.00 22.31 ? 155 LEU B HD23 1  
ATOM 6073   N N    . ALA B 1 156 ? -0.939  33.178  -6.239  1.00 14.15 ? 156 ALA B N    1  
ATOM 6074   C CA   . ALA B 1 156 ? -1.117  32.492  -7.543  1.00 75.32 ? 156 ALA B CA   1  
ATOM 6075   C C    . ALA B 1 156 ? -1.886  31.193  -7.309  1.00 41.25 ? 156 ALA B C    1  
ATOM 6076   O O    . ALA B 1 156 ? -2.770  30.840  -8.063  1.00 33.24 ? 156 ALA B O    1  
ATOM 6077   C CB   . ALA B 1 156 ? 0.246   32.169  -8.147  1.00 71.51 ? 156 ALA B CB   1  
ATOM 6078   H H    . ALA B 1 156 ? -0.034  33.390  -5.908  1.00 4.52  ? 156 ALA B H    1  
ATOM 6079   H HA   . ALA B 1 156 ? -1.673  33.125  -8.217  1.00 72.23 ? 156 ALA B HA   1  
ATOM 6080   H HB1  . ALA B 1 156 ? 0.814   33.079  -8.266  1.00 73.24 ? 156 ALA B HB1  1  
ATOM 6081   H HB2  . ALA B 1 156 ? 0.106   31.701  -9.109  1.00 22.24 ? 156 ALA B HB2  1  
ATOM 6082   H HB3  . ALA B 1 156 ? 0.776   31.494  -7.494  1.00 32.14 ? 156 ALA B HB3  1  
ATOM 6083   N N    . ARG B 1 157 ? -1.551  30.470  -6.270  1.00 32.10 ? 157 ARG B N    1  
ATOM 6084   C CA   . ARG B 1 157 ? -2.264  29.184  -5.999  1.00 3.22  ? 157 ARG B CA   1  
ATOM 6085   C C    . ARG B 1 157 ? -3.514  29.419  -5.157  1.00 73.32 ? 157 ARG B C    1  
ATOM 6086   O O    . ARG B 1 157 ? -4.623  29.239  -5.619  1.00 20.02 ? 157 ARG B O    1  
ATOM 6087   C CB   . ARG B 1 157 ? -1.347  28.230  -5.238  1.00 71.12 ? 157 ARG B CB   1  
ATOM 6088   C CG   . ARG B 1 157 ? -0.018  28.093  -5.974  1.00 63.14 ? 157 ARG B CG   1  
ATOM 6089   C CD   . ARG B 1 157 ? 0.753   26.894  -5.415  1.00 32.34 ? 157 ARG B CD   1  
ATOM 6090   N NE   . ARG B 1 157 ? 0.178   25.633  -5.964  1.00 33.01 ? 157 ARG B NE   1  
ATOM 6091   C CZ   . ARG B 1 157 ? 0.534   24.480  -5.463  1.00 64.10 ? 157 ARG B CZ   1  
ATOM 6092   N NH1  . ARG B 1 157 ? 1.392   24.432  -4.480  1.00 34.34 ? 157 ARG B NH1  1  
ATOM 6093   N NH2  . ARG B 1 157 ? 0.030   23.375  -5.943  1.00 52.22 ? 157 ARG B NH2  1  
ATOM 6094   H H    . ARG B 1 157 ? -0.824  30.768  -5.674  1.00 64.11 ? 157 ARG B H    1  
ATOM 6095   H HA   . ARG B 1 157 ? -2.552  28.729  -6.932  1.00 54.03 ? 157 ARG B HA   1  
ATOM 6096   H HB2  . ARG B 1 157 ? -1.170  28.619  -4.245  1.00 42.20 ? 157 ARG B HB2  1  
ATOM 6097   H HB3  . ARG B 1 157 ? -1.818  27.262  -5.165  1.00 21.01 ? 157 ARG B HB3  1  
ATOM 6098   H HG2  . ARG B 1 157 ? -0.202  27.948  -7.028  1.00 42.11 ? 157 ARG B HG2  1  
ATOM 6099   H HG3  . ARG B 1 157 ? 0.561   28.989  -5.829  1.00 1.41  ? 157 ARG B HG3  1  
ATOM 6100   H HD2  . ARG B 1 157 ? 1.791   26.971  -5.699  1.00 34.11 ? 157 ARG B HD2  1  
ATOM 6101   H HD3  . ARG B 1 157 ? 0.673   26.886  -4.337  1.00 31.21 ? 157 ARG B HD3  1  
ATOM 6102   H HE   . ARG B 1 157 ? -0.467  25.668  -6.701  1.00 72.31 ? 157 ARG B HE   1  
ATOM 6103   H HH11 . ARG B 1 157 ? 1.776   25.277  -4.109  1.00 21.24 ? 157 ARG B HH11 1  
ATOM 6104   H HH12 . ARG B 1 157 ? 1.665   23.549  -4.097  1.00 11.44 ? 157 ARG B HH12 1  
ATOM 6105   H HH21 . ARG B 1 157 ? -0.630  23.411  -6.694  1.00 22.30 ? 157 ARG B HH21 1  
ATOM 6106   H HH22 . ARG B 1 157 ? 0.304   22.493  -5.560  1.00 65.12 ? 157 ARG B HH22 1  
ATOM 6107   N N    . HIS B 1 158 ? -3.349  29.781  -3.916  1.00 61.44 ? 158 HIS B N    1  
ATOM 6108   C CA   . HIS B 1 158 ? -4.544  29.980  -3.049  1.00 43.22 ? 158 HIS B CA   1  
ATOM 6109   C C    . HIS B 1 158 ? -5.343  31.202  -3.522  1.00 53.02 ? 158 HIS B C    1  
ATOM 6110   O O    . HIS B 1 158 ? -5.736  32.051  -2.748  1.00 64.04 ? 158 HIS B O    1  
ATOM 6111   C CB   . HIS B 1 158 ? -4.111  30.106  -1.571  1.00 51.24 ? 158 HIS B CB   1  
ATOM 6112   C CG   . HIS B 1 158 ? -3.757  31.523  -1.199  1.00 73.42 ? 158 HIS B CG   1  
ATOM 6113   N ND1  . HIS B 1 158 ? -2.525  32.089  -1.493  1.00 74.14 ? 158 HIS B ND1  1  
ATOM 6114   C CD2  . HIS B 1 158 ? -4.459  32.486  -0.517  1.00 63.54 ? 158 HIS B CD2  1  
ATOM 6115   C CE1  . HIS B 1 158 ? -2.525  33.339  -0.990  1.00 1.23  ? 158 HIS B CE1  1  
ATOM 6116   N NE2  . HIS B 1 158 ? -3.678  33.626  -0.387  1.00 50.42 ? 158 HIS B NE2  1  
ATOM 6117   H H    . HIS B 1 158 ? -2.444  29.895  -3.551  1.00 24.51 ? 158 HIS B H    1  
ATOM 6118   H HA   . HIS B 1 158 ? -5.173  29.105  -3.150  1.00 71.32 ? 158 HIS B HA   1  
ATOM 6119   H HB2  . HIS B 1 158 ? -4.918  29.776  -0.938  1.00 62.22 ? 158 HIS B HB2  1  
ATOM 6120   H HB3  . HIS B 1 158 ? -3.255  29.472  -1.404  1.00 1.53  ? 158 HIS B HB3  1  
ATOM 6121   H HD1  . HIS B 1 158 ? -1.791  31.659  -1.980  1.00 1.31  ? 158 HIS B HD1  1  
ATOM 6122   H HD2  . HIS B 1 158 ? -5.463  32.371  -0.137  1.00 45.11 ? 158 HIS B HD2  1  
ATOM 6123   H HE1  . HIS B 1 158 ? -1.694  34.024  -1.067  1.00 65.41 ? 158 HIS B HE1  1  
ATOM 6124   H HE2  . HIS B 1 158 ? -3.925  34.466  0.054   1.00 0.00  ? 158 HIS B HE2  1  
ATOM 6125   N N    . ARG B 1 159 ? -5.603  31.286  -4.800  1.00 20.51 ? 159 ARG B N    1  
ATOM 6126   C CA   . ARG B 1 159 ? -6.388  32.436  -5.330  1.00 13.13 ? 159 ARG B CA   1  
ATOM 6127   C C    . ARG B 1 159 ? -7.884  32.135  -5.161  1.00 32.53 ? 159 ARG B C    1  
ATOM 6128   O O    . ARG B 1 159 ? -8.265  31.066  -4.726  1.00 45.20 ? 159 ARG B O    1  
ATOM 6129   C CB   . ARG B 1 159 ? -5.999  32.670  -6.820  1.00 40.32 ? 159 ARG B CB   1  
ATOM 6130   C CG   . ARG B 1 159 ? -6.958  31.982  -7.819  1.00 4.34  ? 159 ARG B CG   1  
ATOM 6131   C CD   . ARG B 1 159 ? -6.909  30.463  -7.637  1.00 21.43 ? 159 ARG B CD   1  
ATOM 6132   N NE   . ARG B 1 159 ? -7.473  29.796  -8.846  1.00 12.45 ? 159 ARG B NE   1  
ATOM 6133   C CZ   . ARG B 1 159 ? -7.234  28.530  -9.061  1.00 61.41 ? 159 ARG B CZ   1  
ATOM 6134   N NH1  . ARG B 1 159 ? -6.470  27.863  -8.240  1.00 4.43  ? 159 ARG B NH1  1  
ATOM 6135   N NH2  . ARG B 1 159 ? -7.754  27.933  -10.098 1.00 43.03 ? 159 ARG B NH2  1  
ATOM 6136   H H    . ARG B 1 159 ? -5.291  30.585  -5.409  1.00 62.33 ? 159 ARG B H    1  
ATOM 6137   H HA   . ARG B 1 159 ? -6.144  33.323  -4.758  1.00 20.11 ? 159 ARG B HA   1  
ATOM 6138   H HB2  . ARG B 1 159 ? -5.992  33.728  -7.022  1.00 42.20 ? 159 ARG B HB2  1  
ATOM 6139   H HB3  . ARG B 1 159 ? -5.002  32.284  -6.977  1.00 73.42 ? 159 ARG B HB3  1  
ATOM 6140   H HG2  . ARG B 1 159 ? -7.966  32.335  -7.673  1.00 34.51 ? 159 ARG B HG2  1  
ATOM 6141   H HG3  . ARG B 1 159 ? -6.646  32.223  -8.825  1.00 72.33 ? 159 ARG B HG3  1  
ATOM 6142   H HD2  . ARG B 1 159 ? -5.886  30.151  -7.500  1.00 14.40 ? 159 ARG B HD2  1  
ATOM 6143   H HD3  . ARG B 1 159 ? -7.490  30.183  -6.774  1.00 54.15 ? 159 ARG B HD3  1  
ATOM 6144   H HE   . ARG B 1 159 ? -8.033  30.302  -9.471  1.00 11.51 ? 159 ARG B HE   1  
ATOM 6145   H HH11 . ARG B 1 159 ? -6.069  28.321  -7.447  1.00 62.25 ? 159 ARG B HH11 1  
ATOM 6146   H HH12 . ARG B 1 159 ? -6.286  26.894  -8.404  1.00 42.14 ? 159 ARG B HH12 1  
ATOM 6147   H HH21 . ARG B 1 159 ? -8.336  28.445  -10.731 1.00 1.42  ? 159 ARG B HH21 1  
ATOM 6148   H HH22 . ARG B 1 159 ? -7.571  26.963  -10.260 1.00 3.24  ? 159 ARG B HH22 1  
ATOM 6149   N N    . ASP B 1 160 ? -8.727  33.062  -5.517  1.00 72.10 ? 160 ASP B N    1  
ATOM 6150   C CA   . ASP B 1 160 ? -10.198 32.839  -5.403  1.00 61.20 ? 160 ASP B CA   1  
ATOM 6151   C C    . ASP B 1 160 ? -10.591 32.431  -3.976  1.00 54.22 ? 160 ASP B C    1  
ATOM 6152   O O    . ASP B 1 160 ? -11.403 31.549  -3.780  1.00 2.51  ? 160 ASP B O    1  
ATOM 6153   C CB   . ASP B 1 160 ? -10.621 31.740  -6.383  1.00 63.13 ? 160 ASP B CB   1  
ATOM 6154   C CG   . ASP B 1 160 ? -12.132 31.525  -6.288  1.00 43.31 ? 160 ASP B CG   1  
ATOM 6155   O OD1  . ASP B 1 160 ? -12.788 32.345  -5.667  1.00 3.52  ? 160 ASP B OD1  1  
ATOM 6156   O OD2  . ASP B 1 160 ? -12.607 30.544  -6.836  1.00 43.41 ? 160 ASP B OD2  1  
ATOM 6157   H H    . ASP B 1 160 ? -8.392  33.907  -5.877  1.00 3.40  ? 160 ASP B H    1  
ATOM 6158   H HA   . ASP B 1 160 ? -10.711 33.753  -5.660  1.00 71.24 ? 160 ASP B HA   1  
ATOM 6159   H HB2  . ASP B 1 160 ? -10.362 32.039  -7.389  1.00 40.34 ? 160 ASP B HB2  1  
ATOM 6160   H HB3  . ASP B 1 160 ? -10.112 30.820  -6.139  1.00 10.02 ? 160 ASP B HB3  1  
ATOM 6161   N N    . GLN B 1 161 ? -10.047 33.069  -2.974  1.00 62.54 ? 161 GLN B N    1  
ATOM 6162   C CA   . GLN B 1 161 ? -10.432 32.709  -1.576  1.00 35.32 ? 161 GLN B CA   1  
ATOM 6163   C C    . GLN B 1 161 ? -10.115 33.872  -0.634  1.00 53.30 ? 161 GLN B C    1  
ATOM 6164   O O    . GLN B 1 161 ? -9.496  34.844  -1.017  1.00 51.03 ? 161 GLN B O    1  
ATOM 6165   C CB   . GLN B 1 161 ? -9.671  31.461  -1.129  1.00 72.25 ? 161 GLN B CB   1  
ATOM 6166   C CG   . GLN B 1 161 ? -8.184  31.631  -1.429  1.00 42.11 ? 161 GLN B CG   1  
ATOM 6167   C CD   . GLN B 1 161 ? -7.429  30.389  -0.954  1.00 31.22 ? 161 GLN B CD   1  
ATOM 6168   O OE1  . GLN B 1 161 ? -7.008  30.317  0.184   1.00 63.22 ? 161 GLN B OE1  1  
ATOM 6169   N NE2  . GLN B 1 161 ? -7.236  29.401  -1.784  1.00 71.52 ? 161 GLN B NE2  1  
ATOM 6170   H H    . GLN B 1 161 ? -9.400  33.788  -3.137  1.00 62.33 ? 161 GLN B H    1  
ATOM 6171   H HA   . GLN B 1 161 ? -11.494 32.507  -1.541  1.00 63.43 ? 161 GLN B HA   1  
ATOM 6172   H HB2  . GLN B 1 161 ? -9.809  31.318  -0.067  1.00 32.43 ? 161 GLN B HB2  1  
ATOM 6173   H HB3  . GLN B 1 161 ? -10.047 30.600  -1.660  1.00 4.05  ? 161 GLN B HB3  1  
ATOM 6174   H HG2  . GLN B 1 161 ? -8.045  31.756  -2.492  1.00 3.41  ? 161 GLN B HG2  1  
ATOM 6175   H HG3  . GLN B 1 161 ? -7.808  32.500  -0.911  1.00 73.24 ? 161 GLN B HG3  1  
ATOM 6176   H HE21 . GLN B 1 161 ? -7.573  29.459  -2.702  1.00 20.32 ? 161 GLN B HE21 1  
ATOM 6177   H HE22 . GLN B 1 161 ? -6.750  28.601  -1.491  1.00 53.10 ? 161 GLN B HE22 1  
ATOM 6178   N N    . ILE B 1 162 ? -10.543 33.781  0.597   1.00 44.24 ? 162 ILE B N    1  
ATOM 6179   C CA   . ILE B 1 162 ? -10.275 34.881  1.565   1.00 53.11 ? 162 ILE B CA   1  
ATOM 6180   C C    . ILE B 1 162 ? -8.800  34.861  1.966   1.00 72.31 ? 162 ILE B C    1  
ATOM 6181   O O    . ILE B 1 162 ? -8.212  33.814  2.154   1.00 51.14 ? 162 ILE B O    1  
ATOM 6182   C CB   . ILE B 1 162 ? -11.139 34.684  2.813   1.00 23.24 ? 162 ILE B CB   1  
ATOM 6183   C CG1  . ILE B 1 162 ? -12.591 34.402  2.402   1.00 21.30 ? 162 ILE B CG1  1  
ATOM 6184   C CG2  . ILE B 1 162 ? -11.089 35.947  3.674   1.00 71.40 ? 162 ILE B CG2  1  
ATOM 6185   C CD1  . ILE B 1 162 ? -13.075 35.464  1.409   1.00 55.45 ? 162 ILE B CD1  1  
ATOM 6186   H H    . ILE B 1 162 ? -11.044 32.989  0.883   1.00 42.33 ? 162 ILE B H    1  
ATOM 6187   H HA   . ILE B 1 162 ? -10.511 35.830  1.108   1.00 41.44 ? 162 ILE B HA   1  
ATOM 6188   H HB   . ILE B 1 162 ? -10.758 33.848  3.382   1.00 11.15 ? 162 ILE B HB   1  
ATOM 6189   H HG12 . ILE B 1 162 ? -12.648 33.428  1.939   1.00 43.20 ? 162 ILE B HG12 1  
ATOM 6190   H HG13 . ILE B 1 162 ? -13.220 34.420  3.279   1.00 3.33  ? 162 ILE B HG13 1  
ATOM 6191   H HG21 . ILE B 1 162 ? -10.071 36.135  3.979   1.00 14.15 ? 162 ILE B HG21 1  
ATOM 6192   H HG22 . ILE B 1 162 ? -11.709 35.812  4.548   1.00 43.51 ? 162 ILE B HG22 1  
ATOM 6193   H HG23 . ILE B 1 162 ? -11.454 36.787  3.101   1.00 54.42 ? 162 ILE B HG23 1  
ATOM 6194   H HD11 . ILE B 1 162 ? -12.724 36.438  1.715   1.00 43.14 ? 162 ILE B HD11 1  
ATOM 6195   H HD12 . ILE B 1 162 ? -14.155 35.465  1.384   1.00 72.12 ? 162 ILE B HD12 1  
ATOM 6196   H HD13 . ILE B 1 162 ? -12.693 35.237  0.425   1.00 13.42 ? 162 ILE B HD13 1  
ATOM 6197   N N    . VAL B 1 163 ? -8.198  36.016  2.097   1.00 64.21 ? 163 VAL B N    1  
ATOM 6198   C CA   . VAL B 1 163 ? -6.755  36.089  2.485   1.00 62.21 ? 163 VAL B CA   1  
ATOM 6199   C C    . VAL B 1 163 ? -6.579  37.135  3.587   1.00 40.44 ? 163 VAL B C    1  
ATOM 6200   O O    . VAL B 1 163 ? -6.736  38.319  3.366   1.00 53.43 ? 163 VAL B O    1  
ATOM 6201   C CB   . VAL B 1 163 ? -5.928  36.495  1.263   1.00 21.25 ? 163 VAL B CB   1  
ATOM 6202   C CG1  . VAL B 1 163 ? -4.440  36.462  1.613   1.00 3.20  ? 163 VAL B CG1  1  
ATOM 6203   C CG2  . VAL B 1 163 ? -6.204  35.519  0.119   1.00 61.21 ? 163 VAL B CG2  1  
ATOM 6204   H H    . VAL B 1 163 ? -8.699  36.843  1.938   1.00 75.03 ? 163 VAL B H    1  
ATOM 6205   H HA   . VAL B 1 163 ? -6.414  35.129  2.848   1.00 71.44 ? 163 VAL B HA   1  
ATOM 6206   H HB   . VAL B 1 163 ? -6.203  37.495  0.960   1.00 73.01 ? 163 VAL B HB   1  
ATOM 6207   H HG11 . VAL B 1 163 ? -4.198  35.513  2.068   1.00 53.20 ? 163 VAL B HG11 1  
ATOM 6208   H HG12 . VAL B 1 163 ? -4.215  37.260  2.305   1.00 34.11 ? 163 VAL B HG12 1  
ATOM 6209   H HG13 . VAL B 1 163 ? -3.855  36.590  0.714   1.00 0.24  ? 163 VAL B HG13 1  
ATOM 6210   H HG21 . VAL B 1 163 ? -5.459  35.647  -0.652  1.00 71.42 ? 163 VAL B HG21 1  
ATOM 6211   H HG22 . VAL B 1 163 ? -7.184  35.713  -0.292  1.00 1.54  ? 163 VAL B HG22 1  
ATOM 6212   H HG23 . VAL B 1 163 ? -6.165  34.507  0.493   1.00 54.12 ? 163 VAL B HG23 1  
ATOM 6213   N N    . SER B 1 164 ? -6.249  36.708  4.776   1.00 52.51 ? 164 SER B N    1  
ATOM 6214   C CA   . SER B 1 164 ? -6.055  37.675  5.896   1.00 35.01 ? 164 SER B CA   1  
ATOM 6215   C C    . SER B 1 164 ? -4.582  38.074  5.959   1.00 74.22 ? 164 SER B C    1  
ATOM 6216   O O    . SER B 1 164 ? -3.735  37.443  5.360   1.00 3.21  ? 164 SER B O    1  
ATOM 6217   C CB   . SER B 1 164 ? -6.457  37.013  7.214   1.00 53.10 ? 164 SER B CB   1  
ATOM 6218   O OG   . SER B 1 164 ? -6.569  38.006  8.224   1.00 23.04 ? 164 SER B OG   1  
ATOM 6219   H H    . SER B 1 164 ? -6.124  35.749  4.933   1.00 30.53 ? 164 SER B H    1  
ATOM 6220   H HA   . SER B 1 164 ? -6.663  38.555  5.734   1.00 34.03 ? 164 SER B HA   1  
ATOM 6221   H HB2  . SER B 1 164 ? -7.406  36.518  7.096   1.00 33.53 ? 164 SER B HB2  1  
ATOM 6222   H HB3  . SER B 1 164 ? -5.706  36.284  7.492   1.00 64.53 ? 164 SER B HB3  1  
ATOM 6223   H HG   . SER B 1 164 ? -6.012  37.744  8.960   1.00 1.42  ? 164 SER B HG   1  
ATOM 6224   N N    . LYS B 1 165 ? -4.260  39.109  6.682   1.00 34.15 ? 165 LYS B N    1  
ATOM 6225   C CA   . LYS B 1 165 ? -2.833  39.521  6.776   1.00 51.24 ? 165 LYS B CA   1  
ATOM 6226   C C    . LYS B 1 165 ? -2.024  38.358  7.360   1.00 4.24  ? 165 LYS B C    1  
ATOM 6227   O O    . LYS B 1 165 ? -0.956  38.018  6.881   1.00 65.31 ? 165 LYS B O    1  
ATOM 6228   C CB   . LYS B 1 165 ? -2.712  40.750  7.682   1.00 11.31 ? 165 LYS B CB   1  
ATOM 6229   C CG   . LYS B 1 165 ? -3.305  41.973  6.971   1.00 12.32 ? 165 LYS B CG   1  
ATOM 6230   C CD   . LYS B 1 165 ? -2.989  43.239  7.776   1.00 24.01 ? 165 LYS B CD   1  
ATOM 6231   C CE   . LYS B 1 165 ? -3.609  44.457  7.085   1.00 4.33  ? 165 LYS B CE   1  
ATOM 6232   N NZ   . LYS B 1 165 ? -3.621  45.614  8.025   1.00 55.02 ? 165 LYS B NZ   1  
ATOM 6233   H H    . LYS B 1 165 ? -4.951  39.606  7.166   1.00 44.44 ? 165 LYS B H    1  
ATOM 6234   H HA   . LYS B 1 165 ? -2.461  39.759  5.789   1.00 72.42 ? 165 LYS B HA   1  
ATOM 6235   H HB2  . LYS B 1 165 ? -3.251  40.572  8.603   1.00 33.22 ? 165 LYS B HB2  1  
ATOM 6236   H HB3  . LYS B 1 165 ? -1.672  40.933  7.905   1.00 34.25 ? 165 LYS B HB3  1  
ATOM 6237   H HG2  . LYS B 1 165 ? -2.877  42.059  5.982   1.00 62.04 ? 165 LYS B HG2  1  
ATOM 6238   H HG3  . LYS B 1 165 ? -4.376  41.859  6.889   1.00 24.44 ? 165 LYS B HG3  1  
ATOM 6239   H HD2  . LYS B 1 165 ? -3.397  43.142  8.771   1.00 2.44  ? 165 LYS B HD2  1  
ATOM 6240   H HD3  . LYS B 1 165 ? -1.919  43.369  7.836   1.00 34.21 ? 165 LYS B HD3  1  
ATOM 6241   H HE2  . LYS B 1 165 ? -3.026  44.711  6.213   1.00 25.53 ? 165 LYS B HE2  1  
ATOM 6242   H HE3  . LYS B 1 165 ? -4.621  44.225  6.786   1.00 14.32 ? 165 LYS B HE3  1  
ATOM 6243   H HZ1  . LYS B 1 165 ? -4.389  46.265  7.765   1.00 23.42 ? 165 LYS B HZ1  1  
ATOM 6244   H HZ2  . LYS B 1 165 ? -2.709  46.113  7.971   1.00 11.41 ? 165 LYS B HZ2  1  
ATOM 6245   H HZ3  . LYS B 1 165 ? -3.773  45.273  8.995   1.00 62.44 ? 165 LYS B HZ3  1  
ATOM 6246   N N    . GLU B 1 166 ? -2.537  37.733  8.385   1.00 25.31 ? 166 GLU B N    1  
ATOM 6247   C CA   . GLU B 1 166 ? -1.816  36.583  8.995   1.00 31.54 ? 166 GLU B CA   1  
ATOM 6248   C C    . GLU B 1 166 ? -1.695  35.465  7.957   1.00 40.05 ? 166 GLU B C    1  
ATOM 6249   O O    . GLU B 1 166 ? -0.813  34.633  8.024   1.00 34.32 ? 166 GLU B O    1  
ATOM 6250   C CB   . GLU B 1 166 ? -2.600  36.075  10.209  1.00 63.45 ? 166 GLU B CB   1  
ATOM 6251   C CG   . GLU B 1 166 ? -2.669  37.176  11.269  1.00 53.01 ? 166 GLU B CG   1  
ATOM 6252   C CD   . GLU B 1 166 ? -1.273  37.420  11.846  1.00 53.35 ? 166 GLU B CD   1  
ATOM 6253   O OE1  . GLU B 1 166 ? -0.526  36.464  11.962  1.00 14.31 ? 166 GLU B OE1  1  
ATOM 6254   O OE2  . GLU B 1 166 ? -0.978  38.560  12.166  1.00 31.24 ? 166 GLU B OE2  1  
ATOM 6255   H H    . GLU B 1 166 ? -3.404  38.015  8.747   1.00 0.31  ? 166 GLU B H    1  
ATOM 6256   H HA   . GLU B 1 166 ? -0.831  36.897  9.306   1.00 13.12 ? 166 GLU B HA   1  
ATOM 6257   H HB2  . GLU B 1 166 ? -3.601  35.804  9.903   1.00 44.52 ? 166 GLU B HB2  1  
ATOM 6258   H HB3  . GLU B 1 166 ? -2.103  35.210  10.622  1.00 33.11 ? 166 GLU B HB3  1  
ATOM 6259   H HG2  . GLU B 1 166 ? -3.037  38.085  10.818  1.00 12.05 ? 166 GLU B HG2  1  
ATOM 6260   H HG3  . GLU B 1 166 ? -3.337  36.872  12.062  1.00 53.13 ? 166 GLU B HG3  1  
ATOM 6261   N N    . GLN B 1 167 ? -2.583  35.440  6.998   1.00 72.40 ? 167 GLN B N    1  
ATOM 6262   C CA   . GLN B 1 167 ? -2.528  34.376  5.955   1.00 13.50 ? 167 GLN B CA   1  
ATOM 6263   C C    . GLN B 1 167 ? -1.201  34.467  5.194   1.00 41.34 ? 167 GLN B C    1  
ATOM 6264   O O    . GLN B 1 167 ? -0.485  33.494  5.058   1.00 31.53 ? 167 GLN B O    1  
ATOM 6265   C CB   . GLN B 1 167 ? -3.695  34.564  4.977   1.00 51.21 ? 167 GLN B CB   1  
ATOM 6266   C CG   . GLN B 1 167 ? -3.908  33.281  4.172   1.00 30.45 ? 167 GLN B CG   1  
ATOM 6267   C CD   . GLN B 1 167 ? -4.514  32.208  5.076   1.00 23.33 ? 167 GLN B CD   1  
ATOM 6268   O OE1  . GLN B 1 167 ? -4.940  32.493  6.177   1.00 61.45 ? 167 GLN B OE1  1  
ATOM 6269   N NE2  . GLN B 1 167 ? -4.572  30.975  4.654   1.00 60.12 ? 167 GLN B NE2  1  
ATOM 6270   H H    . GLN B 1 167 ? -3.288  36.119  6.966   1.00 15.21 ? 167 GLN B H    1  
ATOM 6271   H HA   . GLN B 1 167 ? -2.605  33.408  6.427   1.00 33.32 ? 167 GLN B HA   1  
ATOM 6272   H HB2  . GLN B 1 167 ? -4.594  34.793  5.531   1.00 32.40 ? 167 GLN B HB2  1  
ATOM 6273   H HB3  . GLN B 1 167 ? -3.473  35.375  4.301   1.00 63.24 ? 167 GLN B HB3  1  
ATOM 6274   H HG2  . GLN B 1 167 ? -4.578  33.480  3.349   1.00 13.35 ? 167 GLN B HG2  1  
ATOM 6275   H HG3  . GLN B 1 167 ? -2.961  32.934  3.789   1.00 34.11 ? 167 GLN B HG3  1  
ATOM 6276   H HE21 . GLN B 1 167 ? -4.228  30.745  3.766   1.00 50.24 ? 167 GLN B HE21 1  
ATOM 6277   H HE22 . GLN B 1 167 ? -4.958  30.279  5.225   1.00 43.43 ? 167 GLN B HE22 1  
ATOM 6278   N N    . LEU B 1 168 ? -0.865  35.629  4.702   1.00 55.33 ? 168 LEU B N    1  
ATOM 6279   C CA   . LEU B 1 168 ? 0.416   35.783  3.954   1.00 65.14 ? 168 LEU B CA   1  
ATOM 6280   C C    . LEU B 1 168 ? 1.581   35.451  4.887   1.00 42.21 ? 168 LEU B C    1  
ATOM 6281   O O    . LEU B 1 168 ? 2.532   34.794  4.513   1.00 52.24 ? 168 LEU B O    1  
ATOM 6282   C CB   . LEU B 1 168 ? 0.551   37.228  3.466   1.00 72.32 ? 168 LEU B CB   1  
ATOM 6283   C CG   . LEU B 1 168 ? -0.727  37.658  2.737   1.00 12.01 ? 168 LEU B CG   1  
ATOM 6284   C CD1  . LEU B 1 168 ? -0.617  39.137  2.361   1.00 52.53 ? 168 LEU B CD1  1  
ATOM 6285   C CD2  . LEU B 1 168 ? -0.906  36.823  1.463   1.00 11.32 ? 168 LEU B CD2  1  
ATOM 6286   H H    . LEU B 1 168 ? -1.455  36.402  4.827   1.00 14.04 ? 168 LEU B H    1  
ATOM 6287   H HA   . LEU B 1 168 ? 0.430   35.115  3.111   1.00 72.03 ? 168 LEU B HA   1  
ATOM 6288   H HB2  . LEU B 1 168 ? 0.713   37.875  4.311   1.00 13.34 ? 168 LEU B HB2  1  
ATOM 6289   H HB3  . LEU B 1 168 ? 1.389   37.303  2.791   1.00 3.20  ? 168 LEU B HB3  1  
ATOM 6290   H HG   . LEU B 1 168 ? -1.578  37.515  3.388   1.00 64.14 ? 168 LEU B HG   1  
ATOM 6291   H HD11 . LEU B 1 168 ? -1.475  39.423  1.771   1.00 14.42 ? 168 LEU B HD11 1  
ATOM 6292   H HD12 . LEU B 1 168 ? 0.284   39.297  1.787   1.00 52.25 ? 168 LEU B HD12 1  
ATOM 6293   H HD13 . LEU B 1 168 ? -0.583  39.735  3.260   1.00 12.23 ? 168 LEU B HD13 1  
ATOM 6294   H HD21 . LEU B 1 168 ? -1.273  35.842  1.723   1.00 64.51 ? 168 LEU B HD21 1  
ATOM 6295   H HD22 . LEU B 1 168 ? 0.042   36.731  0.955   1.00 42.23 ? 168 LEU B HD22 1  
ATOM 6296   H HD23 . LEU B 1 168 ? -1.617  37.309  0.810   1.00 2.31  ? 168 LEU B HD23 1  
ATOM 6297   N N    . LEU B 1 169 ? 1.505   35.904  6.103   1.00 73.34 ? 169 LEU B N    1  
ATOM 6298   C CA   . LEU B 1 169 ? 2.596   35.630  7.081   1.00 13.14 ? 169 LEU B CA   1  
ATOM 6299   C C    . LEU B 1 169 ? 2.801   34.122  7.225   1.00 1.21  ? 169 LEU B C    1  
ATOM 6300   O O    . LEU B 1 169 ? 3.836   33.593  6.854   1.00 25.24 ? 169 LEU B O    1  
ATOM 6301   C CB   . LEU B 1 169 ? 2.189   36.256  8.431   1.00 21.54 ? 169 LEU B CB   1  
ATOM 6302   C CG   . LEU B 1 169 ? 3.413   36.793  9.196   1.00 50.34 ? 169 LEU B CG   1  
ATOM 6303   C CD1  . LEU B 1 169 ? 4.487   35.699  9.307   1.00 1.41  ? 169 LEU B CD1  1  
ATOM 6304   C CD2  . LEU B 1 169 ? 3.991   38.038  8.488   1.00 63.25 ? 169 LEU B CD2  1  
ATOM 6305   H H    . LEU B 1 169 ? 0.724   36.433  6.379   1.00 60.23 ? 169 LEU B H    1  
ATOM 6306   H HA   . LEU B 1 169 ? 3.514   36.064  6.729   1.00 71.42 ? 169 LEU B HA   1  
ATOM 6307   H HB2  . LEU B 1 169 ? 1.502   37.069  8.248   1.00 71.04 ? 169 LEU B HB2  1  
ATOM 6308   H HB3  . LEU B 1 169 ? 1.690   35.514  9.039   1.00 4.31  ? 169 LEU B HB3  1  
ATOM 6309   H HG   . LEU B 1 169 ? 3.100   37.073  10.192  1.00 32.42 ? 169 LEU B HG   1  
ATOM 6310   H HD11 . LEU B 1 169 ? 5.109   35.897  10.165  1.00 14.21 ? 169 LEU B HD11 1  
ATOM 6311   H HD12 . LEU B 1 169 ? 5.096   35.692  8.414   1.00 24.35 ? 169 LEU B HD12 1  
ATOM 6312   H HD13 . LEU B 1 169 ? 4.015   34.734  9.428   1.00 15.31 ? 169 LEU B HD13 1  
ATOM 6313   H HD21 . LEU B 1 169 ? 4.506   38.650  9.212   1.00 32.22 ? 169 LEU B HD21 1  
ATOM 6314   H HD22 . LEU B 1 169 ? 3.193   38.614  8.045   1.00 65.13 ? 169 LEU B HD22 1  
ATOM 6315   H HD23 . LEU B 1 169 ? 4.686   37.738  7.718   1.00 42.53 ? 169 LEU B HD23 1  
ATOM 6316   N N    . ASP B 1 170 ? 1.838   33.433  7.773   1.00 42.14 ? 170 ASP B N    1  
ATOM 6317   C CA   . ASP B 1 170 ? 1.988   31.966  7.958   1.00 33.22 ? 170 ASP B CA   1  
ATOM 6318   C C    . ASP B 1 170 ? 2.199   31.290  6.600   1.00 25.42 ? 170 ASP B C    1  
ATOM 6319   O O    . ASP B 1 170 ? 2.655   30.169  6.516   1.00 72.10 ? 170 ASP B O    1  
ATOM 6320   C CB   . ASP B 1 170 ? 0.732   31.400  8.624   1.00 53.10 ? 170 ASP B CB   1  
ATOM 6321   C CG   . ASP B 1 170 ? 1.004   29.968  9.089   1.00 24.45 ? 170 ASP B CG   1  
ATOM 6322   O OD1  . ASP B 1 170 ? 2.156   29.566  9.059   1.00 25.34 ? 170 ASP B OD1  1  
ATOM 6323   O OD2  . ASP B 1 170 ? 0.057   29.298  9.467   1.00 20.42 ? 170 ASP B OD2  1  
ATOM 6324   H H    . ASP B 1 170 ? 1.022   33.885  8.074   1.00 73.10 ? 170 ASP B H    1  
ATOM 6325   H HA   . ASP B 1 170 ? 2.847   31.781  8.591   1.00 71.44 ? 170 ASP B HA   1  
ATOM 6326   H HB2  . ASP B 1 170 ? 0.470   32.011  9.475   1.00 53.54 ? 170 ASP B HB2  1  
ATOM 6327   H HB3  . ASP B 1 170 ? -0.082  31.398  7.915   1.00 22.42 ? 170 ASP B HB3  1  
ATOM 6328   N N    . ALA B 1 171 ? 1.876   31.962  5.529   1.00 62.12 ? 171 ALA B N    1  
ATOM 6329   C CA   . ALA B 1 171 ? 2.077   31.355  4.180   1.00 15.31 ? 171 ALA B CA   1  
ATOM 6330   C C    . ALA B 1 171 ? 3.440   31.789  3.646   1.00 62.13 ? 171 ALA B C    1  
ATOM 6331   O O    . ALA B 1 171 ? 3.862   31.369  2.587   1.00 4.35  ? 171 ALA B O    1  
ATOM 6332   C CB   . ALA B 1 171 ? 0.989   31.838  3.226   1.00 2.22  ? 171 ALA B CB   1  
ATOM 6333   H H    . ALA B 1 171 ? 1.511   32.867  5.609   1.00 30.05 ? 171 ALA B H    1  
ATOM 6334   H HA   . ALA B 1 171 ? 2.042   30.275  4.249   1.00 34.53 ? 171 ALA B HA   1  
ATOM 6335   H HB1  . ALA B 1 171 ? 1.133   31.385  2.257   1.00 62.12 ? 171 ALA B HB1  1  
ATOM 6336   H HB2  . ALA B 1 171 ? 1.050   32.908  3.132   1.00 3.31  ? 171 ALA B HB2  1  
ATOM 6337   H HB3  . ALA B 1 171 ? 0.019   31.564  3.612   1.00 21.23 ? 171 ALA B HB3  1  
ATOM 6338   N N    . ILE B 1 172 ? 4.133   32.634  4.374   1.00 3.11  ? 172 ILE B N    1  
ATOM 6339   C CA   . ILE B 1 172 ? 5.469   33.110  3.922   1.00 71.42 ? 172 ILE B CA   1  
ATOM 6340   C C    . ILE B 1 172 ? 6.452   33.013  5.084   1.00 12.43 ? 172 ILE B C    1  
ATOM 6341   O O    . ILE B 1 172 ? 7.202   32.065  5.167   1.00 11.13 ? 172 ILE B O    1  
ATOM 6342   C CB   . ILE B 1 172 ? 5.366   34.566  3.460   1.00 65.11 ? 172 ILE B CB   1  
ATOM 6343   C CG1  . ILE B 1 172 ? 4.496   34.636  2.203   1.00 32.43 ? 172 ILE B CG1  1  
ATOM 6344   C CG2  . ILE B 1 172 ? 6.765   35.101  3.140   1.00 12.01 ? 172 ILE B CG2  1  
ATOM 6345   C CD1  . ILE B 1 172 ? 4.189   36.097  1.874   1.00 44.32 ? 172 ILE B CD1  1  
ATOM 6346   H H    . ILE B 1 172 ? 3.773   32.958  5.227   1.00 71.23 ? 172 ILE B H    1  
ATOM 6347   H HA   . ILE B 1 172 ? 5.828   32.501  3.102   1.00 1.14  ? 172 ILE B HA   1  
ATOM 6348   H HB   . ILE B 1 172 ? 4.921   35.163  4.243   1.00 33.11 ? 172 ILE B HB   1  
ATOM 6349   H HG12 . ILE B 1 172 ? 5.025   34.184  1.376   1.00 15.44 ? 172 ILE B HG12 1  
ATOM 6350   H HG13 . ILE B 1 172 ? 3.572   34.104  2.373   1.00 61.00 ? 172 ILE B HG13 1  
ATOM 6351   H HG21 . ILE B 1 172 ? 6.681   36.035  2.606   1.00 71.53 ? 172 ILE B HG21 1  
ATOM 6352   H HG22 . ILE B 1 172 ? 7.293   34.384  2.529   1.00 74.40 ? 172 ILE B HG22 1  
ATOM 6353   H HG23 . ILE B 1 172 ? 7.308   35.260  4.060   1.00 1.33  ? 172 ILE B HG23 1  
ATOM 6354   H HD11 . ILE B 1 172 ? 5.107   36.612  1.635   1.00 74.44 ? 172 ILE B HD11 1  
ATOM 6355   H HD12 . ILE B 1 172 ? 3.723   36.568  2.728   1.00 43.42 ? 172 ILE B HD12 1  
ATOM 6356   H HD13 . ILE B 1 172 ? 3.520   36.142  1.028   1.00 40.14 ? 172 ILE B HD13 1  
ATOM 6357   N N    . TRP B 1 173 ? 6.434   33.988  5.980   1.00 65.52 ? 173 TRP B N    1  
ATOM 6358   C CA   . TRP B 1 173 ? 7.371   34.000  7.169   1.00 71.23 ? 173 TRP B CA   1  
ATOM 6359   C C    . TRP B 1 173 ? 7.618   35.448  7.605   1.00 21.43 ? 173 TRP B C    1  
ATOM 6360   O O    . TRP B 1 173 ? 7.184   36.389  6.971   1.00 72.23 ? 173 TRP B O    1  
ATOM 6361   C CB   . TRP B 1 173 ? 8.720   33.341  6.807   1.00 30.04 ? 173 TRP B CB   1  
ATOM 6362   C CG   . TRP B 1 173 ? 8.749   31.882  7.211   1.00 0.03  ? 173 TRP B CG   1  
ATOM 6363   C CD1  . TRP B 1 173 ? 9.891   31.167  7.348   1.00 51.44 ? 173 TRP B CD1  1  
ATOM 6364   C CD2  . TRP B 1 173 ? 7.648   30.950  7.534   1.00 61.04 ? 173 TRP B CD2  1  
ATOM 6365   N NE1  . TRP B 1 173 ? 9.579   29.882  7.745   1.00 55.34 ? 173 TRP B NE1  1  
ATOM 6366   C CE2  . TRP B 1 173 ? 8.220   29.696  7.873   1.00 30.24 ? 173 TRP B CE2  1  
ATOM 6367   C CE3  . TRP B 1 173 ? 6.233   31.051  7.577   1.00 11.14 ? 173 TRP B CE3  1  
ATOM 6368   C CZ2  . TRP B 1 173 ? 7.432   28.602  8.239   1.00 13.41 ? 173 TRP B CZ2  1  
ATOM 6369   C CZ3  . TRP B 1 173 ? 5.450   29.954  7.944   1.00 54.35 ? 173 TRP B CZ3  1  
ATOM 6370   C CH2  . TRP B 1 173 ? 6.044   28.733  8.278   1.00 33.50 ? 173 TRP B CH2  1  
ATOM 6371   H H    . TRP B 1 173 ? 5.790   34.721  5.872   1.00 35.04 ? 173 TRP B H    1  
ATOM 6372   H HA   . TRP B 1 173 ? 6.929   33.492  8.005   1.00 14.34 ? 173 TRP B HA   1  
ATOM 6373   H HB2  . TRP B 1 173 ? 8.894   33.430  5.749   1.00 55.35 ? 173 TRP B HB2  1  
ATOM 6374   H HB3  . TRP B 1 173 ? 9.513   33.856  7.323   1.00 51.54 ? 173 TRP B HB3  1  
ATOM 6375   H HD1  . TRP B 1 173 ? 10.889  31.545  7.183   1.00 63.44 ? 173 TRP B HD1  1  
ATOM 6376   H HE1  . TRP B 1 173 ? 10.232  29.173  7.919   1.00 15.44 ? 173 TRP B HE1  1  
ATOM 6377   H HE3  . TRP B 1 173 ? 5.739   31.964  7.314   1.00 44.23 ? 173 TRP B HE3  1  
ATOM 6378   H HZ2  . TRP B 1 173 ? 7.896   27.662  8.496   1.00 3.13  ? 173 TRP B HZ2  1  
ATOM 6379   H HZ3  . TRP B 1 173 ? 4.380   30.063  7.983   1.00 64.34 ? 173 TRP B HZ3  1  
ATOM 6380   H HH2  . TRP B 1 173 ? 5.429   27.891  8.561   1.00 62.24 ? 173 TRP B HH2  1  
ATOM 6381   N N    . GLU B 1 174 ? 8.314   35.618  8.700   1.00 21.24 ? 174 GLU B N    1  
ATOM 6382   C CA   . GLU B 1 174 ? 8.593   36.987  9.206   1.00 42.44 ? 174 GLU B CA   1  
ATOM 6383   C C    . GLU B 1 174 ? 9.706   36.932  10.260  1.00 41.31 ? 174 GLU B C    1  
ATOM 6384   O O    . GLU B 1 174 ? 10.744  37.545  10.112  1.00 14.10 ? 174 GLU B O    1  
ATOM 6385   C CB   . GLU B 1 174 ? 7.316   37.545  9.830   1.00 12.45 ? 174 GLU B CB   1  
ATOM 6386   C CG   . GLU B 1 174 ? 7.505   39.024  10.172  1.00 32.12 ? 174 GLU B CG   1  
ATOM 6387   C CD   . GLU B 1 174 ? 6.321   39.507  11.013  1.00 43.13 ? 174 GLU B CD   1  
ATOM 6388   O OE1  . GLU B 1 174 ? 5.496   38.680  11.368  1.00 33.44 ? 174 GLU B OE1  1  
ATOM 6389   O OE2  . GLU B 1 174 ? 6.259   40.693  11.289  1.00 52.11 ? 174 GLU B OE2  1  
ATOM 6390   H H    . GLU B 1 174 ? 8.645   34.838  9.193   1.00 75.03 ? 174 GLU B H    1  
ATOM 6391   H HA   . GLU B 1 174 ? 8.902   37.617  8.389   1.00 35.21 ? 174 GLU B HA   1  
ATOM 6392   H HB2  . GLU B 1 174 ? 6.503   37.436  9.127   1.00 31.44 ? 174 GLU B HB2  1  
ATOM 6393   H HB3  . GLU B 1 174 ? 7.087   36.994  10.730  1.00 34.11 ? 174 GLU B HB3  1  
ATOM 6394   H HG2  . GLU B 1 174 ? 8.420   39.152  10.731  1.00 24.02 ? 174 GLU B HG2  1  
ATOM 6395   H HG3  . GLU B 1 174 ? 7.555   39.601  9.261   1.00 74.32 ? 174 GLU B HG3  1  
ATOM 6396   N N    . GLU B 1 175 ? 9.496   36.203  11.324  1.00 52.40 ? 175 GLU B N    1  
ATOM 6397   C CA   . GLU B 1 175 ? 10.542  36.111  12.383  1.00 20.22 ? 175 GLU B CA   1  
ATOM 6398   C C    . GLU B 1 175 ? 11.759  35.316  11.860  1.00 44.22 ? 175 GLU B C    1  
ATOM 6399   O O    . GLU B 1 175 ? 12.853  35.842  11.816  1.00 30.32 ? 175 GLU B O    1  
ATOM 6400   C CB   . GLU B 1 175 ? 9.946   35.459  13.650  1.00 5.00  ? 175 GLU B CB   1  
ATOM 6401   C CG   . GLU B 1 175 ? 11.059  34.874  14.532  1.00 13.34 ? 175 GLU B CG   1  
ATOM 6402   C CD   . GLU B 1 175 ? 10.508  34.576  15.927  1.00 34.24 ? 175 GLU B CD   1  
ATOM 6403   O OE1  . GLU B 1 175 ? 10.436  35.497  16.723  1.00 30.30 ? 175 GLU B OE1  1  
ATOM 6404   O OE2  . GLU B 1 175 ? 10.168  33.431  16.176  1.00 73.04 ? 175 GLU B OE2  1  
ATOM 6405   H H    . GLU B 1 175 ? 8.652   35.716  11.425  1.00 4.04  ? 175 GLU B H    1  
ATOM 6406   H HA   . GLU B 1 175 ? 10.868  37.112  12.628  1.00 12.04 ? 175 GLU B HA   1  
ATOM 6407   H HB2  . GLU B 1 175 ? 9.409   36.210  14.212  1.00 31.45 ? 175 GLU B HB2  1  
ATOM 6408   H HB3  . GLU B 1 175 ? 9.262   34.675  13.369  1.00 1.32  ? 175 GLU B HB3  1  
ATOM 6409   H HG2  . GLU B 1 175 ? 11.428  33.961  14.087  1.00 23.11 ? 175 GLU B HG2  1  
ATOM 6410   H HG3  . GLU B 1 175 ? 11.867  35.586  14.611  1.00 62.40 ? 175 GLU B HG3  1  
ATOM 6411   N N    . PRO B 1 176 ? 11.597  34.068  11.467  1.00 52.42 ? 176 PRO B N    1  
ATOM 6412   C CA   . PRO B 1 176 ? 12.738  33.246  10.955  1.00 13.45 ? 176 PRO B CA   1  
ATOM 6413   C C    . PRO B 1 176 ? 13.517  33.974  9.851   1.00 74.13 ? 176 PRO B C    1  
ATOM 6414   O O    . PRO B 1 176 ? 14.717  33.837  9.731   1.00 62.43 ? 176 PRO B O    1  
ATOM 6415   C CB   . PRO B 1 176 ? 12.068  31.958  10.416  1.00 2.54  ? 176 PRO B CB   1  
ATOM 6416   C CG   . PRO B 1 176 ? 10.603  32.269  10.357  1.00 31.51 ? 176 PRO B CG   1  
ATOM 6417   C CD   . PRO B 1 176 ? 10.347  33.291  11.455  1.00 63.51 ? 176 PRO B CD   1  
ATOM 6418   H HA   . PRO B 1 176 ? 13.404  32.996  11.767  1.00 53.34 ? 176 PRO B HA   1  
ATOM 6419   H HB2  . PRO B 1 176 ? 12.444  31.712  9.429   1.00 2.51  ? 176 PRO B HB2  1  
ATOM 6420   H HB3  . PRO B 1 176 ? 12.242  31.133  11.093  1.00 42.44 ? 176 PRO B HB3  1  
ATOM 6421   H HG2  . PRO B 1 176 ? 10.350  32.691  9.393   1.00 44.00 ? 176 PRO B HG2  1  
ATOM 6422   H HG3  . PRO B 1 176 ? 10.017  31.381  10.542  1.00 34.50 ? 176 PRO B HG3  1  
ATOM 6423   H HD2  . PRO B 1 176 ? 9.498   33.901  11.201  1.00 33.21 ? 176 PRO B HD2  1  
ATOM 6424   H HD3  . PRO B 1 176 ? 10.202  32.799  12.404  1.00 2.13  ? 176 PRO B HD3  1  
ATOM 6425   N N    . GLU B 1 177 ? 12.842  34.752  9.048   1.00 62.35 ? 177 GLU B N    1  
ATOM 6426   C CA   . GLU B 1 177 ? 13.543  35.492  7.961   1.00 44.43 ? 177 GLU B CA   1  
ATOM 6427   C C    . GLU B 1 177 ? 14.122  36.787  8.526   1.00 65.31 ? 177 GLU B C    1  
ATOM 6428   O O    . GLU B 1 177 ? 14.668  37.599  7.807   1.00 72.44 ? 177 GLU B O    1  
ATOM 6429   C CB   . GLU B 1 177 ? 12.547  35.826  6.849   1.00 23.21 ? 177 GLU B CB   1  
ATOM 6430   C CG   . GLU B 1 177 ? 12.253  34.566  6.033   1.00 60.32 ? 177 GLU B CG   1  
ATOM 6431   C CD   . GLU B 1 177 ? 11.141  34.858  5.025   1.00 30.51 ? 177 GLU B CD   1  
ATOM 6432   O OE1  . GLU B 1 177 ? 10.507  35.892  5.155   1.00 63.21 ? 177 GLU B OE1  1  
ATOM 6433   O OE2  . GLU B 1 177 ? 10.942  34.042  4.141   1.00 31.21 ? 177 GLU B OE2  1  
ATOM 6434   H H    . GLU B 1 177 ? 11.874  34.853  9.164   1.00 21.32 ? 177 GLU B H    1  
ATOM 6435   H HA   . GLU B 1 177 ? 14.341  34.883  7.561   1.00 24.30 ? 177 GLU B HA   1  
ATOM 6436   H HB2  . GLU B 1 177 ? 11.631  36.194  7.287   1.00 24.32 ? 177 GLU B HB2  1  
ATOM 6437   H HB3  . GLU B 1 177 ? 12.967  36.581  6.202   1.00 41.31 ? 177 GLU B HB3  1  
ATOM 6438   H HG2  . GLU B 1 177 ? 13.147  34.263  5.507   1.00 31.02 ? 177 GLU B HG2  1  
ATOM 6439   H HG3  . GLU B 1 177 ? 11.939  33.774  6.695   1.00 24.15 ? 177 GLU B HG3  1  
ATOM 6440   N N    . MET B 1 178 ? 14.003  36.992  9.808   1.00 63.43 ? 178 MET B N    1  
ATOM 6441   C CA   . MET B 1 178 ? 14.543  38.242  10.411  1.00 32.34 ? 178 MET B CA   1  
ATOM 6442   C C    . MET B 1 178 ? 14.058  39.444  9.598   1.00 1.15  ? 178 MET B C    1  
ATOM 6443   O O    . MET B 1 178 ? 14.715  40.463  9.528   1.00 15.23 ? 178 MET B O    1  
ATOM 6444   C CB   . MET B 1 178 ? 16.073  38.200  10.390  1.00 2.15  ? 178 MET B CB   1  
ATOM 6445   C CG   . MET B 1 178 ? 16.574  37.208  11.441  1.00 11.11 ? 178 MET B CG   1  
ATOM 6446   S SD   . MET B 1 178 ? 18.384  37.243  11.490  1.00 33.10 ? 178 MET B SD   1  
ATOM 6447   C CE   . MET B 1 178 ? 18.558  38.575  12.704  1.00 21.11 ? 178 MET B CE   1  
ATOM 6448   H H    . MET B 1 178 ? 13.555  36.327  10.372  1.00 42.31 ? 178 MET B H    1  
ATOM 6449   H HA   . MET B 1 178 ? 14.197  38.330  11.430  1.00 4.24  ? 178 MET B HA   1  
ATOM 6450   H HB2  . MET B 1 178 ? 16.411  37.889  9.412   1.00 53.02 ? 178 MET B HB2  1  
ATOM 6451   H HB3  . MET B 1 178 ? 16.462  39.182  10.609  1.00 44.42 ? 178 MET B HB3  1  
ATOM 6452   H HG2  . MET B 1 178 ? 16.182  37.482  12.409  1.00 31.00 ? 178 MET B HG2  1  
ATOM 6453   H HG3  . MET B 1 178 ? 16.240  36.213  11.186  1.00 60.04 ? 178 MET B HG3  1  
ATOM 6454   H HE1  . MET B 1 178 ? 19.555  38.990  12.641  1.00 62.15 ? 178 MET B HE1  1  
ATOM 6455   H HE2  . MET B 1 178 ? 18.395  38.184  13.694  1.00 72.11 ? 178 MET B HE2  1  
ATOM 6456   H HE3  . MET B 1 178 ? 17.828  39.346  12.499  1.00 43.22 ? 178 MET B HE3  1  
ATOM 6457   N N    . VAL B 1 179 ? 12.914  39.332  8.976   1.00 41.40 ? 179 VAL B N    1  
ATOM 6458   C CA   . VAL B 1 179 ? 12.396  40.467  8.164   1.00 14.13 ? 179 VAL B CA   1  
ATOM 6459   C C    . VAL B 1 179 ? 11.993  41.610  9.107   1.00 15.34 ? 179 VAL B C    1  
ATOM 6460   O O    . VAL B 1 179 ? 11.956  41.451  10.311  1.00 54.55 ? 179 VAL B O    1  
ATOM 6461   C CB   . VAL B 1 179 ? 11.194  39.970  7.313   1.00 54.02 ? 179 VAL B CB   1  
ATOM 6462   C CG1  . VAL B 1 179 ? 9.854   40.215  8.025   1.00 71.05 ? 179 VAL B CG1  1  
ATOM 6463   C CG2  . VAL B 1 179 ? 11.169  40.683  5.957   1.00 11.24 ? 179 VAL B CG2  1  
ATOM 6464   H H    . VAL B 1 179 ? 12.398  38.499  9.040   1.00 11.24 ? 179 VAL B H    1  
ATOM 6465   H HA   . VAL B 1 179 ? 13.185  40.815  7.511   1.00 74.52 ? 179 VAL B HA   1  
ATOM 6466   H HB   . VAL B 1 179 ? 11.307  38.909  7.147   1.00 43.31 ? 179 VAL B HB   1  
ATOM 6467   H HG11 . VAL B 1 179 ? 9.660   41.276  8.081   1.00 63.21 ? 179 VAL B HG11 1  
ATOM 6468   H HG12 . VAL B 1 179 ? 9.893   39.802  9.021   1.00 43.24 ? 179 VAL B HG12 1  
ATOM 6469   H HG13 . VAL B 1 179 ? 9.061   39.738  7.467   1.00 23.32 ? 179 VAL B HG13 1  
ATOM 6470   H HG21 . VAL B 1 179 ? 10.359  40.288  5.360   1.00 75.31 ? 179 VAL B HG21 1  
ATOM 6471   H HG22 . VAL B 1 179 ? 12.105  40.515  5.446   1.00 30.31 ? 179 VAL B HG22 1  
ATOM 6472   H HG23 . VAL B 1 179 ? 11.024  41.742  6.108   1.00 12.03 ? 179 VAL B HG23 1  
ATOM 6473   N N    . THR B 1 180 ? 11.690  42.757  8.569   1.00 4.02  ? 180 THR B N    1  
ATOM 6474   C CA   . THR B 1 180 ? 11.289  43.898  9.434   1.00 22.14 ? 180 THR B CA   1  
ATOM 6475   C C    . THR B 1 180 ? 9.850   43.665  9.941   1.00 21.21 ? 180 THR B C    1  
ATOM 6476   O O    . THR B 1 180 ? 8.967   43.388  9.155   1.00 54.51 ? 180 THR B O    1  
ATOM 6477   C CB   . THR B 1 180 ? 11.332  45.185  8.607   1.00 3.34  ? 180 THR B CB   1  
ATOM 6478   O OG1  . THR B 1 180 ? 10.503  45.037  7.463   1.00 4.14  ? 180 THR B OG1  1  
ATOM 6479   C CG2  . THR B 1 180 ? 12.770  45.462  8.167   1.00 62.15 ? 180 THR B CG2  1  
ATOM 6480   H H    . THR B 1 180 ? 11.723  42.866  7.595   1.00 53.32 ? 180 THR B H    1  
ATOM 6481   H HA   . THR B 1 180 ? 11.979  43.978  10.255  1.00 15.04 ? 180 THR B HA   1  
ATOM 6482   H HB   . THR B 1 180 ? 10.977  46.010  9.205   1.00 3.15  ? 180 THR B HB   1  
ATOM 6483   H HG1  . THR B 1 180 ? 10.836  45.622  6.779   1.00 15.42 ? 180 THR B HG1  1  
ATOM 6484   H HG21 . THR B 1 180 ? 13.144  44.618  7.605   1.00 54.54 ? 180 THR B HG21 1  
ATOM 6485   H HG22 . THR B 1 180 ? 13.390  45.616  9.038   1.00 4.34  ? 180 THR B HG22 1  
ATOM 6486   H HG23 . THR B 1 180 ? 12.793  46.345  7.547   1.00 34.23 ? 180 THR B HG23 1  
ATOM 6487   N N    . PRO B 1 181 ? 9.592   43.773  11.231  1.00 13.25 ? 181 PRO B N    1  
ATOM 6488   C CA   . PRO B 1 181 ? 8.218   43.566  11.779  1.00 21.41 ? 181 PRO B CA   1  
ATOM 6489   C C    . PRO B 1 181 ? 7.134   44.223  10.910  1.00 62.55 ? 181 PRO B C    1  
ATOM 6490   O O    . PRO B 1 181 ? 7.401   45.135  10.153  1.00 24.22 ? 181 PRO B O    1  
ATOM 6491   C CB   . PRO B 1 181 ? 8.282   44.235  13.156  1.00 51.41 ? 181 PRO B CB   1  
ATOM 6492   C CG   . PRO B 1 181 ? 9.706   44.085  13.590  1.00 1.43  ? 181 PRO B CG   1  
ATOM 6493   C CD   . PRO B 1 181 ? 10.556  44.095  12.308  1.00 65.22 ? 181 PRO B CD   1  
ATOM 6494   H HA   . PRO B 1 181 ? 8.017   42.514  11.897  1.00 74.34 ? 181 PRO B HA   1  
ATOM 6495   H HB2  . PRO B 1 181 ? 8.018   45.285  13.078  1.00 41.15 ? 181 PRO B HB2  1  
ATOM 6496   H HB3  . PRO B 1 181 ? 7.625   43.734  13.852  1.00 10.04 ? 181 PRO B HB3  1  
ATOM 6497   H HG2  . PRO B 1 181 ? 9.987   44.909  14.236  1.00 0.10  ? 181 PRO B HG2  1  
ATOM 6498   H HG3  . PRO B 1 181 ? 9.841   43.147  14.109  1.00 63.40 ? 181 PRO B HG3  1  
ATOM 6499   H HD2  . PRO B 1 181 ? 10.993  45.073  12.149  1.00 25.25 ? 181 PRO B HD2  1  
ATOM 6500   H HD3  . PRO B 1 181 ? 11.326  43.338  12.359  1.00 23.41 ? 181 PRO B HD3  1  
ATOM 6501   N N    . ASN B 1 182 ? 5.913   43.771  11.022  1.00 64.44 ? 182 ASN B N    1  
ATOM 6502   C CA   . ASN B 1 182 ? 4.813   44.375  10.213  1.00 62.44 ? 182 ASN B CA   1  
ATOM 6503   C C    . ASN B 1 182 ? 5.214   44.398  8.736   1.00 61.43 ? 182 ASN B C    1  
ATOM 6504   O O    . ASN B 1 182 ? 5.202   45.430  8.096   1.00 24.22 ? 182 ASN B O    1  
ATOM 6505   C CB   . ASN B 1 182 ? 4.560   45.805  10.699  1.00 63.40 ? 182 ASN B CB   1  
ATOM 6506   C CG   . ASN B 1 182 ? 4.622   45.841  12.226  1.00 52.52 ? 182 ASN B CG   1  
ATOM 6507   O OD1  . ASN B 1 182 ? 3.652   45.537  12.893  1.00 72.31 ? 182 ASN B OD1  1  
ATOM 6508   N ND2  . ASN B 1 182 ? 5.731   46.202  12.813  1.00 52.41 ? 182 ASN B ND2  1  
ATOM 6509   H H    . ASN B 1 182 ? 5.718   43.039  11.644  1.00 13.42 ? 182 ASN B H    1  
ATOM 6510   H HA   . ASN B 1 182 ? 3.913   43.789  10.334  1.00 41.11 ? 182 ASN B HA   1  
ATOM 6511   H HB2  . ASN B 1 182 ? 5.314   46.464  10.293  1.00 11.23 ? 182 ASN B HB2  1  
ATOM 6512   H HB3  . ASN B 1 182 ? 3.583   46.129  10.372  1.00 54.34 ? 182 ASN B HB3  1  
ATOM 6513   H HD21 . ASN B 1 182 ? 6.512   46.448  12.274  1.00 13.32 ? 182 ASN B HD21 1  
ATOM 6514   H HD22 . ASN B 1 182 ? 5.783   46.225  13.791  1.00 55.44 ? 182 ASN B HD22 1  
ATOM 6515   N N    . VAL B 1 183 ? 5.579   43.271  8.193   1.00 54.13 ? 183 VAL B N    1  
ATOM 6516   C CA   . VAL B 1 183 ? 5.992   43.235  6.761   1.00 63.32 ? 183 VAL B CA   1  
ATOM 6517   C C    . VAL B 1 183 ? 4.751   43.243  5.852   1.00 22.23 ? 183 VAL B C    1  
ATOM 6518   O O    . VAL B 1 183 ? 4.796   43.710  4.732   1.00 24.33 ? 183 VAL B O    1  
ATOM 6519   C CB   . VAL B 1 183 ? 6.842   41.972  6.519   1.00 10.35 ? 183 VAL B CB   1  
ATOM 6520   C CG1  . VAL B 1 183 ? 5.942   40.740  6.362   1.00 30.14 ? 183 VAL B CG1  1  
ATOM 6521   C CG2  . VAL B 1 183 ? 7.691   42.149  5.253   1.00 60.15 ? 183 VAL B CG2  1  
ATOM 6522   H H    . VAL B 1 183 ? 5.588   42.450  8.728   1.00 33.15 ? 183 VAL B H    1  
ATOM 6523   H HA   . VAL B 1 183 ? 6.589   44.109  6.547   1.00 34.40 ? 183 VAL B HA   1  
ATOM 6524   H HB   . VAL B 1 183 ? 7.494   41.822  7.367   1.00 35.23 ? 183 VAL B HB   1  
ATOM 6525   H HG11 . VAL B 1 183 ? 5.505   40.736  5.375   1.00 22.31 ? 183 VAL B HG11 1  
ATOM 6526   H HG12 . VAL B 1 183 ? 5.157   40.772  7.102   1.00 65.42 ? 183 VAL B HG12 1  
ATOM 6527   H HG13 . VAL B 1 183 ? 6.532   39.845  6.500   1.00 52.21 ? 183 VAL B HG13 1  
ATOM 6528   H HG21 . VAL B 1 183 ? 7.062   42.477  4.439   1.00 21.42 ? 183 VAL B HG21 1  
ATOM 6529   H HG22 . VAL B 1 183 ? 8.154   41.207  4.994   1.00 24.13 ? 183 VAL B HG22 1  
ATOM 6530   H HG23 . VAL B 1 183 ? 8.458   42.888  5.435   1.00 41.33 ? 183 VAL B HG23 1  
ATOM 6531   N N    . ILE B 1 184 ? 3.647   42.721  6.318   1.00 1.43  ? 184 ILE B N    1  
ATOM 6532   C CA   . ILE B 1 184 ? 2.416   42.692  5.470   1.00 33.05 ? 184 ILE B CA   1  
ATOM 6533   C C    . ILE B 1 184 ? 2.022   44.106  5.016   1.00 14.24 ? 184 ILE B C    1  
ATOM 6534   O O    . ILE B 1 184 ? 1.487   44.286  3.943   1.00 60.24 ? 184 ILE B O    1  
ATOM 6535   C CB   . ILE B 1 184 ? 1.257   42.103  6.275   1.00 63.45 ? 184 ILE B CB   1  
ATOM 6536   C CG1  . ILE B 1 184 ? 1.651   40.730  6.846   1.00 12.54 ? 184 ILE B CG1  1  
ATOM 6537   C CG2  . ILE B 1 184 ? 0.023   41.961  5.375   1.00 75.03 ? 184 ILE B CG2  1  
ATOM 6538   C CD1  . ILE B 1 184 ? 2.138   39.794  5.731   1.00 74.24 ? 184 ILE B CD1  1  
ATOM 6539   H H    . ILE B 1 184 ? 3.627   42.337  7.222   1.00 2.11  ? 184 ILE B H    1  
ATOM 6540   H HA   . ILE B 1 184 ? 2.595   42.079  4.601   1.00 31.01 ? 184 ILE B HA   1  
ATOM 6541   H HB   . ILE B 1 184 ? 1.021   42.773  7.091   1.00 54.04 ? 184 ILE B HB   1  
ATOM 6542   H HG12 . ILE B 1 184 ? 2.443   40.862  7.569   1.00 35.34 ? 184 ILE B HG12 1  
ATOM 6543   H HG13 . ILE B 1 184 ? 0.795   40.290  7.332   1.00 65.24 ? 184 ILE B HG13 1  
ATOM 6544   H HG21 . ILE B 1 184 ? -0.678  41.279  5.827   1.00 50.52 ? 184 ILE B HG21 1  
ATOM 6545   H HG22 . ILE B 1 184 ? 0.320   41.579  4.408   1.00 44.34 ? 184 ILE B HG22 1  
ATOM 6546   H HG23 . ILE B 1 184 ? -0.444  42.927  5.251   1.00 13.45 ? 184 ILE B HG23 1  
ATOM 6547   H HD11 . ILE B 1 184 ? 1.581   39.979  4.825   1.00 32.10 ? 184 ILE B HD11 1  
ATOM 6548   H HD12 . ILE B 1 184 ? 1.988   38.771  6.039   1.00 21.14 ? 184 ILE B HD12 1  
ATOM 6549   H HD13 . ILE B 1 184 ? 3.188   39.964  5.549   1.00 21.11 ? 184 ILE B HD13 1  
ATOM 6550   N N    . GLU B 1 185 ? 2.248   45.104  5.830   1.00 23.03 ? 185 GLU B N    1  
ATOM 6551   C CA   . GLU B 1 185 ? 1.844   46.494  5.442   1.00 62.31 ? 185 GLU B CA   1  
ATOM 6552   C C    . GLU B 1 185 ? 2.573   46.951  4.169   1.00 10.33 ? 185 GLU B C    1  
ATOM 6553   O O    . GLU B 1 185 ? 1.958   47.228  3.156   1.00 32.44 ? 185 GLU B O    1  
ATOM 6554   C CB   . GLU B 1 185 ? 2.177   47.455  6.589   1.00 14.33 ? 185 GLU B CB   1  
ATOM 6555   C CG   . GLU B 1 185 ? 1.182   47.255  7.741   1.00 31.30 ? 185 GLU B CG   1  
ATOM 6556   C CD   . GLU B 1 185 ? 1.761   47.844  9.031   1.00 14.14 ? 185 GLU B CD   1  
ATOM 6557   O OE1  . GLU B 1 185 ? 2.412   48.874  8.951   1.00 34.32 ? 185 GLU B OE1  1  
ATOM 6558   O OE2  . GLU B 1 185 ? 1.545   47.254  10.076  1.00 64.11 ? 185 GLU B OE2  1  
ATOM 6559   H H    . GLU B 1 185 ? 2.660   44.940  6.704   1.00 73.52 ? 185 GLU B H    1  
ATOM 6560   H HA   . GLU B 1 185 ? 0.778   46.513  5.266   1.00 44.14 ? 185 GLU B HA   1  
ATOM 6561   H HB2  . GLU B 1 185 ? 3.181   47.260  6.938   1.00 72.50 ? 185 GLU B HB2  1  
ATOM 6562   H HB3  . GLU B 1 185 ? 2.111   48.473  6.234   1.00 1.12  ? 185 GLU B HB3  1  
ATOM 6563   H HG2  . GLU B 1 185 ? 0.254   47.755  7.504   1.00 21.22 ? 185 GLU B HG2  1  
ATOM 6564   H HG3  . GLU B 1 185 ? 0.997   46.200  7.881   1.00 1.12  ? 185 GLU B HG3  1  
ATOM 6565   N N    . VAL B 1 186 ? 3.871   47.059  4.212   1.00 20.52 ? 186 VAL B N    1  
ATOM 6566   C CA   . VAL B 1 186 ? 4.615   47.527  3.004   1.00 22.11 ? 186 VAL B CA   1  
ATOM 6567   C C    . VAL B 1 186 ? 4.590   46.456  1.908   1.00 13.12 ? 186 VAL B C    1  
ATOM 6568   O O    . VAL B 1 186 ? 4.596   46.761  0.731   1.00 64.03 ? 186 VAL B O    1  
ATOM 6569   C CB   . VAL B 1 186 ? 6.071   47.845  3.379   1.00 73.00 ? 186 VAL B CB   1  
ATOM 6570   C CG1  . VAL B 1 186 ? 6.096   49.033  4.349   1.00 45.42 ? 186 VAL B CG1  1  
ATOM 6571   C CG2  . VAL B 1 186 ? 6.733   46.619  4.038   1.00 62.10 ? 186 VAL B CG2  1  
ATOM 6572   H H    . VAL B 1 186 ? 4.355   46.854  5.039   1.00 51.32 ? 186 VAL B H    1  
ATOM 6573   H HA   . VAL B 1 186 ? 4.146   48.423  2.628   1.00 15.22 ? 186 VAL B HA   1  
ATOM 6574   H HB   . VAL B 1 186 ? 6.616   48.109  2.484   1.00 41.04 ? 186 VAL B HB   1  
ATOM 6575   H HG11 . VAL B 1 186 ? 5.719   48.722  5.312   1.00 70.34 ? 186 VAL B HG11 1  
ATOM 6576   H HG12 . VAL B 1 186 ? 5.478   49.828  3.958   1.00 22.41 ? 186 VAL B HG12 1  
ATOM 6577   H HG13 . VAL B 1 186 ? 7.111   49.388  4.457   1.00 22.13 ? 186 VAL B HG13 1  
ATOM 6578   H HG21 . VAL B 1 186 ? 6.012   46.094  4.647   1.00 12.13 ? 186 VAL B HG21 1  
ATOM 6579   H HG22 . VAL B 1 186 ? 7.559   46.942  4.660   1.00 74.35 ? 186 VAL B HG22 1  
ATOM 6580   H HG23 . VAL B 1 186 ? 7.105   45.955  3.269   1.00 33.23 ? 186 VAL B HG23 1  
ATOM 6581   N N    . ALA B 1 187 ? 4.584   45.208  2.276   1.00 44.40 ? 187 ALA B N    1  
ATOM 6582   C CA   . ALA B 1 187 ? 4.588   44.133  1.241   1.00 61.12 ? 187 ALA B CA   1  
ATOM 6583   C C    . ALA B 1 187 ? 3.279   44.110  0.441   1.00 5.15  ? 187 ALA B C    1  
ATOM 6584   O O    . ALA B 1 187 ? 3.286   43.851  -0.738  1.00 45.11 ? 187 ALA B O    1  
ATOM 6585   C CB   . ALA B 1 187 ? 4.784   42.771  1.912   1.00 53.24 ? 187 ALA B CB   1  
ATOM 6586   H H    . ALA B 1 187 ? 4.595   44.976  3.229   1.00 45.43 ? 187 ALA B H    1  
ATOM 6587   H HA   . ALA B 1 187 ? 5.408   44.310  0.561   1.00 15.10 ? 187 ALA B HA   1  
ATOM 6588   H HB1  . ALA B 1 187 ? 4.883   42.009  1.153   1.00 15.01 ? 187 ALA B HB1  1  
ATOM 6589   H HB2  . ALA B 1 187 ? 3.930   42.549  2.534   1.00 41.50 ? 187 ALA B HB2  1  
ATOM 6590   H HB3  . ALA B 1 187 ? 5.676   42.791  2.518   1.00 12.41 ? 187 ALA B HB3  1  
ATOM 6591   N N    . ILE B 1 188 ? 2.149   44.342  1.051   1.00 22.43 ? 188 ILE B N    1  
ATOM 6592   C CA   . ILE B 1 188 ? 0.877   44.277  0.265   1.00 45.21 ? 188 ILE B CA   1  
ATOM 6593   C C    . ILE B 1 188 ? 0.657   45.560  -0.540  1.00 61.40 ? 188 ILE B C    1  
ATOM 6594   O O    . ILE B 1 188 ? 0.304   45.517  -1.701  1.00 4.34  ? 188 ILE B O    1  
ATOM 6595   C CB   . ILE B 1 188 ? -0.304  44.058  1.216   1.00 71.24 ? 188 ILE B CB   1  
ATOM 6596   C CG1  . ILE B 1 188 ? -1.576  43.757  0.407   1.00 12.31 ? 188 ILE B CG1  1  
ATOM 6597   C CG2  . ILE B 1 188 ? -0.526  45.315  2.056   1.00 72.43 ? 188 ILE B CG2  1  
ATOM 6598   C CD1  . ILE B 1 188 ? -1.457  42.397  -0.303  1.00 41.43 ? 188 ILE B CD1  1  
ATOM 6599   H H    . ILE B 1 188 ? 2.129   44.533  2.011   1.00 61.53 ? 188 ILE B H    1  
ATOM 6600   H HA   . ILE B 1 188 ? 0.934   43.445  -0.421  1.00 32.33 ? 188 ILE B HA   1  
ATOM 6601   H HB   . ILE B 1 188 ? -0.085  43.229  1.871   1.00 45.33 ? 188 ILE B HB   1  
ATOM 6602   H HG12 . ILE B 1 188 ? -2.427  43.740  1.074   1.00 43.51 ? 188 ILE B HG12 1  
ATOM 6603   H HG13 . ILE B 1 188 ? -1.721  44.531  -0.332  1.00 30.44 ? 188 ILE B HG13 1  
ATOM 6604   H HG21 . ILE B 1 188 ? -1.007  46.072  1.454   1.00 33.45 ? 188 ILE B HG21 1  
ATOM 6605   H HG22 . ILE B 1 188 ? 0.424   45.683  2.405   1.00 64.42 ? 188 ILE B HG22 1  
ATOM 6606   H HG23 . ILE B 1 188 ? -1.151  45.076  2.901   1.00 0.03  ? 188 ILE B HG23 1  
ATOM 6607   H HD11 . ILE B 1 188 ? -0.818  41.734  0.264   1.00 32.12 ? 188 ILE B HD11 1  
ATOM 6608   H HD12 . ILE B 1 188 ? -1.041  42.544  -1.289  1.00 1.55  ? 188 ILE B HD12 1  
ATOM 6609   H HD13 . ILE B 1 188 ? -2.439  41.955  -0.395  1.00 70.14 ? 188 ILE B HD13 1  
ATOM 6610   N N    . ASN B 1 189 ? 0.839   46.701  0.058   1.00 23.20 ? 189 ASN B N    1  
ATOM 6611   C CA   . ASN B 1 189 ? 0.608   47.965  -0.696  1.00 13.05 ? 189 ASN B CA   1  
ATOM 6612   C C    . ASN B 1 189 ? 1.534   48.017  -1.921  1.00 65.14 ? 189 ASN B C    1  
ATOM 6613   O O    . ASN B 1 189 ? 1.183   48.552  -2.956  1.00 43.31 ? 189 ASN B O    1  
ATOM 6614   C CB   . ASN B 1 189 ? 0.892   49.162  0.228   1.00 53.01 ? 189 ASN B CB   1  
ATOM 6615   C CG   . ASN B 1 189 ? -0.369  49.534  1.019   1.00 52.22 ? 189 ASN B CG   1  
ATOM 6616   O OD1  . ASN B 1 189 ? -1.471  49.425  0.519   1.00 12.02 ? 189 ASN B OD1  1  
ATOM 6617   N ND2  . ASN B 1 189 ? -0.251  49.982  2.239   1.00 22.40 ? 189 ASN B ND2  1  
ATOM 6618   H H    . ASN B 1 189 ? 1.111   46.730  1.002   1.00 65.02 ? 189 ASN B H    1  
ATOM 6619   H HA   . ASN B 1 189 ? -0.420  47.998  -1.029  1.00 75.42 ? 189 ASN B HA   1  
ATOM 6620   H HB2  . ASN B 1 189 ? 1.679   48.898  0.918   1.00 44.40 ? 189 ASN B HB2  1  
ATOM 6621   H HB3  . ASN B 1 189 ? 1.204   50.012  -0.361  1.00 71.24 ? 189 ASN B HB3  1  
ATOM 6622   H HD21 . ASN B 1 189 ? 0.637   50.078  2.644   1.00 41.12 ? 189 ASN B HD21 1  
ATOM 6623   H HD22 . ASN B 1 189 ? -1.050  50.228  2.750   1.00 32.51 ? 189 ASN B HD22 1  
ATOM 6624   N N    . GLN B 1 190 ? 2.715   47.482  -1.809  1.00 21.41 ? 190 GLN B N    1  
ATOM 6625   C CA   . GLN B 1 190 ? 3.660   47.519  -2.963  1.00 3.03  ? 190 GLN B CA   1  
ATOM 6626   C C    . GLN B 1 190 ? 3.317   46.405  -3.957  1.00 63.24 ? 190 GLN B C    1  
ATOM 6627   O O    . GLN B 1 190 ? 3.161   46.643  -5.139  1.00 44.13 ? 190 GLN B O    1  
ATOM 6628   C CB   . GLN B 1 190 ? 5.086   47.336  -2.444  1.00 23.11 ? 190 GLN B CB   1  
ATOM 6629   C CG   . GLN B 1 190 ? 5.441   48.510  -1.531  1.00 55.25 ? 190 GLN B CG   1  
ATOM 6630   C CD   . GLN B 1 190 ? 6.840   48.308  -0.942  1.00 33.34 ? 190 GLN B CD   1  
ATOM 6631   O OE1  . GLN B 1 190 ? 7.069   48.582  0.222   1.00 14.24 ? 190 GLN B OE1  1  
ATOM 6632   N NE2  . GLN B 1 190 ? 7.795   47.847  -1.703  1.00 12.13 ? 190 GLN B NE2  1  
ATOM 6633   H H    . GLN B 1 190 ? 2.988   47.062  -0.964  1.00 63.41 ? 190 GLN B H    1  
ATOM 6634   H HA   . GLN B 1 190 ? 3.580   48.476  -3.459  1.00 74.14 ? 190 GLN B HA   1  
ATOM 6635   H HB2  . GLN B 1 190 ? 5.151   46.411  -1.888  1.00 11.34 ? 190 GLN B HB2  1  
ATOM 6636   H HB3  . GLN B 1 190 ? 5.771   47.308  -3.276  1.00 4.30  ? 190 GLN B HB3  1  
ATOM 6637   H HG2  . GLN B 1 190 ? 5.417   49.425  -2.103  1.00 14.32 ? 190 GLN B HG2  1  
ATOM 6638   H HG3  . GLN B 1 190 ? 4.718   48.571  -0.732  1.00 61.02 ? 190 GLN B HG3  1  
ATOM 6639   H HE21 . GLN B 1 190 ? 7.612   47.632  -2.642  1.00 62.02 ? 190 GLN B HE21 1  
ATOM 6640   H HE22 . GLN B 1 190 ? 8.693   47.713  -1.335  1.00 55.13 ? 190 GLN B HE22 1  
ATOM 6641   N N    . ILE B 1 191 ? 3.202   45.191  -3.489  1.00 33.22 ? 191 ILE B N    1  
ATOM 6642   C CA   . ILE B 1 191 ? 2.871   44.060  -4.407  1.00 4.13  ? 191 ILE B CA   1  
ATOM 6643   C C    . ILE B 1 191 ? 1.661   44.434  -5.262  1.00 71.14 ? 191 ILE B C    1  
ATOM 6644   O O    . ILE B 1 191 ? 1.574   44.078  -6.420  1.00 20.41 ? 191 ILE B O    1  
ATOM 6645   C CB   . ILE B 1 191 ? 2.547   42.813  -3.573  1.00 55.44 ? 191 ILE B CB   1  
ATOM 6646   C CG1  . ILE B 1 191 ? 3.835   42.280  -2.931  1.00 74.03 ? 191 ILE B CG1  1  
ATOM 6647   C CG2  . ILE B 1 191 ? 1.934   41.719  -4.459  1.00 23.20 ? 191 ILE B CG2  1  
ATOM 6648   C CD1  . ILE B 1 191 ? 3.487   41.295  -1.806  1.00 42.23 ? 191 ILE B CD1  1  
ATOM 6649   H H    . ILE B 1 191 ? 3.334   45.021  -2.534  1.00 2.22  ? 191 ILE B H    1  
ATOM 6650   H HA   . ILE B 1 191 ? 3.718   43.857  -5.046  1.00 20.10 ? 191 ILE B HA   1  
ATOM 6651   H HB   . ILE B 1 191 ? 1.840   43.084  -2.804  1.00 73.24 ? 191 ILE B HB   1  
ATOM 6652   H HG12 . ILE B 1 191 ? 4.419   41.769  -3.683  1.00 22.44 ? 191 ILE B HG12 1  
ATOM 6653   H HG13 . ILE B 1 191 ? 4.412   43.097  -2.536  1.00 22.15 ? 191 ILE B HG13 1  
ATOM 6654   H HG21 . ILE B 1 191 ? 2.455   41.684  -5.404  1.00 32.34 ? 191 ILE B HG21 1  
ATOM 6655   H HG22 . ILE B 1 191 ? 0.892   41.939  -4.630  1.00 51.34 ? 191 ILE B HG22 1  
ATOM 6656   H HG23 . ILE B 1 191 ? 2.022   40.761  -3.966  1.00 43.53 ? 191 ILE B HG23 1  
ATOM 6657   H HD11 . ILE B 1 191 ? 2.639   41.656  -1.243  1.00 44.13 ? 191 ILE B HD11 1  
ATOM 6658   H HD12 . ILE B 1 191 ? 4.333   41.192  -1.148  1.00 62.13 ? 191 ILE B HD12 1  
ATOM 6659   H HD13 . ILE B 1 191 ? 3.249   40.336  -2.236  1.00 64.53 ? 191 ILE B HD13 1  
ATOM 6660   N N    . ARG B 1 192 ? 0.729   45.149  -4.701  1.00 31.22 ? 192 ARG B N    1  
ATOM 6661   C CA   . ARG B 1 192 ? -0.475  45.551  -5.477  1.00 24.22 ? 192 ARG B CA   1  
ATOM 6662   C C    . ARG B 1 192 ? -0.077  46.628  -6.474  1.00 72.24 ? 192 ARG B C    1  
ATOM 6663   O O    . ARG B 1 192 ? -0.429  46.579  -7.636  1.00 23.00 ? 192 ARG B O    1  
ATOM 6664   C CB   . ARG B 1 192 ? -1.530  46.096  -4.516  1.00 62.10 ? 192 ARG B CB   1  
ATOM 6665   C CG   . ARG B 1 192 ? -2.077  44.940  -3.679  1.00 64.31 ? 192 ARG B CG   1  
ATOM 6666   C CD   . ARG B 1 192 ? -3.157  45.463  -2.730  1.00 32.13 ? 192 ARG B CD   1  
ATOM 6667   N NE   . ARG B 1 192 ? -3.777  44.327  -1.990  1.00 4.12  ? 192 ARG B NE   1  
ATOM 6668   C CZ   . ARG B 1 192 ? -4.538  43.465  -2.613  1.00 52.22 ? 192 ARG B CZ   1  
ATOM 6669   N NH1  . ARG B 1 192 ? -4.740  43.578  -3.899  1.00 41.12 ? 192 ARG B NH1  1  
ATOM 6670   N NH2  . ARG B 1 192 ? -5.095  42.489  -1.951  1.00 71.40 ? 192 ARG B NH2  1  
ATOM 6671   H H    . ARG B 1 192 ? 0.824   45.431  -3.767  1.00 42.22 ? 192 ARG B H    1  
ATOM 6672   H HA   . ARG B 1 192 ? -0.871  44.696  -6.006  1.00 51.03 ? 192 ARG B HA   1  
ATOM 6673   H HB2  . ARG B 1 192 ? -1.080  46.837  -3.868  1.00 53.13 ? 192 ARG B HB2  1  
ATOM 6674   H HB3  . ARG B 1 192 ? -2.333  46.546  -5.079  1.00 10.24 ? 192 ARG B HB3  1  
ATOM 6675   H HG2  . ARG B 1 192 ? -2.495  44.197  -4.338  1.00 43.01 ? 192 ARG B HG2  1  
ATOM 6676   H HG3  . ARG B 1 192 ? -1.275  44.500  -3.105  1.00 35.15 ? 192 ARG B HG3  1  
ATOM 6677   H HD2  . ARG B 1 192 ? -2.706  46.143  -2.021  1.00 65.12 ? 192 ARG B HD2  1  
ATOM 6678   H HD3  . ARG B 1 192 ? -3.913  45.983  -3.298  1.00 44.13 ? 192 ARG B HD3  1  
ATOM 6679   H HE   . ARG B 1 192 ? -3.618  44.231  -1.028  1.00 51.34 ? 192 ARG B HE   1  
ATOM 6680   H HH11 . ARG B 1 192 ? -4.315  44.327  -4.409  1.00 24.34 ? 192 ARG B HH11 1  
ATOM 6681   H HH12 . ARG B 1 192 ? -5.313  42.912  -4.375  1.00 72.33 ? 192 ARG B HH12 1  
ATOM 6682   H HH21 . ARG B 1 192 ? -4.941  42.399  -0.967  1.00 30.13 ? 192 ARG B HH21 1  
ATOM 6683   H HH22 . ARG B 1 192 ? -5.686  41.835  -2.426  1.00 54.24 ? 192 ARG B HH22 1  
ATOM 6684   N N    . GLN B 1 193 ? 0.671   47.594  -6.035  1.00 24.11 ? 193 GLN B N    1  
ATOM 6685   C CA   . GLN B 1 193 ? 1.109   48.665  -6.959  1.00 72.23 ? 193 GLN B CA   1  
ATOM 6686   C C    . GLN B 1 193 ? 2.059   48.064  -8.004  1.00 63.21 ? 193 GLN B C    1  
ATOM 6687   O O    . GLN B 1 193 ? 2.388   48.690  -8.993  1.00 73.10 ? 193 GLN B O    1  
ATOM 6688   C CB   . GLN B 1 193 ? 1.819   49.757  -6.156  1.00 41.00 ? 193 GLN B CB   1  
ATOM 6689   C CG   . GLN B 1 193 ? 2.442   50.779  -7.110  1.00 51.45 ? 193 GLN B CG   1  
ATOM 6690   C CD   . GLN B 1 193 ? 2.721   52.087  -6.363  1.00 55.04 ? 193 GLN B CD   1  
ATOM 6691   O OE1  . GLN B 1 193 ? 1.958   53.029  -6.460  1.00 31.44 ? 193 GLN B OE1  1  
ATOM 6692   N NE2  . GLN B 1 193 ? 3.787   52.187  -5.619  1.00 72.33 ? 193 GLN B NE2  1  
ATOM 6693   H H    . GLN B 1 193 ? 0.954   47.611  -5.095  1.00 53.10 ? 193 GLN B H    1  
ATOM 6694   H HA   . GLN B 1 193 ? 0.247   49.086  -7.456  1.00 33.21 ? 193 GLN B HA   1  
ATOM 6695   H HB2  . GLN B 1 193 ? 1.101   50.250  -5.514  1.00 3.34  ? 193 GLN B HB2  1  
ATOM 6696   H HB3  . GLN B 1 193 ? 2.595   49.312  -5.552  1.00 32.25 ? 193 GLN B HB3  1  
ATOM 6697   H HG2  . GLN B 1 193 ? 3.367   50.382  -7.497  1.00 22.21 ? 193 GLN B HG2  1  
ATOM 6698   H HG3  . GLN B 1 193 ? 1.762   50.973  -7.926  1.00 14.32 ? 193 GLN B HG3  1  
ATOM 6699   H HE21 . GLN B 1 193 ? 4.402   51.429  -5.540  1.00 43.22 ? 193 GLN B HE21 1  
ATOM 6700   H HE22 . GLN B 1 193 ? 3.973   53.022  -5.140  1.00 3.32  ? 193 GLN B HE22 1  
ATOM 6701   N N    . LYS B 1 194 ? 2.507   46.850  -7.780  1.00 72.11 ? 194 LYS B N    1  
ATOM 6702   C CA   . LYS B 1 194 ? 3.449   46.181  -8.738  1.00 13.10 ? 194 LYS B CA   1  
ATOM 6703   C C    . LYS B 1 194 ? 2.734   45.050  -9.501  1.00 64.03 ? 194 LYS B C    1  
ATOM 6704   O O    . LYS B 1 194 ? 3.246   44.529  -10.472 1.00 61.43 ? 194 LYS B O    1  
ATOM 6705   C CB   . LYS B 1 194 ? 4.616   45.577  -7.945  1.00 23.12 ? 194 LYS B CB   1  
ATOM 6706   C CG   . LYS B 1 194 ? 5.438   46.696  -7.271  1.00 10.44 ? 194 LYS B CG   1  
ATOM 6707   C CD   . LYS B 1 194 ? 6.144   46.161  -6.012  1.00 13.03 ? 194 LYS B CD   1  
ATOM 6708   C CE   . LYS B 1 194 ? 7.208   45.128  -6.396  1.00 4.35  ? 194 LYS B CE   1  
ATOM 6709   N NZ   . LYS B 1 194 ? 7.742   44.490  -5.160  1.00 23.33 ? 194 LYS B NZ   1  
ATOM 6710   H H    . LYS B 1 194 ? 2.230   46.377  -6.969  1.00 63.22 ? 194 LYS B H    1  
ATOM 6711   H HA   . LYS B 1 194 ? 3.836   46.903  -9.444  1.00 21.32 ? 194 LYS B HA   1  
ATOM 6712   H HB2  . LYS B 1 194 ? 4.224   44.904  -7.193  1.00 74.43 ? 194 LYS B HB2  1  
ATOM 6713   H HB3  . LYS B 1 194 ? 5.248   45.024  -8.623  1.00 10.35 ? 194 LYS B HB3  1  
ATOM 6714   H HG2  . LYS B 1 194 ? 6.180   47.063  -7.966  1.00 11.53 ? 194 LYS B HG2  1  
ATOM 6715   H HG3  . LYS B 1 194 ? 4.784   47.509  -6.989  1.00 43.25 ? 194 LYS B HG3  1  
ATOM 6716   H HD2  . LYS B 1 194 ? 6.617   46.983  -5.494  1.00 71.30 ? 194 LYS B HD2  1  
ATOM 6717   H HD3  . LYS B 1 194 ? 5.418   45.700  -5.359  1.00 54.52 ? 194 LYS B HD3  1  
ATOM 6718   H HE2  . LYS B 1 194 ? 6.770   44.371  -7.027  1.00 4.12  ? 194 LYS B HE2  1  
ATOM 6719   H HE3  . LYS B 1 194 ? 8.013   45.618  -6.924  1.00 11.31 ? 194 LYS B HE3  1  
ATOM 6720   H HZ1  . LYS B 1 194 ? 7.145   44.749  -4.350  1.00 34.42 ? 194 LYS B HZ1  1  
ATOM 6721   H HZ2  . LYS B 1 194 ? 8.716   44.817  -4.994  1.00 64.52 ? 194 LYS B HZ2  1  
ATOM 6722   H HZ3  . LYS B 1 194 ? 7.738   43.455  -5.276  1.00 32.20 ? 194 LYS B HZ3  1  
ATOM 6723   N N    . MET B 1 195 ? 1.569   44.647  -9.058  1.00 44.33 ? 195 MET B N    1  
ATOM 6724   C CA   . MET B 1 195 ? 0.835   43.533  -9.742  1.00 4.14  ? 195 MET B CA   1  
ATOM 6725   C C    . MET B 1 195 ? -0.190  44.097  -10.727 1.00 1.10  ? 195 MET B C    1  
ATOM 6726   O O    . MET B 1 195 ? -0.198  43.753  -11.893 1.00 12.05 ? 195 MET B O    1  
ATOM 6727   C CB   . MET B 1 195 ? 0.113   42.703  -8.677  1.00 32.13 ? 195 MET B CB   1  
ATOM 6728   C CG   . MET B 1 195 ? -0.457  41.421  -9.291  1.00 40.31 ? 195 MET B CG   1  
ATOM 6729   S SD   . MET B 1 195 ? -1.740  40.757  -8.198  1.00 34.05 ? 195 MET B SD   1  
ATOM 6730   C CE   . MET B 1 195 ? -0.643  40.052  -6.941  1.00 20.22 ? 195 MET B CE   1  
ATOM 6731   H H    . MET B 1 195 ? 1.179   45.068  -8.264  1.00 30.34 ? 195 MET B H    1  
ATOM 6732   H HA   . MET B 1 195 ? 1.536   42.901  -10.271 1.00 55.30 ? 195 MET B HA   1  
ATOM 6733   H HB2  . MET B 1 195 ? 0.813   42.444  -7.901  1.00 71.23 ? 195 MET B HB2  1  
ATOM 6734   H HB3  . MET B 1 195 ? -0.693  43.286  -8.252  1.00 22.32 ? 195 MET B HB3  1  
ATOM 6735   H HG2  . MET B 1 195 ? -0.886  41.638  -10.259 1.00 24.43 ? 195 MET B HG2  1  
ATOM 6736   H HG3  . MET B 1 195 ? 0.333   40.693  -9.401  1.00 30.13 ? 195 MET B HG3  1  
ATOM 6737   H HE1  . MET B 1 195 ? -1.237  39.589  -6.168  1.00 4.23  ? 195 MET B HE1  1  
ATOM 6738   H HE2  . MET B 1 195 ? -0.040  40.829  -6.505  1.00 74.33 ? 195 MET B HE2  1  
ATOM 6739   H HE3  . MET B 1 195 ? 0.000   39.314  -7.400  1.00 65.32 ? 195 MET B HE3  1  
ATOM 6740   N N    . ASP B 1 196 ? -1.062  44.950  -10.268 1.00 51.11 ? 196 ASP B N    1  
ATOM 6741   C CA   . ASP B 1 196 ? -2.096  45.524  -11.174 1.00 2.23  ? 196 ASP B CA   1  
ATOM 6742   C C    . ASP B 1 196 ? -1.418  46.191  -12.374 1.00 34.31 ? 196 ASP B C    1  
ATOM 6743   O O    . ASP B 1 196 ? -1.987  46.287  -13.443 1.00 64.15 ? 196 ASP B O    1  
ATOM 6744   C CB   . ASP B 1 196 ? -2.929  46.561  -10.410 1.00 71.21 ? 196 ASP B CB   1  
ATOM 6745   C CG   . ASP B 1 196 ? -4.234  46.832  -11.166 1.00 31.44 ? 196 ASP B CG   1  
ATOM 6746   O OD1  . ASP B 1 196 ? -4.770  45.898  -11.741 1.00 24.35 ? 196 ASP B OD1  1  
ATOM 6747   O OD2  . ASP B 1 196 ? -4.675  47.969  -11.157 1.00 52.23 ? 196 ASP B OD2  1  
ATOM 6748   H H    . ASP B 1 196 ? -1.041  45.209  -9.323  1.00 24.00 ? 196 ASP B H    1  
ATOM 6749   H HA   . ASP B 1 196 ? -2.742  44.731  -11.523 1.00 4.43  ? 196 ASP B HA   1  
ATOM 6750   H HB2  . ASP B 1 196 ? -3.156  46.185  -9.422  1.00 44.21 ? 196 ASP B HB2  1  
ATOM 6751   H HB3  . ASP B 1 196 ? -2.370  47.481  -10.323 1.00 53.11 ? 196 ASP B HB3  1  
ATOM 6752   N N    . LYS B 1 197 ? -0.211  46.659  -12.207 1.00 31.30 ? 197 LYS B N    1  
ATOM 6753   C CA   . LYS B 1 197 ? 0.486   47.326  -13.343 1.00 75.21 ? 197 LYS B CA   1  
ATOM 6754   C C    . LYS B 1 197 ? 0.773   46.303  -14.460 1.00 32.34 ? 197 LYS B C    1  
ATOM 6755   O O    . LYS B 1 197 ? 0.232   46.411  -15.543 1.00 2.34  ? 197 LYS B O    1  
ATOM 6756   C CB   . LYS B 1 197 ? 1.796   47.982  -12.837 1.00 35.11 ? 197 LYS B CB   1  
ATOM 6757   C CG   . LYS B 1 197 ? 1.566   49.473  -12.554 1.00 34.53 ? 197 LYS B CG   1  
ATOM 6758   C CD   . LYS B 1 197 ? 2.870   50.110  -12.060 1.00 55.43 ? 197 LYS B CD   1  
ATOM 6759   C CE   . LYS B 1 197 ? 2.654   51.605  -11.803 1.00 54.41 ? 197 LYS B CE   1  
ATOM 6760   N NZ   . LYS B 1 197 ? 3.969   52.308  -11.808 1.00 33.20 ? 197 LYS B NZ   1  
ATOM 6761   H H    . LYS B 1 197 ? 0.232   46.578  -11.337 1.00 42.32 ? 197 LYS B H    1  
ATOM 6762   H HA   . LYS B 1 197 ? -0.167  48.089  -13.744 1.00 73.31 ? 197 LYS B HA   1  
ATOM 6763   H HB2  . LYS B 1 197 ? 2.110   47.499  -11.924 1.00 41.22 ? 197 LYS B HB2  1  
ATOM 6764   H HB3  . LYS B 1 197 ? 2.573   47.880  -13.582 1.00 22.24 ? 197 LYS B HB3  1  
ATOM 6765   H HG2  . LYS B 1 197 ? 1.246   49.964  -13.461 1.00 74.04 ? 197 LYS B HG2  1  
ATOM 6766   H HG3  . LYS B 1 197 ? 0.804   49.583  -11.796 1.00 41.41 ? 197 LYS B HG3  1  
ATOM 6767   H HD2  . LYS B 1 197 ? 3.178   49.628  -11.143 1.00 13.20 ? 197 LYS B HD2  1  
ATOM 6768   H HD3  . LYS B 1 197 ? 3.638   49.983  -12.808 1.00 11.11 ? 197 LYS B HD3  1  
ATOM 6769   H HE2  . LYS B 1 197 ? 2.023   52.021  -12.576 1.00 12.52 ? 197 LYS B HE2  1  
ATOM 6770   H HE3  . LYS B 1 197 ? 2.178   51.740  -10.842 1.00 70.42 ? 197 LYS B HE3  1  
ATOM 6771   H HZ1  . LYS B 1 197 ? 4.512   52.021  -12.647 1.00 15.35 ? 197 LYS B HZ1  1  
ATOM 6772   H HZ2  . LYS B 1 197 ? 4.500   52.057  -10.949 1.00 23.55 ? 197 LYS B HZ2  1  
ATOM 6773   H HZ3  . LYS B 1 197 ? 3.814   53.337  -11.834 1.00 71.05 ? 197 LYS B HZ3  1  
ATOM 6774   N N    . PRO B 1 198 ? 1.616   45.323  -14.218 1.00 20.40 ? 198 PRO B N    1  
ATOM 6775   C CA   . PRO B 1 198 ? 1.957   44.292  -15.250 1.00 11.40 ? 198 PRO B CA   1  
ATOM 6776   C C    . PRO B 1 198 ? 0.723   43.523  -15.753 1.00 24.20 ? 198 PRO B C    1  
ATOM 6777   O O    . PRO B 1 198 ? 0.533   43.357  -16.941 1.00 64.01 ? 198 PRO B O    1  
ATOM 6778   C CB   . PRO B 1 198 ? 2.945   43.348  -14.527 1.00 23.51 ? 198 PRO B CB   1  
ATOM 6779   C CG   . PRO B 1 198 ? 2.742   43.612  -13.066 1.00 21.25 ? 198 PRO B CG   1  
ATOM 6780   C CD   . PRO B 1 198 ? 2.338   45.081  -12.957 1.00 75.32 ? 198 PRO B CD   1  
ATOM 6781   H HA   . PRO B 1 198 ? 2.455   44.761  -16.083 1.00 60.04 ? 198 PRO B HA   1  
ATOM 6782   H HB2  . PRO B 1 198 ? 2.728   42.311  -14.761 1.00 1.00  ? 198 PRO B HB2  1  
ATOM 6783   H HB3  . PRO B 1 198 ? 3.963   43.585  -14.806 1.00 63.42 ? 198 PRO B HB3  1  
ATOM 6784   H HG2  . PRO B 1 198 ? 1.955   42.976  -12.677 1.00 34.50 ? 198 PRO B HG2  1  
ATOM 6785   H HG3  . PRO B 1 198 ? 3.659   43.445  -12.521 1.00 64.12 ? 198 PRO B HG3  1  
ATOM 6786   H HD2  . PRO B 1 198 ? 1.697   45.233  -12.105 1.00 5.01  ? 198 PRO B HD2  1  
ATOM 6787   H HD3  . PRO B 1 198 ? 3.212   45.712  -12.901 1.00 4.11  ? 198 PRO B HD3  1  
ATOM 6788   N N    . LEU B 1 199 ? -0.108  43.043  -14.865 1.00 53.14 ? 199 LEU B N    1  
ATOM 6789   C CA   . LEU B 1 199 ? -1.312  42.279  -15.316 1.00 72.25 ? 199 LEU B CA   1  
ATOM 6790   C C    . LEU B 1 199 ? -2.375  43.244  -15.857 1.00 21.22 ? 199 LEU B C    1  
ATOM 6791   O O    . LEU B 1 199 ? -2.989  42.991  -16.874 1.00 40.22 ? 199 LEU B O    1  
ATOM 6792   C CB   . LEU B 1 199 ? -1.884  41.480  -14.131 1.00 62.43 ? 199 LEU B CB   1  
ATOM 6793   C CG   . LEU B 1 199 ? -1.150  40.141  -14.003 1.00 4.24  ? 199 LEU B CG   1  
ATOM 6794   C CD1  . LEU B 1 199 ? 0.356   40.387  -13.910 1.00 55.10 ? 199 LEU B CD1  1  
ATOM 6795   C CD2  . LEU B 1 199 ? -1.627  39.418  -12.742 1.00 13.12 ? 199 LEU B CD2  1  
ATOM 6796   H H    . LEU B 1 199 ? 0.061   43.177  -13.907 1.00 43.30 ? 199 LEU B H    1  
ATOM 6797   H HA   . LEU B 1 199 ? -1.026  41.599  -16.107 1.00 40.21 ? 199 LEU B HA   1  
ATOM 6798   H HB2  . LEU B 1 199 ? -1.755  42.048  -13.221 1.00 61.52 ? 199 LEU B HB2  1  
ATOM 6799   H HB3  . LEU B 1 199 ? -2.937  41.292  -14.290 1.00 0.34  ? 199 LEU B HB3  1  
ATOM 6800   H HG   . LEU B 1 199 ? -1.361  39.532  -14.870 1.00 4.35  ? 199 LEU B HG   1  
ATOM 6801   H HD11 . LEU B 1 199 ? 0.850   39.480  -13.598 1.00 3.31  ? 199 LEU B HD11 1  
ATOM 6802   H HD12 . LEU B 1 199 ? 0.550   41.169  -13.191 1.00 55.13 ? 199 LEU B HD12 1  
ATOM 6803   H HD13 . LEU B 1 199 ? 0.734   40.686  -14.878 1.00 52.03 ? 199 LEU B HD13 1  
ATOM 6804   H HD21 . LEU B 1 199 ? -1.308  38.387  -12.777 1.00 34.21 ? 199 LEU B HD21 1  
ATOM 6805   H HD22 . LEU B 1 199 ? -2.705  39.460  -12.689 1.00 21.15 ? 199 LEU B HD22 1  
ATOM 6806   H HD23 . LEU B 1 199 ? -1.205  39.897  -11.871 1.00 43.34 ? 199 LEU B HD23 1  
ATOM 6807   N N    . GLY B 1 200 ? -2.606  44.342  -15.190 1.00 41.34 ? 200 GLY B N    1  
ATOM 6808   C CA   . GLY B 1 200 ? -3.637  45.306  -15.679 1.00 34.35 ? 200 GLY B CA   1  
ATOM 6809   C C    . GLY B 1 200 ? -5.024  44.862  -15.206 1.00 64.53 ? 200 GLY B C    1  
ATOM 6810   O O    . GLY B 1 200 ? -5.996  45.578  -15.351 1.00 52.32 ? 200 GLY B O    1  
ATOM 6811   H H    . GLY B 1 200 ? -2.106  44.531  -14.368 1.00 42.11 ? 200 GLY B H    1  
ATOM 6812   H HA2  . GLY B 1 200 ? -3.422  46.292  -15.293 1.00 73.24 ? 200 GLY B HA2  1  
ATOM 6813   H HA3  . GLY B 1 200 ? -3.622  45.333  -16.759 1.00 72.20 ? 200 GLY B HA3  1  
ATOM 6814   N N    . ILE B 1 201 ? -5.122  43.680  -14.645 1.00 4.34  ? 201 ILE B N    1  
ATOM 6815   C CA   . ILE B 1 201 ? -6.442  43.164  -14.158 1.00 5.10  ? 201 ILE B CA   1  
ATOM 6816   C C    . ILE B 1 201 ? -6.441  43.123  -12.627 1.00 11.10 ? 201 ILE B C    1  
ATOM 6817   O O    . ILE B 1 201 ? -5.533  42.601  -12.011 1.00 44.23 ? 201 ILE B O    1  
ATOM 6818   C CB   . ILE B 1 201 ? -6.649  41.748  -14.705 1.00 22.54 ? 201 ILE B CB   1  
ATOM 6819   C CG1  . ILE B 1 201 ? -6.443  41.744  -16.228 1.00 23.01 ? 201 ILE B CG1  1  
ATOM 6820   C CG2  . ILE B 1 201 ? -8.062  41.266  -14.372 1.00 5.34  ? 201 ILE B CG2  1  
ATOM 6821   C CD1  . ILE B 1 201 ? -7.312  42.823  -16.890 1.00 42.54 ? 201 ILE B CD1  1  
ATOM 6822   H H    . ILE B 1 201 ? -4.320  43.126  -14.544 1.00 14.24 ? 201 ILE B H    1  
ATOM 6823   H HA   . ILE B 1 201 ? -7.246  43.802  -14.498 1.00 22.13 ? 201 ILE B HA   1  
ATOM 6824   H HB   . ILE B 1 201 ? -5.932  41.083  -14.246 1.00 10.53 ? 201 ILE B HB   1  
ATOM 6825   H HG12 . ILE B 1 201 ? -5.402  41.940  -16.447 1.00 43.34 ? 201 ILE B HG12 1  
ATOM 6826   H HG13 . ILE B 1 201 ? -6.714  40.776  -16.623 1.00 11.35 ? 201 ILE B HG13 1  
ATOM 6827   H HG21 . ILE B 1 201 ? -8.785  41.894  -14.872 1.00 54.21 ? 201 ILE B HG21 1  
ATOM 6828   H HG22 . ILE B 1 201 ? -8.217  41.320  -13.304 1.00 54.30 ? 201 ILE B HG22 1  
ATOM 6829   H HG23 . ILE B 1 201 ? -8.183  40.244  -14.701 1.00 21.30 ? 201 ILE B HG23 1  
ATOM 6830   H HD11 . ILE B 1 201 ? -6.818  43.781  -16.814 1.00 14.11 ? 201 ILE B HD11 1  
ATOM 6831   H HD12 . ILE B 1 201 ? -8.272  42.875  -16.397 1.00 14.43 ? 201 ILE B HD12 1  
ATOM 6832   H HD13 . ILE B 1 201 ? -7.457  42.577  -17.932 1.00 3.13  ? 201 ILE B HD13 1  
ATOM 6833   N N    . SER B 1 202 ? -7.455  43.672  -12.008 1.00 54.01 ? 202 SER B N    1  
ATOM 6834   C CA   . SER B 1 202 ? -7.515  43.668  -10.517 1.00 35.33 ? 202 SER B CA   1  
ATOM 6835   C C    . SER B 1 202 ? -8.068  42.328  -10.032 1.00 51.03 ? 202 SER B C    1  
ATOM 6836   O O    . SER B 1 202 ? -8.949  41.753  -10.639 1.00 13.12 ? 202 SER B O    1  
ATOM 6837   C CB   . SER B 1 202 ? -8.430  44.794  -10.037 1.00 40.30 ? 202 SER B CB   1  
ATOM 6838   O OG   . SER B 1 202 ? -9.780  44.463  -10.338 1.00 13.52 ? 202 SER B OG   1  
ATOM 6839   H H    . SER B 1 202 ? -8.176  44.089  -12.525 1.00 23.35 ? 202 SER B H    1  
ATOM 6840   H HA   . SER B 1 202 ? -6.523  43.814  -10.115 1.00 51.03 ? 202 SER B HA   1  
ATOM 6841   H HB2  . SER B 1 202 ? -8.326  44.915  -8.971  1.00 74.31 ? 202 SER B HB2  1  
ATOM 6842   H HB3  . SER B 1 202 ? -8.155  45.717  -10.531 1.00 22.42 ? 202 SER B HB3  1  
ATOM 6843   H HG   . SER B 1 202 ? -9.817  43.526  -10.547 1.00 45.15 ? 202 SER B HG   1  
ATOM 6844   N N    . THR B 1 203 ? -7.554  41.828  -8.941  1.00 72.40 ? 203 THR B N    1  
ATOM 6845   C CA   . THR B 1 203 ? -8.041  40.522  -8.408  1.00 0.32  ? 203 THR B CA   1  
ATOM 6846   C C    . THR B 1 203 ? -7.898  40.508  -6.882  1.00 70.44 ? 203 THR B C    1  
ATOM 6847   O O    . THR B 1 203 ? -7.858  39.460  -6.268  1.00 71.35 ? 203 THR B O    1  
ATOM 6848   C CB   . THR B 1 203 ? -7.199  39.389  -8.998  1.00 71.40 ? 203 THR B CB   1  
ATOM 6849   O OG1  . THR B 1 203 ? -5.849  39.546  -8.584  1.00 74.40 ? 203 THR B OG1  1  
ATOM 6850   C CG2  . THR B 1 203 ? -7.273  39.423  -10.527 1.00 42.13 ? 203 THR B CG2  1  
ATOM 6851   H H    . THR B 1 203 ? -6.843  42.311  -8.472  1.00 21.43 ? 203 THR B H    1  
ATOM 6852   H HA   . THR B 1 203 ? -9.079  40.379  -8.675  1.00 43.52 ? 203 THR B HA   1  
ATOM 6853   H HB   . THR B 1 203 ? -7.576  38.441  -8.646  1.00 45.53 ? 203 THR B HB   1  
ATOM 6854   H HG1  . THR B 1 203 ? -5.455  40.245  -9.112  1.00 1.42  ? 203 THR B HG1  1  
ATOM 6855   H HG21 . THR B 1 203 ? -8.304  39.500  -10.837 1.00 61.25 ? 203 THR B HG21 1  
ATOM 6856   H HG22 . THR B 1 203 ? -6.844  38.516  -10.926 1.00 73.35 ? 203 THR B HG22 1  
ATOM 6857   H HG23 . THR B 1 203 ? -6.720  40.275  -10.896 1.00 42.41 ? 203 THR B HG23 1  
ATOM 6858   N N    . VAL B 1 204 ? -7.809  41.661  -6.265  1.00 11.21 ? 204 VAL B N    1  
ATOM 6859   C CA   . VAL B 1 204 ? -7.656  41.719  -4.774  1.00 72.12 ? 204 VAL B CA   1  
ATOM 6860   C C    . VAL B 1 204 ? -8.597  42.784  -4.200  1.00 23.15 ? 204 VAL B C    1  
ATOM 6861   O O    . VAL B 1 204 ? -8.725  43.867  -4.736  1.00 3.21  ? 204 VAL B O    1  
ATOM 6862   C CB   . VAL B 1 204 ? -6.201  42.082  -4.438  1.00 23.40 ? 204 VAL B CB   1  
ATOM 6863   C CG1  . VAL B 1 204 ? -5.328  40.824  -4.476  1.00 14.14 ? 204 VAL B CG1  1  
ATOM 6864   C CG2  . VAL B 1 204 ? -5.686  43.090  -5.470  1.00 25.22 ? 204 VAL B CG2  1  
ATOM 6865   H H    . VAL B 1 204 ? -7.836  42.492  -6.783  1.00 14.22 ? 204 VAL B H    1  
ATOM 6866   H HA   . VAL B 1 204 ? -7.901  40.761  -4.336  1.00 74.10 ? 204 VAL B HA   1  
ATOM 6867   H HB   . VAL B 1 204 ? -6.150  42.519  -3.450  1.00 11.54 ? 204 VAL B HB   1  
ATOM 6868   H HG11 . VAL B 1 204 ? -5.577  40.237  -5.348  1.00 71.13 ? 204 VAL B HG11 1  
ATOM 6869   H HG12 . VAL B 1 204 ? -5.508  40.240  -3.586  1.00 25.24 ? 204 VAL B HG12 1  
ATOM 6870   H HG13 . VAL B 1 204 ? -4.286  41.106  -4.516  1.00 54.14 ? 204 VAL B HG13 1  
ATOM 6871   H HG21 . VAL B 1 204 ? -5.586  42.603  -6.428  1.00 22.52 ? 204 VAL B HG21 1  
ATOM 6872   H HG22 . VAL B 1 204 ? -4.726  43.470  -5.155  1.00 73.31 ? 204 VAL B HG22 1  
ATOM 6873   H HG23 . VAL B 1 204 ? -6.387  43.908  -5.553  1.00 31.21 ? 204 VAL B HG23 1  
ATOM 6874   N N    . GLU B 1 205 ? -9.249  42.479  -3.103  1.00 25.41 ? 205 GLU B N    1  
ATOM 6875   C CA   . GLU B 1 205 ? -10.184 43.457  -2.459  1.00 22.03 ? 205 GLU B CA   1  
ATOM 6876   C C    . GLU B 1 205 ? -9.781  43.640  -0.994  1.00 65.41 ? 205 GLU B C    1  
ATOM 6877   O O    . GLU B 1 205 ? -9.539  42.682  -0.288  1.00 53.34 ? 205 GLU B O    1  
ATOM 6878   C CB   . GLU B 1 205 ? -11.615 42.916  -2.521  1.00 13.34 ? 205 GLU B CB   1  
ATOM 6879   C CG   . GLU B 1 205 ? -12.054 42.776  -3.982  1.00 51.54 ? 205 GLU B CG   1  
ATOM 6880   C CD   . GLU B 1 205 ? -13.575 42.615  -4.047  1.00 1.32  ? 205 GLU B CD   1  
ATOM 6881   O OE1  . GLU B 1 205 ? -14.133 42.057  -3.117  1.00 44.31 ? 205 GLU B OE1  1  
ATOM 6882   O OE2  . GLU B 1 205 ? -14.157 43.054  -5.027  1.00 53.12 ? 205 GLU B OE2  1  
ATOM 6883   H H    . GLU B 1 205 ? -9.117  41.599  -2.693  1.00 21.13 ? 205 GLU B H    1  
ATOM 6884   H HA   . GLU B 1 205 ? -10.138 44.410  -2.965  1.00 63.43 ? 205 GLU B HA   1  
ATOM 6885   H HB2  . GLU B 1 205 ? -11.653 41.950  -2.041  1.00 21.30 ? 205 GLU B HB2  1  
ATOM 6886   H HB3  . GLU B 1 205 ? -12.279 43.598  -2.011  1.00 75.33 ? 205 GLU B HB3  1  
ATOM 6887   H HG2  . GLU B 1 205 ? -11.760 43.658  -4.533  1.00 13.51 ? 205 GLU B HG2  1  
ATOM 6888   H HG3  . GLU B 1 205 ? -11.584 41.906  -4.416  1.00 65.30 ? 205 GLU B HG3  1  
ATOM 6889   N N    . THR B 1 206 ? -9.709  44.862  -0.528  1.00 51.43 ? 206 THR B N    1  
ATOM 6890   C CA   . THR B 1 206 ? -9.323  45.110  0.898   1.00 53.41 ? 206 THR B CA   1  
ATOM 6891   C C    . THR B 1 206 ? -10.579 45.424  1.714   1.00 34.03 ? 206 THR B C    1  
ATOM 6892   O O    . THR B 1 206 ? -11.368 46.275  1.353   1.00 63.31 ? 206 THR B O    1  
ATOM 6893   C CB   . THR B 1 206 ? -8.363  46.302  0.960   1.00 71.33 ? 206 THR B CB   1  
ATOM 6894   O OG1  . THR B 1 206 ? -7.925  46.484  2.299   1.00 60.00 ? 206 THR B OG1  1  
ATOM 6895   C CG2  . THR B 1 206 ? -9.074  47.567  0.474   1.00 64.32 ? 206 THR B CG2  1  
ATOM 6896   H H    . THR B 1 206 ? -9.912  45.620  -1.115  1.00 1.33  ? 206 THR B H    1  
ATOM 6897   H HA   . THR B 1 206 ? -8.834  44.236  1.310   1.00 71.40 ? 206 THR B HA   1  
ATOM 6898   H HB   . THR B 1 206 ? -7.511  46.109  0.327   1.00 51.14 ? 206 THR B HB   1  
ATOM 6899   H HG1  . THR B 1 206 ? -8.522  47.104  2.725   1.00 23.40 ? 206 THR B HG1  1  
ATOM 6900   H HG21 . THR B 1 206 ? -8.339  48.314  0.214   1.00 62.12 ? 206 THR B HG21 1  
ATOM 6901   H HG22 . THR B 1 206 ? -9.711  47.948  1.259   1.00 25.41 ? 206 THR B HG22 1  
ATOM 6902   H HG23 . THR B 1 206 ? -9.674  47.336  -0.396  1.00 0.34  ? 206 THR B HG23 1  
ATOM 6903   N N    . VAL B 1 207 ? -10.775 44.743  2.814   1.00 3.21  ? 207 VAL B N    1  
ATOM 6904   C CA   . VAL B 1 207 ? -11.984 45.001  3.656   1.00 12.54 ? 207 VAL B CA   1  
ATOM 6905   C C    . VAL B 1 207 ? -11.631 44.827  5.135   1.00 63.50 ? 207 VAL B C    1  
ATOM 6906   O O    . VAL B 1 207 ? -10.699 44.130  5.485   1.00 62.21 ? 207 VAL B O    1  
ATOM 6907   C CB   . VAL B 1 207 ? -13.093 44.017  3.279   1.00 44.24 ? 207 VAL B CB   1  
ATOM 6908   C CG1  . VAL B 1 207 ? -13.522 44.262  1.832   1.00 23.43 ? 207 VAL B CG1  1  
ATOM 6909   C CG2  . VAL B 1 207 ? -12.580 42.582  3.424   1.00 11.15 ? 207 VAL B CG2  1  
ATOM 6910   H H    . VAL B 1 207 ? -10.127 44.061  3.086   1.00 3.25  ? 207 VAL B H    1  
ATOM 6911   H HA   . VAL B 1 207 ? -12.333 46.011  3.492   1.00 14.41 ? 207 VAL B HA   1  
ATOM 6912   H HB   . VAL B 1 207 ? -13.940 44.166  3.933   1.00 44.04 ? 207 VAL B HB   1  
ATOM 6913   H HG11 . VAL B 1 207 ? -13.673 45.320  1.676   1.00 45.42 ? 207 VAL B HG11 1  
ATOM 6914   H HG12 . VAL B 1 207 ? -14.444 43.735  1.636   1.00 0.24  ? 207 VAL B HG12 1  
ATOM 6915   H HG13 . VAL B 1 207 ? -12.754 43.905  1.162   1.00 63.20 ? 207 VAL B HG13 1  
ATOM 6916   H HG21 . VAL B 1 207 ? -12.509 42.330  4.472   1.00 61.32 ? 207 VAL B HG21 1  
ATOM 6917   H HG22 . VAL B 1 207 ? -11.606 42.497  2.966   1.00 54.24 ? 207 VAL B HG22 1  
ATOM 6918   H HG23 . VAL B 1 207 ? -13.267 41.905  2.938   1.00 11.13 ? 207 VAL B HG23 1  
ATOM 6919   N N    . ARG B 1 208 ? -12.368 45.462  6.007   1.00 24.44 ? 208 ARG B N    1  
ATOM 6920   C CA   . ARG B 1 208 ? -12.079 45.343  7.467   1.00 71.43 ? 208 ARG B CA   1  
ATOM 6921   C C    . ARG B 1 208 ? -12.787 44.109  8.038   1.00 43.44 ? 208 ARG B C    1  
ATOM 6922   O O    . ARG B 1 208 ? -12.511 43.684  9.143   1.00 2.41  ? 208 ARG B O    1  
ATOM 6923   C CB   . ARG B 1 208 ? -12.581 46.599  8.186   1.00 62.01 ? 208 ARG B CB   1  
ATOM 6924   C CG   . ARG B 1 208 ? -11.861 47.831  7.629   1.00 60.23 ? 208 ARG B CG   1  
ATOM 6925   C CD   . ARG B 1 208 ? -12.262 49.069  8.434   1.00 41.35 ? 208 ARG B CD   1  
ATOM 6926   N NE   . ARG B 1 208 ? -13.747 49.200  8.445   1.00 1.24  ? 208 ARG B NE   1  
ATOM 6927   C CZ   . ARG B 1 208 ? -14.324 49.971  9.325   1.00 52.14 ? 208 ARG B CZ   1  
ATOM 6928   N NH1  . ARG B 1 208 ? -13.600 50.630  10.190  1.00 63.41 ? 208 ARG B NH1  1  
ATOM 6929   N NH2  . ARG B 1 208 ? -15.624 50.083  9.340   1.00 74.45 ? 208 ARG B NH2  1  
ATOM 6930   H H    . ARG B 1 208 ? -13.113 46.021  5.701   1.00 54.24 ? 208 ARG B H    1  
ATOM 6931   H HA   . ARG B 1 208 ? -11.014 45.247  7.618   1.00 25.43 ? 208 ARG B HA   1  
ATOM 6932   H HB2  . ARG B 1 208 ? -13.645 46.702  8.030   1.00 72.52 ? 208 ARG B HB2  1  
ATOM 6933   H HB3  . ARG B 1 208 ? -12.378 46.515  9.243   1.00 33.44 ? 208 ARG B HB3  1  
ATOM 6934   H HG2  . ARG B 1 208 ? -10.793 47.685  7.701   1.00 72.31 ? 208 ARG B HG2  1  
ATOM 6935   H HG3  . ARG B 1 208 ? -12.136 47.972  6.594   1.00 44.30 ? 208 ARG B HG3  1  
ATOM 6936   H HD2  . ARG B 1 208 ? -11.904 48.970  9.447   1.00 62.44 ? 208 ARG B HD2  1  
ATOM 6937   H HD3  . ARG B 1 208 ? -11.827 49.948  7.982   1.00 33.01 ? 208 ARG B HD3  1  
ATOM 6938   H HE   . ARG B 1 208 ? -14.289 48.709  7.793   1.00 2.11  ? 208 ARG B HE   1  
ATOM 6939   H HH11 . ARG B 1 208 ? -12.604 50.543  10.177  1.00 70.22 ? 208 ARG B HH11 1  
ATOM 6940   H HH12 . ARG B 1 208 ? -14.042 51.220  10.865  1.00 63.23 ? 208 ARG B HH12 1  
ATOM 6941   H HH21 . ARG B 1 208 ? -16.177 49.579  8.677   1.00 45.22 ? 208 ARG B HH21 1  
ATOM 6942   H HH22 . ARG B 1 208 ? -16.067 50.674  10.014  1.00 43.13 ? 208 ARG B HH22 1  
ATOM 6943   N N    . ARG B 1 209 ? -13.697 43.532  7.301   1.00 73.41 ? 209 ARG B N    1  
ATOM 6944   C CA   . ARG B 1 209 ? -14.419 42.330  7.811   1.00 4.25  ? 209 ARG B CA   1  
ATOM 6945   C C    . ARG B 1 209 ? -13.412 41.248  8.206   1.00 74.14 ? 209 ARG B C    1  
ATOM 6946   O O    . ARG B 1 209 ? -13.588 40.551  9.186   1.00 53.13 ? 209 ARG B O    1  
ATOM 6947   C CB   . ARG B 1 209 ? -15.344 41.787  6.720   1.00 4.24  ? 209 ARG B CB   1  
ATOM 6948   C CG   . ARG B 1 209 ? -16.451 42.804  6.439   1.00 34.12 ? 209 ARG B CG   1  
ATOM 6949   C CD   . ARG B 1 209 ? -17.501 42.174  5.522   1.00 73.55 ? 209 ARG B CD   1  
ATOM 6950   N NE   . ARG B 1 209 ? -18.155 41.036  6.227   1.00 11.45 ? 209 ARG B NE   1  
ATOM 6951   C CZ   . ARG B 1 209 ? -19.004 41.266  7.190   1.00 25.02 ? 209 ARG B CZ   1  
ATOM 6952   N NH1  . ARG B 1 209 ? -19.286 42.493  7.533   1.00 24.31 ? 209 ARG B NH1  1  
ATOM 6953   N NH2  . ARG B 1 209 ? -19.572 40.267  7.809   1.00 2.44  ? 209 ARG B NH2  1  
ATOM 6954   H H    . ARG B 1 209 ? -13.908 43.890  6.413   1.00 23.42 ? 209 ARG B H    1  
ATOM 6955   H HA   . ARG B 1 209 ? -15.007 42.604  8.675   1.00 4.35  ? 209 ARG B HA   1  
ATOM 6956   H HB2  . ARG B 1 209 ? -14.774 41.615  5.818   1.00 3.45  ? 209 ARG B HB2  1  
ATOM 6957   H HB3  . ARG B 1 209 ? -15.785 40.859  7.050   1.00 3.31  ? 209 ARG B HB3  1  
ATOM 6958   H HG2  . ARG B 1 209 ? -16.915 43.098  7.370   1.00 60.31 ? 209 ARG B HG2  1  
ATOM 6959   H HG3  . ARG B 1 209 ? -16.029 43.672  5.956   1.00 13.42 ? 209 ARG B HG3  1  
ATOM 6960   H HD2  . ARG B 1 209 ? -18.244 42.913  5.263   1.00 21.32 ? 209 ARG B HD2  1  
ATOM 6961   H HD3  . ARG B 1 209 ? -17.023 41.814  4.623   1.00 45.11 ? 209 ARG B HD3  1  
ATOM 6962   H HE   . ARG B 1 209 ? -17.944 40.114  5.970   1.00 43.21 ? 209 ARG B HE   1  
ATOM 6963   H HH11 . ARG B 1 209 ? -18.852 43.257  7.057   1.00 30.41 ? 209 ARG B HH11 1  
ATOM 6964   H HH12 . ARG B 1 209 ? -19.936 42.668  8.273   1.00 52.11 ? 209 ARG B HH12 1  
ATOM 6965   H HH21 . ARG B 1 209 ? -19.356 39.327  7.545   1.00 60.14 ? 209 ARG B HH21 1  
ATOM 6966   H HH22 . ARG B 1 209 ? -20.222 40.441  8.549   1.00 31.42 ? 209 ARG B HH22 1  
ATOM 6967   N N    . ARG B 1 210 ? -12.355 41.099  7.452   1.00 74.43 ? 210 ARG B N    1  
ATOM 6968   C CA   . ARG B 1 210 ? -11.335 40.059  7.784   1.00 71.21 ? 210 ARG B CA   1  
ATOM 6969   C C    . ARG B 1 210 ? -9.956  40.546  7.340   1.00 43.32 ? 210 ARG B C    1  
ATOM 6970   O O    . ARG B 1 210 ? -9.008  40.529  8.099   1.00 15.11 ? 210 ARG B O    1  
ATOM 6971   C CB   . ARG B 1 210 ? -11.675 38.756  7.056   1.00 41.24 ? 210 ARG B CB   1  
ATOM 6972   C CG   . ARG B 1 210 ? -12.894 38.105  7.715   1.00 73.45 ? 210 ARG B CG   1  
ATOM 6973   C CD   . ARG B 1 210 ? -13.166 36.747  7.065   1.00 41.13 ? 210 ARG B CD   1  
ATOM 6974   N NE   . ARG B 1 210 ? -14.119 35.977  7.913   1.00 34.33 ? 210 ARG B NE   1  
ATOM 6975   C CZ   . ARG B 1 210 ? -13.711 35.455  9.038   1.00 32.13 ? 210 ARG B CZ   1  
ATOM 6976   N NH1  . ARG B 1 210 ? -12.470 35.600  9.412   1.00 44.25 ? 210 ARG B NH1  1  
ATOM 6977   N NH2  . ARG B 1 210 ? -14.545 34.788  9.789   1.00 13.24 ? 210 ARG B NH2  1  
ATOM 6978   H H    . ARG B 1 210 ? -12.231 41.670  6.666   1.00 71.41 ? 210 ARG B H    1  
ATOM 6979   H HA   . ARG B 1 210 ? -11.324 39.883  8.851   1.00 51.45 ? 210 ARG B HA   1  
ATOM 6980   H HB2  . ARG B 1 210 ? -11.896 38.969  6.021   1.00 55.13 ? 210 ARG B HB2  1  
ATOM 6981   H HB3  . ARG B 1 210 ? -10.835 38.081  7.114   1.00 71.00 ? 210 ARG B HB3  1  
ATOM 6982   H HG2  . ARG B 1 210 ? -12.702 37.968  8.769   1.00 31.11 ? 210 ARG B HG2  1  
ATOM 6983   H HG3  . ARG B 1 210 ? -13.756 38.741  7.585   1.00 43.25 ? 210 ARG B HG3  1  
ATOM 6984   H HD2  . ARG B 1 210 ? -13.595 36.896  6.085   1.00 62.21 ? 210 ARG B HD2  1  
ATOM 6985   H HD3  . ARG B 1 210 ? -12.240 36.199  6.974   1.00 74.04 ? 210 ARG B HD3  1  
ATOM 6986   H HE   . ARG B 1 210 ? -15.051 35.866  7.630   1.00 40.30 ? 210 ARG B HE   1  
ATOM 6987   H HH11 . ARG B 1 210 ? -11.831 36.112  8.836   1.00 74.21 ? 210 ARG B HH11 1  
ATOM 6988   H HH12 . ARG B 1 210 ? -12.156 35.198  10.271  1.00 64.51 ? 210 ARG B HH12 1  
ATOM 6989   H HH21 . ARG B 1 210 ? -15.496 34.676  9.503   1.00 3.35  ? 210 ARG B HH21 1  
ATOM 6990   H HH22 . ARG B 1 210 ? -14.232 34.390  10.651  1.00 44.45 ? 210 ARG B HH22 1  
ATOM 6991   N N    . GLY B 1 211 ? -9.837  40.984  6.118   1.00 3.14  ? 211 GLY B N    1  
ATOM 6992   C CA   . GLY B 1 211 ? -8.518  41.474  5.632   1.00 1.25  ? 211 GLY B CA   1  
ATOM 6993   C C    . GLY B 1 211 ? -8.576  41.675  4.119   1.00 42.45 ? 211 GLY B C    1  
ATOM 6994   O O    . GLY B 1 211 ? -9.285  42.529  3.625   1.00 64.45 ? 211 GLY B O    1  
ATOM 6995   H H    . GLY B 1 211 ? -10.614 40.992  5.521   1.00 70.11 ? 211 GLY B H    1  
ATOM 6996   H HA2  . GLY B 1 211 ? -8.285  42.413  6.113   1.00 23.15 ? 211 GLY B HA2  1  
ATOM 6997   H HA3  . GLY B 1 211 ? -7.755  40.748  5.867   1.00 5.45  ? 211 GLY B HA3  1  
ATOM 6998   N N    . TYR B 1 212 ? -7.831  40.891  3.379   1.00 10.43 ? 212 TYR B N    1  
ATOM 6999   C CA   . TYR B 1 212 ? -7.827  41.022  1.889   1.00 21.35 ? 212 TYR B CA   1  
ATOM 7000   C C    . TYR B 1 212 ? -8.529  39.812  1.266   1.00 61.42 ? 212 TYR B C    1  
ATOM 7001   O O    . TYR B 1 212 ? -8.195  38.678  1.547   1.00 53.01 ? 212 TYR B O    1  
ATOM 7002   C CB   . TYR B 1 212 ? -6.380  41.074  1.397   1.00 22.22 ? 212 TYR B CB   1  
ATOM 7003   C CG   . TYR B 1 212 ? -5.770  42.401  1.783   1.00 15.54 ? 212 TYR B CG   1  
ATOM 7004   C CD1  . TYR B 1 212 ? -5.301  42.603  3.087   1.00 21.13 ? 212 TYR B CD1  1  
ATOM 7005   C CD2  . TYR B 1 212 ? -5.675  43.430  0.838   1.00 23.04 ? 212 TYR B CD2  1  
ATOM 7006   C CE1  . TYR B 1 212 ? -4.737  43.833  3.444   1.00 30.53 ? 212 TYR B CE1  1  
ATOM 7007   C CE2  . TYR B 1 212 ? -5.110  44.660  1.196   1.00 34.30 ? 212 TYR B CE2  1  
ATOM 7008   C CZ   . TYR B 1 212 ? -4.641  44.862  2.499   1.00 40.45 ? 212 TYR B CZ   1  
ATOM 7009   O OH   . TYR B 1 212 ? -4.085  46.075  2.852   1.00 74.21 ? 212 TYR B OH   1  
ATOM 7010   H H    . TYR B 1 212 ? -7.270  40.212  3.807   1.00 20.23 ? 212 TYR B H    1  
ATOM 7011   H HA   . TYR B 1 212 ? -8.336  41.928  1.591   1.00 11.43 ? 212 TYR B HA   1  
ATOM 7012   H HB2  . TYR B 1 212 ? -5.816  40.272  1.852   1.00 5.13  ? 212 TYR B HB2  1  
ATOM 7013   H HB3  . TYR B 1 212 ? -6.358  40.967  0.323   1.00 15.21 ? 212 TYR B HB3  1  
ATOM 7014   H HD1  . TYR B 1 212 ? -5.374  41.810  3.816   1.00 13.15 ? 212 TYR B HD1  1  
ATOM 7015   H HD2  . TYR B 1 212 ? -6.036  43.275  -0.167  1.00 15.14 ? 212 TYR B HD2  1  
ATOM 7016   H HE1  . TYR B 1 212 ? -4.375  43.989  4.449   1.00 41.20 ? 212 TYR B HE1  1  
ATOM 7017   H HE2  . TYR B 1 212 ? -5.036  45.453  0.467   1.00 30.21 ? 212 TYR B HE2  1  
ATOM 7018   H HH   . TYR B 1 212 ? -4.173  46.177  3.803   1.00 0.12  ? 212 TYR B HH   1  
ATOM 7019   N N    . ARG B 1 213 ? -9.501  40.047  0.419   1.00 72.12 ? 213 ARG B N    1  
ATOM 7020   C CA   . ARG B 1 213 ? -10.236 38.918  -0.236  1.00 43.54 ? 213 ARG B CA   1  
ATOM 7021   C C    . ARG B 1 213 ? -9.778  38.799  -1.690  1.00 62.14 ? 213 ARG B C    1  
ATOM 7022   O O    . ARG B 1 213 ? -9.892  39.729  -2.465  1.00 74.03 ? 213 ARG B O    1  
ATOM 7023   C CB   . ARG B 1 213 ? -11.745 39.202  -0.185  1.00 43.21 ? 213 ARG B CB   1  
ATOM 7024   C CG   . ARG B 1 213 ? -12.496 38.236  -1.111  1.00 62.42 ? 213 ARG B CG   1  
ATOM 7025   C CD   . ARG B 1 213 ? -13.985 38.230  -0.756  1.00 2.23  ? 213 ARG B CD   1  
ATOM 7026   N NE   . ARG B 1 213 ? -14.703 37.276  -1.649  1.00 51.21 ? 213 ARG B NE   1  
ATOM 7027   C CZ   . ARG B 1 213 ? -15.863 36.793  -1.296  1.00 32.23 ? 213 ARG B CZ   1  
ATOM 7028   N NH1  . ARG B 1 213 ? -16.393 37.134  -0.153  1.00 60.22 ? 213 ARG B NH1  1  
ATOM 7029   N NH2  . ARG B 1 213 ? -16.492 35.966  -2.085  1.00 43.54 ? 213 ARG B NH2  1  
ATOM 7030   H H    . ARG B 1 213 ? -9.748  40.972  0.210   1.00 44.32 ? 213 ARG B H    1  
ATOM 7031   H HA   . ARG B 1 213 ? -10.031 37.990  0.278   1.00 0.52  ? 213 ARG B HA   1  
ATOM 7032   H HB2  . ARG B 1 213 ? -12.097 39.076  0.828   1.00 34.43 ? 213 ARG B HB2  1  
ATOM 7033   H HB3  . ARG B 1 213 ? -11.929 40.217  -0.503  1.00 32.03 ? 213 ARG B HB3  1  
ATOM 7034   H HG2  . ARG B 1 213 ? -12.373 38.558  -2.137  1.00 41.34 ? 213 ARG B HG2  1  
ATOM 7035   H HG3  . ARG B 1 213 ? -12.095 37.241  -0.995  1.00 61.14 ? 213 ARG B HG3  1  
ATOM 7036   H HD2  . ARG B 1 213 ? -14.109 37.924  0.273   1.00 10.32 ? 213 ARG B HD2  1  
ATOM 7037   H HD3  . ARG B 1 213 ? -14.391 39.222  -0.888  1.00 74.30 ? 213 ARG B HD3  1  
ATOM 7038   H HE   . ARG B 1 213 ? -14.305 37.015  -2.506  1.00 23.41 ? 213 ARG B HE   1  
ATOM 7039   H HH11 . ARG B 1 213 ? -15.910 37.766  0.453   1.00 42.23 ? 213 ARG B HH11 1  
ATOM 7040   H HH12 . ARG B 1 213 ? -17.281 36.763  0.117   1.00 52.33 ? 213 ARG B HH12 1  
ATOM 7041   H HH21 . ARG B 1 213 ? -16.085 35.703  -2.960  1.00 61.43 ? 213 ARG B HH21 1  
ATOM 7042   H HH22 . ARG B 1 213 ? -17.381 35.596  -1.816  1.00 74.22 ? 213 ARG B HH22 1  
ATOM 7043   N N    . PHE B 1 214 ? -9.265  37.656  -2.070  1.00 71.41 ? 214 PHE B N    1  
ATOM 7044   C CA   . PHE B 1 214 ? -8.805  37.473  -3.479  1.00 13.03 ? 214 PHE B CA   1  
ATOM 7045   C C    . PHE B 1 214 ? -9.935  36.837  -4.294  1.00 64.20 ? 214 PHE B C    1  
ATOM 7046   O O    . PHE B 1 214 ? -10.374 35.740  -4.007  1.00 74.34 ? 214 PHE B O    1  
ATOM 7047   C CB   . PHE B 1 214 ? -7.571  36.559  -3.512  1.00 4.21  ? 214 PHE B CB   1  
ATOM 7048   C CG   . PHE B 1 214 ? -6.824  36.787  -4.807  1.00 52.44 ? 214 PHE B CG   1  
ATOM 7049   C CD1  . PHE B 1 214 ? -7.319  36.260  -6.004  1.00 55.11 ? 214 PHE B CD1  1  
ATOM 7050   C CD2  . PHE B 1 214 ? -5.650  37.547  -4.809  1.00 71.14 ? 214 PHE B CD2  1  
ATOM 7051   C CE1  . PHE B 1 214 ? -6.636  36.488  -7.204  1.00 25.54 ? 214 PHE B CE1  1  
ATOM 7052   C CE2  . PHE B 1 214 ? -4.969  37.779  -6.008  1.00 45.43 ? 214 PHE B CE2  1  
ATOM 7053   C CZ   . PHE B 1 214 ? -5.461  37.248  -7.207  1.00 52.53 ? 214 PHE B CZ   1  
ATOM 7054   H H    . PHE B 1 214 ? -9.187  36.919  -1.430  1.00 54.40 ? 214 PHE B H    1  
ATOM 7055   H HA   . PHE B 1 214 ? -8.550  38.435  -3.907  1.00 74.23 ? 214 PHE B HA   1  
ATOM 7056   H HB2  . PHE B 1 214 ? -6.928  36.793  -2.674  1.00 4.14  ? 214 PHE B HB2  1  
ATOM 7057   H HB3  . PHE B 1 214 ? -7.878  35.525  -3.450  1.00 1.20  ? 214 PHE B HB3  1  
ATOM 7058   H HD1  . PHE B 1 214 ? -8.227  35.678  -6.002  1.00 4.45  ? 214 PHE B HD1  1  
ATOM 7059   H HD2  . PHE B 1 214 ? -5.268  37.950  -3.884  1.00 55.31 ? 214 PHE B HD2  1  
ATOM 7060   H HE1  . PHE B 1 214 ? -7.016  36.078  -8.128  1.00 65.54 ? 214 PHE B HE1  1  
ATOM 7061   H HE2  . PHE B 1 214 ? -4.064  38.370  -6.008  1.00 41.22 ? 214 PHE B HE2  1  
ATOM 7062   H HZ   . PHE B 1 214 ? -4.937  37.428  -8.134  1.00 50.41 ? 214 PHE B HZ   1  
ATOM 7063   N N    . CYS B 1 215 ? -10.407 37.525  -5.303  1.00 63.13 ? 215 CYS B N    1  
ATOM 7064   C CA   . CYS B 1 215 ? -11.518 36.989  -6.154  1.00 24.34 ? 215 CYS B CA   1  
ATOM 7065   C C    . CYS B 1 215 ? -11.043 36.868  -7.603  1.00 64.33 ? 215 CYS B C    1  
ATOM 7066   O O    . CYS B 1 215 ? -10.399 37.754  -8.130  1.00 62.43 ? 215 CYS B O    1  
ATOM 7067   C CB   . CYS B 1 215 ? -12.700 37.960  -6.090  1.00 21.34 ? 215 CYS B CB   1  
ATOM 7068   S SG   . CYS B 1 215 ? -14.143 37.221  -6.897  1.00 44.21 ? 215 CYS B SG   1  
ATOM 7069   H H    . CYS B 1 215 ? -10.030 38.407  -5.502  1.00 65.54 ? 215 CYS B H    1  
ATOM 7070   H HA   . CYS B 1 215 ? -11.832 36.018  -5.798  1.00 55.05 ? 215 CYS B HA   1  
ATOM 7071   H HB2  . CYS B 1 215 ? -12.935 38.171  -5.058  1.00 72.21 ? 215 CYS B HB2  1  
ATOM 7072   H HB3  . CYS B 1 215 ? -12.438 38.879  -6.593  1.00 1.40  ? 215 CYS B HB3  1  
ATOM 7073   H HG   . CYS B 1 215 ? -13.963 36.289  -7.029  1.00 13.33 ? 215 CYS B HG   1  
ATOM 7074   N N    . TYR B 1 216 ? -11.361 35.783  -8.257  1.00 70.04 ? 216 TYR B N    1  
ATOM 7075   C CA   . TYR B 1 216 ? -10.932 35.621  -9.674  1.00 2.44  ? 216 TYR B CA   1  
ATOM 7076   C C    . TYR B 1 216 ? -11.517 36.785  -10.491 1.00 32.21 ? 216 TYR B C    1  
ATOM 7077   O O    . TYR B 1 216 ? -12.573 37.292  -10.169 1.00 12.41 ? 216 TYR B O    1  
ATOM 7078   C CB   . TYR B 1 216 ? -11.465 34.291  -10.220 1.00 31.55 ? 216 TYR B CB   1  
ATOM 7079   C CG   . TYR B 1 216 ? -12.944 34.180  -9.932  1.00 62.52 ? 216 TYR B CG   1  
ATOM 7080   C CD1  . TYR B 1 216 ? -13.382 33.740  -8.678  1.00 3.21  ? 216 TYR B CD1  1  
ATOM 7081   C CD2  . TYR B 1 216 ? -13.877 34.520  -10.918 1.00 63.54 ? 216 TYR B CD2  1  
ATOM 7082   C CE1  . TYR B 1 216 ? -14.753 33.639  -8.410  1.00 54.31 ? 216 TYR B CE1  1  
ATOM 7083   C CE2  . TYR B 1 216 ? -15.248 34.421  -10.651 1.00 43.10 ? 216 TYR B CE2  1  
ATOM 7084   C CZ   . TYR B 1 216 ? -15.685 33.980  -9.397  1.00 34.11 ? 216 TYR B CZ   1  
ATOM 7085   O OH   . TYR B 1 216 ? -17.036 33.883  -9.132  1.00 24.01 ? 216 TYR B OH   1  
ATOM 7086   H H    . TYR B 1 216 ? -11.887 35.083  -7.819  1.00 70.54 ? 216 TYR B H    1  
ATOM 7087   H HA   . TYR B 1 216 ? -9.852  35.630  -9.722  1.00 72.31 ? 216 TYR B HA   1  
ATOM 7088   H HB2  . TYR B 1 216 ? -11.304 34.248  -11.287 1.00 65.11 ? 216 TYR B HB2  1  
ATOM 7089   H HB3  . TYR B 1 216 ? -10.945 33.472  -9.745  1.00 14.34 ? 216 TYR B HB3  1  
ATOM 7090   H HD1  . TYR B 1 216 ? -12.664 33.477  -7.917  1.00 44.15 ? 216 TYR B HD1  1  
ATOM 7091   H HD2  . TYR B 1 216 ? -13.540 34.858  -11.885 1.00 61.31 ? 216 TYR B HD2  1  
ATOM 7092   H HE1  . TYR B 1 216 ? -15.090 33.300  -7.442  1.00 64.21 ? 216 TYR B HE1  1  
ATOM 7093   H HE2  . TYR B 1 216 ? -15.967 34.684  -11.413 1.00 12.23 ? 216 TYR B HE2  1  
ATOM 7094   H HH   . TYR B 1 216 ? -17.506 33.911  -9.968  1.00 34.41 ? 216 TYR B HH   1  
ATOM 7095   N N    . PRO B 1 217 ? -10.848 37.217  -11.534 1.00 32.43 ? 217 PRO B N    1  
ATOM 7096   C CA   . PRO B 1 217 ? -11.342 38.348  -12.380 1.00 14.23 ? 217 PRO B CA   1  
ATOM 7097   C C    . PRO B 1 217 ? -12.624 37.975  -13.135 1.00 64.53 ? 217 PRO B C    1  
ATOM 7098   O O    . PRO B 1 217 ? -13.232 36.956  -12.875 1.00 54.54 ? 217 PRO B O    1  
ATOM 7099   C CB   . PRO B 1 217 ? -10.179 38.619  -13.351 1.00 40.53 ? 217 PRO B CB   1  
ATOM 7100   C CG   . PRO B 1 217 ? -9.414  37.335  -13.407 1.00 32.03 ? 217 PRO B CG   1  
ATOM 7101   C CD   . PRO B 1 217 ? -9.565  36.688  -12.029 1.00 65.11 ? 217 PRO B CD   1  
ATOM 7102   H HA   . PRO B 1 217 ? -11.515 39.220  -11.767 1.00 71.01 ? 217 PRO B HA   1  
ATOM 7103   H HB2  . PRO B 1 217 ? -10.554 38.885  -14.333 1.00 22.35 ? 217 PRO B HB2  1  
ATOM 7104   H HB3  . PRO B 1 217 ? -9.547  39.408  -12.967 1.00 2.10  ? 217 PRO B HB3  1  
ATOM 7105   H HG2  . PRO B 1 217 ? -9.829  36.690  -14.172 1.00 63.42 ? 217 PRO B HG2  1  
ATOM 7106   H HG3  . PRO B 1 217 ? -8.370  37.526  -13.609 1.00 23.31 ? 217 PRO B HG3  1  
ATOM 7107   H HD2  . PRO B 1 217 ? -9.601  35.611  -12.116 1.00 21.12 ? 217 PRO B HD2  1  
ATOM 7108   H HD3  . PRO B 1 217 ? -8.761  36.990  -11.375 1.00 44.43 ? 217 PRO B HD3  1  
ATOM 7109   N N    . LYS B 1 218 ? -13.043 38.791  -14.064 1.00 52.20 ? 218 LYS B N    1  
ATOM 7110   C CA   . LYS B 1 218 ? -14.286 38.476  -14.825 1.00 72.40 ? 218 LYS B CA   1  
ATOM 7111   C C    . LYS B 1 218 ? -14.234 37.012  -15.298 1.00 62.03 ? 218 LYS B C    1  
ATOM 7112   O O    . LYS B 1 218 ? -13.166 36.460  -15.480 1.00 52.50 ? 218 LYS B O    1  
ATOM 7113   C CB   . LYS B 1 218 ? -14.387 39.413  -16.036 1.00 44.54 ? 218 LYS B CB   1  
ATOM 7114   C CG   . LYS B 1 218 ? -12.988 39.670  -16.602 1.00 11.31 ? 218 LYS B CG   1  
ATOM 7115   C CD   . LYS B 1 218 ? -13.105 40.270  -18.005 1.00 11.03 ? 218 LYS B CD   1  
ATOM 7116   C CE   . LYS B 1 218 ? -11.709 40.465  -18.599 1.00 22.35 ? 218 LYS B CE   1  
ATOM 7117   N NZ   . LYS B 1 218 ? -10.809 41.058  -17.570 1.00 73.15 ? 218 LYS B NZ   1  
ATOM 7118   H H    . LYS B 1 218 ? -12.542 39.611  -14.259 1.00 3.12  ? 218 LYS B H    1  
ATOM 7119   H HA   . LYS B 1 218 ? -15.138 38.625  -14.181 1.00 2.30  ? 218 LYS B HA   1  
ATOM 7120   H HB2  . LYS B 1 218 ? -15.008 38.962  -16.798 1.00 74.35 ? 218 LYS B HB2  1  
ATOM 7121   H HB3  . LYS B 1 218 ? -14.824 40.352  -15.729 1.00 4.10  ? 218 LYS B HB3  1  
ATOM 7122   H HG2  . LYS B 1 218 ? -12.462 40.361  -15.958 1.00 4.54  ? 218 LYS B HG2  1  
ATOM 7123   H HG3  . LYS B 1 218 ? -12.442 38.740  -16.655 1.00 45.34 ? 218 LYS B HG3  1  
ATOM 7124   H HD2  . LYS B 1 218 ? -13.675 39.602  -18.635 1.00 32.20 ? 218 LYS B HD2  1  
ATOM 7125   H HD3  . LYS B 1 218 ? -13.606 41.225  -17.947 1.00 74.34 ? 218 LYS B HD3  1  
ATOM 7126   H HE2  . LYS B 1 218 ? -11.316 39.510  -18.914 1.00 32.23 ? 218 LYS B HE2  1  
ATOM 7127   H HE3  . LYS B 1 218 ? -11.770 41.128  -19.449 1.00 24.11 ? 218 LYS B HE3  1  
ATOM 7128   H HZ1  . LYS B 1 218 ? -9.969  41.459  -18.033 1.00 53.32 ? 218 LYS B HZ1  1  
ATOM 7129   H HZ2  . LYS B 1 218 ? -10.516 40.319  -16.899 1.00 21.15 ? 218 LYS B HZ2  1  
ATOM 7130   H HZ3  . LYS B 1 218 ? -11.313 41.811  -17.060 1.00 21.01 ? 218 LYS B HZ3  1  
ATOM 7131   N N    . PRO B 1 219 ? -15.371 36.383  -15.498 1.00 10.12 ? 219 PRO B N    1  
ATOM 7132   C CA   . PRO B 1 219 ? -15.431 34.967  -15.956 1.00 71.31 ? 219 PRO B CA   1  
ATOM 7133   C C    . PRO B 1 219 ? -14.345 34.631  -16.984 1.00 25.44 ? 219 PRO B C    1  
ATOM 7134   O O    . PRO B 1 219 ? -14.456 34.959  -18.148 1.00 14.41 ? 219 PRO B O    1  
ATOM 7135   C CB   . PRO B 1 219 ? -16.823 34.866  -16.583 1.00 61.13 ? 219 PRO B CB   1  
ATOM 7136   C CG   . PRO B 1 219 ? -17.665 35.823  -15.797 1.00 4.30  ? 219 PRO B CG   1  
ATOM 7137   C CD   . PRO B 1 219 ? -16.725 36.943  -15.313 1.00 63.43 ? 219 PRO B CD   1  
ATOM 7138   H HA   . PRO B 1 219 ? -15.367 34.299  -15.113 1.00 13.43 ? 219 PRO B HA   1  
ATOM 7139   H HB2  . PRO B 1 219 ? -16.788 35.158  -17.626 1.00 71.05 ? 219 PRO B HB2  1  
ATOM 7140   H HB3  . PRO B 1 219 ? -17.209 33.861  -16.487 1.00 61.42 ? 219 PRO B HB3  1  
ATOM 7141   H HG2  . PRO B 1 219 ? -18.448 36.232  -16.425 1.00 45.12 ? 219 PRO B HG2  1  
ATOM 7142   H HG3  . PRO B 1 219 ? -18.101 35.321  -14.944 1.00 50.13 ? 219 PRO B HG3  1  
ATOM 7143   H HD2  . PRO B 1 219 ? -16.854 37.834  -15.912 1.00 23.42 ? 219 PRO B HD2  1  
ATOM 7144   H HD3  . PRO B 1 219 ? -16.899 37.158  -14.269 1.00 71.32 ? 219 PRO B HD3  1  
ATOM 7145   N N    . ALA B 1 220 ? -13.299 33.970  -16.565 1.00 73.23 ? 220 ALA B N    1  
ATOM 7146   C CA   . ALA B 1 220 ? -12.211 33.603  -17.518 1.00 75.45 ? 220 ALA B CA   1  
ATOM 7147   C C    . ALA B 1 220 ? -12.562 32.271  -18.184 1.00 4.25  ? 220 ALA B C    1  
ATOM 7148   O O    . ALA B 1 220 ? -11.749 31.665  -18.855 1.00 74.25 ? 220 ALA B O    1  
ATOM 7149   C CB   . ALA B 1 220 ? -10.890 33.463  -16.758 1.00 1.51  ? 220 ALA B CB   1  
ATOM 7150   H H    . ALA B 1 220 ? -13.232 33.708  -15.623 1.00 1.22  ? 220 ALA B H    1  
ATOM 7151   H HA   . ALA B 1 220 ? -12.113 34.369  -18.274 1.00 61.34 ? 220 ALA B HA   1  
ATOM 7152   H HB1  . ALA B 1 220 ? -11.036 32.828  -15.897 1.00 45.14 ? 220 ALA B HB1  1  
ATOM 7153   H HB2  . ALA B 1 220 ? -10.557 34.438  -16.433 1.00 24.54 ? 220 ALA B HB2  1  
ATOM 7154   H HB3  . ALA B 1 220 ? -10.146 33.026  -17.407 1.00 0.10  ? 220 ALA B HB3  1  
ATOM 7155   N N    . CYS B 1 221 ? -13.769 31.812  -17.999 1.00 10.51 ? 221 CYS B N    1  
ATOM 7156   C CA   . CYS B 1 221 ? -14.182 30.519  -18.614 1.00 32.02 ? 221 CYS B CA   1  
ATOM 7157   C C    . CYS B 1 221 ? -14.209 30.660  -20.137 1.00 32.11 ? 221 CYS B C    1  
ATOM 7158   O O    . CYS B 1 221 ? -14.625 31.669  -20.672 1.00 52.32 ? 221 CYS B O    1  
ATOM 7159   C CB   . CYS B 1 221 ? -15.576 30.138  -18.110 1.00 23.43 ? 221 CYS B CB   1  
ATOM 7160   S SG   . CYS B 1 221 ? -15.454 29.517  -16.415 1.00 72.22 ? 221 CYS B SG   1  
ATOM 7161   H H    . CYS B 1 221 ? -14.406 32.318  -17.453 1.00 53.21 ? 221 CYS B H    1  
ATOM 7162   H HA   . CYS B 1 221 ? -13.477 29.749  -18.338 1.00 3.40  ? 221 CYS B HA   1  
ATOM 7163   H HB2  . CYS B 1 221 ? -16.216 31.009  -18.129 1.00 71.45 ? 221 CYS B HB2  1  
ATOM 7164   H HB3  . CYS B 1 221 ? -15.994 29.371  -18.746 1.00 72.12 ? 221 CYS B HB3  1  
ATOM 7165   H HG   . CYS B 1 221 ? -16.293 29.111  -16.187 1.00 42.55 ? 221 CYS B HG   1  
ATOM 7166   N N    . GLU B 1 222 ? -13.771 29.651  -20.839 1.00 35.20 ? 222 GLU B N    1  
ATOM 7167   C CA   . GLU B 1 222 ? -13.772 29.721  -22.326 1.00 54.33 ? 222 GLU B CA   1  
ATOM 7168   C C    . GLU B 1 222 ? -15.206 29.904  -22.823 1.00 31.50 ? 222 GLU B C    1  
ATOM 7169   O O    . GLU B 1 222 ? -16.136 29.337  -22.285 1.00 14.15 ? 222 GLU B O    1  
ATOM 7170   C CB   . GLU B 1 222 ? -13.201 28.420  -22.893 1.00 54.14 ? 222 GLU B CB   1  
ATOM 7171   C CG   . GLU B 1 222 ? -11.867 28.112  -22.212 1.00 33.32 ? 222 GLU B CG   1  
ATOM 7172   C CD   . GLU B 1 222 ? -10.882 29.250  -22.479 1.00 31.53 ? 222 GLU B CD   1  
ATOM 7173   O OE1  . GLU B 1 222 ? -10.927 29.804  -23.565 1.00 13.25 ? 222 GLU B OE1  1  
ATOM 7174   O OE2  . GLU B 1 222 ? -10.099 29.549  -21.592 1.00 54.53 ? 222 GLU B OE2  1  
ATOM 7175   H H    . GLU B 1 222 ? -13.443 28.847  -20.386 1.00 74.30 ? 222 GLU B H    1  
ATOM 7176   H HA   . GLU B 1 222 ? -13.167 30.554  -22.650 1.00 32.05 ? 222 GLU B HA   1  
ATOM 7177   H HB2  . GLU B 1 222 ? -13.895 27.613  -22.712 1.00 1.21  ? 222 GLU B HB2  1  
ATOM 7178   H HB3  . GLU B 1 222 ? -13.044 28.529  -23.956 1.00 40.42 ? 222 GLU B HB3  1  
ATOM 7179   H HG2  . GLU B 1 222 ? -12.024 28.012  -21.148 1.00 31.44 ? 222 GLU B HG2  1  
ATOM 7180   H HG3  . GLU B 1 222 ? -11.466 27.190  -22.606 1.00 42.24 ? 222 GLU B HG3  1  
ATOM 7181   N N    . GLU B 1 223 ? -15.395 30.689  -23.847 1.00 2.11  ? 223 GLU B N    1  
ATOM 7182   C CA   . GLU B 1 223 ? -16.772 30.904  -24.374 1.00 4.55  ? 223 GLU B CA   1  
ATOM 7183   C C    . GLU B 1 223 ? -17.297 29.599  -24.975 1.00 11.54 ? 223 GLU B C    1  
ATOM 7184   O O    . GLU B 1 223 ? -17.264 29.473  -26.188 1.00 24.02 ? 223 GLU B O    1  
ATOM 7185   C CB   . GLU B 1 223 ? -16.743 31.987  -25.453 1.00 71.13 ? 223 GLU B CB   1  
ATOM 7186   C CG   . GLU B 1 223 ? -16.269 33.306  -24.840 1.00 34.25 ? 223 GLU B CG   1  
ATOM 7187   C CD   . GLU B 1 223 ? -16.374 34.420  -25.882 1.00 0.45  ? 223 GLU B CD   1  
ATOM 7188   O OE1  . GLU B 1 223 ? -16.408 34.103  -27.059 1.00 34.21 ? 223 GLU B OE1  1  
ATOM 7189   O OE2  . GLU B 1 223 ? -16.419 35.573  -25.484 1.00 41.35 ? 223 GLU B OE2  1  
ATOM 7190   O OXT  . GLU B 1 223 ? -17.723 28.747  -24.212 1.00 0.00  ? 223 GLU B OXT  1  
ATOM 7191   H H    . GLU B 1 223 ? -14.632 31.137  -24.268 1.00 44.31 ? 223 GLU B H    1  
ATOM 7192   H HA   . GLU B 1 223 ? -17.420 31.215  -23.569 1.00 3.12  ? 223 GLU B HA   1  
ATOM 7193   H HB2  . GLU B 1 223 ? -16.066 31.691  -26.242 1.00 35.02 ? 223 GLU B HB2  1  
ATOM 7194   H HB3  . GLU B 1 223 ? -17.735 32.117  -25.858 1.00 12.14 ? 223 GLU B HB3  1  
ATOM 7195   H HG2  . GLU B 1 223 ? -16.888 33.548  -23.987 1.00 62.40 ? 223 GLU B HG2  1  
ATOM 7196   H HG3  . GLU B 1 223 ? -15.242 33.207  -24.523 1.00 32.15 ? 223 GLU B HG3  1  
ATOM 7197   N N    . MET A 1 1   ? 3.098   1.083   3.174   1.00 53.03 ? 1   MET A N    2  
ATOM 7198   C CA   . MET A 1 1   ? 4.559   1.018   2.886   1.00 52.53 ? 1   MET A CA   2  
ATOM 7199   C C    . MET A 1 1   ? 4.985   -0.444  2.741   1.00 40.10 ? 1   MET A C    2  
ATOM 7200   O O    . MET A 1 1   ? 5.187   -1.141  3.716   1.00 15.25 ? 1   MET A O    2  
ATOM 7201   C CB   . MET A 1 1   ? 5.337   1.659   4.040   1.00 24.31 ? 1   MET A CB   2  
ATOM 7202   C CG   . MET A 1 1   ? 6.811   1.833   3.647   1.00 5.14  ? 1   MET A CG   2  
ATOM 7203   S SD   . MET A 1 1   ? 7.005   3.365   2.700   1.00 64.55 ? 1   MET A SD   2  
ATOM 7204   C CE   . MET A 1 1   ? 7.416   4.445   4.093   1.00 65.12 ? 1   MET A CE   2  
ATOM 7205   H H1   . MET A 1 1   ? 2.647   1.760   2.527   1.00 0.00  ? 1   MET A H1   2  
ATOM 7206   H H2   . MET A 1 1   ? 2.952   1.390   4.157   1.00 0.00  ? 1   MET A H2   2  
ATOM 7207   H H3   . MET A 1 1   ? 2.675   0.143   3.037   1.00 0.00  ? 1   MET A H3   2  
ATOM 7208   H HA   . MET A 1 1   ? 4.770   1.548   1.969   1.00 51.41 ? 1   MET A HA   2  
ATOM 7209   H HB2  . MET A 1 1   ? 4.909   2.625   4.266   1.00 14.22 ? 1   MET A HB2  2  
ATOM 7210   H HB3  . MET A 1 1   ? 5.272   1.025   4.911   1.00 12.45 ? 1   MET A HB3  2  
ATOM 7211   H HG2  . MET A 1 1   ? 7.416   1.882   4.539   1.00 24.01 ? 1   MET A HG2  2  
ATOM 7212   H HG3  . MET A 1 1   ? 7.132   0.995   3.045   1.00 64.30 ? 1   MET A HG3  2  
ATOM 7213   H HE1  . MET A 1 1   ? 8.364   4.141   4.516   1.00 62.55 ? 1   MET A HE1  2  
ATOM 7214   H HE2  . MET A 1 1   ? 6.649   4.371   4.847   1.00 10.31 ? 1   MET A HE2  2  
ATOM 7215   H HE3  . MET A 1 1   ? 7.482   5.467   3.748   1.00 63.15 ? 1   MET A HE3  2  
ATOM 7216   N N    . ARG A 1 2   ? 5.131   -0.916  1.530   1.00 72.33 ? 2   ARG A N    2  
ATOM 7217   C CA   . ARG A 1 2   ? 5.553   -2.334  1.321   1.00 30.31 ? 2   ARG A CA   2  
ATOM 7218   C C    . ARG A 1 2   ? 6.440   -2.422  0.076   1.00 53.21 ? 2   ARG A C    2  
ATOM 7219   O O    . ARG A 1 2   ? 6.296   -1.652  -0.864  1.00 63.20 ? 2   ARG A O    2  
ATOM 7220   C CB   . ARG A 1 2   ? 4.314   -3.218  1.135   1.00 45.33 ? 2   ARG A CB   2  
ATOM 7221   C CG   . ARG A 1 2   ? 4.682   -4.685  1.375   1.00 70.40 ? 2   ARG A CG   2  
ATOM 7222   C CD   . ARG A 1 2   ? 3.506   -5.576  0.969   1.00 10.12 ? 2   ARG A CD   2  
ATOM 7223   N NE   . ARG A 1 2   ? 3.713   -6.947  1.513   1.00 11.22 ? 2   ARG A NE   2  
ATOM 7224   C CZ   . ARG A 1 2   ? 3.534   -7.177  2.786   1.00 41.32 ? 2   ARG A CZ   2  
ATOM 7225   N NH1  . ARG A 1 2   ? 3.171   -6.207  3.579   1.00 62.11 ? 2   ARG A NH1  2  
ATOM 7226   N NH2  . ARG A 1 2   ? 3.716   -8.377  3.264   1.00 61.51 ? 2   ARG A NH2  2  
ATOM 7227   H H    . ARG A 1 2   ? 4.969   -0.335  0.758   1.00 35.21 ? 2   ARG A H    2  
ATOM 7228   H HA   . ARG A 1 2   ? 6.115   -2.677  2.180   1.00 21.15 ? 2   ARG A HA   2  
ATOM 7229   H HB2  . ARG A 1 2   ? 3.551   -2.920  1.839   1.00 22.23 ? 2   ARG A HB2  2  
ATOM 7230   H HB3  . ARG A 1 2   ? 3.940   -3.109  0.132   1.00 11.01 ? 2   ARG A HB3  2  
ATOM 7231   H HG2  . ARG A 1 2   ? 5.550   -4.939  0.784   1.00 2.20  ? 2   ARG A HG2  2  
ATOM 7232   H HG3  . ARG A 1 2   ? 4.901   -4.835  2.421   1.00 10.54 ? 2   ARG A HG3  2  
ATOM 7233   H HD2  . ARG A 1 2   ? 2.589   -5.166  1.365   1.00 42.43 ? 2   ARG A HD2  2  
ATOM 7234   H HD3  . ARG A 1 2   ? 3.444   -5.622  -0.109  1.00 43.11 ? 2   ARG A HD3  2  
ATOM 7235   H HE   . ARG A 1 2   ? 3.985   -7.675  0.917   1.00 64.54 ? 2   ARG A HE   2  
ATOM 7236   H HH11 . ARG A 1 2   ? 3.032   -5.287  3.213   1.00 4.02  ? 2   ARG A HH11 2  
ATOM 7237   H HH12 . ARG A 1 2   ? 3.034   -6.383  4.554   1.00 62.10 ? 2   ARG A HH12 2  
ATOM 7238   H HH21 . ARG A 1 2   ? 3.993   -9.121  2.655   1.00 3.13  ? 2   ARG A HH21 2  
ATOM 7239   H HH22 . ARG A 1 2   ? 3.578   -8.554  4.238   1.00 73.31 ? 2   ARG A HH22 2  
ATOM 7240   N N    . VAL A 1 3   ? 7.360   -3.358  0.068   1.00 52.41 ? 3   VAL A N    2  
ATOM 7241   C CA   . VAL A 1 3   ? 8.279   -3.525  -1.100  1.00 12.42 ? 3   VAL A CA   2  
ATOM 7242   C C    . VAL A 1 3   ? 8.039   -4.883  -1.756  1.00 32.15 ? 3   VAL A C    2  
ATOM 7243   O O    . VAL A 1 3   ? 7.969   -5.902  -1.096  1.00 13.13 ? 3   VAL A O    2  
ATOM 7244   C CB   . VAL A 1 3   ? 9.728   -3.448  -0.616  1.00 21.43 ? 3   VAL A CB   2  
ATOM 7245   C CG1  . VAL A 1 3   ? 10.675  -3.642  -1.803  1.00 13.41 ? 3   VAL A CG1  2  
ATOM 7246   C CG2  . VAL A 1 3   ? 9.982   -2.079  0.019   1.00 71.42 ? 3   VAL A CG2  2  
ATOM 7247   H H    . VAL A 1 3   ? 7.446   -3.956  0.840   1.00 51.25 ? 3   VAL A H    2  
ATOM 7248   H HA   . VAL A 1 3   ? 8.103   -2.750  -1.826  1.00 15.44 ? 3   VAL A HA   2  
ATOM 7249   H HB   . VAL A 1 3   ? 9.904   -4.224  0.114   1.00 60.31 ? 3   VAL A HB   2  
ATOM 7250   H HG11 . VAL A 1 3   ? 10.344  -3.033  -2.631  1.00 35.42 ? 3   VAL A HG11 2  
ATOM 7251   H HG12 . VAL A 1 3   ? 10.674  -4.681  -2.097  1.00 55.14 ? 3   VAL A HG12 2  
ATOM 7252   H HG13 . VAL A 1 3   ? 11.674  -3.350  -1.517  1.00 44.13 ? 3   VAL A HG13 2  
ATOM 7253   H HG21 . VAL A 1 3   ? 9.601   -1.304  -0.630  1.00 22.35 ? 3   VAL A HG21 2  
ATOM 7254   H HG22 . VAL A 1 3   ? 11.043  -1.939  0.162   1.00 40.50 ? 3   VAL A HG22 2  
ATOM 7255   H HG23 . VAL A 1 3   ? 9.480   -2.027  0.974   1.00 20.43 ? 3   VAL A HG23 2  
ATOM 7256   N N    . LEU A 1 4   ? 7.915   -4.902  -3.057  1.00 14.02 ? 4   LEU A N    2  
ATOM 7257   C CA   . LEU A 1 4   ? 7.681   -6.189  -3.784  1.00 65.12 ? 4   LEU A CA   2  
ATOM 7258   C C    . LEU A 1 4   ? 9.013   -6.678  -4.366  1.00 24.13 ? 4   LEU A C    2  
ATOM 7259   O O    . LEU A 1 4   ? 9.592   -6.048  -5.226  1.00 40.52 ? 4   LEU A O    2  
ATOM 7260   C CB   . LEU A 1 4   ? 6.647   -5.930  -4.896  1.00 64.50 ? 4   LEU A CB   2  
ATOM 7261   C CG   . LEU A 1 4   ? 6.753   -6.960  -6.034  1.00 51.23 ? 4   LEU A CG   2  
ATOM 7262   C CD1  . LEU A 1 4   ? 6.674   -8.391  -5.465  1.00 34.04 ? 4   LEU A CD1  2  
ATOM 7263   C CD2  . LEU A 1 4   ? 5.593   -6.728  -7.010  1.00 40.50 ? 4   LEU A CD2  2  
ATOM 7264   H H    . LEU A 1 4   ? 7.979   -4.059  -3.563  1.00 30.13 ? 4   LEU A H    2  
ATOM 7265   H HA   . LEU A 1 4   ? 7.294   -6.934  -3.100  1.00 65.22 ? 4   LEU A HA   2  
ATOM 7266   H HB2  . LEU A 1 4   ? 5.655   -5.978  -4.472  1.00 24.12 ? 4   LEU A HB2  2  
ATOM 7267   H HB3  . LEU A 1 4   ? 6.806   -4.946  -5.294  1.00 42.31 ? 4   LEU A HB3  2  
ATOM 7268   H HG   . LEU A 1 4   ? 7.694   -6.824  -6.559  1.00 31.24 ? 4   LEU A HG   2  
ATOM 7269   H HD11 . LEU A 1 4   ? 6.268   -9.059  -6.210  1.00 64.32 ? 4   LEU A HD11 2  
ATOM 7270   H HD12 . LEU A 1 4   ? 6.037   -8.404  -4.592  1.00 24.02 ? 4   LEU A HD12 2  
ATOM 7271   H HD13 . LEU A 1 4   ? 7.663   -8.725  -5.191  1.00 45.41 ? 4   LEU A HD13 2  
ATOM 7272   H HD21 . LEU A 1 4   ? 5.533   -5.678  -7.255  1.00 20.13 ? 4   LEU A HD21 2  
ATOM 7273   H HD22 . LEU A 1 4   ? 4.668   -7.045  -6.552  1.00 53.55 ? 4   LEU A HD22 2  
ATOM 7274   H HD23 . LEU A 1 4   ? 5.762   -7.298  -7.912  1.00 12.41 ? 4   LEU A HD23 2  
ATOM 7275   N N    . LEU A 1 5   ? 9.494   -7.805  -3.900  1.00 2.23  ? 5   LEU A N    2  
ATOM 7276   C CA   . LEU A 1 5   ? 10.789  -8.364  -4.407  1.00 43.52 ? 5   LEU A CA   2  
ATOM 7277   C C    . LEU A 1 5   ? 10.522  -9.681  -5.134  1.00 42.23 ? 5   LEU A C    2  
ATOM 7278   O O    . LEU A 1 5   ? 10.298  -10.701 -4.519  1.00 24.35 ? 5   LEU A O    2  
ATOM 7279   C CB   . LEU A 1 5   ? 11.712  -8.627  -3.209  1.00 62.43 ? 5   LEU A CB   2  
ATOM 7280   C CG   . LEU A 1 5   ? 13.065  -9.187  -3.677  1.00 60.00 ? 5   LEU A CG   2  
ATOM 7281   C CD1  . LEU A 1 5   ? 13.774  -8.179  -4.597  1.00 21.21 ? 5   LEU A CD1  2  
ATOM 7282   C CD2  . LEU A 1 5   ? 13.937  -9.470  -2.447  1.00 31.11 ? 5   LEU A CD2  2  
ATOM 7283   H H    . LEU A 1 5   ? 8.998   -8.290  -3.207  1.00 13.15 ? 5   LEU A H    2  
ATOM 7284   H HA   . LEU A 1 5   ? 11.262  -7.667  -5.085  1.00 32.23 ? 5   LEU A HA   2  
ATOM 7285   H HB2  . LEU A 1 5   ? 11.873  -7.706  -2.671  1.00 61.12 ? 5   LEU A HB2  2  
ATOM 7286   H HB3  . LEU A 1 5   ? 11.243  -9.343  -2.551  1.00 53.20 ? 5   LEU A HB3  2  
ATOM 7287   H HG   . LEU A 1 5   ? 12.904  -10.108 -4.215  1.00 43.21 ? 5   LEU A HG   2  
ATOM 7288   H HD11 . LEU A 1 5   ? 13.428  -8.316  -5.611  1.00 71.33 ? 5   LEU A HD11 2  
ATOM 7289   H HD12 . LEU A 1 5   ? 14.843  -8.342  -4.564  1.00 53.20 ? 5   LEU A HD12 2  
ATOM 7290   H HD13 . LEU A 1 5   ? 13.555  -7.171  -4.275  1.00 61.13 ? 5   LEU A HD13 2  
ATOM 7291   H HD21 . LEU A 1 5   ? 13.871  -8.640  -1.760  1.00 11.25 ? 5   LEU A HD21 2  
ATOM 7292   H HD22 . LEU A 1 5   ? 14.964  -9.600  -2.756  1.00 34.43 ? 5   LEU A HD22 2  
ATOM 7293   H HD23 . LEU A 1 5   ? 13.591  -10.369 -1.960  1.00 71.44 ? 5   LEU A HD23 2  
ATOM 7294   N N    . ILE A 1 6   ? 10.552  -9.679  -6.440  1.00 14.42 ? 6   ILE A N    2  
ATOM 7295   C CA   . ILE A 1 6   ? 10.306  -10.949 -7.191  1.00 71.15 ? 6   ILE A CA   2  
ATOM 7296   C C    . ILE A 1 6   ? 11.646  -11.629 -7.482  1.00 44.41 ? 6   ILE A C    2  
ATOM 7297   O O    . ILE A 1 6   ? 12.450  -11.138 -8.250  1.00 24.15 ? 6   ILE A O    2  
ATOM 7298   C CB   . ILE A 1 6   ? 9.592   -10.635 -8.507  1.00 51.24 ? 6   ILE A CB   2  
ATOM 7299   C CG1  . ILE A 1 6   ? 8.339   -9.806  -8.213  1.00 34.42 ? 6   ILE A CG1  2  
ATOM 7300   C CG2  . ILE A 1 6   ? 9.187   -11.939 -9.200  1.00 15.55 ? 6   ILE A CG2  2  
ATOM 7301   C CD1  . ILE A 1 6   ? 7.540   -9.587  -9.502  1.00 61.12 ? 6   ILE A CD1  2  
ATOM 7302   H H    . ILE A 1 6   ? 10.740  -8.845  -6.927  1.00 54.30 ? 6   ILE A H    2  
ATOM 7303   H HA   . ILE A 1 6   ? 9.689   -11.613 -6.600  1.00 63.34 ? 6   ILE A HA   2  
ATOM 7304   H HB   . ILE A 1 6   ? 10.254  -10.076 -9.149  1.00 24.25 ? 6   ILE A HB   2  
ATOM 7305   H HG12 . ILE A 1 6   ? 7.726   -10.334 -7.497  1.00 44.34 ? 6   ILE A HG12 2  
ATOM 7306   H HG13 . ILE A 1 6   ? 8.628   -8.850  -7.803  1.00 30.23 ? 6   ILE A HG13 2  
ATOM 7307   H HG21 . ILE A 1 6   ? 10.036  -12.602 -9.253  1.00 60.45 ? 6   ILE A HG21 2  
ATOM 7308   H HG22 . ILE A 1 6   ? 8.839   -11.724 -10.199 1.00 1.33  ? 6   ILE A HG22 2  
ATOM 7309   H HG23 . ILE A 1 6   ? 8.395   -12.412 -8.638  1.00 24.33 ? 6   ILE A HG23 2  
ATOM 7310   H HD11 . ILE A 1 6   ? 8.218   -9.409  -10.324 1.00 12.30 ? 6   ILE A HD11 2  
ATOM 7311   H HD12 . ILE A 1 6   ? 6.890   -8.734  -9.381  1.00 41.01 ? 6   ILE A HD12 2  
ATOM 7312   H HD13 . ILE A 1 6   ? 6.947   -10.465 -9.709  1.00 23.55 ? 6   ILE A HD13 2  
ATOM 7313   N N    . GLU A 1 7   ? 11.891  -12.758 -6.870  1.00 61.45 ? 7   GLU A N    2  
ATOM 7314   C CA   . GLU A 1 7   ? 13.175  -13.482 -7.099  1.00 75.34 ? 7   GLU A CA   2  
ATOM 7315   C C    . GLU A 1 7   ? 12.925  -14.989 -7.007  1.00 13.13 ? 7   GLU A C    2  
ATOM 7316   O O    . GLU A 1 7   ? 12.264  -15.462 -6.104  1.00 72.45 ? 7   GLU A O    2  
ATOM 7317   C CB   . GLU A 1 7   ? 14.182  -13.068 -6.026  1.00 23.11 ? 7   GLU A CB   2  
ATOM 7318   C CG   . GLU A 1 7   ? 15.568  -13.600 -6.390  1.00 43.20 ? 7   GLU A CG   2  
ATOM 7319   C CD   . GLU A 1 7   ? 16.153  -12.772 -7.536  1.00 21.41 ? 7   GLU A CD   2  
ATOM 7320   O OE1  . GLU A 1 7   ? 15.836  -11.597 -7.615  1.00 72.12 ? 7   GLU A OE1  2  
ATOM 7321   O OE2  . GLU A 1 7   ? 16.911  -13.327 -8.315  1.00 61.32 ? 7   GLU A OE2  2  
ATOM 7322   H H    . GLU A 1 7   ? 11.229  -13.131 -6.254  1.00 35.12 ? 7   GLU A H    2  
ATOM 7323   H HA   . GLU A 1 7   ? 13.567  -13.240 -8.078  1.00 71.54 ? 7   GLU A HA   2  
ATOM 7324   H HB2  . GLU A 1 7   ? 14.214  -11.990 -5.960  1.00 11.31 ? 7   GLU A HB2  2  
ATOM 7325   H HB3  . GLU A 1 7   ? 13.881  -13.478 -5.074  1.00 11.52 ? 7   GLU A HB3  2  
ATOM 7326   H HG2  . GLU A 1 7   ? 16.212  -13.529 -5.528  1.00 43.31 ? 7   GLU A HG2  2  
ATOM 7327   H HG3  . GLU A 1 7   ? 15.490  -14.632 -6.698  1.00 10.14 ? 7   GLU A HG3  2  
ATOM 7328   N N    . LYS A 1 8   ? 13.447  -15.748 -7.931  1.00 41.50 ? 8   LYS A N    2  
ATOM 7329   C CA   . LYS A 1 8   ? 13.235  -17.223 -7.887  1.00 13.21 ? 8   LYS A CA   2  
ATOM 7330   C C    . LYS A 1 8   ? 14.097  -17.823 -6.769  1.00 72.44 ? 8   LYS A C    2  
ATOM 7331   O O    . LYS A 1 8   ? 13.743  -18.816 -6.166  1.00 42.44 ? 8   LYS A O    2  
ATOM 7332   C CB   . LYS A 1 8   ? 13.621  -17.842 -9.246  1.00 12.41 ? 8   LYS A CB   2  
ATOM 7333   C CG   . LYS A 1 8   ? 14.774  -17.039 -9.890  1.00 65.30 ? 8   LYS A CG   2  
ATOM 7334   C CD   . LYS A 1 8   ? 14.214  -15.900 -10.768 1.00 70.50 ? 8   LYS A CD   2  
ATOM 7335   C CE   . LYS A 1 8   ? 13.890  -16.427 -12.171 1.00 5.32  ? 8   LYS A CE   2  
ATOM 7336   N NZ   . LYS A 1 8   ? 15.149  -16.549 -12.958 1.00 55.23 ? 8   LYS A NZ   2  
ATOM 7337   H H    . LYS A 1 8   ? 13.979  -15.350 -8.651  1.00 54.40 ? 8   LYS A H    2  
ATOM 7338   H HA   . LYS A 1 8   ? 12.194  -17.427 -7.681  1.00 63.23 ? 8   LYS A HA   2  
ATOM 7339   H HB2  . LYS A 1 8   ? 13.935  -18.868 -9.100  1.00 61.24 ? 8   LYS A HB2  2  
ATOM 7340   H HB3  . LYS A 1 8   ? 12.762  -17.827 -9.901  1.00 43.53 ? 8   LYS A HB3  2  
ATOM 7341   H HG2  . LYS A 1 8   ? 15.399  -16.616 -9.114  1.00 21.04 ? 8   LYS A HG2  2  
ATOM 7342   H HG3  . LYS A 1 8   ? 15.373  -17.700 -10.501 1.00 35.41 ? 8   LYS A HG3  2  
ATOM 7343   H HD2  . LYS A 1 8   ? 13.314  -15.504 -10.319 1.00 73.04 ? 8   LYS A HD2  2  
ATOM 7344   H HD3  . LYS A 1 8   ? 14.950  -15.114 -10.846 1.00 12.51 ? 8   LYS A HD3  2  
ATOM 7345   H HE2  . LYS A 1 8   ? 13.419  -17.396 -12.095 1.00 30.32 ? 8   LYS A HE2  2  
ATOM 7346   H HE3  . LYS A 1 8   ? 13.221  -15.740 -12.668 1.00 53.34 ? 8   LYS A HE3  2  
ATOM 7347   H HZ1  . LYS A 1 8   ? 15.469  -17.538 -12.951 1.00 4.55  ? 8   LYS A HZ1  2  
ATOM 7348   H HZ2  . LYS A 1 8   ? 15.882  -15.944 -12.535 1.00 30.52 ? 8   LYS A HZ2  2  
ATOM 7349   H HZ3  . LYS A 1 8   ? 14.976  -16.251 -13.939 1.00 34.52 ? 8   LYS A HZ3  2  
ATOM 7350   N N    . ASN A 1 9   ? 15.225  -17.226 -6.489  1.00 34.13 ? 9   ASN A N    2  
ATOM 7351   C CA   . ASN A 1 9   ? 16.106  -17.762 -5.410  1.00 62.03 ? 9   ASN A CA   2  
ATOM 7352   C C    . ASN A 1 9   ? 15.625  -17.237 -4.055  1.00 50.30 ? 9   ASN A C    2  
ATOM 7353   O O    . ASN A 1 9   ? 15.738  -16.065 -3.756  1.00 41.42 ? 9   ASN A O    2  
ATOM 7354   C CB   . ASN A 1 9   ? 17.545  -17.304 -5.654  1.00 52.35 ? 9   ASN A CB   2  
ATOM 7355   C CG   . ASN A 1 9   ? 18.463  -17.918 -4.596  1.00 62.42 ? 9   ASN A CG   2  
ATOM 7356   O OD1  . ASN A 1 9   ? 18.000  -18.546 -3.665  1.00 63.02 ? 9   ASN A OD1  2  
ATOM 7357   N ND2  . ASN A 1 9   ? 19.755  -17.763 -4.700  1.00 23.44 ? 9   ASN A ND2  2  
ATOM 7358   H H    . ASN A 1 9   ? 15.492  -16.426 -6.987  1.00 50.02 ? 9   ASN A H    2  
ATOM 7359   H HA   . ASN A 1 9   ? 16.067  -18.842 -5.412  1.00 31.10 ? 9   ASN A HA   2  
ATOM 7360   H HB2  . ASN A 1 9   ? 17.862  -17.623 -6.637  1.00 52.54 ? 9   ASN A HB2  2  
ATOM 7361   H HB3  . ASN A 1 9   ? 17.596  -16.228 -5.592  1.00 11.54 ? 9   ASN A HB3  2  
ATOM 7362   H HD21 . ASN A 1 9   ? 20.128  -17.256 -5.452  1.00 72.22 ? 9   ASN A HD21 2  
ATOM 7363   H HD22 . ASN A 1 9   ? 20.351  -18.152 -4.028  1.00 72.42 ? 9   ASN A HD22 2  
ATOM 7364   N N    . SER A 1 10  ? 15.085  -18.097 -3.234  1.00 55.20 ? 10  SER A N    2  
ATOM 7365   C CA   . SER A 1 10  ? 14.591  -17.650 -1.901  1.00 42.33 ? 10  SER A CA   2  
ATOM 7366   C C    . SER A 1 10  ? 15.766  -17.171 -1.043  1.00 50.12 ? 10  SER A C    2  
ATOM 7367   O O    . SER A 1 10  ? 15.627  -16.276 -0.234  1.00 54.35 ? 10  SER A O    2  
ATOM 7368   C CB   . SER A 1 10  ? 13.894  -18.817 -1.200  1.00 72.34 ? 10  SER A CB   2  
ATOM 7369   O OG   . SER A 1 10  ? 12.853  -19.310 -2.033  1.00 31.54 ? 10  SER A OG   2  
ATOM 7370   H H    . SER A 1 10  ? 15.000  -19.037 -3.497  1.00 62.32 ? 10  SER A H    2  
ATOM 7371   H HA   . SER A 1 10  ? 13.889  -16.840 -2.031  1.00 1.44  ? 10  SER A HA   2  
ATOM 7372   H HB2  . SER A 1 10  ? 14.604  -19.605 -1.015  1.00 50.45 ? 10  SER A HB2  2  
ATOM 7373   H HB3  . SER A 1 10  ? 13.484  -18.476 -0.258  1.00 54.41 ? 10  SER A HB3  2  
ATOM 7374   H HG   . SER A 1 10  ? 12.033  -18.890 -1.764  1.00 21.13 ? 10  SER A HG   2  
ATOM 7375   N N    . VAL A 1 11  ? 16.918  -17.761 -1.207  1.00 31.02 ? 11  VAL A N    2  
ATOM 7376   C CA   . VAL A 1 11  ? 18.093  -17.337 -0.392  1.00 41.13 ? 11  VAL A CA   2  
ATOM 7377   C C    . VAL A 1 11  ? 18.463  -15.891 -0.730  1.00 45.14 ? 11  VAL A C    2  
ATOM 7378   O O    . VAL A 1 11  ? 18.637  -15.064 0.144   1.00 54.05 ? 11  VAL A O    2  
ATOM 7379   C CB   . VAL A 1 11  ? 19.281  -18.250 -0.701  1.00 74.02 ? 11  VAL A CB   2  
ATOM 7380   C CG1  . VAL A 1 11  ? 20.495  -17.803 0.117   1.00 63.12 ? 11  VAL A CG1  2  
ATOM 7381   C CG2  . VAL A 1 11  ? 18.924  -19.692 -0.336  1.00 43.33 ? 11  VAL A CG2  2  
ATOM 7382   H H    . VAL A 1 11  ? 17.010  -18.485 -1.861  1.00 54.41 ? 11  VAL A H    2  
ATOM 7383   H HA   . VAL A 1 11  ? 17.848  -17.410 0.657   1.00 21.33 ? 11  VAL A HA   2  
ATOM 7384   H HB   . VAL A 1 11  ? 19.516  -18.190 -1.754  1.00 72.11 ? 11  VAL A HB   2  
ATOM 7385   H HG11 . VAL A 1 11  ? 20.212  -17.705 1.155   1.00 23.13 ? 11  VAL A HG11 2  
ATOM 7386   H HG12 . VAL A 1 11  ? 20.847  -16.852 -0.252  1.00 73.33 ? 11  VAL A HG12 2  
ATOM 7387   H HG13 . VAL A 1 11  ? 21.280  -18.538 0.026   1.00 43.33 ? 11  VAL A HG13 2  
ATOM 7388   H HG21 . VAL A 1 11  ? 19.768  -20.335 -0.540  1.00 13.33 ? 11  VAL A HG21 2  
ATOM 7389   H HG22 . VAL A 1 11  ? 18.077  -20.013 -0.925  1.00 4.50  ? 11  VAL A HG22 2  
ATOM 7390   H HG23 . VAL A 1 11  ? 18.675  -19.747 0.713   1.00 74.42 ? 11  VAL A HG23 2  
ATOM 7391   N N    . LEU A 1 12  ? 18.586  -15.580 -1.990  1.00 23.44 ? 12  LEU A N    2  
ATOM 7392   C CA   . LEU A 1 12  ? 18.947  -14.189 -2.386  1.00 71.15 ? 12  LEU A CA   2  
ATOM 7393   C C    . LEU A 1 12  ? 17.868  -13.223 -1.889  1.00 50.15 ? 12  LEU A C    2  
ATOM 7394   O O    . LEU A 1 12  ? 18.156  -12.123 -1.457  1.00 35.30 ? 12  LEU A O    2  
ATOM 7395   C CB   . LEU A 1 12  ? 19.047  -14.116 -3.914  1.00 43.45 ? 12  LEU A CB   2  
ATOM 7396   C CG   . LEU A 1 12  ? 19.530  -12.727 -4.359  1.00 71.43 ? 12  LEU A CG   2  
ATOM 7397   C CD1  . LEU A 1 12  ? 20.989  -12.497 -3.925  1.00 70.13 ? 12  LEU A CD1  2  
ATOM 7398   C CD2  . LEU A 1 12  ? 19.425  -12.635 -5.886  1.00 32.44 ? 12  LEU A CD2  2  
ATOM 7399   H H    . LEU A 1 12  ? 18.443  -16.263 -2.678  1.00 33.33 ? 12  LEU A H    2  
ATOM 7400   H HA   . LEU A 1 12  ? 19.897  -13.927 -1.947  1.00 3.13  ? 12  LEU A HA   2  
ATOM 7401   H HB2  . LEU A 1 12  ? 19.741  -14.867 -4.263  1.00 72.01 ? 12  LEU A HB2  2  
ATOM 7402   H HB3  . LEU A 1 12  ? 18.075  -14.307 -4.341  1.00 43.02 ? 12  LEU A HB3  2  
ATOM 7403   H HG   . LEU A 1 12  ? 18.902  -11.969 -3.913  1.00 71.01 ? 12  LEU A HG   2  
ATOM 7404   H HD11 . LEU A 1 12  ? 21.010  -12.143 -2.906  1.00 71.22 ? 12  LEU A HD11 2  
ATOM 7405   H HD12 . LEU A 1 12  ? 21.448  -11.757 -4.566  1.00 1.05  ? 12  LEU A HD12 2  
ATOM 7406   H HD13 . LEU A 1 12  ? 21.543  -13.422 -3.996  1.00 31.10 ? 12  LEU A HD13 2  
ATOM 7407   H HD21 . LEU A 1 12  ? 19.834  -13.531 -6.330  1.00 25.23 ? 12  LEU A HD21 2  
ATOM 7408   H HD22 . LEU A 1 12  ? 19.980  -11.778 -6.234  1.00 53.53 ? 12  LEU A HD22 2  
ATOM 7409   H HD23 . LEU A 1 12  ? 18.389  -12.533 -6.171  1.00 42.20 ? 12  LEU A HD23 2  
ATOM 7410   N N    . GLY A 1 13  ? 16.629  -13.626 -1.936  1.00 1.44  ? 13  GLY A N    2  
ATOM 7411   C CA   . GLY A 1 13  ? 15.540  -12.732 -1.458  1.00 41.23 ? 13  GLY A CA   2  
ATOM 7412   C C    . GLY A 1 13  ? 15.555  -12.716 0.066   1.00 61.32 ? 13  GLY A C    2  
ATOM 7413   O O    . GLY A 1 13  ? 15.159  -11.755 0.694   1.00 44.22 ? 13  GLY A O    2  
ATOM 7414   H H    . GLY A 1 13  ? 16.415  -14.518 -2.276  1.00 22.20 ? 13  GLY A H    2  
ATOM 7415   H HA2  . GLY A 1 13  ? 15.701  -11.732 -1.836  1.00 44.13 ? 13  GLY A HA2  2  
ATOM 7416   H HA3  . GLY A 1 13  ? 14.587  -13.103 -1.803  1.00 72.14 ? 13  GLY A HA3  2  
ATOM 7417   N N    . GLY A 1 14  ? 16.015  -13.779 0.665   1.00 34.11 ? 14  GLY A N    2  
ATOM 7418   C CA   . GLY A 1 14  ? 16.063  -13.833 2.149   1.00 71.20 ? 14  GLY A CA   2  
ATOM 7419   C C    . GLY A 1 14  ? 17.028  -12.767 2.663   1.00 55.01 ? 14  GLY A C    2  
ATOM 7420   O O    . GLY A 1 14  ? 16.718  -12.016 3.566   1.00 42.42 ? 14  GLY A O    2  
ATOM 7421   H H    . GLY A 1 14  ? 16.331  -14.541 0.137   1.00 72.33 ? 14  GLY A H    2  
ATOM 7422   H HA2  . GLY A 1 14  ? 15.076  -13.653 2.544   1.00 35.45 ? 14  GLY A HA2  2  
ATOM 7423   H HA3  . GLY A 1 14  ? 16.409  -14.806 2.463   1.00 23.31 ? 14  GLY A HA3  2  
ATOM 7424   N N    . GLU A 1 15  ? 18.199  -12.697 2.093   1.00 51.24 ? 15  GLU A N    2  
ATOM 7425   C CA   . GLU A 1 15  ? 19.187  -11.680 2.548   1.00 71.32 ? 15  GLU A CA   2  
ATOM 7426   C C    . GLU A 1 15  ? 18.645  -10.275 2.265   1.00 23.24 ? 15  GLU A C    2  
ATOM 7427   O O    . GLU A 1 15  ? 18.726  -9.395  3.100   1.00 64.10 ? 15  GLU A O    2  
ATOM 7428   C CB   . GLU A 1 15  ? 20.524  -11.893 1.826   1.00 55.24 ? 15  GLU A CB   2  
ATOM 7429   C CG   . GLU A 1 15  ? 20.295  -12.081 0.326   1.00 2.34  ? 15  GLU A CG   2  
ATOM 7430   C CD   . GLU A 1 15  ? 21.640  -12.291 -0.371  1.00 31.14 ? 15  GLU A CD   2  
ATOM 7431   O OE1  . GLU A 1 15  ? 22.379  -11.327 -0.493  1.00 12.42 ? 15  GLU A OE1  2  
ATOM 7432   O OE2  . GLU A 1 15  ? 21.909  -13.411 -0.772  1.00 15.22 ? 15  GLU A OE2  2  
ATOM 7433   H H    . GLU A 1 15  ? 18.427  -13.314 1.369   1.00 43.41 ? 15  GLU A H    2  
ATOM 7434   H HA   . GLU A 1 15  ? 19.338  -11.791 3.612   1.00 52.34 ? 15  GLU A HA   2  
ATOM 7435   H HB2  . GLU A 1 15  ? 21.158  -11.033 1.984   1.00 61.44 ? 15  GLU A HB2  2  
ATOM 7436   H HB3  . GLU A 1 15  ? 21.007  -12.772 2.225   1.00 72.14 ? 15  GLU A HB3  2  
ATOM 7437   H HG2  . GLU A 1 15  ? 19.667  -12.941 0.160   1.00 72.34 ? 15  GLU A HG2  2  
ATOM 7438   H HG3  . GLU A 1 15  ? 19.819  -11.204 -0.076  1.00 64.34 ? 15  GLU A HG3  2  
ATOM 7439   N N    . ILE A 1 16  ? 18.075  -10.052 1.109   1.00 14.42 ? 16  ILE A N    2  
ATOM 7440   C CA   . ILE A 1 16  ? 17.518  -8.699  0.811   1.00 32.43 ? 16  ILE A CA   2  
ATOM 7441   C C    . ILE A 1 16  ? 16.349  -8.434  1.763   1.00 0.21  ? 16  ILE A C    2  
ATOM 7442   O O    . ILE A 1 16  ? 16.157  -7.333  2.238   1.00 33.53 ? 16  ILE A O    2  
ATOM 7443   C CB   . ILE A 1 16  ? 17.015  -8.646  -0.642  1.00 30.33 ? 16  ILE A CB   2  
ATOM 7444   C CG1  . ILE A 1 16  ? 18.205  -8.736  -1.627  1.00 45.13 ? 16  ILE A CG1  2  
ATOM 7445   C CG2  . ILE A 1 16  ? 16.232  -7.345  -0.874  1.00 23.13 ? 16  ILE A CG2  2  
ATOM 7446   C CD1  . ILE A 1 16  ? 18.835  -7.355  -1.871  1.00 63.23 ? 16  ILE A CD1  2  
ATOM 7447   H H    . ILE A 1 16  ? 18.003  -10.774 0.446   1.00 74.24 ? 16  ILE A H    2  
ATOM 7448   H HA   . ILE A 1 16  ? 18.280  -7.951  0.964   1.00 65.54 ? 16  ILE A HA   2  
ATOM 7449   H HB   . ILE A 1 16  ? 16.352  -9.484  -0.810  1.00 11.33 ? 16  ILE A HB   2  
ATOM 7450   H HG12 . ILE A 1 16  ? 18.955  -9.397  -1.224  1.00 45.54 ? 16  ILE A HG12 2  
ATOM 7451   H HG13 . ILE A 1 16  ? 17.855  -9.134  -2.568  1.00 41.52 ? 16  ILE A HG13 2  
ATOM 7452   H HG21 . ILE A 1 16  ? 15.277  -7.405  -0.375  1.00 40.40 ? 16  ILE A HG21 2  
ATOM 7453   H HG22 . ILE A 1 16  ? 16.076  -7.202  -1.933  1.00 2.41  ? 16  ILE A HG22 2  
ATOM 7454   H HG23 . ILE A 1 16  ? 16.793  -6.512  -0.477  1.00 44.12 ? 16  ILE A HG23 2  
ATOM 7455   H HD11 . ILE A 1 16  ? 18.233  -6.807  -2.582  1.00 34.52 ? 16  ILE A HD11 2  
ATOM 7456   H HD12 . ILE A 1 16  ? 19.831  -7.479  -2.268  1.00 42.23 ? 16  ILE A HD12 2  
ATOM 7457   H HD13 . ILE A 1 16  ? 18.883  -6.806  -0.944  1.00 20.43 ? 16  ILE A HD13 2  
ATOM 7458   N N    . GLU A 1 17  ? 15.563  -9.440  2.040   1.00 14.30 ? 17  GLU A N    2  
ATOM 7459   C CA   . GLU A 1 17  ? 14.404  -9.252  2.955   1.00 51.11 ? 17  GLU A CA   2  
ATOM 7460   C C    . GLU A 1 17  ? 14.906  -8.818  4.333   1.00 22.10 ? 17  GLU A C    2  
ATOM 7461   O O    . GLU A 1 17  ? 14.375  -7.910  4.937   1.00 0.24  ? 17  GLU A O    2  
ATOM 7462   C CB   . GLU A 1 17  ? 13.636  -10.574 3.077   1.00 22.03 ? 17  GLU A CB   2  
ATOM 7463   C CG   . GLU A 1 17  ? 12.309  -10.346 3.811   1.00 23.22 ? 17  GLU A CG   2  
ATOM 7464   C CD   . GLU A 1 17  ? 12.564  -10.169 5.311   1.00 4.12  ? 17  GLU A CD   2  
ATOM 7465   O OE1  . GLU A 1 17  ? 13.613  -10.587 5.771   1.00 22.03 ? 17  GLU A OE1  2  
ATOM 7466   O OE2  . GLU A 1 17  ? 11.701  -9.619  5.975   1.00 25.24 ? 17  GLU A OE2  2  
ATOM 7467   H H    . GLU A 1 17  ? 15.736  -10.319 1.642   1.00 3.12  ? 17  GLU A H    2  
ATOM 7468   H HA   . GLU A 1 17  ? 13.752  -8.491  2.554   1.00 44.10 ? 17  GLU A HA   2  
ATOM 7469   H HB2  . GLU A 1 17  ? 13.435  -10.961 2.089   1.00 63.40 ? 17  GLU A HB2  2  
ATOM 7470   H HB3  . GLU A 1 17  ? 14.232  -11.286 3.626   1.00 54.10 ? 17  GLU A HB3  2  
ATOM 7471   H HG2  . GLU A 1 17  ? 11.826  -9.462  3.422   1.00 22.53 ? 17  GLU A HG2  2  
ATOM 7472   H HG3  . GLU A 1 17  ? 11.666  -11.200 3.659   1.00 71.41 ? 17  GLU A HG3  2  
ATOM 7473   N N    . LYS A 1 18  ? 15.928  -9.460  4.838   1.00 1.35  ? 18  LYS A N    2  
ATOM 7474   C CA   . LYS A 1 18  ? 16.461  -9.081  6.181   1.00 70.42 ? 18  LYS A CA   2  
ATOM 7475   C C    . LYS A 1 18  ? 17.476  -7.956  6.030   1.00 64.53 ? 18  LYS A C    2  
ATOM 7476   O O    . LYS A 1 18  ? 18.018  -7.459  6.997   1.00 41.44 ? 18  LYS A O    2  
ATOM 7477   C CB   . LYS A 1 18  ? 17.129  -10.295 6.830   1.00 73.34 ? 18  LYS A CB   2  
ATOM 7478   C CG   . LYS A 1 18  ? 16.091  -11.401 7.029   1.00 53.23 ? 18  LYS A CG   2  
ATOM 7479   C CD   . LYS A 1 18  ? 16.727  -12.567 7.789   1.00 53.13 ? 18  LYS A CD   2  
ATOM 7480   C CE   . LYS A 1 18  ? 15.729  -13.723 7.877   1.00 4.44  ? 18  LYS A CE   2  
ATOM 7481   N NZ   . LYS A 1 18  ? 14.581  -13.324 8.740   1.00 1.10  ? 18  LYS A NZ   2  
ATOM 7482   H H    . LYS A 1 18  ? 16.344  -10.191 4.335   1.00 75.54 ? 18  LYS A H    2  
ATOM 7483   H HA   . LYS A 1 18  ? 15.655  -8.737  6.803   1.00 11.42 ? 18  LYS A HA   2  
ATOM 7484   H HB2  . LYS A 1 18  ? 17.922  -10.654 6.190   1.00 12.33 ? 18  LYS A HB2  2  
ATOM 7485   H HB3  . LYS A 1 18  ? 17.539  -10.011 7.787   1.00 72.55 ? 18  LYS A HB3  2  
ATOM 7486   H HG2  . LYS A 1 18  ? 15.257  -11.013 7.595   1.00 1.03  ? 18  LYS A HG2  2  
ATOM 7487   H HG3  . LYS A 1 18  ? 15.744  -11.747 6.067   1.00 64.21 ? 18  LYS A HG3  2  
ATOM 7488   H HD2  . LYS A 1 18  ? 17.614  -12.895 7.268   1.00 53.52 ? 18  LYS A HD2  2  
ATOM 7489   H HD3  . LYS A 1 18  ? 16.991  -12.246 8.785   1.00 43.30 ? 18  LYS A HD3  2  
ATOM 7490   H HE2  . LYS A 1 18  ? 15.368  -13.963 6.887   1.00 43.35 ? 18  LYS A HE2  2  
ATOM 7491   H HE3  . LYS A 1 18  ? 16.216  -14.588 8.302   1.00 74.41 ? 18  LYS A HE3  2  
ATOM 7492   H HZ1  . LYS A 1 18  ? 14.066  -14.173 9.047   1.00 42.41 ? 18  LYS A HZ1  2  
ATOM 7493   H HZ2  . LYS A 1 18  ? 13.941  -12.705 8.202   1.00 11.42 ? 18  LYS A HZ2  2  
ATOM 7494   H HZ3  . LYS A 1 18  ? 14.935  -12.816 9.575   1.00 32.32 ? 18  LYS A HZ3  2  
ATOM 7495   N N    . GLY A 1 19  ? 17.730  -7.543  4.826   1.00 2.13  ? 19  GLY A N    2  
ATOM 7496   C CA   . GLY A 1 19  ? 18.701  -6.441  4.605   1.00 62.15 ? 19  GLY A CA   2  
ATOM 7497   C C    . GLY A 1 19  ? 17.972  -5.103  4.726   1.00 22.13 ? 19  GLY A C    2  
ATOM 7498   O O    . GLY A 1 19  ? 18.272  -4.293  5.581   1.00 15.24 ? 19  GLY A O    2  
ATOM 7499   H H    . GLY A 1 19  ? 17.275  -7.954  4.061   1.00 54.31 ? 19  GLY A H    2  
ATOM 7500   H HA2  . GLY A 1 19  ? 19.494  -6.495  5.340   1.00 21.21 ? 19  GLY A HA2  2  
ATOM 7501   H HA3  . GLY A 1 19  ? 19.114  -6.533  3.621   1.00 15.13 ? 19  GLY A HA3  2  
ATOM 7502   N N    . LEU A 1 20  ? 17.008  -4.874  3.880   1.00 33.40 ? 20  LEU A N    2  
ATOM 7503   C CA   . LEU A 1 20  ? 16.243  -3.599  3.940   1.00 10.01 ? 20  LEU A CA   2  
ATOM 7504   C C    . LEU A 1 20  ? 15.525  -3.511  5.288   1.00 34.22 ? 20  LEU A C    2  
ATOM 7505   O O    . LEU A 1 20  ? 15.291  -2.439  5.809   1.00 20.10 ? 20  LEU A O    2  
ATOM 7506   C CB   . LEU A 1 20  ? 15.216  -3.580  2.801   1.00 73.51 ? 20  LEU A CB   2  
ATOM 7507   C CG   . LEU A 1 20  ? 14.189  -4.738  2.984   1.00 35.33 ? 20  LEU A CG   2  
ATOM 7508   C CD1  . LEU A 1 20  ? 12.872  -4.200  3.556   1.00 55.24 ? 20  LEU A CD1  2  
ATOM 7509   C CD2  . LEU A 1 20  ? 13.902  -5.417  1.633   1.00 24.13 ? 20  LEU A CD2  2  
ATOM 7510   H H    . LEU A 1 20  ? 16.781  -5.547  3.205   1.00 1.32  ? 20  LEU A H    2  
ATOM 7511   H HA   . LEU A 1 20  ? 16.918  -2.761  3.833   1.00 20.14 ? 20  LEU A HA   2  
ATOM 7512   H HB2  . LEU A 1 20  ? 14.707  -2.625  2.800   1.00 65.10 ? 20  LEU A HB2  2  
ATOM 7513   H HB3  . LEU A 1 20  ? 15.740  -3.699  1.863   1.00 74.42 ? 20  LEU A HB3  2  
ATOM 7514   H HG   . LEU A 1 20  ? 14.587  -5.474  3.671   1.00 71.41 ? 20  LEU A HG   2  
ATOM 7515   H HD11 . LEU A 1 20  ? 12.139  -4.994  3.578   1.00 42.20 ? 20  LEU A HD11 2  
ATOM 7516   H HD12 . LEU A 1 20  ? 12.509  -3.394  2.935   1.00 25.23 ? 20  LEU A HD12 2  
ATOM 7517   H HD13 . LEU A 1 20  ? 13.038  -3.837  4.559   1.00 2.35  ? 20  LEU A HD13 2  
ATOM 7518   H HD21 . LEU A 1 20  ? 14.832  -5.703  1.165   1.00 62.11 ? 20  LEU A HD21 2  
ATOM 7519   H HD22 . LEU A 1 20  ? 13.371  -4.732  0.989   1.00 21.10 ? 20  LEU A HD22 2  
ATOM 7520   H HD23 . LEU A 1 20  ? 13.299  -6.298  1.795   1.00 61.40 ? 20  LEU A HD23 2  
ATOM 7521   N N    . ASN A 1 21  ? 15.180  -4.634  5.862   1.00 3.33  ? 21  ASN A N    2  
ATOM 7522   C CA   . ASN A 1 21  ? 14.486  -4.612  7.180   1.00 20.45 ? 21  ASN A CA   2  
ATOM 7523   C C    . ASN A 1 21  ? 15.289  -3.746  8.151   1.00 64.41 ? 21  ASN A C    2  
ATOM 7524   O O    . ASN A 1 21  ? 14.736  -3.040  8.971   1.00 51.00 ? 21  ASN A O    2  
ATOM 7525   C CB   . ASN A 1 21  ? 14.379  -6.038  7.730   1.00 74.25 ? 21  ASN A CB   2  
ATOM 7526   C CG   . ASN A 1 21  ? 13.254  -6.785  7.012   1.00 22.12 ? 21  ASN A CG   2  
ATOM 7527   O OD1  . ASN A 1 21  ? 12.452  -6.184  6.324   1.00 51.31 ? 21  ASN A OD1  2  
ATOM 7528   N ND2  . ASN A 1 21  ? 13.158  -8.079  7.144   1.00 33.11 ? 21  ASN A ND2  2  
ATOM 7529   H H    . ASN A 1 21  ? 15.383  -5.489  5.428   1.00 23.23 ? 21  ASN A H    2  
ATOM 7530   H HA   . ASN A 1 21  ? 13.497  -4.196  7.059   1.00 24.01 ? 21  ASN A HA   2  
ATOM 7531   H HB2  . ASN A 1 21  ? 15.313  -6.554  7.568   1.00 43.04 ? 21  ASN A HB2  2  
ATOM 7532   H HB3  . ASN A 1 21  ? 14.166  -6.003  8.788   1.00 70.44 ? 21  ASN A HB3  2  
ATOM 7533   H HD21 . ASN A 1 21  ? 13.804  -8.564  7.700   1.00 31.11 ? 21  ASN A HD21 2  
ATOM 7534   H HD22 . ASN A 1 21  ? 12.441  -8.567  6.689   1.00 23.31 ? 21  ASN A HD22 2  
ATOM 7535   N N    . VAL A 1 22  ? 16.590  -3.787  8.059   1.00 23.44 ? 22  VAL A N    2  
ATOM 7536   C CA   . VAL A 1 22  ? 17.423  -2.957  8.971   1.00 10.23 ? 22  VAL A CA   2  
ATOM 7537   C C    . VAL A 1 22  ? 16.957  -1.505  8.871   1.00 45.40 ? 22  VAL A C    2  
ATOM 7538   O O    . VAL A 1 22  ? 16.969  -0.767  9.836   1.00 33.43 ? 22  VAL A O    2  
ATOM 7539   C CB   . VAL A 1 22  ? 18.892  -3.054  8.556   1.00 41.11 ? 22  VAL A CB   2  
ATOM 7540   C CG1  . VAL A 1 22  ? 19.735  -2.131  9.437   1.00 70.04 ? 22  VAL A CG1  2  
ATOM 7541   C CG2  . VAL A 1 22  ? 19.374  -4.497  8.723   1.00 12.42 ? 22  VAL A CG2  2  
ATOM 7542   H H    . VAL A 1 22  ? 17.018  -4.357  7.387   1.00 64.11 ? 22  VAL A H    2  
ATOM 7543   H HA   . VAL A 1 22  ? 17.307  -3.306  9.987   1.00 24.52 ? 22  VAL A HA   2  
ATOM 7544   H HB   . VAL A 1 22  ? 18.993  -2.756  7.522   1.00 42.15 ? 22  VAL A HB   2  
ATOM 7545   H HG11 . VAL A 1 22  ? 19.494  -2.305  10.475  1.00 45.52 ? 22  VAL A HG11 2  
ATOM 7546   H HG12 . VAL A 1 22  ? 19.523  -1.102  9.186   1.00 24.54 ? 22  VAL A HG12 2  
ATOM 7547   H HG13 . VAL A 1 22  ? 20.783  -2.334  9.271   1.00 54.44 ? 22  VAL A HG13 2  
ATOM 7548   H HG21 . VAL A 1 22  ? 20.352  -4.604  8.279   1.00 72.11 ? 22  VAL A HG21 2  
ATOM 7549   H HG22 . VAL A 1 22  ? 18.682  -5.167  8.234   1.00 64.21 ? 22  VAL A HG22 2  
ATOM 7550   H HG23 . VAL A 1 22  ? 19.427  -4.739  9.774   1.00 71.14 ? 22  VAL A HG23 2  
ATOM 7551   N N    . LYS A 1 23  ? 16.536  -1.096  7.706   1.00 34.31 ? 23  LYS A N    2  
ATOM 7552   C CA   . LYS A 1 23  ? 16.056  0.301   7.530   1.00 1.14  ? 23  LYS A CA   2  
ATOM 7553   C C    . LYS A 1 23  ? 14.635  0.402   8.076   1.00 51.00 ? 23  LYS A C    2  
ATOM 7554   O O    . LYS A 1 23  ? 14.050  1.464   8.147   1.00 22.44 ? 23  LYS A O    2  
ATOM 7555   C CB   . LYS A 1 23  ? 16.081  0.657   6.039   1.00 73.23 ? 23  LYS A CB   2  
ATOM 7556   C CG   . LYS A 1 23  ? 17.373  0.128   5.397   1.00 5.04  ? 23  LYS A CG   2  
ATOM 7557   C CD   . LYS A 1 23  ? 18.586  0.496   6.267   1.00 23.14 ? 23  LYS A CD   2  
ATOM 7558   C CE   . LYS A 1 23  ? 19.865  0.481   5.423   1.00 44.42 ? 23  LYS A CE   2  
ATOM 7559   N NZ   . LYS A 1 23  ? 20.133  -0.907  4.953   1.00 1.14  ? 23  LYS A NZ   2  
ATOM 7560   H H    . LYS A 1 23  ? 16.530  -1.714  6.945   1.00 24.13 ? 23  LYS A H    2  
ATOM 7561   H HA   . LYS A 1 23  ? 16.696  0.975   8.078   1.00 52.42 ? 23  LYS A HA   2  
ATOM 7562   H HB2  . LYS A 1 23  ? 15.229  0.210   5.548   1.00 0.21  ? 23  LYS A HB2  2  
ATOM 7563   H HB3  . LYS A 1 23  ? 16.039  1.729   5.924   1.00 1.43  ? 23  LYS A HB3  2  
ATOM 7564   H HG2  . LYS A 1 23  ? 17.310  -0.948  5.305   1.00 11.13 ? 23  LYS A HG2  2  
ATOM 7565   H HG3  . LYS A 1 23  ? 17.485  0.564   4.416   1.00 44.14 ? 23  LYS A HG3  2  
ATOM 7566   H HD2  . LYS A 1 23  ? 18.443  1.479   6.685   1.00 63.22 ? 23  LYS A HD2  2  
ATOM 7567   H HD3  . LYS A 1 23  ? 18.682  -0.221  7.068   1.00 41.31 ? 23  LYS A HD3  2  
ATOM 7568   H HE2  . LYS A 1 23  ? 19.745  1.133   4.571   1.00 20.33 ? 23  LYS A HE2  2  
ATOM 7569   H HE3  . LYS A 1 23  ? 20.695  0.823   6.023   1.00 12.23 ? 23  LYS A HE3  2  
ATOM 7570   H HZ1  . LYS A 1 23  ? 19.233  -1.376  4.724   1.00 64.31 ? 23  LYS A HZ1  2  
ATOM 7571   H HZ2  . LYS A 1 23  ? 20.621  -1.439  5.703   1.00 35.22 ? 23  LYS A HZ2  2  
ATOM 7572   H HZ3  . LYS A 1 23  ? 20.731  -0.877  4.103   1.00 54.43 ? 23  LYS A HZ3  2  
ATOM 7573   N N    . GLY A 1 24  ? 14.093  -0.707  8.479   1.00 42.42 ? 24  GLY A N    2  
ATOM 7574   C CA   . GLY A 1 24  ? 12.714  -0.716  9.050   1.00 31.41 ? 24  GLY A CA   2  
ATOM 7575   C C    . GLY A 1 24  ? 11.667  -0.680  7.933   1.00 10.20 ? 24  GLY A C    2  
ATOM 7576   O O    . GLY A 1 24  ? 10.701  0.054   8.010   1.00 75.54 ? 24  GLY A O    2  
ATOM 7577   H H    . GLY A 1 24  ? 14.606  -1.539  8.417   1.00 42.23 ? 24  GLY A H    2  
ATOM 7578   H HA2  . GLY A 1 24  ? 12.579  -1.612  9.638   1.00 33.31 ? 24  GLY A HA2  2  
ATOM 7579   H HA3  . GLY A 1 24  ? 12.586  0.149   9.683   1.00 24.23 ? 24  GLY A HA3  2  
ATOM 7580   N N    . PHE A 1 25  ? 11.841  -1.472  6.899   1.00 73.43 ? 25  PHE A N    2  
ATOM 7581   C CA   . PHE A 1 25  ? 10.848  -1.497  5.774   1.00 73.42 ? 25  PHE A CA   2  
ATOM 7582   C C    . PHE A 1 25  ? 10.257  -2.906  5.661   1.00 71.33 ? 25  PHE A C    2  
ATOM 7583   O O    . PHE A 1 25  ? 10.832  -3.868  6.131   1.00 11.43 ? 25  PHE A O    2  
ATOM 7584   C CB   . PHE A 1 25  ? 11.553  -1.120  4.461   1.00 21.03 ? 25  PHE A CB   2  
ATOM 7585   C CG   . PHE A 1 25  ? 11.674  0.388   4.360   1.00 23.20 ? 25  PHE A CG   2  
ATOM 7586   C CD1  . PHE A 1 25  ? 12.462  1.088   5.281   1.00 61.32 ? 25  PHE A CD1  2  
ATOM 7587   C CD2  . PHE A 1 25  ? 10.996  1.084   3.350   1.00 62.51 ? 25  PHE A CD2  2  
ATOM 7588   C CE1  . PHE A 1 25  ? 12.573  2.480   5.193   1.00 22.52 ? 25  PHE A CE1  2  
ATOM 7589   C CE2  . PHE A 1 25  ? 11.108  2.476   3.263   1.00 1.44  ? 25  PHE A CE2  2  
ATOM 7590   C CZ   . PHE A 1 25  ? 11.897  3.174   4.184   1.00 35.11 ? 25  PHE A CZ   2  
ATOM 7591   H H    . PHE A 1 25  ? 12.627  -2.061  6.864   1.00 54.31 ? 25  PHE A H    2  
ATOM 7592   H HA   . PHE A 1 25  ? 10.045  -0.797  5.966   1.00 50.24 ? 25  PHE A HA   2  
ATOM 7593   H HB2  . PHE A 1 25  ? 12.540  -1.558  4.448   1.00 74.51 ? 25  PHE A HB2  2  
ATOM 7594   H HB3  . PHE A 1 25  ? 10.984  -1.493  3.622   1.00 34.12 ? 25  PHE A HB3  2  
ATOM 7595   H HD1  . PHE A 1 25  ? 12.983  0.554   6.059   1.00 62.22 ? 25  PHE A HD1  2  
ATOM 7596   H HD2  . PHE A 1 25  ? 10.387  0.546   2.638   1.00 70.35 ? 25  PHE A HD2  2  
ATOM 7597   H HE1  . PHE A 1 25  ? 13.182  3.019   5.904   1.00 4.30  ? 25  PHE A HE1  2  
ATOM 7598   H HE2  . PHE A 1 25  ? 10.586  3.012   2.485   1.00 11.12 ? 25  PHE A HE2  2  
ATOM 7599   H HZ   . PHE A 1 25  ? 11.983  4.249   4.116   1.00 21.13 ? 25  PHE A HZ   2  
ATOM 7600   N N    . MET A 1 26  ? 9.112   -3.034  5.037   1.00 33.24 ? 26  MET A N    2  
ATOM 7601   C CA   . MET A 1 26  ? 8.470   -4.373  4.881   1.00 43.24 ? 26  MET A CA   2  
ATOM 7602   C C    . MET A 1 26  ? 8.684   -4.849  3.450   1.00 13.50 ? 26  MET A C    2  
ATOM 7603   O O    . MET A 1 26  ? 8.592   -4.079  2.514   1.00 34.21 ? 26  MET A O    2  
ATOM 7604   C CB   . MET A 1 26  ? 6.969   -4.254  5.157   1.00 40.23 ? 26  MET A CB   2  
ATOM 7605   C CG   . MET A 1 26  ? 6.749   -3.620  6.532   1.00 32.23 ? 26  MET A CG   2  
ATOM 7606   S SD   . MET A 1 26  ? 7.472   -4.679  7.810   1.00 35.35 ? 26  MET A SD   2  
ATOM 7607   C CE   . MET A 1 26  ? 7.827   -3.374  9.013   1.00 4.12  ? 26  MET A CE   2  
ATOM 7608   H H    . MET A 1 26  ? 8.673   -2.245  4.660   1.00 62.55 ? 26  MET A H    2  
ATOM 7609   H HA   . MET A 1 26  ? 8.909   -5.083  5.569   1.00 24.50 ? 26  MET A HA   2  
ATOM 7610   H HB2  . MET A 1 26  ? 6.511   -3.637  4.397   1.00 31.44 ? 26  MET A HB2  2  
ATOM 7611   H HB3  . MET A 1 26  ? 6.521   -5.237  5.141   1.00 14.11 ? 26  MET A HB3  2  
ATOM 7612   H HG2  . MET A 1 26  ? 7.221   -2.649  6.560   1.00 33.53 ? 26  MET A HG2  2  
ATOM 7613   H HG3  . MET A 1 26  ? 5.690   -3.511  6.713   1.00 0.43  ? 26  MET A HG3  2  
ATOM 7614   H HE1  . MET A 1 26  ? 6.969   -2.722  9.099   1.00 64.32 ? 26  MET A HE1  2  
ATOM 7615   H HE2  . MET A 1 26  ? 8.679   -2.801  8.683   1.00 43.32 ? 26  MET A HE2  2  
ATOM 7616   H HE3  . MET A 1 26  ? 8.045   -3.821  9.973   1.00 33.23 ? 26  MET A HE3  2  
ATOM 7617   N N    . ALA A 1 27  ? 8.977   -6.108  3.266   1.00 62.11 ? 27  ALA A N    2  
ATOM 7618   C CA   . ALA A 1 27  ? 9.207   -6.626  1.885   1.00 53.12 ? 27  ALA A CA   2  
ATOM 7619   C C    . ALA A 1 27  ? 8.661   -8.050  1.767   1.00 13.21 ? 27  ALA A C    2  
ATOM 7620   O O    . ALA A 1 27  ? 8.466   -8.734  2.752   1.00 11.01 ? 27  ALA A O    2  
ATOM 7621   C CB   . ALA A 1 27  ? 10.709  -6.635  1.599   1.00 12.45 ? 27  ALA A CB   2  
ATOM 7622   H H    . ALA A 1 27  ? 9.053   -6.711  4.034   1.00 74.31 ? 27  ALA A H    2  
ATOM 7623   H HA   . ALA A 1 27  ? 8.709   -5.988  1.168   1.00 64.53 ? 27  ALA A HA   2  
ATOM 7624   H HB1  . ALA A 1 27  ? 11.218  -7.192  2.372   1.00 54.42 ? 27  ALA A HB1  2  
ATOM 7625   H HB2  . ALA A 1 27  ? 11.077  -5.621  1.583   1.00 45.45 ? 27  ALA A HB2  2  
ATOM 7626   H HB3  . ALA A 1 27  ? 10.890  -7.100  0.641   1.00 30.24 ? 27  ALA A HB3  2  
ATOM 7627   N N    . ASP A 1 28  ? 8.422   -8.501  0.562   1.00 3.02  ? 28  ASP A N    2  
ATOM 7628   C CA   . ASP A 1 28  ? 7.895   -9.886  0.350   1.00 74.42 ? 28  ASP A CA   2  
ATOM 7629   C C    . ASP A 1 28  ? 8.659   -10.537 -0.804  1.00 31.22 ? 28  ASP A C    2  
ATOM 7630   O O    . ASP A 1 28  ? 9.109   -9.868  -1.712  1.00 62.21 ? 28  ASP A O    2  
ATOM 7631   C CB   . ASP A 1 28  ? 6.407   -9.818  -0.003  1.00 71.44 ? 28  ASP A CB   2  
ATOM 7632   C CG   . ASP A 1 28  ? 5.605   -9.400  1.231   1.00 61.35 ? 28  ASP A CG   2  
ATOM 7633   O OD1  . ASP A 1 28  ? 6.205   -9.255  2.283   1.00 4.40  ? 28  ASP A OD1  2  
ATOM 7634   O OD2  . ASP A 1 28  ? 4.404   -9.232  1.102   1.00 34.32 ? 28  ASP A OD2  2  
ATOM 7635   H H    . ASP A 1 28  ? 8.596   -7.926  -0.213  1.00 0.02  ? 28  ASP A H    2  
ATOM 7636   H HA   . ASP A 1 28  ? 8.028   -10.477 1.246   1.00 75.40 ? 28  ASP A HA   2  
ATOM 7637   H HB2  . ASP A 1 28  ? 6.257   -9.095  -0.792  1.00 74.24 ? 28  ASP A HB2  2  
ATOM 7638   H HB3  . ASP A 1 28  ? 6.072   -10.789 -0.335  1.00 74.41 ? 28  ASP A HB3  2  
ATOM 7639   N N    . VAL A 1 29  ? 8.808   -11.839 -0.774  1.00 64.21 ? 29  VAL A N    2  
ATOM 7640   C CA   . VAL A 1 29  ? 9.542   -12.555 -1.861  1.00 23.20 ? 29  VAL A CA   2  
ATOM 7641   C C    . VAL A 1 29  ? 8.539   -13.381 -2.671  1.00 52.41 ? 29  VAL A C    2  
ATOM 7642   O O    . VAL A 1 29  ? 7.700   -14.067 -2.119  1.00 2.10  ? 29  VAL A O    2  
ATOM 7643   C CB   . VAL A 1 29  ? 10.599  -13.480 -1.228  1.00 42.24 ? 29  VAL A CB   2  
ATOM 7644   C CG1  . VAL A 1 29  ? 11.911  -12.716 -1.021  1.00 72.15 ? 29  VAL A CG1  2  
ATOM 7645   C CG2  . VAL A 1 29  ? 10.093  -13.975 0.129   1.00 64.35 ? 29  VAL A CG2  2  
ATOM 7646   H H    . VAL A 1 29  ? 8.433   -12.354 -0.032  1.00 75.13 ? 29  VAL A H    2  
ATOM 7647   H HA   . VAL A 1 29  ? 10.026  -11.846 -2.517  1.00 63.42 ? 29  VAL A HA   2  
ATOM 7648   H HB   . VAL A 1 29  ? 10.778  -14.326 -1.874  1.00 35.51 ? 29  VAL A HB   2  
ATOM 7649   H HG11 . VAL A 1 29  ? 12.607  -13.337 -0.477  1.00 35.52 ? 29  VAL A HG11 2  
ATOM 7650   H HG12 . VAL A 1 29  ? 11.718  -11.814 -0.458  1.00 2.32  ? 29  VAL A HG12 2  
ATOM 7651   H HG13 . VAL A 1 29  ? 12.332  -12.457 -1.981  1.00 53.54 ? 29  VAL A HG13 2  
ATOM 7652   H HG21 . VAL A 1 29  ? 10.062  -13.146 0.822   1.00 44.31 ? 29  VAL A HG21 2  
ATOM 7653   H HG22 . VAL A 1 29  ? 10.759  -14.736 0.506   1.00 31.05 ? 29  VAL A HG22 2  
ATOM 7654   H HG23 . VAL A 1 29  ? 9.101   -14.386 0.015   1.00 34.32 ? 29  VAL A HG23 2  
ATOM 7655   N N    . THR A 1 30  ? 8.618   -13.316 -3.977  1.00 3.44  ? 30  THR A N    2  
ATOM 7656   C CA   . THR A 1 30  ? 7.671   -14.090 -4.840  1.00 44.22 ? 30  THR A CA   2  
ATOM 7657   C C    . THR A 1 30  ? 8.452   -14.778 -5.963  1.00 15.33 ? 30  THR A C    2  
ATOM 7658   O O    . THR A 1 30  ? 9.611   -14.495 -6.190  1.00 42.54 ? 30  THR A O    2  
ATOM 7659   C CB   . THR A 1 30  ? 6.644   -13.133 -5.450  1.00 71.42 ? 30  THR A CB   2  
ATOM 7660   O OG1  . THR A 1 30  ? 7.239   -12.433 -6.534  1.00 11.22 ? 30  THR A OG1  2  
ATOM 7661   C CG2  . THR A 1 30  ? 6.180   -12.135 -4.388  1.00 11.43 ? 30  THR A CG2  2  
ATOM 7662   H H    . THR A 1 30  ? 9.303   -12.752 -4.393  1.00 33.45 ? 30  THR A H    2  
ATOM 7663   H HA   . THR A 1 30  ? 7.159   -14.838 -4.250  1.00 54.15 ? 30  THR A HA   2  
ATOM 7664   H HB   . THR A 1 30  ? 5.795   -13.695 -5.806  1.00 2.32  ? 30  THR A HB   2  
ATOM 7665   H HG1  . THR A 1 30  ? 6.539   -12.165 -7.134  1.00 64.32 ? 30  THR A HG1  2  
ATOM 7666   H HG21 . THR A 1 30  ? 5.396   -11.514 -4.797  1.00 4.51  ? 30  THR A HG21 2  
ATOM 7667   H HG22 . THR A 1 30  ? 7.012   -11.515 -4.089  1.00 25.23 ? 30  THR A HG22 2  
ATOM 7668   H HG23 . THR A 1 30  ? 5.803   -12.672 -3.530  1.00 32.25 ? 30  THR A HG23 2  
ATOM 7669   N N    . GLU A 1 31  ? 7.824   -15.683 -6.669  1.00 14.33 ? 31  GLU A N    2  
ATOM 7670   C CA   . GLU A 1 31  ? 8.525   -16.396 -7.782  1.00 0.14  ? 31  GLU A CA   2  
ATOM 7671   C C    . GLU A 1 31  ? 8.271   -15.662 -9.104  1.00 12.42 ? 31  GLU A C    2  
ATOM 7672   O O    . GLU A 1 31  ? 8.820   -14.609 -9.355  1.00 12.40 ? 31  GLU A O    2  
ATOM 7673   C CB   . GLU A 1 31  ? 7.995   -17.834 -7.875  1.00 30.15 ? 31  GLU A CB   2  
ATOM 7674   C CG   . GLU A 1 31  ? 6.488   -17.844 -7.611  1.00 14.13 ? 31  GLU A CG   2  
ATOM 7675   C CD   . GLU A 1 31  ? 5.927   -19.236 -7.906  1.00 53.32 ? 31  GLU A CD   2  
ATOM 7676   O OE1  . GLU A 1 31  ? 6.677   -20.064 -8.395  1.00 42.24 ? 31  GLU A OE1  2  
ATOM 7677   O OE2  . GLU A 1 31  ? 4.756   -19.450 -7.639  1.00 72.33 ? 31  GLU A OE2  2  
ATOM 7678   H H    . GLU A 1 31  ? 6.888   -15.895 -6.468  1.00 33.13 ? 31  GLU A H    2  
ATOM 7679   H HA   . GLU A 1 31  ? 9.588   -16.421 -7.586  1.00 73.11 ? 31  GLU A HA   2  
ATOM 7680   H HB2  . GLU A 1 31  ? 8.192   -18.232 -8.861  1.00 41.31 ? 31  GLU A HB2  2  
ATOM 7681   H HB3  . GLU A 1 31  ? 8.490   -18.446 -7.137  1.00 5.04  ? 31  GLU A HB3  2  
ATOM 7682   H HG2  . GLU A 1 31  ? 6.303   -17.594 -6.576  1.00 30.21 ? 31  GLU A HG2  2  
ATOM 7683   H HG3  . GLU A 1 31  ? 6.005   -17.120 -8.248  1.00 1.53  ? 31  GLU A HG3  2  
ATOM 7684   N N    . SER A 1 32  ? 7.448   -16.214 -9.955  1.00 24.24 ? 32  SER A N    2  
ATOM 7685   C CA   . SER A 1 32  ? 7.166   -15.551 -11.262 1.00 34.44 ? 32  SER A CA   2  
ATOM 7686   C C    . SER A 1 32  ? 6.146   -14.428 -11.067 1.00 74.24 ? 32  SER A C    2  
ATOM 7687   O O    . SER A 1 32  ? 5.525   -14.307 -10.030 1.00 30.34 ? 32  SER A O    2  
ATOM 7688   C CB   . SER A 1 32  ? 6.605   -16.582 -12.243 1.00 61.35 ? 32  SER A CB   2  
ATOM 7689   O OG   . SER A 1 32  ? 5.238   -16.825 -11.937 1.00 32.10 ? 32  SER A OG   2  
ATOM 7690   H H    . SER A 1 32  ? 7.019   -17.067 -9.737  1.00 33.13 ? 32  SER A H    2  
ATOM 7691   H HA   . SER A 1 32  ? 8.080   -15.135 -11.664 1.00 51.14 ? 32  SER A HA   2  
ATOM 7692   H HB2  . SER A 1 32  ? 6.682   -16.204 -13.248 1.00 0.34  ? 32  SER A HB2  2  
ATOM 7693   H HB3  . SER A 1 32  ? 7.172   -17.500 -12.161 1.00 70.44 ? 32  SER A HB3  2  
ATOM 7694   H HG   . SER A 1 32  ? 5.202   -17.504 -11.259 1.00 55.21 ? 32  SER A HG   2  
ATOM 7695   N N    . LEU A 1 33  ? 5.974   -13.604 -12.064 1.00 11.55 ? 33  LEU A N    2  
ATOM 7696   C CA   . LEU A 1 33  ? 5.003   -12.479 -11.957 1.00 53.02 ? 33  LEU A CA   2  
ATOM 7697   C C    . LEU A 1 33  ? 3.628   -13.018 -11.551 1.00 61.34 ? 33  LEU A C    2  
ATOM 7698   O O    . LEU A 1 33  ? 2.852   -12.339 -10.910 1.00 41.35 ? 33  LEU A O    2  
ATOM 7699   C CB   . LEU A 1 33  ? 4.885   -11.784 -13.317 1.00 41.15 ? 33  LEU A CB   2  
ATOM 7700   C CG   . LEU A 1 33  ? 6.263   -11.287 -13.784 1.00 61.12 ? 33  LEU A CG   2  
ATOM 7701   C CD1  . LEU A 1 33  ? 6.234   -11.043 -15.295 1.00 54.41 ? 33  LEU A CD1  2  
ATOM 7702   C CD2  . LEU A 1 33  ? 6.621   -9.975  -13.075 1.00 71.53 ? 33  LEU A CD2  2  
ATOM 7703   H H    . LEU A 1 33  ? 6.490   -13.724 -12.889 1.00 2.01  ? 33  LEU A H    2  
ATOM 7704   H HA   . LEU A 1 33  ? 5.345   -11.774 -11.217 1.00 13.13 ? 33  LEU A HA   2  
ATOM 7705   H HB2  . LEU A 1 33  ? 4.496   -12.490 -14.036 1.00 23.54 ? 33  LEU A HB2  2  
ATOM 7706   H HB3  . LEU A 1 33  ? 4.206   -10.947 -13.234 1.00 44.23 ? 33  LEU A HB3  2  
ATOM 7707   H HG   . LEU A 1 33  ? 7.011   -12.034 -13.558 1.00 15.21 ? 33  LEU A HG   2  
ATOM 7708   H HD11 . LEU A 1 33  ? 7.137   -10.531 -15.594 1.00 63.12 ? 33  LEU A HD11 2  
ATOM 7709   H HD12 . LEU A 1 33  ? 5.376   -10.437 -15.545 1.00 70.03 ? 33  LEU A HD12 2  
ATOM 7710   H HD13 . LEU A 1 33  ? 6.169   -11.989 -15.811 1.00 24.42 ? 33  LEU A HD13 2  
ATOM 7711   H HD21 . LEU A 1 33  ? 7.511   -9.558  -13.522 1.00 15.05 ? 33  LEU A HD21 2  
ATOM 7712   H HD22 . LEU A 1 33  ? 6.803   -10.166 -12.029 1.00 65.32 ? 33  LEU A HD22 2  
ATOM 7713   H HD23 . LEU A 1 33  ? 5.808   -9.273  -13.177 1.00 64.14 ? 33  LEU A HD23 2  
ATOM 7714   N N    . GLU A 1 34  ? 3.314   -14.227 -11.927 1.00 44.01 ? 34  GLU A N    2  
ATOM 7715   C CA   . GLU A 1 34  ? 1.983   -14.793 -11.568 1.00 61.03 ? 34  GLU A CA   2  
ATOM 7716   C C    . GLU A 1 34  ? 1.778   -14.724 -10.053 1.00 72.14 ? 34  GLU A C    2  
ATOM 7717   O O    . GLU A 1 34  ? 0.748   -14.290 -9.577  1.00 74.23 ? 34  GLU A O    2  
ATOM 7718   C CB   . GLU A 1 34  ? 1.909   -16.252 -12.021 1.00 72.20 ? 34  GLU A CB   2  
ATOM 7719   C CG   . GLU A 1 34  ? 2.036   -16.323 -13.545 1.00 3.25  ? 34  GLU A CG   2  
ATOM 7720   C CD   . GLU A 1 34  ? 0.811   -15.676 -14.193 1.00 4.44  ? 34  GLU A CD   2  
ATOM 7721   O OE1  . GLU A 1 34  ? -0.177  -15.500 -13.499 1.00 11.41 ? 34  GLU A OE1  2  
ATOM 7722   O OE2  . GLU A 1 34  ? 0.882   -15.367 -15.371 1.00 2.23  ? 34  GLU A OE2  2  
ATOM 7723   H H    . GLU A 1 34  ? 3.949   -14.758 -12.451 1.00 25.00 ? 34  GLU A H    2  
ATOM 7724   H HA   . GLU A 1 34  ? 1.207   -14.225 -12.060 1.00 22.12 ? 34  GLU A HA   2  
ATOM 7725   H HB2  . GLU A 1 34  ? 2.713   -16.811 -11.565 1.00 63.22 ? 34  GLU A HB2  2  
ATOM 7726   H HB3  . GLU A 1 34  ? 0.962   -16.673 -11.721 1.00 72.21 ? 34  GLU A HB3  2  
ATOM 7727   H HG2  . GLU A 1 34  ? 2.929   -15.799 -13.856 1.00 14.21 ? 34  GLU A HG2  2  
ATOM 7728   H HG3  . GLU A 1 34  ? 2.100   -17.356 -13.853 1.00 52.22 ? 34  GLU A HG3  2  
ATOM 7729   N N    . ASP A 1 35  ? 2.747   -15.149 -9.289  1.00 4.44  ? 35  ASP A N    2  
ATOM 7730   C CA   . ASP A 1 35  ? 2.595   -15.106 -7.807  1.00 42.44 ? 35  ASP A CA   2  
ATOM 7731   C C    . ASP A 1 35  ? 2.611   -13.652 -7.332  1.00 12.02 ? 35  ASP A C    2  
ATOM 7732   O O    . ASP A 1 35  ? 1.810   -13.248 -6.512  1.00 44.05 ? 35  ASP A O    2  
ATOM 7733   C CB   . ASP A 1 35  ? 3.747   -15.871 -7.152  1.00 22.43 ? 35  ASP A CB   2  
ATOM 7734   C CG   . ASP A 1 35  ? 3.525   -15.931 -5.639  1.00 43.13 ? 35  ASP A CG   2  
ATOM 7735   O OD1  . ASP A 1 35  ? 2.824   -16.827 -5.199  1.00 54.03 ? 35  ASP A OD1  2  
ATOM 7736   O OD2  . ASP A 1 35  ? 4.060   -15.080 -4.948  1.00 43.42 ? 35  ASP A OD2  2  
ATOM 7737   H H    . ASP A 1 35  ? 3.571   -15.498 -9.689  1.00 13.11 ? 35  ASP A H    2  
ATOM 7738   H HA   . ASP A 1 35  ? 1.657   -15.564 -7.529  1.00 54.04 ? 35  ASP A HA   2  
ATOM 7739   H HB2  . ASP A 1 35  ? 3.784   -16.874 -7.551  1.00 51.41 ? 35  ASP A HB2  2  
ATOM 7740   H HB3  . ASP A 1 35  ? 4.678   -15.366 -7.358  1.00 71.01 ? 35  ASP A HB3  2  
ATOM 7741   N N    . GLY A 1 36  ? 3.516   -12.863 -7.839  1.00 32.42 ? 36  GLY A N    2  
ATOM 7742   C CA   . GLY A 1 36  ? 3.582   -11.436 -7.415  1.00 4.34  ? 36  GLY A CA   2  
ATOM 7743   C C    . GLY A 1 36  ? 2.351   -10.690 -7.932  1.00 54.21 ? 36  GLY A C    2  
ATOM 7744   O O    . GLY A 1 36  ? 1.779   -9.869  -7.243  1.00 61.41 ? 36  GLY A O    2  
ATOM 7745   H H    . GLY A 1 36  ? 4.153   -13.208 -8.498  1.00 52.31 ? 36  GLY A H    2  
ATOM 7746   H HA2  . GLY A 1 36  ? 3.611   -11.383 -6.336  1.00 51.24 ? 36  GLY A HA2  2  
ATOM 7747   H HA3  . GLY A 1 36  ? 4.472   -10.980 -7.822  1.00 31.10 ? 36  GLY A HA3  2  
ATOM 7748   N N    . GLU A 1 37  ? 1.942   -10.964 -9.141  1.00 32.30 ? 37  GLU A N    2  
ATOM 7749   C CA   . GLU A 1 37  ? 0.751   -10.266 -9.703  1.00 22.33 ? 37  GLU A CA   2  
ATOM 7750   C C    . GLU A 1 37  ? -0.502  -10.668 -8.921  1.00 53.21 ? 37  GLU A C    2  
ATOM 7751   O O    . GLU A 1 37  ? -1.313  -9.839  -8.563  1.00 24.44 ? 37  GLU A O    2  
ATOM 7752   C CB   . GLU A 1 37  ? 0.580   -10.656 -11.173 1.00 5.42  ? 37  GLU A CB   2  
ATOM 7753   C CG   . GLU A 1 37  ? -0.497  -9.777  -11.813 1.00 73.41 ? 37  GLU A CG   2  
ATOM 7754   C CD   . GLU A 1 37  ? -0.777  -10.266 -13.235 1.00 13.51 ? 37  GLU A CD   2  
ATOM 7755   O OE1  . GLU A 1 37  ? -0.188  -11.260 -13.626 1.00 74.10 ? 37  GLU A OE1  2  
ATOM 7756   O OE2  . GLU A 1 37  ? -1.576  -9.638  -13.910 1.00 74.34 ? 37  GLU A OE2  2  
ATOM 7757   H H    . GLU A 1 37  ? 2.420   -11.628 -9.680  1.00 21.50 ? 37  GLU A H    2  
ATOM 7758   H HA   . GLU A 1 37  ? 0.893   -9.198  -9.629  1.00 52.12 ? 37  GLU A HA   2  
ATOM 7759   H HB2  . GLU A 1 37  ? 1.516   -10.516 -11.693 1.00 23.44 ? 37  GLU A HB2  2  
ATOM 7760   H HB3  . GLU A 1 37  ? 0.282   -11.692 -11.239 1.00 21.41 ? 37  GLU A HB3  2  
ATOM 7761   H HG2  . GLU A 1 37  ? -1.403  -9.833  -11.227 1.00 11.35 ? 37  GLU A HG2  2  
ATOM 7762   H HG3  . GLU A 1 37  ? -0.153  -8.754  -11.848 1.00 22.34 ? 37  GLU A HG3  2  
ATOM 7763   N N    . TYR A 1 38  ? -0.671  -11.935 -8.656  1.00 1.21  ? 38  TYR A N    2  
ATOM 7764   C CA   . TYR A 1 38  ? -1.876  -12.379 -7.899  1.00 25.33 ? 38  TYR A CA   2  
ATOM 7765   C C    . TYR A 1 38  ? -1.769  -11.917 -6.443  1.00 1.14  ? 38  TYR A C    2  
ATOM 7766   O O    . TYR A 1 38  ? -2.737  -11.493 -5.843  1.00 44.44 ? 38  TYR A O    2  
ATOM 7767   C CB   . TYR A 1 38  ? -1.971  -13.906 -7.943  1.00 12.00 ? 38  TYR A CB   2  
ATOM 7768   C CG   . TYR A 1 38  ? -3.278  -14.347 -7.329  1.00 44.22 ? 38  TYR A CG   2  
ATOM 7769   C CD1  . TYR A 1 38  ? -4.430  -14.431 -8.120  1.00 64.54 ? 38  TYR A CD1  2  
ATOM 7770   C CD2  . TYR A 1 38  ? -3.337  -14.674 -5.969  1.00 63.13 ? 38  TYR A CD2  2  
ATOM 7771   C CE1  . TYR A 1 38  ? -5.642  -14.841 -7.551  1.00 61.22 ? 38  TYR A CE1  2  
ATOM 7772   C CE2  . TYR A 1 38  ? -4.549  -15.085 -5.400  1.00 75.33 ? 38  TYR A CE2  2  
ATOM 7773   C CZ   . TYR A 1 38  ? -5.701  -15.168 -6.191  1.00 64.13 ? 38  TYR A CZ   2  
ATOM 7774   O OH   . TYR A 1 38  ? -6.896  -15.573 -5.630  1.00 50.34 ? 38  TYR A OH   2  
ATOM 7775   H H    . TYR A 1 38  ? -0.008  -12.593 -8.955  1.00 34.01 ? 38  TYR A H    2  
ATOM 7776   H HA   . TYR A 1 38  ? -2.760  -11.951 -8.348  1.00 11.42 ? 38  TYR A HA   2  
ATOM 7777   H HB2  . TYR A 1 38  ? -1.924  -14.240 -8.969  1.00 33.42 ? 38  TYR A HB2  2  
ATOM 7778   H HB3  . TYR A 1 38  ? -1.150  -14.334 -7.387  1.00 75.31 ? 38  TYR A HB3  2  
ATOM 7779   H HD1  . TYR A 1 38  ? -4.384  -14.179 -9.169  1.00 11.23 ? 38  TYR A HD1  2  
ATOM 7780   H HD2  . TYR A 1 38  ? -2.449  -14.610 -5.358  1.00 25.32 ? 38  TYR A HD2  2  
ATOM 7781   H HE1  . TYR A 1 38  ? -6.531  -14.905 -8.161  1.00 74.11 ? 38  TYR A HE1  2  
ATOM 7782   H HE2  . TYR A 1 38  ? -4.595  -15.337 -4.351  1.00 52.33 ? 38  TYR A HE2  2  
ATOM 7783   H HH   . TYR A 1 38  ? -7.200  -14.875 -5.044  1.00 63.10 ? 38  TYR A HH   2  
ATOM 7784   N N    . LEU A 1 39  ? -0.600  -12.002 -5.870  1.00 74.33 ? 39  LEU A N    2  
ATOM 7785   C CA   . LEU A 1 39  ? -0.428  -11.576 -4.451  1.00 32.41 ? 39  LEU A CA   2  
ATOM 7786   C C    . LEU A 1 39  ? -0.539  -10.055 -4.344  1.00 51.34 ? 39  LEU A C    2  
ATOM 7787   O O    . LEU A 1 39  ? -1.341  -9.534  -3.595  1.00 4.22  ? 39  LEU A O    2  
ATOM 7788   C CB   . LEU A 1 39  ? 0.953   -12.023 -3.958  1.00 11.03 ? 39  LEU A CB   2  
ATOM 7789   C CG   . LEU A 1 39  ? 1.083   -11.788 -2.441  1.00 44.34 ? 39  LEU A CG   2  
ATOM 7790   C CD1  . LEU A 1 39  ? 2.285   -12.582 -1.915  1.00 62.13 ? 39  LEU A CD1  2  
ATOM 7791   C CD2  . LEU A 1 39  ? 1.269   -10.283 -2.123  1.00 72.50 ? 39  LEU A CD2  2  
ATOM 7792   H H    . LEU A 1 39  ? 0.166   -12.351 -6.371  1.00 33.10 ? 39  LEU A H    2  
ATOM 7793   H HA   . LEU A 1 39  ? -1.192  -12.036 -3.843  1.00 33.32 ? 39  LEU A HA   2  
ATOM 7794   H HB2  . LEU A 1 39  ? 1.075   -13.077 -4.166  1.00 21.53 ? 39  LEU A HB2  2  
ATOM 7795   H HB3  . LEU A 1 39  ? 1.719   -11.470 -4.480  1.00 33.21 ? 39  LEU A HB3  2  
ATOM 7796   H HG   . LEU A 1 39  ? 0.187   -12.146 -1.954  1.00 61.45 ? 39  LEU A HG   2  
ATOM 7797   H HD11 . LEU A 1 39  ? 2.120   -13.637 -2.079  1.00 72.31 ? 39  LEU A HD11 2  
ATOM 7798   H HD12 . LEU A 1 39  ? 2.405   -12.397 -0.858  1.00 63.34 ? 39  LEU A HD12 2  
ATOM 7799   H HD13 . LEU A 1 39  ? 3.178   -12.272 -2.438  1.00 24.13 ? 39  LEU A HD13 2  
ATOM 7800   H HD21 . LEU A 1 39  ? 1.727   -9.775  -2.959  1.00 52.20 ? 39  LEU A HD21 2  
ATOM 7801   H HD22 . LEU A 1 39  ? 1.898   -10.166 -1.250  1.00 34.31 ? 39  LEU A HD22 2  
ATOM 7802   H HD23 . LEU A 1 39  ? 0.305   -9.841  -1.919  1.00 73.51 ? 39  LEU A HD23 2  
ATOM 7803   N N    . MET A 1 40  ? 0.268   -9.337  -5.071  1.00 70.32 ? 40  MET A N    2  
ATOM 7804   C CA   . MET A 1 40  ? 0.217   -7.852  -4.991  1.00 44.10 ? 40  MET A CA   2  
ATOM 7805   C C    . MET A 1 40  ? -1.203  -7.358  -5.291  1.00 65.01 ? 40  MET A C    2  
ATOM 7806   O O    . MET A 1 40  ? -1.615  -6.311  -4.834  1.00 43.21 ? 40  MET A O    2  
ATOM 7807   C CB   . MET A 1 40  ? 1.214   -7.254  -5.998  1.00 24.20 ? 40  MET A CB   2  
ATOM 7808   C CG   . MET A 1 40  ? 0.662   -7.351  -7.429  1.00 30.03 ? 40  MET A CG   2  
ATOM 7809   S SD   . MET A 1 40  ? -0.420  -5.931  -7.754  1.00 1.45  ? 40  MET A SD   2  
ATOM 7810   C CE   . MET A 1 40  ? 0.212   -5.502  -9.397  1.00 31.21 ? 40  MET A CE   2  
ATOM 7811   H H    . MET A 1 40  ? 0.918   -9.773  -5.659  1.00 21.14 ? 40  MET A H    2  
ATOM 7812   H HA   . MET A 1 40  ? 0.495   -7.545  -3.993  1.00 34.12 ? 40  MET A HA   2  
ATOM 7813   H HB2  . MET A 1 40  ? 1.391   -6.219  -5.753  1.00 24.14 ? 40  MET A HB2  2  
ATOM 7814   H HB3  . MET A 1 40  ? 2.146   -7.798  -5.939  1.00 13.22 ? 40  MET A HB3  2  
ATOM 7815   H HG2  . MET A 1 40  ? 1.483   -7.351  -8.131  1.00 42.54 ? 40  MET A HG2  2  
ATOM 7816   H HG3  . MET A 1 40  ? 0.097   -8.264  -7.540  1.00 24.13 ? 40  MET A HG3  2  
ATOM 7817   H HE1  . MET A 1 40  ? 0.210   -6.384  -10.023 1.00 52.43 ? 40  MET A HE1  2  
ATOM 7818   H HE2  . MET A 1 40  ? 1.219   -5.127  -9.310  1.00 11.34 ? 40  MET A HE2  2  
ATOM 7819   H HE3  . MET A 1 40  ? -0.418  -4.740  -9.836  1.00 11.21 ? 40  MET A HE3  2  
ATOM 7820   N N    . ASP A 1 41  ? -1.950  -8.096  -6.062  1.00 11.23 ? 41  ASP A N    2  
ATOM 7821   C CA   . ASP A 1 41  ? -3.336  -7.661  -6.396  1.00 55.00 ? 41  ASP A CA   2  
ATOM 7822   C C    . ASP A 1 41  ? -4.184  -7.579  -5.122  1.00 12.43 ? 41  ASP A C    2  
ATOM 7823   O O    . ASP A 1 41  ? -5.022  -6.711  -4.981  1.00 71.22 ? 41  ASP A O    2  
ATOM 7824   C CB   . ASP A 1 41  ? -3.967  -8.667  -7.361  1.00 34.43 ? 41  ASP A CB   2  
ATOM 7825   C CG   . ASP A 1 41  ? -5.381  -8.210  -7.723  1.00 53.53 ? 41  ASP A CG   2  
ATOM 7826   O OD1  . ASP A 1 41  ? -5.755  -7.124  -7.312  1.00 33.14 ? 41  ASP A OD1  2  
ATOM 7827   O OD2  . ASP A 1 41  ? -6.066  -8.955  -8.405  1.00 45.22 ? 41  ASP A OD2  2  
ATOM 7828   H H    . ASP A 1 41  ? -1.599  -8.935  -6.428  1.00 40.41 ? 41  ASP A H    2  
ATOM 7829   H HA   . ASP A 1 41  ? -3.302  -6.689  -6.865  1.00 20.43 ? 41  ASP A HA   2  
ATOM 7830   H HB2  . ASP A 1 41  ? -3.368  -8.729  -8.257  1.00 22.35 ? 41  ASP A HB2  2  
ATOM 7831   H HB3  . ASP A 1 41  ? -4.014  -9.637  -6.890  1.00 23.23 ? 41  ASP A HB3  2  
ATOM 7832   N N    . ILE A 1 42  ? -3.986  -8.483  -4.198  1.00 61.34 ? 42  ILE A N    2  
ATOM 7833   C CA   . ILE A 1 42  ? -4.795  -8.462  -2.939  1.00 74.14 ? 42  ILE A CA   2  
ATOM 7834   C C    . ILE A 1 42  ? -4.082  -7.641  -1.859  1.00 74.11 ? 42  ILE A C    2  
ATOM 7835   O O    . ILE A 1 42  ? -4.588  -7.478  -0.766  1.00 53.21 ? 42  ILE A O    2  
ATOM 7836   C CB   . ILE A 1 42  ? -4.990  -9.897  -2.441  1.00 35.42 ? 42  ILE A CB   2  
ATOM 7837   C CG1  . ILE A 1 42  ? -3.637  -10.609 -2.380  1.00 60.14 ? 42  ILE A CG1  2  
ATOM 7838   C CG2  . ILE A 1 42  ? -5.915  -10.647 -3.401  1.00 51.11 ? 42  ILE A CG2  2  
ATOM 7839   C CD1  . ILE A 1 42  ? -3.778  -11.905 -1.580  1.00 41.41 ? 42  ILE A CD1  2  
ATOM 7840   H H    . ILE A 1 42  ? -3.312  -9.182  -4.334  1.00 41.35 ? 42  ILE A H    2  
ATOM 7841   H HA   . ILE A 1 42  ? -5.763  -8.023  -3.138  1.00 55.01 ? 42  ILE A HA   2  
ATOM 7842   H HB   . ILE A 1 42  ? -5.434  -9.877  -1.456  1.00 44.40 ? 42  ILE A HB   2  
ATOM 7843   H HG12 . ILE A 1 42  ? -3.305  -10.838 -3.382  1.00 32.20 ? 42  ILE A HG12 2  
ATOM 7844   H HG13 . ILE A 1 42  ? -2.913  -9.970  -1.898  1.00 20.32 ? 42  ILE A HG13 2  
ATOM 7845   H HG21 . ILE A 1 42  ? -5.483  -10.647 -4.391  1.00 23.32 ? 42  ILE A HG21 2  
ATOM 7846   H HG22 . ILE A 1 42  ? -6.878  -10.160 -3.428  1.00 13.35 ? 42  ILE A HG22 2  
ATOM 7847   H HG23 . ILE A 1 42  ? -6.036  -11.666 -3.062  1.00 74.41 ? 42  ILE A HG23 2  
ATOM 7848   H HD11 . ILE A 1 42  ? -3.962  -11.670 -0.542  1.00 52.51 ? 42  ILE A HD11 2  
ATOM 7849   H HD12 . ILE A 1 42  ? -2.869  -12.481 -1.664  1.00 70.54 ? 42  ILE A HD12 2  
ATOM 7850   H HD13 . ILE A 1 42  ? -4.605  -12.480 -1.970  1.00 41.31 ? 42  ILE A HD13 2  
ATOM 7851   N N    . ARG A 1 43  ? -2.912  -7.125  -2.152  1.00 40.51 ? 43  ARG A N    2  
ATOM 7852   C CA   . ARG A 1 43  ? -2.158  -6.312  -1.138  1.00 64.41 ? 43  ARG A CA   2  
ATOM 7853   C C    . ARG A 1 43  ? -1.709  -4.990  -1.766  1.00 72.24 ? 43  ARG A C    2  
ATOM 7854   O O    . ARG A 1 43  ? -1.385  -4.924  -2.935  1.00 64.35 ? 43  ARG A O    2  
ATOM 7855   C CB   . ARG A 1 43  ? -0.923  -7.098  -0.677  1.00 40.15 ? 43  ARG A CB   2  
ATOM 7856   C CG   . ARG A 1 43  ? -1.339  -8.249  0.258   1.00 54.34 ? 43  ARG A CG   2  
ATOM 7857   C CD   . ARG A 1 43  ? -1.476  -7.745  1.701   1.00 31.33 ? 43  ARG A CD   2  
ATOM 7858   N NE   . ARG A 1 43  ? -1.725  -8.902  2.606   1.00 61.12 ? 43  ARG A NE   2  
ATOM 7859   C CZ   . ARG A 1 43  ? -0.754  -9.727  2.892   1.00 14.01 ? 43  ARG A CZ   2  
ATOM 7860   N NH1  . ARG A 1 43  ? 0.433   -9.538  2.384   1.00 23.23 ? 43  ARG A NH1  2  
ATOM 7861   N NH2  . ARG A 1 43  ? -0.971  -10.740 3.685   1.00 23.43 ? 43  ARG A NH2  2  
ATOM 7862   H H    . ARG A 1 43  ? -2.524  -7.274  -3.039  1.00 63.20 ? 43  ARG A H    2  
ATOM 7863   H HA   . ARG A 1 43  ? -2.787  -6.100  -0.286  1.00 11.44 ? 43  ARG A HA   2  
ATOM 7864   H HB2  . ARG A 1 43  ? -0.421  -7.505  -1.544  1.00 54.12 ? 43  ARG A HB2  2  
ATOM 7865   H HB3  . ARG A 1 43  ? -0.248  -6.433  -0.157  1.00 23.44 ? 43  ARG A HB3  2  
ATOM 7866   H HG2  . ARG A 1 43  ? -2.286  -8.657  -0.068  1.00 31.24 ? 43  ARG A HG2  2  
ATOM 7867   H HG3  . ARG A 1 43  ? -0.588  -9.025  0.224   1.00 34.44 ? 43  ARG A HG3  2  
ATOM 7868   H HD2  . ARG A 1 43  ? -0.565  -7.248  1.999   1.00 22.53 ? 43  ARG A HD2  2  
ATOM 7869   H HD3  . ARG A 1 43  ? -2.302  -7.054  1.769   1.00 44.42 ? 43  ARG A HD3  2  
ATOM 7870   H HE   . ARG A 1 43  ? -2.617  -9.044  2.987   1.00 34.50 ? 43  ARG A HE   2  
ATOM 7871   H HH11 . ARG A 1 43  ? 0.599   -8.762  1.776   1.00 34.21 ? 43  ARG A HH11 2  
ATOM 7872   H HH12 . ARG A 1 43  ? 1.176   -10.170 2.603   1.00 75.41 ? 43  ARG A HH12 2  
ATOM 7873   H HH21 . ARG A 1 43  ? -1.881  -10.885 4.074   1.00 0.41  ? 43  ARG A HH21 2  
ATOM 7874   H HH22 . ARG A 1 43  ? -0.228  -11.372 3.904   1.00 43.31 ? 43  ARG A HH22 2  
ATOM 7875   N N    . ASN A 1 44  ? -1.680  -3.936  -0.993  1.00 21.40 ? 44  ASN A N    2  
ATOM 7876   C CA   . ASN A 1 44  ? -1.244  -2.614  -1.535  1.00 75.42 ? 44  ASN A CA   2  
ATOM 7877   C C    . ASN A 1 44  ? 0.271   -2.482  -1.367  1.00 65.33 ? 44  ASN A C    2  
ATOM 7878   O O    . ASN A 1 44  ? 0.859   -3.072  -0.482  1.00 23.23 ? 44  ASN A O    2  
ATOM 7879   C CB   . ASN A 1 44  ? -1.945  -1.490  -0.766  1.00 52.53 ? 44  ASN A CB   2  
ATOM 7880   C CG   . ASN A 1 44  ? -1.472  -1.488  0.689   1.00 65.05 ? 44  ASN A CG   2  
ATOM 7881   O OD1  . ASN A 1 44  ? -0.920  -2.462  1.162   1.00 70.31 ? 44  ASN A OD1  2  
ATOM 7882   N ND2  . ASN A 1 44  ? -1.665  -0.428  1.424   1.00 63.40 ? 44  ASN A ND2  2  
ATOM 7883   H H    . ASN A 1 44  ? -1.940  -4.014  -0.051  1.00 54.01 ? 44  ASN A H    2  
ATOM 7884   H HA   . ASN A 1 44  ? -1.498  -2.547  -2.584  1.00 42.40 ? 44  ASN A HA   2  
ATOM 7885   H HB2  . ASN A 1 44  ? -1.709  -0.540  -1.224  1.00 55.42 ? 44  ASN A HB2  2  
ATOM 7886   H HB3  . ASN A 1 44  ? -3.013  -1.647  -0.795  1.00 42.44 ? 44  ASN A HB3  2  
ATOM 7887   H HD21 . ASN A 1 44  ? -2.110  0.358   1.043   1.00 2.55  ? 44  ASN A HD21 2  
ATOM 7888   H HD22 . ASN A 1 44  ? -1.366  -0.417  2.357   1.00 23.31 ? 44  ASN A HD22 2  
ATOM 7889   N N    . TYR A 1 45  ? 0.914   -1.720  -2.213  1.00 25.01 ? 45  TYR A N    2  
ATOM 7890   C CA   . TYR A 1 45  ? 2.394   -1.564  -2.100  1.00 21.20 ? 45  TYR A CA   2  
ATOM 7891   C C    . TYR A 1 45  ? 2.820   -0.214  -2.680  1.00 41.02 ? 45  TYR A C    2  
ATOM 7892   O O    . TYR A 1 45  ? 2.010   0.532   -3.193  1.00 3.21  ? 45  TYR A O    2  
ATOM 7893   C CB   . TYR A 1 45  ? 3.078   -2.698  -2.869  1.00 74.23 ? 45  TYR A CB   2  
ATOM 7894   C CG   . TYR A 1 45  ? 2.380   -2.886  -4.194  1.00 0.43  ? 45  TYR A CG   2  
ATOM 7895   C CD1  . TYR A 1 45  ? 1.190   -3.620  -4.260  1.00 4.43  ? 45  TYR A CD1  2  
ATOM 7896   C CD2  . TYR A 1 45  ? 2.915   -2.316  -5.355  1.00 31.54 ? 45  TYR A CD2  2  
ATOM 7897   C CE1  . TYR A 1 45  ? 0.535   -3.783  -5.485  1.00 51.13 ? 45  TYR A CE1  2  
ATOM 7898   C CE2  . TYR A 1 45  ? 2.260   -2.482  -6.581  1.00 44.14 ? 45  TYR A CE2  2  
ATOM 7899   C CZ   . TYR A 1 45  ? 1.070   -3.215  -6.646  1.00 33.25 ? 45  TYR A CZ   2  
ATOM 7900   O OH   . TYR A 1 45  ? 0.424   -3.373  -7.855  1.00 12.30 ? 45  TYR A OH   2  
ATOM 7901   H H    . TYR A 1 45  ? 0.425   -1.257  -2.924  1.00 35.11 ? 45  TYR A H    2  
ATOM 7902   H HA   . TYR A 1 45  ? 2.683   -1.608  -1.062  1.00 53.00 ? 45  TYR A HA   2  
ATOM 7903   H HB2  . TYR A 1 45  ? 4.116   -2.448  -3.038  1.00 32.12 ? 45  TYR A HB2  2  
ATOM 7904   H HB3  . TYR A 1 45  ? 3.015   -3.611  -2.298  1.00 40.05 ? 45  TYR A HB3  2  
ATOM 7905   H HD1  . TYR A 1 45  ? 0.778   -4.063  -3.366  1.00 22.11 ? 45  TYR A HD1  2  
ATOM 7906   H HD2  . TYR A 1 45  ? 3.834   -1.752  -5.304  1.00 54.03 ? 45  TYR A HD2  2  
ATOM 7907   H HE1  . TYR A 1 45  ? -0.382  -4.351  -5.534  1.00 4.34  ? 45  TYR A HE1  2  
ATOM 7908   H HE2  . TYR A 1 45  ? 2.672   -2.045  -7.476  1.00 71.43 ? 45  TYR A HE2  2  
ATOM 7909   H HH   . TYR A 1 45  ? -0.520  -3.301  -7.698  1.00 40.20 ? 45  TYR A HH   2  
ATOM 7910   N N    . ASP A 1 46  ? 4.091   0.107   -2.592  1.00 3.24  ? 46  ASP A N    2  
ATOM 7911   C CA   . ASP A 1 46  ? 4.587   1.416   -3.128  1.00 72.04 ? 46  ASP A CA   2  
ATOM 7912   C C    . ASP A 1 46  ? 5.840   1.188   -3.978  1.00 71.40 ? 46  ASP A C    2  
ATOM 7913   O O    . ASP A 1 46  ? 6.024   1.824   -5.002  1.00 5.32  ? 46  ASP A O    2  
ATOM 7914   C CB   . ASP A 1 46  ? 4.931   2.341   -1.959  1.00 31.43 ? 46  ASP A CB   2  
ATOM 7915   C CG   . ASP A 1 46  ? 3.662   2.650   -1.163  1.00 40.24 ? 46  ASP A CG   2  
ATOM 7916   O OD1  . ASP A 1 46  ? 2.585   2.426   -1.691  1.00 62.45 ? 46  ASP A OD1  2  
ATOM 7917   O OD2  . ASP A 1 46  ? 3.788   3.106   -0.038  1.00 13.21 ? 46  ASP A OD2  2  
ATOM 7918   H H    . ASP A 1 46  ? 4.721   -0.513  -2.166  1.00 43.34 ? 46  ASP A H    2  
ATOM 7919   H HA   . ASP A 1 46  ? 3.826   1.882   -3.740  1.00 53.23 ? 46  ASP A HA   2  
ATOM 7920   H HB2  . ASP A 1 46  ? 5.651   1.856   -1.317  1.00 4.15  ? 46  ASP A HB2  2  
ATOM 7921   H HB3  . ASP A 1 46  ? 5.348   3.261   -2.339  1.00 75.32 ? 46  ASP A HB3  2  
ATOM 7922   N N    . LEU A 1 47  ? 6.707   0.290   -3.566  1.00 42.22 ? 47  LEU A N    2  
ATOM 7923   C CA   . LEU A 1 47  ? 7.956   0.026   -4.356  1.00 72.13 ? 47  LEU A CA   2  
ATOM 7924   C C    . LEU A 1 47  ? 7.794   -1.278  -5.133  1.00 61.22 ? 47  LEU A C    2  
ATOM 7925   O O    . LEU A 1 47  ? 7.743   -2.352  -4.567  1.00 65.31 ? 47  LEU A O    2  
ATOM 7926   C CB   . LEU A 1 47  ? 9.151   -0.078  -3.390  1.00 13.22 ? 47  LEU A CB   2  
ATOM 7927   C CG   . LEU A 1 47  ? 10.497  0.100   -4.126  1.00 24.01 ? 47  LEU A CG   2  
ATOM 7928   C CD1  . LEU A 1 47  ? 10.659  -0.970  -5.215  1.00 70.21 ? 47  LEU A CD1  2  
ATOM 7929   C CD2  . LEU A 1 47  ? 10.597  1.507   -4.751  1.00 50.23 ? 47  LEU A CD2  2  
ATOM 7930   H H    . LEU A 1 47  ? 6.538   -0.210  -2.736  1.00 34.44 ? 47  LEU A H    2  
ATOM 7931   H HA   . LEU A 1 47  ? 8.126   0.826   -5.051  1.00 3.44  ? 47  LEU A HA   2  
ATOM 7932   H HB2  . LEU A 1 47  ? 9.061   0.687   -2.634  1.00 50.11 ? 47  LEU A HB2  2  
ATOM 7933   H HB3  . LEU A 1 47  ? 9.139   -1.042  -2.915  1.00 2.12  ? 47  LEU A HB3  2  
ATOM 7934   H HG   . LEU A 1 47  ? 11.297  -0.020  -3.408  1.00 4.30  ? 47  LEU A HG   2  
ATOM 7935   H HD11 . LEU A 1 47  ? 10.284  -1.916  -4.853  1.00 43.33 ? 47  LEU A HD11 2  
ATOM 7936   H HD12 . LEU A 1 47  ? 11.706  -1.072  -5.461  1.00 51.22 ? 47  LEU A HD12 2  
ATOM 7937   H HD13 . LEU A 1 47  ? 10.112  -0.675  -6.098  1.00 4.42  ? 47  LEU A HD13 2  
ATOM 7938   H HD21 . LEU A 1 47  ? 10.230  1.486   -5.767  1.00 50.44 ? 47  LEU A HD21 2  
ATOM 7939   H HD22 . LEU A 1 47  ? 11.629  1.822   -4.755  1.00 30.22 ? 47  LEU A HD22 2  
ATOM 7940   H HD23 . LEU A 1 47  ? 10.013  2.209   -4.172  1.00 53.35 ? 47  LEU A HD23 2  
ATOM 7941   N N    . VAL A 1 48  ? 7.723   -1.189  -6.438  1.00 63.22 ? 48  VAL A N    2  
ATOM 7942   C CA   . VAL A 1 48  ? 7.576   -2.418  -7.272  1.00 21.21 ? 48  VAL A CA   2  
ATOM 7943   C C    . VAL A 1 48  ? 8.956   -2.846  -7.770  1.00 35.23 ? 48  VAL A C    2  
ATOM 7944   O O    . VAL A 1 48  ? 9.463   -2.322  -8.741  1.00 72.34 ? 48  VAL A O    2  
ATOM 7945   C CB   . VAL A 1 48  ? 6.664   -2.121  -8.464  1.00 31.21 ? 48  VAL A CB   2  
ATOM 7946   C CG1  . VAL A 1 48  ? 6.652   -3.321  -9.413  1.00 10.13 ? 48  VAL A CG1  2  
ATOM 7947   C CG2  . VAL A 1 48  ? 5.243   -1.861  -7.961  1.00 62.52 ? 48  VAL A CG2  2  
ATOM 7948   H H    . VAL A 1 48  ? 7.774   -0.311  -6.870  1.00 42.31 ? 48  VAL A H    2  
ATOM 7949   H HA   . VAL A 1 48  ? 7.146   -3.209  -6.685  1.00 21.10 ? 48  VAL A HA   2  
ATOM 7950   H HB   . VAL A 1 48  ? 7.025   -1.251  -8.989  1.00 4.03  ? 48  VAL A HB   2  
ATOM 7951   H HG11 . VAL A 1 48  ? 5.846   -3.211  -10.123 1.00 33.15 ? 48  VAL A HG11 2  
ATOM 7952   H HG12 . VAL A 1 48  ? 6.510   -4.228  -8.845  1.00 61.42 ? 48  VAL A HG12 2  
ATOM 7953   H HG13 . VAL A 1 48  ? 7.593   -3.371  -9.942  1.00 13.22 ? 48  VAL A HG13 2  
ATOM 7954   H HG21 . VAL A 1 48  ? 4.575   -1.774  -8.803  1.00 32.13 ? 48  VAL A HG21 2  
ATOM 7955   H HG22 . VAL A 1 48  ? 5.225   -0.945  -7.390  1.00 43.25 ? 48  VAL A HG22 2  
ATOM 7956   H HG23 . VAL A 1 48  ? 4.927   -2.682  -7.334  1.00 4.41  ? 48  VAL A HG23 2  
ATOM 7957   N N    . MET A 1 49  ? 9.569   -3.796  -7.104  1.00 41.12 ? 49  MET A N    2  
ATOM 7958   C CA   . MET A 1 49  ? 10.927  -4.273  -7.518  1.00 74.03 ? 49  MET A CA   2  
ATOM 7959   C C    . MET A 1 49  ? 10.810  -5.691  -8.085  1.00 42.03 ? 49  MET A C    2  
ATOM 7960   O O    . MET A 1 49  ? 10.252  -6.581  -7.469  1.00 61.14 ? 49  MET A O    2  
ATOM 7961   C CB   . MET A 1 49  ? 11.864  -4.231  -6.293  1.00 74.11 ? 49  MET A CB   2  
ATOM 7962   C CG   . MET A 1 49  ? 13.022  -5.229  -6.440  1.00 34.34 ? 49  MET A CG   2  
ATOM 7963   S SD   . MET A 1 49  ? 13.778  -5.049  -8.077  1.00 0.30  ? 49  MET A SD   2  
ATOM 7964   C CE   . MET A 1 49  ? 15.146  -3.966  -7.592  1.00 11.04 ? 49  MET A CE   2  
ATOM 7965   H H    . MET A 1 49  ? 9.134   -4.196  -6.322  1.00 62.41 ? 49  MET A H    2  
ATOM 7966   H HA   . MET A 1 49  ? 11.319  -3.629  -8.286  1.00 65.24 ? 49  MET A HA   2  
ATOM 7967   H HB2  . MET A 1 49  ? 12.271  -3.234  -6.193  1.00 12.33 ? 49  MET A HB2  2  
ATOM 7968   H HB3  . MET A 1 49  ? 11.300  -4.468  -5.408  1.00 41.31 ? 49  MET A HB3  2  
ATOM 7969   H HG2  . MET A 1 49  ? 13.761  -5.037  -5.677  1.00 33.00 ? 49  MET A HG2  2  
ATOM 7970   H HG3  . MET A 1 49  ? 12.645  -6.234  -6.327  1.00 53.42 ? 49  MET A HG3  2  
ATOM 7971   H HE1  . MET A 1 49  ? 15.959  -4.565  -7.206  1.00 42.24 ? 49  MET A HE1  2  
ATOM 7972   H HE2  . MET A 1 49  ? 14.812  -3.283  -6.827  1.00 14.10 ? 49  MET A HE2  2  
ATOM 7973   H HE3  . MET A 1 49  ? 15.481  -3.404  -8.452  1.00 14.21 ? 49  MET A HE3  2  
ATOM 7974   N N    . VAL A 1 50  ? 11.336  -5.901  -9.267  1.00 2.32  ? 50  VAL A N    2  
ATOM 7975   C CA   . VAL A 1 50  ? 11.263  -7.245  -9.906  1.00 20.34 ? 50  VAL A CA   2  
ATOM 7976   C C    . VAL A 1 50  ? 12.601  -7.569  -10.578 1.00 20.13 ? 50  VAL A C    2  
ATOM 7977   O O    . VAL A 1 50  ? 13.119  -6.799  -11.362 1.00 11.33 ? 50  VAL A O    2  
ATOM 7978   C CB   . VAL A 1 50  ? 10.130  -7.238  -10.948 1.00 20.04 ? 50  VAL A CB   2  
ATOM 7979   C CG1  . VAL A 1 50  ? 10.192  -5.947  -11.768 1.00 61.12 ? 50  VAL A CG1  2  
ATOM 7980   C CG2  . VAL A 1 50  ? 10.262  -8.439  -11.894 1.00 60.52 ? 50  VAL A CG2  2  
ATOM 7981   H H    . VAL A 1 50  ? 11.776  -5.167  -9.738  1.00 23.43 ? 50  VAL A H    2  
ATOM 7982   H HA   . VAL A 1 50  ? 11.058  -7.989  -9.157  1.00 10.35 ? 50  VAL A HA   2  
ATOM 7983   H HB   . VAL A 1 50  ? 9.179   -7.286  -10.437 1.00 63.32 ? 50  VAL A HB   2  
ATOM 7984   H HG11 . VAL A 1 50  ? 9.424   -5.968  -12.528 1.00 65.03 ? 50  VAL A HG11 2  
ATOM 7985   H HG12 . VAL A 1 50  ? 11.159  -5.863  -12.238 1.00 3.05  ? 50  VAL A HG12 2  
ATOM 7986   H HG13 . VAL A 1 50  ? 10.031  -5.099  -11.120 1.00 71.24 ? 50  VAL A HG13 2  
ATOM 7987   H HG21 . VAL A 1 50  ? 10.443  -9.333  -11.322 1.00 53.54 ? 50  VAL A HG21 2  
ATOM 7988   H HG22 . VAL A 1 50  ? 11.087  -8.273  -12.570 1.00 11.34 ? 50  VAL A HG22 2  
ATOM 7989   H HG23 . VAL A 1 50  ? 9.350   -8.552  -12.462 1.00 21.33 ? 50  VAL A HG23 2  
ATOM 7990   N N    . SER A 1 51  ? 13.160  -8.713  -10.278 1.00 55.11 ? 51  SER A N    2  
ATOM 7991   C CA   . SER A 1 51  ? 14.460  -9.105  -10.903 1.00 44.20 ? 51  SER A CA   2  
ATOM 7992   C C    . SER A 1 51  ? 14.195  -10.007 -12.113 1.00 5.33  ? 51  SER A C    2  
ATOM 7993   O O    . SER A 1 51  ? 15.110  -10.523 -12.725 1.00 73.11 ? 51  SER A O    2  
ATOM 7994   C CB   . SER A 1 51  ? 15.310  -9.861  -9.881  1.00 44.15 ? 51  SER A CB   2  
ATOM 7995   O OG   . SER A 1 51  ? 15.608  -9.001  -8.789  1.00 52.34 ? 51  SER A OG   2  
ATOM 7996   H H    . SER A 1 51  ? 12.719  -9.319  -9.644  1.00 21.32 ? 51  SER A H    2  
ATOM 7997   H HA   . SER A 1 51  ? 14.992  -8.222  -11.227 1.00 64.11 ? 51  SER A HA   2  
ATOM 7998   H HB2  . SER A 1 51  ? 14.767  -10.717 -9.520  1.00 70.40 ? 51  SER A HB2  2  
ATOM 7999   H HB3  . SER A 1 51  ? 16.227  -10.192 -10.352 1.00 3.24  ? 51  SER A HB3  2  
ATOM 8000   H HG   . SER A 1 51  ? 15.368  -9.457  -7.979  1.00 62.04 ? 51  SER A HG   2  
ATOM 8001   N N    . ASP A 1 52  ? 12.952  -10.201 -12.466 1.00 12.03 ? 52  ASP A N    2  
ATOM 8002   C CA   . ASP A 1 52  ? 12.636  -11.070 -13.638 1.00 45.34 ? 52  ASP A CA   2  
ATOM 8003   C C    . ASP A 1 52  ? 12.925  -10.301 -14.931 1.00 3.52  ? 52  ASP A C    2  
ATOM 8004   O O    . ASP A 1 52  ? 12.684  -9.114  -15.025 1.00 11.30 ? 52  ASP A O    2  
ATOM 8005   C CB   . ASP A 1 52  ? 11.159  -11.473 -13.591 1.00 14.22 ? 52  ASP A CB   2  
ATOM 8006   C CG   . ASP A 1 52  ? 10.903  -12.328 -12.349 1.00 52.55 ? 52  ASP A CG   2  
ATOM 8007   O OD1  . ASP A 1 52  ? 11.854  -12.597 -11.633 1.00 41.44 ? 52  ASP A OD1  2  
ATOM 8008   O OD2  . ASP A 1 52  ? 9.761   -12.699 -12.134 1.00 45.31 ? 52  ASP A OD2  2  
ATOM 8009   H H    . ASP A 1 52  ? 12.227  -9.776  -11.961 1.00 3.33  ? 52  ASP A H    2  
ATOM 8010   H HA   . ASP A 1 52  ? 13.252  -11.957 -13.603 1.00 5.50  ? 52  ASP A HA   2  
ATOM 8011   H HB2  . ASP A 1 52  ? 10.544  -10.586 -13.552 1.00 63.40 ? 52  ASP A HB2  2  
ATOM 8012   H HB3  . ASP A 1 52  ? 10.911  -12.045 -14.473 1.00 31.24 ? 52  ASP A HB3  2  
ATOM 8013   N N    . LYS A 1 53  ? 13.454  -10.964 -15.925 1.00 43.01 ? 53  LYS A N    2  
ATOM 8014   C CA   . LYS A 1 53  ? 13.774  -10.267 -17.205 1.00 15.35 ? 53  LYS A CA   2  
ATOM 8015   C C    . LYS A 1 53  ? 12.501  -10.053 -18.031 1.00 21.44 ? 53  LYS A C    2  
ATOM 8016   O O    . LYS A 1 53  ? 12.328  -9.030  -18.660 1.00 10.34 ? 53  LYS A O    2  
ATOM 8017   C CB   . LYS A 1 53  ? 14.770  -11.109 -18.007 1.00 34.05 ? 53  LYS A CB   2  
ATOM 8018   C CG   . LYS A 1 53  ? 14.122  -12.438 -18.401 1.00 44.22 ? 53  LYS A CG   2  
ATOM 8019   C CD   . LYS A 1 53  ? 15.185  -13.367 -18.993 1.00 34.10 ? 53  LYS A CD   2  
ATOM 8020   C CE   . LYS A 1 53  ? 14.507  -14.578 -19.639 1.00 44.22 ? 53  LYS A CE   2  
ATOM 8021   N NZ   . LYS A 1 53  ? 13.911  -14.176 -20.944 1.00 11.42 ? 53  LYS A NZ   2  
ATOM 8022   H H    . LYS A 1 53  ? 13.651  -11.919 -15.825 1.00 15.54 ? 53  LYS A H    2  
ATOM 8023   H HA   . LYS A 1 53  ? 14.219  -9.308  -16.985 1.00 51.34 ? 53  LYS A HA   2  
ATOM 8024   H HB2  . LYS A 1 53  ? 15.059  -10.571 -18.898 1.00 65.44 ? 53  LYS A HB2  2  
ATOM 8025   H HB3  . LYS A 1 53  ? 15.645  -11.302 -17.404 1.00 55.13 ? 53  LYS A HB3  2  
ATOM 8026   H HG2  . LYS A 1 53  ? 13.686  -12.899 -17.526 1.00 32.10 ? 53  LYS A HG2  2  
ATOM 8027   H HG3  . LYS A 1 53  ? 13.353  -12.261 -19.137 1.00 53.31 ? 53  LYS A HG3  2  
ATOM 8028   H HD2  . LYS A 1 53  ? 15.754  -12.832 -19.739 1.00 45.23 ? 53  LYS A HD2  2  
ATOM 8029   H HD3  . LYS A 1 53  ? 15.846  -13.704 -18.208 1.00 10.42 ? 53  LYS A HD3  2  
ATOM 8030   H HE2  . LYS A 1 53  ? 15.239  -15.355 -19.802 1.00 2.20  ? 53  LYS A HE2  2  
ATOM 8031   H HE3  . LYS A 1 53  ? 13.729  -14.948 -18.986 1.00 4.44  ? 53  LYS A HE3  2  
ATOM 8032   H HZ1  . LYS A 1 53  ? 14.665  -14.067 -21.651 1.00 50.12 ? 53  LYS A HZ1  2  
ATOM 8033   H HZ2  . LYS A 1 53  ? 13.408  -13.272 -20.831 1.00 23.13 ? 53  LYS A HZ2  2  
ATOM 8034   H HZ3  . LYS A 1 53  ? 13.244  -14.907 -21.261 1.00 1.02  ? 53  LYS A HZ3  2  
ATOM 8035   N N    . ASN A 1 54  ? 11.611  -11.007 -18.041 1.00 70.44 ? 54  ASN A N    2  
ATOM 8036   C CA   . ASN A 1 54  ? 10.358  -10.844 -18.836 1.00 20.31 ? 54  ASN A CA   2  
ATOM 8037   C C    . ASN A 1 54  ? 9.447   -9.824  -18.150 1.00 25.20 ? 54  ASN A C    2  
ATOM 8038   O O    . ASN A 1 54  ? 8.282   -9.699  -18.472 1.00 4.22  ? 54  ASN A O    2  
ATOM 8039   C CB   . ASN A 1 54  ? 9.635   -12.190 -18.929 1.00 60.14 ? 54  ASN A CB   2  
ATOM 8040   C CG   . ASN A 1 54  ? 10.544  -13.211 -19.616 1.00 41.52 ? 54  ASN A CG   2  
ATOM 8041   O OD1  . ASN A 1 54  ? 10.703  -14.318 -19.141 1.00 61.11 ? 54  ASN A OD1  2  
ATOM 8042   N ND2  . ASN A 1 54  ? 11.151  -12.884 -20.724 1.00 65.23 ? 54  ASN A ND2  2  
ATOM 8043   H H    . ASN A 1 54  ? 11.766  -11.829 -17.531 1.00 45.32 ? 54  ASN A H    2  
ATOM 8044   H HA   . ASN A 1 54  ? 10.603  -10.498 -19.829 1.00 73.13 ? 54  ASN A HA   2  
ATOM 8045   H HB2  . ASN A 1 54  ? 9.391   -12.536 -17.935 1.00 13.23 ? 54  ASN A HB2  2  
ATOM 8046   H HB3  . ASN A 1 54  ? 8.729   -12.074 -19.503 1.00 23.13 ? 54  ASN A HB3  2  
ATOM 8047   H HD21 . ASN A 1 54  ? 11.022  -11.991 -21.108 1.00 1.44  ? 54  ASN A HD21 2  
ATOM 8048   H HD22 . ASN A 1 54  ? 11.735  -13.530 -21.172 1.00 2.42  ? 54  ASN A HD22 2  
ATOM 8049   N N    . ALA A 1 55  ? 9.970   -9.101  -17.200 1.00 2.24  ? 55  ALA A N    2  
ATOM 8050   C CA   . ALA A 1 55  ? 9.142   -8.094  -16.479 1.00 15.35 ? 55  ALA A CA   2  
ATOM 8051   C C    . ALA A 1 55  ? 8.919   -6.855  -17.352 1.00 64.14 ? 55  ALA A C    2  
ATOM 8052   O O    . ALA A 1 55  ? 8.002   -6.093  -17.123 1.00 14.33 ? 55  ALA A O    2  
ATOM 8053   C CB   . ALA A 1 55  ? 9.857   -7.690  -15.190 1.00 25.51 ? 55  ALA A CB   2  
ATOM 8054   H H    . ALA A 1 55  ? 10.910  -9.226  -16.954 1.00 52.42 ? 55  ALA A H    2  
ATOM 8055   H HA   . ALA A 1 55  ? 8.186   -8.531  -16.231 1.00 0.24  ? 55  ALA A HA   2  
ATOM 8056   H HB1  . ALA A 1 55  ? 10.271  -8.569  -14.722 1.00 25.22 ? 55  ALA A HB1  2  
ATOM 8057   H HB2  . ALA A 1 55  ? 9.153   -7.221  -14.518 1.00 24.11 ? 55  ALA A HB2  2  
ATOM 8058   H HB3  . ALA A 1 55  ? 10.654  -6.996  -15.419 1.00 44.54 ? 55  ALA A HB3  2  
ATOM 8059   N N    . LEU A 1 56  ? 9.757   -6.638  -18.337 1.00 10.43 ? 56  LEU A N    2  
ATOM 8060   C CA   . LEU A 1 56  ? 9.604   -5.434  -19.218 1.00 44.14 ? 56  LEU A CA   2  
ATOM 8061   C C    . LEU A 1 56  ? 8.125   -5.189  -19.537 1.00 41.01 ? 56  LEU A C    2  
ATOM 8062   O O    . LEU A 1 56  ? 7.610   -4.106  -19.339 1.00 42.32 ? 56  LEU A O    2  
ATOM 8063   C CB   . LEU A 1 56  ? 10.371  -5.655  -20.525 1.00 32.41 ? 56  LEU A CB   2  
ATOM 8064   C CG   . LEU A 1 56  ? 11.824  -6.037  -20.223 1.00 24.14 ? 56  LEU A CG   2  
ATOM 8065   C CD1  . LEU A 1 56  ? 12.578  -6.230  -21.542 1.00 42.45 ? 56  LEU A CD1  2  
ATOM 8066   C CD2  . LEU A 1 56  ? 12.500  -4.929  -19.398 1.00 41.43 ? 56  LEU A CD2  2  
ATOM 8067   H H    . LEU A 1 56  ? 10.496  -7.263  -18.493 1.00 32.45 ? 56  LEU A H    2  
ATOM 8068   H HA   . LEU A 1 56  ? 10.004  -4.568  -18.713 1.00 15.44 ? 56  LEU A HA   2  
ATOM 8069   H HB2  . LEU A 1 56  ? 9.900   -6.449  -21.086 1.00 51.13 ? 56  LEU A HB2  2  
ATOM 8070   H HB3  . LEU A 1 56  ? 10.355  -4.746  -21.108 1.00 51.22 ? 56  LEU A HB3  2  
ATOM 8071   H HG   . LEU A 1 56  ? 11.840  -6.962  -19.665 1.00 74.43 ? 56  LEU A HG   2  
ATOM 8072   H HD11 . LEU A 1 56  ? 13.608  -6.477  -21.334 1.00 54.22 ? 56  LEU A HD11 2  
ATOM 8073   H HD12 . LEU A 1 56  ? 12.535  -5.317  -22.117 1.00 22.31 ? 56  LEU A HD12 2  
ATOM 8074   H HD13 . LEU A 1 56  ? 12.121  -7.031  -22.103 1.00 74.24 ? 56  LEU A HD13 2  
ATOM 8075   H HD21 . LEU A 1 56  ? 13.573  -4.995  -19.510 1.00 45.12 ? 56  LEU A HD21 2  
ATOM 8076   H HD22 . LEU A 1 56  ? 12.245  -5.049  -18.356 1.00 32.21 ? 56  LEU A HD22 2  
ATOM 8077   H HD23 . LEU A 1 56  ? 12.163  -3.961  -19.741 1.00 34.55 ? 56  LEU A HD23 2  
ATOM 8078   N N    . SER A 1 57  ? 7.433   -6.183  -20.017 1.00 12.42 ? 57  SER A N    2  
ATOM 8079   C CA   . SER A 1 57  ? 5.989   -5.990  -20.328 1.00 11.20 ? 57  SER A CA   2  
ATOM 8080   C C    . SER A 1 57  ? 5.226   -5.766  -19.021 1.00 55.23 ? 57  SER A C    2  
ATOM 8081   O O    . SER A 1 57  ? 4.248   -5.046  -18.971 1.00 33.44 ? 57  SER A O    2  
ATOM 8082   C CB   . SER A 1 57  ? 5.446   -7.235  -21.032 1.00 14.33 ? 57  SER A CB   2  
ATOM 8083   O OG   . SER A 1 57  ? 4.120   -6.982  -21.476 1.00 30.24 ? 57  SER A OG   2  
ATOM 8084   H H    . SER A 1 57  ? 7.857   -7.054  -20.165 1.00 44.13 ? 57  SER A H    2  
ATOM 8085   H HA   . SER A 1 57  ? 5.869   -5.130  -20.969 1.00 4.31  ? 57  SER A HA   2  
ATOM 8086   H HB2  . SER A 1 57  ? 6.066   -7.470  -21.881 1.00 42.32 ? 57  SER A HB2  2  
ATOM 8087   H HB3  . SER A 1 57  ? 5.453   -8.069  -20.342 1.00 63.23 ? 57  SER A HB3  2  
ATOM 8088   H HG   . SER A 1 57  ? 3.538   -7.030  -20.714 1.00 0.12  ? 57  SER A HG   2  
ATOM 8089   N N    . PHE A 1 58  ? 5.672   -6.384  -17.960 1.00 74.44 ? 58  PHE A N    2  
ATOM 8090   C CA   . PHE A 1 58  ? 4.982   -6.220  -16.650 1.00 64.52 ? 58  PHE A CA   2  
ATOM 8091   C C    . PHE A 1 58  ? 5.130   -4.778  -16.160 1.00 74.33 ? 58  PHE A C    2  
ATOM 8092   O O    . PHE A 1 58  ? 4.159   -4.087  -15.946 1.00 44.32 ? 58  PHE A O    2  
ATOM 8093   C CB   . PHE A 1 58  ? 5.608   -7.173  -15.629 1.00 11.14 ? 58  PHE A CB   2  
ATOM 8094   C CG   . PHE A 1 58  ? 4.757   -7.210  -14.381 1.00 33.22 ? 58  PHE A CG   2  
ATOM 8095   C CD1  . PHE A 1 58  ? 3.589   -7.981  -14.354 1.00 14.02 ? 58  PHE A CD1  2  
ATOM 8096   C CD2  . PHE A 1 58  ? 5.138   -6.478  -13.250 1.00 30.32 ? 58  PHE A CD2  2  
ATOM 8097   C CE1  . PHE A 1 58  ? 2.801   -8.019  -13.198 1.00 61.32 ? 58  PHE A CE1  2  
ATOM 8098   C CE2  . PHE A 1 58  ? 4.351   -6.516  -12.093 1.00 44.22 ? 58  PHE A CE2  2  
ATOM 8099   C CZ   . PHE A 1 58  ? 3.182   -7.286  -12.067 1.00 33.41 ? 58  PHE A CZ   2  
ATOM 8100   H H    . PHE A 1 58  ? 6.462   -6.960  -18.027 1.00 71.22 ? 58  PHE A H    2  
ATOM 8101   H HA   . PHE A 1 58  ? 3.933   -6.454  -16.763 1.00 74.41 ? 58  PHE A HA   2  
ATOM 8102   H HB2  . PHE A 1 58  ? 5.667   -8.164  -16.053 1.00 12.43 ? 58  PHE A HB2  2  
ATOM 8103   H HB3  . PHE A 1 58  ? 6.600   -6.830  -15.378 1.00 70.24 ? 58  PHE A HB3  2  
ATOM 8104   H HD1  . PHE A 1 58  ? 3.295   -8.545  -15.227 1.00 34.34 ? 58  PHE A HD1  2  
ATOM 8105   H HD2  . PHE A 1 58  ? 6.040   -5.883  -13.270 1.00 32.50 ? 58  PHE A HD2  2  
ATOM 8106   H HE1  . PHE A 1 58  ? 1.900   -8.613  -13.177 1.00 43.13 ? 58  PHE A HE1  2  
ATOM 8107   H HE2  . PHE A 1 58  ? 4.644   -5.951  -11.221 1.00 22.54 ? 58  PHE A HE2  2  
ATOM 8108   H HZ   . PHE A 1 58  ? 2.575   -7.316  -11.175 1.00 63.23 ? 58  PHE A HZ   2  
ATOM 8109   N N    . VAL A 1 59  ? 6.331   -4.309  -15.973 1.00 74.03 ? 59  VAL A N    2  
ATOM 8110   C CA   . VAL A 1 59  ? 6.497   -2.910  -15.488 1.00 50.23 ? 59  VAL A CA   2  
ATOM 8111   C C    . VAL A 1 59  ? 5.688   -1.963  -16.376 1.00 51.24 ? 59  VAL A C    2  
ATOM 8112   O O    . VAL A 1 59  ? 5.157   -0.971  -15.918 1.00 54.43 ? 59  VAL A O    2  
ATOM 8113   C CB   . VAL A 1 59  ? 7.970   -2.508  -15.527 1.00 12.34 ? 59  VAL A CB   2  
ATOM 8114   C CG1  . VAL A 1 59  ? 8.755   -3.335  -14.506 1.00 72.34 ? 59  VAL A CG1  2  
ATOM 8115   C CG2  . VAL A 1 59  ? 8.536   -2.756  -16.925 1.00 4.45  ? 59  VAL A CG2  2  
ATOM 8116   H H    . VAL A 1 59  ? 7.115   -4.871  -16.143 1.00 61.54 ? 59  VAL A H    2  
ATOM 8117   H HA   . VAL A 1 59  ? 6.135   -2.842  -14.473 1.00 63.03 ? 59  VAL A HA   2  
ATOM 8118   H HB   . VAL A 1 59  ? 8.057   -1.461  -15.284 1.00 44.30 ? 59  VAL A HB   2  
ATOM 8119   H HG11 . VAL A 1 59  ? 8.242   -3.317  -13.556 1.00 24.44 ? 59  VAL A HG11 2  
ATOM 8120   H HG12 . VAL A 1 59  ? 9.744   -2.917  -14.388 1.00 71.13 ? 59  VAL A HG12 2  
ATOM 8121   H HG13 . VAL A 1 59  ? 8.835   -4.355  -14.853 1.00 1.34  ? 59  VAL A HG13 2  
ATOM 8122   H HG21 . VAL A 1 59  ? 9.581   -2.484  -16.944 1.00 52.51 ? 59  VAL A HG21 2  
ATOM 8123   H HG22 . VAL A 1 59  ? 7.995   -2.160  -17.644 1.00 45.01 ? 59  VAL A HG22 2  
ATOM 8124   H HG23 . VAL A 1 59  ? 8.432   -3.799  -17.171 1.00 44.42 ? 59  VAL A HG23 2  
ATOM 8125   N N    . SER A 1 60  ? 5.589   -2.257  -17.644 1.00 22.40 ? 60  SER A N    2  
ATOM 8126   C CA   . SER A 1 60  ? 4.814   -1.366  -18.553 1.00 41.22 ? 60  SER A CA   2  
ATOM 8127   C C    . SER A 1 60  ? 3.372   -1.245  -18.052 1.00 64.30 ? 60  SER A C    2  
ATOM 8128   O O    . SER A 1 60  ? 2.872   -0.157  -17.824 1.00 1.32  ? 60  SER A O    2  
ATOM 8129   C CB   . SER A 1 60  ? 4.814   -1.955  -19.963 1.00 50.04 ? 60  SER A CB   2  
ATOM 8130   O OG   . SER A 1 60  ? 4.244   -1.014  -20.864 1.00 20.22 ? 60  SER A OG   2  
ATOM 8131   H H    . SER A 1 60  ? 6.025   -3.061  -17.998 1.00 40.02 ? 60  SER A H    2  
ATOM 8132   H HA   . SER A 1 60  ? 5.271   -0.388  -18.572 1.00 40.12 ? 60  SER A HA   2  
ATOM 8133   H HB2  . SER A 1 60  ? 5.826   -2.168  -20.267 1.00 73.54 ? 60  SER A HB2  2  
ATOM 8134   H HB3  . SER A 1 60  ? 4.238   -2.871  -19.970 1.00 40.23 ? 60  SER A HB3  2  
ATOM 8135   H HG   . SER A 1 60  ? 4.833   -0.258  -20.916 1.00 72.13 ? 60  SER A HG   2  
ATOM 8136   N N    . ARG A 1 61  ? 2.694   -2.348  -17.880 1.00 43.05 ? 61  ARG A N    2  
ATOM 8137   C CA   . ARG A 1 61  ? 1.286   -2.273  -17.400 1.00 61.31 ? 61  ARG A CA   2  
ATOM 8138   C C    . ARG A 1 61  ? 1.252   -1.697  -15.981 1.00 62.25 ? 61  ARG A C    2  
ATOM 8139   O O    . ARG A 1 61  ? 0.281   -1.095  -15.576 1.00 53.34 ? 61  ARG A O    2  
ATOM 8140   C CB   . ARG A 1 61  ? 0.635   -3.663  -17.403 1.00 62.53 ? 61  ARG A CB   2  
ATOM 8141   C CG   . ARG A 1 61  ? 1.589   -4.693  -16.802 1.00 61.11 ? 61  ARG A CG   2  
ATOM 8142   C CD   . ARG A 1 61  ? 0.898   -6.056  -16.751 1.00 20.41 ? 61  ARG A CD   2  
ATOM 8143   N NE   . ARG A 1 61  ? 0.677   -6.553  -18.138 1.00 64.44 ? 61  ARG A NE   2  
ATOM 8144   C CZ   . ARG A 1 61  ? 0.284   -7.781  -18.336 1.00 2.14  ? 61  ARG A CZ   2  
ATOM 8145   N NH1  . ARG A 1 61  ? 0.086   -8.576  -17.320 1.00 52.42 ? 61  ARG A NH1  2  
ATOM 8146   N NH2  . ARG A 1 61  ? 0.088   -8.216  -19.551 1.00 41.54 ? 61  ARG A NH2  2  
ATOM 8147   H H    . ARG A 1 61  ? 3.107   -3.217  -18.071 1.00 63.45 ? 61  ARG A H    2  
ATOM 8148   H HA   . ARG A 1 61  ? 0.730   -1.625  -18.059 1.00 64.53 ? 61  ARG A HA   2  
ATOM 8149   H HB2  . ARG A 1 61  ? -0.272  -3.634  -16.814 1.00 44.23 ? 61  ARG A HB2  2  
ATOM 8150   H HB3  . ARG A 1 61  ? 0.396   -3.945  -18.417 1.00 25.13 ? 61  ARG A HB3  2  
ATOM 8151   H HG2  . ARG A 1 61  ? 2.474   -4.761  -17.415 1.00 51.34 ? 61  ARG A HG2  2  
ATOM 8152   H HG3  . ARG A 1 61  ? 1.859   -4.392  -15.802 1.00 44.20 ? 61  ARG A HG3  2  
ATOM 8153   H HD2  . ARG A 1 61  ? 1.521   -6.755  -16.213 1.00 20.23 ? 61  ARG A HD2  2  
ATOM 8154   H HD3  . ARG A 1 61  ? -0.052  -5.959  -16.247 1.00 0.11  ? 61  ARG A HD3  2  
ATOM 8155   H HE   . ARG A 1 61  ? 0.826   -5.957  -18.902 1.00 73.34 ? 61  ARG A HE   2  
ATOM 8156   H HH11 . ARG A 1 61  ? 0.235   -8.243  -16.389 1.00 64.20 ? 61  ARG A HH11 2  
ATOM 8157   H HH12 . ARG A 1 61  ? -0.215  -9.517  -17.472 1.00 35.30 ? 61  ARG A HH12 2  
ATOM 8158   H HH21 . ARG A 1 61  ? 0.240   -7.607  -20.330 1.00 23.11 ? 61  ARG A HH21 2  
ATOM 8159   H HH22 . ARG A 1 61  ? -0.212  -9.157  -19.703 1.00 50.15 ? 61  ARG A HH22 2  
ATOM 8160   N N    . ILE A 1 62  ? 2.296   -1.876  -15.218 1.00 63.21 ? 62  ILE A N    2  
ATOM 8161   C CA   . ILE A 1 62  ? 2.294   -1.336  -13.826 1.00 54.23 ? 62  ILE A CA   2  
ATOM 8162   C C    . ILE A 1 62  ? 2.252   0.193   -13.861 1.00 62.20 ? 62  ILE A C    2  
ATOM 8163   O O    . ILE A 1 62  ? 1.556   0.821   -13.088 1.00 12.24 ? 62  ILE A O    2  
ATOM 8164   C CB   . ILE A 1 62  ? 3.567   -1.787  -13.100 1.00 12.45 ? 62  ILE A CB   2  
ATOM 8165   C CG1  . ILE A 1 62  ? 3.587   -3.328  -12.970 1.00 13.14 ? 62  ILE A CG1  2  
ATOM 8166   C CG2  . ILE A 1 62  ? 3.631   -1.132  -11.715 1.00 42.40 ? 62  ILE A CG2  2  
ATOM 8167   C CD1  . ILE A 1 62  ? 2.780   -3.802  -11.747 1.00 3.12  ? 62  ILE A CD1  2  
ATOM 8168   H H    . ILE A 1 62  ? 3.078   -2.367  -15.555 1.00 14.04 ? 62  ILE A H    2  
ATOM 8169   H HA   . ILE A 1 62  ? 1.428   -1.704  -13.301 1.00 1.42  ? 62  ILE A HA   2  
ATOM 8170   H HB   . ILE A 1 62  ? 4.426   -1.466  -13.674 1.00 15.43 ? 62  ILE A HB   2  
ATOM 8171   H HG12 . ILE A 1 62  ? 3.164   -3.768  -13.860 1.00 72.11 ? 62  ILE A HG12 2  
ATOM 8172   H HG13 . ILE A 1 62  ? 4.610   -3.659  -12.866 1.00 72.04 ? 62  ILE A HG13 2  
ATOM 8173   H HG21 . ILE A 1 62  ? 2.678   -1.243  -11.219 1.00 31.21 ? 62  ILE A HG21 2  
ATOM 8174   H HG22 . ILE A 1 62  ? 3.861   -0.082  -11.823 1.00 55.33 ? 62  ILE A HG22 2  
ATOM 8175   H HG23 . ILE A 1 62  ? 4.401   -1.610  -11.128 1.00 43.21 ? 62  ILE A HG23 2  
ATOM 8176   H HD11 . ILE A 1 62  ? 1.959   -3.127  -11.563 1.00 10.21 ? 62  ILE A HD11 2  
ATOM 8177   H HD12 . ILE A 1 62  ? 3.424   -3.827  -10.881 1.00 73.35 ? 62  ILE A HD12 2  
ATOM 8178   H HD13 . ILE A 1 62  ? 2.395   -4.793  -11.935 1.00 23.42 ? 62  ILE A HD13 2  
ATOM 8179   N N    . LYS A 1 63  ? 3.005   0.799   -14.736 1.00 2.54  ? 63  LYS A N    2  
ATOM 8180   C CA   . LYS A 1 63  ? 3.018   2.287   -14.798 1.00 41.43 ? 63  LYS A CA   2  
ATOM 8181   C C    . LYS A 1 63  ? 1.665   2.813   -15.288 1.00 72.24 ? 63  LYS A C    2  
ATOM 8182   O O    . LYS A 1 63  ? 1.111   3.729   -14.716 1.00 55.11 ? 63  LYS A O    2  
ATOM 8183   C CB   . LYS A 1 63  ? 4.129   2.752   -15.748 1.00 62.03 ? 63  LYS A CB   2  
ATOM 8184   C CG   . LYS A 1 63  ? 5.493   2.196   -15.289 1.00 51.42 ? 63  LYS A CG   2  
ATOM 8185   C CD   . LYS A 1 63  ? 6.079   3.020   -14.125 1.00 33.23 ? 63  LYS A CD   2  
ATOM 8186   C CE   . LYS A 1 63  ? 6.313   4.483   -14.546 1.00 35.21 ? 63  LYS A CE   2  
ATOM 8187   N NZ   . LYS A 1 63  ? 6.547   4.558   -16.016 1.00 74.42 ? 63  LYS A NZ   2  
ATOM 8188   H H    . LYS A 1 63  ? 3.571   0.276   -15.342 1.00 2.24  ? 63  LYS A H    2  
ATOM 8189   H HA   . LYS A 1 63  ? 3.205   2.678   -13.812 1.00 20.10 ? 63  LYS A HA   2  
ATOM 8190   H HB2  . LYS A 1 63  ? 3.915   2.390   -16.744 1.00 31.41 ? 63  LYS A HB2  2  
ATOM 8191   H HB3  . LYS A 1 63  ? 4.158   3.828   -15.763 1.00 4.53  ? 63  LYS A HB3  2  
ATOM 8192   H HG2  . LYS A 1 63  ? 5.366   1.174   -14.965 1.00 4.33  ? 63  LYS A HG2  2  
ATOM 8193   H HG3  . LYS A 1 63  ? 6.182   2.215   -16.118 1.00 1.01  ? 63  LYS A HG3  2  
ATOM 8194   H HD2  . LYS A 1 63  ? 5.404   2.990   -13.284 1.00 32.31 ? 63  LYS A HD2  2  
ATOM 8195   H HD3  . LYS A 1 63  ? 7.023   2.581   -13.831 1.00 31.03 ? 63  LYS A HD3  2  
ATOM 8196   H HE2  . LYS A 1 63  ? 5.447   5.076   -14.291 1.00 32.14 ? 63  LYS A HE2  2  
ATOM 8197   H HE3  . LYS A 1 63  ? 7.176   4.875   -14.026 1.00 71.20 ? 63  LYS A HE3  2  
ATOM 8198   H HZ1  . LYS A 1 63  ? 5.790   4.048   -16.514 1.00 63.13 ? 63  LYS A HZ1  2  
ATOM 8199   H HZ2  . LYS A 1 63  ? 7.466   4.126   -16.243 1.00 40.21 ? 63  LYS A HZ2  2  
ATOM 8200   H HZ3  . LYS A 1 63  ? 6.547   5.553   -16.317 1.00 50.53 ? 63  LYS A HZ3  2  
ATOM 8201   N N    . GLU A 1 64  ? 1.121   2.259   -16.338 1.00 0.35  ? 64  GLU A N    2  
ATOM 8202   C CA   . GLU A 1 64  ? -0.195  2.773   -16.824 1.00 5.40  ? 64  GLU A CA   2  
ATOM 8203   C C    . GLU A 1 64  ? -1.295  2.396   -15.822 1.00 70.32 ? 64  GLU A C    2  
ATOM 8204   O O    . GLU A 1 64  ? -2.166  3.185   -15.517 1.00 2.15  ? 64  GLU A O    2  
ATOM 8205   C CB   . GLU A 1 64  ? -0.505  2.195   -18.215 1.00 62.42 ? 64  GLU A CB   2  
ATOM 8206   C CG   . GLU A 1 64  ? -1.025  0.760   -18.092 1.00 35.13 ? 64  GLU A CG   2  
ATOM 8207   C CD   . GLU A 1 64  ? -0.932  0.057   -19.448 1.00 45.54 ? 64  GLU A CD   2  
ATOM 8208   O OE1  . GLU A 1 64  ? -0.500  0.693   -20.395 1.00 14.11 ? 64  GLU A OE1  2  
ATOM 8209   O OE2  . GLU A 1 64  ? -1.296  -1.106  -19.517 1.00 33.41 ? 64  GLU A OE2  2  
ATOM 8210   H H    . GLU A 1 64  ? 1.572   1.520   -16.804 1.00 53.34 ? 64  GLU A H    2  
ATOM 8211   H HA   . GLU A 1 64  ? -0.143  3.848   -16.893 1.00 72.12 ? 64  GLU A HA   2  
ATOM 8212   H HB2  . GLU A 1 64  ? -1.254  2.807   -18.696 1.00 63.35 ? 64  GLU A HB2  2  
ATOM 8213   H HB3  . GLU A 1 64  ? 0.396   2.199   -18.811 1.00 4.34  ? 64  GLU A HB3  2  
ATOM 8214   H HG2  . GLU A 1 64  ? -0.431  0.231   -17.367 1.00 61.12 ? 64  GLU A HG2  2  
ATOM 8215   H HG3  . GLU A 1 64  ? -2.055  0.778   -17.768 1.00 74.55 ? 64  GLU A HG3  2  
ATOM 8216   N N    . LYS A 1 65  ? -1.255  1.198   -15.304 1.00 72.24 ? 65  LYS A N    2  
ATOM 8217   C CA   . LYS A 1 65  ? -2.294  0.778   -14.317 1.00 1.13  ? 65  LYS A CA   2  
ATOM 8218   C C    . LYS A 1 65  ? -2.026  1.472   -12.979 1.00 35.23 ? 65  LYS A C    2  
ATOM 8219   O O    . LYS A 1 65  ? -2.908  1.625   -12.158 1.00 32.33 ? 65  LYS A O    2  
ATOM 8220   C CB   . LYS A 1 65  ? -2.245  -0.743  -14.125 1.00 14.41 ? 65  LYS A CB   2  
ATOM 8221   C CG   . LYS A 1 65  ? -2.623  -1.438  -15.436 1.00 4.34  ? 65  LYS A CG   2  
ATOM 8222   C CD   . LYS A 1 65  ? -2.460  -2.956  -15.284 1.00 34.23 ? 65  LYS A CD   2  
ATOM 8223   C CE   . LYS A 1 65  ? -3.541  -3.518  -14.353 1.00 4.41  ? 65  LYS A CE   2  
ATOM 8224   N NZ   . LYS A 1 65  ? -3.673  -4.985  -14.580 1.00 75.22 ? 65  LYS A NZ   2  
ATOM 8225   H H    . LYS A 1 65  ? -0.541  0.579   -15.559 1.00 34.20 ? 65  LYS A H    2  
ATOM 8226   H HA   . LYS A 1 65  ? -3.270  1.064   -14.680 1.00 23.35 ? 65  LYS A HA   2  
ATOM 8227   H HB2  . LYS A 1 65  ? -1.250  -1.038  -13.830 1.00 22.31 ? 65  LYS A HB2  2  
ATOM 8228   H HB3  . LYS A 1 65  ? -2.943  -1.031  -13.358 1.00 44.42 ? 65  LYS A HB3  2  
ATOM 8229   H HG2  . LYS A 1 65  ? -3.648  -1.205  -15.685 1.00 62.15 ? 65  LYS A HG2  2  
ATOM 8230   H HG3  . LYS A 1 65  ? -1.977  -1.089  -16.226 1.00 11.51 ? 65  LYS A HG3  2  
ATOM 8231   H HD2  . LYS A 1 65  ? -2.545  -3.423  -16.254 1.00 2.32  ? 65  LYS A HD2  2  
ATOM 8232   H HD3  . LYS A 1 65  ? -1.486  -3.170  -14.868 1.00 73.11 ? 65  LYS A HD3  2  
ATOM 8233   H HE2  . LYS A 1 65  ? -3.261  -3.340  -13.325 1.00 30.33 ? 65  LYS A HE2  2  
ATOM 8234   H HE3  . LYS A 1 65  ? -4.487  -3.038  -14.557 1.00 52.40 ? 65  LYS A HE3  2  
ATOM 8235   H HZ1  . LYS A 1 65  ? -4.412  -5.368  -13.958 1.00 42.04 ? 65  LYS A HZ1  2  
ATOM 8236   H HZ2  . LYS A 1 65  ? -2.766  -5.451  -14.371 1.00 44.34 ? 65  LYS A HZ2  2  
ATOM 8237   H HZ3  . LYS A 1 65  ? -3.933  -5.161  -15.571 1.00 23.50 ? 65  LYS A HZ3  2  
ATOM 8238   N N    . HIS A 1 66  ? -0.809  1.896   -12.756 1.00 55.14 ? 66  HIS A N    2  
ATOM 8239   C CA   . HIS A 1 66  ? -0.471  2.585   -11.476 1.00 20.20 ? 66  HIS A CA   2  
ATOM 8240   C C    . HIS A 1 66  ? 0.704   3.536   -11.713 1.00 74.13 ? 66  HIS A C    2  
ATOM 8241   O O    . HIS A 1 66  ? 1.777   3.352   -11.179 1.00 2.34  ? 66  HIS A O    2  
ATOM 8242   C CB   . HIS A 1 66  ? -0.074  1.543   -10.426 1.00 52.12 ? 66  HIS A CB   2  
ATOM 8243   C CG   . HIS A 1 66  ? -1.299  0.816   -9.944  1.00 21.41 ? 66  HIS A CG   2  
ATOM 8244   N ND1  . HIS A 1 66  ? -2.026  1.241   -8.840  1.00 13.04 ? 66  HIS A ND1  2  
ATOM 8245   C CD2  . HIS A 1 66  ? -1.935  -0.314  -10.399 1.00 23.44 ? 66  HIS A CD2  2  
ATOM 8246   C CE1  . HIS A 1 66  ? -3.045  0.379   -8.669  1.00 62.04 ? 66  HIS A CE1  2  
ATOM 8247   N NE2  . HIS A 1 66  ? -3.034  -0.584  -9.592  1.00 71.21 ? 66  HIS A NE2  2  
ATOM 8248   H H    . HIS A 1 66  ? -0.115  1.762   -13.435 1.00 52.42 ? 66  HIS A H    2  
ATOM 8249   H HA   . HIS A 1 66  ? -1.325  3.146   -11.125 1.00 12.35 ? 66  HIS A HA   2  
ATOM 8250   H HB2  . HIS A 1 66  ? 0.614   0.836   -10.864 1.00 63.33 ? 66  HIS A HB2  2  
ATOM 8251   H HB3  . HIS A 1 66  ? 0.401   2.038   -9.591  1.00 53.04 ? 66  HIS A HB3  2  
ATOM 8252   H HD1  . HIS A 1 66  ? -1.832  2.026   -8.287  1.00 3.20  ? 66  HIS A HD1  2  
ATOM 8253   H HD2  . HIS A 1 66  ? -1.627  -0.903  -11.250 1.00 13.01 ? 66  HIS A HD2  2  
ATOM 8254   H HE1  . HIS A 1 66  ? -3.782  0.459   -7.884  1.00 63.03 ? 66  HIS A HE1  2  
ATOM 8255   H HE2  . HIS A 1 66  ? -3.668  -1.325  -9.683  1.00 0.00  ? 66  HIS A HE2  2  
ATOM 8256   N N    . SER A 1 67  ? 0.513   4.548   -12.514 1.00 70.00 ? 67  SER A N    2  
ATOM 8257   C CA   . SER A 1 67  ? 1.624   5.505   -12.790 1.00 45.40 ? 67  SER A CA   2  
ATOM 8258   C C    . SER A 1 67  ? 2.098   6.146   -11.484 1.00 73.24 ? 67  SER A C    2  
ATOM 8259   O O    . SER A 1 67  ? 3.271   6.404   -11.300 1.00 55.42 ? 67  SER A O    2  
ATOM 8260   C CB   . SER A 1 67  ? 1.131   6.595   -13.742 1.00 31.21 ? 67  SER A CB   2  
ATOM 8261   O OG   . SER A 1 67  ? 2.227   7.416   -14.124 1.00 42.53 ? 67  SER A OG   2  
ATOM 8262   H H    . SER A 1 67  ? -0.361  4.677   -12.939 1.00 21.23 ? 67  SER A H    2  
ATOM 8263   H HA   . SER A 1 67  ? 2.448   4.977   -13.246 1.00 35.50 ? 67  SER A HA   2  
ATOM 8264   H HB2  . SER A 1 67  ? 0.705   6.142   -14.622 1.00 61.31 ? 67  SER A HB2  2  
ATOM 8265   H HB3  . SER A 1 67  ? 0.376   7.191   -13.246 1.00 72.45 ? 67  SER A HB3  2  
ATOM 8266   H HG   . SER A 1 67  ? 1.917   8.033   -14.791 1.00 53.03 ? 67  SER A HG   2  
ATOM 8267   N N    . SER A 1 68  ? 1.199   6.409   -10.576 1.00 5.11  ? 68  SER A N    2  
ATOM 8268   C CA   . SER A 1 68  ? 1.606   7.036   -9.287  1.00 24.31 ? 68  SER A CA   2  
ATOM 8269   C C    . SER A 1 68  ? 2.303   5.995   -8.408  1.00 25.55 ? 68  SER A C    2  
ATOM 8270   O O    . SER A 1 68  ? 1.968   5.821   -7.253  1.00 61.01 ? 68  SER A O    2  
ATOM 8271   C CB   . SER A 1 68  ? 0.366   7.565   -8.565  1.00 2.45  ? 68  SER A CB   2  
ATOM 8272   O OG   . SER A 1 68  ? -0.401  6.469   -8.085  1.00 33.10 ? 68  SER A OG   2  
ATOM 8273   H H    . SER A 1 68  ? 0.257   6.196   -10.743 1.00 64.23 ? 68  SER A H    2  
ATOM 8274   H HA   . SER A 1 68  ? 2.284   7.853   -9.483  1.00 54.53 ? 68  SER A HA   2  
ATOM 8275   H HB2  . SER A 1 68  ? 0.667   8.179   -7.732  1.00 52.31 ? 68  SER A HB2  2  
ATOM 8276   H HB3  . SER A 1 68  ? -0.223  8.158   -9.252  1.00 71.44 ? 68  SER A HB3  2  
ATOM 8277   H HG   . SER A 1 68  ? -0.362  5.770   -8.742  1.00 71.42 ? 68  SER A HG   2  
ATOM 8278   N N    . ILE A 1 69  ? 3.272   5.297   -8.945  1.00 71.33 ? 69  ILE A N    2  
ATOM 8279   C CA   . ILE A 1 69  ? 3.991   4.262   -8.140  1.00 0.43  ? 69  ILE A CA   2  
ATOM 8280   C C    . ILE A 1 69  ? 5.464   4.216   -8.565  1.00 14.44 ? 69  ILE A C    2  
ATOM 8281   O O    . ILE A 1 69  ? 5.845   4.786   -9.569  1.00 32.23 ? 69  ILE A O    2  
ATOM 8282   C CB   . ILE A 1 69  ? 3.321   2.892   -8.371  1.00 63.34 ? 69  ILE A CB   2  
ATOM 8283   C CG1  . ILE A 1 69  ? 3.648   1.949   -7.206  1.00 1.33  ? 69  ILE A CG1  2  
ATOM 8284   C CG2  . ILE A 1 69  ? 3.808   2.264   -9.692  1.00 55.14 ? 69  ILE A CG2  2  
ATOM 8285   C CD1  . ILE A 1 69  ? 2.869   0.646   -7.380  1.00 23.31 ? 69  ILE A CD1  2  
ATOM 8286   H H    . ILE A 1 69  ? 3.525   5.451   -9.879  1.00 51.13 ? 69  ILE A H    2  
ATOM 8287   H HA   . ILE A 1 69  ? 3.935   4.519   -7.090  1.00 20.44 ? 69  ILE A HA   2  
ATOM 8288   H HB   . ILE A 1 69  ? 2.250   3.032   -8.424  1.00 52.11 ? 69  ILE A HB   2  
ATOM 8289   H HG12 . ILE A 1 69  ? 4.707   1.740   -7.198  1.00 12.21 ? 69  ILE A HG12 2  
ATOM 8290   H HG13 . ILE A 1 69  ? 3.364   2.413   -6.273  1.00 22.14 ? 69  ILE A HG13 2  
ATOM 8291   H HG21 . ILE A 1 69  ? 3.960   3.041   -10.427 1.00 51.15 ? 69  ILE A HG21 2  
ATOM 8292   H HG22 . ILE A 1 69  ? 3.068   1.566   -10.054 1.00 23.23 ? 69  ILE A HG22 2  
ATOM 8293   H HG23 . ILE A 1 69  ? 4.741   1.743   -9.526  1.00 61.24 ? 69  ILE A HG23 2  
ATOM 8294   H HD11 . ILE A 1 69  ? 3.282   0.089   -8.208  1.00 61.55 ? 69  ILE A HD11 2  
ATOM 8295   H HD12 . ILE A 1 69  ? 1.831   0.871   -7.580  1.00 54.42 ? 69  ILE A HD12 2  
ATOM 8296   H HD13 . ILE A 1 69  ? 2.942   0.060   -6.478  1.00 22.33 ? 69  ILE A HD13 2  
ATOM 8297   N N    . VAL A 1 70  ? 6.293   3.536   -7.811  1.00 24.03 ? 70  VAL A N    2  
ATOM 8298   C CA   . VAL A 1 70  ? 7.745   3.441   -8.166  1.00 72.13 ? 70  VAL A CA   2  
ATOM 8299   C C    . VAL A 1 70  ? 8.029   2.055   -8.755  1.00 62.02 ? 70  VAL A C    2  
ATOM 8300   O O    . VAL A 1 70  ? 7.351   1.094   -8.452  1.00 3.50  ? 70  VAL A O    2  
ATOM 8301   C CB   . VAL A 1 70  ? 8.582   3.646   -6.903  1.00 53.24 ? 70  VAL A CB   2  
ATOM 8302   C CG1  . VAL A 1 70  ? 10.068  3.670   -7.269  1.00 53.24 ? 70  VAL A CG1  2  
ATOM 8303   C CG2  . VAL A 1 70  ? 8.199   4.978   -6.252  1.00 63.33 ? 70  VAL A CG2  2  
ATOM 8304   H H    . VAL A 1 70  ? 5.958   3.081   -7.006  1.00 13.22 ? 70  VAL A H    2  
ATOM 8305   H HA   . VAL A 1 70  ? 8.002   4.200   -8.892  1.00 21.44 ? 70  VAL A HA   2  
ATOM 8306   H HB   . VAL A 1 70  ? 8.392   2.840   -6.212  1.00 73.02 ? 70  VAL A HB   2  
ATOM 8307   H HG11 . VAL A 1 70  ? 10.657  3.802   -6.374  1.00 54.43 ? 70  VAL A HG11 2  
ATOM 8308   H HG12 . VAL A 1 70  ? 10.257  4.487   -7.949  1.00 2.24  ? 70  VAL A HG12 2  
ATOM 8309   H HG13 . VAL A 1 70  ? 10.338  2.738   -7.743  1.00 55.42 ? 70  VAL A HG13 2  
ATOM 8310   H HG21 . VAL A 1 70  ? 8.332   5.778   -6.965  1.00 24.05 ? 70  VAL A HG21 2  
ATOM 8311   H HG22 . VAL A 1 70  ? 8.829   5.153   -5.393  1.00 43.12 ? 70  VAL A HG22 2  
ATOM 8312   H HG23 . VAL A 1 70  ? 7.166   4.942   -5.940  1.00 22.42 ? 70  VAL A HG23 2  
ATOM 8313   N N    . VAL A 1 71  ? 9.028   1.942   -9.597  1.00 33.43 ? 71  VAL A N    2  
ATOM 8314   C CA   . VAL A 1 71  ? 9.356   0.618   -10.206 1.00 12.11 ? 71  VAL A CA   2  
ATOM 8315   C C    . VAL A 1 71  ? 10.870  0.491   -10.345 1.00 52.45 ? 71  VAL A C    2  
ATOM 8316   O O    . VAL A 1 71  ? 11.512  1.286   -11.003 1.00 24.24 ? 71  VAL A O    2  
ATOM 8317   C CB   . VAL A 1 71  ? 8.707   0.508   -11.589 1.00 40.30 ? 71  VAL A CB   2  
ATOM 8318   C CG1  . VAL A 1 71  ? 8.724   -0.951  -12.047 1.00 54.21 ? 71  VAL A CG1  2  
ATOM 8319   C CG2  . VAL A 1 71  ? 7.259   0.998   -11.512 1.00 21.34 ? 71  VAL A CG2  2  
ATOM 8320   H H    . VAL A 1 71  ? 9.566   2.725   -9.824  1.00 12.42 ? 71  VAL A H    2  
ATOM 8321   H HA   . VAL A 1 71  ? 8.992   -0.176  -9.572  1.00 41.03 ? 71  VAL A HA   2  
ATOM 8322   H HB   . VAL A 1 71  ? 9.259   1.112   -12.296 1.00 23.23 ? 71  VAL A HB   2  
ATOM 8323   H HG11 . VAL A 1 71  ? 8.246   -1.569  -11.302 1.00 53.05 ? 71  VAL A HG11 2  
ATOM 8324   H HG12 . VAL A 1 71  ? 9.745   -1.275  -12.182 1.00 45.24 ? 71  VAL A HG12 2  
ATOM 8325   H HG13 . VAL A 1 71  ? 8.192   -1.040  -12.983 1.00 1.25  ? 71  VAL A HG13 2  
ATOM 8326   H HG21 . VAL A 1 71  ? 6.740   0.730   -12.420 1.00 15.33 ? 71  VAL A HG21 2  
ATOM 8327   H HG22 . VAL A 1 71  ? 7.248   2.072   -11.395 1.00 12.23 ? 71  VAL A HG22 2  
ATOM 8328   H HG23 . VAL A 1 71  ? 6.768   0.539   -10.667 1.00 13.20 ? 71  VAL A HG23 2  
ATOM 8329   N N    . LEU A 1 72  ? 11.440  -0.508  -9.723  1.00 3.53  ? 72  LEU A N    2  
ATOM 8330   C CA   . LEU A 1 72  ? 12.919  -0.720  -9.791  1.00 50.24 ? 72  LEU A CA   2  
ATOM 8331   C C    . LEU A 1 72  ? 13.191  -2.090  -10.425 1.00 2.02  ? 72  LEU A C    2  
ATOM 8332   O O    . LEU A 1 72  ? 13.026  -3.124  -9.805  1.00 23.22 ? 72  LEU A O    2  
ATOM 8333   C CB   . LEU A 1 72  ? 13.480  -0.658  -8.350  1.00 13.41 ? 72  LEU A CB   2  
ATOM 8334   C CG   . LEU A 1 72  ? 14.214  0.669   -8.105  1.00 4.21  ? 72  LEU A CG   2  
ATOM 8335   C CD1  . LEU A 1 72  ? 13.211  1.825   -8.143  1.00 35.41 ? 72  LEU A CD1  2  
ATOM 8336   C CD2  . LEU A 1 72  ? 14.886  0.630   -6.731  1.00 20.43 ? 72  LEU A CD2  2  
ATOM 8337   H H    . LEU A 1 72  ? 10.889  -1.128  -9.199  1.00 72.22 ? 72  LEU A H    2  
ATOM 8338   H HA   . LEU A 1 72  ? 13.383  0.043   -10.405 1.00 11.05 ? 72  LEU A HA   2  
ATOM 8339   H HB2  . LEU A 1 72  ? 12.655  -0.731  -7.656  1.00 2.00  ? 72  LEU A HB2  2  
ATOM 8340   H HB3  . LEU A 1 72  ? 14.165  -1.478  -8.179  1.00 74.21 ? 72  LEU A HB3  2  
ATOM 8341   H HG   . LEU A 1 72  ? 14.963  0.815   -8.870  1.00 55.33 ? 72  LEU A HG   2  
ATOM 8342   H HD11 . LEU A 1 72  ? 12.808  1.922   -9.140  1.00 74.13 ? 72  LEU A HD11 2  
ATOM 8343   H HD12 . LEU A 1 72  ? 13.709  2.742   -7.866  1.00 62.20 ? 72  LEU A HD12 2  
ATOM 8344   H HD13 . LEU A 1 72  ? 12.408  1.627   -7.449  1.00 33.41 ? 72  LEU A HD13 2  
ATOM 8345   H HD21 . LEU A 1 72  ? 14.130  0.638   -5.960  1.00 13.54 ? 72  LEU A HD21 2  
ATOM 8346   H HD22 . LEU A 1 72  ? 15.524  1.494   -6.617  1.00 21.21 ? 72  LEU A HD22 2  
ATOM 8347   H HD23 . LEU A 1 72  ? 15.478  -0.269  -6.645  1.00 43.34 ? 72  LEU A HD23 2  
ATOM 8348   N N    . VAL A 1 73  ? 13.607  -2.101  -11.663 1.00 42.53 ? 73  VAL A N    2  
ATOM 8349   C CA   . VAL A 1 73  ? 13.898  -3.394  -12.350 1.00 74.41 ? 73  VAL A CA   2  
ATOM 8350   C C    . VAL A 1 73  ? 15.391  -3.705  -12.223 1.00 3.21  ? 73  VAL A C    2  
ATOM 8351   O O    . VAL A 1 73  ? 16.234  -2.871  -12.491 1.00 43.12 ? 73  VAL A O    2  
ATOM 8352   C CB   . VAL A 1 73  ? 13.523  -3.276  -13.829 1.00 33.43 ? 73  VAL A CB   2  
ATOM 8353   C CG1  . VAL A 1 73  ? 14.390  -2.206  -14.499 1.00 21.31 ? 73  VAL A CG1  2  
ATOM 8354   C CG2  . VAL A 1 73  ? 13.751  -4.623  -14.520 1.00 1.53  ? 73  VAL A CG2  2  
ATOM 8355   H H    . VAL A 1 73  ? 13.728  -1.254  -12.143 1.00 12.14 ? 73  VAL A H    2  
ATOM 8356   H HA   . VAL A 1 73  ? 13.324  -4.191  -11.896 1.00 44.54 ? 73  VAL A HA   2  
ATOM 8357   H HB   . VAL A 1 73  ? 12.482  -2.999  -13.914 1.00 15.40 ? 73  VAL A HB   2  
ATOM 8358   H HG11 . VAL A 1 73  ? 15.383  -2.597  -14.666 1.00 41.54 ? 73  VAL A HG11 2  
ATOM 8359   H HG12 . VAL A 1 73  ? 14.448  -1.337  -13.860 1.00 11.12 ? 73  VAL A HG12 2  
ATOM 8360   H HG13 . VAL A 1 73  ? 13.950  -1.928  -15.445 1.00 13.45 ? 73  VAL A HG13 2  
ATOM 8361   H HG21 . VAL A 1 73  ? 13.381  -4.575  -15.534 1.00 73.23 ? 73  VAL A HG21 2  
ATOM 8362   H HG22 . VAL A 1 73  ? 13.226  -5.398  -13.981 1.00 13.31 ? 73  VAL A HG22 2  
ATOM 8363   H HG23 . VAL A 1 73  ? 14.808  -4.847  -14.533 1.00 41.04 ? 73  VAL A HG23 2  
ATOM 8364   N N    . SER A 1 74  ? 15.728  -4.900  -11.814 1.00 42.04 ? 74  SER A N    2  
ATOM 8365   C CA   . SER A 1 74  ? 17.169  -5.266  -11.671 1.00 12.54 ? 74  SER A CA   2  
ATOM 8366   C C    . SER A 1 74  ? 17.660  -5.871  -12.987 1.00 1.12  ? 74  SER A C    2  
ATOM 8367   O O    . SER A 1 74  ? 16.877  -6.235  -13.841 1.00 33.23 ? 74  SER A O    2  
ATOM 8368   C CB   . SER A 1 74  ? 17.330  -6.293  -10.544 1.00 40.12 ? 74  SER A CB   2  
ATOM 8369   O OG   . SER A 1 74  ? 17.242  -7.604  -11.085 1.00 72.31 ? 74  SER A OG   2  
ATOM 8370   H H    . SER A 1 74  ? 15.033  -5.558  -11.601 1.00 32.40 ? 74  SER A H    2  
ATOM 8371   H HA   . SER A 1 74  ? 17.749  -4.381  -11.442 1.00 31.40 ? 74  SER A HA   2  
ATOM 8372   H HB2  . SER A 1 74  ? 18.289  -6.169  -10.073 1.00 25.42 ? 74  SER A HB2  2  
ATOM 8373   H HB3  . SER A 1 74  ? 16.553  -6.145  -9.807  1.00 33.40 ? 74  SER A HB3  2  
ATOM 8374   H HG   . SER A 1 74  ? 16.838  -8.171  -10.423 1.00 64.34 ? 74  SER A HG   2  
ATOM 8375   N N    . SER A 1 75  ? 18.949  -5.987  -13.162 1.00 55.12 ? 75  SER A N    2  
ATOM 8376   C CA   . SER A 1 75  ? 19.471  -6.575  -14.431 1.00 43.21 ? 75  SER A CA   2  
ATOM 8377   C C    . SER A 1 75  ? 20.900  -7.074  -14.224 1.00 43.32 ? 75  SER A C    2  
ATOM 8378   O O    . SER A 1 75  ? 21.805  -6.308  -13.961 1.00 0.02  ? 75  SER A O    2  
ATOM 8379   C CB   . SER A 1 75  ? 19.458  -5.515  -15.530 1.00 64.54 ? 75  SER A CB   2  
ATOM 8380   O OG   . SER A 1 75  ? 18.185  -4.884  -15.559 1.00 55.33 ? 75  SER A OG   2  
ATOM 8381   H H    . SER A 1 75  ? 19.571  -5.690  -12.461 1.00 34.33 ? 75  SER A H    2  
ATOM 8382   H HA   . SER A 1 75  ? 18.845  -7.404  -14.726 1.00 31.14 ? 75  SER A HA   2  
ATOM 8383   H HB2  . SER A 1 75  ? 20.215  -4.778  -15.329 1.00 62.02 ? 75  SER A HB2  2  
ATOM 8384   H HB3  . SER A 1 75  ? 19.661  -5.985  -16.483 1.00 53.24 ? 75  SER A HB3  2  
ATOM 8385   H HG   . SER A 1 75  ? 18.185  -4.184  -14.902 1.00 32.11 ? 75  SER A HG   2  
ATOM 8386   N N    . ASP A 1 76  ? 21.108  -8.359  -14.339 1.00 62.04 ? 76  ASP A N    2  
ATOM 8387   C CA   . ASP A 1 76  ? 22.476  -8.918  -14.149 1.00 40.33 ? 76  ASP A CA   2  
ATOM 8388   C C    . ASP A 1 76  ? 23.341  -8.548  -15.356 1.00 54.11 ? 76  ASP A C    2  
ATOM 8389   O O    . ASP A 1 76  ? 24.428  -9.061  -15.536 1.00 43.10 ? 76  ASP A O    2  
ATOM 8390   C CB   . ASP A 1 76  ? 22.388  -10.441 -14.032 1.00 35.13 ? 76  ASP A CB   2  
ATOM 8391   C CG   . ASP A 1 76  ? 21.746  -11.017 -15.295 1.00 53.23 ? 76  ASP A CG   2  
ATOM 8392   O OD1  . ASP A 1 76  ? 21.580  -10.271 -16.246 1.00 13.33 ? 76  ASP A OD1  2  
ATOM 8393   O OD2  . ASP A 1 76  ? 21.429  -12.195 -15.290 1.00 74.13 ? 76  ASP A OD2  2  
ATOM 8394   H H    . ASP A 1 76  ? 20.361  -8.957  -14.551 1.00 63.53 ? 76  ASP A H    2  
ATOM 8395   H HA   . ASP A 1 76  ? 22.911  -8.512  -13.247 1.00 21.24 ? 76  ASP A HA   2  
ATOM 8396   H HB2  . ASP A 1 76  ? 23.381  -10.850 -13.913 1.00 33.43 ? 76  ASP A HB2  2  
ATOM 8397   H HB3  . ASP A 1 76  ? 21.787  -10.702 -13.174 1.00 61.23 ? 76  ASP A HB3  2  
ATOM 8398   N N    . ASN A 1 77  ? 22.857  -7.664  -16.189 1.00 1.40  ? 77  ASN A N    2  
ATOM 8399   C CA   . ASN A 1 77  ? 23.631  -7.252  -17.400 1.00 35.23 ? 77  ASN A CA   2  
ATOM 8400   C C    . ASN A 1 77  ? 23.434  -5.750  -17.646 1.00 72.55 ? 77  ASN A C    2  
ATOM 8401   O O    . ASN A 1 77  ? 22.873  -5.360  -18.651 1.00 32.12 ? 77  ASN A O    2  
ATOM 8402   C CB   . ASN A 1 77  ? 23.105  -8.027  -18.611 1.00 4.32  ? 77  ASN A CB   2  
ATOM 8403   C CG   . ASN A 1 77  ? 23.938  -7.676  -19.844 1.00 31.12 ? 77  ASN A CG   2  
ATOM 8404   O OD1  . ASN A 1 77  ? 23.416  -7.581  -20.937 1.00 73.34 ? 77  ASN A OD1  2  
ATOM 8405   N ND2  . ASN A 1 77  ? 25.222  -7.479  -19.715 1.00 24.21 ? 77  ASN A ND2  2  
ATOM 8406   H H    . ASN A 1 77  ? 21.975  -7.272  -16.022 1.00 54.43 ? 77  ASN A H    2  
ATOM 8407   H HA   . ASN A 1 77  ? 24.680  -7.471  -17.270 1.00 54.21 ? 77  ASN A HA   2  
ATOM 8408   H HB2  . ASN A 1 77  ? 23.175  -9.088  -18.417 1.00 32.45 ? 77  ASN A HB2  2  
ATOM 8409   H HB3  . ASN A 1 77  ? 22.073  -7.761  -18.788 1.00 0.02  ? 77  ASN A HB3  2  
ATOM 8410   H HD21 . ASN A 1 77  ? 25.643  -7.556  -18.834 1.00 14.03 ? 77  ASN A HD21 2  
ATOM 8411   H HD22 . ASN A 1 77  ? 25.764  -7.253  -20.500 1.00 12.01 ? 77  ASN A HD22 2  
ATOM 8412   N N    . PRO A 1 78  ? 23.879  -4.905  -16.743 1.00 23.12 ? 78  PRO A N    2  
ATOM 8413   C CA   . PRO A 1 78  ? 23.725  -3.427  -16.897 1.00 1.33  ? 78  PRO A CA   2  
ATOM 8414   C C    . PRO A 1 78  ? 24.224  -2.944  -18.264 1.00 44.23 ? 78  PRO A C    2  
ATOM 8415   O O    . PRO A 1 78  ? 25.346  -2.497  -18.408 1.00 54.40 ? 78  PRO A O    2  
ATOM 8416   C CB   . PRO A 1 78  ? 24.561  -2.828  -15.740 1.00 31.20 ? 78  PRO A CB   2  
ATOM 8417   C CG   . PRO A 1 78  ? 25.363  -3.971  -15.185 1.00 10.52 ? 78  PRO A CG   2  
ATOM 8418   C CD   . PRO A 1 78  ? 24.570  -5.239  -15.489 1.00 63.22 ? 78  PRO A CD   2  
ATOM 8419   H HA   . PRO A 1 78  ? 22.688  -3.155  -16.773 1.00 71.32 ? 78  PRO A HA   2  
ATOM 8420   H HB2  . PRO A 1 78  ? 25.217  -2.045  -16.106 1.00 24.22 ? 78  PRO A HB2  2  
ATOM 8421   H HB3  . PRO A 1 78  ? 23.908  -2.432  -14.973 1.00 23.41 ? 78  PRO A HB3  2  
ATOM 8422   H HG2  . PRO A 1 78  ? 26.332  -4.013  -15.666 1.00 10.44 ? 78  PRO A HG2  2  
ATOM 8423   H HG3  . PRO A 1 78  ? 25.484  -3.865  -14.117 1.00 30.55 ? 78  PRO A HG3  2  
ATOM 8424   H HD2  . PRO A 1 78  ? 25.239  -6.075  -15.615 1.00 51.42 ? 78  PRO A HD2  2  
ATOM 8425   H HD3  . PRO A 1 78  ? 23.853  -5.436  -14.710 1.00 12.45 ? 78  PRO A HD3  2  
ATOM 8426   N N    . THR A 1 79  ? 23.386  -3.032  -19.265 1.00 62.53 ? 79  THR A N    2  
ATOM 8427   C CA   . THR A 1 79  ? 23.770  -2.585  -20.640 1.00 33.53 ? 79  THR A CA   2  
ATOM 8428   C C    . THR A 1 79  ? 22.896  -1.398  -21.045 1.00 20.01 ? 79  THR A C    2  
ATOM 8429   O O    . THR A 1 79  ? 21.810  -1.211  -20.535 1.00 43.50 ? 79  THR A O    2  
ATOM 8430   C CB   . THR A 1 79  ? 23.548  -3.735  -21.627 1.00 23.20 ? 79  THR A CB   2  
ATOM 8431   O OG1  . THR A 1 79  ? 22.233  -4.249  -21.464 1.00 54.34 ? 79  THR A OG1  2  
ATOM 8432   C CG2  . THR A 1 79  ? 24.569  -4.843  -21.362 1.00 60.10 ? 79  THR A CG2  2  
ATOM 8433   H H    . THR A 1 79  ? 22.490  -3.394  -19.108 1.00 43.40 ? 79  THR A H    2  
ATOM 8434   H HA   . THR A 1 79  ? 24.810  -2.289  -20.663 1.00 3.44  ? 79  THR A HA   2  
ATOM 8435   H HB   . THR A 1 79  ? 23.671  -3.373  -22.636 1.00 51.53 ? 79  THR A HB   2  
ATOM 8436   H HG1  . THR A 1 79  ? 21.731  -4.034  -22.254 1.00 30.12 ? 79  THR A HG1  2  
ATOM 8437   H HG21 . THR A 1 79  ? 24.351  -5.691  -21.994 1.00 11.33 ? 79  THR A HG21 2  
ATOM 8438   H HG22 . THR A 1 79  ? 24.515  -5.142  -20.326 1.00 60.44 ? 79  THR A HG22 2  
ATOM 8439   H HG23 . THR A 1 79  ? 25.561  -4.477  -21.579 1.00 20.32 ? 79  THR A HG23 2  
ATOM 8440   N N    . SER A 1 80  ? 23.362  -0.595  -21.959 1.00 14.23 ? 80  SER A N    2  
ATOM 8441   C CA   . SER A 1 80  ? 22.560  0.580   -22.400 1.00 73.44 ? 80  SER A CA   2  
ATOM 8442   C C    . SER A 1 80  ? 21.277  0.099   -23.082 1.00 54.34 ? 80  SER A C    2  
ATOM 8443   O O    . SER A 1 80  ? 20.222  0.676   -22.916 1.00 3.24  ? 80  SER A O    2  
ATOM 8444   C CB   . SER A 1 80  ? 23.387  1.406   -23.387 1.00 35.41 ? 80  SER A CB   2  
ATOM 8445   O OG   . SER A 1 80  ? 22.520  2.028   -24.326 1.00 24.32 ? 80  SER A OG   2  
ATOM 8446   H H    . SER A 1 80  ? 24.241  -0.765  -22.358 1.00 30.53 ? 80  SER A H    2  
ATOM 8447   H HA   . SER A 1 80  ? 22.305  1.187   -21.543 1.00 74.14 ? 80  SER A HA   2  
ATOM 8448   H HB2  . SER A 1 80  ? 23.939  2.164   -22.855 1.00 13.33 ? 80  SER A HB2  2  
ATOM 8449   H HB3  . SER A 1 80  ? 24.082  0.754   -23.900 1.00 54.00 ? 80  SER A HB3  2  
ATOM 8450   H HG   . SER A 1 80  ? 21.698  2.238   -23.878 1.00 41.13 ? 80  SER A HG   2  
ATOM 8451   N N    . GLU A 1 81  ? 21.359  -0.952  -23.851 1.00 2.14  ? 81  GLU A N    2  
ATOM 8452   C CA   . GLU A 1 81  ? 20.142  -1.463  -24.543 1.00 61.54 ? 81  GLU A CA   2  
ATOM 8453   C C    . GLU A 1 81  ? 19.048  -1.737  -23.510 1.00 71.42 ? 81  GLU A C    2  
ATOM 8454   O O    . GLU A 1 81  ? 17.899  -1.385  -23.697 1.00 65.43 ? 81  GLU A O    2  
ATOM 8455   C CB   . GLU A 1 81  ? 20.484  -2.759  -25.283 1.00 60.53 ? 81  GLU A CB   2  
ATOM 8456   C CG   . GLU A 1 81  ? 19.284  -3.203  -26.123 1.00 42.25 ? 81  GLU A CG   2  
ATOM 8457   C CD   . GLU A 1 81  ? 19.605  -4.530  -26.812 1.00 24.42 ? 81  GLU A CD   2  
ATOM 8458   O OE1  . GLU A 1 81  ? 20.693  -5.038  -26.597 1.00 30.23 ? 81  GLU A OE1  2  
ATOM 8459   O OE2  . GLU A 1 81  ? 18.758  -5.016  -27.543 1.00 41.41 ? 81  GLU A OE2  2  
ATOM 8460   H H    . GLU A 1 81  ? 22.220  -1.404  -23.975 1.00 62.04 ? 81  GLU A H    2  
ATOM 8461   H HA   . GLU A 1 81  ? 19.793  -0.726  -25.251 1.00 2.40  ? 81  GLU A HA   2  
ATOM 8462   H HB2  . GLU A 1 81  ? 21.333  -2.591  -25.928 1.00 22.11 ? 81  GLU A HB2  2  
ATOM 8463   H HB3  . GLU A 1 81  ? 20.723  -3.530  -24.566 1.00 2.22  ? 81  GLU A HB3  2  
ATOM 8464   H HG2  . GLU A 1 81  ? 18.423  -3.328  -25.482 1.00 33.22 ? 81  GLU A HG2  2  
ATOM 8465   H HG3  . GLU A 1 81  ? 19.071  -2.454  -26.870 1.00 63.42 ? 81  GLU A HG3  2  
ATOM 8466   N N    . GLU A 1 82  ? 19.393  -2.362  -22.418 1.00 43.21 ? 82  GLU A N    2  
ATOM 8467   C CA   . GLU A 1 82  ? 18.373  -2.654  -21.374 1.00 54.52 ? 82  GLU A CA   2  
ATOM 8468   C C    . GLU A 1 82  ? 18.030  -1.367  -20.622 1.00 73.43 ? 82  GLU A C    2  
ATOM 8469   O O    . GLU A 1 82  ? 16.927  -1.191  -20.144 1.00 51.41 ? 82  GLU A O    2  
ATOM 8470   C CB   . GLU A 1 82  ? 18.927  -3.688  -20.391 1.00 73.21 ? 82  GLU A CB   2  
ATOM 8471   C CG   . GLU A 1 82  ? 17.785  -4.253  -19.546 1.00 11.24 ? 82  GLU A CG   2  
ATOM 8472   C CD   . GLU A 1 82  ? 18.323  -5.356  -18.635 1.00 53.12 ? 82  GLU A CD   2  
ATOM 8473   O OE1  . GLU A 1 82  ? 19.467  -5.738  -18.814 1.00 34.22 ? 82  GLU A OE1  2  
ATOM 8474   O OE2  . GLU A 1 82  ? 17.582  -5.800  -17.773 1.00 3.32  ? 82  GLU A OE2  2  
ATOM 8475   H H    . GLU A 1 82  ? 20.324  -2.637  -22.284 1.00 21.54 ? 82  GLU A H    2  
ATOM 8476   H HA   . GLU A 1 82  ? 17.481  -3.045  -21.843 1.00 61.32 ? 82  GLU A HA   2  
ATOM 8477   H HB2  . GLU A 1 82  ? 19.402  -4.488  -20.938 1.00 54.33 ? 82  GLU A HB2  2  
ATOM 8478   H HB3  . GLU A 1 82  ? 19.651  -3.216  -19.744 1.00 15.23 ? 82  GLU A HB3  2  
ATOM 8479   H HG2  . GLU A 1 82  ? 17.358  -3.463  -18.944 1.00 34.25 ? 82  GLU A HG2  2  
ATOM 8480   H HG3  . GLU A 1 82  ? 17.025  -4.663  -20.194 1.00 32.03 ? 82  GLU A HG3  2  
ATOM 8481   N N    . GLU A 1 83  ? 18.970  -0.468  -20.508 1.00 45.41 ? 83  GLU A N    2  
ATOM 8482   C CA   . GLU A 1 83  ? 18.699  0.803   -19.781 1.00 13.43 ? 83  GLU A CA   2  
ATOM 8483   C C    . GLU A 1 83  ? 17.607  1.592   -20.506 1.00 64.54 ? 83  GLU A C    2  
ATOM 8484   O O    . GLU A 1 83  ? 16.583  1.912   -19.938 1.00 2.12  ? 83  GLU A O    2  
ATOM 8485   C CB   . GLU A 1 83  ? 19.980  1.639   -19.724 1.00 64.01 ? 83  GLU A CB   2  
ATOM 8486   C CG   . GLU A 1 83  ? 19.749  2.867   -18.842 1.00 12.12 ? 83  GLU A CG   2  
ATOM 8487   C CD   . GLU A 1 83  ? 21.024  3.712   -18.799 1.00 15.41 ? 83  GLU A CD   2  
ATOM 8488   O OE1  . GLU A 1 83  ? 22.023  3.269   -19.339 1.00 61.41 ? 83  GLU A OE1  2  
ATOM 8489   O OE2  . GLU A 1 83  ? 20.978  4.788   -18.225 1.00 74.22 ? 83  GLU A OE2  2  
ATOM 8490   H H    . GLU A 1 83  ? 19.854  -0.632  -20.898 1.00 71.41 ? 83  GLU A H    2  
ATOM 8491   H HA   . GLU A 1 83  ? 18.373  0.579   -18.776 1.00 31.41 ? 83  GLU A HA   2  
ATOM 8492   H HB2  . GLU A 1 83  ? 20.781  1.043   -19.310 1.00 42.11 ? 83  GLU A HB2  2  
ATOM 8493   H HB3  . GLU A 1 83  ? 20.246  1.958   -20.720 1.00 23.03 ? 83  GLU A HB3  2  
ATOM 8494   H HG2  . GLU A 1 83  ? 18.940  3.456   -19.249 1.00 34.25 ? 83  GLU A HG2  2  
ATOM 8495   H HG3  . GLU A 1 83  ? 19.497  2.550   -17.842 1.00 32.03 ? 83  GLU A HG3  2  
ATOM 8496   N N    . VAL A 1 84  ? 17.811  1.906   -21.756 1.00 23.53 ? 84  VAL A N    2  
ATOM 8497   C CA   . VAL A 1 84  ? 16.774  2.674   -22.502 1.00 21.42 ? 84  VAL A CA   2  
ATOM 8498   C C    . VAL A 1 84  ? 15.463  1.889   -22.499 1.00 53.34 ? 84  VAL A C    2  
ATOM 8499   O O    . VAL A 1 84  ? 14.399  2.440   -22.300 1.00 73.20 ? 84  VAL A O    2  
ATOM 8500   C CB   . VAL A 1 84  ? 17.233  2.900   -23.944 1.00 54.40 ? 84  VAL A CB   2  
ATOM 8501   C CG1  . VAL A 1 84  ? 18.501  3.755   -23.949 1.00 5.11  ? 84  VAL A CG1  2  
ATOM 8502   C CG2  . VAL A 1 84  ? 17.526  1.553   -24.608 1.00 53.05 ? 84  VAL A CG2  2  
ATOM 8503   H H    . VAL A 1 84  ? 18.641  1.639   -22.202 1.00 14.11 ? 84  VAL A H    2  
ATOM 8504   H HA   . VAL A 1 84  ? 16.621  3.629   -22.020 1.00 13.34 ? 84  VAL A HA   2  
ATOM 8505   H HB   . VAL A 1 84  ? 16.455  3.411   -24.492 1.00 62.13 ? 84  VAL A HB   2  
ATOM 8506   H HG11 . VAL A 1 84  ? 19.191  3.380   -23.207 1.00 2.43  ? 84  VAL A HG11 2  
ATOM 8507   H HG12 . VAL A 1 84  ? 18.245  4.778   -23.717 1.00 5.34  ? 84  VAL A HG12 2  
ATOM 8508   H HG13 . VAL A 1 84  ? 18.962  3.711   -24.924 1.00 74.15 ? 84  VAL A HG13 2  
ATOM 8509   H HG21 . VAL A 1 84  ? 16.597  1.048   -24.825 1.00 22.14 ? 84  VAL A HG21 2  
ATOM 8510   H HG22 . VAL A 1 84  ? 18.119  0.945   -23.943 1.00 45.40 ? 84  VAL A HG22 2  
ATOM 8511   H HG23 . VAL A 1 84  ? 18.070  1.715   -25.527 1.00 2.41  ? 84  VAL A HG23 2  
ATOM 8512   N N    . HIS A 1 85  ? 15.529  0.604   -22.714 1.00 53.33 ? 85  HIS A N    2  
ATOM 8513   C CA   . HIS A 1 85  ? 14.284  -0.213  -22.720 1.00 32.22 ? 85  HIS A CA   2  
ATOM 8514   C C    . HIS A 1 85  ? 13.637  -0.172  -21.334 1.00 31.14 ? 85  HIS A C    2  
ATOM 8515   O O    . HIS A 1 85  ? 12.463  -0.434  -21.180 1.00 43.31 ? 85  HIS A O    2  
ATOM 8516   C CB   . HIS A 1 85  ? 14.625  -1.661  -23.083 1.00 31.13 ? 85  HIS A CB   2  
ATOM 8517   C CG   . HIS A 1 85  ? 14.929  -1.754  -24.553 1.00 3.12  ? 85  HIS A CG   2  
ATOM 8518   N ND1  . HIS A 1 85  ? 16.028  -2.448  -25.041 1.00 51.32 ? 85  HIS A ND1  2  
ATOM 8519   C CD2  . HIS A 1 85  ? 14.287  -1.246  -25.656 1.00 45.21 ? 85  HIS A CD2  2  
ATOM 8520   C CE1  . HIS A 1 85  ? 16.014  -2.340  -26.383 1.00 53.22 ? 85  HIS A CE1  2  
ATOM 8521   N NE2  . HIS A 1 85  ? 14.974  -1.618  -26.805 1.00 4.21  ? 85  HIS A NE2  2  
ATOM 8522   H H    . HIS A 1 85  ? 16.398  0.176   -22.869 1.00 22.42 ? 85  HIS A H    2  
ATOM 8523   H HA   . HIS A 1 85  ? 13.595  0.188   -23.449 1.00 43.30 ? 85  HIS A HA   2  
ATOM 8524   H HB2  . HIS A 1 85  ? 15.488  -1.980  -22.516 1.00 34.40 ? 85  HIS A HB2  2  
ATOM 8525   H HB3  . HIS A 1 85  ? 13.785  -2.298  -22.848 1.00 72.54 ? 85  HIS A HB3  2  
ATOM 8526   H HD1  . HIS A 1 85  ? 16.693  -2.930  -24.506 1.00 53.55 ? 85  HIS A HD1  2  
ATOM 8527   H HD2  . HIS A 1 85  ? 13.387  -0.649  -25.633 1.00 71.41 ? 85  HIS A HD2  2  
ATOM 8528   H HE1  . HIS A 1 85  ? 16.751  -2.782  -27.036 1.00 23.51 ? 85  HIS A HE1  2  
ATOM 8529   H HE2  . HIS A 1 85  ? 14.744  -1.397  -27.732 1.00 0.00  ? 85  HIS A HE2  2  
ATOM 8530   N N    . ALA A 1 86  ? 14.394  0.148   -20.321 1.00 0.13  ? 86  ALA A N    2  
ATOM 8531   C CA   . ALA A 1 86  ? 13.816  0.196   -18.947 1.00 22.42 ? 86  ALA A CA   2  
ATOM 8532   C C    . ALA A 1 86  ? 12.982  1.469   -18.773 1.00 64.11 ? 86  ALA A C    2  
ATOM 8533   O O    . ALA A 1 86  ? 11.859  1.427   -18.307 1.00 14.43 ? 86  ALA A O    2  
ATOM 8534   C CB   . ALA A 1 86  ? 14.947  0.183   -17.919 1.00 24.54 ? 86  ALA A CB   2  
ATOM 8535   H H    . ALA A 1 86  ? 15.342  0.352   -20.461 1.00 4.30  ? 86  ALA A H    2  
ATOM 8536   H HA   . ALA A 1 86  ? 13.185  -0.668  -18.795 1.00 64.22 ? 86  ALA A HA   2  
ATOM 8537   H HB1  . ALA A 1 86  ? 14.537  0.007   -16.935 1.00 30.31 ? 86  ALA A HB1  2  
ATOM 8538   H HB2  . ALA A 1 86  ? 15.457  1.135   -17.932 1.00 12.13 ? 86  ALA A HB2  2  
ATOM 8539   H HB3  . ALA A 1 86  ? 15.646  -0.604  -18.163 1.00 41.52 ? 86  ALA A HB3  2  
ATOM 8540   N N    . PHE A 1 87  ? 13.518  2.604   -19.138 1.00 63.44 ? 87  PHE A N    2  
ATOM 8541   C CA   . PHE A 1 87  ? 12.750  3.872   -18.985 1.00 1.22  ? 87  PHE A CA   2  
ATOM 8542   C C    . PHE A 1 87  ? 11.779  4.020   -20.155 1.00 2.13  ? 87  PHE A C    2  
ATOM 8543   O O    . PHE A 1 87  ? 10.737  4.633   -20.035 1.00 24.23 ? 87  PHE A O    2  
ATOM 8544   C CB   . PHE A 1 87  ? 13.716  5.062   -18.961 1.00 45.30 ? 87  PHE A CB   2  
ATOM 8545   C CG   . PHE A 1 87  ? 14.533  5.019   -17.692 1.00 53.13 ? 87  PHE A CG   2  
ATOM 8546   C CD1  . PHE A 1 87  ? 15.683  4.225   -17.628 1.00 70.24 ? 87  PHE A CD1  2  
ATOM 8547   C CD2  . PHE A 1 87  ? 14.141  5.774   -16.580 1.00 44.31 ? 87  PHE A CD2  2  
ATOM 8548   C CE1  . PHE A 1 87  ? 16.442  4.184   -16.453 1.00 74.34 ? 87  PHE A CE1  2  
ATOM 8549   C CE2  . PHE A 1 87  ? 14.900  5.733   -15.404 1.00 21.22 ? 87  PHE A CE2  2  
ATOM 8550   C CZ   . PHE A 1 87  ? 16.051  4.938   -15.341 1.00 34.42 ? 87  PHE A CZ   2  
ATOM 8551   H H    . PHE A 1 87  ? 14.422  2.622   -19.513 1.00 42.32 ? 87  PHE A H    2  
ATOM 8552   H HA   . PHE A 1 87  ? 12.193  3.845   -18.060 1.00 73.23 ? 87  PHE A HA   2  
ATOM 8553   H HB2  . PHE A 1 87  ? 14.375  5.013   -19.816 1.00 15.11 ? 87  PHE A HB2  2  
ATOM 8554   H HB3  . PHE A 1 87  ? 13.153  5.982   -18.993 1.00 31.01 ? 87  PHE A HB3  2  
ATOM 8555   H HD1  . PHE A 1 87  ? 15.985  3.644   -18.485 1.00 73.00 ? 87  PHE A HD1  2  
ATOM 8556   H HD2  . PHE A 1 87  ? 13.254  6.387   -16.629 1.00 2.31  ? 87  PHE A HD2  2  
ATOM 8557   H HE1  . PHE A 1 87  ? 17.330  3.570   -16.404 1.00 43.35 ? 87  PHE A HE1  2  
ATOM 8558   H HE2  . PHE A 1 87  ? 14.599  6.315   -14.547 1.00 23.02 ? 87  PHE A HE2  2  
ATOM 8559   H HZ   . PHE A 1 87  ? 16.638  4.907   -14.435 1.00 53.04 ? 87  PHE A HZ   2  
ATOM 8560   N N    . GLU A 1 88  ? 12.110  3.464   -21.288 1.00 24.11 ? 88  GLU A N    2  
ATOM 8561   C CA   . GLU A 1 88  ? 11.200  3.578   -22.459 1.00 33.33 ? 88  GLU A CA   2  
ATOM 8562   C C    . GLU A 1 88  ? 9.985   2.670   -22.258 1.00 12.42 ? 88  GLU A C    2  
ATOM 8563   O O    . GLU A 1 88  ? 8.864   3.049   -22.533 1.00 74.14 ? 88  GLU A O    2  
ATOM 8564   C CB   . GLU A 1 88  ? 11.942  3.165   -23.732 1.00 74.42 ? 88  GLU A CB   2  
ATOM 8565   C CG   . GLU A 1 88  ? 12.984  4.229   -24.086 1.00 1.42  ? 88  GLU A CG   2  
ATOM 8566   C CD   . GLU A 1 88  ? 12.278  5.502   -24.554 1.00 73.01 ? 88  GLU A CD   2  
ATOM 8567   O OE1  . GLU A 1 88  ? 11.105  5.420   -24.881 1.00 72.33 ? 88  GLU A OE1  2  
ATOM 8568   O OE2  . GLU A 1 88  ? 12.921  6.539   -24.577 1.00 33.51 ? 88  GLU A OE2  2  
ATOM 8569   H H    . GLU A 1 88  ? 12.955  2.973   -21.367 1.00 23.32 ? 88  GLU A H    2  
ATOM 8570   H HA   . GLU A 1 88  ? 10.872  4.600   -22.550 1.00 22.41 ? 88  GLU A HA   2  
ATOM 8571   H HB2  . GLU A 1 88  ? 12.432  2.217   -23.572 1.00 21.43 ? 88  GLU A HB2  2  
ATOM 8572   H HB3  . GLU A 1 88  ? 11.236  3.072   -24.545 1.00 53.14 ? 88  GLU A HB3  2  
ATOM 8573   H HG2  . GLU A 1 88  ? 13.583  4.449   -23.214 1.00 62.11 ? 88  GLU A HG2  2  
ATOM 8574   H HG3  . GLU A 1 88  ? 13.620  3.861   -24.877 1.00 42.25 ? 88  GLU A HG3  2  
ATOM 8575   N N    . GLN A 1 89  ? 10.194  1.471   -21.781 1.00 23.14 ? 89  GLN A N    2  
ATOM 8576   C CA   . GLN A 1 89  ? 9.044   0.547   -21.569 1.00 70.41 ? 89  GLN A CA   2  
ATOM 8577   C C    . GLN A 1 89  ? 8.169   1.066   -20.427 1.00 21.43 ? 89  GLN A C    2  
ATOM 8578   O O    . GLN A 1 89  ? 6.968   1.188   -20.562 1.00 35.33 ? 89  GLN A O    2  
ATOM 8579   C CB   . GLN A 1 89  ? 9.563   -0.850  -21.221 1.00 34.11 ? 89  GLN A CB   2  
ATOM 8580   C CG   . GLN A 1 89  ? 10.242  -1.462  -22.448 1.00 12.52 ? 89  GLN A CG   2  
ATOM 8581   C CD   . GLN A 1 89  ? 9.179   -1.891  -23.461 1.00 33.33 ? 89  GLN A CD   2  
ATOM 8582   O OE1  . GLN A 1 89  ? 8.273   -2.631  -23.132 1.00 64.13 ? 89  GLN A OE1  2  
ATOM 8583   N NE2  . GLN A 1 89  ? 9.251   -1.454  -24.688 1.00 74.24 ? 89  GLN A NE2  2  
ATOM 8584   H H    . GLN A 1 89  ? 11.105  1.180   -21.566 1.00 44.14 ? 89  GLN A H    2  
ATOM 8585   H HA   . GLN A 1 89  ? 8.456   0.495   -22.474 1.00 62.52 ? 89  GLN A HA   2  
ATOM 8586   H HB2  . GLN A 1 89  ? 10.273  -0.778  -20.411 1.00 71.44 ? 89  GLN A HB2  2  
ATOM 8587   H HB3  . GLN A 1 89  ? 8.736   -1.476  -20.920 1.00 64.43 ? 89  GLN A HB3  2  
ATOM 8588   H HG2  . GLN A 1 89  ? 10.895  -0.730  -22.901 1.00 23.41 ? 89  GLN A HG2  2  
ATOM 8589   H HG3  . GLN A 1 89  ? 10.820  -2.324  -22.149 1.00 63.42 ? 89  GLN A HG3  2  
ATOM 8590   H HE21 . GLN A 1 89  ? 9.981   -0.857  -24.954 1.00 74.32 ? 89  GLN A HE21 2  
ATOM 8591   H HE22 . GLN A 1 89  ? 8.574   -1.723  -25.345 1.00 74.52 ? 89  GLN A HE22 2  
ATOM 8592   N N    . GLY A 1 90  ? 8.757   1.379   -19.300 1.00 61.32 ? 90  GLY A N    2  
ATOM 8593   C CA   . GLY A 1 90  ? 7.946   1.895   -18.155 1.00 51.44 ? 90  GLY A CA   2  
ATOM 8594   C C    . GLY A 1 90  ? 8.606   1.513   -16.827 1.00 61.51 ? 90  GLY A C    2  
ATOM 8595   O O    . GLY A 1 90  ? 8.053   0.767   -16.045 1.00 1.24  ? 90  GLY A O    2  
ATOM 8596   H H    . GLY A 1 90  ? 9.728   1.278   -19.207 1.00 74.21 ? 90  GLY A H    2  
ATOM 8597   H HA2  . GLY A 1 90  ? 7.875   2.971   -18.224 1.00 43.31 ? 90  GLY A HA2  2  
ATOM 8598   H HA3  . GLY A 1 90  ? 6.954   1.468   -18.192 1.00 20.55 ? 90  GLY A HA3  2  
ATOM 8599   N N    . ALA A 1 91  ? 9.784   2.026   -16.565 1.00 13.33 ? 91  ALA A N    2  
ATOM 8600   C CA   . ALA A 1 91  ? 10.493  1.709   -15.282 1.00 55.33 ? 91  ALA A CA   2  
ATOM 8601   C C    . ALA A 1 91  ? 10.960  3.014   -14.634 1.00 2.41  ? 91  ALA A C    2  
ATOM 8602   O O    . ALA A 1 91  ? 11.393  3.929   -15.306 1.00 24.55 ? 91  ALA A O    2  
ATOM 8603   C CB   . ALA A 1 91  ? 11.708  0.826   -15.578 1.00 34.31 ? 91  ALA A CB   2  
ATOM 8604   H H    . ALA A 1 91  ? 10.204  2.629   -17.213 1.00 64.10 ? 91  ALA A H    2  
ATOM 8605   H HA   . ALA A 1 91  ? 9.829   1.192   -14.601 1.00 14.40 ? 91  ALA A HA   2  
ATOM 8606   H HB1  . ALA A 1 91  ? 11.421  0.035   -16.254 1.00 4.22  ? 91  ALA A HB1  2  
ATOM 8607   H HB2  . ALA A 1 91  ? 12.075  0.398   -14.657 1.00 40.42 ? 91  ALA A HB2  2  
ATOM 8608   H HB3  . ALA A 1 91  ? 12.485  1.423   -16.032 1.00 33.41 ? 91  ALA A HB3  2  
ATOM 8609   N N    . ASP A 1 92  ? 10.873  3.114   -13.334 1.00 71.14 ? 92  ASP A N    2  
ATOM 8610   C CA   . ASP A 1 92  ? 11.313  4.368   -12.658 1.00 73.42 ? 92  ASP A CA   2  
ATOM 8611   C C    . ASP A 1 92  ? 12.835  4.371   -12.526 1.00 63.44 ? 92  ASP A C    2  
ATOM 8612   O O    . ASP A 1 92  ? 13.479  5.387   -12.692 1.00 11.14 ? 92  ASP A O    2  
ATOM 8613   C CB   . ASP A 1 92  ? 10.679  4.449   -11.269 1.00 3.52  ? 92  ASP A CB   2  
ATOM 8614   C CG   . ASP A 1 92  ? 9.165   4.610   -11.410 1.00 63.41 ? 92  ASP A CG   2  
ATOM 8615   O OD1  . ASP A 1 92  ? 8.577   3.855   -12.166 1.00 72.32 ? 92  ASP A OD1  2  
ATOM 8616   O OD2  . ASP A 1 92  ? 8.620   5.489   -10.763 1.00 20.14 ? 92  ASP A OD2  2  
ATOM 8617   H H    . ASP A 1 92  ? 10.521  2.366   -12.804 1.00 41.32 ? 92  ASP A H    2  
ATOM 8618   H HA   . ASP A 1 92  ? 11.002  5.220   -13.244 1.00 54.30 ? 92  ASP A HA   2  
ATOM 8619   H HB2  . ASP A 1 92  ? 10.898  3.544   -10.720 1.00 1.23  ? 92  ASP A HB2  2  
ATOM 8620   H HB3  . ASP A 1 92  ? 11.082  5.299   -10.738 1.00 11.01 ? 92  ASP A HB3  2  
ATOM 8621   N N    . ASP A 1 93  ? 13.417  3.241   -12.228 1.00 33.13 ? 93  ASP A N    2  
ATOM 8622   C CA   . ASP A 1 93  ? 14.900  3.177   -12.085 1.00 53.12 ? 93  ASP A CA   2  
ATOM 8623   C C    . ASP A 1 93  ? 15.384  1.770   -12.418 1.00 72.45 ? 93  ASP A C    2  
ATOM 8624   O O    . ASP A 1 93  ? 14.612  0.834   -12.482 1.00 75.04 ? 93  ASP A O    2  
ATOM 8625   C CB   . ASP A 1 93  ? 15.296  3.533   -10.651 1.00 74.33 ? 93  ASP A CB   2  
ATOM 8626   C CG   . ASP A 1 93  ? 14.904  4.983   -10.358 1.00 3.43  ? 93  ASP A CG   2  
ATOM 8627   O OD1  . ASP A 1 93  ? 15.232  5.839   -11.163 1.00 70.32 ? 93  ASP A OD1  2  
ATOM 8628   O OD2  . ASP A 1 93  ? 14.284  5.212   -9.333  1.00 0.02  ? 93  ASP A OD2  2  
ATOM 8629   H H    . ASP A 1 93  ? 12.878  2.433   -12.098 1.00 23.32 ? 93  ASP A H    2  
ATOM 8630   H HA   . ASP A 1 93  ? 15.361  3.872   -12.770 1.00 24.22 ? 93  ASP A HA   2  
ATOM 8631   H HB2  . ASP A 1 93  ? 14.785  2.876   -9.964  1.00 72.01 ? 93  ASP A HB2  2  
ATOM 8632   H HB3  . ASP A 1 93  ? 16.363  3.420   -10.533 1.00 61.31 ? 93  ASP A HB3  2  
ATOM 8633   N N    . TYR A 1 94  ? 16.661  1.621   -12.647 1.00 63.14 ? 94  TYR A N    2  
ATOM 8634   C CA   . TYR A 1 94  ? 17.218  0.282   -12.996 1.00 25.13 ? 94  TYR A CA   2  
ATOM 8635   C C    . TYR A 1 94  ? 18.558  0.104   -12.272 1.00 12.04 ? 94  TYR A C    2  
ATOM 8636   O O    . TYR A 1 94  ? 19.415  0.964   -12.314 1.00 21.44 ? 94  TYR A O    2  
ATOM 8637   C CB   . TYR A 1 94  ? 17.360  0.211   -14.543 1.00 44.23 ? 94  TYR A CB   2  
ATOM 8638   C CG   . TYR A 1 94  ? 18.789  -0.068  -14.982 1.00 2.34  ? 94  TYR A CG   2  
ATOM 8639   C CD1  . TYR A 1 94  ? 19.320  -1.359  -14.868 1.00 71.33 ? 94  TYR A CD1  2  
ATOM 8640   C CD2  . TYR A 1 94  ? 19.574  0.966   -15.510 1.00 24.21 ? 94  TYR A CD2  2  
ATOM 8641   C CE1  . TYR A 1 94  ? 20.635  -1.613  -15.280 1.00 55.15 ? 94  TYR A CE1  2  
ATOM 8642   C CE2  . TYR A 1 94  ? 20.887  0.710   -15.922 1.00 4.32  ? 94  TYR A CE2  2  
ATOM 8643   C CZ   . TYR A 1 94  ? 21.417  -0.579  -15.807 1.00 1.23  ? 94  TYR A CZ   2  
ATOM 8644   O OH   . TYR A 1 94  ? 22.711  -0.831  -16.214 1.00 52.23 ? 94  TYR A OH   2  
ATOM 8645   H H    . TYR A 1 94  ? 17.257  2.397   -12.599 1.00 32.22 ? 94  TYR A H    2  
ATOM 8646   H HA   . TYR A 1 94  ? 16.542  -0.493  -12.654 1.00 4.03  ? 94  TYR A HA   2  
ATOM 8647   H HB2  . TYR A 1 94  ? 16.718  -0.565  -14.925 1.00 33.32 ? 94  TYR A HB2  2  
ATOM 8648   H HB3  . TYR A 1 94  ? 17.043  1.156   -14.964 1.00 70.13 ? 94  TYR A HB3  2  
ATOM 8649   H HD1  . TYR A 1 94  ? 18.717  -2.157  -14.461 1.00 53.23 ? 94  TYR A HD1  2  
ATOM 8650   H HD2  . TYR A 1 94  ? 19.165  1.962   -15.597 1.00 3.54  ? 94  TYR A HD2  2  
ATOM 8651   H HE1  . TYR A 1 94  ? 21.045  -2.607  -15.192 1.00 33.42 ? 94  TYR A HE1  2  
ATOM 8652   H HE2  . TYR A 1 94  ? 21.492  1.507   -16.329 1.00 31.32 ? 94  TYR A HE2  2  
ATOM 8653   H HH   . TYR A 1 94  ? 23.306  -0.416  -15.585 1.00 43.22 ? 94  TYR A HH   2  
ATOM 8654   N N    . ILE A 1 95  ? 18.725  -1.005  -11.590 1.00 64.53 ? 95  ILE A N    2  
ATOM 8655   C CA   . ILE A 1 95  ? 19.992  -1.256  -10.829 1.00 12.23 ? 95  ILE A CA   2  
ATOM 8656   C C    . ILE A 1 95  ? 20.625  -2.578  -11.282 1.00 24.44 ? 95  ILE A C    2  
ATOM 8657   O O    . ILE A 1 95  ? 19.941  -3.536  -11.593 1.00 53.34 ? 95  ILE A O    2  
ATOM 8658   C CB   . ILE A 1 95  ? 19.661  -1.333  -9.323  1.00 43.40 ? 95  ILE A CB   2  
ATOM 8659   C CG1  . ILE A 1 95  ? 18.491  -0.378  -9.008  1.00 15.34 ? 95  ILE A CG1  2  
ATOM 8660   C CG2  . ILE A 1 95  ? 20.890  -0.926  -8.498  1.00 71.13 ? 95  ILE A CG2  2  
ATOM 8661   C CD1  . ILE A 1 95  ? 17.139  -0.981  -9.448  1.00 15.23 ? 95  ILE A CD1  2  
ATOM 8662   H H    . ILE A 1 95  ? 18.001  -1.670  -11.564 1.00 25.40 ? 95  ILE A H    2  
ATOM 8663   H HA   . ILE A 1 95  ? 20.696  -0.452  -11.003 1.00 55.11 ? 95  ILE A HA   2  
ATOM 8664   H HB   . ILE A 1 95  ? 19.381  -2.344  -9.059  1.00 54.45 ? 95  ILE A HB   2  
ATOM 8665   H HG12 . ILE A 1 95  ? 18.459  -0.193  -7.946  1.00 13.12 ? 95  ILE A HG12 2  
ATOM 8666   H HG13 . ILE A 1 95  ? 18.646  0.557   -9.525  1.00 32.11 ? 95  ILE A HG13 2  
ATOM 8667   H HG21 . ILE A 1 95  ? 21.773  -1.382  -8.920  1.00 61.05 ? 95  ILE A HG21 2  
ATOM 8668   H HG22 . ILE A 1 95  ? 20.765  -1.261  -7.479  1.00 54.10 ? 95  ILE A HG22 2  
ATOM 8669   H HG23 . ILE A 1 95  ? 20.997  0.148   -8.514  1.00 73.12 ? 95  ILE A HG23 2  
ATOM 8670   H HD11 . ILE A 1 95  ? 16.505  -1.101  -8.583  1.00 64.14 ? 95  ILE A HD11 2  
ATOM 8671   H HD12 . ILE A 1 95  ? 17.283  -1.943  -9.921  1.00 74.51 ? 95  ILE A HD12 2  
ATOM 8672   H HD13 . ILE A 1 95  ? 16.662  -0.310  -10.146 1.00 14.00 ? 95  ILE A HD13 2  
ATOM 8673   N N    . ALA A 1 96  ? 21.930  -2.643  -11.302 1.00 30.40 ? 96  ALA A N    2  
ATOM 8674   C CA   . ALA A 1 96  ? 22.601  -3.907  -11.710 1.00 42.03 ? 96  ALA A CA   2  
ATOM 8675   C C    . ALA A 1 96  ? 22.207  -4.998  -10.716 1.00 64.32 ? 96  ALA A C    2  
ATOM 8676   O O    . ALA A 1 96  ? 22.278  -4.810  -9.518  1.00 54.13 ? 96  ALA A O    2  
ATOM 8677   C CB   . ALA A 1 96  ? 24.119  -3.714  -11.685 1.00 13.10 ? 96  ALA A CB   2  
ATOM 8678   H H    . ALA A 1 96  ? 22.465  -1.867  -11.034 1.00 40.31 ? 96  ALA A H    2  
ATOM 8679   H HA   . ALA A 1 96  ? 22.284  -4.185  -12.704 1.00 1.41  ? 96  ALA A HA   2  
ATOM 8680   H HB1  . ALA A 1 96  ? 24.444  -3.538  -10.670 1.00 21.14 ? 96  ALA A HB1  2  
ATOM 8681   H HB2  . ALA A 1 96  ? 24.384  -2.866  -12.300 1.00 21.23 ? 96  ALA A HB2  2  
ATOM 8682   H HB3  . ALA A 1 96  ? 24.601  -4.601  -12.069 1.00 52.20 ? 96  ALA A HB3  2  
ATOM 8683   N N    . LYS A 1 97  ? 21.773  -6.129  -11.194 1.00 62.20 ? 97  LYS A N    2  
ATOM 8684   C CA   . LYS A 1 97  ? 21.358  -7.209  -10.258 1.00 13.35 ? 97  LYS A CA   2  
ATOM 8685   C C    . LYS A 1 97  ? 22.438  -7.493  -9.217  1.00 22.33 ? 97  LYS A C    2  
ATOM 8686   O O    . LYS A 1 97  ? 22.150  -7.519  -8.040  1.00 22.10 ? 97  LYS A O    2  
ATOM 8687   C CB   . LYS A 1 97  ? 21.060  -8.511  -11.019 1.00 13.41 ? 97  LYS A CB   2  
ATOM 8688   C CG   . LYS A 1 97  ? 20.015  -9.389  -10.284 1.00 25.42 ? 97  LYS A CG   2  
ATOM 8689   C CD   . LYS A 1 97  ? 20.250  -9.478  -8.754  1.00 4.05  ? 97  LYS A CD   2  
ATOM 8690   C CE   . LYS A 1 97  ? 21.573  -10.201 -8.424  1.00 35.32 ? 97  LYS A CE   2  
ATOM 8691   N NZ   . LYS A 1 97  ? 21.304  -11.655 -8.241  1.00 2.00  ? 97  LYS A NZ   2  
ATOM 8692   H H    . LYS A 1 97  ? 21.707  -6.263  -12.162 1.00 2.30  ? 97  LYS A H    2  
ATOM 8693   H HA   . LYS A 1 97  ? 20.465  -6.881  -9.759  1.00 74.51 ? 97  LYS A HA   2  
ATOM 8694   H HB2  . LYS A 1 97  ? 20.678  -8.257  -11.973 1.00 24.12 ? 97  LYS A HB2  2  
ATOM 8695   H HB3  . LYS A 1 97  ? 21.960  -9.074  -11.162 1.00 21.32 ? 97  LYS A HB3  2  
ATOM 8696   H HG2  . LYS A 1 97  ? 19.034  -8.977  -10.457 1.00 2.22  ? 97  LYS A HG2  2  
ATOM 8697   H HG3  . LYS A 1 97  ? 20.049  -10.385 -10.700 1.00 70.04 ? 97  LYS A HG3  2  
ATOM 8698   H HD2  . LYS A 1 97  ? 20.239  -8.497  -8.312  1.00 23.01 ? 97  LYS A HD2  2  
ATOM 8699   H HD3  . LYS A 1 97  ? 19.444  -10.042 -8.325  1.00 35.32 ? 97  LYS A HD3  2  
ATOM 8700   H HE2  . LYS A 1 97  ? 22.282  -10.073 -9.220  1.00 22.53 ? 97  LYS A HE2  2  
ATOM 8701   H HE3  . LYS A 1 97  ? 21.987  -9.801  -7.510  1.00 60.54 ? 97  LYS A HE3  2  
ATOM 8702   H HZ1  . LYS A 1 97  ? 21.684  -12.183 -9.052  1.00 2.20  ? 97  LYS A HZ1  2  
ATOM 8703   H HZ2  . LYS A 1 97  ? 20.277  -11.811 -8.176  1.00 1.21  ? 97  LYS A HZ2  2  
ATOM 8704   H HZ3  . LYS A 1 97  ? 21.762  -11.986 -7.369  1.00 12.31 ? 97  LYS A HZ3  2  
ATOM 8705   N N    . PRO A 1 98  ? 23.662  -7.771  -9.608  1.00 70.01 ? 98  PRO A N    2  
ATOM 8706   C CA   . PRO A 1 98  ? 24.701  -8.122  -8.627  1.00 4.12  ? 98  PRO A CA   2  
ATOM 8707   C C    . PRO A 1 98  ? 24.653  -7.232  -7.372  1.00 13.34 ? 98  PRO A C    2  
ATOM 8708   O O    . PRO A 1 98  ? 25.284  -7.517  -6.374  1.00 21.24 ? 98  PRO A O    2  
ATOM 8709   C CB   . PRO A 1 98  ? 26.038  -7.970  -9.392  1.00 25.24 ? 98  PRO A CB   2  
ATOM 8710   C CG   . PRO A 1 98  ? 25.671  -7.379  -10.722 1.00 73.11 ? 98  PRO A CG   2  
ATOM 8711   C CD   . PRO A 1 98  ? 24.226  -7.791  -10.969 1.00 60.52 ? 98  PRO A CD   2  
ATOM 8712   H HA   . PRO A 1 98  ? 24.541  -9.151  -8.366  1.00 40.21 ? 98  PRO A HA   2  
ATOM 8713   H HB2  . PRO A 1 98  ? 26.715  -7.312  -8.857  1.00 33.14 ? 98  PRO A HB2  2  
ATOM 8714   H HB3  . PRO A 1 98  ? 26.500  -8.938  -9.534  1.00 63.30 ? 98  PRO A HB3  2  
ATOM 8715   H HG2  . PRO A 1 98  ? 25.750  -6.298  -10.688 1.00 11.10 ? 98  PRO A HG2  2  
ATOM 8716   H HG3  . PRO A 1 98  ? 26.302  -7.774  -11.504 1.00 52.34 ? 98  PRO A HG3  2  
ATOM 8717   H HD2  . PRO A 1 98  ? 23.746  -7.087  -11.621 1.00 2.21  ? 98  PRO A HD2  2  
ATOM 8718   H HD3  . PRO A 1 98  ? 24.194  -8.788  -11.374 1.00 2.01  ? 98  PRO A HD3  2  
ATOM 8719   N N    . TYR A 1 99  ? 23.898  -6.167  -7.430  1.00 25.14 ? 99  TYR A N    2  
ATOM 8720   C CA   . TYR A 1 99  ? 23.763  -5.242  -6.273  1.00 11.20 ? 99  TYR A CA   2  
ATOM 8721   C C    . TYR A 1 99  ? 25.131  -4.667  -5.900  1.00 44.43 ? 99  TYR A C    2  
ATOM 8722   O O    . TYR A 1 99  ? 26.114  -5.377  -5.833  1.00 13.34 ? 99  TYR A O    2  
ATOM 8723   C CB   . TYR A 1 99  ? 23.173  -5.971  -5.059  1.00 45.54 ? 99  TYR A CB   2  
ATOM 8724   C CG   . TYR A 1 99  ? 21.818  -6.543  -5.410  1.00 22.21 ? 99  TYR A CG   2  
ATOM 8725   C CD1  . TYR A 1 99  ? 20.766  -5.684  -5.749  1.00 42.31 ? 99  TYR A CD1  2  
ATOM 8726   C CD2  . TYR A 1 99  ? 21.609  -7.928  -5.391  1.00 65.22 ? 99  TYR A CD2  2  
ATOM 8727   C CE1  . TYR A 1 99  ? 19.508  -6.206  -6.067  1.00 4.20  ? 99  TYR A CE1  2  
ATOM 8728   C CE2  . TYR A 1 99  ? 20.351  -8.450  -5.710  1.00 64.15 ? 99  TYR A CE2  2  
ATOM 8729   C CZ   . TYR A 1 99  ? 19.300  -7.590  -6.048  1.00 25.21 ? 99  TYR A CZ   2  
ATOM 8730   O OH   . TYR A 1 99  ? 18.059  -8.106  -6.362  1.00 53.15 ? 99  TYR A OH   2  
ATOM 8731   H H    . TYR A 1 99  ? 23.402  -5.976  -8.252  1.00 30.21 ? 99  TYR A H    2  
ATOM 8732   H HA   . TYR A 1 99  ? 23.098  -4.444  -6.557  1.00 50.13 ? 99  TYR A HA   2  
ATOM 8733   H HB2  . TYR A 1 99  ? 23.836  -6.764  -4.751  1.00 35.42 ? 99  TYR A HB2  2  
ATOM 8734   H HB3  . TYR A 1 99  ? 23.061  -5.267  -4.249  1.00 32.10 ? 99  TYR A HB3  2  
ATOM 8735   H HD1  . TYR A 1 99  ? 20.926  -4.617  -5.763  1.00 72.54 ? 99  TYR A HD1  2  
ATOM 8736   H HD2  . TYR A 1 99  ? 22.419  -8.593  -5.130  1.00 32.24 ? 99  TYR A HD2  2  
ATOM 8737   H HE1  . TYR A 1 99  ? 18.697  -5.542  -6.328  1.00 12.44 ? 99  TYR A HE1  2  
ATOM 8738   H HE2  . TYR A 1 99  ? 20.190  -9.517  -5.694  1.00 50.12 ? 99  TYR A HE2  2  
ATOM 8739   H HH   . TYR A 1 99  ? 18.148  -8.627  -7.163  1.00 53.15 ? 99  TYR A HH   2  
ATOM 8740   N N    . ARG A 1 100 ? 25.206  -3.387  -5.654  1.00 31.21 ? 100 ARG A N    2  
ATOM 8741   C CA   . ARG A 1 100 ? 26.517  -2.786  -5.286  1.00 31.21 ? 100 ARG A CA   2  
ATOM 8742   C C    . ARG A 1 100 ? 26.886  -3.180  -3.853  1.00 34.40 ? 100 ARG A C    2  
ATOM 8743   O O    . ARG A 1 100 ? 28.008  -3.555  -3.578  1.00 61.10 ? 100 ARG A O    2  
ATOM 8744   C CB   . ARG A 1 100 ? 26.446  -1.259  -5.392  1.00 63.04 ? 100 ARG A CB   2  
ATOM 8745   C CG   . ARG A 1 100 ? 26.161  -0.844  -6.847  1.00 3.22  ? 100 ARG A CG   2  
ATOM 8746   C CD   . ARG A 1 100 ? 26.647  0.593   -7.096  1.00 55.21 ? 100 ARG A CD   2  
ATOM 8747   N NE   . ARG A 1 100 ? 25.876  1.187   -8.225  1.00 72.35 ? 100 ARG A NE   2  
ATOM 8748   C CZ   . ARG A 1 100 ? 26.093  0.785   -9.447  1.00 64.14 ? 100 ARG A CZ   2  
ATOM 8749   N NH1  . ARG A 1 100 ? 26.983  -0.141  -9.681  1.00 41.42 ? 100 ARG A NH1  2  
ATOM 8750   N NH2  . ARG A 1 100 ? 25.420  1.307   -10.435 1.00 71.02 ? 100 ARG A NH2  2  
ATOM 8751   H H    . ARG A 1 100 ? 24.404  -2.826  -5.710  1.00 45.24 ? 100 ARG A H    2  
ATOM 8752   H HA   . ARG A 1 100 ? 27.277  -3.154  -5.959  1.00 72.41 ? 100 ARG A HA   2  
ATOM 8753   H HB2  . ARG A 1 100 ? 25.656  -0.892  -4.752  1.00 62.22 ? 100 ARG A HB2  2  
ATOM 8754   H HB3  . ARG A 1 100 ? 27.389  -0.839  -5.076  1.00 55.22 ? 100 ARG A HB3  2  
ATOM 8755   H HG2  . ARG A 1 100 ? 26.674  -1.515  -7.523  1.00 51.04 ? 100 ARG A HG2  2  
ATOM 8756   H HG3  . ARG A 1 100 ? 25.099  -0.897  -7.031  1.00 1.40  ? 100 ARG A HG3  2  
ATOM 8757   H HD2  . ARG A 1 100 ? 26.501  1.191   -6.208  1.00 54.31 ? 100 ARG A HD2  2  
ATOM 8758   H HD3  . ARG A 1 100 ? 27.697  0.579   -7.349  1.00 23.13 ? 100 ARG A HD3  2  
ATOM 8759   H HE   . ARG A 1 100 ? 25.207  1.881   -8.049  1.00 74.54 ? 100 ARG A HE   2  
ATOM 8760   H HH11 . ARG A 1 100 ? 27.498  -0.542  -8.923  1.00 53.11 ? 100 ARG A HH11 2  
ATOM 8761   H HH12 . ARG A 1 100 ? 27.149  -0.449  -10.617 1.00 21.13 ? 100 ARG A HH12 2  
ATOM 8762   H HH21 . ARG A 1 100 ? 24.738  2.016   -10.255 1.00 35.43 ? 100 ARG A HH21 2  
ATOM 8763   H HH22 . ARG A 1 100 ? 25.586  0.999   -11.372 1.00 25.10 ? 100 ARG A HH22 2  
ATOM 8764   N N    . SER A 1 101 ? 25.960  -3.101  -2.931  1.00 13.40 ? 101 SER A N    2  
ATOM 8765   C CA   . SER A 1 101 ? 26.296  -3.477  -1.527  1.00 1.41  ? 101 SER A CA   2  
ATOM 8766   C C    . SER A 1 101 ? 25.035  -3.689  -0.696  1.00 4.34  ? 101 SER A C    2  
ATOM 8767   O O    . SER A 1 101 ? 25.043  -3.425  0.482   1.00 63.11 ? 101 SER A O    2  
ATOM 8768   C CB   . SER A 1 101 ? 27.107  -2.364  -0.872  1.00 55.12 ? 101 SER A CB   2  
ATOM 8769   O OG   . SER A 1 101 ? 27.442  -2.746  0.455   1.00 71.32 ? 101 SER A OG   2  
ATOM 8770   H H    . SER A 1 101 ? 25.057  -2.796  -3.160  1.00 13.34 ? 101 SER A H    2  
ATOM 8771   H HA   . SER A 1 101 ? 26.880  -4.384  -1.532  1.00 43.31 ? 101 SER A HA   2  
ATOM 8772   H HB2  . SER A 1 101 ? 28.004  -2.199  -1.427  1.00 40.31 ? 101 SER A HB2  2  
ATOM 8773   H HB3  . SER A 1 101 ? 26.521  -1.454  -0.857  1.00 74.14 ? 101 SER A HB3  2  
ATOM 8774   H HG   . SER A 1 101 ? 28.158  -3.384  0.408   1.00 33.03 ? 101 SER A HG   2  
ATOM 8775   N N    . ILE A 1 102 ? 23.966  -4.164  -1.283  1.00 2.23  ? 102 ILE A N    2  
ATOM 8776   C CA   . ILE A 1 102 ? 22.712  -4.393  -0.493  1.00 75.43 ? 102 ILE A CA   2  
ATOM 8777   C C    . ILE A 1 102 ? 22.330  -3.120  0.274   1.00 34.03 ? 102 ILE A C    2  
ATOM 8778   O O    . ILE A 1 102 ? 21.364  -2.456  -0.046  1.00 0.30  ? 102 ILE A O    2  
ATOM 8779   C CB   . ILE A 1 102 ? 22.943  -5.529  0.512   1.00 43.23 ? 102 ILE A CB   2  
ATOM 8780   C CG1  . ILE A 1 102 ? 23.698  -6.682  -0.163  1.00 45.42 ? 102 ILE A CG1  2  
ATOM 8781   C CG2  . ILE A 1 102 ? 21.596  -6.035  1.034   1.00 31.15 ? 102 ILE A CG2  2  
ATOM 8782   C CD1  . ILE A 1 102 ? 22.973  -7.114  -1.440  1.00 24.21 ? 102 ILE A CD1  2  
ATOM 8783   H H    . ILE A 1 102 ? 23.987  -4.375  -2.240  1.00 62.23 ? 102 ILE A H    2  
ATOM 8784   H HA   . ILE A 1 102 ? 21.905  -4.659  -1.164  1.00 31.33 ? 102 ILE A HA   2  
ATOM 8785   H HB   . ILE A 1 102 ? 23.528  -5.158  1.342   1.00 11.32 ? 102 ILE A HB   2  
ATOM 8786   H HG12 . ILE A 1 102 ? 24.698  -6.357  -0.411  1.00 61.14 ? 102 ILE A HG12 2  
ATOM 8787   H HG13 . ILE A 1 102 ? 23.753  -7.520  0.516   1.00 32.35 ? 102 ILE A HG13 2  
ATOM 8788   H HG21 . ILE A 1 102 ? 21.763  -6.813  1.764   1.00 42.35 ? 102 ILE A HG21 2  
ATOM 8789   H HG22 . ILE A 1 102 ? 21.016  -6.429  0.213   1.00 75.33 ? 102 ILE A HG22 2  
ATOM 8790   H HG23 . ILE A 1 102 ? 21.060  -5.218  1.495   1.00 4.42  ? 102 ILE A HG23 2  
ATOM 8791   H HD11 . ILE A 1 102 ? 23.117  -6.367  -2.203  1.00 0.42  ? 102 ILE A HD11 2  
ATOM 8792   H HD12 . ILE A 1 102 ? 21.919  -7.227  -1.240  1.00 44.45 ? 102 ILE A HD12 2  
ATOM 8793   H HD13 . ILE A 1 102 ? 23.376  -8.056  -1.780  1.00 21.40 ? 102 ILE A HD13 2  
ATOM 8794   N N    . LYS A 1 103 ? 23.090  -2.772  1.278   1.00 31.15 ? 103 LYS A N    2  
ATOM 8795   C CA   . LYS A 1 103 ? 22.787  -1.546  2.057   1.00 71.41 ? 103 LYS A CA   2  
ATOM 8796   C C    . LYS A 1 103 ? 22.783  -0.365  1.094   1.00 63.41 ? 103 LYS A C    2  
ATOM 8797   O O    . LYS A 1 103 ? 22.130  0.635   1.315   1.00 12.13 ? 103 LYS A O    2  
ATOM 8798   C CB   . LYS A 1 103 ? 23.865  -1.339  3.130   1.00 21.52 ? 103 LYS A CB   2  
ATOM 8799   C CG   . LYS A 1 103 ? 23.584  -2.245  4.334   1.00 54.15 ? 103 LYS A CG   2  
ATOM 8800   C CD   . LYS A 1 103 ? 23.714  -3.711  3.917   1.00 43.44 ? 103 LYS A CD   2  
ATOM 8801   C CE   . LYS A 1 103 ? 23.801  -4.591  5.165   1.00 5.42  ? 103 LYS A CE   2  
ATOM 8802   N NZ   . LYS A 1 103 ? 23.817  -6.026  4.762   1.00 52.02 ? 103 LYS A NZ   2  
ATOM 8803   H H    . LYS A 1 103 ? 23.878  -3.315  1.504   1.00 13.51 ? 103 LYS A H    2  
ATOM 8804   H HA   . LYS A 1 103 ? 21.819  -1.642  2.524   1.00 31.35 ? 103 LYS A HA   2  
ATOM 8805   H HB2  . LYS A 1 103 ? 24.833  -1.581  2.717   1.00 63.35 ? 103 LYS A HB2  2  
ATOM 8806   H HB3  . LYS A 1 103 ? 23.861  -0.307  3.452   1.00 71.42 ? 103 LYS A HB3  2  
ATOM 8807   H HG2  . LYS A 1 103 ? 24.294  -2.028  5.118   1.00 22.51 ? 103 LYS A HG2  2  
ATOM 8808   H HG3  . LYS A 1 103 ? 22.583  -2.063  4.696   1.00 2.43  ? 103 LYS A HG3  2  
ATOM 8809   H HD2  . LYS A 1 103 ? 22.851  -3.998  3.334   1.00 32.53 ? 103 LYS A HD2  2  
ATOM 8810   H HD3  . LYS A 1 103 ? 24.608  -3.840  3.325   1.00 41.33 ? 103 LYS A HD3  2  
ATOM 8811   H HE2  . LYS A 1 103 ? 24.706  -4.360  5.707   1.00 25.00 ? 103 LYS A HE2  2  
ATOM 8812   H HE3  . LYS A 1 103 ? 22.946  -4.405  5.798   1.00 50.24 ? 103 LYS A HE3  2  
ATOM 8813   H HZ1  . LYS A 1 103 ? 22.860  -6.422  4.852   1.00 31.00 ? 103 LYS A HZ1  2  
ATOM 8814   H HZ2  . LYS A 1 103 ? 24.470  -6.552  5.379   1.00 74.14 ? 103 LYS A HZ2  2  
ATOM 8815   H HZ3  . LYS A 1 103 ? 24.131  -6.106  3.775   1.00 71.53 ? 103 LYS A HZ3  2  
ATOM 8816   N N    . ALA A 1 104 ? 23.514  -0.480  0.020   1.00 51.34 ? 104 ALA A N    2  
ATOM 8817   C CA   . ALA A 1 104 ? 23.559  0.633   -0.969  1.00 3.23  ? 104 ALA A CA   2  
ATOM 8818   C C    . ALA A 1 104 ? 22.242  0.682   -1.752  1.00 54.13 ? 104 ALA A C    2  
ATOM 8819   O O    . ALA A 1 104 ? 21.657  1.731   -1.935  1.00 63.24 ? 104 ALA A O    2  
ATOM 8820   C CB   . ALA A 1 104 ? 24.724  0.408   -1.935  1.00 24.52 ? 104 ALA A CB   2  
ATOM 8821   H H    . ALA A 1 104 ? 24.035  -1.303  -0.135  1.00 21.32 ? 104 ALA A H    2  
ATOM 8822   H HA   . ALA A 1 104 ? 23.700  1.569   -0.449  1.00 41.23 ? 104 ALA A HA   2  
ATOM 8823   H HB1  . ALA A 1 104 ? 24.587  1.017   -2.818  1.00 54.15 ? 104 ALA A HB1  2  
ATOM 8824   H HB2  . ALA A 1 104 ? 24.761  -0.633  -2.218  1.00 21.30 ? 104 ALA A HB2  2  
ATOM 8825   H HB3  . ALA A 1 104 ? 25.647  0.682   -1.449  1.00 50.23 ? 104 ALA A HB3  2  
ATOM 8826   N N    . LEU A 1 105 ? 21.775  -0.444  -2.221  1.00 73.11 ? 105 LEU A N    2  
ATOM 8827   C CA   . LEU A 1 105 ? 20.501  -0.456  -2.997  1.00 34.52 ? 105 LEU A CA   2  
ATOM 8828   C C    . LEU A 1 105 ? 19.345  0.003   -2.097  1.00 73.22 ? 105 LEU A C    2  
ATOM 8829   O O    . LEU A 1 105 ? 18.672  0.972   -2.387  1.00 13.44 ? 105 LEU A O    2  
ATOM 8830   C CB   . LEU A 1 105 ? 20.241  -1.881  -3.514  1.00 50.14 ? 105 LEU A CB   2  
ATOM 8831   C CG   . LEU A 1 105 ? 18.812  -2.006  -4.064  1.00 52.11 ? 105 LEU A CG   2  
ATOM 8832   C CD1  . LEU A 1 105 ? 18.524  -0.858  -5.042  1.00 2.40  ? 105 LEU A CD1  2  
ATOM 8833   C CD2  . LEU A 1 105 ? 18.653  -3.351  -4.791  1.00 43.22 ? 105 LEU A CD2  2  
ATOM 8834   H H    . LEU A 1 105 ? 22.263  -1.279  -2.068  1.00 52.13 ? 105 LEU A H    2  
ATOM 8835   H HA   . LEU A 1 105 ? 20.588  0.218   -3.836  1.00 0.12  ? 105 LEU A HA   2  
ATOM 8836   H HB2  . LEU A 1 105 ? 20.946  -2.108  -4.301  1.00 63.14 ? 105 LEU A HB2  2  
ATOM 8837   H HB3  . LEU A 1 105 ? 20.374  -2.584  -2.704  1.00 30.22 ? 105 LEU A HB3  2  
ATOM 8838   H HG   . LEU A 1 105 ? 18.113  -1.963  -3.243  1.00 41.14 ? 105 LEU A HG   2  
ATOM 8839   H HD11 . LEU A 1 105 ? 18.308  0.042   -4.491  1.00 34.52 ? 105 LEU A HD11 2  
ATOM 8840   H HD12 . LEU A 1 105 ? 17.674  -1.112  -5.659  1.00 73.10 ? 105 LEU A HD12 2  
ATOM 8841   H HD13 . LEU A 1 105 ? 19.387  -0.695  -5.671  1.00 45.12 ? 105 LEU A HD13 2  
ATOM 8842   H HD21 . LEU A 1 105 ? 17.606  -3.614  -4.831  1.00 0.42  ? 105 LEU A HD21 2  
ATOM 8843   H HD22 . LEU A 1 105 ? 19.194  -4.121  -4.259  1.00 14.03 ? 105 LEU A HD22 2  
ATOM 8844   H HD23 . LEU A 1 105 ? 19.040  -3.269  -5.797  1.00 53.23 ? 105 LEU A HD23 2  
ATOM 8845   N N    . VAL A 1 106 ? 19.108  -0.678  -1.009  1.00 43.43 ? 106 VAL A N    2  
ATOM 8846   C CA   . VAL A 1 106 ? 17.995  -0.269  -0.111  1.00 13.30 ? 106 VAL A CA   2  
ATOM 8847   C C    . VAL A 1 106 ? 18.135  1.215   0.231   1.00 11.13 ? 106 VAL A C    2  
ATOM 8848   O O    . VAL A 1 106 ? 17.166  1.947   0.261   1.00 31.03 ? 106 VAL A O    2  
ATOM 8849   C CB   . VAL A 1 106 ? 18.045  -1.110  1.166   1.00 60.11 ? 106 VAL A CB   2  
ATOM 8850   C CG1  . VAL A 1 106 ? 18.119  -2.594  0.795   1.00 22.11 ? 106 VAL A CG1  2  
ATOM 8851   C CG2  . VAL A 1 106 ? 19.279  -0.725  1.989   1.00 13.32 ? 106 VAL A CG2  2  
ATOM 8852   H H    . VAL A 1 106 ? 19.656  -1.455  -0.783  1.00 33.23 ? 106 VAL A H    2  
ATOM 8853   H HA   . VAL A 1 106 ? 17.052  -0.431  -0.611  1.00 24.41 ? 106 VAL A HA   2  
ATOM 8854   H HB   . VAL A 1 106 ? 17.155  -0.932  1.744   1.00 74.54 ? 106 VAL A HB   2  
ATOM 8855   H HG11 . VAL A 1 106 ? 17.298  -2.843  0.139   1.00 61.31 ? 106 VAL A HG11 2  
ATOM 8856   H HG12 . VAL A 1 106 ? 18.058  -3.192  1.691   1.00 2.42  ? 106 VAL A HG12 2  
ATOM 8857   H HG13 . VAL A 1 106 ? 19.054  -2.793  0.292   1.00 24.51 ? 106 VAL A HG13 2  
ATOM 8858   H HG21 . VAL A 1 106 ? 19.090  0.203   2.506   1.00 13.05 ? 106 VAL A HG21 2  
ATOM 8859   H HG22 . VAL A 1 106 ? 20.126  -0.603  1.330   1.00 45.33 ? 106 VAL A HG22 2  
ATOM 8860   H HG23 . VAL A 1 106 ? 19.491  -1.502  2.709   1.00 34.02 ? 106 VAL A HG23 2  
ATOM 8861   N N    . ALA A 1 107 ? 19.332  1.670   0.480   1.00 53.54 ? 107 ALA A N    2  
ATOM 8862   C CA   . ALA A 1 107 ? 19.518  3.110   0.805   1.00 11.34 ? 107 ALA A CA   2  
ATOM 8863   C C    . ALA A 1 107 ? 18.925  3.945   -0.329  1.00 70.42 ? 107 ALA A C    2  
ATOM 8864   O O    . ALA A 1 107 ? 18.240  4.925   -0.106  1.00 14.32 ? 107 ALA A O    2  
ATOM 8865   C CB   . ALA A 1 107 ? 21.010  3.417   0.944   1.00 54.12 ? 107 ALA A CB   2  
ATOM 8866   H H    . ALA A 1 107 ? 20.105  1.069   0.445   1.00 3.10  ? 107 ALA A H    2  
ATOM 8867   H HA   . ALA A 1 107 ? 19.010  3.342   1.730   1.00 34.32 ? 107 ALA A HA   2  
ATOM 8868   H HB1  . ALA A 1 107 ? 21.407  2.893   1.801   1.00 63.43 ? 107 ALA A HB1  2  
ATOM 8869   H HB2  . ALA A 1 107 ? 21.148  4.480   1.077   1.00 15.23 ? 107 ALA A HB2  2  
ATOM 8870   H HB3  . ALA A 1 107 ? 21.529  3.096   0.053   1.00 75.50 ? 107 ALA A HB3  2  
ATOM 8871   N N    . ARG A 1 108 ? 19.173  3.553   -1.549  1.00 73.53 ? 108 ARG A N    2  
ATOM 8872   C CA   . ARG A 1 108 ? 18.617  4.311   -2.702  1.00 52.41 ? 108 ARG A CA   2  
ATOM 8873   C C    . ARG A 1 108 ? 17.089  4.225   -2.667  1.00 71.42 ? 108 ARG A C    2  
ATOM 8874   O O    . ARG A 1 108 ? 16.399  5.135   -3.079  1.00 23.13 ? 108 ARG A O    2  
ATOM 8875   C CB   . ARG A 1 108 ? 19.134  3.708   -4.010  1.00 11.15 ? 108 ARG A CB   2  
ATOM 8876   C CG   . ARG A 1 108 ? 18.714  4.600   -5.181  1.00 4.10  ? 108 ARG A CG   2  
ATOM 8877   C CD   . ARG A 1 108 ? 19.184  3.974   -6.496  1.00 74.41 ? 108 ARG A CD   2  
ATOM 8878   N NE   . ARG A 1 108 ? 18.894  4.908   -7.620  1.00 62.42 ? 108 ARG A NE   2  
ATOM 8879   C CZ   . ARG A 1 108 ? 19.217  4.580   -8.841  1.00 72.34 ? 108 ARG A CZ   2  
ATOM 8880   N NH1  . ARG A 1 108 ? 19.793  3.433   -9.078  1.00 4.34  ? 108 ARG A NH1  2  
ATOM 8881   N NH2  . ARG A 1 108 ? 18.964  5.399   -9.825  1.00 63.04 ? 108 ARG A NH2  2  
ATOM 8882   H H    . ARG A 1 108 ? 19.719  2.755   -1.706  1.00 64.21 ? 108 ARG A H    2  
ATOM 8883   H HA   . ARG A 1 108 ? 18.923  5.346   -2.635  1.00 42.42 ? 108 ARG A HA   2  
ATOM 8884   H HB2  . ARG A 1 108 ? 20.212  3.642   -3.975  1.00 41.24 ? 108 ARG A HB2  2  
ATOM 8885   H HB3  . ARG A 1 108 ? 18.716  2.722   -4.143  1.00 31.04 ? 108 ARG A HB3  2  
ATOM 8886   H HG2  . ARG A 1 108 ? 17.638  4.696   -5.192  1.00 13.42 ? 108 ARG A HG2  2  
ATOM 8887   H HG3  . ARG A 1 108 ? 19.162  5.575   -5.069  1.00 53.40 ? 108 ARG A HG3  2  
ATOM 8888   H HD2  . ARG A 1 108 ? 20.246  3.788   -6.447  1.00 71.24 ? 108 ARG A HD2  2  
ATOM 8889   H HD3  . ARG A 1 108 ? 18.662  3.042   -6.658  1.00 23.12 ? 108 ARG A HD3  2  
ATOM 8890   H HE   . ARG A 1 108 ? 18.461  5.769   -7.443  1.00 3.01  ? 108 ARG A HE   2  
ATOM 8891   H HH11 . ARG A 1 108 ? 19.986  2.805   -8.324  1.00 3.41  ? 108 ARG A HH11 2  
ATOM 8892   H HH12 . ARG A 1 108 ? 20.040  3.181   -10.014 1.00 65.05 ? 108 ARG A HH12 2  
ATOM 8893   H HH21 . ARG A 1 108 ? 18.523  6.278   -9.643  1.00 30.24 ? 108 ARG A HH21 2  
ATOM 8894   H HH22 . ARG A 1 108 ? 19.212  5.148   -10.761 1.00 72.23 ? 108 ARG A HH22 2  
ATOM 8895   N N    . ILE A 1 109 ? 16.553  3.143   -2.163  1.00 33.02 ? 109 ILE A N    2  
ATOM 8896   C CA   . ILE A 1 109 ? 15.074  3.017   -2.090  1.00 2.21  ? 109 ILE A CA   2  
ATOM 8897   C C    . ILE A 1 109 ? 14.574  3.970   -1.013  1.00 55.23 ? 109 ILE A C    2  
ATOM 8898   O O    . ILE A 1 109 ? 13.517  4.560   -1.122  1.00 62.54 ? 109 ILE A O    2  
ATOM 8899   C CB   . ILE A 1 109 ? 14.685  1.578   -1.732  1.00 55.10 ? 109 ILE A CB   2  
ATOM 8900   C CG1  . ILE A 1 109 ? 15.287  0.620   -2.769  1.00 3.41  ? 109 ILE A CG1  2  
ATOM 8901   C CG2  . ILE A 1 109 ? 13.158  1.446   -1.736  1.00 1.43  ? 109 ILE A CG2  2  
ATOM 8902   C CD1  . ILE A 1 109 ? 14.902  -0.828  -2.438  1.00 44.34 ? 109 ILE A CD1  2  
ATOM 8903   H H    . ILE A 1 109 ? 17.121  2.427   -1.819  1.00 41.40 ? 109 ILE A H    2  
ATOM 8904   H HA   . ILE A 1 109 ? 14.641  3.285   -3.042  1.00 21.35 ? 109 ILE A HA   2  
ATOM 8905   H HB   . ILE A 1 109 ? 15.065  1.335   -0.750  1.00 32.23 ? 109 ILE A HB   2  
ATOM 8906   H HG12 . ILE A 1 109 ? 14.912  0.874   -3.750  1.00 14.24 ? 109 ILE A HG12 2  
ATOM 8907   H HG13 . ILE A 1 109 ? 16.362  0.713   -2.762  1.00 73.24 ? 109 ILE A HG13 2  
ATOM 8908   H HG21 . ILE A 1 109 ? 12.783  1.654   -2.727  1.00 14.22 ? 109 ILE A HG21 2  
ATOM 8909   H HG22 . ILE A 1 109 ? 12.732  2.149   -1.036  1.00 60.41 ? 109 ILE A HG22 2  
ATOM 8910   H HG23 . ILE A 1 109 ? 12.879  0.443   -1.449  1.00 14.13 ? 109 ILE A HG23 2  
ATOM 8911   H HD11 . ILE A 1 109 ? 15.611  -1.501  -2.897  1.00 31.31 ? 109 ILE A HD11 2  
ATOM 8912   H HD12 . ILE A 1 109 ? 13.913  -1.032  -2.819  1.00 21.22 ? 109 ILE A HD12 2  
ATOM 8913   H HD13 . ILE A 1 109 ? 14.911  -0.973  -1.367  1.00 13.32 ? 109 ILE A HD13 2  
ATOM 8914   N N    . GLU A 1 110 ? 15.341  4.128   0.029   1.00 52.12 ? 110 GLU A N    2  
ATOM 8915   C CA   . GLU A 1 110 ? 14.932  5.044   1.119   1.00 4.11  ? 110 GLU A CA   2  
ATOM 8916   C C    . GLU A 1 110 ? 14.831  6.466   0.566   1.00 45.21 ? 110 GLU A C    2  
ATOM 8917   O O    . GLU A 1 110 ? 13.992  7.245   0.971   1.00 74.34 ? 110 GLU A O    2  
ATOM 8918   C CB   . GLU A 1 110 ? 15.971  4.994   2.243   1.00 1.51  ? 110 GLU A CB   2  
ATOM 8919   C CG   . GLU A 1 110 ? 15.601  6.003   3.331   1.00 51.31 ? 110 GLU A CG   2  
ATOM 8920   C CD   . GLU A 1 110 ? 16.500  5.794   4.551   1.00 2.21  ? 110 GLU A CD   2  
ATOM 8921   O OE1  . GLU A 1 110 ? 17.367  4.939   4.483   1.00 4.21  ? 110 GLU A OE1  2  
ATOM 8922   O OE2  . GLU A 1 110 ? 16.305  6.493   5.532   1.00 65.15 ? 110 GLU A OE2  2  
ATOM 8923   H H    . GLU A 1 110 ? 16.192  3.645   0.088   1.00 3.43  ? 110 GLU A H    2  
ATOM 8924   H HA   . GLU A 1 110 ? 13.974  4.734   1.498   1.00 23.12 ? 110 GLU A HA   2  
ATOM 8925   H HB2  . GLU A 1 110 ? 15.994  4.000   2.666   1.00 3.05  ? 110 GLU A HB2  2  
ATOM 8926   H HB3  . GLU A 1 110 ? 16.944  5.239   1.844   1.00 21.33 ? 110 GLU A HB3  2  
ATOM 8927   H HG2  . GLU A 1 110 ? 15.739  7.005   2.952   1.00 54.15 ? 110 GLU A HG2  2  
ATOM 8928   H HG3  . GLU A 1 110 ? 14.569  5.864   3.617   1.00 41.55 ? 110 GLU A HG3  2  
ATOM 8929   N N    . ALA A 1 111 ? 15.681  6.808   -0.363  1.00 12.40 ? 111 ALA A N    2  
ATOM 8930   C CA   . ALA A 1 111 ? 15.638  8.177   -0.949  1.00 73.32 ? 111 ALA A CA   2  
ATOM 8931   C C    . ALA A 1 111 ? 14.469  8.280   -1.931  1.00 13.10 ? 111 ALA A C    2  
ATOM 8932   O O    . ALA A 1 111 ? 13.580  9.093   -1.770  1.00 10.33 ? 111 ALA A O    2  
ATOM 8933   C CB   . ALA A 1 111 ? 16.950  8.452   -1.689  1.00 24.12 ? 111 ALA A CB   2  
ATOM 8934   H H    . ALA A 1 111 ? 16.350  6.162   -0.676  1.00 72.42 ? 111 ALA A H    2  
ATOM 8935   H HA   . ALA A 1 111 ? 15.509  8.904   -0.160  1.00 62.10 ? 111 ALA A HA   2  
ATOM 8936   H HB1  . ALA A 1 111 ? 16.826  9.305   -2.339  1.00 23.40 ? 111 ALA A HB1  2  
ATOM 8937   H HB2  . ALA A 1 111 ? 17.217  7.587   -2.278  1.00 41.12 ? 111 ALA A HB2  2  
ATOM 8938   H HB3  . ALA A 1 111 ? 17.731  8.654   -0.973  1.00 44.04 ? 111 ALA A HB3  2  
ATOM 8939   N N    . ARG A 1 112 ? 14.466  7.466   -2.950  1.00 41.13 ? 112 ARG A N    2  
ATOM 8940   C CA   . ARG A 1 112 ? 13.358  7.520   -3.945  1.00 12.40 ? 112 ARG A CA   2  
ATOM 8941   C C    . ARG A 1 112 ? 12.019  7.287   -3.233  1.00 40.03 ? 112 ARG A C    2  
ATOM 8942   O O    . ARG A 1 112 ? 10.966  7.455   -3.815  1.00 13.34 ? 112 ARG A O    2  
ATOM 8943   C CB   . ARG A 1 112 ? 13.576  6.435   -5.015  1.00 11.52 ? 112 ARG A CB   2  
ATOM 8944   C CG   . ARG A 1 112 ? 14.526  6.951   -6.108  1.00 3.54  ? 112 ARG A CG   2  
ATOM 8945   C CD   . ARG A 1 112 ? 15.821  7.483   -5.482  1.00 2.21  ? 112 ARG A CD   2  
ATOM 8946   N NE   . ARG A 1 112 ? 15.621  8.895   -5.049  1.00 52.41 ? 112 ARG A NE   2  
ATOM 8947   C CZ   . ARG A 1 112 ? 15.527  9.843   -5.941  1.00 41.24 ? 112 ARG A CZ   2  
ATOM 8948   N NH1  . ARG A 1 112 ? 15.610  9.554   -7.211  1.00 31.33 ? 112 ARG A NH1  2  
ATOM 8949   N NH2  . ARG A 1 112 ? 15.350  11.079  -5.563  1.00 31.12 ? 112 ARG A NH2  2  
ATOM 8950   H H    . ARG A 1 112 ? 15.194  6.820   -3.063  1.00 72.12 ? 112 ARG A H    2  
ATOM 8951   H HA   . ARG A 1 112 ? 13.343  8.494   -4.413  1.00 54.04 ? 112 ARG A HA   2  
ATOM 8952   H HB2  . ARG A 1 112 ? 14.007  5.560   -4.553  1.00 24.12 ? 112 ARG A HB2  2  
ATOM 8953   H HB3  . ARG A 1 112 ? 12.630  6.172   -5.466  1.00 55.12 ? 112 ARG A HB3  2  
ATOM 8954   H HG2  . ARG A 1 112 ? 14.761  6.143   -6.786  1.00 74.23 ? 112 ARG A HG2  2  
ATOM 8955   H HG3  . ARG A 1 112 ? 14.042  7.746   -6.656  1.00 2.42  ? 112 ARG A HG3  2  
ATOM 8956   H HD2  . ARG A 1 112 ? 16.091  6.879   -4.629  1.00 74.42 ? 112 ARG A HD2  2  
ATOM 8957   H HD3  . ARG A 1 112 ? 16.616  7.443   -6.213  1.00 2.42  ? 112 ARG A HD3  2  
ATOM 8958   H HE   . ARG A 1 112 ? 15.559  9.111   -4.096  1.00 52.15 ? 112 ARG A HE   2  
ATOM 8959   H HH11 . ARG A 1 112 ? 15.745  8.607   -7.500  1.00 72.53 ? 112 ARG A HH11 2  
ATOM 8960   H HH12 . ARG A 1 112 ? 15.538  10.280  -7.895  1.00 44.43 ? 112 ARG A HH12 2  
ATOM 8961   H HH21 . ARG A 1 112 ? 15.287  11.300  -4.590  1.00 51.11 ? 112 ARG A HH21 2  
ATOM 8962   H HH22 . ARG A 1 112 ? 15.278  11.806  -6.247  1.00 51.43 ? 112 ARG A HH22 2  
ATOM 8963   N N    . LEU A 1 113 ? 12.049  6.896   -1.981  1.00 54.11 ? 113 LEU A N    2  
ATOM 8964   C CA   . LEU A 1 113 ? 10.773  6.648   -1.238  1.00 25.25 ? 113 LEU A CA   2  
ATOM 8965   C C    . LEU A 1 113 ? 10.901  7.160   0.201   1.00 35.15 ? 113 LEU A C    2  
ATOM 8966   O O    . LEU A 1 113 ? 11.171  6.409   1.117   1.00 33.32 ? 113 LEU A O    2  
ATOM 8967   C CB   . LEU A 1 113 ? 10.487  5.143   -1.220  1.00 63.10 ? 113 LEU A CB   2  
ATOM 8968   C CG   . LEU A 1 113 ? 9.039   4.883   -0.771  1.00 13.51 ? 113 LEU A CG   2  
ATOM 8969   C CD1  . LEU A 1 113 ? 8.042   5.281   -1.879  1.00 65.24 ? 113 LEU A CD1  2  
ATOM 8970   C CD2  . LEU A 1 113 ? 8.879   3.393   -0.446  1.00 0.43  ? 113 LEU A CD2  2  
ATOM 8971   H H    . LEU A 1 113 ? 12.910  6.761   -1.532  1.00 53.03 ? 113 LEU A H    2  
ATOM 8972   H HA   . LEU A 1 113 ? 9.959   7.163   -1.724  1.00 45.31 ? 113 LEU A HA   2  
ATOM 8973   H HB2  . LEU A 1 113 ? 10.642  4.735   -2.208  1.00 3.24  ? 113 LEU A HB2  2  
ATOM 8974   H HB3  . LEU A 1 113 ? 11.162  4.662   -0.528  1.00 50.03 ? 113 LEU A HB3  2  
ATOM 8975   H HG   . LEU A 1 113 ? 8.833   5.465   0.116   1.00 1.11  ? 113 LEU A HG   2  
ATOM 8976   H HD11 . LEU A 1 113 ? 7.815   6.333   -1.800  1.00 74.33 ? 113 LEU A HD11 2  
ATOM 8977   H HD12 . LEU A 1 113 ? 7.127   4.715   -1.767  1.00 22.42 ? 113 LEU A HD12 2  
ATOM 8978   H HD13 . LEU A 1 113 ? 8.467   5.077   -2.851  1.00 0.22  ? 113 LEU A HD13 2  
ATOM 8979   H HD21 . LEU A 1 113 ? 9.332   2.802   -1.229  1.00 73.42 ? 113 LEU A HD21 2  
ATOM 8980   H HD22 . LEU A 1 113 ? 7.829   3.151   -0.374  1.00 22.25 ? 113 LEU A HD22 2  
ATOM 8981   H HD23 . LEU A 1 113 ? 9.364   3.176   0.494   1.00 31.12 ? 113 LEU A HD23 2  
ATOM 8982   N N    . ARG A 1 114 ? 10.700  8.437   0.405   1.00 32.33 ? 114 ARG A N    2  
ATOM 8983   C CA   . ARG A 1 114 ? 10.798  9.009   1.783   1.00 11.12 ? 114 ARG A CA   2  
ATOM 8984   C C    . ARG A 1 114 ? 9.888   10.245  1.875   1.00 23.33 ? 114 ARG A C    2  
ATOM 8985   O O    . ARG A 1 114 ? 9.098   10.379  2.788   1.00 51.35 ? 114 ARG A O    2  
ATOM 8986   C CB   . ARG A 1 114 ? 12.272  9.404   2.066   1.00 2.31  ? 114 ARG A CB   2  
ATOM 8987   C CG   . ARG A 1 114 ? 12.909  8.451   3.091   1.00 33.21 ? 114 ARG A CG   2  
ATOM 8988   C CD   . ARG A 1 114 ? 12.451  8.822   4.506   1.00 53.41 ? 114 ARG A CD   2  
ATOM 8989   N NE   . ARG A 1 114 ? 13.197  8.000   5.500   1.00 34.44 ? 114 ARG A NE   2  
ATOM 8990   C CZ   . ARG A 1 114 ? 12.774  7.924   6.732   1.00 55.14 ? 114 ARG A CZ   2  
ATOM 8991   N NH1  . ARG A 1 114 ? 11.701  8.571   7.094   1.00 42.03 ? 114 ARG A NH1  2  
ATOM 8992   N NH2  . ARG A 1 114 ? 13.425  7.201   7.602   1.00 64.45 ? 114 ARG A NH2  2  
ATOM 8993   H H    . ARG A 1 114 ? 10.480  9.021   -0.349  1.00 41.23 ? 114 ARG A H    2  
ATOM 8994   H HA   . ARG A 1 114 ? 10.464  8.272   2.500   1.00 2.52  ? 114 ARG A HA   2  
ATOM 8995   H HB2  . ARG A 1 114 ? 12.832  9.349   1.144   1.00 13.14 ? 114 ARG A HB2  2  
ATOM 8996   H HB3  . ARG A 1 114 ? 12.321  10.416  2.446   1.00 64.13 ? 114 ARG A HB3  2  
ATOM 8997   H HG2  . ARG A 1 114 ? 12.614  7.435   2.873   1.00 53.02 ? 114 ARG A HG2  2  
ATOM 8998   H HG3  . ARG A 1 114 ? 13.982  8.534   3.033   1.00 74.44 ? 114 ARG A HG3  2  
ATOM 8999   H HD2  . ARG A 1 114 ? 12.647  9.868   4.688   1.00 63.50 ? 114 ARG A HD2  2  
ATOM 9000   H HD3  . ARG A 1 114 ? 11.393  8.632   4.606   1.00 72.11 ? 114 ARG A HD3  2  
ATOM 9001   H HE   . ARG A 1 114 ? 14.005  7.516   5.228   1.00 54.12 ? 114 ARG A HE   2  
ATOM 9002   H HH11 . ARG A 1 114 ? 11.203  9.126   6.427   1.00 31.44 ? 114 ARG A HH11 2  
ATOM 9003   H HH12 . ARG A 1 114 ? 11.377  8.514   8.038   1.00 12.44 ? 114 ARG A HH12 2  
ATOM 9004   H HH21 . ARG A 1 114 ? 14.248  6.706   7.325   1.00 60.24 ? 114 ARG A HH21 2  
ATOM 9005   H HH22 . ARG A 1 114 ? 13.101  7.144   8.546   1.00 34.13 ? 114 ARG A HH22 2  
ATOM 9006   N N    . PHE A 1 115 ? 10.004  11.150  0.940   1.00 13.22 ? 115 PHE A N    2  
ATOM 9007   C CA   . PHE A 1 115 ? 9.159   12.383  0.971   1.00 74.43 ? 115 PHE A CA   2  
ATOM 9008   C C    . PHE A 1 115 ? 7.848   12.138  0.221   1.00 2.51  ? 115 PHE A C    2  
ATOM 9009   O O    . PHE A 1 115 ? 7.130   13.063  -0.105  1.00 10.13 ? 115 PHE A O    2  
ATOM 9010   C CB   . PHE A 1 115 ? 9.914   13.527  0.296   1.00 51.30 ? 115 PHE A CB   2  
ATOM 9011   C CG   . PHE A 1 115 ? 11.072  13.947  1.166   1.00 54.14 ? 115 PHE A CG   2  
ATOM 9012   C CD1  . PHE A 1 115 ? 10.880  14.903  2.169   1.00 12.33 ? 115 PHE A CD1  2  
ATOM 9013   C CD2  . PHE A 1 115 ? 12.338  13.383  0.968   1.00 33.22 ? 115 PHE A CD2  2  
ATOM 9014   C CE1  . PHE A 1 115 ? 11.953  15.294  2.978   1.00 14.52 ? 115 PHE A CE1  2  
ATOM 9015   C CE2  . PHE A 1 115 ? 13.411  13.773  1.777   1.00 44.30 ? 115 PHE A CE2  2  
ATOM 9016   C CZ   . PHE A 1 115 ? 13.219  14.730  2.781   1.00 72.10 ? 115 PHE A CZ   2  
ATOM 9017   H H    . PHE A 1 115 ? 10.654  11.023  0.218   1.00 14.13 ? 115 PHE A H    2  
ATOM 9018   H HA   . PHE A 1 115 ? 8.943   12.652  1.995   1.00 33.24 ? 115 PHE A HA   2  
ATOM 9019   H HB2  . PHE A 1 115 ? 10.286  13.196  -0.663  1.00 25.10 ? 115 PHE A HB2  2  
ATOM 9020   H HB3  . PHE A 1 115 ? 9.248   14.365  0.154   1.00 61.02 ? 115 PHE A HB3  2  
ATOM 9021   H HD1  . PHE A 1 115 ? 9.903   15.338  2.321   1.00 12.25 ? 115 PHE A HD1  2  
ATOM 9022   H HD2  . PHE A 1 115 ? 12.485  12.645  0.193   1.00 32.15 ? 115 PHE A HD2  2  
ATOM 9023   H HE1  . PHE A 1 115 ? 11.805  16.031  3.753   1.00 53.30 ? 115 PHE A HE1  2  
ATOM 9024   H HE2  . PHE A 1 115 ? 14.388  13.337  1.625   1.00 20.23 ? 115 PHE A HE2  2  
ATOM 9025   H HZ   . PHE A 1 115 ? 14.048  15.031  3.405   1.00 33.23 ? 115 PHE A HZ   2  
ATOM 9026   N N    . TRP A 1 116 ? 7.529   10.907  -0.063  1.00 74.42 ? 116 TRP A N    2  
ATOM 9027   C CA   . TRP A 1 116 ? 6.266   10.622  -0.798  1.00 61.23 ? 116 TRP A CA   2  
ATOM 9028   C C    . TRP A 1 116 ? 5.065   10.951  0.092   1.00 61.21 ? 116 TRP A C    2  
ATOM 9029   O O    . TRP A 1 116 ? 4.946   10.461  1.198   1.00 72.01 ? 116 TRP A O    2  
ATOM 9030   C CB   . TRP A 1 116 ? 6.228   9.144   -1.192  1.00 60.33 ? 116 TRP A CB   2  
ATOM 9031   C CG   . TRP A 1 116 ? 6.149   8.297   0.038   1.00 32.12 ? 116 TRP A CG   2  
ATOM 9032   C CD1  . TRP A 1 116 ? 7.189   8.012   0.855   1.00 24.14 ? 116 TRP A CD1  2  
ATOM 9033   C CD2  . TRP A 1 116 ? 4.988   7.623   0.601   1.00 2.22  ? 116 TRP A CD2  2  
ATOM 9034   N NE1  . TRP A 1 116 ? 6.739   7.203   1.883   1.00 12.35 ? 116 TRP A NE1  2  
ATOM 9035   C CE2  . TRP A 1 116 ? 5.389   6.936   1.771   1.00 2.21  ? 116 TRP A CE2  2  
ATOM 9036   C CE3  . TRP A 1 116 ? 3.639   7.543   0.213   1.00 35.34 ? 116 TRP A CE3  2  
ATOM 9037   C CZ2  . TRP A 1 116 ? 4.482   6.193   2.529   1.00 30.21 ? 116 TRP A CZ2  2  
ATOM 9038   C CZ3  . TRP A 1 116 ? 2.724   6.798   0.973   1.00 22.04 ? 116 TRP A CZ3  2  
ATOM 9039   C CH2  . TRP A 1 116 ? 3.145   6.124   2.128   1.00 63.55 ? 116 TRP A CH2  2  
ATOM 9040   H H    . TRP A 1 116 ? 8.121   10.172  0.203   1.00 2.11  ? 116 TRP A H    2  
ATOM 9041   H HA   . TRP A 1 116 ? 6.227   11.231  -1.689  1.00 13.44 ? 116 TRP A HA   2  
ATOM 9042   H HB2  . TRP A 1 116 ? 5.362   8.960   -1.811  1.00 60.34 ? 116 TRP A HB2  2  
ATOM 9043   H HB3  . TRP A 1 116 ? 7.123   8.896   -1.743  1.00 72.53 ? 116 TRP A HB3  2  
ATOM 9044   H HD1  . TRP A 1 116 ? 8.204   8.357   0.726   1.00 54.43 ? 116 TRP A HD1  2  
ATOM 9045   H HE1  . TRP A 1 116 ? 7.294   6.853   2.611   1.00 62.51 ? 116 TRP A HE1  2  
ATOM 9046   H HE3  . TRP A 1 116 ? 3.305   8.059   -0.675  1.00 74.44 ? 116 TRP A HE3  2  
ATOM 9047   H HZ2  . TRP A 1 116 ? 4.811   5.676   3.418   1.00 31.03 ? 116 TRP A HZ2  2  
ATOM 9048   H HZ3  . TRP A 1 116 ? 1.690   6.743   0.666   1.00 11.22 ? 116 TRP A HZ3  2  
ATOM 9049   H HH2  . TRP A 1 116 ? 2.436   5.552   2.709   1.00 62.12 ? 116 TRP A HH2  2  
ATOM 9050   N N    . GLY A 1 117 ? 4.172   11.779  -0.387  1.00 75.04 ? 117 GLY A N    2  
ATOM 9051   C CA   . GLY A 1 117 ? 2.968   12.152  0.419   1.00 64.43 ? 117 GLY A CA   2  
ATOM 9052   C C    . GLY A 1 117 ? 2.683   13.643  0.236   1.00 70.14 ? 117 GLY A C    2  
ATOM 9053   O O    . GLY A 1 117 ? 3.577   14.464  0.277   1.00 25.31 ? 117 GLY A O    2  
ATOM 9054   H H    . GLY A 1 117 ? 4.294   12.158  -1.282  1.00 55.02 ? 117 GLY A H    2  
ATOM 9055   H HA2  . GLY A 1 117 ? 2.117   11.578  0.081   1.00 64.23 ? 117 GLY A HA2  2  
ATOM 9056   H HA3  . GLY A 1 117 ? 3.145   11.952  1.466   1.00 13.31 ? 117 GLY A HA3  2  
ATOM 9057   N N    . SER A 1 118 ? 1.444   14.005  0.037   1.00 61.14 ? 118 SER A N    2  
ATOM 9058   C CA   . SER A 1 118 ? 1.117   15.448  -0.142  1.00 34.53 ? 118 SER A CA   2  
ATOM 9059   C C    . SER A 1 118 ? -0.378  15.662  -0.021  1.00 31.40 ? 118 SER A C    2  
ATOM 9060   O O    . SER A 1 118 ? -1.155  14.731  0.057   1.00 10.40 ? 118 SER A O    2  
ATOM 9061   C CB   . SER A 1 118 ? 1.598   15.932  -1.510  1.00 22.51 ? 118 SER A CB   2  
ATOM 9062   O OG   . SER A 1 118 ? 3.016   15.842  -1.568  1.00 2.43  ? 118 SER A OG   2  
ATOM 9063   H H    . SER A 1 118 ? 0.732   13.332  0.010   1.00 43.41 ? 118 SER A H    2  
ATOM 9064   H HA   . SER A 1 118 ? 1.595   16.024  0.633   1.00 2.40  ? 118 SER A HA   2  
ATOM 9065   H HB2  . SER A 1 118 ? 1.171   15.317  -2.284  1.00 34.15 ? 118 SER A HB2  2  
ATOM 9066   H HB3  . SER A 1 118 ? 1.287   16.959  -1.656  1.00 63.01 ? 118 SER A HB3  2  
ATOM 9067   H HG   . SER A 1 118 ? 3.244   15.192  -2.237  1.00 70.11 ? 118 SER A HG   2  
ATOM 9068   N N    . ASN A 1 119 ? -0.779  16.896  0.023   1.00 41.35 ? 119 ASN A N    2  
ATOM 9069   C CA   . ASN A 1 119 ? -2.218  17.204  0.174   1.00 54.22 ? 119 ASN A CA   2  
ATOM 9070   C C    . ASN A 1 119 ? -2.483  18.606  -0.388  1.00 54.24 ? 119 ASN A C    2  
ATOM 9071   O O    . ASN A 1 119 ? -2.178  19.602  0.238   1.00 1.23  ? 119 ASN A O    2  
ATOM 9072   C CB   . ASN A 1 119 ? -2.591  17.137  1.679   1.00 65.24 ? 119 ASN A CB   2  
ATOM 9073   C CG   . ASN A 1 119 ? -1.418  16.592  2.503   1.00 53.14 ? 119 ASN A CG   2  
ATOM 9074   O OD1  . ASN A 1 119 ? -1.431  15.450  2.918   1.00 5.13  ? 119 ASN A OD1  2  
ATOM 9075   N ND2  . ASN A 1 119 ? -0.400  17.367  2.761   1.00 51.40 ? 119 ASN A ND2  2  
ATOM 9076   H H    . ASN A 1 119 ? -0.124  17.624  -0.022  1.00 14.02 ? 119 ASN A H    2  
ATOM 9077   H HA   . ASN A 1 119 ? -2.803  16.482  -0.382  1.00 33.51 ? 119 ASN A HA   2  
ATOM 9078   H HB2  . ASN A 1 119 ? -2.839  18.121  2.044   1.00 32.00 ? 119 ASN A HB2  2  
ATOM 9079   H HB3  . ASN A 1 119 ? -3.436  16.485  1.809   1.00 23.51 ? 119 ASN A HB3  2  
ATOM 9080   H HD21 . ASN A 1 119 ? -0.389  18.289  2.428   1.00 34.14 ? 119 ASN A HD21 2  
ATOM 9081   H HD22 . ASN A 1 119 ? 0.353   17.028  3.287   1.00 62.15 ? 119 ASN A HD22 2  
ATOM 9082   N N    . VAL A 1 120 ? -3.046  18.694  -1.560  1.00 73.11 ? 120 VAL A N    2  
ATOM 9083   C CA   . VAL A 1 120 ? -3.325  20.032  -2.142  1.00 31.12 ? 120 VAL A CA   2  
ATOM 9084   C C    . VAL A 1 120 ? -4.485  20.678  -1.381  1.00 61.20 ? 120 VAL A C    2  
ATOM 9085   O O    . VAL A 1 120 ? -4.560  21.885  -1.263  1.00 60.53 ? 120 VAL A O    2  
ATOM 9086   C CB   . VAL A 1 120 ? -3.685  19.889  -3.622  1.00 11.25 ? 120 VAL A CB   2  
ATOM 9087   C CG1  . VAL A 1 120 ? -4.062  21.259  -4.188  1.00 44.23 ? 120 VAL A CG1  2  
ATOM 9088   C CG2  . VAL A 1 120 ? -2.477  19.338  -4.384  1.00 40.14 ? 120 VAL A CG2  2  
ATOM 9089   H H    . VAL A 1 120 ? -3.286  17.882  -2.053  1.00 44.22 ? 120 VAL A H    2  
ATOM 9090   H HA   . VAL A 1 120 ? -2.446  20.654  -2.046  1.00 71.12 ? 120 VAL A HA   2  
ATOM 9091   H HB   . VAL A 1 120 ? -4.518  19.211  -3.726  1.00 13.45 ? 120 VAL A HB   2  
ATOM 9092   H HG11 . VAL A 1 120 ? -5.012  21.569  -3.778  1.00 35.54 ? 120 VAL A HG11 2  
ATOM 9093   H HG12 . VAL A 1 120 ? -4.135  21.197  -5.263  1.00 21.32 ? 120 VAL A HG12 2  
ATOM 9094   H HG13 . VAL A 1 120 ? -3.303  21.979  -3.920  1.00 24.44 ? 120 VAL A HG13 2  
ATOM 9095   H HG21 . VAL A 1 120 ? -2.646  19.433  -5.447  1.00 74.22 ? 120 VAL A HG21 2  
ATOM 9096   H HG22 . VAL A 1 120 ? -2.338  18.296  -4.134  1.00 5.10  ? 120 VAL A HG22 2  
ATOM 9097   H HG23 . VAL A 1 120 ? -1.593  19.895  -4.110  1.00 22.51 ? 120 VAL A HG23 2  
ATOM 9098   N N    . ILE A 1 121 ? -5.386  19.880  -0.852  1.00 55.10 ? 121 ILE A N    2  
ATOM 9099   C CA   . ILE A 1 121 ? -6.543  20.438  -0.080  1.00 72.24 ? 121 ILE A CA   2  
ATOM 9100   C C    . ILE A 1 121 ? -6.610  19.734  1.275   1.00 71.45 ? 121 ILE A C    2  
ATOM 9101   O O    . ILE A 1 121 ? -6.537  18.524  1.360   1.00 22.42 ? 121 ILE A O    2  
ATOM 9102   C CB   . ILE A 1 121 ? -7.849  20.202  -0.853  1.00 25.21 ? 121 ILE A CB   2  
ATOM 9103   C CG1  . ILE A 1 121 ? -7.688  20.665  -2.325  1.00 10.42 ? 121 ILE A CG1  2  
ATOM 9104   C CG2  . ILE A 1 121 ? -8.976  20.999  -0.187  1.00 43.01 ? 121 ILE A CG2  2  
ATOM 9105   C CD1  . ILE A 1 121 ? -7.233  19.497  -3.206  1.00 64.11 ? 121 ILE A CD1  2  
ATOM 9106   H H    . ILE A 1 121 ? -5.297  18.904  -0.955  1.00 74.42 ? 121 ILE A H    2  
ATOM 9107   H HA   . ILE A 1 121 ? -6.408  21.500  0.082   1.00 33.43 ? 121 ILE A HA   2  
ATOM 9108   H HB   . ILE A 1 121 ? -8.097  19.149  -0.823  1.00 3.33  ? 121 ILE A HB   2  
ATOM 9109   H HG12 . ILE A 1 121 ? -8.635  21.031  -2.695  1.00 71.10 ? 121 ILE A HG12 2  
ATOM 9110   H HG13 . ILE A 1 121 ? -6.956  21.459  -2.383  1.00 12.42 ? 121 ILE A HG13 2  
ATOM 9111   H HG21 . ILE A 1 121 ? -9.928  20.652  -0.560  1.00 41.40 ? 121 ILE A HG21 2  
ATOM 9112   H HG22 . ILE A 1 121 ? -8.860  22.047  -0.418  1.00 12.50 ? 121 ILE A HG22 2  
ATOM 9113   H HG23 . ILE A 1 121 ? -8.934  20.858  0.882   1.00 22.51 ? 121 ILE A HG23 2  
ATOM 9114   H HD11 . ILE A 1 121 ? -8.095  18.923  -3.516  1.00 51.44 ? 121 ILE A HD11 2  
ATOM 9115   H HD12 . ILE A 1 121 ? -6.563  18.867  -2.649  1.00 33.52 ? 121 ILE A HD12 2  
ATOM 9116   H HD13 . ILE A 1 121 ? -6.726  19.881  -4.079  1.00 43.23 ? 121 ILE A HD13 2  
ATOM 9117   N N    . GLU A 1 122 ? -6.731  20.480  2.341   1.00 71.32 ? 122 GLU A N    2  
ATOM 9118   C CA   . GLU A 1 122 ? -6.783  19.849  3.693   1.00 41.41 ? 122 GLU A CA   2  
ATOM 9119   C C    . GLU A 1 122 ? -7.645  20.704  4.624   1.00 3.10  ? 122 GLU A C    2  
ATOM 9120   O O    . GLU A 1 122 ? -7.449  21.897  4.753   1.00 72.34 ? 122 GLU A O    2  
ATOM 9121   C CB   . GLU A 1 122 ? -5.353  19.737  4.251   1.00 41.52 ? 122 GLU A CB   2  
ATOM 9122   C CG   . GLU A 1 122 ? -4.511  20.919  3.763   1.00 33.25 ? 122 GLU A CG   2  
ATOM 9123   C CD   . GLU A 1 122 ? -3.140  20.875  4.438   1.00 43.42 ? 122 GLU A CD   2  
ATOM 9124   O OE1  . GLU A 1 122 ? -2.802  19.835  4.978   1.00 25.32 ? 122 GLU A OE1  2  
ATOM 9125   O OE2  . GLU A 1 122 ? -2.450  21.881  4.403   1.00 52.43 ? 122 GLU A OE2  2  
ATOM 9126   H H    . GLU A 1 122 ? -6.778  21.455  2.253   1.00 72.42 ? 122 GLU A H    2  
ATOM 9127   H HA   . GLU A 1 122 ? -7.218  18.862  3.618   1.00 43.35 ? 122 GLU A HA   2  
ATOM 9128   H HB2  . GLU A 1 122 ? -5.378  19.736  5.332   1.00 45.11 ? 122 GLU A HB2  2  
ATOM 9129   H HB3  . GLU A 1 122 ? -4.904  18.817  3.904   1.00 73.30 ? 122 GLU A HB3  2  
ATOM 9130   H HG2  . GLU A 1 122 ? -4.386  20.857  2.691   1.00 10.43 ? 122 GLU A HG2  2  
ATOM 9131   H HG3  . GLU A 1 122 ? -5.007  21.845  4.016   1.00 33.33 ? 122 GLU A HG3  2  
ATOM 9132   N N    . ILE A 1 123 ? -8.601  20.099  5.276   1.00 71.44 ? 123 ILE A N    2  
ATOM 9133   C CA   . ILE A 1 123 ? -9.476  20.870  6.199   1.00 61.34 ? 123 ILE A CA   2  
ATOM 9134   C C    . ILE A 1 123 ? -10.178 19.907  7.162   1.00 30.41 ? 123 ILE A C    2  
ATOM 9135   O O    . ILE A 1 123 ? -10.661 18.861  6.774   1.00 51.10 ? 123 ILE A O    2  
ATOM 9136   C CB   . ILE A 1 123 ? -10.518 21.639  5.382   1.00 53.23 ? 123 ILE A CB   2  
ATOM 9137   C CG1  . ILE A 1 123 ? -11.356 22.535  6.306   1.00 3.42  ? 123 ILE A CG1  2  
ATOM 9138   C CG2  . ILE A 1 123 ? -11.440 20.646  4.670   1.00 13.43 ? 123 ILE A CG2  2  
ATOM 9139   C CD1  . ILE A 1 123 ? -10.477 23.615  6.955   1.00 30.24 ? 123 ILE A CD1  2  
ATOM 9140   H H    . ILE A 1 123 ? -8.741  19.135  5.158   1.00 64.05 ? 123 ILE A H    2  
ATOM 9141   H HA   . ILE A 1 123 ? -8.874  21.566  6.763   1.00 75.34 ? 123 ILE A HA   2  
ATOM 9142   H HB   . ILE A 1 123 ? -10.014 22.248  4.646   1.00 44.23 ? 123 ILE A HB   2  
ATOM 9143   H HG12 . ILE A 1 123 ? -12.134 23.011  5.728   1.00 1.35  ? 123 ILE A HG12 2  
ATOM 9144   H HG13 . ILE A 1 123 ? -11.807 21.931  7.078   1.00 62.24 ? 123 ILE A HG13 2  
ATOM 9145   H HG21 . ILE A 1 123 ? -12.050 21.174  3.953   1.00 14.10 ? 123 ILE A HG21 2  
ATOM 9146   H HG22 . ILE A 1 123 ? -12.075 20.159  5.394   1.00 73.42 ? 123 ILE A HG22 2  
ATOM 9147   H HG23 . ILE A 1 123 ? -10.843 19.906  4.157   1.00 55.23 ? 123 ILE A HG23 2  
ATOM 9148   H HD11 . ILE A 1 123 ? -10.057 23.234  7.874   1.00 62.11 ? 123 ILE A HD11 2  
ATOM 9149   H HD12 . ILE A 1 123 ? -11.081 24.484  7.172   1.00 32.14 ? 123 ILE A HD12 2  
ATOM 9150   H HD13 . ILE A 1 123 ? -9.679  23.895  6.282   1.00 64.33 ? 123 ILE A HD13 2  
ATOM 9151   N N    . GLY A 1 124 ? -10.240 20.255  8.416   1.00 12.11 ? 124 GLY A N    2  
ATOM 9152   C CA   . GLY A 1 124 ? -10.914 19.366  9.402   1.00 60.10 ? 124 GLY A CA   2  
ATOM 9153   C C    . GLY A 1 124 ? -10.232 18.001  9.421   1.00 64.02 ? 124 GLY A C    2  
ATOM 9154   O O    . GLY A 1 124 ? -9.159  17.820  8.878   1.00 73.40 ? 124 GLY A O    2  
ATOM 9155   H H    . GLY A 1 124 ? -9.847  21.103  8.711   1.00 63.04 ? 124 GLY A H    2  
ATOM 9156   H HA2  . GLY A 1 124 ? -10.858 19.809  10.381  1.00 75.13 ? 124 GLY A HA2  2  
ATOM 9157   H HA3  . GLY A 1 124 ? -11.949 19.240  9.122   1.00 72.15 ? 124 GLY A HA3  2  
ATOM 9158   N N    . ASP A 1 125 ? -10.857 17.035  10.034  1.00 74.45 ? 125 ASP A N    2  
ATOM 9159   C CA   . ASP A 1 125 ? -10.266 15.670  10.086  1.00 1.40  ? 125 ASP A CA   2  
ATOM 9160   C C    . ASP A 1 125 ? -10.334 15.050  8.692   1.00 64.14 ? 125 ASP A C    2  
ATOM 9161   O O    . ASP A 1 125 ? -10.132 13.866  8.515   1.00 32.44 ? 125 ASP A O    2  
ATOM 9162   C CB   . ASP A 1 125 ? -11.069 14.812  11.067  1.00 15.21 ? 125 ASP A CB   2  
ATOM 9163   C CG   . ASP A 1 125 ? -10.890 15.357  12.485  1.00 71.55 ? 125 ASP A CG   2  
ATOM 9164   O OD1  . ASP A 1 125 ? -9.806  15.831  12.784  1.00 40.22 ? 125 ASP A OD1  2  
ATOM 9165   O OD2  . ASP A 1 125 ? -11.840 15.293  13.248  1.00 71.41 ? 125 ASP A OD2  2  
ATOM 9166   H H    . ASP A 1 125 ? -11.725 17.207  10.454  1.00 62.24 ? 125 ASP A H    2  
ATOM 9167   H HA   . ASP A 1 125 ? -9.237  15.729  10.409  1.00 3.22  ? 125 ASP A HA   2  
ATOM 9168   H HB2  . ASP A 1 125 ? -12.115 14.844  10.799  1.00 4.13  ? 125 ASP A HB2  2  
ATOM 9169   H HB3  . ASP A 1 125 ? -10.718 13.792  11.028  1.00 24.21 ? 125 ASP A HB3  2  
ATOM 9170   N N    . LEU A 1 126 ? -10.633 15.853  7.701   1.00 22.30 ? 126 LEU A N    2  
ATOM 9171   C CA   . LEU A 1 126 ? -10.739 15.350  6.300   1.00 22.43 ? 126 LEU A CA   2  
ATOM 9172   C C    . LEU A 1 126 ? -9.564  15.891  5.470   1.00 22.02 ? 126 LEU A C    2  
ATOM 9173   O O    . LEU A 1 126 ? -9.267  17.069  5.494   1.00 53.21 ? 126 LEU A O    2  
ATOM 9174   C CB   . LEU A 1 126 ? -12.081 15.840  5.727   1.00 32.02 ? 126 LEU A CB   2  
ATOM 9175   C CG   . LEU A 1 126 ? -12.123 15.689  4.182   1.00 54.21 ? 126 LEU A CG   2  
ATOM 9176   C CD1  . LEU A 1 126 ? -13.521 15.235  3.732   1.00 22.13 ? 126 LEU A CD1  2  
ATOM 9177   C CD2  . LEU A 1 126 ? -11.802 17.036  3.512   1.00 4.14  ? 126 LEU A CD2  2  
ATOM 9178   H H    . LEU A 1 126 ? -10.799 16.801  7.882   1.00 3.42  ? 126 LEU A H    2  
ATOM 9179   H HA   . LEU A 1 126 ? -10.719 14.269  6.289   1.00 50.42 ? 126 LEU A HA   2  
ATOM 9180   H HB2  . LEU A 1 126 ? -12.876 15.256  6.173   1.00 3.13  ? 126 LEU A HB2  2  
ATOM 9181   H HB3  . LEU A 1 126 ? -12.219 16.877  5.997   1.00 5.43  ? 126 LEU A HB3  2  
ATOM 9182   H HG   . LEU A 1 126 ? -11.397 14.950  3.867   1.00 33.23 ? 126 LEU A HG   2  
ATOM 9183   H HD11 . LEU A 1 126 ? -13.769 14.301  4.214   1.00 4.52  ? 126 LEU A HD11 2  
ATOM 9184   H HD12 . LEU A 1 126 ? -13.529 15.099  2.660   1.00 45.32 ? 126 LEU A HD12 2  
ATOM 9185   H HD13 . LEU A 1 126 ? -14.249 15.986  4.004   1.00 1.53  ? 126 LEU A HD13 2  
ATOM 9186   H HD21 . LEU A 1 126 ? -11.001 17.523  4.043   1.00 42.30 ? 126 LEU A HD21 2  
ATOM 9187   H HD22 . LEU A 1 126 ? -12.677 17.669  3.533   1.00 12.24 ? 126 LEU A HD22 2  
ATOM 9188   H HD23 . LEU A 1 126 ? -11.504 16.867  2.489   1.00 53.20 ? 126 LEU A HD23 2  
ATOM 9189   N N    . THR A 1 127 ? -8.889  15.031  4.741   1.00 54.13 ? 127 THR A N    2  
ATOM 9190   C CA   . THR A 1 127 ? -7.727  15.475  3.897   1.00 12.42 ? 127 THR A CA   2  
ATOM 9191   C C    . THR A 1 127 ? -7.898  14.903  2.484   1.00 54.50 ? 127 THR A C    2  
ATOM 9192   O O    . THR A 1 127 ? -8.370  13.796  2.311   1.00 2.41  ? 127 THR A O    2  
ATOM 9193   C CB   . THR A 1 127 ? -6.415  14.960  4.510   1.00 42.33 ? 127 THR A CB   2  
ATOM 9194   O OG1  . THR A 1 127 ? -6.610  13.640  4.998   1.00 22.45 ? 127 THR A OG1  2  
ATOM 9195   C CG2  . THR A 1 127 ? -5.988  15.872  5.664   1.00 34.35 ? 127 THR A CG2  2  
ATOM 9196   H H    . THR A 1 127 ? -9.149  14.085  4.746   1.00 61.43 ? 127 THR A H    2  
ATOM 9197   H HA   . THR A 1 127 ? -7.702  16.555  3.838   1.00 54.00 ? 127 THR A HA   2  
ATOM 9198   H HB   . THR A 1 127 ? -5.640  14.954  3.757   1.00 70.24 ? 127 THR A HB   2  
ATOM 9199   H HG1  . THR A 1 127 ? -6.077  13.535  5.790   1.00 1.04  ? 127 THR A HG1  2  
ATOM 9200   H HG21 . THR A 1 127 ? -5.869  16.882  5.300   1.00 33.51 ? 127 THR A HG21 2  
ATOM 9201   H HG22 . THR A 1 127 ? -5.049  15.525  6.070   1.00 12.55 ? 127 THR A HG22 2  
ATOM 9202   H HG23 . THR A 1 127 ? -6.742  15.853  6.436   1.00 52.21 ? 127 THR A HG23 2  
ATOM 9203   N N    . ILE A 1 128 ? -7.532  15.653  1.468   1.00 15.41 ? 128 ILE A N    2  
ATOM 9204   C CA   . ILE A 1 128 ? -7.687  15.155  0.061   1.00 11.11 ? 128 ILE A CA   2  
ATOM 9205   C C    . ILE A 1 128 ? -6.440  15.480  -0.768  1.00 41.11 ? 128 ILE A C    2  
ATOM 9206   O O    . ILE A 1 128 ? -5.910  16.582  -0.732  1.00 11.11 ? 128 ILE A O    2  
ATOM 9207   C CB   . ILE A 1 128 ? -8.918  15.813  -0.584  1.00 43.12 ? 128 ILE A CB   2  
ATOM 9208   C CG1  . ILE A 1 128 ? -10.185 15.295  0.117   1.00 45.15 ? 128 ILE A CG1  2  
ATOM 9209   C CG2  . ILE A 1 128 ? -8.968  15.476  -2.094  1.00 40.40 ? 128 ILE A CG2  2  
ATOM 9210   C CD1  . ILE A 1 128 ? -11.402 16.093  -0.353  1.00 2.20  ? 128 ILE A CD1  2  
ATOM 9211   H H    . ILE A 1 128 ? -7.162  16.545  1.630   1.00 31.03 ? 128 ILE A H    2  
ATOM 9212   H HA   . ILE A 1 128 ? -7.826  14.080  0.065   1.00 4.32  ? 128 ILE A HA   2  
ATOM 9213   H HB   . ILE A 1 128 ? -8.852  16.886  -0.457  1.00 1.42  ? 128 ILE A HB   2  
ATOM 9214   H HG12 . ILE A 1 128 ? -10.326 14.254  -0.119  1.00 72.43 ? 128 ILE A HG12 2  
ATOM 9215   H HG13 . ILE A 1 128 ? -10.079 15.408  1.184   1.00 32.12 ? 128 ILE A HG13 2  
ATOM 9216   H HG21 . ILE A 1 128 ? -8.486  14.525  -2.274  1.00 20.31 ? 128 ILE A HG21 2  
ATOM 9217   H HG22 . ILE A 1 128 ? -8.454  16.245  -2.652  1.00 52.12 ? 128 ILE A HG22 2  
ATOM 9218   H HG23 . ILE A 1 128 ? -9.995  15.423  -2.429  1.00 51.22 ? 128 ILE A HG23 2  
ATOM 9219   H HD11 . ILE A 1 128 ? -11.605 15.862  -1.388  1.00 32.33 ? 128 ILE A HD11 2  
ATOM 9220   H HD12 . ILE A 1 128 ? -11.201 17.149  -0.253  1.00 53.21 ? 128 ILE A HD12 2  
ATOM 9221   H HD13 . ILE A 1 128 ? -12.259 15.830  0.249   1.00 62.45 ? 128 ILE A HD13 2  
ATOM 9222   N N    . SER A 1 129 ? -5.986  14.514  -1.530  1.00 11.01 ? 129 SER A N    2  
ATOM 9223   C CA   . SER A 1 129 ? -4.787  14.700  -2.403  1.00 34.34 ? 129 SER A CA   2  
ATOM 9224   C C    . SER A 1 129 ? -5.163  14.281  -3.842  1.00 64.40 ? 129 SER A C    2  
ATOM 9225   O O    . SER A 1 129 ? -5.273  13.105  -4.127  1.00 41.43 ? 129 SER A O    2  
ATOM 9226   C CB   . SER A 1 129 ? -3.658  13.801  -1.897  1.00 43.24 ? 129 SER A CB   2  
ATOM 9227   O OG   . SER A 1 129 ? -3.512  13.976  -0.493  1.00 71.11 ? 129 SER A OG   2  
ATOM 9228   H H    . SER A 1 129 ? -6.453  13.652  -1.536  1.00 1.33  ? 129 SER A H    2  
ATOM 9229   H HA   . SER A 1 129 ? -4.464  15.728  -2.376  1.00 13.15 ? 129 SER A HA   2  
ATOM 9230   H HB2  . SER A 1 129 ? -3.896  12.771  -2.102  1.00 53.22 ? 129 SER A HB2  2  
ATOM 9231   H HB3  . SER A 1 129 ? -2.736  14.063  -2.401  1.00 11.43 ? 129 SER A HB3  2  
ATOM 9232   H HG   . SER A 1 129 ? -2.850  14.656  -0.347  1.00 32.32 ? 129 SER A HG   2  
ATOM 9233   N N    . PRO A 1 130 ? -5.381  15.221  -4.742  1.00 41.33 ? 130 PRO A N    2  
ATOM 9234   C CA   . PRO A 1 130 ? -5.770  14.909  -6.148  1.00 22.01 ? 130 PRO A CA   2  
ATOM 9235   C C    . PRO A 1 130 ? -4.557  14.590  -7.027  1.00 44.13 ? 130 PRO A C    2  
ATOM 9236   O O    . PRO A 1 130 ? -4.663  13.892  -8.016  1.00 23.42 ? 130 PRO A O    2  
ATOM 9237   C CB   . PRO A 1 130 ? -6.456  16.199  -6.605  1.00 53.34 ? 130 PRO A CB   2  
ATOM 9238   C CG   . PRO A 1 130 ? -5.742  17.287  -5.864  1.00 40.02 ? 130 PRO A CG   2  
ATOM 9239   C CD   . PRO A 1 130 ? -5.281  16.675  -4.530  1.00 65.41 ? 130 PRO A CD   2  
ATOM 9240   H HA   . PRO A 1 130 ? -6.475  14.095  -6.171  1.00 52.43 ? 130 PRO A HA   2  
ATOM 9241   H HB2  . PRO A 1 130 ? -6.352  16.328  -7.677  1.00 75.14 ? 130 PRO A HB2  2  
ATOM 9242   H HB3  . PRO A 1 130 ? -7.500  16.186  -6.328  1.00 63.10 ? 130 PRO A HB3  2  
ATOM 9243   H HG2  . PRO A 1 130 ? -4.887  17.628  -6.438  1.00 72.24 ? 130 PRO A HG2  2  
ATOM 9244   H HG3  . PRO A 1 130 ? -6.411  18.114  -5.674  1.00 51.15 ? 130 PRO A HG3  2  
ATOM 9245   H HD2  . PRO A 1 130 ? -4.258  16.957  -4.317  1.00 12.34 ? 130 PRO A HD2  2  
ATOM 9246   H HD3  . PRO A 1 130 ? -5.932  16.969  -3.726  1.00 40.44 ? 130 PRO A HD3  2  
ATOM 9247   N N    . ASP A 1 131 ? -3.408  15.091  -6.672  1.00 11.43 ? 131 ASP A N    2  
ATOM 9248   C CA   . ASP A 1 131 ? -2.195  14.807  -7.486  1.00 21.11 ? 131 ASP A CA   2  
ATOM 9249   C C    . ASP A 1 131 ? -1.874  13.315  -7.390  1.00 40.33 ? 131 ASP A C    2  
ATOM 9250   O O    . ASP A 1 131 ? -1.473  12.690  -8.351  1.00 63.32 ? 131 ASP A O    2  
ATOM 9251   C CB   . ASP A 1 131 ? -1.021  15.627  -6.949  1.00 40.40 ? 131 ASP A CB   2  
ATOM 9252   C CG   . ASP A 1 131 ? -1.373  17.115  -7.010  1.00 32.33 ? 131 ASP A CG   2  
ATOM 9253   O OD1  . ASP A 1 131 ? -2.393  17.439  -7.597  1.00 44.12 ? 131 ASP A OD1  2  
ATOM 9254   O OD2  . ASP A 1 131 ? -0.618  17.906  -6.468  1.00 1.45  ? 131 ASP A OD2  2  
ATOM 9255   H H    . ASP A 1 131 ? -3.341  15.650  -5.869  1.00 44.14 ? 131 ASP A H    2  
ATOM 9256   H HA   . ASP A 1 131 ? -2.382  15.072  -8.518  1.00 60.43 ? 131 ASP A HA   2  
ATOM 9257   H HB2  . ASP A 1 131 ? -0.823  15.345  -5.925  1.00 41.24 ? 131 ASP A HB2  2  
ATOM 9258   H HB3  . ASP A 1 131 ? -0.144  15.441  -7.551  1.00 72.50 ? 131 ASP A HB3  2  
ATOM 9259   N N    . GLU A 1 132 ? -2.051  12.739  -6.228  1.00 40.41 ? 132 GLU A N    2  
ATOM 9260   C CA   . GLU A 1 132 ? -1.764  11.283  -6.047  1.00 72.42 ? 132 GLU A CA   2  
ATOM 9261   C C    . GLU A 1 132 ? -3.067  10.485  -6.149  1.00 45.11 ? 132 GLU A C    2  
ATOM 9262   O O    . GLU A 1 132 ? -3.105  9.302   -5.872  1.00 72.52 ? 132 GLU A O    2  
ATOM 9263   C CB   . GLU A 1 132 ? -1.140  11.062  -4.669  1.00 24.41 ? 132 GLU A CB   2  
ATOM 9264   C CG   . GLU A 1 132 ? 0.249   11.702  -4.630  1.00 61.30 ? 132 GLU A CG   2  
ATOM 9265   C CD   . GLU A 1 132 ? 1.215   10.889  -5.495  1.00 71.40 ? 132 GLU A CD   2  
ATOM 9266   O OE1  . GLU A 1 132 ? 1.002   9.695   -5.627  1.00 62.34 ? 132 GLU A OE1  2  
ATOM 9267   O OE2  . GLU A 1 132 ? 2.153   11.475  -6.009  1.00 14.24 ? 132 GLU A OE2  2  
ATOM 9268   H H    . GLU A 1 132 ? -2.378  13.267  -5.470  1.00 12.43 ? 132 GLU A H    2  
ATOM 9269   H HA   . GLU A 1 132 ? -1.076  10.945  -6.810  1.00 35.12 ? 132 GLU A HA   2  
ATOM 9270   H HB2  . GLU A 1 132 ? -1.766  11.516  -3.913  1.00 73.14 ? 132 GLU A HB2  2  
ATOM 9271   H HB3  . GLU A 1 132 ? -1.053  10.004  -4.476  1.00 40.14 ? 132 GLU A HB3  2  
ATOM 9272   H HG2  . GLU A 1 132 ? 0.190   12.712  -5.009  1.00 2.35  ? 132 GLU A HG2  2  
ATOM 9273   H HG3  . GLU A 1 132 ? 0.609   11.720  -3.613  1.00 3.32  ? 132 GLU A HG3  2  
ATOM 9274   N N    . GLU A 1 133 ? -4.136  11.122  -6.543  1.00 20.31 ? 133 GLU A N    2  
ATOM 9275   C CA   . GLU A 1 133 ? -5.436  10.397  -6.661  1.00 61.40 ? 133 GLU A CA   2  
ATOM 9276   C C    . GLU A 1 133 ? -5.682  9.572   -5.393  1.00 42.44 ? 133 GLU A C    2  
ATOM 9277   O O    . GLU A 1 133 ? -5.793  8.363   -5.444  1.00 75.33 ? 133 GLU A O    2  
ATOM 9278   C CB   . GLU A 1 133 ? -5.383  9.452   -7.864  1.00 24.23 ? 133 GLU A CB   2  
ATOM 9279   C CG   . GLU A 1 133 ? -4.953  10.228  -9.111  1.00 44.01 ? 133 GLU A CG   2  
ATOM 9280   C CD   . GLU A 1 133 ? -4.840  9.267   -10.298 1.00 32.34 ? 133 GLU A CD   2  
ATOM 9281   O OE1  . GLU A 1 133 ? -5.678  8.384   -10.402 1.00 23.23 ? 133 GLU A OE1  2  
ATOM 9282   O OE2  . GLU A 1 133 ? -3.918  9.432   -11.082 1.00 3.30  ? 133 GLU A OE2  2  
ATOM 9283   H H    . GLU A 1 133 ? -4.086  12.076  -6.762  1.00 42.52 ? 133 GLU A H    2  
ATOM 9284   H HA   . GLU A 1 133 ? -6.238  11.108  -6.794  1.00 5.31  ? 133 GLU A HA   2  
ATOM 9285   H HB2  . GLU A 1 133 ? -4.673  8.662   -7.669  1.00 72.41 ? 133 GLU A HB2  2  
ATOM 9286   H HB3  . GLU A 1 133 ? -6.361  9.023   -8.029  1.00 14.35 ? 133 GLU A HB3  2  
ATOM 9287   H HG2  . GLU A 1 133 ? -5.688  10.988  -9.333  1.00 40.31 ? 133 GLU A HG2  2  
ATOM 9288   H HG3  . GLU A 1 133 ? -3.995  10.692  -8.933  1.00 33.13 ? 133 GLU A HG3  2  
ATOM 9289   N N    . LYS A 1 134 ? -5.761  10.210  -4.252  1.00 23.41 ? 134 LYS A N    2  
ATOM 9290   C CA   . LYS A 1 134 ? -5.990  9.449   -2.987  1.00 43.00 ? 134 LYS A CA   2  
ATOM 9291   C C    . LYS A 1 134 ? -6.669  10.347  -1.948  1.00 62.00 ? 134 LYS A C    2  
ATOM 9292   O O    . LYS A 1 134 ? -6.226  11.448  -1.686  1.00 61.11 ? 134 LYS A O    2  
ATOM 9293   C CB   . LYS A 1 134 ? -4.641  8.982   -2.435  1.00 71.23 ? 134 LYS A CB   2  
ATOM 9294   C CG   . LYS A 1 134 ? -4.863  8.005   -1.270  1.00 22.44 ? 134 LYS A CG   2  
ATOM 9295   C CD   . LYS A 1 134 ? -3.556  7.269   -0.952  1.00 45.33 ? 134 LYS A CD   2  
ATOM 9296   C CE   . LYS A 1 134 ? -2.540  8.250   -0.363  1.00 51.14 ? 134 LYS A CE   2  
ATOM 9297   N NZ   . LYS A 1 134 ? -1.399  7.490   0.221   1.00 10.22 ? 134 LYS A NZ   2  
ATOM 9298   H H    . LYS A 1 134 ? -5.664  11.185  -4.228  1.00 62.50 ? 134 LYS A H    2  
ATOM 9299   H HA   . LYS A 1 134 ? -6.616  8.591   -3.187  1.00 0.32  ? 134 LYS A HA   2  
ATOM 9300   H HB2  . LYS A 1 134 ? -4.081  8.493   -3.219  1.00 31.13 ? 134 LYS A HB2  2  
ATOM 9301   H HB3  . LYS A 1 134 ? -4.090  9.841   -2.080  1.00 62.41 ? 134 LYS A HB3  2  
ATOM 9302   H HG2  . LYS A 1 134 ? -5.187  8.555   -0.399  1.00 1.11  ? 134 LYS A HG2  2  
ATOM 9303   H HG3  . LYS A 1 134 ? -5.619  7.285   -1.541  1.00 61.10 ? 134 LYS A HG3  2  
ATOM 9304   H HD2  . LYS A 1 134 ? -3.752  6.482   -0.237  1.00 1.34  ? 134 LYS A HD2  2  
ATOM 9305   H HD3  . LYS A 1 134 ? -3.154  6.838   -1.857  1.00 21.52 ? 134 LYS A HD3  2  
ATOM 9306   H HE2  . LYS A 1 134 ? -2.174  8.902   -1.141  1.00 13.43 ? 134 LYS A HE2  2  
ATOM 9307   H HE3  . LYS A 1 134 ? -3.012  8.838   0.410   1.00 71.13 ? 134 LYS A HE3  2  
ATOM 9308   H HZ1  . LYS A 1 134 ? -1.506  7.440   1.254   1.00 20.12 ? 134 LYS A HZ1  2  
ATOM 9309   H HZ2  . LYS A 1 134 ? -0.508  7.973   -0.013  1.00 34.00 ? 134 LYS A HZ2  2  
ATOM 9310   H HZ3  . LYS A 1 134 ? -1.387  6.528   -0.171  1.00 24.12 ? 134 LYS A HZ3  2  
ATOM 9311   N N    . ILE A 1 135 ? -7.731  9.871   -1.340  1.00 43.40 ? 135 ILE A N    2  
ATOM 9312   C CA   . ILE A 1 135 ? -8.445  10.672  -0.294  1.00 64.23 ? 135 ILE A CA   2  
ATOM 9313   C C    . ILE A 1 135 ? -8.245  9.987   1.064   1.00 32.24 ? 135 ILE A C    2  
ATOM 9314   O O    . ILE A 1 135 ? -8.309  8.779   1.171   1.00 74.02 ? 135 ILE A O    2  
ATOM 9315   C CB   . ILE A 1 135 ? -9.947  10.737  -0.627  1.00 73.30 ? 135 ILE A CB   2  
ATOM 9316   C CG1  . ILE A 1 135 ? -10.181 11.684  -1.812  1.00 25.51 ? 135 ILE A CG1  2  
ATOM 9317   C CG2  . ILE A 1 135 ? -10.723 11.267  0.586   1.00 50.12 ? 135 ILE A CG2  2  
ATOM 9318   C CD1  . ILE A 1 135 ? -9.645  11.080  -3.120  1.00 4.01  ? 135 ILE A CD1  2  
ATOM 9319   H H    . ILE A 1 135 ? -8.055  8.974   -1.564  1.00 63.45 ? 135 ILE A H    2  
ATOM 9320   H HA   . ILE A 1 135 ? -8.041  11.676  -0.249  1.00 53.43 ? 135 ILE A HA   2  
ATOM 9321   H HB   . ILE A 1 135 ? -10.307 9.748   -0.877  1.00 75.33 ? 135 ILE A HB   2  
ATOM 9322   H HG12 . ILE A 1 135 ? -11.239 11.868  -1.912  1.00 21.34 ? 135 ILE A HG12 2  
ATOM 9323   H HG13 . ILE A 1 135 ? -9.676  12.618  -1.624  1.00 23.41 ? 135 ILE A HG13 2  
ATOM 9324   H HG21 . ILE A 1 135 ? -10.790 10.493  1.336   1.00 35.51 ? 135 ILE A HG21 2  
ATOM 9325   H HG22 . ILE A 1 135 ? -11.716 11.558  0.279   1.00 34.53 ? 135 ILE A HG22 2  
ATOM 9326   H HG23 . ILE A 1 135 ? -10.208 12.123  0.997   1.00 2.43  ? 135 ILE A HG23 2  
ATOM 9327   H HD11 . ILE A 1 135 ? -8.637  11.430  -3.290  1.00 13.33 ? 135 ILE A HD11 2  
ATOM 9328   H HD12 . ILE A 1 135 ? -10.275 11.397  -3.940  1.00 35.13 ? 135 ILE A HD12 2  
ATOM 9329   H HD13 . ILE A 1 135 ? -9.648  10.001  -3.067  1.00 72.41 ? 135 ILE A HD13 2  
ATOM 9330   N N    . ILE A 1 136 ? -7.998  10.753  2.100   1.00 54.21 ? 136 ILE A N    2  
ATOM 9331   C CA   . ILE A 1 136 ? -7.786  10.161  3.462   1.00 12.13 ? 136 ILE A CA   2  
ATOM 9332   C C    . ILE A 1 136 ? -8.756  10.822  4.447   1.00 31.23 ? 136 ILE A C    2  
ATOM 9333   O O    . ILE A 1 136 ? -8.870  12.031  4.491   1.00 45.51 ? 136 ILE A O    2  
ATOM 9334   C CB   . ILE A 1 136 ? -6.345  10.433  3.915   1.00 22.43 ? 136 ILE A CB   2  
ATOM 9335   C CG1  . ILE A 1 136 ? -5.364  10.127  2.773   1.00 60.23 ? 136 ILE A CG1  2  
ATOM 9336   C CG2  . ILE A 1 136 ? -6.012  9.542   5.112   1.00 32.34 ? 136 ILE A CG2  2  
ATOM 9337   C CD1  . ILE A 1 136 ? -3.953  10.549  3.193   1.00 14.41 ? 136 ILE A CD1  2  
ATOM 9338   H H    . ILE A 1 136 ? -7.950  11.725  1.982   1.00 70.23 ? 136 ILE A H    2  
ATOM 9339   H HA   . ILE A 1 136 ? -7.966  9.094   3.445   1.00 60.21 ? 136 ILE A HA   2  
ATOM 9340   H HB   . ILE A 1 136 ? -6.248  11.469  4.203   1.00 11.15 ? 136 ILE A HB   2  
ATOM 9341   H HG12 . ILE A 1 136 ? -5.377  9.069   2.559   1.00 71.11 ? 136 ILE A HG12 2  
ATOM 9342   H HG13 . ILE A 1 136 ? -5.648  10.678  1.890   1.00 34.01 ? 136 ILE A HG13 2  
ATOM 9343   H HG21 . ILE A 1 136 ? -6.058  8.506   4.813   1.00 70.11 ? 136 ILE A HG21 2  
ATOM 9344   H HG22 . ILE A 1 136 ? -6.726  9.720   5.903   1.00 11.21 ? 136 ILE A HG22 2  
ATOM 9345   H HG23 . ILE A 1 136 ? -5.018  9.772   5.466   1.00 23.35 ? 136 ILE A HG23 2  
ATOM 9346   H HD11 . ILE A 1 136 ? -3.963  11.588  3.490   1.00 62.33 ? 136 ILE A HD11 2  
ATOM 9347   H HD12 . ILE A 1 136 ? -3.275  10.418  2.362   1.00 25.41 ? 136 ILE A HD12 2  
ATOM 9348   H HD13 . ILE A 1 136 ? -3.628  9.941   4.023   1.00 20.15 ? 136 ILE A HD13 2  
ATOM 9349   N N    . TYR A 1 137 ? -9.459  10.044  5.241   1.00 55.04 ? 137 TYR A N    2  
ATOM 9350   C CA   . TYR A 1 137 ? -10.423 10.641  6.223   1.00 21.11 ? 137 TYR A CA   2  
ATOM 9351   C C    . TYR A 1 137 ? -10.341 9.892   7.560   1.00 62.32 ? 137 TYR A C    2  
ATOM 9352   O O    . TYR A 1 137 ? -10.239 8.683   7.603   1.00 52.31 ? 137 TYR A O    2  
ATOM 9353   C CB   . TYR A 1 137 ? -11.853 10.569  5.650   1.00 25.11 ? 137 TYR A CB   2  
ATOM 9354   C CG   . TYR A 1 137 ? -12.465 9.199   5.880   1.00 42.15 ? 137 TYR A CG   2  
ATOM 9355   C CD1  . TYR A 1 137 ? -12.131 8.129   5.042   1.00 52.45 ? 137 TYR A CD1  2  
ATOM 9356   C CD2  . TYR A 1 137 ? -13.368 9.007   6.933   1.00 24.43 ? 137 TYR A CD2  2  
ATOM 9357   C CE1  . TYR A 1 137 ? -12.702 6.868   5.257   1.00 20.55 ? 137 TYR A CE1  2  
ATOM 9358   C CE2  . TYR A 1 137 ? -13.939 7.748   7.148   1.00 54.53 ? 137 TYR A CE2  2  
ATOM 9359   C CZ   . TYR A 1 137 ? -13.605 6.678   6.311   1.00 2.02  ? 137 TYR A CZ   2  
ATOM 9360   O OH   . TYR A 1 137 ? -14.171 5.436   6.520   1.00 61.55 ? 137 TYR A OH   2  
ATOM 9361   H H    . TYR A 1 137 ? -9.354  9.071   5.190   1.00 12.21 ? 137 TYR A H    2  
ATOM 9362   H HA   . TYR A 1 137 ? -10.166 11.679  6.396   1.00 70.22 ? 137 TYR A HA   2  
ATOM 9363   H HB2  . TYR A 1 137 ? -12.467 11.316  6.134   1.00 32.14 ? 137 TYR A HB2  2  
ATOM 9364   H HB3  . TYR A 1 137 ? -11.821 10.771  4.590   1.00 31.32 ? 137 TYR A HB3  2  
ATOM 9365   H HD1  . TYR A 1 137 ? -11.434 8.275   4.230   1.00 55.32 ? 137 TYR A HD1  2  
ATOM 9366   H HD2  . TYR A 1 137 ? -13.626 9.833   7.578   1.00 50.54 ? 137 TYR A HD2  2  
ATOM 9367   H HE1  . TYR A 1 137 ? -12.446 6.041   4.611   1.00 74.14 ? 137 TYR A HE1  2  
ATOM 9368   H HE2  . TYR A 1 137 ? -14.634 7.601   7.961   1.00 61.44 ? 137 TYR A HE2  2  
ATOM 9369   H HH   . TYR A 1 137 ? -13.460 4.799   6.623   1.00 51.24 ? 137 TYR A HH   2  
ATOM 9370   N N    . LYS A 1 138 ? -10.390 10.612  8.648   1.00 65.40 ? 138 LYS A N    2  
ATOM 9371   C CA   . LYS A 1 138 ? -10.322 9.966   9.993   1.00 34.32 ? 138 LYS A CA   2  
ATOM 9372   C C    . LYS A 1 138 ? -9.082  9.070   10.087  1.00 75.40 ? 138 LYS A C    2  
ATOM 9373   O O    . LYS A 1 138 ? -9.056  8.109   10.830  1.00 54.52 ? 138 LYS A O    2  
ATOM 9374   C CB   . LYS A 1 138 ? -11.585 9.128   10.232  1.00 44.34 ? 138 LYS A CB   2  
ATOM 9375   C CG   . LYS A 1 138 ? -12.766 10.051  10.557  1.00 62.52 ? 138 LYS A CG   2  
ATOM 9376   C CD   . LYS A 1 138 ? -13.973 9.212   10.986  1.00 32.40 ? 138 LYS A CD   2  
ATOM 9377   C CE   . LYS A 1 138 ? -15.200 10.116  11.129  1.00 74.13 ? 138 LYS A CE   2  
ATOM 9378   N NZ   . LYS A 1 138 ? -16.324 9.341   11.729  1.00 22.13 ? 138 LYS A NZ   2  
ATOM 9379   H H    . LYS A 1 138 ? -10.476 11.587  8.582   1.00 72.15 ? 138 LYS A H    2  
ATOM 9380   H HA   . LYS A 1 138 ? -10.255 10.734  10.749  1.00 74.51 ? 138 LYS A HA   2  
ATOM 9381   H HB2  . LYS A 1 138 ? -11.810 8.556   9.343   1.00 73.42 ? 138 LYS A HB2  2  
ATOM 9382   H HB3  . LYS A 1 138 ? -11.420 8.454   11.059  1.00 33.31 ? 138 LYS A HB3  2  
ATOM 9383   H HG2  . LYS A 1 138 ? -12.492 10.719  11.361  1.00 71.22 ? 138 LYS A HG2  2  
ATOM 9384   H HG3  . LYS A 1 138 ? -13.024 10.628  9.683   1.00 44.43 ? 138 LYS A HG3  2  
ATOM 9385   H HD2  . LYS A 1 138 ? -14.169 8.452   10.242  1.00 21.01 ? 138 LYS A HD2  2  
ATOM 9386   H HD3  . LYS A 1 138 ? -13.765 8.741   11.935  1.00 5.03  ? 138 LYS A HD3  2  
ATOM 9387   H HE2  . LYS A 1 138 ? -14.958 10.952  11.769  1.00 73.14 ? 138 LYS A HE2  2  
ATOM 9388   H HE3  . LYS A 1 138 ? -15.493 10.480  10.156  1.00 23.44 ? 138 LYS A HE3  2  
ATOM 9389   H HZ1  . LYS A 1 138 ? -17.170 9.440   11.134  1.00 32.52 ? 138 LYS A HZ1  2  
ATOM 9390   H HZ2  . LYS A 1 138 ? -16.525 9.705   12.683  1.00 53.23 ? 138 LYS A HZ2  2  
ATOM 9391   H HZ3  . LYS A 1 138 ? -16.061 8.336   11.790  1.00 53.43 ? 138 LYS A HZ3  2  
ATOM 9392   N N    . GLY A 1 139 ? -8.049  9.383   9.354   1.00 10.11 ? 139 GLY A N    2  
ATOM 9393   C CA   . GLY A 1 139 ? -6.811  8.555   9.422   1.00 60.21 ? 139 GLY A CA   2  
ATOM 9394   C C    . GLY A 1 139 ? -6.985  7.269   8.618   1.00 3.42  ? 139 GLY A C    2  
ATOM 9395   O O    . GLY A 1 139 ? -6.204  6.346   8.738   1.00 72.24 ? 139 GLY A O    2  
ATOM 9396   H H    . GLY A 1 139 ? -8.083  10.167  8.769   1.00 13.43 ? 139 GLY A H    2  
ATOM 9397   H HA2  . GLY A 1 139 ? -5.988  9.116   9.015   1.00 61.24 ? 139 GLY A HA2  2  
ATOM 9398   H HA3  . GLY A 1 139 ? -6.602  8.305   10.451  1.00 61.03 ? 139 GLY A HA3  2  
ATOM 9399   N N    . ARG A 1 140 ? -7.998  7.203   7.795   1.00 24.10 ? 140 ARG A N    2  
ATOM 9400   C CA   . ARG A 1 140 ? -8.230  5.980   6.967   1.00 33.20 ? 140 ARG A CA   2  
ATOM 9401   C C    . ARG A 1 140 ? -7.823  6.279   5.521   1.00 55.41 ? 140 ARG A C    2  
ATOM 9402   O O    . ARG A 1 140 ? -8.159  7.310   4.971   1.00 51.25 ? 140 ARG A O    2  
ATOM 9403   C CB   . ARG A 1 140 ? -9.711  5.611   7.052   1.00 51.21 ? 140 ARG A CB   2  
ATOM 9404   C CG   . ARG A 1 140 ? -10.057 5.304   8.516   1.00 10.31 ? 140 ARG A CG   2  
ATOM 9405   C CD   . ARG A 1 140 ? -11.573 5.290   8.700   1.00 71.22 ? 140 ARG A CD   2  
ATOM 9406   N NE   . ARG A 1 140 ? -12.139 4.119   7.959   1.00 21.41 ? 140 ARG A NE   2  
ATOM 9407   C CZ   . ARG A 1 140 ? -13.094 3.375   8.472   1.00 35.21 ? 140 ARG A CZ   2  
ATOM 9408   N NH1  . ARG A 1 140 ? -13.601 3.641   9.649   1.00 21.40 ? 140 ARG A NH1  2  
ATOM 9409   N NH2  . ARG A 1 140 ? -13.541 2.353   7.792   1.00 44.42 ? 140 ARG A NH2  2  
ATOM 9410   H H    . ARG A 1 140 ? -8.609  7.964   7.715   1.00 51.45 ? 140 ARG A H    2  
ATOM 9411   H HA   . ARG A 1 140 ? -7.635  5.158   7.341   1.00 73.12 ? 140 ARG A HA   2  
ATOM 9412   H HB2  . ARG A 1 140 ? -10.311 6.438   6.699   1.00 21.15 ? 140 ARG A HB2  2  
ATOM 9413   H HB3  . ARG A 1 140 ? -9.902  4.738   6.446   1.00 41.42 ? 140 ARG A HB3  2  
ATOM 9414   H HG2  . ARG A 1 140 ? -9.656  4.338   8.785   1.00 53.33 ? 140 ARG A HG2  2  
ATOM 9415   H HG3  . ARG A 1 140 ? -9.627  6.061   9.157   1.00 71.42 ? 140 ARG A HG3  2  
ATOM 9416   H HD2  . ARG A 1 140 ? -11.799 5.217   9.752   1.00 20.50 ? 140 ARG A HD2  2  
ATOM 9417   H HD3  . ARG A 1 140 ? -11.988 6.206   8.305   1.00 51.41 ? 140 ARG A HD3  2  
ATOM 9418   H HE   . ARG A 1 140 ? -11.784 3.898   7.074   1.00 14.34 ? 140 ARG A HE   2  
ATOM 9419   H HH11 . ARG A 1 140 ? -13.267 4.419   10.177  1.00 1.52  ? 140 ARG A HH11 2  
ATOM 9420   H HH12 . ARG A 1 140 ? -14.328 3.063   10.021  1.00 31.45 ? 140 ARG A HH12 2  
ATOM 9421   H HH21 . ARG A 1 140 ? -13.156 2.145   6.892   1.00 2.05  ? 140 ARG A HH21 2  
ATOM 9422   H HH22 . ARG A 1 140 ? -14.267 1.778   8.170   1.00 51.04 ? 140 ARG A HH22 2  
ATOM 9423   N N    . GLU A 1 141 ? -7.077  5.395   4.911   1.00 22.05 ? 141 GLU A N    2  
ATOM 9424   C CA   . GLU A 1 141 ? -6.615  5.633   3.511   1.00 63.43 ? 141 GLU A CA   2  
ATOM 9425   C C    . GLU A 1 141 ? -7.619  5.050   2.517   1.00 24.52 ? 141 GLU A C    2  
ATOM 9426   O O    . GLU A 1 141 ? -8.001  3.901   2.611   1.00 71.42 ? 141 GLU A O    2  
ATOM 9427   C CB   . GLU A 1 141 ? -5.260  4.948   3.316   1.00 45.24 ? 141 GLU A CB   2  
ATOM 9428   C CG   . GLU A 1 141 ? -4.277  5.454   4.373   1.00 63.23 ? 141 GLU A CG   2  
ATOM 9429   C CD   . GLU A 1 141 ? -2.929  4.752   4.196   1.00 62.13 ? 141 GLU A CD   2  
ATOM 9430   O OE1  . GLU A 1 141 ? -2.932  3.558   3.950   1.00 54.03 ? 141 GLU A OE1  2  
ATOM 9431   O OE2  . GLU A 1 141 ? -1.915  5.422   4.314   1.00 63.23 ? 141 GLU A OE2  2  
ATOM 9432   H H    . GLU A 1 141 ? -6.803  4.581   5.382   1.00 10.13 ? 141 GLU A H    2  
ATOM 9433   H HA   . GLU A 1 141 ? -6.507  6.693   3.337   1.00 23.42 ? 141 GLU A HA   2  
ATOM 9434   H HB2  . GLU A 1 141 ? -5.380  3.879   3.418   1.00 2.25  ? 141 GLU A HB2  2  
ATOM 9435   H HB3  . GLU A 1 141 ? -4.878  5.176   2.332   1.00 72.32 ? 141 GLU A HB3  2  
ATOM 9436   H HG2  . GLU A 1 141 ? -4.145  6.521   4.262   1.00 62.24 ? 141 GLU A HG2  2  
ATOM 9437   H HG3  . GLU A 1 141 ? -4.665  5.240   5.357   1.00 71.13 ? 141 GLU A HG3  2  
ATOM 9438   N N    . VAL A 1 142 ? -8.036  5.834   1.552   1.00 52.42 ? 142 VAL A N    2  
ATOM 9439   C CA   . VAL A 1 142 ? -9.002  5.339   0.526   1.00 10.42 ? 142 VAL A CA   2  
ATOM 9440   C C    . VAL A 1 142 ? -8.428  5.639   -0.861  1.00 53.02 ? 142 VAL A C    2  
ATOM 9441   O O    . VAL A 1 142 ? -8.381  6.773   -1.294  1.00 40.32 ? 142 VAL A O    2  
ATOM 9442   C CB   . VAL A 1 142 ? -10.354 6.060   0.704   1.00 22.33 ? 142 VAL A CB   2  
ATOM 9443   C CG1  . VAL A 1 142 ? -11.494 5.191   0.151   1.00 41.23 ? 142 VAL A CG1  2  
ATOM 9444   C CG2  . VAL A 1 142 ? -10.592 6.325   2.194   1.00 33.45 ? 142 VAL A CG2  2  
ATOM 9445   H H    . VAL A 1 142 ? -7.700  6.752   1.495   1.00 13.11 ? 142 VAL A H    2  
ATOM 9446   H HA   . VAL A 1 142 ? -9.141  4.269   0.627   1.00 53.33 ? 142 VAL A HA   2  
ATOM 9447   H HB   . VAL A 1 142 ? -10.337 7.003   0.173   1.00 12.33 ? 142 VAL A HB   2  
ATOM 9448   H HG11 . VAL A 1 142 ? -12.358 5.811   -0.037  1.00 54.41 ? 142 VAL A HG11 2  
ATOM 9449   H HG12 . VAL A 1 142 ? -11.750 4.425   0.869   1.00 53.32 ? 142 VAL A HG12 2  
ATOM 9450   H HG13 . VAL A 1 142 ? -11.178 4.725   -0.771  1.00 62.34 ? 142 VAL A HG13 2  
ATOM 9451   H HG21 . VAL A 1 142 ? -11.595 6.700   2.336   1.00 23.11 ? 142 VAL A HG21 2  
ATOM 9452   H HG22 . VAL A 1 142 ? -9.881  7.057   2.545   1.00 41.55 ? 142 VAL A HG22 2  
ATOM 9453   H HG23 . VAL A 1 142 ? -10.469 5.406   2.750   1.00 23.10 ? 142 VAL A HG23 2  
ATOM 9454   N N    . GLU A 1 143 ? -7.998  4.629   -1.565  1.00 12.41 ? 143 GLU A N    2  
ATOM 9455   C CA   . GLU A 1 143 ? -7.434  4.847   -2.929  1.00 21.34 ? 143 GLU A CA   2  
ATOM 9456   C C    . GLU A 1 143 ? -8.566  4.691   -3.939  1.00 32.23 ? 143 GLU A C    2  
ATOM 9457   O O    . GLU A 1 143 ? -8.991  3.593   -4.242  1.00 14.21 ? 143 GLU A O    2  
ATOM 9458   C CB   . GLU A 1 143 ? -6.339  3.809   -3.193  1.00 13.00 ? 143 GLU A CB   2  
ATOM 9459   C CG   . GLU A 1 143 ? -5.191  4.022   -2.198  1.00 41.11 ? 143 GLU A CG   2  
ATOM 9460   C CD   . GLU A 1 143 ? -4.185  2.872   -2.310  1.00 23.21 ? 143 GLU A CD   2  
ATOM 9461   O OE1  . GLU A 1 143 ? -4.214  2.181   -3.315  1.00 60.45 ? 143 GLU A OE1  2  
ATOM 9462   O OE2  . GLU A 1 143 ? -3.400  2.706   -1.390  1.00 54.31 ? 143 GLU A OE2  2  
ATOM 9463   H H    . GLU A 1 143 ? -8.052  3.723   -1.198  1.00 14.23 ? 143 GLU A H    2  
ATOM 9464   H HA   . GLU A 1 143 ? -7.016  5.843   -3.002  1.00 33.35 ? 143 GLU A HA   2  
ATOM 9465   H HB2  . GLU A 1 143 ? -6.747  2.815   -3.069  1.00 61.23 ? 143 GLU A HB2  2  
ATOM 9466   H HB3  . GLU A 1 143 ? -5.967  3.924   -4.200  1.00 40.31 ? 143 GLU A HB3  2  
ATOM 9467   H HG2  . GLU A 1 143 ? -4.694  4.956   -2.418  1.00 52.30 ? 143 GLU A HG2  2  
ATOM 9468   H HG3  . GLU A 1 143 ? -5.585  4.053   -1.193  1.00 35.41 ? 143 GLU A HG3  2  
ATOM 9469   N N    . VAL A 1 144 ? -9.082  5.789   -4.433  1.00 74.44 ? 144 VAL A N    2  
ATOM 9470   C CA   . VAL A 1 144 ? -10.225 5.735   -5.400  1.00 3.21  ? 144 VAL A CA   2  
ATOM 9471   C C    . VAL A 1 144 ? -9.804  6.284   -6.768  1.00 65.52 ? 144 VAL A C    2  
ATOM 9472   O O    . VAL A 1 144 ? -9.113  7.279   -6.872  1.00 71.02 ? 144 VAL A O    2  
ATOM 9473   C CB   . VAL A 1 144 ? -11.375 6.591   -4.838  1.00 24.44 ? 144 VAL A CB   2  
ATOM 9474   C CG1  . VAL A 1 144 ? -12.184 5.777   -3.824  1.00 52.30 ? 144 VAL A CG1  2  
ATOM 9475   C CG2  . VAL A 1 144 ? -10.796 7.827   -4.134  1.00 70.13 ? 144 VAL A CG2  2  
ATOM 9476   H H    . VAL A 1 144 ? -8.733  6.659   -4.146  1.00 62.21 ? 144 VAL A H    2  
ATOM 9477   H HA   . VAL A 1 144 ? -10.566 4.716   -5.521  1.00 34.33 ? 144 VAL A HA   2  
ATOM 9478   H HB   . VAL A 1 144 ? -12.027 6.904   -5.643  1.00 10.31 ? 144 VAL A HB   2  
ATOM 9479   H HG11 . VAL A 1 144 ? -12.600 4.906   -4.309  1.00 10.04 ? 144 VAL A HG11 2  
ATOM 9480   H HG12 . VAL A 1 144 ? -12.984 6.388   -3.431  1.00 12.42 ? 144 VAL A HG12 2  
ATOM 9481   H HG13 . VAL A 1 144 ? -11.538 5.467   -3.016  1.00 24.20 ? 144 VAL A HG13 2  
ATOM 9482   H HG21 . VAL A 1 144 ? -10.377 7.537   -3.182  1.00 21.43 ? 144 VAL A HG21 2  
ATOM 9483   H HG22 . VAL A 1 144 ? -11.580 8.551   -3.971  1.00 31.33 ? 144 VAL A HG22 2  
ATOM 9484   H HG23 . VAL A 1 144 ? -10.023 8.266   -4.749  1.00 34.22 ? 144 VAL A HG23 2  
ATOM 9485   N N    . LYS A 1 145 ? -10.251 5.646   -7.817  1.00 10.54 ? 145 LYS A N    2  
ATOM 9486   C CA   . LYS A 1 145 ? -9.926  6.120   -9.189  1.00 11.44 ? 145 LYS A CA   2  
ATOM 9487   C C    . LYS A 1 145 ? -10.936 5.519   -10.173 1.00 45.14 ? 145 LYS A C    2  
ATOM 9488   O O    . LYS A 1 145 ? -11.136 4.322   -10.225 1.00 2.54  ? 145 LYS A O    2  
ATOM 9489   C CB   . LYS A 1 145 ? -8.499  5.716   -9.580  1.00 62.42 ? 145 LYS A CB   2  
ATOM 9490   C CG   . LYS A 1 145 ? -8.263  4.234   -9.292  1.00 3.20  ? 145 LYS A CG   2  
ATOM 9491   C CD   . LYS A 1 145 ? -6.844  3.857   -9.721  1.00 45.54 ? 145 LYS A CD   2  
ATOM 9492   C CE   . LYS A 1 145 ? -6.532  2.439   -9.244  1.00 4.13  ? 145 LYS A CE   2  
ATOM 9493   N NZ   . LYS A 1 145 ? -5.321  1.926   -9.947  1.00 65.15 ? 145 LYS A NZ   2  
ATOM 9494   H H    . LYS A 1 145 ? -10.825 4.860   -7.700  1.00 75.42 ? 145 LYS A H    2  
ATOM 9495   H HA   . LYS A 1 145 ? -10.006 7.192   -9.216  1.00 32.14 ? 145 LYS A HA   2  
ATOM 9496   H HB2  . LYS A 1 145 ? -8.353  5.902   -10.633 1.00 52.32 ? 145 LYS A HB2  2  
ATOM 9497   H HB3  . LYS A 1 145 ? -7.794  6.306   -9.013  1.00 61.21 ? 145 LYS A HB3  2  
ATOM 9498   H HG2  . LYS A 1 145 ? -8.384  4.048   -8.235  1.00 21.51 ? 145 LYS A HG2  2  
ATOM 9499   H HG3  . LYS A 1 145 ? -8.971  3.639   -9.846  1.00 25.33 ? 145 LYS A HG3  2  
ATOM 9500   H HD2  . LYS A 1 145 ? -6.772  3.902   -10.799 1.00 63.54 ? 145 LYS A HD2  2  
ATOM 9501   H HD3  . LYS A 1 145 ? -6.140  4.547   -9.283  1.00 5.32  ? 145 LYS A HD3  2  
ATOM 9502   H HE2  . LYS A 1 145 ? -6.356  2.454   -8.180  1.00 25.33 ? 145 LYS A HE2  2  
ATOM 9503   H HE3  . LYS A 1 145 ? -7.373  1.795   -9.460  1.00 1.13  ? 145 LYS A HE3  2  
ATOM 9504   H HZ1  . LYS A 1 145 ? -4.832  2.713   -10.418 1.00 63.44 ? 145 LYS A HZ1  2  
ATOM 9505   H HZ2  . LYS A 1 145 ? -5.607  1.219   -10.656 1.00 53.52 ? 145 LYS A HZ2  2  
ATOM 9506   H HZ3  . LYS A 1 145 ? -4.682  1.486   -9.258  1.00 21.52 ? 145 LYS A HZ3  2  
ATOM 9507   N N    . GLY A 1 146 ? -11.593 6.342   -10.943 1.00 64.01 ? 146 GLY A N    2  
ATOM 9508   C CA   . GLY A 1 146 ? -12.600 5.815   -11.910 1.00 3.01  ? 146 GLY A CA   2  
ATOM 9509   C C    . GLY A 1 146 ? -13.669 6.878   -12.171 1.00 43.33 ? 146 GLY A C    2  
ATOM 9510   O O    . GLY A 1 146 ? -13.386 8.056   -12.234 1.00 73.34 ? 146 GLY A O    2  
ATOM 9511   H H    . GLY A 1 146 ? -11.431 7.304   -10.881 1.00 30.43 ? 146 GLY A H    2  
ATOM 9512   H HA2  . GLY A 1 146 ? -12.107 5.560   -12.838 1.00 41.03 ? 146 GLY A HA2  2  
ATOM 9513   H HA3  . GLY A 1 146 ? -13.071 4.933   -11.501 1.00 33.04 ? 146 GLY A HA3  2  
ATOM 9514   N N    . LYS A 1 147 ? -14.896 6.466   -12.327 1.00 71.31 ? 147 LYS A N    2  
ATOM 9515   C CA   . LYS A 1 147 ? -15.990 7.440   -12.591 1.00 52.52 ? 147 LYS A CA   2  
ATOM 9516   C C    . LYS A 1 147 ? -16.288 8.274   -11.326 1.00 44.11 ? 147 LYS A C    2  
ATOM 9517   O O    . LYS A 1 147 ? -16.193 9.486   -11.357 1.00 31.23 ? 147 LYS A O    2  
ATOM 9518   C CB   . LYS A 1 147 ? -17.248 6.663   -13.049 1.00 72.22 ? 147 LYS A CB   2  
ATOM 9519   C CG   . LYS A 1 147 ? -17.406 6.741   -14.575 1.00 5.31  ? 147 LYS A CG   2  
ATOM 9520   C CD   . LYS A 1 147 ? -18.624 5.915   -14.995 1.00 45.41 ? 147 LYS A CD   2  
ATOM 9521   C CE   . LYS A 1 147 ? -18.802 5.986   -16.514 1.00 43.24 ? 147 LYS A CE   2  
ATOM 9522   N NZ   . LYS A 1 147 ? -19.442 7.283   -16.877 1.00 21.22 ? 147 LYS A NZ   2  
ATOM 9523   H H    . LYS A 1 147 ? -15.100 5.509   -12.275 1.00 3.53  ? 147 LYS A H    2  
ATOM 9524   H HA   . LYS A 1 147 ? -15.674 8.113   -13.377 1.00 33.13 ? 147 LYS A HA   2  
ATOM 9525   H HB2  . LYS A 1 147 ? -17.144 5.627   -12.766 1.00 3.23  ? 147 LYS A HB2  2  
ATOM 9526   H HB3  . LYS A 1 147 ? -18.133 7.074   -12.582 1.00 54.33 ? 147 LYS A HB3  2  
ATOM 9527   H HG2  . LYS A 1 147 ? -17.545 7.771   -14.870 1.00 63.24 ? 147 LYS A HG2  2  
ATOM 9528   H HG3  . LYS A 1 147 ? -16.521 6.344   -15.051 1.00 43.15 ? 147 LYS A HG3  2  
ATOM 9529   H HD2  . LYS A 1 147 ? -18.481 4.888   -14.696 1.00 2.30  ? 147 LYS A HD2  2  
ATOM 9530   H HD3  . LYS A 1 147 ? -19.505 6.310   -14.514 1.00 55.52 ? 147 LYS A HD3  2  
ATOM 9531   H HE2  . LYS A 1 147 ? -17.838 5.910   -16.998 1.00 31.33 ? 147 LYS A HE2  2  
ATOM 9532   H HE3  . LYS A 1 147 ? -19.431 5.171   -16.840 1.00 11.30 ? 147 LYS A HE3  2  
ATOM 9533   H HZ1  . LYS A 1 147 ? -19.646 7.821   -16.012 1.00 22.35 ? 147 LYS A HZ1  2  
ATOM 9534   H HZ2  . LYS A 1 147 ? -20.328 7.101   -17.391 1.00 33.43 ? 147 LYS A HZ2  2  
ATOM 9535   H HZ3  . LYS A 1 147 ? -18.796 7.833   -17.479 1.00 42.55 ? 147 LYS A HZ3  2  
ATOM 9536   N N    . PRO A 1 148 ? -16.659 7.652   -10.228 1.00 20.33 ? 148 PRO A N    2  
ATOM 9537   C CA   . PRO A 1 148 ? -16.984 8.393   -8.967  1.00 52.51 ? 148 PRO A CA   2  
ATOM 9538   C C    . PRO A 1 148 ? -15.754 9.063   -8.337  1.00 62.44 ? 148 PRO A C    2  
ATOM 9539   O O    . PRO A 1 148 ? -15.832 9.630   -7.265  1.00 65.23 ? 148 PRO A O    2  
ATOM 9540   C CB   . PRO A 1 148 ? -17.558 7.305   -8.042  1.00 13.44 ? 148 PRO A CB   2  
ATOM 9541   C CG   . PRO A 1 148 ? -16.952 6.032   -8.534  1.00 2.50  ? 148 PRO A CG   2  
ATOM 9542   C CD   . PRO A 1 148 ? -16.815 6.193   -10.049 1.00 51.32 ? 148 PRO A CD   2  
ATOM 9543   H HA   . PRO A 1 148 ? -17.742 9.134   -9.162  1.00 61.14 ? 148 PRO A HA   2  
ATOM 9544   H HB2  . PRO A 1 148 ? -17.279 7.490   -7.010  1.00 34.12 ? 148 PRO A HB2  2  
ATOM 9545   H HB3  . PRO A 1 148 ? -18.635 7.261   -8.138  1.00 25.42 ? 148 PRO A HB3  2  
ATOM 9546   H HG2  . PRO A 1 148 ? -15.979 5.884   -8.081  1.00 44.40 ? 148 PRO A HG2  2  
ATOM 9547   H HG3  . PRO A 1 148 ? -17.597 5.196   -8.311  1.00 21.43 ? 148 PRO A HG3  2  
ATOM 9548   H HD2  . PRO A 1 148 ? -15.947 5.660   -10.404 1.00 54.41 ? 148 PRO A HD2  2  
ATOM 9549   H HD3  . PRO A 1 148 ? -17.708 5.849   -10.546 1.00 75.45 ? 148 PRO A HD3  2  
ATOM 9550   N N    . PHE A 1 149 ? -14.621 9.004   -8.994  1.00 60.11 ? 149 PHE A N    2  
ATOM 9551   C CA   . PHE A 1 149 ? -13.384 9.638   -8.433  1.00 32.32 ? 149 PHE A CA   2  
ATOM 9552   C C    . PHE A 1 149 ? -13.113 10.979  -9.124  1.00 52.53 ? 149 PHE A C    2  
ATOM 9553   O O    . PHE A 1 149 ? -12.967 11.997  -8.476  1.00 54.10 ? 149 PHE A O    2  
ATOM 9554   C CB   . PHE A 1 149 ? -12.188 8.713   -8.663  1.00 34.43 ? 149 PHE A CB   2  
ATOM 9555   C CG   . PHE A 1 149 ? -10.930 9.400   -8.183  1.00 10.24 ? 149 PHE A CG   2  
ATOM 9556   C CD1  . PHE A 1 149 ? -10.764 9.656   -6.822  1.00 55.42 ? 149 PHE A CD1  2  
ATOM 9557   C CD2  . PHE A 1 149 ? -9.936  9.781   -9.095  1.00 23.01 ? 149 PHE A CD2  2  
ATOM 9558   C CE1  . PHE A 1 149 ? -9.606  10.293  -6.363  1.00 42.21 ? 149 PHE A CE1  2  
ATOM 9559   C CE2  . PHE A 1 149 ? -8.777  10.419  -8.639  1.00 20.51 ? 149 PHE A CE2  2  
ATOM 9560   C CZ   . PHE A 1 149 ? -8.611  10.674  -7.272  1.00 1.24  ? 149 PHE A CZ   2  
ATOM 9561   H H    . PHE A 1 149 ? -14.582 8.543   -9.856  1.00 1.43  ? 149 PHE A H    2  
ATOM 9562   H HA   . PHE A 1 149 ? -13.504 9.802   -7.369  1.00 3.33  ? 149 PHE A HA   2  
ATOM 9563   H HB2  . PHE A 1 149 ? -12.329 7.794   -8.110  1.00 61.01 ? 149 PHE A HB2  2  
ATOM 9564   H HB3  . PHE A 1 149 ? -12.101 8.490   -9.714  1.00 52.04 ? 149 PHE A HB3  2  
ATOM 9565   H HD1  . PHE A 1 149 ? -11.535 9.363   -6.127  1.00 64.21 ? 149 PHE A HD1  2  
ATOM 9566   H HD2  . PHE A 1 149 ? -10.065 9.583   -10.150 1.00 64.14 ? 149 PHE A HD2  2  
ATOM 9567   H HE1  . PHE A 1 149 ? -9.478  10.487  -5.307  1.00 42.44 ? 149 PHE A HE1  2  
ATOM 9568   H HE2  . PHE A 1 149 ? -8.011  10.715  -9.341  1.00 65.24 ? 149 PHE A HE2  2  
ATOM 9569   H HZ   . PHE A 1 149 ? -7.718  11.167  -6.919  1.00 40.00 ? 149 PHE A HZ   2  
ATOM 9570   N N    . GLU A 1 150 ? -13.025 10.989  -10.430 1.00 3.01  ? 150 GLU A N    2  
ATOM 9571   C CA   . GLU A 1 150 ? -12.738 12.269  -11.144 1.00 22.00 ? 150 GLU A CA   2  
ATOM 9572   C C    . GLU A 1 150 ? -13.641 13.375  -10.596 1.00 32.12 ? 150 GLU A C    2  
ATOM 9573   O O    . GLU A 1 150 ? -13.238 14.516  -10.471 1.00 64.21 ? 150 GLU A O    2  
ATOM 9574   C CB   . GLU A 1 150 ? -12.983 12.096  -12.648 1.00 11.02 ? 150 GLU A CB   2  
ATOM 9575   C CG   . GLU A 1 150 ? -14.284 11.325  -12.880 1.00 4.10  ? 150 GLU A CG   2  
ATOM 9576   C CD   . GLU A 1 150 ? -14.591 11.300  -14.378 1.00 24.33 ? 150 GLU A CD   2  
ATOM 9577   O OE1  . GLU A 1 150 ? -13.989 12.081  -15.097 1.00 1.11  ? 150 GLU A OE1  2  
ATOM 9578   O OE2  . GLU A 1 150 ? -15.419 10.499  -14.784 1.00 23.52 ? 150 GLU A OE2  2  
ATOM 9579   H H    . GLU A 1 150 ? -13.132 10.155  -10.937 1.00 12.44 ? 150 GLU A H    2  
ATOM 9580   H HA   . GLU A 1 150 ? -11.706 12.543  -10.981 1.00 25.01 ? 150 GLU A HA   2  
ATOM 9581   H HB2  . GLU A 1 150 ? -13.053 13.068  -13.116 1.00 3.42  ? 150 GLU A HB2  2  
ATOM 9582   H HB3  . GLU A 1 150 ? -12.161 11.548  -13.083 1.00 72.52 ? 150 GLU A HB3  2  
ATOM 9583   H HG2  . GLU A 1 150 ? -14.172 10.314  -12.516 1.00 63.54 ? 150 GLU A HG2  2  
ATOM 9584   H HG3  . GLU A 1 150 ? -15.091 11.812  -12.356 1.00 35.54 ? 150 GLU A HG3  2  
ATOM 9585   N N    . VAL A 1 151 ? -14.853 13.047  -10.252 1.00 4.14  ? 151 VAL A N    2  
ATOM 9586   C CA   . VAL A 1 151 ? -15.769 14.080  -9.698  1.00 71.02 ? 151 VAL A CA   2  
ATOM 9587   C C    . VAL A 1 151 ? -15.422 14.321  -8.223  1.00 11.20 ? 151 VAL A C    2  
ATOM 9588   O O    . VAL A 1 151 ? -15.578 15.409  -7.710  1.00 72.02 ? 151 VAL A O    2  
ATOM 9589   C CB   . VAL A 1 151 ? -17.223 13.604  -9.836  1.00 10.31 ? 151 VAL A CB   2  
ATOM 9590   C CG1  . VAL A 1 151 ? -17.518 12.489  -8.819  1.00 24.11 ? 151 VAL A CG1  2  
ATOM 9591   C CG2  . VAL A 1 151 ? -18.172 14.783  -9.596  1.00 31.01 ? 151 VAL A CG2  2  
ATOM 9592   H H    . VAL A 1 151 ? -15.157 12.121  -10.349 1.00 32.52 ? 151 VAL A H    2  
ATOM 9593   H HA   . VAL A 1 151 ? -15.641 15.002  -10.247 1.00 24.04 ? 151 VAL A HA   2  
ATOM 9594   H HB   . VAL A 1 151 ? -17.376 13.220  -10.835 1.00 31.20 ? 151 VAL A HB   2  
ATOM 9595   H HG11 . VAL A 1 151 ? -17.742 12.924  -7.855  1.00 3.41  ? 151 VAL A HG11 2  
ATOM 9596   H HG12 . VAL A 1 151 ? -16.655 11.844  -8.729  1.00 34.32 ? 151 VAL A HG12 2  
ATOM 9597   H HG13 . VAL A 1 151 ? -18.364 11.908  -9.157  1.00 15.31 ? 151 VAL A HG13 2  
ATOM 9598   H HG21 . VAL A 1 151 ? -17.897 15.607  -10.240 1.00 74.21 ? 151 VAL A HG21 2  
ATOM 9599   H HG22 . VAL A 1 151 ? -18.105 15.095  -8.564  1.00 0.33  ? 151 VAL A HG22 2  
ATOM 9600   H HG23 . VAL A 1 151 ? -19.185 14.478  -9.815  1.00 63.34 ? 151 VAL A HG23 2  
ATOM 9601   N N    . LEU A 1 152 ? -14.949 13.312  -7.538  1.00 51.54 ? 152 LEU A N    2  
ATOM 9602   C CA   . LEU A 1 152 ? -14.593 13.490  -6.099  1.00 34.25 ? 152 LEU A CA   2  
ATOM 9603   C C    . LEU A 1 152 ? -13.450 14.501  -5.989  1.00 53.21 ? 152 LEU A C    2  
ATOM 9604   O O    . LEU A 1 152 ? -13.414 15.330  -5.101  1.00 55.15 ? 152 LEU A O    2  
ATOM 9605   C CB   . LEU A 1 152 ? -14.157 12.140  -5.506  1.00 73.31 ? 152 LEU A CB   2  
ATOM 9606   C CG   . LEU A 1 152 ? -14.259 12.175  -3.971  1.00 2.01  ? 152 LEU A CG   2  
ATOM 9607   C CD1  . LEU A 1 152 ? -15.736 12.230  -3.519  1.00 4.31  ? 152 LEU A CD1  2  
ATOM 9608   C CD2  . LEU A 1 152 ? -13.587 10.918  -3.396  1.00 22.13 ? 152 LEU A CD2  2  
ATOM 9609   H H    . LEU A 1 152 ? -14.826 12.441  -7.968  1.00 73.31 ? 152 LEU A H    2  
ATOM 9610   H HA   . LEU A 1 152 ? -15.452 13.862  -5.566  1.00 65.43 ? 152 LEU A HA   2  
ATOM 9611   H HB2  . LEU A 1 152 ? -14.793 11.359  -5.895  1.00 33.03 ? 152 LEU A HB2  2  
ATOM 9612   H HB3  . LEU A 1 152 ? -13.132 11.935  -5.787  1.00 15.33 ? 152 LEU A HB3  2  
ATOM 9613   H HG   . LEU A 1 152 ? -13.747 13.053  -3.605  1.00 11.22 ? 152 LEU A HG   2  
ATOM 9614   H HD11 . LEU A 1 152 ? -16.049 13.260  -3.433  1.00 72.32 ? 152 LEU A HD11 2  
ATOM 9615   H HD12 . LEU A 1 152 ? -15.844 11.749  -2.555  1.00 35.14 ? 152 LEU A HD12 2  
ATOM 9616   H HD13 . LEU A 1 152 ? -16.362 11.724  -4.239  1.00 41.40 ? 152 LEU A HD13 2  
ATOM 9617   H HD21 . LEU A 1 152 ? -12.603 10.802  -3.825  1.00 43.00 ? 152 LEU A HD21 2  
ATOM 9618   H HD22 . LEU A 1 152 ? -14.185 10.050  -3.631  1.00 42.20 ? 152 LEU A HD22 2  
ATOM 9619   H HD23 . LEU A 1 152 ? -13.501 11.014  -2.324  1.00 73.12 ? 152 LEU A HD23 2  
ATOM 9620   N N    . THR A 1 153 ? -12.518 14.447  -6.896  1.00 62.12 ? 153 THR A N    2  
ATOM 9621   C CA   . THR A 1 153 ? -11.390 15.411  -6.851  1.00 45.53 ? 153 THR A CA   2  
ATOM 9622   C C    . THR A 1 153 ? -11.888 16.768  -7.351  1.00 74.31 ? 153 THR A C    2  
ATOM 9623   O O    . THR A 1 153 ? -11.444 17.810  -6.916  1.00 21.34 ? 153 THR A O    2  
ATOM 9624   C CB   . THR A 1 153 ? -10.264 14.915  -7.762  1.00 12.24 ? 153 THR A CB   2  
ATOM 9625   O OG1  . THR A 1 153 ? -10.812 14.497  -9.004  1.00 2.31  ? 153 THR A OG1  2  
ATOM 9626   C CG2  . THR A 1 153 ? -9.545  13.738  -7.099  1.00 13.42 ? 153 THR A CG2  2  
ATOM 9627   H H    . THR A 1 153 ? -12.567 13.780  -7.612  1.00 43.43 ? 153 THR A H    2  
ATOM 9628   H HA   . THR A 1 153 ? -11.028 15.498  -5.837  1.00 22.03 ? 153 THR A HA   2  
ATOM 9629   H HB   . THR A 1 153 ? -9.558  15.713  -7.931  1.00 63.11 ? 153 THR A HB   2  
ATOM 9630   H HG1  . THR A 1 153 ? -11.687 14.136  -8.834  1.00 51.30 ? 153 THR A HG1  2  
ATOM 9631   H HG21 . THR A 1 153 ? -8.934  13.232  -7.833  1.00 54.12 ? 153 THR A HG21 2  
ATOM 9632   H HG22 . THR A 1 153 ? -10.275 13.048  -6.700  1.00 62.02 ? 153 THR A HG22 2  
ATOM 9633   H HG23 . THR A 1 153 ? -8.918  14.102  -6.299  1.00 24.20 ? 153 THR A HG23 2  
ATOM 9634   N N    . HIS A 1 154 ? -12.813 16.750  -8.271  1.00 52.21 ? 154 HIS A N    2  
ATOM 9635   C CA   . HIS A 1 154 ? -13.360 18.019  -8.831  1.00 50.23 ? 154 HIS A CA   2  
ATOM 9636   C C    . HIS A 1 154 ? -13.889 18.916  -7.709  1.00 1.54  ? 154 HIS A C    2  
ATOM 9637   O O    . HIS A 1 154 ? -13.553 20.081  -7.629  1.00 60.14 ? 154 HIS A O    2  
ATOM 9638   C CB   . HIS A 1 154 ? -14.499 17.683  -9.792  1.00 63.42 ? 154 HIS A CB   2  
ATOM 9639   C CG   . HIS A 1 154 ? -15.057 18.952  -10.377 1.00 34.53 ? 154 HIS A CG   2  
ATOM 9640   N ND1  . HIS A 1 154 ? -16.320 19.429  -10.048 1.00 4.00  ? 154 HIS A ND1  2  
ATOM 9641   C CD2  . HIS A 1 154 ? -14.541 19.851  -11.278 1.00 74.31 ? 154 HIS A CD2  2  
ATOM 9642   C CE1  . HIS A 1 154 ? -16.520 20.563  -10.745 1.00 53.24 ? 154 HIS A CE1  2  
ATOM 9643   N NE2  . HIS A 1 154 ? -15.467 20.863  -11.506 1.00 21.04 ? 154 HIS A NE2  2  
ATOM 9644   H H    . HIS A 1 154 ? -13.149 15.891  -8.603  1.00 35.34 ? 154 HIS A H    2  
ATOM 9645   H HA   . HIS A 1 154 ? -12.582 18.538  -9.370  1.00 15.13 ? 154 HIS A HA   2  
ATOM 9646   H HB2  . HIS A 1 154 ? -14.123 17.053  -10.585 1.00 71.23 ? 154 HIS A HB2  2  
ATOM 9647   H HB3  . HIS A 1 154 ? -15.277 17.161  -9.257  1.00 75.45 ? 154 HIS A HB3  2  
ATOM 9648   H HD1  . HIS A 1 154 ? -16.949 19.018  -9.419  1.00 55.23 ? 154 HIS A HD1  2  
ATOM 9649   H HD2  . HIS A 1 154 ? -13.563 19.791  -11.730 1.00 72.31 ? 154 HIS A HD2  2  
ATOM 9650   H HE1  . HIS A 1 154 ? -17.421 21.157  -10.693 1.00 22.52 ? 154 HIS A HE1  2  
ATOM 9651   H HE2  . HIS A 1 154 ? -15.372 21.629  -12.109 1.00 0.00  ? 154 HIS A HE2  2  
ATOM 9652   N N    . LEU A 1 155 ? -14.717 18.395  -6.846  1.00 30.23 ? 155 LEU A N    2  
ATOM 9653   C CA   . LEU A 1 155 ? -15.259 19.240  -5.742  1.00 52.32 ? 155 LEU A CA   2  
ATOM 9654   C C    . LEU A 1 155 ? -14.167 19.502  -4.703  1.00 61.31 ? 155 LEU A C    2  
ATOM 9655   O O    . LEU A 1 155 ? -14.128 20.547  -4.085  1.00 75.34 ? 155 LEU A O    2  
ATOM 9656   C CB   . LEU A 1 155 ? -16.455 18.535  -5.075  1.00 42.12 ? 155 LEU A CB   2  
ATOM 9657   C CG   . LEU A 1 155 ? -16.069 17.097  -4.626  1.00 13.15 ? 155 LEU A CG   2  
ATOM 9658   C CD1  . LEU A 1 155 ? -15.717 17.076  -3.131  1.00 64.45 ? 155 LEU A CD1  2  
ATOM 9659   C CD2  . LEU A 1 155 ? -17.244 16.136  -4.866  1.00 14.04 ? 155 LEU A CD2  2  
ATOM 9660   H H    . LEU A 1 155 ? -14.986 17.455  -6.924  1.00 2.44  ? 155 LEU A H    2  
ATOM 9661   H HA   . LEU A 1 155 ? -15.589 20.184  -6.150  1.00 44.15 ? 155 LEU A HA   2  
ATOM 9662   H HB2  . LEU A 1 155 ? -16.771 19.115  -4.218  1.00 24.33 ? 155 LEU A HB2  2  
ATOM 9663   H HB3  . LEU A 1 155 ? -17.266 18.489  -5.787  1.00 14.41 ? 155 LEU A HB3  2  
ATOM 9664   H HG   . LEU A 1 155 ? -15.219 16.756  -5.193  1.00 5.32  ? 155 LEU A HG   2  
ATOM 9665   H HD11 . LEU A 1 155 ? -15.367 16.091  -2.857  1.00 52.11 ? 155 LEU A HD11 2  
ATOM 9666   H HD12 . LEU A 1 155 ? -16.593 17.320  -2.550  1.00 73.53 ? 155 LEU A HD12 2  
ATOM 9667   H HD13 . LEU A 1 155 ? -14.945 17.799  -2.929  1.00 10.35 ? 155 LEU A HD13 2  
ATOM 9668   H HD21 . LEU A 1 155 ? -17.026 15.181  -4.407  1.00 65.20 ? 155 LEU A HD21 2  
ATOM 9669   H HD22 . LEU A 1 155 ? -17.388 16.001  -5.928  1.00 50.44 ? 155 LEU A HD22 2  
ATOM 9670   H HD23 . LEU A 1 155 ? -18.142 16.546  -4.432  1.00 42.24 ? 155 LEU A HD23 2  
ATOM 9671   N N    . ALA A 1 156 ? -13.283 18.563  -4.493  1.00 51.21 ? 156 ALA A N    2  
ATOM 9672   C CA   . ALA A 1 156 ? -12.208 18.775  -3.483  1.00 61.35 ? 156 ALA A CA   2  
ATOM 9673   C C    . ALA A 1 156 ? -11.522 20.119  -3.735  1.00 62.14 ? 156 ALA A C    2  
ATOM 9674   O O    . ALA A 1 156 ? -11.263 20.876  -2.820  1.00 11.42 ? 156 ALA A O    2  
ATOM 9675   C CB   . ALA A 1 156 ? -11.175 17.653  -3.589  1.00 14.42 ? 156 ALA A CB   2  
ATOM 9676   H H    . ALA A 1 156 ? -13.329 17.716  -4.993  1.00 43.13 ? 156 ALA A H    2  
ATOM 9677   H HA   . ALA A 1 156 ? -12.640 18.772  -2.494  1.00 14.41 ? 156 ALA A HA   2  
ATOM 9678   H HB1  . ALA A 1 156 ? -11.680 16.700  -3.634  1.00 51.11 ? 156 ALA A HB1  2  
ATOM 9679   H HB2  . ALA A 1 156 ? -10.529 17.679  -2.723  1.00 44.15 ? 156 ALA A HB2  2  
ATOM 9680   H HB3  . ALA A 1 156 ? -10.586 17.790  -4.484  1.00 15.14 ? 156 ALA A HB3  2  
ATOM 9681   N N    . ARG A 1 157 ? -11.215 20.421  -4.967  1.00 52.41 ? 157 ARG A N    2  
ATOM 9682   C CA   . ARG A 1 157 ? -10.536 21.715  -5.268  1.00 4.55  ? 157 ARG A CA   2  
ATOM 9683   C C    . ARG A 1 157 ? -11.546 22.862  -5.236  1.00 41.13 ? 157 ARG A C    2  
ATOM 9684   O O    . ARG A 1 157 ? -11.276 23.929  -4.721  1.00 55.30 ? 157 ARG A O    2  
ATOM 9685   C CB   . ARG A 1 157 ? -9.915  21.662  -6.664  1.00 54.14 ? 157 ARG A CB   2  
ATOM 9686   C CG   . ARG A 1 157 ? -9.187  20.331  -6.873  1.00 61.03 ? 157 ARG A CG   2  
ATOM 9687   C CD   . ARG A 1 157 ? -8.206  20.454  -8.053  1.00 33.13 ? 157 ARG A CD   2  
ATOM 9688   N NE   . ARG A 1 157 ? -8.089  19.143  -8.750  1.00 20.23 ? 157 ARG A NE   2  
ATOM 9689   C CZ   . ARG A 1 157 ? -7.052  18.894  -9.507  1.00 1.40  ? 157 ARG A CZ   2  
ATOM 9690   N NH1  . ARG A 1 157 ? -6.091  19.773  -9.613  1.00 43.04 ? 157 ARG A NH1  2  
ATOM 9691   N NH2  . ARG A 1 157 ? -6.976  17.765  -10.157 1.00 13.12 ? 157 ARG A NH2  2  
ATOM 9692   H H    . ARG A 1 157 ? -11.424 19.795  -5.694  1.00 71.51 ? 157 ARG A H    2  
ATOM 9693   H HA   . ARG A 1 157 ? -9.762  21.896  -4.539  1.00 51.04 ? 157 ARG A HA   2  
ATOM 9694   H HB2  . ARG A 1 157 ? -10.693 21.760  -7.409  1.00 12.33 ? 157 ARG A HB2  2  
ATOM 9695   H HB3  . ARG A 1 157 ? -9.211  22.475  -6.773  1.00 34.02 ? 157 ARG A HB3  2  
ATOM 9696   H HG2  . ARG A 1 157 ? -8.644  20.071  -5.973  1.00 14.04 ? 157 ARG A HG2  2  
ATOM 9697   H HG3  . ARG A 1 157 ? -9.910  19.562  -7.090  1.00 72.22 ? 157 ARG A HG3  2  
ATOM 9698   H HD2  . ARG A 1 157 ? -8.568  21.196  -8.755  1.00 44.32 ? 157 ARG A HD2  2  
ATOM 9699   H HD3  . ARG A 1 157 ? -7.237  20.755  -7.684  1.00 10.42 ? 157 ARG A HD3  2  
ATOM 9700   H HE   . ARG A 1 157 ? -8.799  18.475  -8.658  1.00 54.43 ? 157 ARG A HE   2  
ATOM 9701   H HH11 . ARG A 1 157 ? -6.147  20.638  -9.115  1.00 25.24 ? 157 ARG A HH11 2  
ATOM 9702   H HH12 . ARG A 1 157 ? -5.298  19.578  -10.190 1.00 50.04 ? 157 ARG A HH12 2  
ATOM 9703   H HH21 . ARG A 1 157 ? -7.711  17.092  -10.077 1.00 65.31 ? 157 ARG A HH21 2  
ATOM 9704   H HH22 . ARG A 1 157 ? -6.182  17.571  -10.733 1.00 70.21 ? 157 ARG A HH22 2  
ATOM 9705   N N    . HIS A 1 158 ? -12.696 22.663  -5.818  1.00 33.25 ? 158 HIS A N    2  
ATOM 9706   C CA   . HIS A 1 158 ? -13.710 23.753  -5.859  1.00 13.23 ? 158 HIS A CA   2  
ATOM 9707   C C    . HIS A 1 158 ? -14.507 23.804  -4.552  1.00 54.21 ? 158 HIS A C    2  
ATOM 9708   O O    . HIS A 1 158 ? -15.679 24.119  -4.548  1.00 21.11 ? 158 HIS A O    2  
ATOM 9709   C CB   . HIS A 1 158 ? -14.658 23.509  -7.031  1.00 2.21  ? 158 HIS A CB   2  
ATOM 9710   C CG   . HIS A 1 158 ? -13.847 23.284  -8.279  1.00 14.01 ? 158 HIS A CG   2  
ATOM 9711   N ND1  . HIS A 1 158 ? -14.099 22.230  -9.145  1.00 74.12 ? 158 HIS A ND1  2  
ATOM 9712   C CD2  . HIS A 1 158 ? -12.775 23.961  -8.812  1.00 62.13 ? 158 HIS A CD2  2  
ATOM 9713   C CE1  . HIS A 1 158 ? -13.197 22.300  -10.143 1.00 62.51 ? 158 HIS A CE1  2  
ATOM 9714   N NE2  . HIS A 1 158 ? -12.369 23.335  -9.986  1.00 1.33  ? 158 HIS A NE2  2  
ATOM 9715   H H    . HIS A 1 158 ? -12.882 21.804  -6.253  1.00 1.25  ? 158 HIS A H    2  
ATOM 9716   H HA   . HIS A 1 158 ? -13.207 24.698  -6.008  1.00 15.01 ? 158 HIS A HA   2  
ATOM 9717   H HB2  . HIS A 1 158 ? -15.263 22.636  -6.829  1.00 41.01 ? 158 HIS A HB2  2  
ATOM 9718   H HB3  . HIS A 1 158 ? -15.297 24.369  -7.164  1.00 64.12 ? 158 HIS A HB3  2  
ATOM 9719   H HD1  . HIS A 1 158 ? -14.803 21.557  -9.047  1.00 21.13 ? 158 HIS A HD1  2  
ATOM 9720   H HD2  . HIS A 1 158 ? -12.317 24.842  -8.384  1.00 1.11  ? 158 HIS A HD2  2  
ATOM 9721   H HE1  . HIS A 1 158 ? -13.147 21.603  -10.966 1.00 1.11  ? 158 HIS A HE1  2  
ATOM 9722   H HE2  . HIS A 1 158 ? -11.625 23.595  -10.571 1.00 0.00  ? 158 HIS A HE2  2  
ATOM 9723   N N    . ARG A 1 159 ? -13.888 23.517  -3.439  1.00 32.34 ? 159 ARG A N    2  
ATOM 9724   C CA   . ARG A 1 159 ? -14.634 23.579  -2.150  1.00 2.43  ? 159 ARG A CA   2  
ATOM 9725   C C    . ARG A 1 159 ? -15.047 25.041  -1.912  1.00 1.43  ? 159 ARG A C    2  
ATOM 9726   O O    . ARG A 1 159 ? -14.598 25.928  -2.609  1.00 50.04 ? 159 ARG A O    2  
ATOM 9727   C CB   . ARG A 1 159 ? -13.727 23.082  -1.006  1.00 70.32 ? 159 ARG A CB   2  
ATOM 9728   C CG   . ARG A 1 159 ? -14.582 22.499  0.128   1.00 53.23 ? 159 ARG A CG   2  
ATOM 9729   C CD   . ARG A 1 159 ? -13.698 22.212  1.345   1.00 23.11 ? 159 ARG A CD   2  
ATOM 9730   N NE   . ARG A 1 159 ? -13.237 23.496  1.944   1.00 71.13 ? 159 ARG A NE   2  
ATOM 9731   C CZ   . ARG A 1 159 ? -12.164 23.525  2.689   1.00 51.24 ? 159 ARG A CZ   2  
ATOM 9732   N NH1  . ARG A 1 159 ? -11.480 22.431  2.899   1.00 44.03 ? 159 ARG A NH1  2  
ATOM 9733   N NH2  . ARG A 1 159 ? -11.772 24.645  3.226   1.00 31.44 ? 159 ARG A NH2  2  
ATOM 9734   H H    . ARG A 1 159 ? -12.939 23.276  -3.449  1.00 20.13 ? 159 ARG A H    2  
ATOM 9735   H HA   . ARG A 1 159 ? -15.516 22.957  -2.217  1.00 61.44 ? 159 ARG A HA   2  
ATOM 9736   H HB2  . ARG A 1 159 ? -13.068 22.315  -1.386  1.00 43.24 ? 159 ARG A HB2  2  
ATOM 9737   H HB3  . ARG A 1 159 ? -13.136 23.903  -0.624  1.00 14.01 ? 159 ARG A HB3  2  
ATOM 9738   H HG2  . ARG A 1 159 ? -15.352 23.205  0.400   1.00 33.10 ? 159 ARG A HG2  2  
ATOM 9739   H HG3  . ARG A 1 159 ? -15.039 21.578  -0.204  1.00 22.15 ? 159 ARG A HG3  2  
ATOM 9740   H HD2  . ARG A 1 159 ? -14.267 21.659  2.078   1.00 12.42 ? 159 ARG A HD2  2  
ATOM 9741   H HD3  . ARG A 1 159 ? -12.842 21.628  1.038   1.00 53.25 ? 159 ARG A HD3  2  
ATOM 9742   H HE   . ARG A 1 159 ? -13.744 24.321  1.786   1.00 2.50  ? 159 ARG A HE   2  
ATOM 9743   H HH11 . ARG A 1 159 ? -11.776 21.568  2.491   1.00 14.13 ? 159 ARG A HH11 2  
ATOM 9744   H HH12 . ARG A 1 159 ? -10.658 22.459  3.467   1.00 74.34 ? 159 ARG A HH12 2  
ATOM 9745   H HH21 . ARG A 1 159 ? -12.292 25.484  3.068   1.00 74.23 ? 159 ARG A HH21 2  
ATOM 9746   H HH22 . ARG A 1 159 ? -10.952 24.665  3.798   1.00 74.24 ? 159 ARG A HH22 2  
ATOM 9747   N N    . ASP A 1 160 ? -15.898 25.296  -0.944  1.00 32.45 ? 160 ASP A N    2  
ATOM 9748   C CA   . ASP A 1 160 ? -16.342 26.702  -0.668  1.00 35.40 ? 160 ASP A CA   2  
ATOM 9749   C C    . ASP A 1 160 ? -16.600 27.442  -1.988  1.00 75.45 ? 160 ASP A C    2  
ATOM 9750   O O    . ASP A 1 160 ? -16.037 28.487  -2.249  1.00 11.13 ? 160 ASP A O    2  
ATOM 9751   C CB   . ASP A 1 160 ? -15.269 27.438  0.144   1.00 64.13 ? 160 ASP A CB   2  
ATOM 9752   C CG   . ASP A 1 160 ? -13.970 27.520  -0.657  1.00 42.33 ? 160 ASP A CG   2  
ATOM 9753   O OD1  . ASP A 1 160 ? -13.814 28.473  -1.401  1.00 33.31 ? 160 ASP A OD1  2  
ATOM 9754   O OD2  . ASP A 1 160 ? -13.150 26.630  -0.511  1.00 4.12  ? 160 ASP A OD2  2  
ATOM 9755   H H    . ASP A 1 160 ? -16.248 24.560  -0.399  1.00 31.45 ? 160 ASP A H    2  
ATOM 9756   H HA   . ASP A 1 160 ? -17.256 26.676  -0.095  1.00 51.44 ? 160 ASP A HA   2  
ATOM 9757   H HB2  . ASP A 1 160 ? -15.612 28.436  0.372   1.00 72.30 ? 160 ASP A HB2  2  
ATOM 9758   H HB3  . ASP A 1 160 ? -15.086 26.903  1.064   1.00 62.44 ? 160 ASP A HB3  2  
ATOM 9759   N N    . GLN A 1 161 ? -17.449 26.901  -2.823  1.00 62.45 ? 161 GLN A N    2  
ATOM 9760   C CA   . GLN A 1 161 ? -17.747 27.560  -4.127  1.00 64.00 ? 161 GLN A CA   2  
ATOM 9761   C C    . GLN A 1 161 ? -19.101 27.060  -4.645  1.00 3.33  ? 161 GLN A C    2  
ATOM 9762   O O    . GLN A 1 161 ? -19.550 25.985  -4.298  1.00 15.14 ? 161 GLN A O    2  
ATOM 9763   C CB   . GLN A 1 161 ? -16.638 27.207  -5.136  1.00 35.10 ? 161 GLN A CB   2  
ATOM 9764   C CG   . GLN A 1 161 ? -16.541 28.291  -6.215  1.00 14.25 ? 161 GLN A CG   2  
ATOM 9765   C CD   . GLN A 1 161 ? -15.905 29.552  -5.620  1.00 73.41 ? 161 GLN A CD   2  
ATOM 9766   O OE1  . GLN A 1 161 ? -16.289 30.654  -5.958  1.00 51.24 ? 161 GLN A OE1  2  
ATOM 9767   N NE2  . GLN A 1 161 ? -14.944 29.436  -4.741  1.00 42.43 ? 161 GLN A NE2  2  
ATOM 9768   H H    . GLN A 1 161 ? -17.890 26.058  -2.591  1.00 30.32 ? 161 GLN A H    2  
ATOM 9769   H HA   . GLN A 1 161 ? -17.787 28.631  -3.988  1.00 40.32 ? 161 GLN A HA   2  
ATOM 9770   H HB2  . GLN A 1 161 ? -15.695 27.135  -4.616  1.00 12.13 ? 161 GLN A HB2  2  
ATOM 9771   H HB3  . GLN A 1 161 ? -16.857 26.257  -5.604  1.00 23.22 ? 161 GLN A HB3  2  
ATOM 9772   H HG2  . GLN A 1 161 ? -15.934 27.932  -7.034  1.00 42.12 ? 161 GLN A HG2  2  
ATOM 9773   H HG3  . GLN A 1 161 ? -17.530 28.528  -6.579  1.00 10.45 ? 161 GLN A HG3  2  
ATOM 9774   H HE21 . GLN A 1 161 ? -14.634 28.549  -4.467  1.00 53.33 ? 161 GLN A HE21 2  
ATOM 9775   H HE22 . GLN A 1 161 ? -14.534 30.239  -4.356  1.00 43.40 ? 161 GLN A HE22 2  
ATOM 9776   N N    . ILE A 1 162 ? -19.751 27.827  -5.480  1.00 53.15 ? 162 ILE A N    2  
ATOM 9777   C CA   . ILE A 1 162 ? -21.068 27.387  -6.027  1.00 74.41 ? 162 ILE A CA   2  
ATOM 9778   C C    . ILE A 1 162 ? -20.813 26.473  -7.229  1.00 32.43 ? 162 ILE A C    2  
ATOM 9779   O O    . ILE A 1 162 ? -20.153 26.861  -8.172  1.00 73.33 ? 162 ILE A O    2  
ATOM 9780   C CB   . ILE A 1 162 ? -21.878 28.616  -6.473  1.00 65.14 ? 162 ILE A CB   2  
ATOM 9781   C CG1  . ILE A 1 162 ? -22.338 29.414  -5.240  1.00 53.14 ? 162 ILE A CG1  2  
ATOM 9782   C CG2  . ILE A 1 162 ? -23.113 28.158  -7.263  1.00 65.24 ? 162 ILE A CG2  2  
ATOM 9783   C CD1  . ILE A 1 162 ? -21.147 30.124  -4.576  1.00 43.10 ? 162 ILE A CD1  2  
ATOM 9784   H H    . ILE A 1 162 ? -19.367 28.686  -5.754  1.00 64.01 ? 162 ILE A H    2  
ATOM 9785   H HA   . ILE A 1 162 ? -21.616 26.846  -5.270  1.00 54.22 ? 162 ILE A HA   2  
ATOM 9786   H HB   . ILE A 1 162 ? -21.263 29.240  -7.104  1.00 15.33 ? 162 ILE A HB   2  
ATOM 9787   H HG12 . ILE A 1 162 ? -23.065 30.153  -5.546  1.00 1.55  ? 162 ILE A HG12 2  
ATOM 9788   H HG13 . ILE A 1 162 ? -22.792 28.741  -4.529  1.00 15.14 ? 162 ILE A HG13 2  
ATOM 9789   H HG21 . ILE A 1 162 ? -22.813 27.860  -8.257  1.00 32.14 ? 162 ILE A HG21 2  
ATOM 9790   H HG22 . ILE A 1 162 ? -23.823 28.971  -7.331  1.00 41.41 ? 162 ILE A HG22 2  
ATOM 9791   H HG23 . ILE A 1 162 ? -23.573 27.321  -6.761  1.00 23.12 ? 162 ILE A HG23 2  
ATOM 9792   H HD11 . ILE A 1 162 ? -21.510 30.954  -3.986  1.00 22.43 ? 162 ILE A HD11 2  
ATOM 9793   H HD12 . ILE A 1 162 ? -20.472 30.493  -5.332  1.00 41.31 ? 162 ILE A HD12 2  
ATOM 9794   H HD13 . ILE A 1 162 ? -20.626 29.432  -3.933  1.00 25.20 ? 162 ILE A HD13 2  
ATOM 9795   N N    . VAL A 1 163 ? -21.323 25.262  -7.200  1.00 44.30 ? 163 VAL A N    2  
ATOM 9796   C CA   . VAL A 1 163 ? -21.105 24.310  -8.340  1.00 33.44 ? 163 VAL A CA   2  
ATOM 9797   C C    . VAL A 1 163 ? -22.445 23.938  -8.976  1.00 4.20  ? 163 VAL A C    2  
ATOM 9798   O O    . VAL A 1 163 ? -23.371 23.514  -8.307  1.00 3.22  ? 163 VAL A O    2  
ATOM 9799   C CB   . VAL A 1 163 ? -20.434 23.041  -7.816  1.00 72.31 ? 163 VAL A CB   2  
ATOM 9800   C CG1  . VAL A 1 163 ? -20.145 22.095  -8.985  1.00 51.32 ? 163 VAL A CG1  2  
ATOM 9801   C CG2  . VAL A 1 163 ? -19.122 23.416  -7.130  1.00 45.34 ? 163 VAL A CG2  2  
ATOM 9802   H H    . VAL A 1 163 ? -21.846 24.974  -6.422  1.00 5.25  ? 163 VAL A H    2  
ATOM 9803   H HA   . VAL A 1 163 ? -20.471 24.761  -9.091  1.00 33.32 ? 163 VAL A HA   2  
ATOM 9804   H HB   . VAL A 1 163 ? -21.088 22.552  -7.108  1.00 31.40 ? 163 VAL A HB   2  
ATOM 9805   H HG11 . VAL A 1 163 ? -19.443 21.337  -8.671  1.00 43.21 ? 163 VAL A HG11 2  
ATOM 9806   H HG12 . VAL A 1 163 ? -19.724 22.656  -9.808  1.00 54.34 ? 163 VAL A HG12 2  
ATOM 9807   H HG13 . VAL A 1 163 ? -21.063 21.623  -9.304  1.00 32.45 ? 163 VAL A HG13 2  
ATOM 9808   H HG21 . VAL A 1 163 ? -19.332 23.902  -6.188  1.00 44.13 ? 163 VAL A HG21 2  
ATOM 9809   H HG22 . VAL A 1 163 ? -18.564 24.088  -7.767  1.00 40.21 ? 163 VAL A HG22 2  
ATOM 9810   H HG23 . VAL A 1 163 ? -18.542 22.524  -6.953  1.00 72.53 ? 163 VAL A HG23 2  
ATOM 9811   N N    . SER A 1 164 ? -22.550 24.089  -10.273 1.00 2.21  ? 164 SER A N    2  
ATOM 9812   C CA   . SER A 1 164 ? -23.820 23.746  -10.980 1.00 23.53 ? 164 SER A CA   2  
ATOM 9813   C C    . SER A 1 164 ? -23.681 22.376  -11.647 1.00 3.55  ? 164 SER A C    2  
ATOM 9814   O O    . SER A 1 164 ? -22.612 21.983  -12.075 1.00 0.45  ? 164 SER A O    2  
ATOM 9815   C CB   . SER A 1 164 ? -24.106 24.805  -12.046 1.00 74.12 ? 164 SER A CB   2  
ATOM 9816   O OG   . SER A 1 164 ? -25.338 24.507  -12.689 1.00 73.31 ? 164 SER A OG   2  
ATOM 9817   H H    . SER A 1 164 ? -21.787 24.428  -10.786 1.00 42.02 ? 164 SER A H    2  
ATOM 9818   H HA   . SER A 1 164 ? -24.640 23.718  -10.276 1.00 1.10  ? 164 SER A HA   2  
ATOM 9819   H HB2  . SER A 1 164 ? -24.174 25.774  -11.582 1.00 21.22 ? 164 SER A HB2  2  
ATOM 9820   H HB3  . SER A 1 164 ? -23.301 24.812  -12.771 1.00 41.13 ? 164 SER A HB3  2  
ATOM 9821   H HG   . SER A 1 164 ? -26.042 24.604  -12.043 1.00 63.31 ? 164 SER A HG   2  
ATOM 9822   N N    . LYS A 1 165 ? -24.759 21.649  -11.737 1.00 11.34 ? 165 LYS A N    2  
ATOM 9823   C CA   . LYS A 1 165 ? -24.715 20.303  -12.372 1.00 24.40 ? 165 LYS A CA   2  
ATOM 9824   C C    . LYS A 1 165 ? -24.004 20.391  -13.729 1.00 40.11 ? 165 LYS A C    2  
ATOM 9825   O O    . LYS A 1 165 ? -23.104 19.623  -14.025 1.00 13.41 ? 165 LYS A O    2  
ATOM 9826   C CB   . LYS A 1 165 ? -26.154 19.814  -12.574 1.00 31.24 ? 165 LYS A CB   2  
ATOM 9827   C CG   . LYS A 1 165 ? -26.747 19.373  -11.226 1.00 63.33 ? 165 LYS A CG   2  
ATOM 9828   C CD   . LYS A 1 165 ? -28.281 19.437  -11.281 1.00 43.42 ? 165 LYS A CD   2  
ATOM 9829   C CE   . LYS A 1 165 ? -28.813 18.476  -12.354 1.00 40.21 ? 165 LYS A CE   2  
ATOM 9830   N NZ   . LYS A 1 165 ? -28.805 19.160  -13.679 1.00 70.43 ? 165 LYS A NZ   2  
ATOM 9831   H H    . LYS A 1 165 ? -25.606 21.993  -11.383 1.00 53.32 ? 165 LYS A H    2  
ATOM 9832   H HA   . LYS A 1 165 ? -24.187 19.614  -11.728 1.00 33.23 ? 165 LYS A HA   2  
ATOM 9833   H HB2  . LYS A 1 165 ? -26.747 20.619  -12.987 1.00 14.42 ? 165 LYS A HB2  2  
ATOM 9834   H HB3  . LYS A 1 165 ? -26.159 18.982  -13.259 1.00 22.51 ? 165 LYS A HB3  2  
ATOM 9835   H HG2  . LYS A 1 165 ? -26.440 18.359  -11.013 1.00 52.34 ? 165 LYS A HG2  2  
ATOM 9836   H HG3  . LYS A 1 165 ? -26.394 20.027  -10.441 1.00 4.34  ? 165 LYS A HG3  2  
ATOM 9837   H HD2  . LYS A 1 165 ? -28.685 19.159  -10.318 1.00 22.33 ? 165 LYS A HD2  2  
ATOM 9838   H HD3  . LYS A 1 165 ? -28.588 20.444  -11.521 1.00 41.52 ? 165 LYS A HD3  2  
ATOM 9839   H HE2  . LYS A 1 165 ? -28.189 17.594  -12.399 1.00 31.42 ? 165 LYS A HE2  2  
ATOM 9840   H HE3  . LYS A 1 165 ? -29.824 18.186  -12.107 1.00 35.51 ? 165 LYS A HE3  2  
ATOM 9841   H HZ1  . LYS A 1 165 ? -27.864 19.563  -13.857 1.00 34.22 ? 165 LYS A HZ1  2  
ATOM 9842   H HZ2  . LYS A 1 165 ? -29.516 19.921  -13.679 1.00 12.43 ? 165 LYS A HZ2  2  
ATOM 9843   H HZ3  . LYS A 1 165 ? -29.033 18.473  -14.425 1.00 20.41 ? 165 LYS A HZ3  2  
ATOM 9844   N N    . GLU A 1 166 ? -24.396 21.320  -14.557 1.00 44.34 ? 166 GLU A N    2  
ATOM 9845   C CA   . GLU A 1 166 ? -23.740 21.450  -15.888 1.00 73.52 ? 166 GLU A CA   2  
ATOM 9846   C C    . GLU A 1 166 ? -22.224 21.525  -15.704 1.00 1.14  ? 166 GLU A C    2  
ATOM 9847   O O    . GLU A 1 166 ? -21.466 20.996  -16.492 1.00 35.53 ? 166 GLU A O    2  
ATOM 9848   C CB   . GLU A 1 166 ? -24.229 22.721  -16.586 1.00 33.24 ? 166 GLU A CB   2  
ATOM 9849   C CG   . GLU A 1 166 ? -23.776 22.704  -18.049 1.00 52.45 ? 166 GLU A CG   2  
ATOM 9850   C CD   . GLU A 1 166 ? -24.043 24.067  -18.693 1.00 51.10 ? 166 GLU A CD   2  
ATOM 9851   O OE1  . GLU A 1 166 ? -25.193 24.475  -18.720 1.00 61.31 ? 166 GLU A OE1  2  
ATOM 9852   O OE2  . GLU A 1 166 ? -23.092 24.679  -19.151 1.00 71.12 ? 166 GLU A OE2  2  
ATOM 9853   H H    . GLU A 1 166 ? -25.119 21.931  -14.304 1.00 60.02 ? 166 GLU A H    2  
ATOM 9854   H HA   . GLU A 1 166 ? -23.985 20.590  -16.494 1.00 72.33 ? 166 GLU A HA   2  
ATOM 9855   H HB2  . GLU A 1 166 ? -25.308 22.765  -16.540 1.00 44.05 ? 166 GLU A HB2  2  
ATOM 9856   H HB3  . GLU A 1 166 ? -23.812 23.586  -16.092 1.00 74.32 ? 166 GLU A HB3  2  
ATOM 9857   H HG2  . GLU A 1 166 ? -22.720 22.486  -18.096 1.00 4.34  ? 166 GLU A HG2  2  
ATOM 9858   H HG3  . GLU A 1 166 ? -24.324 21.944  -18.586 1.00 61.11 ? 166 GLU A HG3  2  
ATOM 9859   N N    . GLN A 1 167 ? -21.769 22.177  -14.668 1.00 51.31 ? 167 GLN A N    2  
ATOM 9860   C CA   . GLN A 1 167 ? -20.299 22.275  -14.450 1.00 24.42 ? 167 GLN A CA   2  
ATOM 9861   C C    . GLN A 1 167 ? -19.717 20.868  -14.324 1.00 74.52 ? 167 GLN A C    2  
ATOM 9862   O O    . GLN A 1 167 ? -18.690 20.557  -14.893 1.00 21.42 ? 167 GLN A O    2  
ATOM 9863   C CB   . GLN A 1 167 ? -20.013 23.065  -13.172 1.00 45.03 ? 167 GLN A CB   2  
ATOM 9864   C CG   . GLN A 1 167 ? -18.539 23.476  -13.151 1.00 23.44 ? 167 GLN A CG   2  
ATOM 9865   C CD   . GLN A 1 167 ? -18.201 24.095  -11.796 1.00 33.52 ? 167 GLN A CD   2  
ATOM 9866   O OE1  . GLN A 1 167 ? -17.274 23.672  -11.134 1.00 54.35 ? 167 GLN A OE1  2  
ATOM 9867   N NE2  . GLN A 1 167 ? -18.919 25.089  -11.355 1.00 23.03 ? 167 GLN A NE2  2  
ATOM 9868   H H    . GLN A 1 167 ? -22.390 22.600  -14.039 1.00 2.14  ? 167 GLN A H    2  
ATOM 9869   H HA   . GLN A 1 167 ? -19.845 22.775  -15.292 1.00 42.34 ? 167 GLN A HA   2  
ATOM 9870   H HB2  . GLN A 1 167 ? -20.636 23.948  -13.148 1.00 14.31 ? 167 GLN A HB2  2  
ATOM 9871   H HB3  . GLN A 1 167 ? -20.226 22.450  -12.311 1.00 64.54 ? 167 GLN A HB3  2  
ATOM 9872   H HG2  . GLN A 1 167 ? -17.920 22.606  -13.316 1.00 13.20 ? 167 GLN A HG2  2  
ATOM 9873   H HG3  . GLN A 1 167 ? -18.358 24.201  -13.931 1.00 11.22 ? 167 GLN A HG3  2  
ATOM 9874   H HE21 . GLN A 1 167 ? -19.665 25.429  -11.893 1.00 24.21 ? 167 GLN A HE21 2  
ATOM 9875   H HE22 . GLN A 1 167 ? -18.715 25.496  -10.488 1.00 14.44 ? 167 GLN A HE22 2  
ATOM 9876   N N    . LEU A 1 168 ? -20.374 20.008  -13.595 1.00 2.33  ? 168 LEU A N    2  
ATOM 9877   C CA   . LEU A 1 168 ? -19.865 18.617  -13.450 1.00 25.13 ? 168 LEU A CA   2  
ATOM 9878   C C    . LEU A 1 168 ? -19.708 18.014  -14.833 1.00 32.34 ? 168 LEU A C    2  
ATOM 9879   O O    . LEU A 1 168 ? -18.778 17.283  -15.100 1.00 72.31 ? 168 LEU A O    2  
ATOM 9880   C CB   . LEU A 1 168 ? -20.859 17.790  -12.631 1.00 2.33  ? 168 LEU A CB   2  
ATOM 9881   C CG   . LEU A 1 168 ? -21.255 18.561  -11.368 1.00 1.13  ? 168 LEU A CG   2  
ATOM 9882   C CD1  . LEU A 1 168 ? -22.088 17.655  -10.461 1.00 60.04 ? 168 LEU A CD1  2  
ATOM 9883   C CD2  . LEU A 1 168 ? -19.995 19.018  -10.621 1.00 4.14  ? 168 LEU A CD2  2  
ATOM 9884   H H    . LEU A 1 168 ? -21.208 20.274  -13.153 1.00 22.02 ? 168 LEU A H    2  
ATOM 9885   H HA   . LEU A 1 168 ? -18.903 18.623  -12.964 1.00 55.11 ? 168 LEU A HA   2  
ATOM 9886   H HB2  . LEU A 1 168 ? -21.741 17.598  -13.225 1.00 30.22 ? 168 LEU A HB2  2  
ATOM 9887   H HB3  . LEU A 1 168 ? -20.402 16.852  -12.351 1.00 41.11 ? 168 LEU A HB3  2  
ATOM 9888   H HG   . LEU A 1 168 ? -21.842 19.425  -11.647 1.00 54.43 ? 168 LEU A HG   2  
ATOM 9889   H HD11 . LEU A 1 168 ? -22.988 17.356  -10.979 1.00 22.24 ? 168 LEU A HD11 2  
ATOM 9890   H HD12 . LEU A 1 168 ? -22.352 18.192  -9.561  1.00 73.32 ? 168 LEU A HD12 2  
ATOM 9891   H HD13 . LEU A 1 168 ? -21.514 16.778  -10.202 1.00 33.33 ? 168 LEU A HD13 2  
ATOM 9892   H HD21 . LEU A 1 168 ? -20.247 19.264  -9.600  1.00 33.33 ? 168 LEU A HD21 2  
ATOM 9893   H HD22 . LEU A 1 168 ? -19.585 19.890  -11.109 1.00 53.43 ? 168 LEU A HD22 2  
ATOM 9894   H HD23 . LEU A 1 168 ? -19.262 18.224  -10.629 1.00 74.41 ? 168 LEU A HD23 2  
ATOM 9895   N N    . LEU A 1 169 ? -20.597 18.319  -15.726 1.00 10.34 ? 169 LEU A N    2  
ATOM 9896   C CA   . LEU A 1 169 ? -20.456 17.754  -17.087 1.00 14.54 ? 169 LEU A CA   2  
ATOM 9897   C C    . LEU A 1 169 ? -19.180 18.307  -17.727 1.00 34.33 ? 169 LEU A C    2  
ATOM 9898   O O    . LEU A 1 169 ? -18.192 17.611  -17.861 1.00 0.13  ? 169 LEU A O    2  
ATOM 9899   C CB   . LEU A 1 169 ? -21.664 18.144  -17.943 1.00 53.33 ? 169 LEU A CB   2  
ATOM 9900   C CG   . LEU A 1 169 ? -22.951 17.591  -17.321 1.00 4.32  ? 169 LEU A CG   2  
ATOM 9901   C CD1  . LEU A 1 169 ? -24.149 18.035  -18.171 1.00 2.11  ? 169 LEU A CD1  2  
ATOM 9902   C CD2  . LEU A 1 169 ? -22.887 16.050  -17.264 1.00 23.20 ? 169 LEU A CD2  2  
ATOM 9903   H H    . LEU A 1 169 ? -21.346 18.918  -15.504 1.00 61.44 ? 169 LEU A H    2  
ATOM 9904   H HA   . LEU A 1 169 ? -20.387 16.679  -17.025 1.00 73.24 ? 169 LEU A HA   2  
ATOM 9905   H HB2  . LEU A 1 169 ? -21.731 19.219  -18.006 1.00 5.54  ? 169 LEU A HB2  2  
ATOM 9906   H HB3  . LEU A 1 169 ? -21.548 17.733  -18.934 1.00 60.33 ? 169 LEU A HB3  2  
ATOM 9907   H HG   . LEU A 1 169 ? -23.060 17.984  -16.319 1.00 73.32 ? 169 LEU A HG   2  
ATOM 9908   H HD11 . LEU A 1 169 ? -24.039 19.077  -18.435 1.00 72.42 ? 169 LEU A HD11 2  
ATOM 9909   H HD12 . LEU A 1 169 ? -25.061 17.902  -17.606 1.00 44.54 ? 169 LEU A HD12 2  
ATOM 9910   H HD13 . LEU A 1 169 ? -24.193 17.438  -19.069 1.00 75.14 ? 169 LEU A HD13 2  
ATOM 9911   H HD21 . LEU A 1 169 ? -22.455 15.746  -16.321 1.00 33.14 ? 169 LEU A HD21 2  
ATOM 9912   H HD22 . LEU A 1 169 ? -22.277 15.674  -18.074 1.00 14.23 ? 169 LEU A HD22 2  
ATOM 9913   H HD23 . LEU A 1 169 ? -23.881 15.637  -17.348 1.00 13.30 ? 169 LEU A HD23 2  
ATOM 9914   N N    . ASP A 1 170 ? -19.199 19.542  -18.142 1.00 42.53 ? 170 ASP A N    2  
ATOM 9915   C CA   . ASP A 1 170 ? -17.997 20.136  -18.798 1.00 14.54 ? 170 ASP A CA   2  
ATOM 9916   C C    . ASP A 1 170 ? -16.731 19.800  -18.004 1.00 44.41 ? 170 ASP A C    2  
ATOM 9917   O O    . ASP A 1 170 ? -15.626 19.979  -18.478 1.00 31.43 ? 170 ASP A O    2  
ATOM 9918   C CB   . ASP A 1 170 ? -18.165 21.655  -18.861 1.00 62.44 ? 170 ASP A CB   2  
ATOM 9919   C CG   . ASP A 1 170 ? -19.316 22.004  -19.806 1.00 3.30  ? 170 ASP A CG   2  
ATOM 9920   O OD1  . ASP A 1 170 ? -19.494 21.291  -20.779 1.00 32.10 ? 170 ASP A OD1  2  
ATOM 9921   O OD2  . ASP A 1 170 ? -19.999 22.978  -19.542 1.00 60.11 ? 170 ASP A OD2  2  
ATOM 9922   H H    . ASP A 1 170 ? -20.013 20.078  -18.037 1.00 54.21 ? 170 ASP A H    2  
ATOM 9923   H HA   . ASP A 1 170 ? -17.904 19.746  -19.801 1.00 65.03 ? 170 ASP A HA   2  
ATOM 9924   H HB2  . ASP A 1 170 ? -18.384 22.032  -17.872 1.00 2.44  ? 170 ASP A HB2  2  
ATOM 9925   H HB3  . ASP A 1 170 ? -17.254 22.104  -19.225 1.00 44.41 ? 170 ASP A HB3  2  
ATOM 9926   N N    . ALA A 1 171 ? -16.877 19.340  -16.793 1.00 12.52 ? 171 ALA A N    2  
ATOM 9927   C CA   . ALA A 1 171 ? -15.680 19.022  -15.957 1.00 15.21 ? 171 ALA A CA   2  
ATOM 9928   C C    . ALA A 1 171 ? -15.282 17.544  -16.086 1.00 60.21 ? 171 ALA A C    2  
ATOM 9929   O O    . ALA A 1 171 ? -14.112 17.215  -16.075 1.00 1.43  ? 171 ALA A O    2  
ATOM 9930   C CB   . ALA A 1 171 ? -16.018 19.322  -14.500 1.00 34.12 ? 171 ALA A CB   2  
ATOM 9931   H H    . ALA A 1 171 ? -17.775 19.220  -16.422 1.00 61.11 ? 171 ALA A H    2  
ATOM 9932   H HA   . ALA A 1 171 ? -14.848 19.643  -16.259 1.00 70.21 ? 171 ALA A HA   2  
ATOM 9933   H HB1  . ALA A 1 171 ? -16.102 20.390  -14.365 1.00 61.42 ? 171 ALA A HB1  2  
ATOM 9934   H HB2  . ALA A 1 171 ? -15.238 18.937  -13.861 1.00 3.11  ? 171 ALA A HB2  2  
ATOM 9935   H HB3  . ALA A 1 171 ? -16.958 18.854  -14.249 1.00 62.12 ? 171 ALA A HB3  2  
ATOM 9936   N N    . ILE A 1 172 ? -16.234 16.647  -16.178 1.00 32.11 ? 172 ILE A N    2  
ATOM 9937   C CA   . ILE A 1 172 ? -15.891 15.190  -16.270 1.00 21.54 ? 172 ILE A CA   2  
ATOM 9938   C C    . ILE A 1 172 ? -15.857 14.738  -17.739 1.00 1.41  ? 172 ILE A C    2  
ATOM 9939   O O    . ILE A 1 172 ? -14.862 14.217  -18.201 1.00 22.31 ? 172 ILE A O    2  
ATOM 9940   C CB   . ILE A 1 172 ? -16.935 14.380  -15.464 1.00 12.32 ? 172 ILE A CB   2  
ATOM 9941   C CG1  . ILE A 1 172 ? -16.544 14.367  -13.972 1.00 22.21 ? 172 ILE A CG1  2  
ATOM 9942   C CG2  . ILE A 1 172 ? -17.008 12.928  -15.971 1.00 24.15 ? 172 ILE A CG2  2  
ATOM 9943   C CD1  . ILE A 1 172 ? -16.237 15.788  -13.485 1.00 75.32 ? 172 ILE A CD1  2  
ATOM 9944   H H    . ILE A 1 172 ? -17.173 16.927  -16.166 1.00 41.30 ? 172 ILE A H    2  
ATOM 9945   H HA   . ILE A 1 172 ? -14.911 15.023  -15.844 1.00 45.20 ? 172 ILE A HA   2  
ATOM 9946   H HB   . ILE A 1 172 ? -17.905 14.843  -15.574 1.00 54.31 ? 172 ILE A HB   2  
ATOM 9947   H HG12 . ILE A 1 172 ? -17.360 13.960  -13.393 1.00 51.04 ? 172 ILE A HG12 2  
ATOM 9948   H HG13 . ILE A 1 172 ? -15.670 13.747  -13.837 1.00 32.50 ? 172 ILE A HG13 2  
ATOM 9949   H HG21 . ILE A 1 172 ? -16.012 12.575  -16.192 1.00 21.45 ? 172 ILE A HG21 2  
ATOM 9950   H HG22 . ILE A 1 172 ? -17.607 12.892  -16.868 1.00 23.03 ? 172 ILE A HG22 2  
ATOM 9951   H HG23 . ILE A 1 172 ? -17.455 12.297  -15.215 1.00 71.22 ? 172 ILE A HG23 2  
ATOM 9952   H HD11 . ILE A 1 172 ? -16.291 15.817  -12.406 1.00 44.25 ? 172 ILE A HD11 2  
ATOM 9953   H HD12 . ILE A 1 172 ? -16.958 16.473  -13.897 1.00 73.54 ? 172 ILE A HD12 2  
ATOM 9954   H HD13 . ILE A 1 172 ? -15.245 16.076  -13.803 1.00 64.45 ? 172 ILE A HD13 2  
ATOM 9955   N N    . TRP A 1 173 ? -16.920 14.914  -18.484 1.00 31.23 ? 173 TRP A N    2  
ATOM 9956   C CA   . TRP A 1 173 ? -16.878 14.455  -19.918 1.00 61.20 ? 173 TRP A CA   2  
ATOM 9957   C C    . TRP A 1 173 ? -16.195 15.529  -20.772 1.00 25.45 ? 173 TRP A C    2  
ATOM 9958   O O    . TRP A 1 173 ? -16.352 16.714  -20.551 1.00 50.42 ? 173 TRP A O    2  
ATOM 9959   C CB   . TRP A 1 173 ? -18.313 14.132  -20.443 1.00 55.43 ? 173 TRP A CB   2  
ATOM 9960   C CG   . TRP A 1 173 ? -18.659 14.948  -21.667 1.00 53.02 ? 173 TRP A CG   2  
ATOM 9961   C CD1  . TRP A 1 173 ? -18.502 14.552  -22.953 1.00 41.44 ? 173 TRP A CD1  2  
ATOM 9962   C CD2  . TRP A 1 173 ? -19.195 16.293  -21.725 1.00 42.35 ? 173 TRP A CD2  2  
ATOM 9963   N NE1  . TRP A 1 173 ? -18.909 15.579  -23.790 1.00 64.11 ? 173 TRP A NE1  2  
ATOM 9964   C CE2  . TRP A 1 173 ? -19.343 16.676  -23.075 1.00 70.14 ? 173 TRP A CE2  2  
ATOM 9965   C CE3  . TRP A 1 173 ? -19.557 17.202  -20.736 1.00 43.04 ? 173 TRP A CE3  2  
ATOM 9966   C CZ2  . TRP A 1 173 ? -19.840 17.935  -23.425 1.00 5.32  ? 173 TRP A CZ2  2  
ATOM 9967   C CZ3  . TRP A 1 173 ? -20.055 18.469  -21.069 1.00 73.14 ? 173 TRP A CZ3  2  
ATOM 9968   C CH2  . TRP A 1 173 ? -20.194 18.839  -22.416 1.00 4.42  ? 173 TRP A CH2  2  
ATOM 9969   H H    . TRP A 1 173 ? -17.730 15.336  -18.105 1.00 33.40 ? 173 TRP A H    2  
ATOM 9970   H HA   . TRP A 1 173 ? -16.275 13.555  -19.971 1.00 0.31  ? 173 TRP A HA   2  
ATOM 9971   H HB2  . TRP A 1 173 ? -18.372 13.085  -20.698 1.00 25.21 ? 173 TRP A HB2  2  
ATOM 9972   H HB3  . TRP A 1 173 ? -19.026 14.334  -19.664 1.00 52.51 ? 173 TRP A HB3  2  
ATOM 9973   H HD1  . TRP A 1 173 ? -18.123 13.598  -23.274 1.00 13.43 ? 173 TRP A HD1  2  
ATOM 9974   H HE1  . TRP A 1 173 ? -18.898 15.548  -24.770 1.00 40.24 ? 173 TRP A HE1  2  
ATOM 9975   H HE3  . TRP A 1 173 ? -19.459 16.914  -19.712 1.00 71.14 ? 173 TRP A HE3  2  
ATOM 9976   H HZ2  . TRP A 1 173 ? -19.943 18.211  -24.465 1.00 43.42 ? 173 TRP A HZ2  2  
ATOM 9977   H HZ3  . TRP A 1 173 ? -20.321 19.164  -20.284 1.00 61.31 ? 173 TRP A HZ3  2  
ATOM 9978   H HH2  . TRP A 1 173 ? -20.579 19.815  -22.673 1.00 63.02 ? 173 TRP A HH2  2  
ATOM 9979   N N    . GLU A 1 174 ? -15.444 15.108  -21.751 1.00 4.33  ? 174 GLU A N    2  
ATOM 9980   C CA   . GLU A 1 174 ? -14.748 16.077  -22.638 1.00 64.43 ? 174 GLU A CA   2  
ATOM 9981   C C    . GLU A 1 174 ? -14.102 15.324  -23.804 1.00 41.00 ? 174 GLU A C    2  
ATOM 9982   O O    . GLU A 1 174 ? -13.928 15.858  -24.882 1.00 42.25 ? 174 GLU A O    2  
ATOM 9983   C CB   . GLU A 1 174 ? -13.669 16.818  -21.847 1.00 32.52 ? 174 GLU A CB   2  
ATOM 9984   C CG   . GLU A 1 174 ? -13.202 18.032  -22.652 1.00 60.44 ? 174 GLU A CG   2  
ATOM 9985   C CD   . GLU A 1 174 ? -12.173 18.823  -21.845 1.00 73.24 ? 174 GLU A CD   2  
ATOM 9986   O OE1  . GLU A 1 174 ? -11.822 18.375  -20.765 1.00 14.03 ? 174 GLU A OE1  2  
ATOM 9987   O OE2  . GLU A 1 174 ? -11.752 19.865  -22.320 1.00 70.44 ? 174 GLU A OE2  2  
ATOM 9988   H H    . GLU A 1 174 ? -15.345 14.146  -21.904 1.00 13.31 ? 174 GLU A H    2  
ATOM 9989   H HA   . GLU A 1 174 ? -15.466 16.787  -23.023 1.00 5.41  ? 174 GLU A HA   2  
ATOM 9990   H HB2  . GLU A 1 174 ? -14.075 17.145  -20.899 1.00 50.54 ? 174 GLU A HB2  2  
ATOM 9991   H HB3  . GLU A 1 174 ? -12.831 16.160  -21.673 1.00 51.23 ? 174 GLU A HB3  2  
ATOM 9992   H HG2  . GLU A 1 174 ? -12.755 17.698  -23.578 1.00 10.22 ? 174 GLU A HG2  2  
ATOM 9993   H HG3  . GLU A 1 174 ? -14.049 18.665  -22.870 1.00 63.41 ? 174 GLU A HG3  2  
ATOM 9994   N N    . GLU A 1 175 ? -13.739 14.083  -23.595 1.00 25.42 ? 175 GLU A N    2  
ATOM 9995   C CA   . GLU A 1 175 ? -13.100 13.289  -24.689 1.00 0.51  ? 175 GLU A CA   2  
ATOM 9996   C C    . GLU A 1 175 ? -13.437 11.787  -24.557 1.00 5.33  ? 175 GLU A C    2  
ATOM 9997   O O    . GLU A 1 175 ? -13.643 11.120  -25.553 1.00 13.13 ? 175 GLU A O    2  
ATOM 9998   C CB   . GLU A 1 175 ? -11.571 13.490  -24.645 1.00 34.25 ? 175 GLU A CB   2  
ATOM 9999   C CG   . GLU A 1 175 ? -10.979 13.326  -26.049 1.00 42.44 ? 175 GLU A CG   2  
ATOM 10000  C CD   . GLU A 1 175 ? -11.374 14.525  -26.912 1.00 4.24  ? 175 GLU A CD   2  
ATOM 10001  O OE1  . GLU A 1 175 ? -11.573 15.592  -26.354 1.00 44.43 ? 175 GLU A OE1  2  
ATOM 10002  O OE2  . GLU A 1 175 ? -11.472 14.357  -28.116 1.00 23.51 ? 175 GLU A OE2  2  
ATOM 10003  H H    . GLU A 1 175 ? -13.884 13.681  -22.724 1.00 11.35 ? 175 GLU A H    2  
ATOM 10004  H HA   . GLU A 1 175 ? -13.477 13.641  -25.641 1.00 63.33 ? 175 GLU A HA   2  
ATOM 10005  H HB2  . GLU A 1 175 ? -11.353 14.483  -24.280 1.00 32.11 ? 175 GLU A HB2  2  
ATOM 10006  H HB3  . GLU A 1 175 ? -11.122 12.762  -23.986 1.00 43.01 ? 175 GLU A HB3  2  
ATOM 10007  H HG2  . GLU A 1 175 ? -9.902  13.268  -25.982 1.00 61.15 ? 175 GLU A HG2  2  
ATOM 10008  H HG3  . GLU A 1 175 ? -11.361 12.421  -26.497 1.00 11.55 ? 175 GLU A HG3  2  
ATOM 10009  N N    . PRO A 1 176 ? -13.480 11.239  -23.358 1.00 12.25 ? 176 PRO A N    2  
ATOM 10010  C CA   . PRO A 1 176 ? -13.780 9.801   -23.145 1.00 52.13 ? 176 PRO A CA   2  
ATOM 10011  C C    . PRO A 1 176 ? -15.264 9.546   -22.845 1.00 40.40 ? 176 PRO A C    2  
ATOM 10012  O O    . PRO A 1 176 ? -15.987 9.003   -23.658 1.00 72.51 ? 176 PRO A O    2  
ATOM 10013  C CB   . PRO A 1 176 ? -12.906 9.468   -21.930 1.00 2.54  ? 176 PRO A CB   2  
ATOM 10014  C CG   . PRO A 1 176 ? -12.826 10.748  -21.131 1.00 31.35 ? 176 PRO A CG   2  
ATOM 10015  C CD   . PRO A 1 176 ? -13.262 11.901  -22.064 1.00 53.33 ? 176 PRO A CD   2  
ATOM 10016  H HA   . PRO A 1 176 ? -13.460 9.217   -23.994 1.00 70.21 ? 176 PRO A HA   2  
ATOM 10017  H HB2  . PRO A 1 176 ? -13.358 8.674   -21.345 1.00 5.33  ? 176 PRO A HB2  2  
ATOM 10018  H HB3  . PRO A 1 176 ? -11.918 9.171   -22.254 1.00 42.31 ? 176 PRO A HB3  2  
ATOM 10019  H HG2  . PRO A 1 176 ? -13.490 10.692  -20.274 1.00 23.43 ? 176 PRO A HG2  2  
ATOM 10020  H HG3  . PRO A 1 176 ? -11.812 10.917  -20.794 1.00 2.43  ? 176 PRO A HG3  2  
ATOM 10021  H HD2  . PRO A 1 176 ? -14.182 12.345  -21.705 1.00 14.22 ? 176 PRO A HD2  2  
ATOM 10022  H HD3  . PRO A 1 176 ? -12.487 12.646  -22.146 1.00 62.52 ? 176 PRO A HD3  2  
ATOM 10023  N N    . GLU A 1 177 ? -15.721 9.931   -21.683 1.00 2.21  ? 177 GLU A N    2  
ATOM 10024  C CA   . GLU A 1 177 ? -17.154 9.708   -21.331 1.00 63.11 ? 177 GLU A CA   2  
ATOM 10025  C C    . GLU A 1 177 ? -18.050 10.420  -22.346 1.00 60.35 ? 177 GLU A C    2  
ATOM 10026  O O    . GLU A 1 177 ? -17.640 11.366  -22.982 1.00 2.53  ? 177 GLU A O    2  
ATOM 10027  C CB   . GLU A 1 177 ? -17.422 10.245  -19.922 1.00 40.51 ? 177 GLU A CB   2  
ATOM 10028  C CG   . GLU A 1 177 ? -16.613 9.431   -18.908 1.00 23.24 ? 177 GLU A CG   2  
ATOM 10029  C CD   . GLU A 1 177 ? -17.094 9.748   -17.491 1.00 63.24 ? 177 GLU A CD   2  
ATOM 10030  O OE1  . GLU A 1 177 ? -18.269 10.041  -17.337 1.00 24.12 ? 177 GLU A OE1  2  
ATOM 10031  O OE2  . GLU A 1 177 ? -16.282 9.688   -16.583 1.00 23.43 ? 177 GLU A OE2  2  
ATOM 10032  H H    . GLU A 1 177 ? -15.121 10.364  -21.042 1.00 23.20 ? 177 GLU A H    2  
ATOM 10033  H HA   . GLU A 1 177 ? -17.367 8.656   -21.352 1.00 75.34 ? 177 GLU A HA   2  
ATOM 10034  H HB2  . GLU A 1 177 ? -17.128 11.283  -19.869 1.00 34.53 ? 177 GLU A HB2  2  
ATOM 10035  H HB3  . GLU A 1 177 ? -18.473 10.155  -19.695 1.00 12.24 ? 177 GLU A HB3  2  
ATOM 10036  H HG2  . GLU A 1 177 ? -16.743 8.377   -19.107 1.00 11.04 ? 177 GLU A HG2  2  
ATOM 10037  H HG3  . GLU A 1 177 ? -15.567 9.686   -18.996 1.00 11.23 ? 177 GLU A HG3  2  
ATOM 10038  N N    . MET A 1 178 ? -19.272 9.961   -22.505 1.00 44.31 ? 178 MET A N    2  
ATOM 10039  C CA   . MET A 1 178 ? -20.217 10.601  -23.482 1.00 73.50 ? 178 MET A CA   2  
ATOM 10040  C C    . MET A 1 178 ? -21.485 11.034  -22.740 1.00 54.02 ? 178 MET A C    2  
ATOM 10041  O O    . MET A 1 178 ? -22.354 11.679  -23.293 1.00 41.41 ? 178 MET A O    2  
ATOM 10042  C CB   . MET A 1 178 ? -20.580 9.603   -24.590 1.00 63.53 ? 178 MET A CB   2  
ATOM 10043  C CG   . MET A 1 178 ? -21.071 8.285   -23.983 1.00 32.54 ? 178 MET A CG   2  
ATOM 10044  S SD   . MET A 1 178 ? -21.144 7.025   -25.283 1.00 12.21 ? 178 MET A SD   2  
ATOM 10045  C CE   . MET A 1 178 ? -21.939 5.726   -24.306 1.00 43.30 ? 178 MET A CE   2  
ATOM 10046  H H    . MET A 1 178 ? -19.570 9.191   -21.979 1.00 21.21 ? 178 MET A H    2  
ATOM 10047  H HA   . MET A 1 178 ? -19.757 11.473  -23.927 1.00 62.01 ? 178 MET A HA   2  
ATOM 10048  H HB2  . MET A 1 178 ? -21.359 10.024  -25.208 1.00 61.20 ? 178 MET A HB2  2  
ATOM 10049  H HB3  . MET A 1 178 ? -19.707 9.412   -25.197 1.00 52.41 ? 178 MET A HB3  2  
ATOM 10050  H HG2  . MET A 1 178 ? -20.390 7.963   -23.209 1.00 63.13 ? 178 MET A HG2  2  
ATOM 10051  H HG3  . MET A 1 178 ? -22.056 8.425   -23.563 1.00 44.32 ? 178 MET A HG3  2  
ATOM 10052  H HE1  . MET A 1 178 ? -22.975 5.985   -24.139 1.00 2.24  ? 178 MET A HE1  2  
ATOM 10053  H HE2  . MET A 1 178 ? -21.437 5.630   -23.357 1.00 4.22  ? 178 MET A HE2  2  
ATOM 10054  H HE3  . MET A 1 178 ? -21.878 4.788   -24.841 1.00 74.51 ? 178 MET A HE3  2  
ATOM 10055  N N    . VAL A 1 179 ? -21.585 10.692  -21.485 1.00 65.22 ? 179 VAL A N    2  
ATOM 10056  C CA   . VAL A 1 179 ? -22.781 11.085  -20.684 1.00 11.44 ? 179 VAL A CA   2  
ATOM 10057  C C    . VAL A 1 179 ? -24.067 10.742  -21.440 1.00 53.11 ? 179 VAL A C    2  
ATOM 10058  O O    . VAL A 1 179 ? -24.501 11.474  -22.307 1.00 31.03 ? 179 VAL A O    2  
ATOM 10059  C CB   . VAL A 1 179 ? -22.746 12.592  -20.413 1.00 33.12 ? 179 VAL A CB   2  
ATOM 10060  C CG1  . VAL A 1 179 ? -23.697 12.928  -19.261 1.00 34.33 ? 179 VAL A CG1  2  
ATOM 10061  C CG2  . VAL A 1 179 ? -21.325 13.012  -20.037 1.00 12.23 ? 179 VAL A CG2  2  
ATOM 10062  H H    . VAL A 1 179 ? -20.866 10.179  -21.062 1.00 11.10 ? 179 VAL A H    2  
ATOM 10063  H HA   . VAL A 1 179 ? -22.769 10.553  -19.743 1.00 15.43 ? 179 VAL A HA   2  
ATOM 10064  H HB   . VAL A 1 179 ? -23.057 13.127  -21.300 1.00 0.43  ? 179 VAL A HB   2  
ATOM 10065  H HG11 . VAL A 1 179 ? -24.634 12.411  -19.405 1.00 62.33 ? 179 VAL A HG11 2  
ATOM 10066  H HG12 . VAL A 1 179 ? -23.874 13.993  -19.238 1.00 44.53 ? 179 VAL A HG12 2  
ATOM 10067  H HG13 . VAL A 1 179 ? -23.254 12.617  -18.326 1.00 21.51 ? 179 VAL A HG13 2  
ATOM 10068  H HG21 . VAL A 1 179 ? -21.339 14.025  -19.662 1.00 25.01 ? 179 VAL A HG21 2  
ATOM 10069  H HG22 . VAL A 1 179 ? -20.692 12.960  -20.910 1.00 20.32 ? 179 VAL A HG22 2  
ATOM 10070  H HG23 . VAL A 1 179 ? -20.943 12.351  -19.273 1.00 32.23 ? 179 VAL A HG23 2  
ATOM 10071  N N    . THR A 1 180 ? -24.693 9.650   -21.100 1.00 32.13 ? 180 THR A N    2  
ATOM 10072  C CA   . THR A 1 180 ? -25.965 9.280   -21.781 1.00 51.13 ? 180 THR A CA   2  
ATOM 10073  C C    . THR A 1 180 ? -26.940 10.458  -21.620 1.00 2.04  ? 180 THR A C    2  
ATOM 10074  O O    . THR A 1 180 ? -26.736 11.319  -20.788 1.00 2.44  ? 180 THR A O    2  
ATOM 10075  C CB   . THR A 1 180 ? -26.529 8.002   -21.111 1.00 14.54 ? 180 THR A CB   2  
ATOM 10076  O OG1  . THR A 1 180 ? -25.840 7.785   -19.892 1.00 13.35 ? 180 THR A OG1  2  
ATOM 10077  C CG2  . THR A 1 180 ? -26.326 6.775   -22.009 1.00 71.42 ? 180 THR A CG2  2  
ATOM 10078  H H    . THR A 1 180 ? -24.337 9.083   -20.385 1.00 55.41 ? 180 THR A H    2  
ATOM 10079  H HA   . THR A 1 180 ? -25.776 9.109   -22.831 1.00 73.10 ? 180 THR A HA   2  
ATOM 10080  H HB   . THR A 1 180 ? -27.583 8.119   -20.905 1.00 61.32 ? 180 THR A HB   2  
ATOM 10081  H HG1  . THR A 1 180 ? -25.575 6.863   -19.862 1.00 20.32 ? 180 THR A HG1  2  
ATOM 10082  H HG21 . THR A 1 180 ? -26.706 6.978   -22.998 1.00 73.22 ? 180 THR A HG21 2  
ATOM 10083  H HG22 . THR A 1 180 ? -26.854 5.933   -21.586 1.00 64.35 ? 180 THR A HG22 2  
ATOM 10084  H HG23 . THR A 1 180 ? -25.272 6.545   -22.067 1.00 71.51 ? 180 THR A HG23 2  
ATOM 10085  N N    . PRO A 1 181 ? -27.986 10.502  -22.405 1.00 13.01 ? 181 PRO A N    2  
ATOM 10086  C CA   . PRO A 1 181 ? -28.988 11.601  -22.336 1.00 14.30 ? 181 PRO A CA   2  
ATOM 10087  C C    . PRO A 1 181 ? -29.256 12.057  -20.895 1.00 14.21 ? 181 PRO A C    2  
ATOM 10088  O O    . PRO A 1 181 ? -29.696 13.165  -20.657 1.00 21.20 ? 181 PRO A O    2  
ATOM 10089  C CB   . PRO A 1 181 ? -30.231 10.964  -22.955 1.00 32.45 ? 181 PRO A CB   2  
ATOM 10090  C CG   . PRO A 1 181 ? -29.694 10.013  -23.981 1.00 41.22 ? 181 PRO A CG   2  
ATOM 10091  C CD   . PRO A 1 181 ? -28.336 9.519   -23.448 1.00 13.02 ? 181 PRO A CD   2  
ATOM 10092  H HA   . PRO A 1 181 ? -28.673 12.436  -22.939 1.00 62.43 ? 181 PRO A HA   2  
ATOM 10093  H HB2  . PRO A 1 181 ? -30.796 10.431  -22.200 1.00 1.54  ? 181 PRO A HB2  2  
ATOM 10094  H HB3  . PRO A 1 181 ? -30.847 11.715  -23.427 1.00 2.14  ? 181 PRO A HB3  2  
ATOM 10095  H HG2  . PRO A 1 181 ? -30.376 9.180   -24.110 1.00 24.14 ? 181 PRO A HG2  2  
ATOM 10096  H HG3  . PRO A 1 181 ? -29.551 10.522  -24.924 1.00 32.23 ? 181 PRO A HG3  2  
ATOM 10097  H HD2  . PRO A 1 181 ? -28.437 8.531   -23.021 1.00 4.13  ? 181 PRO A HD2  2  
ATOM 10098  H HD3  . PRO A 1 181 ? -27.592 9.522   -24.230 1.00 31.32 ? 181 PRO A HD3  2  
ATOM 10099  N N    . ASN A 1 182 ? -28.983 11.216  -19.933 1.00 23.21 ? 182 ASN A N    2  
ATOM 10100  C CA   . ASN A 1 182 ? -29.212 11.604  -18.510 1.00 3.52  ? 182 ASN A CA   2  
ATOM 10101  C C    . ASN A 1 182 ? -28.313 10.758  -17.604 1.00 24.32 ? 182 ASN A C    2  
ATOM 10102  O O    . ASN A 1 182 ? -28.409 9.547   -17.581 1.00 4.41  ? 182 ASN A O    2  
ATOM 10103  C CB   . ASN A 1 182 ? -30.676 11.359  -18.145 1.00 41.42 ? 182 ASN A CB   2  
ATOM 10104  C CG   . ASN A 1 182 ? -30.992 9.867   -18.280 1.00 64.54 ? 182 ASN A CG   2  
ATOM 10105  O OD1  . ASN A 1 182 ? -30.314 9.154   -18.993 1.00 61.04 ? 182 ASN A OD1  2  
ATOM 10106  N ND2  . ASN A 1 182 ? -31.999 9.361   -17.620 1.00 15.42 ? 182 ASN A ND2  2  
ATOM 10107  H H    . ASN A 1 182 ? -28.622 10.330  -20.147 1.00 45.30 ? 182 ASN A H    2  
ATOM 10108  H HA   . ASN A 1 182 ? -28.974 12.650  -18.377 1.00 24.23 ? 182 ASN A HA   2  
ATOM 10109  H HB2  . ASN A 1 182 ? -30.850 11.674  -17.126 1.00 50.24 ? 182 ASN A HB2  2  
ATOM 10110  H HB3  . ASN A 1 182 ? -31.312 11.921  -18.811 1.00 3.34  ? 182 ASN A HB3  2  
ATOM 10111  H HD21 . ASN A 1 182 ? -32.546 9.935   -17.044 1.00 73.13 ? 182 ASN A HD21 2  
ATOM 10112  H HD22 . ASN A 1 182 ? -32.209 8.407   -17.701 1.00 4.33  ? 182 ASN A HD22 2  
ATOM 10113  N N    . VAL A 1 183 ? -27.435 11.385  -16.858 1.00 64.22 ? 183 VAL A N    2  
ATOM 10114  C CA   . VAL A 1 183 ? -26.524 10.612  -15.956 1.00 52.03 ? 183 VAL A CA   2  
ATOM 10115  C C    . VAL A 1 183 ? -26.256 11.403  -14.672 1.00 33.22 ? 183 VAL A C    2  
ATOM 10116  O O    . VAL A 1 183 ? -26.041 10.836  -13.619 1.00 35.32 ? 183 VAL A O    2  
ATOM 10117  C CB   . VAL A 1 183 ? -25.199 10.361  -16.680 1.00 14.22 ? 183 VAL A CB   2  
ATOM 10118  C CG1  . VAL A 1 183 ? -24.335 9.399   -15.860 1.00 74.02 ? 183 VAL A CG1  2  
ATOM 10119  C CG2  . VAL A 1 183 ? -25.488 9.736   -18.042 1.00 5.02  ? 183 VAL A CG2  2  
ATOM 10120  H H    . VAL A 1 183 ? -27.372 12.362  -16.895 1.00 44.53 ? 183 VAL A H    2  
ATOM 10121  H HA   . VAL A 1 183 ? -26.977 9.662   -15.706 1.00 72.43 ? 183 VAL A HA   2  
ATOM 10122  H HB   . VAL A 1 183 ? -24.675 11.295  -16.812 1.00 12.10 ? 183 VAL A HB   2  
ATOM 10123  H HG11 . VAL A 1 183 ? -23.342 9.361   -16.281 1.00 65.34 ? 183 VAL A HG11 2  
ATOM 10124  H HG12 . VAL A 1 183 ? -24.774 8.413   -15.887 1.00 50.43 ? 183 VAL A HG12 2  
ATOM 10125  H HG13 . VAL A 1 183 ? -24.280 9.740   -14.838 1.00 0.11  ? 183 VAL A HG13 2  
ATOM 10126  H HG21 . VAL A 1 183 ? -25.919 10.479  -18.697 1.00 30.12 ? 183 VAL A HG21 2  
ATOM 10127  H HG22 . VAL A 1 183 ? -26.183 8.921   -17.914 1.00 73.13 ? 183 VAL A HG22 2  
ATOM 10128  H HG23 . VAL A 1 183 ? -24.570 9.363   -18.472 1.00 50.01 ? 183 VAL A HG23 2  
ATOM 10129  N N    . ILE A 1 184 ? -26.249 12.705  -14.749 1.00 61.22 ? 184 ILE A N    2  
ATOM 10130  C CA   . ILE A 1 184 ? -25.974 13.520  -13.531 1.00 72.33 ? 184 ILE A CA   2  
ATOM 10131  C C    . ILE A 1 184 ? -26.993 13.185  -12.439 1.00 51.22 ? 184 ILE A C    2  
ATOM 10132  O O    . ILE A 1 184 ? -26.684 13.190  -11.264 1.00 22.32 ? 184 ILE A O    2  
ATOM 10133  C CB   . ILE A 1 184 ? -26.061 15.017  -13.878 1.00 64.41 ? 184 ILE A CB   2  
ATOM 10134  C CG1  . ILE A 1 184 ? -25.380 15.279  -15.248 1.00 32.32 ? 184 ILE A CG1  2  
ATOM 10135  C CG2  . ILE A 1 184 ? -25.363 15.836  -12.779 1.00 50.11 ? 184 ILE A CG2  2  
ATOM 10136  C CD1  . ILE A 1 184 ? -26.384 15.140  -16.416 1.00 64.01 ? 184 ILE A CD1  2  
ATOM 10137  H H    . ILE A 1 184 ? -26.410 13.144  -15.607 1.00 33.23 ? 184 ILE A H    2  
ATOM 10138  H HA   . ILE A 1 184 ? -24.983 13.290  -13.175 1.00 23.22 ? 184 ILE A HA   2  
ATOM 10139  H HB   . ILE A 1 184 ? -27.099 15.313  -13.923 1.00 4.33  ? 184 ILE A HB   2  
ATOM 10140  H HG12 . ILE A 1 184 ? -24.972 16.281  -15.261 1.00 11.24 ? 184 ILE A HG12 2  
ATOM 10141  H HG13 . ILE A 1 184 ? -24.573 14.573  -15.391 1.00 65.14 ? 184 ILE A HG13 2  
ATOM 10142  H HG21 . ILE A 1 184 ? -25.261 16.858  -13.107 1.00 30.54 ? 184 ILE A HG21 2  
ATOM 10143  H HG22 . ILE A 1 184 ? -24.384 15.427  -12.580 1.00 2.33  ? 184 ILE A HG22 2  
ATOM 10144  H HG23 . ILE A 1 184 ? -25.956 15.806  -11.876 1.00 65.32 ? 184 ILE A HG23 2  
ATOM 10145  H HD11 . ILE A 1 184 ? -26.625 16.121  -16.797 1.00 63.22 ? 184 ILE A HD11 2  
ATOM 10146  H HD12 . ILE A 1 184 ? -27.291 14.653  -16.087 1.00 22.33 ? 184 ILE A HD12 2  
ATOM 10147  H HD13 . ILE A 1 184 ? -25.936 14.555  -17.205 1.00 34.44 ? 184 ILE A HD13 2  
ATOM 10148  N N    . GLU A 1 185 ? -28.206 12.901  -12.817 1.00 24.32 ? 185 GLU A N    2  
ATOM 10149  C CA   . GLU A 1 185 ? -29.244 12.572  -11.801 1.00 73.31 ? 185 GLU A CA   2  
ATOM 10150  C C    . GLU A 1 185 ? -28.733 11.455  -10.886 1.00 14.11 ? 185 GLU A C    2  
ATOM 10151  O O    . GLU A 1 185 ? -28.786 11.556  -9.674  1.00 74.40 ? 185 GLU A O    2  
ATOM 10152  C CB   . GLU A 1 185 ? -30.511 12.104  -12.518 1.00 61.24 ? 185 GLU A CB   2  
ATOM 10153  C CG   . GLU A 1 185 ? -31.168 13.291  -13.228 1.00 12.43 ? 185 GLU A CG   2  
ATOM 10154  C CD   . GLU A 1 185 ? -32.344 12.793  -14.070 1.00 2.44  ? 185 GLU A CD   2  
ATOM 10155  O OE1  . GLU A 1 185 ? -32.673 11.624  -13.959 1.00 24.14 ? 185 GLU A OE1  2  
ATOM 10156  O OE2  . GLU A 1 185 ? -32.892 13.588  -14.817 1.00 23.53 ? 185 GLU A OE2  2  
ATOM 10157  H H    . GLU A 1 185 ? -28.437 12.907  -13.769 1.00 41.52 ? 185 GLU A H    2  
ATOM 10158  H HA   . GLU A 1 185 ? -29.465 13.450  -11.212 1.00 50.14 ? 185 GLU A HA   2  
ATOM 10159  H HB2  . GLU A 1 185 ? -30.252 11.349  -13.245 1.00 55.33 ? 185 GLU A HB2  2  
ATOM 10160  H HB3  . GLU A 1 185 ? -31.202 11.690  -11.799 1.00 10.15 ? 185 GLU A HB3  2  
ATOM 10161  H HG2  . GLU A 1 185 ? -31.524 13.997  -12.492 1.00 14.40 ? 185 GLU A HG2  2  
ATOM 10162  H HG3  . GLU A 1 185 ? -30.445 13.772  -13.870 1.00 53.40 ? 185 GLU A HG3  2  
ATOM 10163  N N    . VAL A 1 186 ? -28.238 10.390  -11.454 1.00 70.42 ? 186 VAL A N    2  
ATOM 10164  C CA   . VAL A 1 186 ? -27.730 9.269   -10.615 1.00 32.41 ? 186 VAL A CA   2  
ATOM 10165  C C    . VAL A 1 186 ? -26.348 9.618   -10.058 1.00 11.14 ? 186 VAL A C    2  
ATOM 10166  O O    . VAL A 1 186 ? -25.978 9.191   -8.983  1.00 41.10 ? 186 VAL A O    2  
ATOM 10167  C CB   . VAL A 1 186 ? -27.634 7.993   -11.456 1.00 25.24 ? 186 VAL A CB   2  
ATOM 10168  C CG1  . VAL A 1 186 ? -29.040 7.503   -11.809 1.00 42.23 ? 186 VAL A CG1  2  
ATOM 10169  C CG2  . VAL A 1 186 ? -26.859 8.282   -12.744 1.00 60.34 ? 186 VAL A CG2  2  
ATOM 10170  H H    . VAL A 1 186 ? -28.205 10.328  -12.431 1.00 74.32 ? 186 VAL A H    2  
ATOM 10171  H HA   . VAL A 1 186 ? -28.412 9.103   -9.793  1.00 53.31 ? 186 VAL A HA   2  
ATOM 10172  H HB   . VAL A 1 186 ? -27.121 7.228   -10.891 1.00 40.15 ? 186 VAL A HB   2  
ATOM 10173  H HG11 . VAL A 1 186 ? -29.513 7.105   -10.925 1.00 61.42 ? 186 VAL A HG11 2  
ATOM 10174  H HG12 . VAL A 1 186 ? -28.973 6.729   -12.561 1.00 31.43 ? 186 VAL A HG12 2  
ATOM 10175  H HG13 . VAL A 1 186 ? -29.625 8.326   -12.191 1.00 1.40  ? 186 VAL A HG13 2  
ATOM 10176  H HG21 . VAL A 1 186 ? -27.437 8.942   -13.373 1.00 0.24  ? 186 VAL A HG21 2  
ATOM 10177  H HG22 . VAL A 1 186 ? -26.676 7.356   -13.267 1.00 54.10 ? 186 VAL A HG22 2  
ATOM 10178  H HG23 . VAL A 1 186 ? -25.918 8.750   -12.500 1.00 74.11 ? 186 VAL A HG23 2  
ATOM 10179  N N    . ALA A 1 187 ? -25.577 10.385  -10.775 1.00 22.21 ? 187 ALA A N    2  
ATOM 10180  C CA   . ALA A 1 187 ? -24.222 10.743  -10.273 1.00 23.22 ? 187 ALA A CA   2  
ATOM 10181  C C    . ALA A 1 187 ? -24.342 11.541  -8.970  1.00 52.11 ? 187 ALA A C    2  
ATOM 10182  O O    . ALA A 1 187 ? -23.707 11.228  -7.985  1.00 30.13 ? 187 ALA A O    2  
ATOM 10183  C CB   . ALA A 1 187 ? -23.490 11.581  -11.325 1.00 31.51 ? 187 ALA A CB   2  
ATOM 10184  H H    . ALA A 1 187 ? -25.885 10.721  -11.644 1.00 22.24 ? 187 ALA A H    2  
ATOM 10185  H HA   . ALA A 1 187 ? -23.661 9.839   -10.085 1.00 73.23 ? 187 ALA A HA   2  
ATOM 10186  H HB1  . ALA A 1 187 ? -23.826 12.606  -11.272 1.00 53.22 ? 187 ALA A HB1  2  
ATOM 10187  H HB2  . ALA A 1 187 ? -23.697 11.186  -12.310 1.00 32.01 ? 187 ALA A HB2  2  
ATOM 10188  H HB3  . ALA A 1 187 ? -22.427 11.542  -11.139 1.00 30.52 ? 187 ALA A HB3  2  
ATOM 10189  N N    . ILE A 1 188 ? -25.139 12.576  -8.953  1.00 0.31  ? 188 ILE A N    2  
ATOM 10190  C CA   . ILE A 1 188 ? -25.265 13.383  -7.706  1.00 24.14 ? 188 ILE A CA   2  
ATOM 10191  C C    . ILE A 1 188 ? -25.963 12.561  -6.617  1.00 15.34 ? 188 ILE A C    2  
ATOM 10192  O O    . ILE A 1 188 ? -25.553 12.561  -5.474  1.00 64.54 ? 188 ILE A O    2  
ATOM 10193  C CB   . ILE A 1 188 ? -26.052 14.678  -7.999  1.00 65.34 ? 188 ILE A CB   2  
ATOM 10194  C CG1  . ILE A 1 188 ? -25.817 15.708  -6.870  1.00 13.51 ? 188 ILE A CG1  2  
ATOM 10195  C CG2  . ILE A 1 188 ? -27.553 14.367  -8.110  1.00 71.40 ? 188 ILE A CG2  2  
ATOM 10196  C CD1  . ILE A 1 188 ? -24.545 16.523  -7.145  1.00 30.42 ? 188 ILE A CD1  2  
ATOM 10197  H H    . ILE A 1 188 ? -25.641 12.826  -9.756  1.00 24.25 ? 188 ILE A H    2  
ATOM 10198  H HA   . ILE A 1 188 ? -24.278 13.635  -7.361  1.00 61.44 ? 188 ILE A HA   2  
ATOM 10199  H HB   . ILE A 1 188 ? -25.712 15.089  -8.940  1.00 52.44 ? 188 ILE A HB   2  
ATOM 10200  H HG12 . ILE A 1 188 ? -26.657 16.383  -6.817  1.00 74.31 ? 188 ILE A HG12 2  
ATOM 10201  H HG13 . ILE A 1 188 ? -25.713 15.196  -5.925  1.00 22.42 ? 188 ILE A HG13 2  
ATOM 10202  H HG21 . ILE A 1 188 ? -27.692 13.461  -8.679  1.00 70.25 ? 188 ILE A HG21 2  
ATOM 10203  H HG22 . ILE A 1 188 ? -28.053 15.186  -8.607  1.00 24.24 ? 188 ILE A HG22 2  
ATOM 10204  H HG23 . ILE A 1 188 ? -27.968 14.240  -7.121  1.00 65.22 ? 188 ILE A HG23 2  
ATOM 10205  H HD11 . ILE A 1 188 ? -23.704 15.860  -7.263  1.00 5.23  ? 188 ILE A HD11 2  
ATOM 10206  H HD12 . ILE A 1 188 ? -24.360 17.190  -6.315  1.00 4.35  ? 188 ILE A HD12 2  
ATOM 10207  H HD13 . ILE A 1 188 ? -24.677 17.102  -8.047  1.00 73.11 ? 188 ILE A HD13 2  
ATOM 10208  N N    . ASN A 1 189 ? -27.005 11.855  -6.954  1.00 15.11 ? 189 ASN A N    2  
ATOM 10209  C CA   . ASN A 1 189 ? -27.696 11.038  -5.918  1.00 73.14 ? 189 ASN A CA   2  
ATOM 10210  C C    . ASN A 1 189 ? -26.703 10.017  -5.356  1.00 54.43 ? 189 ASN A C    2  
ATOM 10211  O O    . ASN A 1 189 ? -26.695 9.716   -4.177  1.00 73.44 ? 189 ASN A O    2  
ATOM 10212  C CB   . ASN A 1 189 ? -28.890 10.316  -6.558  1.00 43.13 ? 189 ASN A CB   2  
ATOM 10213  C CG   . ASN A 1 189 ? -29.425 9.235   -5.612  1.00 40.55 ? 189 ASN A CG   2  
ATOM 10214  O OD1  . ASN A 1 189 ? -29.456 8.069   -5.957  1.00 13.22 ? 189 ASN A OD1  2  
ATOM 10215  N ND2  . ASN A 1 189 ? -29.851 9.574   -4.429  1.00 21.02 ? 189 ASN A ND2  2  
ATOM 10216  H H    . ASN A 1 189 ? -27.327 11.854  -7.881  1.00 44.12 ? 189 ASN A H    2  
ATOM 10217  H HA   . ASN A 1 189 ? -28.043 11.682  -5.123  1.00 60.31 ? 189 ASN A HA   2  
ATOM 10218  H HB2  . ASN A 1 189 ? -29.673 11.032  -6.758  1.00 50.04 ? 189 ASN A HB2  2  
ATOM 10219  H HB3  . ASN A 1 189 ? -28.577 9.857   -7.485  1.00 63.41 ? 189 ASN A HB3  2  
ATOM 10220  H HD21 . ASN A 1 189 ? -29.829 10.514  -4.152  1.00 15.14 ? 189 ASN A HD21 2  
ATOM 10221  H HD22 . ASN A 1 189 ? -30.193 8.891   -3.816  1.00 55.23 ? 189 ASN A HD22 2  
ATOM 10222  N N    . GLN A 1 190 ? -25.870 9.481   -6.202  1.00 42.25 ? 190 GLN A N    2  
ATOM 10223  C CA   . GLN A 1 190 ? -24.877 8.470   -5.746  1.00 32.32 ? 190 GLN A CA   2  
ATOM 10224  C C    . GLN A 1 190 ? -23.776 9.133   -4.913  1.00 10.04 ? 190 GLN A C    2  
ATOM 10225  O O    . GLN A 1 190 ? -23.459 8.688   -3.828  1.00 61.14 ? 190 GLN A O    2  
ATOM 10226  C CB   . GLN A 1 190 ? -24.255 7.802   -6.975  1.00 2.23  ? 190 GLN A CB   2  
ATOM 10227  C CG   . GLN A 1 190 ? -25.271 6.847   -7.609  1.00 71.42 ? 190 GLN A CG   2  
ATOM 10228  C CD   . GLN A 1 190 ? -25.323 5.547   -6.803  1.00 44.03 ? 190 GLN A CD   2  
ATOM 10229  O OE1  . GLN A 1 190 ? -24.297 4.996   -6.454  1.00 11.43 ? 190 GLN A OE1  2  
ATOM 10230  N NE2  . GLN A 1 190 ? -26.478 5.031   -6.486  1.00 20.41 ? 190 GLN A NE2  2  
ATOM 10231  H H    . GLN A 1 190 ? -25.902 9.740   -7.147  1.00 14.22 ? 190 GLN A H    2  
ATOM 10232  H HA   . GLN A 1 190 ? -25.376 7.724   -5.149  1.00 33.33 ? 190 GLN A HA   2  
ATOM 10233  H HB2  . GLN A 1 190 ? -23.977 8.560   -7.694  1.00 3.22  ? 190 GLN A HB2  2  
ATOM 10234  H HB3  . GLN A 1 190 ? -23.377 7.248   -6.681  1.00 63.20 ? 190 GLN A HB3  2  
ATOM 10235  H HG2  . GLN A 1 190 ? -26.249 7.311   -7.613  1.00 11.50 ? 190 GLN A HG2  2  
ATOM 10236  H HG3  . GLN A 1 190 ? -24.974 6.628   -8.623  1.00 62.52 ? 190 GLN A HG3  2  
ATOM 10237  H HE21 . GLN A 1 190 ? -27.306 5.475   -6.764  1.00 63.52 ? 190 GLN A HE21 2  
ATOM 10238  H HE22 . GLN A 1 190 ? -26.517 4.198   -5.971  1.00 11.40 ? 190 GLN A HE22 2  
ATOM 10239  N N    . ILE A 1 191 ? -23.178 10.181  -5.412  1.00 44.14 ? 191 ILE A N    2  
ATOM 10240  C CA   . ILE A 1 191 ? -22.088 10.848  -4.644  1.00 61.55 ? 191 ILE A CA   2  
ATOM 10241  C C    . ILE A 1 191 ? -22.573 11.178  -3.230  1.00 21.15 ? 191 ILE A C    2  
ATOM 10242  O O    . ILE A 1 191 ? -21.999 10.741  -2.258  1.00 22.45 ? 191 ILE A O    2  
ATOM 10243  C CB   . ILE A 1 191 ? -21.669 12.137  -5.358  1.00 43.21 ? 191 ILE A CB   2  
ATOM 10244  C CG1  . ILE A 1 191 ? -20.992 11.785  -6.691  1.00 50.42 ? 191 ILE A CG1  2  
ATOM 10245  C CG2  . ILE A 1 191 ? -20.682 12.912  -4.478  1.00 20.45 ? 191 ILE A CG2  2  
ATOM 10246  C CD1  . ILE A 1 191 ? -20.993 13.011  -7.604  1.00 4.50  ? 191 ILE A CD1  2  
ATOM 10247  H H    . ILE A 1 191 ? -23.438 10.522  -6.293  1.00 62.22 ? 191 ILE A H    2  
ATOM 10248  H HA   . ILE A 1 191 ? -21.238 10.185  -4.585  1.00 15.13 ? 191 ILE A HA   2  
ATOM 10249  H HB   . ILE A 1 191 ? -22.545 12.746  -5.542  1.00 21.13 ? 191 ILE A HB   2  
ATOM 10250  H HG12 . ILE A 1 191 ? -19.973 11.475  -6.509  1.00 64.02 ? 191 ILE A HG12 2  
ATOM 10251  H HG13 . ILE A 1 191 ? -21.529 10.982  -7.172  1.00 12.42 ? 191 ILE A HG13 2  
ATOM 10252  H HG21 . ILE A 1 191 ? -19.957 12.228  -4.063  1.00 72.44 ? 191 ILE A HG21 2  
ATOM 10253  H HG22 . ILE A 1 191 ? -21.216 13.398  -3.676  1.00 61.22 ? 191 ILE A HG22 2  
ATOM 10254  H HG23 . ILE A 1 191 ? -20.173 13.656  -5.071  1.00 12.04 ? 191 ILE A HG23 2  
ATOM 10255  H HD11 . ILE A 1 191 ? -20.451 12.787  -8.510  1.00 53.12 ? 191 ILE A HD11 2  
ATOM 10256  H HD12 . ILE A 1 191 ? -20.519 13.838  -7.095  1.00 12.21 ? 191 ILE A HD12 2  
ATOM 10257  H HD13 . ILE A 1 191 ? -22.011 13.276  -7.849  1.00 0.33  ? 191 ILE A HD13 2  
ATOM 10258  N N    . ARG A 1 192 ? -23.619 11.946  -3.105  1.00 62.31 ? 192 ARG A N    2  
ATOM 10259  C CA   . ARG A 1 192 ? -24.121 12.296  -1.746  1.00 54.22 ? 192 ARG A CA   2  
ATOM 10260  C C    . ARG A 1 192 ? -24.293 11.007  -0.929  1.00 60.22 ? 192 ARG A C    2  
ATOM 10261  O O    . ARG A 1 192 ? -23.956 10.952  0.236   1.00 14.32 ? 192 ARG A O    2  
ATOM 10262  C CB   . ARG A 1 192 ? -25.474 13.046  -1.879  1.00 15.03 ? 192 ARG A CB   2  
ATOM 10263  C CG   . ARG A 1 192 ? -25.354 14.480  -1.341  1.00 53.03 ? 192 ARG A CG   2  
ATOM 10264  C CD   . ARG A 1 192 ? -26.592 15.281  -1.749  1.00 11.51 ? 192 ARG A CD   2  
ATOM 10265  N NE   . ARG A 1 192 ? -27.817 14.613  -1.217  1.00 63.34 ? 192 ARG A NE   2  
ATOM 10266  C CZ   . ARG A 1 192 ? -28.167 14.783  0.029   1.00 25.53 ? 192 ARG A CZ   2  
ATOM 10267  N NH1  . ARG A 1 192 ? -27.452 15.546  0.810   1.00 55.31 ? 192 ARG A NH1  2  
ATOM 10268  N NH2  . ARG A 1 192 ? -29.237 14.196  0.493   1.00 40.32 ? 192 ARG A NH2  2  
ATOM 10269  H H    . ARG A 1 192 ? -24.071 12.294  -3.901  1.00 3.52  ? 192 ARG A H    2  
ATOM 10270  H HA   . ARG A 1 192 ? -23.393 12.927  -1.254  1.00 31.02 ? 192 ARG A HA   2  
ATOM 10271  H HB2  . ARG A 1 192 ? -25.753 13.085  -2.921  1.00 52.53 ? 192 ARG A HB2  2  
ATOM 10272  H HB3  . ARG A 1 192 ? -26.247 12.528  -1.326  1.00 41.40 ? 192 ARG A HB3  2  
ATOM 10273  H HG2  . ARG A 1 192 ? -25.277 14.455  -0.264  1.00 35.42 ? 192 ARG A HG2  2  
ATOM 10274  H HG3  . ARG A 1 192 ? -24.472 14.947  -1.756  1.00 21.02 ? 192 ARG A HG3  2  
ATOM 10275  H HD2  . ARG A 1 192 ? -26.523 16.279  -1.347  1.00 60.25 ? 192 ARG A HD2  2  
ATOM 10276  H HD3  . ARG A 1 192 ? -26.649 15.330  -2.826  1.00 64.22 ? 192 ARG A HD3  2  
ATOM 10277  H HE   . ARG A 1 192 ? -28.358 14.044  -1.803  1.00 45.23 ? 192 ARG A HE   2  
ATOM 10278  H HH11 . ARG A 1 192 ? -26.635 16.001  0.454   1.00 54.40 ? 192 ARG A HH11 2  
ATOM 10279  H HH12 . ARG A 1 192 ? -27.718 15.674  1.765   1.00 15.24 ? 192 ARG A HH12 2  
ATOM 10280  H HH21 . ARG A 1 192 ? -29.788 13.615  -0.105  1.00 1.34  ? 192 ARG A HH21 2  
ATOM 10281  H HH22 . ARG A 1 192 ? -29.504 14.326  1.448   1.00 44.30 ? 192 ARG A HH22 2  
ATOM 10282  N N    . GLN A 1 193 ? -24.815 9.970   -1.528  1.00 35.22 ? 193 GLN A N    2  
ATOM 10283  C CA   . GLN A 1 193 ? -25.001 8.697   -0.771  1.00 24.03 ? 193 GLN A CA   2  
ATOM 10284  C C    . GLN A 1 193 ? -23.636 8.043   -0.502  1.00 11.33 ? 193 GLN A C    2  
ATOM 10285  O O    . GLN A 1 193 ? -23.489 7.257   0.414   1.00 52.02 ? 193 GLN A O    2  
ATOM 10286  C CB   . GLN A 1 193 ? -25.881 7.735   -1.592  1.00 52.21 ? 193 GLN A CB   2  
ATOM 10287  C CG   . GLN A 1 193 ? -27.363 8.061   -1.368  1.00 12.43 ? 193 GLN A CG   2  
ATOM 10288  C CD   . GLN A 1 193 ? -28.209 7.391   -2.452  1.00 50.15 ? 193 GLN A CD   2  
ATOM 10289  O OE1  . GLN A 1 193 ? -29.301 7.836   -2.748  1.00 61.24 ? 193 GLN A OE1  2  
ATOM 10290  N NE2  . GLN A 1 193 ? -27.751 6.331   -3.064  1.00 4.02  ? 193 GLN A NE2  2  
ATOM 10291  H H    . GLN A 1 193 ? -25.086 10.028  -2.471  1.00 15.42 ? 193 GLN A H    2  
ATOM 10292  H HA   . GLN A 1 193 ? -25.483 8.913   0.172   1.00 22.34 ? 193 GLN A HA   2  
ATOM 10293  H HB2  . GLN A 1 193 ? -25.647 7.844   -2.641  1.00 12.42 ? 193 GLN A HB2  2  
ATOM 10294  H HB3  . GLN A 1 193 ? -25.692 6.717   -1.284  1.00 32.53 ? 193 GLN A HB3  2  
ATOM 10295  H HG2  . GLN A 1 193 ? -27.666 7.692   -0.396  1.00 74.32 ? 193 GLN A HG2  2  
ATOM 10296  H HG3  . GLN A 1 193 ? -27.507 9.129   -1.408  1.00 21.02 ? 193 GLN A HG3  2  
ATOM 10297  H HE21 . GLN A 1 193 ? -26.871 5.970   -2.827  1.00 64.30 ? 193 GLN A HE21 2  
ATOM 10298  H HE22 . GLN A 1 193 ? -28.287 5.896   -3.761  1.00 10.52 ? 193 GLN A HE22 2  
ATOM 10299  N N    . LYS A 1 194 ? -22.647 8.343   -1.306  1.00 63.35 ? 194 LYS A N    2  
ATOM 10300  C CA   . LYS A 1 194 ? -21.294 7.723   -1.119  1.00 2.12  ? 194 LYS A CA   2  
ATOM 10301  C C    . LYS A 1 194 ? -20.344 8.703   -0.417  1.00 64.14 ? 194 LYS A C    2  
ATOM 10302  O O    . LYS A 1 194 ? -19.195 8.392   -0.178  1.00 21.31 ? 194 LYS A O    2  
ATOM 10303  C CB   . LYS A 1 194 ? -20.720 7.370   -2.496  1.00 75.13 ? 194 LYS A CB   2  
ATOM 10304  C CG   . LYS A 1 194 ? -21.653 6.380   -3.213  1.00 73.44 ? 194 LYS A CG   2  
ATOM 10305  C CD   . LYS A 1 194 ? -21.436 6.460   -4.729  1.00 74.42 ? 194 LYS A CD   2  
ATOM 10306  C CE   . LYS A 1 194 ? -19.963 6.205   -5.073  1.00 70.24 ? 194 LYS A CE   2  
ATOM 10307  N NZ   . LYS A 1 194 ? -19.206 7.483   -4.978  1.00 43.44 ? 194 LYS A NZ   2  
ATOM 10308  H H    . LYS A 1 194 ? -22.798 8.966   -2.049  1.00 10.31 ? 194 LYS A H    2  
ATOM 10309  H HA   . LYS A 1 194 ? -21.380 6.820   -0.529  1.00 14.25 ? 194 LYS A HA   2  
ATOM 10310  H HB2  . LYS A 1 194 ? -20.624 8.272   -3.083  1.00 34.44 ? 194 LYS A HB2  2  
ATOM 10311  H HB3  . LYS A 1 194 ? -19.747 6.919   -2.373  1.00 53.40 ? 194 LYS A HB3  2  
ATOM 10312  H HG2  . LYS A 1 194 ? -21.442 5.378   -2.874  1.00 52.14 ? 194 LYS A HG2  2  
ATOM 10313  H HG3  . LYS A 1 194 ? -22.683 6.623   -2.991  1.00 24.24 ? 194 LYS A HG3  2  
ATOM 10314  H HD2  . LYS A 1 194 ? -22.052 5.721   -5.217  1.00 73.34 ? 194 LYS A HD2  2  
ATOM 10315  H HD3  . LYS A 1 194 ? -21.717 7.444   -5.073  1.00 10.21 ? 194 LYS A HD3  2  
ATOM 10316  H HE2  . LYS A 1 194 ? -19.542 5.487   -4.386  1.00 31.52 ? 194 LYS A HE2  2  
ATOM 10317  H HE3  . LYS A 1 194 ? -19.891 5.822   -6.080  1.00 2.14  ? 194 LYS A HE3  2  
ATOM 10318  H HZ1  . LYS A 1 194 ? -18.253 7.352   -5.373  1.00 63.22 ? 194 LYS A HZ1  2  
ATOM 10319  H HZ2  . LYS A 1 194 ? -19.133 7.770   -3.980  1.00 73.53 ? 194 LYS A HZ2  2  
ATOM 10320  H HZ3  . LYS A 1 194 ? -19.704 8.220   -5.516  1.00 75.31 ? 194 LYS A HZ3  2  
ATOM 10321  N N    . MET A 1 195 ? -20.808 9.886   -0.096  1.00 3.10  ? 195 MET A N    2  
ATOM 10322  C CA   . MET A 1 195 ? -19.927 10.895  0.579   1.00 34.00 ? 195 MET A CA   2  
ATOM 10323  C C    . MET A 1 195 ? -20.359 11.076  2.038   1.00 35.10 ? 195 MET A C    2  
ATOM 10324  O O    . MET A 1 195 ? -19.609 11.570  2.856   1.00 62.12 ? 195 MET A O    2  
ATOM 10325  C CB   . MET A 1 195 ? -20.050 12.238  -0.158  1.00 41.31 ? 195 MET A CB   2  
ATOM 10326  C CG   . MET A 1 195 ? -18.881 13.172  0.229   1.00 0.33  ? 195 MET A CG   2  
ATOM 10327  S SD   . MET A 1 195 ? -17.592 13.102  -1.042  1.00 74.02 ? 195 MET A SD   2  
ATOM 10328  C CE   . MET A 1 195 ? -16.816 14.697  -0.680  1.00 4.22  ? 195 MET A CE   2  
ATOM 10329  H H    . MET A 1 195 ? -21.737 10.118  -0.307  1.00 65.43 ? 195 MET A H    2  
ATOM 10330  H HA   . MET A 1 195 ? -18.895 10.570  0.551   1.00 60.24 ? 195 MET A HA   2  
ATOM 10331  H HB2  . MET A 1 195 ? -20.034 12.061  -1.225  1.00 15.13 ? 195 MET A HB2  2  
ATOM 10332  H HB3  . MET A 1 195 ? -20.987 12.706  0.109   1.00 10.20 ? 195 MET A HB3  2  
ATOM 10333  H HG2  . MET A 1 195 ? -19.242 14.186  0.310   1.00 23.42 ? 195 MET A HG2  2  
ATOM 10334  H HG3  . MET A 1 195 ? -18.462 12.868  1.179   1.00 4.31  ? 195 MET A HG3  2  
ATOM 10335  H HE1  . MET A 1 195 ? -16.080 14.916  -1.441  1.00 55.23 ? 195 MET A HE1  2  
ATOM 10336  H HE2  . MET A 1 195 ? -16.332 14.652  0.283   1.00 20.40 ? 195 MET A HE2  2  
ATOM 10337  H HE3  . MET A 1 195 ? -17.572 15.472  -0.667  1.00 24.31 ? 195 MET A HE3  2  
ATOM 10338  N N    . ASP A 1 196 ? -21.564 10.689  2.371   1.00 71.53 ? 196 ASP A N    2  
ATOM 10339  C CA   . ASP A 1 196 ? -22.047 10.848  3.780   1.00 5.54  ? 196 ASP A CA   2  
ATOM 10340  C C    . ASP A 1 196 ? -21.896 9.528   4.542   1.00 60.10 ? 196 ASP A C    2  
ATOM 10341  O O    . ASP A 1 196 ? -22.159 9.459   5.726   1.00 41.22 ? 196 ASP A O    2  
ATOM 10342  C CB   . ASP A 1 196 ? -23.525 11.246  3.760   1.00 22.31 ? 196 ASP A CB   2  
ATOM 10343  C CG   . ASP A 1 196 ? -24.363 10.085  3.214   1.00 74.02 ? 196 ASP A CG   2  
ATOM 10344  O OD1  . ASP A 1 196 ? -24.015 9.572   2.163   1.00 24.54 ? 196 ASP A OD1  2  
ATOM 10345  O OD2  . ASP A 1 196 ? -25.338 9.731   3.856   1.00 3.53  ? 196 ASP A OD2  2  
ATOM 10346  H H    . ASP A 1 196 ? -22.155 10.298  1.694   1.00 63.52 ? 196 ASP A H    2  
ATOM 10347  H HA   . ASP A 1 196 ? -21.479 11.620  4.281   1.00 14.31 ? 196 ASP A HA   2  
ATOM 10348  H HB2  . ASP A 1 196 ? -23.847 11.481  4.765   1.00 61.32 ? 196 ASP A HB2  2  
ATOM 10349  H HB3  . ASP A 1 196 ? -23.657 12.110  3.129   1.00 44.33 ? 196 ASP A HB3  2  
ATOM 10350  N N    . LYS A 1 197 ? -21.495 8.475   3.869   1.00 10.23 ? 197 LYS A N    2  
ATOM 10351  C CA   . LYS A 1 197 ? -21.347 7.144   4.548   1.00 31.04 ? 197 LYS A CA   2  
ATOM 10352  C C    . LYS A 1 197 ? -19.860 6.837   4.821   1.00 73.21 ? 197 LYS A C    2  
ATOM 10353  O O    . LYS A 1 197 ? -19.458 6.754   5.966   1.00 63.23 ? 197 LYS A O    2  
ATOM 10354  C CB   . LYS A 1 197 ? -21.991 6.056   3.664   1.00 75.43 ? 197 LYS A CB   2  
ATOM 10355  C CG   . LYS A 1 197 ? -23.478 5.910   4.018   1.00 33.54 ? 197 LYS A CG   2  
ATOM 10356  C CD   . LYS A 1 197 ? -24.147 4.911   3.065   1.00 20.41 ? 197 LYS A CD   2  
ATOM 10357  C CE   . LYS A 1 197 ? -25.662 5.134   3.071   1.00 10.41 ? 197 LYS A CE   2  
ATOM 10358  N NZ   . LYS A 1 197 ? -25.968 6.483   2.516   1.00 1.11  ? 197 LYS A NZ   2  
ATOM 10359  H H    . LYS A 1 197 ? -21.305 8.556   2.912   1.00 53.53 ? 197 LYS A H    2  
ATOM 10360  H HA   . LYS A 1 197 ? -21.861 7.169   5.504   1.00 13.12 ? 197 LYS A HA   2  
ATOM 10361  H HB2  . LYS A 1 197 ? -21.912 6.345   2.629   1.00 3.10  ? 197 LYS A HB2  2  
ATOM 10362  H HB3  . LYS A 1 197 ? -21.492 5.110   3.819   1.00 41.05 ? 197 LYS A HB3  2  
ATOM 10363  H HG2  . LYS A 1 197 ? -23.571 5.556   5.034   1.00 41.54 ? 197 LYS A HG2  2  
ATOM 10364  H HG3  . LYS A 1 197 ? -23.961 6.874   3.927   1.00 53.11 ? 197 LYS A HG3  2  
ATOM 10365  H HD2  . LYS A 1 197 ? -23.767 5.051   2.062   1.00 41.32 ? 197 LYS A HD2  2  
ATOM 10366  H HD3  . LYS A 1 197 ? -23.932 3.904   3.392   1.00 43.11 ? 197 LYS A HD3  2  
ATOM 10367  H HE2  . LYS A 1 197 ? -26.141 4.378   2.467   1.00 40.22 ? 197 LYS A HE2  2  
ATOM 10368  H HE3  . LYS A 1 197 ? -26.030 5.070   4.085   1.00 14.22 ? 197 LYS A HE3  2  
ATOM 10369  H HZ1  . LYS A 1 197 ? -26.998 6.604   2.442   1.00 61.21 ? 197 LYS A HZ1  2  
ATOM 10370  H HZ2  . LYS A 1 197 ? -25.539 6.575   1.572   1.00 52.10 ? 197 LYS A HZ2  2  
ATOM 10371  H HZ3  . LYS A 1 197 ? -25.580 7.215   3.145   1.00 20.52 ? 197 LYS A HZ3  2  
ATOM 10372  N N    . PRO A 1 198 ? -19.037 6.669   3.807   1.00 15.12 ? 198 PRO A N    2  
ATOM 10373  C CA   . PRO A 1 198 ? -17.582 6.373   4.007   1.00 21.22 ? 198 PRO A CA   2  
ATOM 10374  C C    . PRO A 1 198 ? -16.862 7.504   4.759   1.00 5.35  ? 198 PRO A C    2  
ATOM 10375  O O    . PRO A 1 198 ? -16.266 7.290   5.797   1.00 72.32 ? 198 PRO A O    2  
ATOM 10376  C CB   . PRO A 1 198 ? -17.031 6.232   2.574   1.00 21.14 ? 198 PRO A CB   2  
ATOM 10377  C CG   . PRO A 1 198 ? -18.019 6.953   1.714   1.00 13.33 ? 198 PRO A CG   2  
ATOM 10378  C CD   . PRO A 1 198 ? -19.374 6.731   2.376   1.00 13.13 ? 198 PRO A CD   2  
ATOM 10379  H HA   . PRO A 1 198 ? -17.463 5.442   4.538   1.00 12.00 ? 198 PRO A HA   2  
ATOM 10380  H HB2  . PRO A 1 198 ? -16.050 6.686   2.491   1.00 64.23 ? 198 PRO A HB2  2  
ATOM 10381  H HB3  . PRO A 1 198 ? -16.986 5.190   2.289   1.00 1.24  ? 198 PRO A HB3  2  
ATOM 10382  H HG2  . PRO A 1 198 ? -17.786 8.011   1.681   1.00 34.13 ? 198 PRO A HG2  2  
ATOM 10383  H HG3  . PRO A 1 198 ? -18.028 6.541   0.716   1.00 21.43 ? 198 PRO A HG3  2  
ATOM 10384  H HD2  . PRO A 1 198 ? -20.041 7.555   2.166   1.00 5.23  ? 198 PRO A HD2  2  
ATOM 10385  H HD3  . PRO A 1 198 ? -19.797 5.794   2.051   1.00 15.45 ? 198 PRO A HD3  2  
ATOM 10386  N N    . LEU A 1 199 ? -16.909 8.701   4.239   1.00 42.44 ? 199 LEU A N    2  
ATOM 10387  C CA   . LEU A 1 199 ? -16.225 9.835   4.921   1.00 10.14 ? 199 LEU A CA   2  
ATOM 10388  C C    . LEU A 1 199 ? -16.968 10.170  6.222   1.00 45.30 ? 199 LEU A C    2  
ATOM 10389  O O    . LEU A 1 199 ? -16.364 10.397  7.252   1.00 52.21 ? 199 LEU A O    2  
ATOM 10390  C CB   . LEU A 1 199 ? -16.222 11.061  3.992   1.00 14.11 ? 199 LEU A CB   2  
ATOM 10391  C CG   . LEU A 1 199 ? -15.018 11.005  3.042   1.00 74.54 ? 199 LEU A CG   2  
ATOM 10392  C CD1  . LEU A 1 199 ? -15.073 9.726   2.204   1.00 41.35 ? 199 LEU A CD1  2  
ATOM 10393  C CD2  . LEU A 1 199 ? -15.047 12.225  2.117   1.00 11.32 ? 199 LEU A CD2  2  
ATOM 10394  H H    . LEU A 1 199 ? -17.391 8.852   3.400   1.00 32.04 ? 199 LEU A H    2  
ATOM 10395  H HA   . LEU A 1 199 ? -15.209 9.551   5.154   1.00 64.11 ? 199 LEU A HA   2  
ATOM 10396  H HB2  . LEU A 1 199 ? -17.132 11.071  3.411   1.00 3.12  ? 199 LEU A HB2  2  
ATOM 10397  H HB3  . LEU A 1 199 ? -16.165 11.966  4.581   1.00 30.13 ? 199 LEU A HB3  2  
ATOM 10398  H HG   . LEU A 1 199 ? -14.105 11.013  3.621   1.00 23.50 ? 199 LEU A HG   2  
ATOM 10399  H HD11 . LEU A 1 199 ? -16.032 9.659   1.712   1.00 31.12 ? 199 LEU A HD11 2  
ATOM 10400  H HD12 . LEU A 1 199 ? -14.936 8.868   2.847   1.00 74.32 ? 199 LEU A HD12 2  
ATOM 10401  H HD13 . LEU A 1 199 ? -14.287 9.749   1.463   1.00 32.34 ? 199 LEU A HD13 2  
ATOM 10402  H HD21 . LEU A 1 199 ? -14.080 12.346  1.653   1.00 32.33 ? 199 LEU A HD21 2  
ATOM 10403  H HD22 . LEU A 1 199 ? -15.281 13.108  2.693   1.00 2.24  ? 199 LEU A HD22 2  
ATOM 10404  H HD23 . LEU A 1 199 ? -15.798 12.083  1.352   1.00 44.40 ? 199 LEU A HD23 2  
ATOM 10405  N N    . GLY A 1 200 ? -18.276 10.197  6.183   1.00 61.51 ? 200 GLY A N    2  
ATOM 10406  C CA   . GLY A 1 200 ? -19.062 10.511  7.418   1.00 12.10 ? 200 GLY A CA   2  
ATOM 10407  C C    . GLY A 1 200 ? -19.394 12.008  7.470   1.00 50.01 ? 200 GLY A C    2  
ATOM 10408  O O    . GLY A 1 200 ? -20.371 12.409  8.072   1.00 43.40 ? 200 GLY A O    2  
ATOM 10409  H H    . GLY A 1 200 ? -18.743 10.005  5.342   1.00 24.32 ? 200 GLY A H    2  
ATOM 10410  H HA2  . GLY A 1 200 ? -19.980 9.944   7.409   1.00 20.51 ? 200 GLY A HA2  2  
ATOM 10411  H HA3  . GLY A 1 200 ? -18.488 10.244  8.296   1.00 52.20 ? 200 GLY A HA3  2  
ATOM 10412  N N    . ILE A 1 201 ? -18.588 12.843  6.859   1.00 61.22 ? 201 ILE A N    2  
ATOM 10413  C CA   . ILE A 1 201 ? -18.859 14.319  6.896   1.00 11.40 ? 201 ILE A CA   2  
ATOM 10414  C C    . ILE A 1 201 ? -19.556 14.763  5.608   1.00 1.15  ? 201 ILE A C    2  
ATOM 10415  O O    . ILE A 1 201 ? -19.145 14.422  4.517   1.00 22.41 ? 201 ILE A O    2  
ATOM 10416  C CB   . ILE A 1 201 ? -17.538 15.085  7.024   1.00 40.21 ? 201 ILE A CB   2  
ATOM 10417  C CG1  . ILE A 1 201 ? -16.814 14.673  8.319   1.00 35.35 ? 201 ILE A CG1  2  
ATOM 10418  C CG2  . ILE A 1 201 ? -17.827 16.590  7.065   1.00 43.35 ? 201 ILE A CG2  2  
ATOM 10419  C CD1  . ILE A 1 201 ? -16.236 13.251  8.201   1.00 53.34 ? 201 ILE A CD1  2  
ATOM 10420  H H    . ILE A 1 201 ? -17.797 12.504  6.387   1.00 74.25 ? 201 ILE A H    2  
ATOM 10421  H HA   . ILE A 1 201 ? -19.489 14.558  7.743   1.00 61.02 ? 201 ILE A HA   2  
ATOM 10422  H HB   . ILE A 1 201 ? -16.915 14.870  6.169   1.00 23.05 ? 201 ILE A HB   2  
ATOM 10423  H HG12 . ILE A 1 201 ? -16.010 15.369  8.511   1.00 65.10 ? 201 ILE A HG12 2  
ATOM 10424  H HG13 . ILE A 1 201 ? -17.512 14.704  9.143   1.00 61.00 ? 201 ILE A HG13 2  
ATOM 10425  H HG21 . ILE A 1 201 ? -18.172 16.919  6.095   1.00 1.42  ? 201 ILE A HG21 2  
ATOM 10426  H HG22 . ILE A 1 201 ? -16.925 17.126  7.322   1.00 4.12  ? 201 ILE A HG22 2  
ATOM 10427  H HG23 . ILE A 1 201 ? -18.588 16.793  7.804   1.00 21.24 ? 201 ILE A HG23 2  
ATOM 10428  H HD11 . ILE A 1 201 ? -15.341 13.182  8.799   1.00 2.22  ? 201 ILE A HD11 2  
ATOM 10429  H HD12 . ILE A 1 201 ? -15.994 13.028  7.172   1.00 33.00 ? 201 ILE A HD12 2  
ATOM 10430  H HD13 . ILE A 1 201 ? -16.959 12.537  8.563   1.00 11.20 ? 201 ILE A HD13 2  
ATOM 10431  N N    . SER A 1 202 ? -20.598 15.544  5.734   1.00 40.44 ? 202 SER A N    2  
ATOM 10432  C CA   . SER A 1 202 ? -21.329 16.053  4.531   1.00 72.00 ? 202 SER A CA   2  
ATOM 10433  C C    . SER A 1 202 ? -20.983 17.535  4.355   1.00 32.24 ? 202 SER A C    2  
ATOM 10434  O O    . SER A 1 202 ? -20.890 18.272  5.317   1.00 11.15 ? 202 SER A O    2  
ATOM 10435  C CB   . SER A 1 202 ? -22.836 15.896  4.748   1.00 71.14 ? 202 SER A CB   2  
ATOM 10436  O OG   . SER A 1 202 ? -23.109 14.561  5.158   1.00 14.40 ? 202 SER A OG   2  
ATOM 10437  H H    . SER A 1 202 ? -20.893 15.815  6.628   1.00 15.34 ? 202 SER A H    2  
ATOM 10438  H HA   . SER A 1 202 ? -21.031 15.505  3.648   1.00 30.11 ? 202 SER A HA   2  
ATOM 10439  H HB2  . SER A 1 202 ? -23.167 16.579  5.512   1.00 24.23 ? 202 SER A HB2  2  
ATOM 10440  H HB3  . SER A 1 202 ? -23.354 16.114  3.824   1.00 0.53  ? 202 SER A HB3  2  
ATOM 10441  H HG   . SER A 1 202 ? -22.747 13.969  4.495   1.00 62.44 ? 202 SER A HG   2  
ATOM 10442  N N    . THR A 1 203 ? -20.771 17.978  3.142   1.00 11.35 ? 203 THR A N    2  
ATOM 10443  C CA   . THR A 1 203 ? -20.407 19.414  2.921   1.00 61.41 ? 203 THR A CA   2  
ATOM 10444  C C    . THR A 1 203 ? -21.091 19.942  1.660   1.00 64.45 ? 203 THR A C    2  
ATOM 10445  O O    . THR A 1 203 ? -20.491 20.645  0.872   1.00 3.03  ? 203 THR A O    2  
ATOM 10446  C CB   . THR A 1 203 ? -18.891 19.518  2.750   1.00 74.44 ? 203 THR A CB   2  
ATOM 10447  O OG1  . THR A 1 203 ? -18.542 19.162  1.421   1.00 11.12 ? 203 THR A OG1  2  
ATOM 10448  C CG2  . THR A 1 203 ? -18.199 18.572  3.733   1.00 65.22 ? 203 THR A CG2  2  
ATOM 10449  H H    . THR A 1 203 ? -20.834 17.366  2.379   1.00 0.23  ? 203 THR A H    2  
ATOM 10450  H HA   . THR A 1 203 ? -20.714 20.012  3.768   1.00 63.51 ? 203 THR A HA   2  
ATOM 10451  H HB   . THR A 1 203 ? -18.575 20.527  2.946   1.00 22.04 ? 203 THR A HB   2  
ATOM 10452  H HG1  . THR A 1 203 ? -18.967 19.784  0.824   1.00 3.24  ? 203 THR A HG1  2  
ATOM 10453  H HG21 . THR A 1 203 ? -18.334 17.552  3.408   1.00 71.42 ? 203 THR A HG21 2  
ATOM 10454  H HG22 . THR A 1 203 ? -18.630 18.698  4.715   1.00 43.33 ? 203 THR A HG22 2  
ATOM 10455  H HG23 . THR A 1 203 ? -17.144 18.798  3.769   1.00 74.01 ? 203 THR A HG23 2  
ATOM 10456  N N    . VAL A 1 204 ? -22.343 19.619  1.465   1.00 64.35 ? 204 VAL A N    2  
ATOM 10457  C CA   . VAL A 1 204 ? -23.065 20.110  0.250   1.00 64.12 ? 204 VAL A CA   2  
ATOM 10458  C C    . VAL A 1 204 ? -24.519 20.437  0.609   1.00 24.34 ? 204 VAL A C    2  
ATOM 10459  O O    . VAL A 1 204 ? -25.074 19.904  1.549   1.00 10.42 ? 204 VAL A O    2  
ATOM 10460  C CB   . VAL A 1 204 ? -23.029 19.021  -0.835  1.00 2.34  ? 204 VAL A CB   2  
ATOM 10461  C CG1  . VAL A 1 204 ? -21.707 19.098  -1.606  1.00 51.22 ? 204 VAL A CG1  2  
ATOM 10462  C CG2  . VAL A 1 204 ? -23.150 17.641  -0.176  1.00 55.01 ? 204 VAL A CG2  2  
ATOM 10463  H H    . VAL A 1 204 ? -22.810 19.057  2.117   1.00 65.11 ? 204 VAL A H    2  
ATOM 10464  H HA   . VAL A 1 204 ? -22.589 21.007  -0.121  1.00 1.32  ? 204 VAL A HA   2  
ATOM 10465  H HB   . VAL A 1 204 ? -23.851 19.165  -1.524  1.00 71.13 ? 204 VAL A HB   2  
ATOM 10466  H HG11 . VAL A 1 204 ? -21.717 19.964  -2.250  1.00 2.10  ? 204 VAL A HG11 2  
ATOM 10467  H HG12 . VAL A 1 204 ? -21.587 18.208  -2.204  1.00 1.33  ? 204 VAL A HG12 2  
ATOM 10468  H HG13 . VAL A 1 204 ? -20.887 19.177  -0.909  1.00 23.52 ? 204 VAL A HG13 2  
ATOM 10469  H HG21 . VAL A 1 204 ? -22.205 17.367  0.271   1.00 43.44 ? 204 VAL A HG21 2  
ATOM 10470  H HG22 . VAL A 1 204 ? -23.421 16.910  -0.922  1.00 53.01 ? 204 VAL A HG22 2  
ATOM 10471  H HG23 . VAL A 1 204 ? -23.913 17.671  0.589   1.00 24.42 ? 204 VAL A HG23 2  
ATOM 10472  N N    . GLU A 1 205 ? -25.133 21.314  -0.146  1.00 11.43 ? 205 GLU A N    2  
ATOM 10473  C CA   . GLU A 1 205 ? -26.554 21.701  0.112   1.00 63.31 ? 205 GLU A CA   2  
ATOM 10474  C C    . GLU A 1 205 ? -27.346 21.555  -1.188  1.00 12.14 ? 205 GLU A C    2  
ATOM 10475  O O    . GLU A 1 205 ? -26.910 21.989  -2.236  1.00 54.30 ? 205 GLU A O    2  
ATOM 10476  C CB   . GLU A 1 205 ? -26.608 23.160  0.569   1.00 51.41 ? 205 GLU A CB   2  
ATOM 10477  C CG   . GLU A 1 205 ? -25.802 23.326  1.858   1.00 71.41 ? 205 GLU A CG   2  
ATOM 10478  C CD   . GLU A 1 205 ? -25.801 24.798  2.272   1.00 21.20 ? 205 GLU A CD   2  
ATOM 10479  O OE1  . GLU A 1 205 ? -26.238 25.615  1.478   1.00 4.43  ? 205 GLU A OE1  2  
ATOM 10480  O OE2  . GLU A 1 205 ? -25.364 25.084  3.374   1.00 31.43 ? 205 GLU A OE2  2  
ATOM 10481  H H    . GLU A 1 205 ? -24.653 21.720  -0.898  1.00 23.14 ? 205 GLU A H    2  
ATOM 10482  H HA   . GLU A 1 205 ? -26.987 21.065  0.872   1.00 1.34  ? 205 GLU A HA   2  
ATOM 10483  H HB2  . GLU A 1 205 ? -26.191 23.793  -0.202  1.00 45.45 ? 205 GLU A HB2  2  
ATOM 10484  H HB3  . GLU A 1 205 ? -27.634 23.443  0.749   1.00 33.14 ? 205 GLU A HB3  2  
ATOM 10485  H HG2  . GLU A 1 205 ? -26.247 22.729  2.641   1.00 73.51 ? 205 GLU A HG2  2  
ATOM 10486  H HG3  . GLU A 1 205 ? -24.786 23.000  1.691   1.00 72.12 ? 205 GLU A HG3  2  
ATOM 10487  N N    . THR A 1 206 ? -28.509 20.956  -1.137  1.00 63.03 ? 206 THR A N    2  
ATOM 10488  C CA   . THR A 1 206 ? -29.324 20.797  -2.381  1.00 73.52 ? 206 THR A CA   2  
ATOM 10489  C C    . THR A 1 206 ? -30.330 21.947  -2.476  1.00 24.45 ? 206 THR A C    2  
ATOM 10490  O O    . THR A 1 206 ? -31.000 22.282  -1.521  1.00 1.11  ? 206 THR A O    2  
ATOM 10491  C CB   . THR A 1 206 ? -30.072 19.455  -2.350  1.00 35.35 ? 206 THR A CB   2  
ATOM 10492  O OG1  . THR A 1 206 ? -31.063 19.444  -3.368  1.00 10.41 ? 206 THR A OG1  2  
ATOM 10493  C CG2  . THR A 1 206 ? -30.740 19.237  -0.989  1.00 21.42 ? 206 THR A CG2  2  
ATOM 10494  H H    . THR A 1 206 ? -28.849 20.617  -0.283  1.00 60.33 ? 206 THR A H    2  
ATOM 10495  H HA   . THR A 1 206 ? -28.676 20.820  -3.249  1.00 21.11 ? 206 THR A HA   2  
ATOM 10496  H HB   . THR A 1 206 ? -29.372 18.654  -2.527  1.00 70.41 ? 206 THR A HB   2  
ATOM 10497  H HG1  . THR A 1 206 ? -31.621 18.674  -3.231  1.00 33.33 ? 206 THR A HG1  2  
ATOM 10498  H HG21 . THR A 1 206 ? -31.158 20.165  -0.635  1.00 61.31 ? 206 THR A HG21 2  
ATOM 10499  H HG22 . THR A 1 206 ? -30.008 18.878  -0.281  1.00 71.32 ? 206 THR A HG22 2  
ATOM 10500  H HG23 . THR A 1 206 ? -31.528 18.505  -1.091  1.00 2.12  ? 206 THR A HG23 2  
ATOM 10501  N N    . VAL A 1 207 ? -30.443 22.564  -3.621  1.00 71.02 ? 207 VAL A N    2  
ATOM 10502  C CA   . VAL A 1 207 ? -31.411 23.689  -3.759  1.00 3.25  ? 207 VAL A CA   2  
ATOM 10503  C C    . VAL A 1 207 ? -31.800 23.851  -5.228  1.00 2.25  ? 207 VAL A C    2  
ATOM 10504  O O    . VAL A 1 207 ? -30.993 23.682  -6.120  1.00 32.44 ? 207 VAL A O    2  
ATOM 10505  C CB   . VAL A 1 207 ? -30.780 24.982  -3.235  1.00 12.00 ? 207 VAL A CB   2  
ATOM 10506  C CG1  . VAL A 1 207 ? -29.628 25.404  -4.152  1.00 41.33 ? 207 VAL A CG1  2  
ATOM 10507  C CG2  . VAL A 1 207 ? -31.845 26.087  -3.193  1.00 21.05 ? 207 VAL A CG2  2  
ATOM 10508  H H    . VAL A 1 207 ? -29.894 22.289  -4.386  1.00 64.44 ? 207 VAL A H    2  
ATOM 10509  H HA   . VAL A 1 207 ? -32.296 23.467  -3.185  1.00 3.40  ? 207 VAL A HA   2  
ATOM 10510  H HB   . VAL A 1 207 ? -30.398 24.813  -2.239  1.00 61.22 ? 207 VAL A HB   2  
ATOM 10511  H HG11 . VAL A 1 207 ? -30.022 25.914  -5.014  1.00 52.22 ? 207 VAL A HG11 2  
ATOM 10512  H HG12 . VAL A 1 207 ? -29.077 24.530  -4.473  1.00 25.53 ? 207 VAL A HG12 2  
ATOM 10513  H HG13 . VAL A 1 207 ? -28.968 26.066  -3.616  1.00 72.15 ? 207 VAL A HG13 2  
ATOM 10514  H HG21 . VAL A 1 207 ? -32.215 26.270  -4.192  1.00 30.33 ? 207 VAL A HG21 2  
ATOM 10515  H HG22 . VAL A 1 207 ? -31.411 26.993  -2.800  1.00 54.43 ? 207 VAL A HG22 2  
ATOM 10516  H HG23 . VAL A 1 207 ? -32.661 25.775  -2.557  1.00 55.33 ? 207 VAL A HG23 2  
ATOM 10517  N N    . ARG A 1 208 ? -33.038 24.172  -5.484  1.00 32.10 ? 208 ARG A N    2  
ATOM 10518  C CA   . ARG A 1 208 ? -33.490 24.341  -6.891  1.00 44.20 ? 208 ARG A CA   2  
ATOM 10519  C C    . ARG A 1 208 ? -32.764 25.529  -7.522  1.00 51.41 ? 208 ARG A C    2  
ATOM 10520  O O    . ARG A 1 208 ? -32.349 25.481  -8.662  1.00 32.02 ? 208 ARG A O    2  
ATOM 10521  C CB   . ARG A 1 208 ? -34.997 24.598  -6.909  1.00 54.43 ? 208 ARG A CB   2  
ATOM 10522  C CG   . ARG A 1 208 ? -35.721 23.401  -6.293  1.00 63.14 ? 208 ARG A CG   2  
ATOM 10523  C CD   . ARG A 1 208 ? -37.225 23.542  -6.521  1.00 33.15 ? 208 ARG A CD   2  
ATOM 10524  N NE   . ARG A 1 208 ? -37.934 22.425  -5.838  1.00 20.15 ? 208 ARG A NE   2  
ATOM 10525  C CZ   . ARG A 1 208 ? -37.875 21.217  -6.327  1.00 72.12 ? 208 ARG A CZ   2  
ATOM 10526  N NH1  . ARG A 1 208 ? -37.206 20.988  -7.423  1.00 4.45  ? 208 ARG A NH1  2  
ATOM 10527  N NH2  . ARG A 1 208 ? -38.486 20.237  -5.718  1.00 2.25  ? 208 ARG A NH2  2  
ATOM 10528  H H    . ARG A 1 208 ? -33.672 24.299  -4.747  1.00 72.34 ? 208 ARG A H    2  
ATOM 10529  H HA   . ARG A 1 208 ? -33.272 23.443  -7.450  1.00 3.13  ? 208 ARG A HA   2  
ATOM 10530  H HB2  . ARG A 1 208 ? -35.216 25.489  -6.336  1.00 62.52 ? 208 ARG A HB2  2  
ATOM 10531  H HB3  . ARG A 1 208 ? -35.327 24.735  -7.927  1.00 15.24 ? 208 ARG A HB3  2  
ATOM 10532  H HG2  . ARG A 1 208 ? -35.369 22.490  -6.757  1.00 64.00 ? 208 ARG A HG2  2  
ATOM 10533  H HG3  . ARG A 1 208 ? -35.522 23.365  -5.233  1.00 72.40 ? 208 ARG A HG3  2  
ATOM 10534  H HD2  . ARG A 1 208 ? -37.561 24.484  -6.114  1.00 14.01 ? 208 ARG A HD2  2  
ATOM 10535  H HD3  . ARG A 1 208 ? -37.435 23.511  -7.580  1.00 64.24 ? 208 ARG A HD3  2  
ATOM 10536  H HE   . ARG A 1 208 ? -38.440 22.596  -5.016  1.00 14.32 ? 208 ARG A HE   2  
ATOM 10537  H HH11 . ARG A 1 208 ? -36.738 21.739  -7.889  1.00 61.32 ? 208 ARG A HH11 2  
ATOM 10538  H HH12 . ARG A 1 208 ? -37.159 20.061  -7.796  1.00 12.42 ? 208 ARG A HH12 2  
ATOM 10539  H HH21 . ARG A 1 208 ? -38.998 20.413  -4.877  1.00 43.12 ? 208 ARG A HH21 2  
ATOM 10540  H HH22 . ARG A 1 208 ? -38.439 19.310  -6.090  1.00 23.12 ? 208 ARG A HH22 2  
ATOM 10541  N N    . ARG A 1 209 ? -32.607 26.593  -6.786  1.00 34.24 ? 209 ARG A N    2  
ATOM 10542  C CA   . ARG A 1 209 ? -31.907 27.788  -7.338  1.00 53.00 ? 209 ARG A CA   2  
ATOM 10543  C C    . ARG A 1 209 ? -30.493 27.375  -7.779  1.00 34.05 ? 209 ARG A C    2  
ATOM 10544  O O    . ARG A 1 209 ? -29.919 26.449  -7.248  1.00 33.43 ? 209 ARG A O    2  
ATOM 10545  C CB   . ARG A 1 209 ? -31.833 28.876  -6.235  1.00 31.14 ? 209 ARG A CB   2  
ATOM 10546  C CG   . ARG A 1 209 ? -32.131 30.269  -6.817  1.00 55.05 ? 209 ARG A CG   2  
ATOM 10547  C CD   . ARG A 1 209 ? -32.236 31.299  -5.678  1.00 3.25  ? 209 ARG A CD   2  
ATOM 10548  N NE   . ARG A 1 209 ? -31.322 30.917  -4.562  1.00 64.41 ? 209 ARG A NE   2  
ATOM 10549  C CZ   . ARG A 1 209 ? -30.871 31.826  -3.736  1.00 43.21 ? 209 ARG A CZ   2  
ATOM 10550  N NH1  . ARG A 1 209 ? -31.242 33.072  -3.862  1.00 12.45 ? 209 ARG A NH1  2  
ATOM 10551  N NH2  . ARG A 1 209 ? -30.054 31.485  -2.778  1.00 3.24  ? 209 ARG A NH2  2  
ATOM 10552  H H    . ARG A 1 209 ? -32.950 26.608  -5.868  1.00 34.03 ? 209 ARG A H    2  
ATOM 10553  H HA   . ARG A 1 209 ? -32.456 28.158  -8.193  1.00 60.20 ? 209 ARG A HA   2  
ATOM 10554  H HB2  . ARG A 1 209 ? -32.561 28.651  -5.470  1.00 11.31 ? 209 ARG A HB2  2  
ATOM 10555  H HB3  . ARG A 1 209 ? -30.845 28.880  -5.793  1.00 62.32 ? 209 ARG A HB3  2  
ATOM 10556  H HG2  . ARG A 1 209 ? -31.334 30.552  -7.490  1.00 14.23 ? 209 ARG A HG2  2  
ATOM 10557  H HG3  . ARG A 1 209 ? -33.066 30.241  -7.359  1.00 50.30 ? 209 ARG A HG3  2  
ATOM 10558  H HD2  . ARG A 1 209 ? -31.961 32.276  -6.050  1.00 23.11 ? 209 ARG A HD2  2  
ATOM 10559  H HD3  . ARG A 1 209 ? -33.253 31.331  -5.313  1.00 31.54 ? 209 ARG A HD3  2  
ATOM 10560  H HE   . ARG A 1 209 ? -31.054 29.983  -4.448  1.00 71.35 ? 209 ARG A HE   2  
ATOM 10561  H HH11 . ARG A 1 209 ? -31.875 33.335  -4.589  1.00 12.54 ? 209 ARG A HH11 2  
ATOM 10562  H HH12 . ARG A 1 209 ? -30.892 33.763  -3.229  1.00 53.42 ? 209 ARG A HH12 2  
ATOM 10563  H HH21 . ARG A 1 209 ? -29.774 30.530  -2.677  1.00 72.14 ? 209 ARG A HH21 2  
ATOM 10564  H HH22 . ARG A 1 209 ? -29.706 32.178  -2.147  1.00 73.31 ? 209 ARG A HH22 2  
ATOM 10565  N N    . ARG A 1 210 ? -29.929 28.062  -8.738  1.00 62.12 ? 210 ARG A N    2  
ATOM 10566  C CA   . ARG A 1 210 ? -28.549 27.718  -9.206  1.00 71.54 ? 210 ARG A CA   2  
ATOM 10567  C C    . ARG A 1 210 ? -28.406 26.192  -9.328  1.00 1.31  ? 210 ARG A C    2  
ATOM 10568  O O    . ARG A 1 210 ? -28.738 25.606  -10.339 1.00 4.44  ? 210 ARG A O    2  
ATOM 10569  C CB   . ARG A 1 210 ? -27.523 28.258  -8.186  1.00 44.33 ? 210 ARG A CB   2  
ATOM 10570  C CG   . ARG A 1 210 ? -27.115 29.695  -8.540  1.00 4.34  ? 210 ARG A CG   2  
ATOM 10571  C CD   . ARG A 1 210 ? -28.312 30.633  -8.368  1.00 42.43 ? 210 ARG A CD   2  
ATOM 10572  N NE   . ARG A 1 210 ? -27.929 32.010  -8.791  1.00 12.24 ? 210 ARG A NE   2  
ATOM 10573  C CZ   . ARG A 1 210 ? -28.854 32.878  -9.101  1.00 55.34 ? 210 ARG A CZ   2  
ATOM 10574  N NH1  . ARG A 1 210 ? -30.113 32.541  -9.034  1.00 61.10 ? 210 ARG A NH1  2  
ATOM 10575  N NH2  . ARG A 1 210 ? -28.521 34.083  -9.479  1.00 1.53  ? 210 ARG A NH2  2  
ATOM 10576  H H    . ARG A 1 210 ? -30.408 28.810  -9.148  1.00 41.41 ? 210 ARG A H    2  
ATOM 10577  H HA   . ARG A 1 210 ? -28.376 28.167  -10.172 1.00 33.12 ? 210 ARG A HA   2  
ATOM 10578  H HB2  . ARG A 1 210 ? -27.966 28.248  -7.201  1.00 34.11 ? 210 ARG A HB2  2  
ATOM 10579  H HB3  . ARG A 1 210 ? -26.642 27.632  -8.185  1.00 43.44 ? 210 ARG A HB3  2  
ATOM 10580  H HG2  . ARG A 1 210 ? -26.315 30.010  -7.885  1.00 50.11 ? 210 ARG A HG2  2  
ATOM 10581  H HG3  . ARG A 1 210 ? -26.774 29.733  -9.564  1.00 35.14 ? 210 ARG A HG3  2  
ATOM 10582  H HD2  . ARG A 1 210 ? -29.131 30.286  -8.978  1.00 41.04 ? 210 ARG A HD2  2  
ATOM 10583  H HD3  . ARG A 1 210 ? -28.615 30.644  -7.331  1.00 33.32 ? 210 ARG A HD3  2  
ATOM 10584  H HE   . ARG A 1 210 ? -26.984 32.263  -8.838  1.00 4.05  ? 210 ARG A HE   2  
ATOM 10585  H HH11 . ARG A 1 210 ? -30.368 31.619  -8.745  1.00 41.12 ? 210 ARG A HH11 2  
ATOM 10586  H HH12 . ARG A 1 210 ? -30.822 33.206  -9.269  1.00 61.34 ? 210 ARG A HH12 2  
ATOM 10587  H HH21 . ARG A 1 210 ? -27.557 34.342  -9.531  1.00 70.45 ? 210 ARG A HH21 2  
ATOM 10588  H HH22 . ARG A 1 210 ? -29.231 34.747  -9.715  1.00 20.34 ? 210 ARG A HH22 2  
ATOM 10589  N N    . GLY A 1 211 ? -27.911 25.554  -8.301  1.00 70.25 ? 211 GLY A N    2  
ATOM 10590  C CA   . GLY A 1 211 ? -27.741 24.073  -8.344  1.00 50.11 ? 211 GLY A CA   2  
ATOM 10591  C C    . GLY A 1 211 ? -27.350 23.564  -6.955  1.00 42.11 ? 211 GLY A C    2  
ATOM 10592  O O    . GLY A 1 211 ? -28.120 23.646  -6.017  1.00 72.03 ? 211 GLY A O    2  
ATOM 10593  H H    . GLY A 1 211 ? -27.650 26.052  -7.498  1.00 74.45 ? 211 GLY A H    2  
ATOM 10594  H HA2  . GLY A 1 211 ? -28.669 23.612  -8.651  1.00 11.50 ? 211 GLY A HA2  2  
ATOM 10595  H HA3  . GLY A 1 211 ? -26.963 23.819  -9.049  1.00 4.15  ? 211 GLY A HA3  2  
ATOM 10596  N N    . TYR A 1 212 ? -26.154 23.043  -6.816  1.00 2.30  ? 212 TYR A N    2  
ATOM 10597  C CA   . TYR A 1 212 ? -25.689 22.525  -5.489  1.00 51.34 ? 212 TYR A CA   2  
ATOM 10598  C C    . TYR A 1 212 ? -24.580 23.440  -4.955  1.00 40.43 ? 212 TYR A C    2  
ATOM 10599  O O    . TYR A 1 212 ? -23.736 23.901  -5.699  1.00 11.34 ? 212 TYR A O    2  
ATOM 10600  C CB   . TYR A 1 212 ? -25.128 21.111  -5.669  1.00 75.54 ? 212 TYR A CB   2  
ATOM 10601  C CG   . TYR A 1 212 ? -26.244 20.158  -6.038  1.00 64.21 ? 212 TYR A CG   2  
ATOM 10602  C CD1  . TYR A 1 212 ? -26.956 19.492  -5.035  1.00 3.44  ? 212 TYR A CD1  2  
ATOM 10603  C CD2  . TYR A 1 212 ? -26.560 19.937  -7.385  1.00 73.20 ? 212 TYR A CD2  2  
ATOM 10604  C CE1  . TYR A 1 212 ? -27.986 18.607  -5.378  1.00 43.34 ? 212 TYR A CE1  2  
ATOM 10605  C CE2  . TYR A 1 212 ? -27.588 19.051  -7.725  1.00 51.53 ? 212 TYR A CE2  2  
ATOM 10606  C CZ   . TYR A 1 212 ? -28.301 18.386  -6.721  1.00 50.15 ? 212 TYR A CZ   2  
ATOM 10607  O OH   . TYR A 1 212 ? -29.312 17.509  -7.055  1.00 61.34 ? 212 TYR A OH   2  
ATOM 10608  H H    . TYR A 1 212 ? -25.553 22.995  -7.591  1.00 0.53  ? 212 TYR A H    2  
ATOM 10609  H HA   . TYR A 1 212 ? -26.513 22.501  -4.783  1.00 21.22 ? 212 TYR A HA   2  
ATOM 10610  H HB2  . TYR A 1 212 ? -24.388 21.118  -6.456  1.00 65.13 ? 212 TYR A HB2  2  
ATOM 10611  H HB3  . TYR A 1 212 ? -24.669 20.786  -4.747  1.00 24.23 ? 212 TYR A HB3  2  
ATOM 10612  H HD1  . TYR A 1 212 ? -26.713 19.662  -3.996  1.00 43.40 ? 212 TYR A HD1  2  
ATOM 10613  H HD2  . TYR A 1 212 ? -26.009 20.449  -8.161  1.00 13.45 ? 212 TYR A HD2  2  
ATOM 10614  H HE1  . TYR A 1 212 ? -28.535 18.092  -4.606  1.00 4.34  ? 212 TYR A HE1  2  
ATOM 10615  H HE2  . TYR A 1 212 ? -27.832 18.880  -8.762  1.00 65.31 ? 212 TYR A HE2  2  
ATOM 10616  H HH   . TYR A 1 212 ? -30.074 18.023  -7.330  1.00 44.45 ? 212 TYR A HH   2  
ATOM 10617  N N    . ARG A 1 213 ? -24.578 23.710  -3.670  1.00 13.20 ? 213 ARG A N    2  
ATOM 10618  C CA   . ARG A 1 213 ? -23.528 24.602  -3.076  1.00 41.11 ? 213 ARG A CA   2  
ATOM 10619  C C    . ARG A 1 213 ? -22.516 23.757  -2.291  1.00 11.22 ? 213 ARG A C    2  
ATOM 10620  O O    . ARG A 1 213 ? -22.874 22.802  -1.632  1.00 75.31 ? 213 ARG A O    2  
ATOM 10621  C CB   . ARG A 1 213 ? -24.193 25.607  -2.121  1.00 21.20 ? 213 ARG A CB   2  
ATOM 10622  C CG   . ARG A 1 213 ? -25.544 26.042  -2.688  1.00 43.00 ? 213 ARG A CG   2  
ATOM 10623  C CD   . ARG A 1 213 ? -26.172 27.087  -1.766  1.00 11.31 ? 213 ARG A CD   2  
ATOM 10624  N NE   . ARG A 1 213 ? -27.316 27.730  -2.467  1.00 11.25 ? 213 ARG A NE   2  
ATOM 10625  C CZ   . ARG A 1 213 ? -27.785 28.874  -2.050  1.00 43.55 ? 213 ARG A CZ   2  
ATOM 10626  N NH1  . ARG A 1 213 ? -27.261 29.455  -1.005  1.00 13.25 ? 213 ARG A NH1  2  
ATOM 10627  N NH2  . ARG A 1 213 ? -28.780 29.434  -2.681  1.00 15.41 ? 213 ARG A NH2  2  
ATOM 10628  H H    . ARG A 1 213 ? -25.272 23.328  -3.094  1.00 73.54 ? 213 ARG A H    2  
ATOM 10629  H HA   . ARG A 1 213 ? -23.012 25.141  -3.859  1.00 60.32 ? 213 ARG A HA   2  
ATOM 10630  H HB2  . ARG A 1 213 ? -24.344 25.149  -1.152  1.00 3.10  ? 213 ARG A HB2  2  
ATOM 10631  H HB3  . ARG A 1 213 ? -23.557 26.473  -2.012  1.00 25.30 ? 213 ARG A HB3  2  
ATOM 10632  H HG2  . ARG A 1 213 ? -25.405 26.467  -3.671  1.00 11.52 ? 213 ARG A HG2  2  
ATOM 10633  H HG3  . ARG A 1 213 ? -26.202 25.187  -2.754  1.00 75.24 ? 213 ARG A HG3  2  
ATOM 10634  H HD2  . ARG A 1 213 ? -26.524 26.606  -0.864  1.00 23.54 ? 213 ARG A HD2  2  
ATOM 10635  H HD3  . ARG A 1 213 ? -25.436 27.834  -1.513  1.00 70.13 ? 213 ARG A HD3  2  
ATOM 10636  H HE   . ARG A 1 213 ? -27.716 27.296  -3.248  1.00 72.31 ? 213 ARG A HE   2  
ATOM 10637  H HH11 . ARG A 1 213 ? -26.499 29.024  -0.522  1.00 4.11  ? 213 ARG A HH11 2  
ATOM 10638  H HH12 . ARG A 1 213 ? -27.620 30.334  -0.690  1.00 32.52 ? 213 ARG A HH12 2  
ATOM 10639  H HH21 . ARG A 1 213 ? -29.179 28.986  -3.481  1.00 63.34 ? 213 ARG A HH21 2  
ATOM 10640  H HH22 . ARG A 1 213 ? -29.142 30.312  -2.367  1.00 42.43 ? 213 ARG A HH22 2  
ATOM 10641  N N    . PHE A 1 214 ? -21.257 24.119  -2.346  1.00 53.44 ? 214 PHE A N    2  
ATOM 10642  C CA   . PHE A 1 214 ? -20.203 23.362  -1.594  1.00 4.21  ? 214 PHE A CA   2  
ATOM 10643  C C    . PHE A 1 214 ? -19.600 24.290  -0.537  1.00 11.51 ? 214 PHE A C    2  
ATOM 10644  O O    . PHE A 1 214 ? -18.953 25.266  -0.856  1.00 74.00 ? 214 PHE A O    2  
ATOM 10645  C CB   . PHE A 1 214 ? -19.113 22.904  -2.573  1.00 64.21 ? 214 PHE A CB   2  
ATOM 10646  C CG   . PHE A 1 214 ? -19.566 21.646  -3.281  1.00 60.21 ? 214 PHE A CG   2  
ATOM 10647  C CD1  . PHE A 1 214 ? -20.470 21.729  -4.348  1.00 43.32 ? 214 PHE A CD1  2  
ATOM 10648  C CD2  . PHE A 1 214 ? -19.086 20.396  -2.866  1.00 75.41 ? 214 PHE A CD2  2  
ATOM 10649  C CE1  . PHE A 1 214 ? -20.894 20.563  -4.998  1.00 15.02 ? 214 PHE A CE1  2  
ATOM 10650  C CE2  . PHE A 1 214 ? -19.509 19.233  -3.518  1.00 42.31 ? 214 PHE A CE2  2  
ATOM 10651  C CZ   . PHE A 1 214 ? -20.413 19.315  -4.584  1.00 54.32 ? 214 PHE A CZ   2  
ATOM 10652  H H    . PHE A 1 214 ? -21.002 24.903  -2.877  1.00 73.11 ? 214 PHE A H    2  
ATOM 10653  H HA   . PHE A 1 214 ? -20.635 22.501  -1.102  1.00 3.42  ? 214 PHE A HA   2  
ATOM 10654  H HB2  . PHE A 1 214 ? -18.937 23.681  -3.302  1.00 60.23 ? 214 PHE A HB2  2  
ATOM 10655  H HB3  . PHE A 1 214 ? -18.199 22.702  -2.034  1.00 32.12 ? 214 PHE A HB3  2  
ATOM 10656  H HD1  . PHE A 1 214 ? -20.841 22.692  -4.668  1.00 74.22 ? 214 PHE A HD1  2  
ATOM 10657  H HD2  . PHE A 1 214 ? -18.389 20.329  -2.045  1.00 2.44  ? 214 PHE A HD2  2  
ATOM 10658  H HE1  . PHE A 1 214 ? -21.592 20.625  -5.821  1.00 51.34 ? 214 PHE A HE1  2  
ATOM 10659  H HE2  . PHE A 1 214 ? -19.139 18.270  -3.197  1.00 34.52 ? 214 PHE A HE2  2  
ATOM 10660  H HZ   . PHE A 1 214 ? -20.740 18.417  -5.086  1.00 43.13 ? 214 PHE A HZ   2  
ATOM 10661  N N    . CYS A 1 215 ? -19.827 23.996  0.722   1.00 2.24  ? 215 CYS A N    2  
ATOM 10662  C CA   . CYS A 1 215 ? -19.291 24.858  1.826   1.00 32.42 ? 215 CYS A CA   2  
ATOM 10663  C C    . CYS A 1 215 ? -18.351 24.040  2.714   1.00 34.01 ? 215 CYS A C    2  
ATOM 10664  O O    . CYS A 1 215 ? -18.384 22.828  2.720   1.00 34.11 ? 215 CYS A O    2  
ATOM 10665  C CB   . CYS A 1 215 ? -20.460 25.367  2.670   1.00 22.41 ? 215 CYS A CB   2  
ATOM 10666  S SG   . CYS A 1 215 ? -21.518 23.977  3.147   1.00 74.14 ? 215 CYS A SG   2  
ATOM 10667  H H    . CYS A 1 215 ? -20.366 23.209  0.944   1.00 34.53 ? 215 CYS A H    2  
ATOM 10668  H HA   . CYS A 1 215 ? -18.752 25.702  1.418   1.00 62.12 ? 215 CYS A HA   2  
ATOM 10669  H HB2  . CYS A 1 215 ? -20.078 25.849  3.556   1.00 64.40 ? 215 CYS A HB2  2  
ATOM 10670  H HB3  . CYS A 1 215 ? -21.036 26.075  2.094   1.00 43.43 ? 215 CYS A HB3  2  
ATOM 10671  H HG   . CYS A 1 215 ? -21.213 23.652  3.999   1.00 73.41 ? 215 CYS A HG   2  
ATOM 10672  N N    . TYR A 1 216 ? -17.513 24.701  3.465   1.00 52.43 ? 216 TYR A N    2  
ATOM 10673  C CA   . TYR A 1 216 ? -16.565 23.976  4.360   1.00 41.13 ? 216 TYR A CA   2  
ATOM 10674  C C    . TYR A 1 216 ? -17.357 23.302  5.500   1.00 13.42 ? 216 TYR A C    2  
ATOM 10675  O O    . TYR A 1 216 ? -18.404 23.780  5.885   1.00 52.15 ? 216 TYR A O    2  
ATOM 10676  C CB   . TYR A 1 216 ? -15.555 24.990  4.924   1.00 50.23 ? 216 TYR A CB   2  
ATOM 10677  C CG   . TYR A 1 216 ? -16.228 25.887  5.939   1.00 53.33 ? 216 TYR A CG   2  
ATOM 10678  C CD1  . TYR A 1 216 ? -16.281 25.500  7.282   1.00 75.32 ? 216 TYR A CD1  2  
ATOM 10679  C CD2  . TYR A 1 216 ? -16.796 27.104  5.538   1.00 64.22 ? 216 TYR A CD2  2  
ATOM 10680  C CE1  . TYR A 1 216 ? -16.898 26.327  8.225   1.00 33.12 ? 216 TYR A CE1  2  
ATOM 10681  C CE2  . TYR A 1 216 ? -17.415 27.933  6.483   1.00 4.33  ? 216 TYR A CE2  2  
ATOM 10682  C CZ   . TYR A 1 216 ? -17.466 27.543  7.826   1.00 51.31 ? 216 TYR A CZ   2  
ATOM 10683  O OH   . TYR A 1 216 ? -18.074 28.357  8.760   1.00 23.24 ? 216 TYR A OH   2  
ATOM 10684  H H    . TYR A 1 216 ? -17.506 25.681  3.442   1.00 24.21 ? 216 TYR A H    2  
ATOM 10685  H HA   . TYR A 1 216 ? -16.042 23.224  3.788   1.00 20.42 ? 216 TYR A HA   2  
ATOM 10686  H HB2  . TYR A 1 216 ? -14.737 24.469  5.396   1.00 64.33 ? 216 TYR A HB2  2  
ATOM 10687  H HB3  . TYR A 1 216 ? -15.171 25.596  4.116   1.00 53.34 ? 216 TYR A HB3  2  
ATOM 10688  H HD1  . TYR A 1 216 ? -15.841 24.562  7.591   1.00 75.13 ? 216 TYR A HD1  2  
ATOM 10689  H HD2  . TYR A 1 216 ? -16.754 27.403  4.502   1.00 3.13  ? 216 TYR A HD2  2  
ATOM 10690  H HE1  . TYR A 1 216 ? -16.938 26.026  9.263   1.00 3.11  ? 216 TYR A HE1  2  
ATOM 10691  H HE2  . TYR A 1 216 ? -17.853 28.872  6.175   1.00 60.14 ? 216 TYR A HE2  2  
ATOM 10692  H HH   . TYR A 1 216 ? -18.441 27.797  9.449   1.00 53.04 ? 216 TYR A HH   2  
ATOM 10693  N N    . PRO A 1 217 ? -16.873 22.199  6.035   1.00 14.15 ? 217 PRO A N    2  
ATOM 10694  C CA   . PRO A 1 217 ? -17.574 21.472  7.135   1.00 42.12 ? 217 PRO A CA   2  
ATOM 10695  C C    . PRO A 1 217 ? -18.253 22.432  8.128   1.00 63.54 ? 217 PRO A C    2  
ATOM 10696  O O    . PRO A 1 217 ? -17.855 23.570  8.269   1.00 35.11 ? 217 PRO A O    2  
ATOM 10697  C CB   . PRO A 1 217 ? -16.448 20.675  7.803   1.00 44.32 ? 217 PRO A CB   2  
ATOM 10698  C CG   . PRO A 1 217 ? -15.460 20.395  6.706   1.00 73.11 ? 217 PRO A CG   2  
ATOM 10699  C CD   . PRO A 1 217 ? -15.610 21.522  5.665   1.00 22.15 ? 217 PRO A CD   2  
ATOM 10700  H HA   . PRO A 1 217 ? -18.299 20.790  6.720   1.00 25.11 ? 217 PRO A HA   2  
ATOM 10701  H HB2  . PRO A 1 217 ? -15.989 21.261  8.590   1.00 32.42 ? 217 PRO A HB2  2  
ATOM 10702  H HB3  . PRO A 1 217 ? -16.830 19.746  8.201   1.00 44.05 ? 217 PRO A HB3  2  
ATOM 10703  H HG2  . PRO A 1 217 ? -14.452 20.386  7.110   1.00 63.23 ? 217 PRO A HG2  2  
ATOM 10704  H HG3  . PRO A 1 217 ? -15.675 19.441  6.243   1.00 11.44 ? 217 PRO A HG3  2  
ATOM 10705  H HD2  . PRO A 1 217 ? -14.776 22.205  5.731   1.00 12.43 ? 217 PRO A HD2  2  
ATOM 10706  H HD3  . PRO A 1 217 ? -15.685 21.112  4.668   1.00 10.34 ? 217 PRO A HD3  2  
ATOM 10707  N N    . LYS A 1 218 ? -19.287 21.985  8.803   1.00 64.34 ? 218 LYS A N    2  
ATOM 10708  C CA   . LYS A 1 218 ? -20.008 22.878  9.772   1.00 13.34 ? 218 LYS A CA   2  
ATOM 10709  C C    . LYS A 1 218 ? -19.573 22.652  11.240  1.00 0.13  ? 218 LYS A C    2  
ATOM 10710  O O    . LYS A 1 218 ? -19.813 23.506  12.069  1.00 22.14 ? 218 LYS A O    2  
ATOM 10711  C CB   . LYS A 1 218 ? -21.524 22.645  9.656   1.00 24.12 ? 218 LYS A CB   2  
ATOM 10712  C CG   . LYS A 1 218 ? -21.842 21.149  9.710   1.00 75.25 ? 218 LYS A CG   2  
ATOM 10713  C CD   . LYS A 1 218 ? -23.340 20.938  9.487   1.00 64.50 ? 218 LYS A CD   2  
ATOM 10714  C CE   . LYS A 1 218 ? -23.616 19.449  9.283   1.00 71.15 ? 218 LYS A CE   2  
ATOM 10715  N NZ   . LYS A 1 218 ? -23.029 19.010  7.986   1.00 35.23 ? 218 LYS A NZ   2  
ATOM 10716  H H    . LYS A 1 218 ? -19.597 21.067  8.663   1.00 2.54  ? 218 LYS A H    2  
ATOM 10717  H HA   . LYS A 1 218 ? -19.807 23.910  9.516   1.00 61.52 ? 218 LYS A HA   2  
ATOM 10718  H HB2  . LYS A 1 218 ? -22.024 23.145  10.473  1.00 45.24 ? 218 LYS A HB2  2  
ATOM 10719  H HB3  . LYS A 1 218 ? -21.878 23.051  8.720   1.00 62.04 ? 218 LYS A HB3  2  
ATOM 10720  H HG2  . LYS A 1 218 ? -21.291 20.634  8.938   1.00 40.22 ? 218 LYS A HG2  2  
ATOM 10721  H HG3  . LYS A 1 218 ? -21.568 20.756  10.678  1.00 75.20 ? 218 LYS A HG3  2  
ATOM 10722  H HD2  . LYS A 1 218 ? -23.886 21.292  10.350  1.00 52.21 ? 218 LYS A HD2  2  
ATOM 10723  H HD3  . LYS A 1 218 ? -23.654 21.485  8.611   1.00 73.21 ? 218 LYS A HD3  2  
ATOM 10724  H HE2  . LYS A 1 218 ? -23.168 18.887  10.089  1.00 30.25 ? 218 LYS A HE2  2  
ATOM 10725  H HE3  . LYS A 1 218 ? -24.683 19.277  9.273   1.00 20.43 ? 218 LYS A HE3  2  
ATOM 10726  H HZ1  . LYS A 1 218 ? -23.143 17.981  7.883   1.00 11.02 ? 218 LYS A HZ1  2  
ATOM 10727  H HZ2  . LYS A 1 218 ? -22.016 19.251  7.967   1.00 14.31 ? 218 LYS A HZ2  2  
ATOM 10728  H HZ3  . LYS A 1 218 ? -23.516 19.490  7.204   1.00 22.20 ? 218 LYS A HZ3  2  
ATOM 10729  N N    . PRO A 1 219 ? -18.961 21.537  11.597  1.00 22.01 ? 219 PRO A N    2  
ATOM 10730  C CA   . PRO A 1 219 ? -18.547 21.290  13.007  1.00 4.44  ? 219 PRO A CA   2  
ATOM 10731  C C    . PRO A 1 219 ? -17.154 21.851  13.312  1.00 75.10 ? 219 PRO A C    2  
ATOM 10732  O O    . PRO A 1 219 ? -16.760 21.986  14.453  1.00 54.14 ? 219 PRO A O    2  
ATOM 10733  C CB   . PRO A 1 219 ? -18.550 19.766  13.085  1.00 73.13 ? 219 PRO A CB   2  
ATOM 10734  C CG   . PRO A 1 219 ? -18.086 19.327  11.731  1.00 22.41 ? 219 PRO A CG   2  
ATOM 10735  C CD   . PRO A 1 219 ? -18.577 20.399  10.737  1.00 34.50 ? 219 PRO A CD   2  
ATOM 10736  H HA   . PRO A 1 219 ? -19.276 21.690  13.691  1.00 21.45 ? 219 PRO A HA   2  
ATOM 10737  H HB2  . PRO A 1 219 ? -17.872 19.422  13.857  1.00 34.41 ? 219 PRO A HB2  2  
ATOM 10738  H HB3  . PRO A 1 219 ? -19.550 19.401  13.271  1.00 61.42 ? 219 PRO A HB3  2  
ATOM 10739  H HG2  . PRO A 1 219 ? -17.003 19.266  11.715  1.00 55.43 ? 219 PRO A HG2  2  
ATOM 10740  H HG3  . PRO A 1 219 ? -18.514 18.367  11.478  1.00 71.32 ? 219 PRO A HG3  2  
ATOM 10741  H HD2  . PRO A 1 219 ? -17.777 20.684  10.069  1.00 61.23 ? 219 PRO A HD2  2  
ATOM 10742  H HD3  . PRO A 1 219 ? -19.428 20.042  10.182  1.00 50.33 ? 219 PRO A HD3  2  
ATOM 10743  N N    . ALA A 1 220 ? -16.407 22.169  12.292  1.00 71.14 ? 220 ALA A N    2  
ATOM 10744  C CA   . ALA A 1 220 ? -15.036 22.713  12.501  1.00 22.54 ? 220 ALA A CA   2  
ATOM 10745  C C    . ALA A 1 220 ? -15.081 23.882  13.490  1.00 22.13 ? 220 ALA A C    2  
ATOM 10746  O O    . ALA A 1 220 ? -14.186 24.058  14.293  1.00 51.50 ? 220 ALA A O    2  
ATOM 10747  C CB   . ALA A 1 220 ? -14.475 23.192  11.158  1.00 4.05  ? 220 ALA A CB   2  
ATOM 10748  H H    . ALA A 1 220 ? -16.748 22.043  11.383  1.00 44.43 ? 220 ALA A H    2  
ATOM 10749  H HA   . ALA A 1 220 ? -14.400 21.936  12.897  1.00 44.31 ? 220 ALA A HA   2  
ATOM 10750  H HB1  . ALA A 1 220 ? -15.252 23.700  10.604  1.00 22.25 ? 220 ALA A HB1  2  
ATOM 10751  H HB2  . ALA A 1 220 ? -14.128 22.341  10.590  1.00 50.14 ? 220 ALA A HB2  2  
ATOM 10752  H HB3  . ALA A 1 220 ? -13.652 23.870  11.327  1.00 44.43 ? 220 ALA A HB3  2  
ATOM 10753  N N    . CYS A 1 221 ? -16.109 24.685  13.442  1.00 52.13 ? 221 CYS A N    2  
ATOM 10754  C CA   . CYS A 1 221 ? -16.193 25.839  14.384  1.00 5.20  ? 221 CYS A CA   2  
ATOM 10755  C C    . CYS A 1 221 ? -16.192 25.325  15.829  1.00 71.13 ? 221 CYS A C    2  
ATOM 10756  O O    . CYS A 1 221 ? -16.871 24.375  16.160  1.00 54.02 ? 221 CYS A O    2  
ATOM 10757  C CB   . CYS A 1 221 ? -17.479 26.628  14.116  1.00 31.14 ? 221 CYS A CB   2  
ATOM 10758  S SG   . CYS A 1 221 ? -18.849 25.478  13.840  1.00 43.24 ? 221 CYS A SG   2  
ATOM 10759  H H    . CYS A 1 221 ? -16.822 24.531  12.788  1.00 31.41 ? 221 CYS A H    2  
ATOM 10760  H HA   . CYS A 1 221 ? -15.339 26.484  14.235  1.00 54.12 ? 221 CYS A HA   2  
ATOM 10761  H HB2  . CYS A 1 221 ? -17.702 27.257  14.966  1.00 11.21 ? 221 CYS A HB2  2  
ATOM 10762  H HB3  . CYS A 1 221 ? -17.346 27.245  13.239  1.00 51.23 ? 221 CYS A HB3  2  
ATOM 10763  H HG   . CYS A 1 221 ? -18.610 24.633  14.227  1.00 3.24  ? 221 CYS A HG   2  
ATOM 10764  N N    . GLU A 1 222 ? -15.429 25.949  16.690  1.00 12.42 ? 222 GLU A N    2  
ATOM 10765  C CA   . GLU A 1 222 ? -15.373 25.504  18.117  1.00 75.35 ? 222 GLU A CA   2  
ATOM 10766  C C    . GLU A 1 222 ? -16.384 26.302  18.946  1.00 64.11 ? 222 GLU A C    2  
ATOM 10767  O O    . GLU A 1 222 ? -17.308 26.889  18.420  1.00 53.15 ? 222 GLU A O    2  
ATOM 10768  C CB   . GLU A 1 222 ? -13.966 25.748  18.667  1.00 2.11  ? 222 GLU A CB   2  
ATOM 10769  C CG   . GLU A 1 222 ? -12.942 25.010  17.802  1.00 34.21 ? 222 GLU A CG   2  
ATOM 10770  C CD   . GLU A 1 222 ? -11.545 25.203  18.392  1.00 64.34 ? 222 GLU A CD   2  
ATOM 10771  O OE1  . GLU A 1 222 ? -11.425 25.954  19.346  1.00 62.53 ? 222 GLU A OE1  2  
ATOM 10772  O OE2  . GLU A 1 222 ? -10.618 24.598  17.880  1.00 4.33  ? 222 GLU A OE2  2  
ATOM 10773  H H    . GLU A 1 222 ? -14.888 26.713  16.398  1.00 42.41 ? 222 GLU A H    2  
ATOM 10774  H HA   . GLU A 1 222 ? -15.607 24.451  18.182  1.00 15.52 ? 222 GLU A HA   2  
ATOM 10775  H HB2  . GLU A 1 222 ? -13.754 26.807  18.655  1.00 1.32  ? 222 GLU A HB2  2  
ATOM 10776  H HB3  . GLU A 1 222 ? -13.909 25.381  19.681  1.00 73.23 ? 222 GLU A HB3  2  
ATOM 10777  H HG2  . GLU A 1 222 ? -13.182 23.957  17.779  1.00 65.45 ? 222 GLU A HG2  2  
ATOM 10778  H HG3  . GLU A 1 222 ? -12.966 25.407  16.798  1.00 61.13 ? 222 GLU A HG3  2  
ATOM 10779  N N    . GLU A 1 223 ? -16.214 26.325  20.241  1.00 73.41 ? 223 GLU A N    2  
ATOM 10780  C CA   . GLU A 1 223 ? -17.164 27.081  21.107  1.00 52.04 ? 223 GLU A CA   2  
ATOM 10781  C C    . GLU A 1 223 ? -18.595 26.642  20.794  1.00 1.53  ? 223 GLU A C    2  
ATOM 10782  O O    . GLU A 1 223 ? -19.505 27.396  21.099  1.00 50.41 ? 223 GLU A O    2  
ATOM 10783  C CB   . GLU A 1 223 ? -17.022 28.582  20.839  1.00 33.00 ? 223 GLU A CB   2  
ATOM 10784  C CG   . GLU A 1 223 ? -15.579 29.016  21.102  1.00 63.43 ? 223 GLU A CG   2  
ATOM 10785  C CD   . GLU A 1 223 ? -15.463 30.533  20.935  1.00 31.23 ? 223 GLU A CD   2  
ATOM 10786  O OE1  . GLU A 1 223 ? -16.431 31.138  20.506  1.00 14.42 ? 223 GLU A OE1  2  
ATOM 10787  O OE2  . GLU A 1 223 ? -14.407 31.065  21.241  1.00 11.11 ? 223 GLU A OE2  2  
ATOM 10788  O OXT  . GLU A 1 223 ? -18.759 25.559  20.257  1.00 0.00  ? 223 GLU A OXT  2  
ATOM 10789  H H    . GLU A 1 223 ? -15.461 25.843  20.644  1.00 42.24 ? 223 GLU A H    2  
ATOM 10790  H HA   . GLU A 1 223 ? -16.944 26.878  22.146  1.00 1.41  ? 223 GLU A HA   2  
ATOM 10791  H HB2  . GLU A 1 223 ? -17.279 28.789  19.810  1.00 40.15 ? 223 GLU A HB2  2  
ATOM 10792  H HB3  . GLU A 1 223 ? -17.685 29.129  21.492  1.00 33.30 ? 223 GLU A HB3  2  
ATOM 10793  H HG2  . GLU A 1 223 ? -15.298 28.741  22.108  1.00 13.32 ? 223 GLU A HG2  2  
ATOM 10794  H HG3  . GLU A 1 223 ? -14.922 28.528  20.398  1.00 12.35 ? 223 GLU A HG3  2  
ATOM 10795  N N    . MET B 1 1   ? 16.836  25.474  -22.653 1.00 44.41 ? 1   MET B N    2  
ATOM 10796  C CA   . MET B 1 1   ? 17.566  24.972  -21.455 1.00 11.23 ? 1   MET B CA   2  
ATOM 10797  C C    . MET B 1 1   ? 19.042  24.769  -21.806 1.00 1.11  ? 1   MET B C    2  
ATOM 10798  O O    . MET B 1 1   ? 19.441  24.885  -22.948 1.00 71.14 ? 1   MET B O    2  
ATOM 10799  C CB   . MET B 1 1   ? 16.955  23.639  -21.006 1.00 33.15 ? 1   MET B CB   2  
ATOM 10800  C CG   . MET B 1 1   ? 16.612  22.786  -22.233 1.00 32.41 ? 1   MET B CG   2  
ATOM 10801  S SD   . MET B 1 1   ? 15.033  23.337  -22.927 1.00 32.40 ? 1   MET B SD   2  
ATOM 10802  C CE   . MET B 1 1   ? 13.957  22.334  -21.872 1.00 44.52 ? 1   MET B CE   2  
ATOM 10803  H H1   . MET B 1 1   ? 16.862  24.754  -23.402 1.00 0.00  ? 1   MET B H1   2  
ATOM 10804  H H2   . MET B 1 1   ? 17.288  26.347  -22.994 1.00 0.00  ? 1   MET B H2   2  
ATOM 10805  H H3   . MET B 1 1   ? 15.847  25.671  -22.400 1.00 0.00  ? 1   MET B H3   2  
ATOM 10806  H HA   . MET B 1 1   ? 17.482  25.693  -20.655 1.00 61.22 ? 1   MET B HA   2  
ATOM 10807  H HB2  . MET B 1 1   ? 17.660  23.106  -20.383 1.00 62.01 ? 1   MET B HB2  2  
ATOM 10808  H HB3  . MET B 1 1   ? 16.054  23.830  -20.443 1.00 55.24 ? 1   MET B HB3  2  
ATOM 10809  H HG2  . MET B 1 1   ? 17.388  22.889  -22.978 1.00 75.24 ? 1   MET B HG2  2  
ATOM 10810  H HG3  . MET B 1 1   ? 16.532  21.750  -21.939 1.00 40.44 ? 1   MET B HG3  2  
ATOM 10811  H HE1  . MET B 1 1   ? 14.229  21.292  -21.970 1.00 70.12 ? 1   MET B HE1  2  
ATOM 10812  H HE2  . MET B 1 1   ? 12.931  22.465  -22.175 1.00 34.05 ? 1   MET B HE2  2  
ATOM 10813  H HE3  . MET B 1 1   ? 14.070  22.646  -20.843 1.00 35.03 ? 1   MET B HE3  2  
ATOM 10814  N N    . ARG B 1 2   ? 19.857  24.467  -20.827 1.00 73.23 ? 2   ARG B N    2  
ATOM 10815  C CA   . ARG B 1 2   ? 21.314  24.251  -21.087 1.00 64.32 ? 2   ARG B CA   2  
ATOM 10816  C C    . ARG B 1 2   ? 21.804  23.067  -20.242 1.00 12.34 ? 2   ARG B C    2  
ATOM 10817  O O    . ARG B 1 2   ? 21.306  22.803  -19.158 1.00 73.05 ? 2   ARG B O    2  
ATOM 10818  C CB   . ARG B 1 2   ? 22.089  25.543  -20.729 1.00 63.20 ? 2   ARG B CB   2  
ATOM 10819  C CG   . ARG B 1 2   ? 23.518  25.223  -20.254 1.00 72.32 ? 2   ARG B CG   2  
ATOM 10820  C CD   . ARG B 1 2   ? 24.340  26.507  -20.171 1.00 12.14 ? 2   ARG B CD   2  
ATOM 10821  N NE   . ARG B 1 2   ? 23.701  27.450  -19.213 1.00 14.32 ? 2   ARG B NE   2  
ATOM 10822  C CZ   . ARG B 1 2   ? 24.413  28.389  -18.652 1.00 4.14  ? 2   ARG B CZ   2  
ATOM 10823  N NH1  . ARG B 1 2   ? 25.680  28.510  -18.943 1.00 5.51  ? 2   ARG B NH1  2  
ATOM 10824  N NH2  . ARG B 1 2   ? 23.860  29.206  -17.805 1.00 70.23 ? 2   ARG B NH2  2  
ATOM 10825  H H    . ARG B 1 2   ? 19.508  24.379  -19.916 1.00 73.52 ? 2   ARG B H    2  
ATOM 10826  H HA   . ARG B 1 2   ? 21.469  24.020  -22.133 1.00 60.10 ? 2   ARG B HA   2  
ATOM 10827  H HB2  . ARG B 1 2   ? 22.142  26.179  -21.601 1.00 11.03 ? 2   ARG B HB2  2  
ATOM 10828  H HB3  . ARG B 1 2   ? 21.565  26.065  -19.948 1.00 64.14 ? 2   ARG B HB3  2  
ATOM 10829  H HG2  . ARG B 1 2   ? 23.479  24.765  -19.276 1.00 63.42 ? 2   ARG B HG2  2  
ATOM 10830  H HG3  . ARG B 1 2   ? 23.985  24.544  -20.951 1.00 54.24 ? 2   ARG B HG3  2  
ATOM 10831  H HD2  . ARG B 1 2   ? 25.334  26.268  -19.826 1.00 1.35  ? 2   ARG B HD2  2  
ATOM 10832  H HD3  . ARG B 1 2   ? 24.397  26.966  -21.146 1.00 51.04 ? 2   ARG B HD3  2  
ATOM 10833  H HE   . ARG B 1 2   ? 22.749  27.362  -18.999 1.00 31.13 ? 2   ARG B HE   2  
ATOM 10834  H HH11 . ARG B 1 2   ? 26.106  27.884  -19.595 1.00 33.42 ? 2   ARG B HH11 2  
ATOM 10835  H HH12 . ARG B 1 2   ? 26.225  29.230  -18.513 1.00 72.31 ? 2   ARG B HH12 2  
ATOM 10836  H HH21 . ARG B 1 2   ? 22.891  29.115  -17.583 1.00 32.45 ? 2   ARG B HH21 2  
ATOM 10837  H HH22 . ARG B 1 2   ? 24.405  29.926  -17.375 1.00 73.32 ? 2   ARG B HH22 2  
ATOM 10838  N N    . VAL B 1 3   ? 22.800  22.369  -20.737 1.00 72.24 ? 3   VAL B N    2  
ATOM 10839  C CA   . VAL B 1 3   ? 23.377  21.209  -19.994 1.00 24.25 ? 3   VAL B CA   2  
ATOM 10840  C C    . VAL B 1 3   ? 24.828  21.532  -19.640 1.00 34.51 ? 3   VAL B C    2  
ATOM 10841  O O    . VAL B 1 3   ? 25.601  21.960  -20.474 1.00 55.33 ? 3   VAL B O    2  
ATOM 10842  C CB   . VAL B 1 3   ? 23.323  19.958  -20.874 1.00 1.23  ? 3   VAL B CB   2  
ATOM 10843  C CG1  . VAL B 1 3   ? 24.014  18.797  -20.155 1.00 0.21  ? 3   VAL B CG1  2  
ATOM 10844  C CG2  . VAL B 1 3   ? 21.861  19.591  -21.144 1.00 33.31 ? 3   VAL B CG2  2  
ATOM 10845  H H    . VAL B 1 3   ? 23.181  22.624  -21.603 1.00 43.44 ? 3   VAL B H    2  
ATOM 10846  H HA   . VAL B 1 3   ? 22.823  21.037  -19.086 1.00 12.11 ? 3   VAL B HA   2  
ATOM 10847  H HB   . VAL B 1 3   ? 23.827  20.153  -21.809 1.00 43.12 ? 3   VAL B HB   2  
ATOM 10848  H HG11 . VAL B 1 3   ? 25.080  18.960  -20.153 1.00 11.45 ? 3   VAL B HG11 2  
ATOM 10849  H HG12 . VAL B 1 3   ? 23.792  17.873  -20.669 1.00 53.53 ? 3   VAL B HG12 2  
ATOM 10850  H HG13 . VAL B 1 3   ? 23.657  18.739  -19.138 1.00 71.13 ? 3   VAL B HG13 2  
ATOM 10851  H HG21 . VAL B 1 3   ? 21.295  19.661  -20.227 1.00 61.43 ? 3   VAL B HG21 2  
ATOM 10852  H HG22 . VAL B 1 3   ? 21.806  18.580  -21.522 1.00 5.14  ? 3   VAL B HG22 2  
ATOM 10853  H HG23 . VAL B 1 3   ? 21.448  20.271  -21.875 1.00 64.53 ? 3   VAL B HG23 2  
ATOM 10854  N N    . LEU B 1 4   ? 25.193  21.354  -18.398 1.00 51.44 ? 4   LEU B N    2  
ATOM 10855  C CA   . LEU B 1 4   ? 26.589  21.672  -17.958 1.00 31.34 ? 4   LEU B CA   2  
ATOM 10856  C C    . LEU B 1 4   ? 27.407  20.380  -17.833 1.00 21.40 ? 4   LEU B C    2  
ATOM 10857  O O    . LEU B 1 4   ? 27.108  19.525  -17.030 1.00 5.24  ? 4   LEU B O    2  
ATOM 10858  C CB   . LEU B 1 4   ? 26.492  22.400  -16.601 1.00 44.25 ? 4   LEU B CB   2  
ATOM 10859  C CG   . LEU B 1 4   ? 27.789  22.281  -15.781 1.00 54.33 ? 4   LEU B CG   2  
ATOM 10860  C CD1  . LEU B 1 4   ? 28.982  22.797  -16.607 1.00 21.41 ? 4   LEU B CD1  2  
ATOM 10861  C CD2  . LEU B 1 4   ? 27.645  23.128  -14.511 1.00 33.12 ? 4   LEU B CD2  2  
ATOM 10862  H H    . LEU B 1 4   ? 24.539  21.023  -17.742 1.00 14.40 ? 4   LEU B H    2  
ATOM 10863  H HA   . LEU B 1 4   ? 27.064  22.326  -18.677 1.00 4.53  ? 4   LEU B HA   2  
ATOM 10864  H HB2  . LEU B 1 4   ? 26.286  23.445  -16.778 1.00 24.44 ? 4   LEU B HB2  2  
ATOM 10865  H HB3  . LEU B 1 4   ? 25.680  21.978  -16.038 1.00 21.34 ? 4   LEU B HB3  2  
ATOM 10866  H HG   . LEU B 1 4   ? 27.952  21.243  -15.501 1.00 61.33 ? 4   LEU B HG   2  
ATOM 10867  H HD11 . LEU B 1 4   ? 29.775  23.114  -15.945 1.00 2.03  ? 4   LEU B HD11 2  
ATOM 10868  H HD12 . LEU B 1 4   ? 28.669  23.636  -17.213 1.00 52.21 ? 4   LEU B HD12 2  
ATOM 10869  H HD13 . LEU B 1 4   ? 29.346  22.010  -17.247 1.00 25.50 ? 4   LEU B HD13 2  
ATOM 10870  H HD21 . LEU B 1 4   ? 26.929  22.665  -13.849 1.00 3.51  ? 4   LEU B HD21 2  
ATOM 10871  H HD22 . LEU B 1 4   ? 27.303  24.118  -14.775 1.00 73.34 ? 4   LEU B HD22 2  
ATOM 10872  H HD23 . LEU B 1 4   ? 28.601  23.198  -14.015 1.00 41.54 ? 4   LEU B HD23 2  
ATOM 10873  N N    . LEU B 1 5   ? 28.459  20.257  -18.609 1.00 63.53 ? 5   LEU B N    2  
ATOM 10874  C CA   . LEU B 1 5   ? 29.340  19.045  -18.537 1.00 33.24 ? 5   LEU B CA   2  
ATOM 10875  C C    . LEU B 1 5   ? 30.716  19.478  -18.036 1.00 14.22 ? 5   LEU B C    2  
ATOM 10876  O O    . LEU B 1 5   ? 31.444  20.167  -18.722 1.00 42.42 ? 5   LEU B O    2  
ATOM 10877  C CB   . LEU B 1 5   ? 29.494  18.434  -19.937 1.00 64.33 ? 5   LEU B CB   2  
ATOM 10878  C CG   . LEU B 1 5   ? 28.115  18.087  -20.523 1.00 4.24  ? 5   LEU B CG   2  
ATOM 10879  C CD1  . LEU B 1 5   ? 28.213  17.986  -22.048 1.00 74.35 ? 5   LEU B CD1  2  
ATOM 10880  C CD2  . LEU B 1 5   ? 27.633  16.741  -19.967 1.00 43.14 ? 5   LEU B CD2  2  
ATOM 10881  H H    . LEU B 1 5   ? 28.684  20.979  -19.232 1.00 31.35 ? 5   LEU B H    2  
ATOM 10882  H HA   . LEU B 1 5   ? 28.928  18.310  -17.857 1.00 31.31 ? 5   LEU B HA   2  
ATOM 10883  H HB2  . LEU B 1 5   ? 29.991  19.148  -20.578 1.00 15.15 ? 5   LEU B HB2  2  
ATOM 10884  H HB3  . LEU B 1 5   ? 30.094  17.538  -19.871 1.00 43.41 ? 5   LEU B HB3  2  
ATOM 10885  H HG   . LEU B 1 5   ? 27.408  18.860  -20.262 1.00 14.24 ? 5   LEU B HG   2  
ATOM 10886  H HD11 . LEU B 1 5   ? 28.601  18.911  -22.447 1.00 15.13 ? 5   LEU B HD11 2  
ATOM 10887  H HD12 . LEU B 1 5   ? 27.232  17.799  -22.460 1.00 3.42  ? 5   LEU B HD12 2  
ATOM 10888  H HD13 . LEU B 1 5   ? 28.875  17.174  -22.313 1.00 24.03 ? 5   LEU B HD13 2  
ATOM 10889  H HD21 . LEU B 1 5   ? 26.699  16.472  -20.439 1.00 52.33 ? 5   LEU B HD21 2  
ATOM 10890  H HD22 . LEU B 1 5   ? 27.487  16.821  -18.903 1.00 74.35 ? 5   LEU B HD22 2  
ATOM 10891  H HD23 . LEU B 1 5   ? 28.371  15.981  -20.174 1.00 52.20 ? 5   LEU B HD23 2  
ATOM 10892  N N    . ILE B 1 6   ? 31.078  19.081  -16.843 1.00 15.24 ? 6   ILE B N    2  
ATOM 10893  C CA   . ILE B 1 6   ? 32.411  19.468  -16.282 1.00 42.55 ? 6   ILE B CA   2  
ATOM 10894  C C    . ILE B 1 6   ? 33.326  18.243  -16.266 1.00 15.41 ? 6   ILE B C    2  
ATOM 10895  O O    . ILE B 1 6   ? 33.075  17.278  -15.571 1.00 30.00 ? 6   ILE B O    2  
ATOM 10896  C CB   . ILE B 1 6   ? 32.226  19.984  -14.856 1.00 35.42 ? 6   ILE B CB   2  
ATOM 10897  C CG1  . ILE B 1 6   ? 31.244  21.164  -14.858 1.00 12.24 ? 6   ILE B CG1  2  
ATOM 10898  C CG2  . ILE B 1 6   ? 33.573  20.448  -14.299 1.00 31.11 ? 6   ILE B CG2  2  
ATOM 10899  C CD1  . ILE B 1 6   ? 30.776  21.489  -13.428 1.00 12.33 ? 6   ILE B CD1  2  
ATOM 10900  H H    . ILE B 1 6   ? 30.470  18.527  -16.311 1.00 2.51  ? 6   ILE B H    2  
ATOM 10901  H HA   . ILE B 1 6   ? 32.859  20.243  -16.882 1.00 43.33 ? 6   ILE B HA   2  
ATOM 10902  H HB   . ILE B 1 6   ? 31.837  19.194  -14.242 1.00 1.41  ? 6   ILE B HB   2  
ATOM 10903  H HG12 . ILE B 1 6   ? 31.733  22.030  -15.277 1.00 63.33 ? 6   ILE B HG12 2  
ATOM 10904  H HG13 . ILE B 1 6   ? 30.386  20.911  -15.462 1.00 51.12 ? 6   ILE B HG13 2  
ATOM 10905  H HG21 . ILE B 1 6   ? 33.987  21.208  -14.946 1.00 44.33 ? 6   ILE B HG21 2  
ATOM 10906  H HG22 . ILE B 1 6   ? 34.251  19.610  -14.249 1.00 54.50 ? 6   ILE B HG22 2  
ATOM 10907  H HG23 . ILE B 1 6   ? 33.431  20.857  -13.310 1.00 41.34 ? 6   ILE B HG23 2  
ATOM 10908  H HD11 . ILE B 1 6   ? 31.334  20.909  -12.706 1.00 63.44 ? 6   ILE B HD11 2  
ATOM 10909  H HD12 . ILE B 1 6   ? 29.726  21.256  -13.335 1.00 30.33 ? 6   ILE B HD12 2  
ATOM 10910  H HD13 . ILE B 1 6   ? 30.926  22.541  -13.234 1.00 41.33 ? 6   ILE B HD13 2  
ATOM 10911  N N    . GLU B 1 7   ? 34.387  18.273  -17.026 1.00 74.52 ? 7   GLU B N    2  
ATOM 10912  C CA   . GLU B 1 7   ? 35.316  17.108  -17.053 1.00 34.13 ? 7   GLU B CA   2  
ATOM 10913  C C    . GLU B 1 7   ? 36.677  17.555  -17.591 1.00 65.54 ? 7   GLU B C    2  
ATOM 10914  O O    . GLU B 1 7   ? 36.764  18.347  -18.509 1.00 53.01 ? 7   GLU B O    2  
ATOM 10915  C CB   . GLU B 1 7   ? 34.742  16.013  -17.958 1.00 24.14 ? 7   GLU B CB   2  
ATOM 10916  C CG   . GLU B 1 7   ? 34.222  16.634  -19.260 1.00 35.25 ? 7   GLU B CG   2  
ATOM 10917  C CD   . GLU B 1 7   ? 32.876  17.321  -19.009 1.00 30.22 ? 7   GLU B CD   2  
ATOM 10918  O OE1  . GLU B 1 7   ? 32.138  16.847  -18.160 1.00 71.20 ? 7   GLU B OE1  2  
ATOM 10919  O OE2  . GLU B 1 7   ? 32.606  18.308  -19.672 1.00 41.30 ? 7   GLU B OE2  2  
ATOM 10920  H H    . GLU B 1 7   ? 34.571  19.060  -17.579 1.00 10.42 ? 7   GLU B H    2  
ATOM 10921  H HA   . GLU B 1 7   ? 35.436  16.721  -16.052 1.00 22.42 ? 7   GLU B HA   2  
ATOM 10922  H HB2  . GLU B 1 7   ? 35.517  15.295  -18.188 1.00 30.51 ? 7   GLU B HB2  2  
ATOM 10923  H HB3  . GLU B 1 7   ? 33.931  15.514  -17.449 1.00 21.40 ? 7   GLU B HB3  2  
ATOM 10924  H HG2  . GLU B 1 7   ? 34.935  17.362  -19.621 1.00 42.32 ? 7   GLU B HG2  2  
ATOM 10925  H HG3  . GLU B 1 7   ? 34.094  15.859  -20.001 1.00 42.05 ? 7   GLU B HG3  2  
ATOM 10926  N N    . LYS B 1 8   ? 37.741  17.054  -17.028 1.00 50.14 ? 8   LYS B N    2  
ATOM 10927  C CA   . LYS B 1 8   ? 39.095  17.450  -17.507 1.00 62.55 ? 8   LYS B CA   2  
ATOM 10928  C C    . LYS B 1 8   ? 39.275  16.988  -18.955 1.00 22.42 ? 8   LYS B C    2  
ATOM 10929  O O    . LYS B 1 8   ? 39.971  17.610  -19.733 1.00 22.14 ? 8   LYS B O    2  
ATOM 10930  C CB   . LYS B 1 8   ? 40.163  16.794  -16.627 1.00 30.12 ? 8   LYS B CB   2  
ATOM 10931  C CG   . LYS B 1 8   ? 39.828  17.014  -15.147 1.00 24.41 ? 8   LYS B CG   2  
ATOM 10932  C CD   . LYS B 1 8   ? 39.847  18.513  -14.825 1.00 23.51 ? 8   LYS B CD   2  
ATOM 10933  C CE   . LYS B 1 8   ? 39.934  18.712  -13.310 1.00 13.41 ? 8   LYS B CE   2  
ATOM 10934  N NZ   . LYS B 1 8   ? 41.270  18.262  -12.825 1.00 51.11 ? 8   LYS B NZ   2  
ATOM 10935  H H    . LYS B 1 8   ? 37.650  16.416  -16.289 1.00 2.32  ? 8   LYS B H    2  
ATOM 10936  H HA   . LYS B 1 8   ? 39.196  18.523  -17.459 1.00 1.03  ? 8   LYS B HA   2  
ATOM 10937  H HB2  . LYS B 1 8   ? 40.196  15.734  -16.834 1.00 73.50 ? 8   LYS B HB2  2  
ATOM 10938  H HB3  . LYS B 1 8   ? 41.126  17.232  -16.844 1.00 32.54 ? 8   LYS B HB3  2  
ATOM 10939  H HG2  . LYS B 1 8   ? 38.847  16.613  -14.937 1.00 33.54 ? 8   LYS B HG2  2  
ATOM 10940  H HG3  . LYS B 1 8   ? 40.560  16.507  -14.536 1.00 62.21 ? 8   LYS B HG3  2  
ATOM 10941  H HD2  . LYS B 1 8   ? 40.703  18.973  -15.299 1.00 10.14 ? 8   LYS B HD2  2  
ATOM 10942  H HD3  . LYS B 1 8   ? 38.942  18.972  -15.192 1.00 73.42 ? 8   LYS B HD3  2  
ATOM 10943  H HE2  . LYS B 1 8   ? 39.800  19.757  -13.076 1.00 52.15 ? 8   LYS B HE2  2  
ATOM 10944  H HE3  . LYS B 1 8   ? 39.162  18.133  -12.826 1.00 3.45  ? 8   LYS B HE3  2  
ATOM 10945  H HZ1  . LYS B 1 8   ? 41.295  17.223  -12.794 1.00 14.01 ? 8   LYS B HZ1  2  
ATOM 10946  H HZ2  . LYS B 1 8   ? 41.438  18.643  -11.872 1.00 24.04 ? 8   LYS B HZ2  2  
ATOM 10947  H HZ3  . LYS B 1 8   ? 42.007  18.605  -13.472 1.00 74.13 ? 8   LYS B HZ3  2  
ATOM 10948  N N    . ASN B 1 9   ? 38.653  15.899  -19.323 1.00 4.40  ? 9   ASN B N    2  
ATOM 10949  C CA   . ASN B 1 9   ? 38.787  15.394  -20.721 1.00 53.04 ? 9   ASN B CA   2  
ATOM 10950  C C    . ASN B 1 9   ? 37.745  16.073  -21.612 1.00 40.50 ? 9   ASN B C    2  
ATOM 10951  O O    . ASN B 1 9   ? 36.567  15.782  -21.539 1.00 0.04  ? 9   ASN B O    2  
ATOM 10952  C CB   . ASN B 1 9   ? 38.561  13.881  -20.736 1.00 4.21  ? 9   ASN B CB   2  
ATOM 10953  C CG   . ASN B 1 9   ? 39.654  13.193  -19.915 1.00 42.11 ? 9   ASN B CG   2  
ATOM 10954  O OD1  . ASN B 1 9   ? 40.701  13.762  -19.678 1.00 53.42 ? 9   ASN B OD1  2  
ATOM 10955  N ND2  . ASN B 1 9   ? 39.453  11.983  -19.469 1.00 73.11 ? 9   ASN B ND2  2  
ATOM 10956  H H    . ASN B 1 9   ? 38.098  15.413  -18.679 1.00 22.21 ? 9   ASN B H    2  
ATOM 10957  H HA   . ASN B 1 9   ? 39.778  15.613  -21.094 1.00 4.43  ? 9   ASN B HA   2  
ATOM 10958  H HB2  . ASN B 1 9   ? 37.594  13.658  -20.309 1.00 45.32 ? 9   ASN B HB2  2  
ATOM 10959  H HB3  . ASN B 1 9   ? 38.598  13.522  -21.753 1.00 45.23 ? 9   ASN B HB3  2  
ATOM 10960  H HD21 . ASN B 1 9   ? 38.609  11.524  -19.660 1.00 34.11 ? 9   ASN B HD21 2  
ATOM 10961  H HD22 . ASN B 1 9   ? 40.147  11.534  -18.942 1.00 74.23 ? 9   ASN B HD22 2  
ATOM 10962  N N    . SER B 1 10  ? 38.168  16.977  -22.453 1.00 32.34 ? 10  SER B N    2  
ATOM 10963  C CA   . SER B 1 10  ? 37.203  17.676  -23.348 1.00 65.54 ? 10  SER B CA   2  
ATOM 10964  C C    . SER B 1 10  ? 36.721  16.719  -24.441 1.00 3.02  ? 10  SER B C    2  
ATOM 10965  O O    . SER B 1 10  ? 35.621  16.840  -24.943 1.00 33.42 ? 10  SER B O    2  
ATOM 10966  C CB   . SER B 1 10  ? 37.890  18.880  -23.993 1.00 60.01 ? 10  SER B CB   2  
ATOM 10967  O OG   . SER B 1 10  ? 38.370  19.748  -22.975 1.00 1.04  ? 10  SER B OG   2  
ATOM 10968  H H    . SER B 1 10  ? 39.122  17.197  -22.494 1.00 52.51 ? 10  SER B H    2  
ATOM 10969  H HA   . SER B 1 10  ? 36.357  18.014  -22.768 1.00 43.20 ? 10  SER B HA   2  
ATOM 10970  H HB2  . SER B 1 10  ? 38.719  18.545  -24.594 1.00 51.44 ? 10  SER B HB2  2  
ATOM 10971  H HB3  . SER B 1 10  ? 37.181  19.403  -24.621 1.00 35.42 ? 10  SER B HB3  2  
ATOM 10972  H HG   . SER B 1 10  ? 39.322  19.825  -23.075 1.00 0.53  ? 10  SER B HG   2  
ATOM 10973  N N    . VAL B 1 11  ? 37.536  15.772  -24.820 1.00 31.21 ? 11  VAL B N    2  
ATOM 10974  C CA   . VAL B 1 11  ? 37.122  14.816  -25.887 1.00 73.23 ? 11  VAL B CA   2  
ATOM 10975  C C    . VAL B 1 11  ? 35.820  14.121  -25.479 1.00 13.33 ? 11  VAL B C    2  
ATOM 10976  O O    . VAL B 1 11  ? 34.871  14.066  -26.237 1.00 60.42 ? 11  VAL B O    2  
ATOM 10977  C CB   . VAL B 1 11  ? 38.219  13.768  -26.085 1.00 54.31 ? 11  VAL B CB   2  
ATOM 10978  C CG1  . VAL B 1 11  ? 37.749  12.721  -27.096 1.00 24.22 ? 11  VAL B CG1  2  
ATOM 10979  C CG2  . VAL B 1 11  ? 39.485  14.450  -26.609 1.00 75.55 ? 11  VAL B CG2  2  
ATOM 10980  H H    . VAL B 1 11  ? 38.422  15.693  -24.407 1.00 63.21 ? 11  VAL B H    2  
ATOM 10981  H HA   . VAL B 1 11  ? 36.968  15.353  -26.811 1.00 44.11 ? 11  VAL B HA   2  
ATOM 10982  H HB   . VAL B 1 11  ? 38.431  13.287  -25.141 1.00 62.42 ? 11  VAL B HB   2  
ATOM 10983  H HG11 . VAL B 1 11  ? 37.332  13.217  -27.960 1.00 1.45  ? 11  VAL B HG11 2  
ATOM 10984  H HG12 . VAL B 1 11  ? 36.995  12.095  -26.642 1.00 1.45  ? 11  VAL B HG12 2  
ATOM 10985  H HG13 . VAL B 1 11  ? 38.588  12.113  -27.401 1.00 35.12 ? 11  VAL B HG13 2  
ATOM 10986  H HG21 . VAL B 1 11  ? 39.874  15.116  -25.854 1.00 64.22 ? 11  VAL B HG21 2  
ATOM 10987  H HG22 . VAL B 1 11  ? 39.248  15.014  -27.499 1.00 44.41 ? 11  VAL B HG22 2  
ATOM 10988  H HG23 . VAL B 1 11  ? 40.226  13.701  -26.845 1.00 44.02 ? 11  VAL B HG23 2  
ATOM 10989  N N    . LEU B 1 12  ? 35.766  13.591  -24.288 1.00 70.14 ? 12  LEU B N    2  
ATOM 10990  C CA   . LEU B 1 12  ? 34.523  12.904  -23.837 1.00 45.20 ? 12  LEU B CA   2  
ATOM 10991  C C    . LEU B 1 12  ? 33.377  13.919  -23.786 1.00 44.23 ? 12  LEU B C    2  
ATOM 10992  O O    . LEU B 1 12  ? 32.241  13.605  -24.083 1.00 11.32 ? 12  LEU B O    2  
ATOM 10993  C CB   . LEU B 1 12  ? 34.748  12.304  -22.442 1.00 54.02 ? 12  LEU B CB   2  
ATOM 10994  C CG   . LEU B 1 12  ? 35.541  10.988  -22.546 1.00 13.35 ? 12  LEU B CG   2  
ATOM 10995  C CD1  . LEU B 1 12  ? 34.678  9.872   -23.171 1.00 34.21 ? 12  LEU B CD1  2  
ATOM 10996  C CD2  . LEU B 1 12  ? 36.794  11.212  -23.401 1.00 61.43 ? 12  LEU B CD2  2  
ATOM 10997  H H    . LEU B 1 12  ? 36.540  13.647  -23.691 1.00 20.30 ? 12  LEU B H    2  
ATOM 10998  H HA   . LEU B 1 12  ? 34.273  12.119  -24.533 1.00 41.32 ? 12  LEU B HA   2  
ATOM 10999  H HB2  . LEU B 1 12  ? 35.305  13.007  -21.840 1.00 22.14 ? 12  LEU B HB2  2  
ATOM 11000  H HB3  . LEU B 1 12  ? 33.795  12.113  -21.971 1.00 51.51 ? 12  LEU B HB3  2  
ATOM 11001  H HG   . LEU B 1 12  ? 35.841  10.682  -21.554 1.00 61.22 ? 12  LEU B HG   2  
ATOM 11002  H HD11 . LEU B 1 12  ? 35.014  8.915   -22.800 1.00 23.31 ? 12  LEU B HD11 2  
ATOM 11003  H HD12 . LEU B 1 12  ? 34.773  9.887   -24.248 1.00 14.55 ? 12  LEU B HD12 2  
ATOM 11004  H HD13 . LEU B 1 12  ? 33.641  10.012  -22.903 1.00 33.20 ? 12  LEU B HD13 2  
ATOM 11005  H HD21 . LEU B 1 12  ? 37.466  10.375  -23.281 1.00 30.40 ? 12  LEU B HD21 2  
ATOM 11006  H HD22 . LEU B 1 12  ? 37.288  12.118  -23.085 1.00 50.14 ? 12  LEU B HD22 2  
ATOM 11007  H HD23 . LEU B 1 12  ? 36.511  11.301  -24.439 1.00 63.31 ? 12  LEU B HD23 2  
ATOM 11008  N N    . GLY B 1 13  ? 33.667  15.138  -23.424 1.00 33.23 ? 13  GLY B N    2  
ATOM 11009  C CA   . GLY B 1 13  ? 32.595  16.167  -23.368 1.00 11.15 ? 13  GLY B CA   2  
ATOM 11010  C C    . GLY B 1 13  ? 32.190  16.526  -24.792 1.00 75.40 ? 13  GLY B C    2  
ATOM 11011  O O    . GLY B 1 13  ? 31.084  16.960  -25.048 1.00 53.25 ? 13  GLY B O    2  
ATOM 11012  H H    . GLY B 1 13  ? 34.588  15.379  -23.202 1.00 72.22 ? 13  GLY B H    2  
ATOM 11013  H HA2  . GLY B 1 13  ? 31.742  15.774  -22.832 1.00 41.23 ? 13  GLY B HA2  2  
ATOM 11014  H HA3  . GLY B 1 13  ? 32.965  17.048  -22.867 1.00 70.13 ? 13  GLY B HA3  2  
ATOM 11015  N N    . GLY B 1 14  ? 33.083  16.343  -25.723 1.00 23.52 ? 14  GLY B N    2  
ATOM 11016  C CA   . GLY B 1 14  ? 32.763  16.666  -27.136 1.00 55.01 ? 14  GLY B CA   2  
ATOM 11017  C C    . GLY B 1 14  ? 31.672  15.721  -27.637 1.00 20.23 ? 14  GLY B C    2  
ATOM 11018  O O    . GLY B 1 14  ? 30.648  16.145  -28.136 1.00 65.44 ? 14  GLY B O    2  
ATOM 11019  H H    . GLY B 1 14  ? 33.966  15.990  -25.490 1.00 42.31 ? 14  GLY B H    2  
ATOM 11020  H HA2  . GLY B 1 14  ? 32.420  17.686  -27.197 1.00 15.22 ? 14  GLY B HA2  2  
ATOM 11021  H HA3  . GLY B 1 14  ? 33.646  16.542  -27.744 1.00 61.12 ? 14  GLY B HA3  2  
ATOM 11022  N N    . GLU B 1 15  ? 31.888  14.441  -27.513 1.00 33.24 ? 15  GLU B N    2  
ATOM 11023  C CA   . GLU B 1 15  ? 30.868  13.465  -27.986 1.00 2.30  ? 15  GLU B CA   2  
ATOM 11024  C C    . GLU B 1 15  ? 29.533  13.731  -27.281 1.00 12.11 ? 15  GLU B C    2  
ATOM 11025  O O    . GLU B 1 15  ? 28.495  13.781  -27.910 1.00 4.21  ? 15  GLU B O    2  
ATOM 11026  C CB   . GLU B 1 15  ? 31.343  12.035  -27.702 1.00 0.03  ? 15  GLU B CB   2  
ATOM 11027  C CG   . GLU B 1 15  ? 31.894  11.932  -26.280 1.00 30.42 ? 15  GLU B CG   2  
ATOM 11028  C CD   . GLU B 1 15  ? 32.396  10.509  -26.031 1.00 60.21 ? 15  GLU B CD   2  
ATOM 11029  O OE1  . GLU B 1 15  ? 33.248  10.062  -26.782 1.00 52.44 ? 15  GLU B OE1  2  
ATOM 11030  O OE2  . GLU B 1 15  ? 31.920  9.889   -25.094 1.00 2.53  ? 15  GLU B OE2  2  
ATOM 11031  H H    . GLU B 1 15  ? 32.724  14.124  -27.113 1.00 43.34 ? 15  GLU B H    2  
ATOM 11032  H HA   . GLU B 1 15  ? 30.732  13.588  -29.051 1.00 14.14 ? 15  GLU B HA   2  
ATOM 11033  H HB2  . GLU B 1 15  ? 30.516  11.352  -27.815 1.00 31.13 ? 15  GLU B HB2  2  
ATOM 11034  H HB3  . GLU B 1 15  ? 32.122  11.776  -28.404 1.00 72.20 ? 15  GLU B HB3  2  
ATOM 11035  H HG2  . GLU B 1 15  ? 32.709  12.626  -26.161 1.00 0.22  ? 15  GLU B HG2  2  
ATOM 11036  H HG3  . GLU B 1 15  ? 31.115  12.164  -25.572 1.00 15.24 ? 15  GLU B HG3  2  
ATOM 11037  N N    . ILE B 1 16  ? 29.543  13.919  -25.987 1.00 13.24 ? 16  ILE B N    2  
ATOM 11038  C CA   . ILE B 1 16  ? 28.258  14.199  -25.279 1.00 41.04 ? 16  ILE B CA   2  
ATOM 11039  C C    . ILE B 1 16  ? 27.682  15.510  -25.812 1.00 60.13 ? 16  ILE B C    2  
ATOM 11040  O O    . ILE B 1 16  ? 26.490  15.646  -25.995 1.00 55.35 ? 16  ILE B O    2  
ATOM 11041  C CB   . ILE B 1 16  ? 28.504  14.332  -23.770 1.00 75.15 ? 16  ILE B CB   2  
ATOM 11042  C CG1  . ILE B 1 16  ? 29.092  13.029  -23.198 1.00 45.21 ? 16  ILE B CG1  2  
ATOM 11043  C CG2  . ILE B 1 16  ? 27.185  14.651  -23.063 1.00 30.11 ? 16  ILE B CG2  2  
ATOM 11044  C CD1  . ILE B 1 16  ? 28.211  11.824  -23.557 1.00 73.31 ? 16  ILE B CD1  2  
ATOM 11045  H H    . ILE B 1 16  ? 30.388  13.890  -25.488 1.00 33.32 ? 16  ILE B H    2  
ATOM 11046  H HA   . ILE B 1 16  ? 27.555  13.402  -25.469 1.00 45.43 ? 16  ILE B HA   2  
ATOM 11047  H HB   . ILE B 1 16  ? 29.199  15.142  -23.598 1.00 64.51 ? 16  ILE B HB   2  
ATOM 11048  H HG12 . ILE B 1 16  ? 30.078  12.877  -23.603 1.00 33.43 ? 16  ILE B HG12 2  
ATOM 11049  H HG13 . ILE B 1 16  ? 29.158  13.111  -22.124 1.00 5.02  ? 16  ILE B HG13 2  
ATOM 11050  H HG21 . ILE B 1 16  ? 27.326  14.590  -21.994 1.00 44.11 ? 16  ILE B HG21 2  
ATOM 11051  H HG22 . ILE B 1 16  ? 26.432  13.939  -23.367 1.00 13.42 ? 16  ILE B HG22 2  
ATOM 11052  H HG23 . ILE B 1 16  ? 26.866  15.648  -23.328 1.00 52.25 ? 16  ILE B HG23 2  
ATOM 11053  H HD11 . ILE B 1 16  ? 28.474  11.468  -24.541 1.00 54.44 ? 16  ILE B HD11 2  
ATOM 11054  H HD12 . ILE B 1 16  ? 27.170  12.112  -23.545 1.00 5.24  ? 16  ILE B HD12 2  
ATOM 11055  H HD13 . ILE B 1 16  ? 28.372  11.036  -22.836 1.00 11.22 ? 16  ILE B HD13 2  
ATOM 11056  N N    . GLU B 1 17  ? 28.523  16.474  -26.066 1.00 33.35 ? 17  GLU B N    2  
ATOM 11057  C CA   . GLU B 1 17  ? 28.030  17.777  -26.591 1.00 43.31 ? 17  GLU B CA   2  
ATOM 11058  C C    . GLU B 1 17  ? 27.354  17.559  -27.946 1.00 62.21 ? 17  GLU B C    2  
ATOM 11059  O O    . GLU B 1 17  ? 26.306  18.106  -28.221 1.00 73.01 ? 17  GLU B O    2  
ATOM 11060  C CB   . GLU B 1 17  ? 29.213  18.734  -26.759 1.00 55.34 ? 17  GLU B CB   2  
ATOM 11061  C CG   . GLU B 1 17  ? 28.697  20.137  -27.083 1.00 44.02 ? 17  GLU B CG   2  
ATOM 11062  C CD   . GLU B 1 17  ? 29.880  21.057  -27.392 1.00 2.43  ? 17  GLU B CD   2  
ATOM 11063  O OE1  . GLU B 1 17  ? 31.001  20.576  -27.368 1.00 63.20 ? 17  GLU B OE1  2  
ATOM 11064  O OE2  . GLU B 1 17  ? 29.644  22.227  -27.647 1.00 64.22 ? 17  GLU B OE2  2  
ATOM 11065  H H    . GLU B 1 17  ? 29.482  16.339  -25.914 1.00 64.32 ? 17  GLU B H    2  
ATOM 11066  H HA   . GLU B 1 17  ? 27.316  18.200  -25.897 1.00 30.12 ? 17  GLU B HA   2  
ATOM 11067  H HB2  . GLU B 1 17  ? 29.787  18.761  -25.844 1.00 11.03 ? 17  GLU B HB2  2  
ATOM 11068  H HB3  . GLU B 1 17  ? 29.841  18.389  -27.567 1.00 52.43 ? 17  GLU B HB3  2  
ATOM 11069  H HG2  . GLU B 1 17  ? 28.042  20.090  -27.942 1.00 41.21 ? 17  GLU B HG2  2  
ATOM 11070  H HG3  . GLU B 1 17  ? 28.153  20.526  -26.236 1.00 50.11 ? 17  GLU B HG3  2  
ATOM 11071  N N    . LYS B 1 18  ? 27.944  16.760  -28.796 1.00 44.03 ? 18  LYS B N    2  
ATOM 11072  C CA   . LYS B 1 18  ? 27.330  16.505  -30.133 1.00 30.51 ? 18  LYS B CA   2  
ATOM 11073  C C    . LYS B 1 18  ? 26.356  15.341  -30.022 1.00 62.10 ? 18  LYS B C    2  
ATOM 11074  O O    . LYS B 1 18  ? 25.761  14.916  -30.992 1.00 3.33  ? 18  LYS B O    2  
ATOM 11075  C CB   . LYS B 1 18  ? 28.424  16.164  -31.149 1.00 74.30 ? 18  LYS B CB   2  
ATOM 11076  C CG   . LYS B 1 18  ? 29.540  17.213  -31.087 1.00 14.32 ? 18  LYS B CG   2  
ATOM 11077  C CD   . LYS B 1 18  ? 28.994  18.580  -31.517 1.00 32.31 ? 18  LYS B CD   2  
ATOM 11078  C CE   . LYS B 1 18  ? 30.157  19.510  -31.871 1.00 63.44 ? 18  LYS B CE   2  
ATOM 11079  N NZ   . LYS B 1 18  ? 31.165  19.486  -30.773 1.00 13.34 ? 18  LYS B NZ   2  
ATOM 11080  H H    . LYS B 1 18  ? 28.789  16.327  -28.555 1.00 41.15 ? 18  LYS B H    2  
ATOM 11081  H HA   . LYS B 1 18  ? 26.791  17.377  -30.459 1.00 33.45 ? 18  LYS B HA   2  
ATOM 11082  H HB2  . LYS B 1 18  ? 28.834  15.190  -30.921 1.00 53.03 ? 18  LYS B HB2  2  
ATOM 11083  H HB3  . LYS B 1 18  ? 28.001  16.151  -32.142 1.00 4.22  ? 18  LYS B HB3  2  
ATOM 11084  H HG2  . LYS B 1 18  ? 29.917  17.277  -30.077 1.00 24.25 ? 18  LYS B HG2  2  
ATOM 11085  H HG3  . LYS B 1 18  ? 30.340  16.922  -31.751 1.00 62.10 ? 18  LYS B HG3  2  
ATOM 11086  H HD2  . LYS B 1 18  ? 28.354  18.460  -32.379 1.00 30.13 ? 18  LYS B HD2  2  
ATOM 11087  H HD3  . LYS B 1 18  ? 28.428  19.013  -30.705 1.00 2.45  ? 18  LYS B HD3  2  
ATOM 11088  H HE2  . LYS B 1 18  ? 30.617  19.178  -32.790 1.00 44.12 ? 18  LYS B HE2  2  
ATOM 11089  H HE3  . LYS B 1 18  ? 29.787  20.517  -31.998 1.00 12.41 ? 18  LYS B HE3  2  
ATOM 11090  H HZ1  . LYS B 1 18  ? 31.790  18.665  -30.895 1.00 32.23 ? 18  LYS B HZ1  2  
ATOM 11091  H HZ2  . LYS B 1 18  ? 30.677  19.418  -29.857 1.00 3.02  ? 18  LYS B HZ2  2  
ATOM 11092  H HZ3  . LYS B 1 18  ? 31.731  20.357  -30.802 1.00 72.43 ? 18  LYS B HZ3  2  
ATOM 11093  N N    . GLY B 1 19  ? 26.186  14.825  -28.841 1.00 61.24 ? 19  GLY B N    2  
ATOM 11094  C CA   . GLY B 1 19  ? 25.249  13.689  -28.647 1.00 70.54 ? 19  GLY B CA   2  
ATOM 11095  C C    . GLY B 1 19  ? 23.848  14.228  -28.360 1.00 5.52  ? 19  GLY B C    2  
ATOM 11096  O O    . GLY B 1 19  ? 22.895  13.905  -29.041 1.00 2.14  ? 19  GLY B O    2  
ATOM 11097  H H    . GLY B 1 19  ? 26.677  15.189  -28.075 1.00 50.42 ? 19  GLY B H    2  
ATOM 11098  H HA2  . GLY B 1 19  ? 25.227  13.071  -29.536 1.00 44.01 ? 19  GLY B HA2  2  
ATOM 11099  H HA3  . GLY B 1 19  ? 25.581  13.105  -27.812 1.00 55.20 ? 19  GLY B HA3  2  
ATOM 11100  N N    . LEU B 1 20  ? 23.714  15.048  -27.354 1.00 31.00 ? 20  LEU B N    2  
ATOM 11101  C CA   . LEU B 1 20  ? 22.375  15.607  -27.022 1.00 52.21 ? 20  LEU B CA   2  
ATOM 11102  C C    . LEU B 1 20  ? 21.963  16.628  -28.091 1.00 11.15 ? 20  LEU B C    2  
ATOM 11103  O O    . LEU B 1 20  ? 20.797  16.923  -28.263 1.00 12.51 ? 20  LEU B O    2  
ATOM 11104  C CB   . LEU B 1 20  ? 22.412  16.241  -25.608 1.00 55.12 ? 20  LEU B CB   2  
ATOM 11105  C CG   . LEU B 1 20  ? 22.897  17.709  -25.623 1.00 52.13 ? 20  LEU B CG   2  
ATOM 11106  C CD1  . LEU B 1 20  ? 22.765  18.297  -24.214 1.00 71.34 ? 20  LEU B CD1  2  
ATOM 11107  C CD2  . LEU B 1 20  ? 24.364  17.773  -26.054 1.00 11.34 ? 20  LEU B CD2  2  
ATOM 11108  H H    . LEU B 1 20  ? 24.495  15.296  -26.816 1.00 52.52 ? 20  LEU B H    2  
ATOM 11109  H HA   . LEU B 1 20  ? 21.656  14.798  -27.023 1.00 33.40 ? 20  LEU B HA   2  
ATOM 11110  H HB2  . LEU B 1 20  ? 21.421  16.204  -25.183 1.00 21.35 ? 20  LEU B HB2  2  
ATOM 11111  H HB3  . LEU B 1 20  ? 23.081  15.659  -24.987 1.00 13.05 ? 20  LEU B HB3  2  
ATOM 11112  H HG   . LEU B 1 20  ? 22.295  18.297  -26.296 1.00 50.51 ? 20  LEU B HG   2  
ATOM 11113  H HD11 . LEU B 1 20  ? 21.811  18.018  -23.793 1.00 72.02 ? 20  LEU B HD11 2  
ATOM 11114  H HD12 . LEU B 1 20  ? 22.829  19.373  -24.268 1.00 72.35 ? 20  LEU B HD12 2  
ATOM 11115  H HD13 . LEU B 1 20  ? 23.560  17.919  -23.587 1.00 23.02 ? 20  LEU B HD13 2  
ATOM 11116  H HD21 . LEU B 1 20  ? 24.980  17.302  -25.302 1.00 75.43 ? 20  LEU B HD21 2  
ATOM 11117  H HD22 . LEU B 1 20  ? 24.660  18.805  -26.166 1.00 43.33 ? 20  LEU B HD22 2  
ATOM 11118  H HD23 . LEU B 1 20  ? 24.489  17.262  -26.993 1.00 74.33 ? 20  LEU B HD23 2  
ATOM 11119  N N    . ASN B 1 21  ? 22.911  17.173  -28.804 1.00 33.33 ? 21  ASN B N    2  
ATOM 11120  C CA   . ASN B 1 21  ? 22.577  18.175  -29.851 1.00 33.35 ? 21  ASN B CA   2  
ATOM 11121  C C    . ASN B 1 21  ? 21.511  17.604  -30.788 1.00 63.33 ? 21  ASN B C    2  
ATOM 11122  O O    . ASN B 1 21  ? 20.664  18.318  -31.288 1.00 62.12 ? 21  ASN B O    2  
ATOM 11123  C CB   . ASN B 1 21  ? 23.842  18.508  -30.646 1.00 61.41 ? 21  ASN B CB   2  
ATOM 11124  C CG   . ASN B 1 21  ? 24.733  19.445  -29.829 1.00 33.35 ? 21  ASN B CG   2  
ATOM 11125  O OD1  . ASN B 1 21  ? 24.300  20.008  -28.843 1.00 64.41 ? 21  ASN B OD1  2  
ATOM 11126  N ND2  . ASN B 1 21  ? 25.970  19.638  -30.199 1.00 62.31 ? 21  ASN B ND2  2  
ATOM 11127  H H    . ASN B 1 21  ? 23.845  16.927  -28.651 1.00 72.11 ? 21  ASN B H    2  
ATOM 11128  H HA   . ASN B 1 21  ? 22.199  19.072  -29.383 1.00 41.35 ? 21  ASN B HA   2  
ATOM 11129  H HB2  . ASN B 1 21  ? 24.380  17.597  -30.860 1.00 14.44 ? 21  ASN B HB2  2  
ATOM 11130  H HB3  . ASN B 1 21  ? 23.570  18.989  -31.570 1.00 14.02 ? 21  ASN B HB3  2  
ATOM 11131  H HD21 . ASN B 1 21  ? 26.319  19.184  -30.995 1.00 73.20 ? 21  ASN B HD21 2  
ATOM 11132  H HD22 . ASN B 1 21  ? 26.549  20.236  -29.682 1.00 32.34 ? 21  ASN B HD22 2  
ATOM 11133  N N    . VAL B 1 22  ? 21.542  16.323  -31.030 1.00 33.33 ? 22  VAL B N    2  
ATOM 11134  C CA   . VAL B 1 22  ? 20.525  15.714  -31.933 1.00 3.21  ? 22  VAL B CA   2  
ATOM 11135  C C    . VAL B 1 22  ? 19.129  15.964  -31.360 1.00 43.45 ? 22  VAL B C    2  
ATOM 11136  O O    . VAL B 1 22  ? 18.166  16.118  -32.085 1.00 63.14 ? 22  VAL B O    2  
ATOM 11137  C CB   . VAL B 1 22  ? 20.772  14.208  -32.038 1.00 74.23 ? 22  VAL B CB   2  
ATOM 11138  C CG1  . VAL B 1 22  ? 19.652  13.562  -32.856 1.00 23.20 ? 22  VAL B CG1  2  
ATOM 11139  C CG2  . VAL B 1 22  ? 22.115  13.958  -32.727 1.00 35.11 ? 22  VAL B CG2  2  
ATOM 11140  H H    . VAL B 1 22  ? 22.230  15.762  -30.616 1.00 24.44 ? 22  VAL B H    2  
ATOM 11141  H HA   . VAL B 1 22  ? 20.598  16.161  -32.913 1.00 0.23  ? 22  VAL B HA   2  
ATOM 11142  H HB   . VAL B 1 22  ? 20.788  13.776  -31.047 1.00 43.42 ? 22  VAL B HB   2  
ATOM 11143  H HG11 . VAL B 1 22  ? 18.750  13.522  -32.264 1.00 65.12 ? 22  VAL B HG11 2  
ATOM 11144  H HG12 . VAL B 1 22  ? 19.943  12.560  -33.137 1.00 31.43 ? 22  VAL B HG12 2  
ATOM 11145  H HG13 . VAL B 1 22  ? 19.473  14.147  -33.746 1.00 53.13 ? 22  VAL B HG13 2  
ATOM 11146  H HG21 . VAL B 1 22  ? 22.905  14.420  -32.154 1.00 50.30 ? 22  VAL B HG21 2  
ATOM 11147  H HG22 . VAL B 1 22  ? 22.094  14.384  -33.720 1.00 61.34 ? 22  VAL B HG22 2  
ATOM 11148  H HG23 . VAL B 1 22  ? 22.293  12.895  -32.795 1.00 42.14 ? 22  VAL B HG23 2  
ATOM 11149  N N    . LYS B 1 23  ? 19.014  16.003  -30.061 1.00 63.42 ? 23  LYS B N    2  
ATOM 11150  C CA   . LYS B 1 23  ? 17.684  16.239  -29.434 1.00 53.01 ? 23  LYS B CA   2  
ATOM 11151  C C    . LYS B 1 23  ? 17.361  17.731  -29.488 1.00 53.15 ? 23  LYS B C    2  
ATOM 11152  O O    . LYS B 1 23  ? 16.285  18.164  -29.124 1.00 60.22 ? 23  LYS B O    2  
ATOM 11153  C CB   . LYS B 1 23  ? 17.723  15.760  -27.978 1.00 1.14  ? 23  LYS B CB   2  
ATOM 11154  C CG   . LYS B 1 23  ? 18.512  14.446  -27.883 1.00 1.01  ? 23  LYS B CG   2  
ATOM 11155  C CD   . LYS B 1 23  ? 18.031  13.455  -28.958 1.00 32.34 ? 23  LYS B CD   2  
ATOM 11156  C CE   . LYS B 1 23  ? 18.332  12.018  -28.519 1.00 22.13 ? 23  LYS B CE   2  
ATOM 11157  N NZ   . LYS B 1 23  ? 18.028  11.083  -29.639 1.00 42.24 ? 23  LYS B NZ   2  
ATOM 11158  H H    . LYS B 1 23  ? 19.805  15.874  -29.496 1.00 32.23 ? 23  LYS B H    2  
ATOM 11159  H HA   . LYS B 1 23  ? 16.928  15.694  -29.977 1.00 52.43 ? 23  LYS B HA   2  
ATOM 11160  H HB2  . LYS B 1 23  ? 18.202  16.508  -27.363 1.00 54.14 ? 23  LYS B HB2  2  
ATOM 11161  H HB3  . LYS B 1 23  ? 16.717  15.597  -27.627 1.00 62.11 ? 23  LYS B HB3  2  
ATOM 11162  H HG2  . LYS B 1 23  ? 19.561  14.651  -28.030 1.00 22.25 ? 23  LYS B HG2  2  
ATOM 11163  H HG3  . LYS B 1 23  ? 18.365  14.016  -26.903 1.00 4.10  ? 23  LYS B HG3  2  
ATOM 11164  H HD2  . LYS B 1 23  ? 16.969  13.571  -29.106 1.00 4.00  ? 23  LYS B HD2  2  
ATOM 11165  H HD3  . LYS B 1 23  ? 18.543  13.656  -29.887 1.00 72.11 ? 23  LYS B HD3  2  
ATOM 11166  H HE2  . LYS B 1 23  ? 19.375  11.934  -28.252 1.00 2.42  ? 23  LYS B HE2  2  
ATOM 11167  H HE3  . LYS B 1 23  ? 17.721  11.767  -27.664 1.00 3.15  ? 23  LYS B HE3  2  
ATOM 11168  H HZ1  . LYS B 1 23  ? 17.878  11.625  -30.512 1.00 1.30  ? 23  LYS B HZ1  2  
ATOM 11169  H HZ2  . LYS B 1 23  ? 17.169  10.540  -29.413 1.00 73.52 ? 23  LYS B HZ2  2  
ATOM 11170  H HZ3  . LYS B 1 23  ? 18.826  10.430  -29.772 1.00 62.30 ? 23  LYS B HZ3  2  
ATOM 11171  N N    . GLY B 1 24  ? 18.288  18.512  -29.952 1.00 44.23 ? 24  GLY B N    2  
ATOM 11172  C CA   . GLY B 1 24  ? 18.056  19.984  -30.053 1.00 53.43 ? 24  GLY B CA   2  
ATOM 11173  C C    . GLY B 1 24  ? 18.308  20.655  -28.699 1.00 2.43  ? 24  GLY B C    2  
ATOM 11174  O O    . GLY B 1 24  ? 17.632  21.596  -28.333 1.00 3.31  ? 24  GLY B O    2  
ATOM 11175  H H    . GLY B 1 24  ? 19.139  18.125  -30.244 1.00 35.13 ? 24  GLY B H    2  
ATOM 11176  H HA2  . GLY B 1 24  ? 18.728  20.401  -30.790 1.00 32.22 ? 24  GLY B HA2  2  
ATOM 11177  H HA3  . GLY B 1 24  ? 17.036  20.167  -30.356 1.00 33.14 ? 24  GLY B HA3  2  
ATOM 11178  N N    . PHE B 1 25  ? 19.281  20.182  -27.958 1.00 45.32 ? 25  PHE B N    2  
ATOM 11179  C CA   . PHE B 1 25  ? 19.599  20.788  -26.622 1.00 5.43  ? 25  PHE B CA   2  
ATOM 11180  C C    . PHE B 1 25  ? 20.985  21.438  -26.688 1.00 13.14 ? 25  PHE B C    2  
ATOM 11181  O O    . PHE B 1 25  ? 21.784  21.126  -27.549 1.00 55.32 ? 25  PHE B O    2  
ATOM 11182  C CB   . PHE B 1 25  ? 19.590  19.688  -25.549 1.00 31.22 ? 25  PHE B CB   2  
ATOM 11183  C CG   . PHE B 1 25  ? 18.163  19.390  -25.133 1.00 34.23 ? 25  PHE B CG   2  
ATOM 11184  C CD1  . PHE B 1 25  ? 17.249  18.902  -26.074 1.00 71.12 ? 25  PHE B CD1  2  
ATOM 11185  C CD2  . PHE B 1 25  ? 17.755  19.602  -23.808 1.00 43.21 ? 25  PHE B CD2  2  
ATOM 11186  C CE1  . PHE B 1 25  ? 15.930  18.626  -25.694 1.00 11.51 ? 25  PHE B CE1  2  
ATOM 11187  C CE2  . PHE B 1 25  ? 16.436  19.326  -23.429 1.00 22.51 ? 25  PHE B CE2  2  
ATOM 11188  C CZ   . PHE B 1 25  ? 15.524  18.838  -24.372 1.00 14.34 ? 25  PHE B CZ   2  
ATOM 11189  H H    . PHE B 1 25  ? 19.812  19.426  -28.284 1.00 43.25 ? 25  PHE B H    2  
ATOM 11190  H HA   . PHE B 1 25  ? 18.866  21.545  -26.369 1.00 24.42 ? 25  PHE B HA   2  
ATOM 11191  H HB2  . PHE B 1 25  ? 20.038  18.792  -25.953 1.00 51.12 ? 25  PHE B HB2  2  
ATOM 11192  H HB3  . PHE B 1 25  ? 20.156  20.016  -24.689 1.00 30.41 ? 25  PHE B HB3  2  
ATOM 11193  H HD1  . PHE B 1 25  ? 17.560  18.739  -27.093 1.00 43.53 ? 25  PHE B HD1  2  
ATOM 11194  H HD2  . PHE B 1 25  ? 18.458  19.979  -23.079 1.00 35.01 ? 25  PHE B HD2  2  
ATOM 11195  H HE1  . PHE B 1 25  ? 15.226  18.250  -26.421 1.00 53.23 ? 25  PHE B HE1  2  
ATOM 11196  H HE2  . PHE B 1 25  ? 16.121  19.489  -22.410 1.00 12.33 ? 25  PHE B HE2  2  
ATOM 11197  H HZ   . PHE B 1 25  ? 14.506  18.625  -24.079 1.00 31.53 ? 25  PHE B HZ   2  
ATOM 11198  N N    . MET B 1 26  ? 21.273  22.345  -25.785 1.00 30.45 ? 26  MET B N    2  
ATOM 11199  C CA   . MET B 1 26  ? 22.602  23.032  -25.782 1.00 75.24 ? 26  MET B CA   2  
ATOM 11200  C C    . MET B 1 26  ? 23.434  22.505  -24.615 1.00 34.14 ? 26  MET B C    2  
ATOM 11201  O O    . MET B 1 26  ? 22.925  22.276  -23.536 1.00 12.43 ? 26  MET B O    2  
ATOM 11202  C CB   . MET B 1 26  ? 22.391  24.538  -25.612 1.00 63.34 ? 26  MET B CB   2  
ATOM 11203  C CG   . MET B 1 26  ? 21.518  25.064  -26.752 1.00 73.15 ? 26  MET B CG   2  
ATOM 11204  S SD   . MET B 1 26  ? 22.397  24.874  -28.323 1.00 22.30 ? 26  MET B SD   2  
ATOM 11205  C CE   . MET B 1 26  ? 20.941  24.633  -29.371 1.00 71.21 ? 26  MET B CE   2  
ATOM 11206  H H    . MET B 1 26  ? 20.611  22.576  -25.102 1.00 22.03 ? 26  MET B H    2  
ATOM 11207  H HA   . MET B 1 26  ? 23.124  22.845  -26.710 1.00 72.22 ? 26  MET B HA   2  
ATOM 11208  H HB2  . MET B 1 26  ? 21.904  24.729  -24.666 1.00 24.04 ? 26  MET B HB2  2  
ATOM 11209  H HB3  . MET B 1 26  ? 23.347  25.040  -25.632 1.00 4.52  ? 26  MET B HB3  2  
ATOM 11210  H HG2  . MET B 1 26  ? 20.595  24.505  -26.786 1.00 13.01 ? 26  MET B HG2  2  
ATOM 11211  H HG3  . MET B 1 26  ? 21.300  26.109  -26.586 1.00 52.12 ? 26  MET B HG3  2  
ATOM 11212  H HE1  . MET B 1 26  ? 20.639  23.595  -29.332 1.00 43.54 ? 26  MET B HE1  2  
ATOM 11213  H HE2  . MET B 1 26  ? 21.180  24.897  -30.389 1.00 25.42 ? 26  MET B HE2  2  
ATOM 11214  H HE3  . MET B 1 26  ? 20.136  25.262  -29.018 1.00 10.34 ? 26  MET B HE3  2  
ATOM 11215  N N    . ALA B 1 27  ? 24.712  22.309  -24.824 1.00 72.12 ? 27  ALA B N    2  
ATOM 11216  C CA   . ALA B 1 27  ? 25.591  21.792  -23.730 1.00 20.23 ? 27  ALA B CA   2  
ATOM 11217  C C    . ALA B 1 27  ? 26.889  22.603  -23.691 1.00 51.22 ? 27  ALA B C    2  
ATOM 11218  O O    . ALA B 1 27  ? 27.219  23.314  -24.620 1.00 25.14 ? 27  ALA B O    2  
ATOM 11219  C CB   . ALA B 1 27  ? 25.924  20.321  -23.997 1.00 53.33 ? 27  ALA B CB   2  
ATOM 11220  H H    . ALA B 1 27  ? 25.095  22.500  -25.706 1.00 12.50 ? 27  ALA B H    2  
ATOM 11221  H HA   . ALA B 1 27  ? 25.086  21.879  -22.777 1.00 43.53 ? 27  ALA B HA   2  
ATOM 11222  H HB1  . ALA B 1 27  ? 25.072  19.709  -23.748 1.00 64.41 ? 27  ALA B HB1  2  
ATOM 11223  H HB2  . ALA B 1 27  ? 26.767  20.025  -23.390 1.00 73.25 ? 27  ALA B HB2  2  
ATOM 11224  H HB3  . ALA B 1 27  ? 26.168  20.192  -25.040 1.00 4.23  ? 27  ALA B HB3  2  
ATOM 11225  N N    . ASP B 1 28  ? 27.631  22.495  -22.619 1.00 72.31 ? 28  ASP B N    2  
ATOM 11226  C CA   . ASP B 1 28  ? 28.918  23.247  -22.503 1.00 51.32 ? 28  ASP B CA   2  
ATOM 11227  C C    . ASP B 1 28  ? 29.954  22.356  -21.817 1.00 34.51 ? 28  ASP B C    2  
ATOM 11228  O O    . ASP B 1 28  ? 29.626  21.568  -20.952 1.00 4.20  ? 28  ASP B O    2  
ATOM 11229  C CB   . ASP B 1 28  ? 28.697  24.510  -21.668 1.00 34.20 ? 28  ASP B CB   2  
ATOM 11230  C CG   . ASP B 1 28  ? 29.980  25.342  -21.651 1.00 42.14 ? 28  ASP B CG   2  
ATOM 11231  O OD1  . ASP B 1 28  ? 30.194  26.085  -22.595 1.00 41.45 ? 28  ASP B OD1  2  
ATOM 11232  O OD2  . ASP B 1 28  ? 30.728  25.223  -20.694 1.00 51.14 ? 28  ASP B OD2  2  
ATOM 11233  H H    . ASP B 1 28  ? 27.343  21.911  -21.887 1.00 11.34 ? 28  ASP B H    2  
ATOM 11234  H HA   . ASP B 1 28  ? 29.276  23.522  -23.487 1.00 31.42 ? 28  ASP B HA   2  
ATOM 11235  H HB2  . ASP B 1 28  ? 27.895  25.092  -22.099 1.00 31.14 ? 28  ASP B HB2  2  
ATOM 11236  H HB3  . ASP B 1 28  ? 28.437  24.233  -20.657 1.00 33.32 ? 28  ASP B HB3  2  
ATOM 11237  N N    . VAL B 1 29  ? 31.204  22.472  -22.199 1.00 64.43 ? 29  VAL B N    2  
ATOM 11238  C CA   . VAL B 1 29  ? 32.275  21.637  -21.585 1.00 33.40 ? 29  VAL B CA   2  
ATOM 11239  C C    . VAL B 1 29  ? 33.223  22.541  -20.797 1.00 42.30 ? 29  VAL B C    2  
ATOM 11240  O O    . VAL B 1 29  ? 33.596  23.607  -21.247 1.00 44.44 ? 29  VAL B O    2  
ATOM 11241  C CB   . VAL B 1 29  ? 33.048  20.935  -22.702 1.00 0.31  ? 29  VAL B CB   2  
ATOM 11242  C CG1  . VAL B 1 29  ? 32.227  19.759  -23.237 1.00 62.30 ? 29  VAL B CG1  2  
ATOM 11243  C CG2  . VAL B 1 29  ? 33.311  21.926  -23.840 1.00 62.32 ? 29  VAL B CG2  2  
ATOM 11244  H H    . VAL B 1 29  ? 31.443  23.110  -22.898 1.00 62.14 ? 29  VAL B H    2  
ATOM 11245  H HA   . VAL B 1 29  ? 31.848  20.898  -20.921 1.00 33.10 ? 29  VAL B HA   2  
ATOM 11246  H HB   . VAL B 1 29  ? 33.984  20.575  -22.316 1.00 3.20  ? 29  VAL B HB   2  
ATOM 11247  H HG11 . VAL B 1 29  ? 31.334  20.132  -23.717 1.00 2.11  ? 29  VAL B HG11 2  
ATOM 11248  H HG12 . VAL B 1 29  ? 31.952  19.110  -22.420 1.00 11.24 ? 29  VAL B HG12 2  
ATOM 11249  H HG13 . VAL B 1 29  ? 32.816  19.206  -23.953 1.00 61.35 ? 29  VAL B HG13 2  
ATOM 11250  H HG21 . VAL B 1 29  ? 33.939  21.459  -24.584 1.00 72.14 ? 29  VAL B HG21 2  
ATOM 11251  H HG22 . VAL B 1 29  ? 33.808  22.801  -23.448 1.00 11.24 ? 29  VAL B HG22 2  
ATOM 11252  H HG23 . VAL B 1 29  ? 32.373  22.215  -24.290